CNRS Nantes University UFIP UFIP
home |  start a new run |  job status |  references&downloads |  examples |  help  

Should you encounter any unexpected behaviour,
please let us know.


***    ***

elNémo ID: 21121723430024816

Job options:

ID        	=	 21121723430024816
JOBID     	=	 
USERID    	=	 unknown
PRIVAT    	=	 0

NMODES    	=	 5
DQMIN     	=	 -100
DQMAX     	=	 100
DQSTEP    	=	 20
DOGRAPHS  	=	 on

DOPROJMODS	=	 0
DORMSD    	=	 0

NRBL      	=	 0
CUTOFF    	=	 0
CAONLY    	=	 0


Input data for this run:


TITLE     SWISS-MODEL SERVER (https://swissmodel.expasy.org)
TITLE    2 Untitled Project
EXPDTA    THEORETICAL MODEL (SWISS-MODEL SERVER)
AUTHOR    SWISS-MODEL SERVER (SEE REFERENCE IN JRNL Records)
REVDAT   1   17-DEC-21 1MOD    1       20:19
JRNL        AUTH   A.WATERHOUSE,M.BERTONI,S.BIENERT,G.STUDER,G.TAURIELLO,
JRNL        AUTH 2 R.GUMIENNY,F.T.HEER,T.A.P.DE BEER,C.REMPFER,L.BORDOLI,
JRNL        AUTH 3 R.LEPORE,T.SCHWEDE
JRNL        TITL   SWISS-MODEL: HOMOLOGY MODELLING OF PROTEIN STRUCTURES AND
JRNL        TITL 2 COMPLEXES
JRNL        REF    NUCLEIC.ACIDS.RES..           V.  46 W296  2018
JRNL        PMID   29788355
JRNL        DOI    10.1093/nar/gky427
REMARK   1
REMARK   1 REFERENCE 1
REMARK   1  AUTH   S.BIENERT,A.WATERHOUSE,T.A.P.DE BEER,G.TAURIELLO,G.STUDER,
REMARK   1  AUTH 2 L.BORDOLI,T.SCHWEDE
REMARK   1  TITL   THE SWISS-MODEL REPOSITORY - NEW FEATURES AND FUNCTIONALITY
REMARK   1  REF    NUCLEIC.ACIDS.RES..           V.  45       2017
REMARK   1  REFN                   ISSN 0305-1048
REMARK   1  PMID   27899672
REMARK   1  DOI    10.1093/nar/gkw1132
REMARK   1
REMARK   1 REFERENCE 2
REMARK   1  AUTH   N.GUEX,M.C.PEITSCH,T.SCHWEDE
REMARK   1  TITL   AUTOMATED COMPARATIVE PROTEIN STRUCTURE MODELING WITH
REMARK   1  TITL 2 SWISS-MODEL AND SWISS-PDBVIEWER: A HISTORICAL PERSPECTIVE
REMARK   1  REF    ELECTROPHORESIS               V.  30       2009
REMARK   1  REFN                   ISSN 0173-0835
REMARK   1  PMID   19517507
REMARK   1  DOI    10.1002/elps.200900140
REMARK   1
REMARK   1 REFERENCE 3
REMARK   1  AUTH   G.STUDER,G.TAURIELLO,S.BIENERT,M.BIASINI,N.JOHNER,T.SCHWEDE
REMARK   1  TITL   PROMOD3 - A VERSATILE HOMOLOGY MODELLING TOOLBOX
REMARK   1  REF    PLOS COMP. BIOL.              V.  17       2021
REMARK   1  REFN                   ISSN 
REMARK   1  PMID   33507980
REMARK   1  DOI    https://doi.org/10.1371/journal.pcbi.1008667
REMARK   1
REMARK   1 REFERENCE 4
REMARK   1  AUTH   G.STUDER,C.REMPFER,A.WATERHOUSE,R.GUMIENNY,J.HAAS,T.SCHWEDE
REMARK   1  TITL   QMEANDISCO - DISTANCE CONSTRAINTS APPLIED ON MODEL QUALITY 
REMARK   1  TITL 2 ESTIMATION
REMARK   1  REF    BIOINFORMATICS                V.  36       2020
REMARK   1  REFN                   ISSN 
REMARK   1  PMID   31697312
REMARK   1  DOI    https://doi.org/10.1093/bioinformatics/btz828
REMARK   1
REMARK   1 REFERENCE 5
REMARK   1  AUTH   P.BENKERT,M.BIASINI,T.SCHWEDE
REMARK   1  TITL   TOWARD THE ESTIMATION OF THE ABSOLUTE QUALITY OF INDIVIDUAL
REMARK   1  TITL 2 PROTEIN STRUCTURE MODELS
REMARK   1  REF    BIOINFORMATICS                V.  27       2011
REMARK   1  REFN                   ISSN 1367-4803
REMARK   1  PMID   21134891
REMARK   1  DOI    10.1093/bioinformatics/btq662
REMARK   1
REMARK   1 REFERENCE 6
REMARK   1  AUTH   M.BERTONI,F.KIEFER,M.BIASINI,L.BORDOLI,T.SCHWEDE
REMARK   1  TITL   MODELING PROTEIN QUATERNARY STRUCTURE OF HOMO- AND
REMARK   1  TITL 2 HETERO-OLIGOMERS BEYOND BINARY INTERACTIONS BY HOMOLOGY
REMARK   1  REF    SCI.REP.                      V.   7       2017
REMARK   1  REFN                   ISSN
REMARK   1  PMID   28874689
REMARK   1  DOI    10.1038/s41598-017-09654-8
REMARK   1
REMARK   1 DISCLAIMER
REMARK   1 The SWISS-MODEL SERVER produces theoretical models for proteins.
REMARK   1 The results of any theoretical modelling procedure is
REMARK   1 NON-EXPERIMENTAL and MUST be considered with care. These models may
REMARK   1 contain significant errors. This is especially true for automated
REMARK   1 modeling since there is no human intervention during model
REMARK   1 building. Please read the header section and the logfile carefully
REMARK   1 to know what templates and alignments were used during the model
REMARK   1 building process. All information by the SWISS-MODEL SERVER is
REMARK   1 provided "AS-IS", without any warranty, expressed or implied.
REMARK   2
REMARK   2 COPYRIGHT NOTICE
REMARK   2 This SWISS-MODEL protein model is copyright. It is produced by the
REMARK   2 SWISS-MODEL server, developed by the Computational Structural
REMARK   2 Biology Group at the SIB Swiss Institute of Bioinformatics at the
REMARK   2 Biozentrum, University of Basel (https://swissmodel.expasy.org). This
REMARK   2 model is licensed under the CC BY-SA 4.0 Creative Commons
REMARK   2 Attribution-ShareAlike 4.0 International License
REMARK   2 (https://creativecommons.org/licenses/by-sa/4.0/legalcode), i.e. you
REMARK   2 can copy and redistribute the model in any medium or format,
REMARK   2 transform and build upon the model for any purpose, even
REMARK   2 commercially, under the following terms:
REMARK   2 Attribution - You must give appropriate credit, provide a link to
REMARK   2 the license, and indicate if changes were made. You may do so in any
REMARK   2 reasonable manner, but not in any way that suggests the licensor
REMARK   2 endorses you or your use. When you publish, patent or distribute
REMARK   2 results that were fully or partially based on the model, please cite
REMARK   2 the corresponding papers mentioned under JRNL.
REMARK   2 ShareAlike - If you remix, transform, or build upon the material,
REMARK   2 you must distribute your contributions under the same license as the
REMARK   2 original.
REMARK   2 No additional restrictions - you may not apply legal terms or
REMARK   2 technological measures that legally restrict others from doing
REMARK   2 anything the license permits.
REMARK   2 Find a human-readable summary of (and not a substitute for) the
REMARK   2 CC BY-SA 4.0 license at this link:
REMARK   2 https://creativecommons.org/licenses/by-sa/4.0/
REMARK   3 
REMARK   3 MODEL INFORMATION
REMARK   3  ENGIN   PROMOD3
REMARK   3  VERSN   3.2.1
REMARK   3  OSTAT   homo-dimer
REMARK   3  OSRSN   PREDICTION
REMARK   3  QSPRD   0.989
REMARK   3  GMQE    0.90
REMARK   3  QMNV    4.3.0
REMARK   3  QMNDG   0.87
REMARK   3  MODT    FALSE
REMARK   3 
REMARK   3 MODEL LIGAND 1
REMARK   3  NAME    GLC
REMARK   3  BIND    A.136
REMARK   3  BIND 2  A.137
REMARK   3  BIND 3  A.140
REMARK   3  BIND 4  A.285
REMARK   3  BIND 5  A.378
REMARK   3  BIND 6  A.456
REMARK   3  BIND 7  A.485
REMARK   3  BIND 8  A.574
REMARK   3  BIND 9  A.673
REMARK   3  BIND 10  A.674
REMARK   3  BIND 11  A.675
REMARK   3  BIND 12  A.676
REMARK   3  BIND 13  A.677
REMARK   3  BIND 14  _.1
REMARK   3 
REMARK   3 MODEL LIGAND 2
REMARK   3  NAME    GLC
REMARK   3  BIND    B.136
REMARK   3  BIND 2  B.137
REMARK   3  BIND 3  B.140
REMARK   3  BIND 4  B.285
REMARK   3  BIND 5  B.378
REMARK   3  BIND 6  B.456
REMARK   3  BIND 7  B.485
REMARK   3  BIND 8  B.574
REMARK   3  BIND 9  B.673
REMARK   3  BIND 10  B.674
REMARK   3  BIND 11  B.675
REMARK   3  BIND 12  B.676
REMARK   3  BIND 13  B.677
REMARK   3  BIND 14  _.4
REMARK   3 
REMARK   3 MODEL LIGAND 3
REMARK   3  NAME    AMP
REMARK   3  BIND    A.68
REMARK   3  BIND 2  A.72
REMARK   3  BIND 3  A.76
REMARK   3  BIND 4  A.310
REMARK   3  BIND 5  A.311
REMARK   3  BIND 6  A.316
REMARK   3  BIND 7  A.317
REMARK   3  BIND 8  A.318
REMARK   3  BIND 9  A.319
REMARK   3  BIND 10  B.41
REMARK   3  BIND 11  B.43
REMARK   3  BIND 12  B.45
REMARK   3  BIND 13  B.46
REMARK   3  BIND 14  _.2
REMARK   3 
REMARK   3 MODEL LIGAND 4
REMARK   3  NAME    AMP
REMARK   3  BIND    A.41
REMARK   3  BIND 2  A.43
REMARK   3  BIND 3  A.45
REMARK   3  BIND 4  A.46
REMARK   3  BIND 5  B.68
REMARK   3  BIND 6  B.72
REMARK   3  BIND 7  B.76
REMARK   3  BIND 8  B.310
REMARK   3  BIND 9  B.311
REMARK   3  BIND 10  B.316
REMARK   3  BIND 11  B.317
REMARK   3  BIND 12  B.318
REMARK   3  BIND 13  B.319
REMARK   3  BIND 14  _.5
REMARK   3 
REMARK   3 MODEL LIGAND 5
REMARK   3  NAME    ADE
REMARK   3  BIND    A.283
REMARK   3  BIND 2  A.286
REMARK   3  BIND 3  A.611
REMARK   3  BIND 4  A.613
REMARK   3  BIND 5  A.614
REMARK   3  BIND 6  _.3
REMARK   3 
REMARK   3 MODEL LIGAND 6
REMARK   3  NAME    ADE
REMARK   3  BIND    B.283
REMARK   3  BIND 2  B.286
REMARK   3  BIND 3  B.611
REMARK   3  BIND 4  B.613
REMARK   3  BIND 5  B.614
REMARK   3  BIND 6  _.6
REMARK   3 
REMARK   3 TEMPLATE 1
REMARK   3  PDBID   1z8d
REMARK   3  CHAIN   A
REMARK   3  MMCIF   A
REMARK   3  PDBV    2021-12-10
REMARK   3  SMTLE   1z8d.1.A
REMARK   3  SMTLV   2021-12-15
REMARK   3  MTHD    X-RAY DIFFRACTION 2.30 A
REMARK   3  FOUND   BLAST
REMARK   3  GMQE    0.95
REMARK   3  SIM     0.57
REMARK   3  SID     83.91
REMARK   3  OSTAT   homo-dimer
REMARK   3  LIGND   GLC
REMARK   3  LIGND 2 GLC
REMARK   3  LIGND 3 AMP
REMARK   3  LIGND 4 AMP
REMARK   3  LIGND 5 ADE
REMARK   3  LIGND 6 ADE
REMARK   3  ALN A TRG MAKPLTDSEKRKQISVRGLAGLGDVAEVRKSFNRHLHFTLVKDRNVATPRDYFFALAH
REMARK   3  ALN A TRG TVRDHLVGRWIRTQQHYYERDPKRIYYLSLEFYMGRTLQNTMVNLGLQNACDEAIYQL
REMARK   3  ALN A TRG GLDLEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEFGIFNQKIVNG
REMARK   3  ALN A TRG WQVEEADDWLRYGNPWEKARPEYMLPVHFYGRVEHTPDGVKWLDTQVVLAMPYDTPVP
REMARK   3  ALN A TRG GYKNNTVNTMRLWSAKAPNDFKLQDFNVGDYIEAVLDRNLAENISRVLYPNDNFFEGK
REMARK   3  ALN A TRG ELRLKQEYFVVAATLQDIIRRFKSSKFGCRDPVRTCFETFPDKVAIQLNDTHPALSIP
REMARK   3  ALN A TRG ELMRILVDVEKVDWDKAWEITKKTCAYTNHTVLPEALERWPVSMFEKLLPRHLEIIYA
REMARK   3  ALN A TRG INQRHLDHVAALFPGDVDRLRRMSVIEEGDCKRINMAHLCVIGSHAVNGVARIHSEIV
REMARK   3  ALN A TRG KQSVFKDFYELEPEKFQNKTNGITPRRWLLLCNPGLADTIVEKIGEEFLTDLSQLKKL
REMARK   3  ALN A TRG LPLVSDEVFIRDVAKVKQENKLKFSAFLEKEYKVKINPSSMFDVHVKRIHEYKRQLLN
REMARK   3  ALN A TRG CLHVVTLYNRIKRDPAKAFVPRTVMIGGKAAPGYHMAKLIIKLVTSIGDVVNHDPVVG
REMARK   3  ALN A TRG DRLKVIFLENYRVSLAEKVIPAADLSQQISTAGTEASGTGNMKFMLNGALTIGTMDGA
REMARK   3  ALN A TRG NVEMAEEAGAENLFIFGLRVEDVEALDRKGYNAREYYDHLPELKQAVDQISSGFFSPK
REMARK   3  ALN A TRG EPDCFKDIVNMLMHHDRFKVFADYEAYMQCQAQVDQLYRNPKEWTKKVIRNIACSGKF
REMARK   3  ALN A TRG SSDRTITEYAREIWGVEPSDLQIPPPNIPRD
REMARK   3  ALN A TPL MSRPLSDQEKRKQISVRGLAGVENVTELKKNFNRHLHFTLVKDRNVATPRDYYFALAH
REMARK   3  ALN A TPL TVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEFYMGRTLQNTMVNLALENACDEATYQL
REMARK   3  ALN A TPL GLDMEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEFGIFNQKISGG
REMARK   3  ALN A TPL WQMEEADDWLRYGNPWEKARPEFTLPVHFYGHVEHTSQGAKWVDTQVVLAMPYDTPVP
REMARK   3  ALN A TPL GYRNNVVNTMRLWSAKAPNDFNLKDFNVGGYIQAVLDRNLAENISRVLYPNDNFFEGK
REMARK   3  ALN A TPL ELRLKQEYFVVAATLQDIIRRFKSSKFGCRDPVRTNFDAFPDKVAIQLNDTHPSLAIP
REMARK   3  ALN A TPL ELMRILVDLERMDWDKAWDVTVRTCAYTNHTVLPEALERWPVHLLETLLPRHLQIIYE
REMARK   3  ALN A TPL INQRFLNRVAAAFPGDVDRLRRMSLVEEGAVKRINMAHLCIAGSHAVNGVARIHSEIL
REMARK   3  ALN A TPL KKTIFKDFYELEPHKFQNKTNGITPRRWLVLCNPGLAEVIAERIGEDFISDLDQLRKL
REMARK   3  ALN A TPL LSFVDDEAFIRDVAKVKQENKLKFAAYLEREYKVHINPNSLFDIQVKRIHEYKRQLLN
REMARK   3  ALN A TPL CLHVITLYNRIKREPNKFFVPRTVMIGGKAAPGYHMAKMIIRLVTAIGDVVNHDPAVG
REMARK   3  ALN A TPL DRLRVIFLENYRVSLAEKVIPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGA
REMARK   3  ALN A TPL NVEMAEEAGEENFFIFGMRVEDVDKLDQRGYNAQEYYDRIPELRQVIEQLSSGFFSPK
REMARK   3  ALN A TPL QPDLFKDIVNMLMHHDRFKVFADYEDYIKCQEKVSALYKNPREWTRMVIRNIATSGKF
REMARK   3  ALN A TPL SSDRTIAQYAREIWGVEPSRQRLPAPD----
REMARK   3  ALN A OFF 0
ATOM      1  N   LYS A   3      30.973 -23.516  61.156  1.00  0.68           N  
ATOM      2  CA  LYS A   3      30.460 -24.410  60.063  1.00  0.68           C  
ATOM      3  C   LYS A   3      31.240 -24.127  58.806  1.00  0.68           C  
ATOM      4  O   LYS A   3      31.585 -22.958  58.637  1.00  0.68           O  
ATOM      5  CB  LYS A   3      28.947 -24.094  59.852  1.00  0.68           C  
ATOM      6  CG  LYS A   3      28.232 -24.898  58.743  1.00  0.68           C  
ATOM      7  CD  LYS A   3      26.708 -24.652  58.702  1.00  0.68           C  
ATOM      8  CE  LYS A   3      26.007 -25.435  57.579  1.00  0.68           C  
ATOM      9  NZ  LYS A   3      24.544 -25.191  57.594  1.00  0.68           N  
ATOM     10  N   PRO A   4      31.603 -25.059  57.938  1.00  0.72           N  
ATOM     11  CA  PRO A   4      32.179 -24.724  56.647  1.00  0.72           C  
ATOM     12  C   PRO A   4      31.283 -23.846  55.799  1.00  0.72           C  
ATOM     13  O   PRO A   4      30.147 -24.225  55.514  1.00  0.72           O  
ATOM     14  CB  PRO A   4      32.459 -26.079  55.996  1.00  0.72           C  
ATOM     15  CG  PRO A   4      32.685 -27.006  57.190  1.00  0.72           C  
ATOM     16  CD  PRO A   4      31.651 -26.503  58.192  1.00  0.72           C  
ATOM     17  N   LEU A   5      31.776 -22.670  55.402  1.00  0.60           N  
ATOM     18  CA  LEU A   5      31.097 -21.785  54.484  1.00  0.60           C  
ATOM     19  C   LEU A   5      31.263 -22.292  53.061  1.00  0.60           C  
ATOM     20  O   LEU A   5      32.316 -22.797  52.673  1.00  0.60           O  
ATOM     21  CB  LEU A   5      31.660 -20.340  54.593  1.00  0.60           C  
ATOM     22  CG  LEU A   5      31.075 -19.452  55.719  1.00  0.60           C  
ATOM     23  CD1 LEU A   5      31.062 -20.114  57.101  1.00  0.60           C  
ATOM     24  CD2 LEU A   5      31.840 -18.124  55.818  1.00  0.60           C  
ATOM     25  N   THR A   6      30.215 -22.148  52.232  1.00  0.66           N  
ATOM     26  CA  THR A   6      30.288 -22.449  50.811  1.00  0.66           C  
ATOM     27  C   THR A   6      30.997 -21.312  50.104  1.00  0.66           C  
ATOM     28  O   THR A   6      31.200 -20.235  50.669  1.00  0.66           O  
ATOM     29  CB  THR A   6      28.927 -22.670  50.139  1.00  0.66           C  
ATOM     30  OG1 THR A   6      28.106 -21.507  50.195  1.00  0.66           O  
ATOM     31  CG2 THR A   6      28.149 -23.797  50.838  1.00  0.66           C  
ATOM     32  N   ASP A   7      31.380 -21.490  48.830  1.00  0.69           N  
ATOM     33  CA  ASP A   7      32.014 -20.444  48.055  1.00  0.69           C  
ATOM     34  C   ASP A   7      31.160 -19.191  47.909  1.00  0.69           C  
ATOM     35  O   ASP A   7      31.652 -18.070  47.988  1.00  0.69           O  
ATOM     36  CB  ASP A   7      32.386 -20.987  46.669  1.00  0.69           C  
ATOM     37  CG  ASP A   7      33.351 -22.139  46.863  1.00  0.69           C  
ATOM     38  OD1 ASP A   7      34.344 -21.965  47.619  1.00  0.69           O  
ATOM     39  OD2 ASP A   7      33.052 -23.221  46.308  1.00  0.69           O  
ATOM     40  N   SER A   8      29.830 -19.347  47.777  1.00  0.72           N  
ATOM     41  CA  SER A   8      28.874 -18.248  47.784  1.00  0.72           C  
ATOM     42  C   SER A   8      28.936 -17.396  49.034  1.00  0.72           C  
ATOM     43  O   SER A   8      28.877 -16.171  48.955  1.00  0.72           O  
ATOM     44  CB  SER A   8      27.411 -18.755  47.701  1.00  0.72           C  
ATOM     45  OG  SER A   8      27.219 -19.544  46.530  1.00  0.72           O  
ATOM     46  N   GLU A   9      29.058 -18.019  50.223  1.00  0.70           N  
ATOM     47  CA  GLU A   9      29.176 -17.279  51.465  1.00  0.70           C  
ATOM     48  C   GLU A   9      30.540 -16.658  51.692  1.00  0.70           C  
ATOM     49  O   GLU A   9      30.680 -15.529  52.155  1.00  0.70           O  
ATOM     50  CB  GLU A   9      28.709 -18.127  52.665  1.00  0.70           C  
ATOM     51  CG  GLU A   9      28.299 -17.305  53.921  1.00  0.70           C  
ATOM     52  CD  GLU A   9      27.121 -16.356  53.749  1.00  0.70           C  
ATOM     53  OE1 GLU A   9      26.634 -15.787  54.754  1.00  0.70           O  
ATOM     54  OE2 GLU A   9      26.666 -16.182  52.593  1.00  0.70           O  
ATOM     55  N   LYS A  10      31.615 -17.351  51.294  1.00  0.75           N  
ATOM     56  CA  LYS A  10      32.950 -16.790  51.323  1.00  0.75           C  
ATOM     57  C   LYS A  10      33.128 -15.564  50.434  1.00  0.75           C  
ATOM     58  O   LYS A  10      33.726 -14.568  50.845  1.00  0.75           O  
ATOM     59  CB  LYS A  10      33.956 -17.856  50.889  1.00  0.75           C  
ATOM     60  CG  LYS A  10      34.087 -19.034  51.860  1.00  0.75           C  
ATOM     61  CD  LYS A  10      35.048 -20.059  51.256  1.00  0.75           C  
ATOM     62  CE  LYS A  10      35.353 -21.263  52.133  1.00  0.75           C  
ATOM     63  NZ  LYS A  10      36.257 -22.142  51.371  1.00  0.75           N  
ATOM     64  N   ARG A  11      32.550 -15.574  49.213  1.00  0.63           N  
ATOM     65  CA  ARG A  11      32.626 -14.459  48.285  1.00  0.63           C  
ATOM     66  C   ARG A  11      31.898 -13.212  48.768  1.00  0.63           C  
ATOM     67  O   ARG A  11      32.068 -12.133  48.209  1.00  0.63           O  
ATOM     68  CB  ARG A  11      32.102 -14.827  46.871  1.00  0.63           C  
ATOM     69  CG  ARG A  11      32.989 -15.846  46.125  1.00  0.63           C  
ATOM     70  CD  ARG A  11      32.514 -16.138  44.700  1.00  0.63           C  
ATOM     71  NE  ARG A  11      33.159 -17.409  44.250  1.00  0.63           N  
ATOM     72  CZ  ARG A  11      33.121 -17.909  43.010  1.00  0.63           C  
ATOM     73  NH1 ARG A  11      32.577 -17.243  41.998  1.00  0.63           N  
ATOM     74  NH2 ARG A  11      33.684 -19.094  42.792  1.00  0.63           N  
ATOM     75  N   LYS A  12      31.104 -13.273  49.857  1.00  0.73           N  
ATOM     76  CA  LYS A  12      30.492 -12.104  50.470  1.00  0.73           C  
ATOM     77  C   LYS A  12      31.524 -11.120  51.008  1.00  0.73           C  
ATOM     78  O   LYS A  12      31.292  -9.912  51.047  1.00  0.73           O  
ATOM     79  CB  LYS A  12      29.538 -12.501  51.615  1.00  0.73           C  
ATOM     80  CG  LYS A  12      28.430 -13.483  51.206  1.00  0.73           C  
ATOM     81  CD  LYS A  12      27.386 -12.931  50.230  1.00  0.73           C  
ATOM     82  CE  LYS A  12      26.348 -13.987  49.821  1.00  0.73           C  
ATOM     83  NZ  LYS A  12      25.647 -14.552  50.982  1.00  0.73           N  
ATOM     84  N   GLN A  13      32.730 -11.633  51.343  1.00  0.62           N  
ATOM     85  CA  GLN A  13      33.889 -10.846  51.716  1.00  0.62           C  
ATOM     86  C   GLN A  13      34.461 -10.043  50.565  1.00  0.62           C  
ATOM     87  O   GLN A  13      35.248  -9.119  50.777  1.00  0.62           O  
ATOM     88  CB  GLN A  13      35.036 -11.751  52.211  1.00  0.62           C  
ATOM     89  CG  GLN A  13      34.715 -12.572  53.474  1.00  0.62           C  
ATOM     90  CD  GLN A  13      35.909 -13.476  53.766  1.00  0.62           C  
ATOM     91  OE1 GLN A  13      36.958 -13.020  54.228  1.00  0.62           O  
ATOM     92  NE2 GLN A  13      35.765 -14.774  53.429  1.00  0.62           N  
ATOM     93  N   ILE A  14      34.067 -10.338  49.306  1.00  0.61           N  
ATOM     94  CA  ILE A  14      34.348  -9.506  48.158  1.00  0.61           C  
ATOM     95  C   ILE A  14      33.424  -8.287  48.240  1.00  0.61           C  
ATOM     96  O   ILE A  14      32.367  -8.222  47.600  1.00  0.61           O  
ATOM     97  CB  ILE A  14      34.270 -10.273  46.845  1.00  0.61           C  
ATOM     98  CG1 ILE A  14      35.187 -11.523  46.922  1.00  0.61           C  
ATOM     99  CG2 ILE A  14      34.687  -9.357  45.672  1.00  0.61           C  
ATOM    100  CD1 ILE A  14      35.051 -12.469  45.729  1.00  0.61           C  
ATOM    101  N   SER A  15      33.820  -7.340  49.131  1.00  0.69           N  
ATOM    102  CA  SER A  15      33.130  -6.151  49.626  1.00  0.69           C  
ATOM    103  C   SER A  15      33.718  -4.892  49.021  1.00  0.69           C  
ATOM    104  O   SER A  15      34.912  -4.830  48.771  1.00  0.69           O  
ATOM    105  CB  SER A  15      31.583  -6.234  49.578  1.00  0.69           C  
ATOM    106  OG  SER A  15      30.887  -5.197  50.281  1.00  0.69           O  
ATOM    107  N   VAL A  16      32.927  -3.825  48.807  1.00  0.73           N  
ATOM    108  CA  VAL A  16      33.457  -2.530  48.390  1.00  0.73           C  
ATOM    109  C   VAL A  16      33.905  -1.777  49.634  1.00  0.73           C  
ATOM    110  O   VAL A  16      33.087  -1.165  50.335  1.00  0.73           O  
ATOM    111  CB  VAL A  16      32.407  -1.684  47.666  1.00  0.73           C  
ATOM    112  CG1 VAL A  16      32.904  -0.259  47.335  1.00  0.73           C  
ATOM    113  CG2 VAL A  16      31.987  -2.381  46.367  1.00  0.73           C  
ATOM    114  N   ARG A  17      35.215  -1.805  49.958  1.00  0.56           N  
ATOM    115  CA  ARG A  17      35.753  -1.169  51.148  1.00  0.56           C  
ATOM    116  C   ARG A  17      37.194  -0.723  51.004  1.00  0.56           C  
ATOM    117  O   ARG A  17      37.905  -1.080  50.072  1.00  0.56           O  
ATOM    118  CB  ARG A  17      35.646  -2.088  52.398  1.00  0.56           C  
ATOM    119  CG  ARG A  17      34.285  -2.071  53.136  1.00  0.56           C  
ATOM    120  CD  ARG A  17      33.866  -0.741  53.803  1.00  0.56           C  
ATOM    121  NE  ARG A  17      33.327   0.181  52.752  1.00  0.56           N  
ATOM    122  CZ  ARG A  17      33.097   1.497  52.908  1.00  0.56           C  
ATOM    123  NH1 ARG A  17      33.179   2.105  54.084  1.00  0.56           N  
ATOM    124  NH2 ARG A  17      32.782   2.226  51.840  1.00  0.56           N  
ATOM    125  N   GLY A  18      37.647   0.148  51.935  1.00  0.57           N  
ATOM    126  CA  GLY A  18      38.990   0.726  51.940  1.00  0.57           C  
ATOM    127  C   GLY A  18      39.092   2.029  51.193  1.00  0.57           C  
ATOM    128  O   GLY A  18      39.715   2.982  51.643  1.00  0.57           O  
ATOM    129  N   LEU A  19      38.466   2.121  50.019  1.00  0.47           N  
ATOM    130  CA  LEU A  19      38.385   3.332  49.234  1.00  0.47           C  
ATOM    131  C   LEU A  19      37.540   4.449  49.804  1.00  0.47           C  
ATOM    132  O   LEU A  19      36.379   4.266  50.163  1.00  0.47           O  
ATOM    133  CB  LEU A  19      37.877   2.889  47.872  1.00  0.47           C  
ATOM    134  CG  LEU A  19      37.720   3.915  46.746  1.00  0.47           C  
ATOM    135  CD1 LEU A  19      37.757   3.134  45.446  1.00  0.47           C  
ATOM    136  CD2 LEU A  19      36.439   4.730  46.848  1.00  0.47           C  
ATOM    137  N   ALA A  20      38.129   5.658  49.885  1.00  0.55           N  
ATOM    138  CA  ALA A  20      37.469   6.871  50.329  1.00  0.55           C  
ATOM    139  C   ALA A  20      36.850   6.874  51.706  1.00  0.55           C  
ATOM    140  O   ALA A  20      36.230   7.859  52.092  1.00  0.55           O  
ATOM    141  CB  ALA A  20      36.414   7.381  49.325  1.00  0.55           C  
ATOM    142  N   GLY A  21      37.092   5.824  52.525  1.00  0.53           N  
ATOM    143  CA  GLY A  21      36.595   5.754  53.896  1.00  0.53           C  
ATOM    144  C   GLY A  21      37.243   6.801  54.731  1.00  0.53           C  
ATOM    145  O   GLY A  21      36.708   7.266  55.733  1.00  0.53           O  
ATOM    146  N   LEU A  22      38.429   7.214  54.285  1.00  0.56           N  
ATOM    147  CA  LEU A  22      39.142   8.310  54.858  1.00  0.56           C  
ATOM    148  C   LEU A  22      39.655   9.179  53.731  1.00  0.56           C  
ATOM    149  O   LEU A  22      40.767   8.971  53.226  1.00  0.56           O  
ATOM    150  CB  LEU A  22      40.338   7.776  55.675  1.00  0.56           C  
ATOM    151  CG  LEU A  22      39.923   6.826  56.815  1.00  0.56           C  
ATOM    152  CD1 LEU A  22      41.115   6.057  57.387  1.00  0.56           C  
ATOM    153  CD2 LEU A  22      39.161   7.533  57.942  1.00  0.56           C  
ATOM    154  N   GLY A  23      38.917  10.230  53.310  1.00  0.70           N  
ATOM    155  CA  GLY A  23      39.420  11.300  52.441  1.00  0.70           C  
ATOM    156  C   GLY A  23      40.316  12.230  53.228  1.00  0.70           C  
ATOM    157  O   GLY A  23      40.102  13.413  53.343  1.00  0.70           O  
ATOM    158  N   ASP A  24      41.342  11.601  53.833  1.00  0.78           N  
ATOM    159  CA  ASP A  24      42.273  12.198  54.747  1.00  0.78           C  
ATOM    160  C   ASP A  24      43.525  12.624  53.991  1.00  0.78           C  
ATOM    161  O   ASP A  24      43.943  11.996  53.030  1.00  0.78           O  
ATOM    162  CB  ASP A  24      42.599  11.134  55.833  1.00  0.78           C  
ATOM    163  CG  ASP A  24      43.325  11.685  57.048  1.00  0.78           C  
ATOM    164  OD1 ASP A  24      44.445  12.227  56.873  1.00  0.78           O  
ATOM    165  OD2 ASP A  24      42.774  11.554  58.163  1.00  0.78           O  
ATOM    166  N   VAL A  25      44.202  13.698  54.445  1.00  0.79           N  
ATOM    167  CA  VAL A  25      45.492  14.108  53.900  1.00  0.79           C  
ATOM    168  C   VAL A  25      46.552  13.016  54.062  1.00  0.79           C  
ATOM    169  O   VAL A  25      47.333  12.721  53.152  1.00  0.79           O  
ATOM    170  CB  VAL A  25      45.967  15.402  54.557  1.00  0.79           C  
ATOM    171  CG1 VAL A  25      47.374  15.794  54.070  1.00  0.79           C  
ATOM    172  CG2 VAL A  25      44.979  16.529  54.200  1.00  0.79           C  
ATOM    173  N   ALA A  26      46.570  12.337  55.224  1.00  0.78           N  
ATOM    174  CA  ALA A  26      47.462  11.246  55.532  1.00  0.78           C  
ATOM    175  C   ALA A  26      47.218   9.999  54.700  1.00  0.78           C  
ATOM    176  O   ALA A  26      48.166   9.310  54.319  1.00  0.78           O  
ATOM    177  CB  ALA A  26      47.380  10.900  57.031  1.00  0.78           C  
ATOM    178  N   GLU A  27      45.947   9.655  54.427  1.00  0.75           N  
ATOM    179  CA  GLU A  27      45.589   8.555  53.546  1.00  0.75           C  
ATOM    180  C   GLU A  27      45.802   8.862  52.076  1.00  0.75           C  
ATOM    181  O   GLU A  27      46.350   8.037  51.347  1.00  0.75           O  
ATOM    182  CB  GLU A  27      44.162   8.037  53.818  1.00  0.75           C  
ATOM    183  CG  GLU A  27      44.019   7.361  55.207  1.00  0.75           C  
ATOM    184  CD  GLU A  27      45.041   6.261  55.451  1.00  0.75           C  
ATOM    185  OE1 GLU A  27      45.709   6.316  56.519  1.00  0.75           O  
ATOM    186  OE2 GLU A  27      45.253   5.405  54.560  1.00  0.75           O  
ATOM    187  N   VAL A  28      45.465  10.088  51.610  1.00  0.81           N  
ATOM    188  CA  VAL A  28      45.747  10.551  50.250  1.00  0.81           C  
ATOM    189  C   VAL A  28      47.240  10.498  49.958  1.00  0.81           C  
ATOM    190  O   VAL A  28      47.674  10.075  48.889  1.00  0.81           O  
ATOM    191  CB  VAL A  28      45.210  11.965  50.008  1.00  0.81           C  
ATOM    192  CG1 VAL A  28      45.729  12.602  48.701  1.00  0.81           C  
ATOM    193  CG2 VAL A  28      43.671  11.926  49.939  1.00  0.81           C  
ATOM    194  N   ARG A  29      48.083  10.870  50.943  1.00  0.79           N  
ATOM    195  CA  ARG A  29      49.521  10.718  50.844  1.00  0.79           C  
ATOM    196  C   ARG A  29      49.977   9.273  50.640  1.00  0.79           C  
ATOM    197  O   ARG A  29      50.790   8.995  49.761  1.00  0.79           O  
ATOM    198  CB  ARG A  29      50.179  11.280  52.129  1.00  0.79           C  
ATOM    199  CG  ARG A  29      51.722  11.307  52.101  1.00  0.79           C  
ATOM    200  CD  ARG A  29      52.400  11.677  53.429  1.00  0.79           C  
ATOM    201  NE  ARG A  29      52.040  10.624  54.439  1.00  0.79           N  
ATOM    202  CZ  ARG A  29      52.639   9.430  54.541  1.00  0.79           C  
ATOM    203  NH1 ARG A  29      52.227   8.585  55.486  1.00  0.79           N  
ATOM    204  NH2 ARG A  29      53.620   9.054  53.728  1.00  0.79           N  
ATOM    205  N   LYS A  30      49.443   8.301  51.415  1.00  0.78           N  
ATOM    206  CA  LYS A  30      49.791   6.895  51.258  1.00  0.78           C  
ATOM    207  C   LYS A  30      49.367   6.317  49.919  1.00  0.78           C  
ATOM    208  O   LYS A  30      50.125   5.610  49.262  1.00  0.78           O  
ATOM    209  CB  LYS A  30      49.127   6.000  52.329  1.00  0.78           C  
ATOM    210  CG  LYS A  30      49.561   6.261  53.774  1.00  0.78           C  
ATOM    211  CD  LYS A  30      48.761   5.344  54.708  1.00  0.78           C  
ATOM    212  CE  LYS A  30      48.854   5.698  56.188  1.00  0.78           C  
ATOM    213  NZ  LYS A  30      48.176   6.983  56.433  1.00  0.78           N  
ATOM    214  N   SER A  31      48.136   6.607  49.468  1.00  0.82           N  
ATOM    215  CA  SER A  31      47.628   6.156  48.183  1.00  0.82           C  
ATOM    216  C   SER A  31      48.346   6.759  47.000  1.00  0.82           C  
ATOM    217  O   SER A  31      48.663   6.045  46.051  1.00  0.82           O  
ATOM    218  CB  SER A  31      46.104   6.343  48.052  1.00  0.82           C  
ATOM    219  OG  SER A  31      45.725   7.693  48.274  1.00  0.82           O  
ATOM    220  N   PHE A  32      48.701   8.061  47.057  1.00  0.87           N  
ATOM    221  CA  PHE A  32      49.538   8.712  46.057  1.00  0.87           C  
ATOM    222  C   PHE A  32      50.881   8.022  45.941  1.00  0.87           C  
ATOM    223  O   PHE A  32      51.360   7.712  44.852  1.00  0.87           O  
ATOM    224  CB  PHE A  32      49.737  10.205  46.459  1.00  0.87           C  
ATOM    225  CG  PHE A  32      50.577  10.985  45.479  1.00  0.87           C  
ATOM    226  CD1 PHE A  32      51.983  10.901  45.510  1.00  0.87           C  
ATOM    227  CD2 PHE A  32      49.970  11.819  44.531  1.00  0.87           C  
ATOM    228  CE1 PHE A  32      52.765  11.609  44.592  1.00  0.87           C  
ATOM    229  CE2 PHE A  32      50.751  12.535  43.616  1.00  0.87           C  
ATOM    230  CZ  PHE A  32      52.143  12.423  43.641  1.00  0.87           C  
ATOM    231  N   ASN A  33      51.492   7.731  47.100  1.00  0.85           N  
ATOM    232  CA  ASN A  33      52.749   7.032  47.192  1.00  0.85           C  
ATOM    233  C   ASN A  33      52.656   5.618  46.620  1.00  0.85           C  
ATOM    234  O   ASN A  33      53.432   5.217  45.759  1.00  0.85           O  
ATOM    235  CB  ASN A  33      53.113   7.025  48.700  1.00  0.85           C  
ATOM    236  CG  ASN A  33      54.559   6.699  49.001  1.00  0.85           C  
ATOM    237  OD1 ASN A  33      54.864   5.999  49.967  1.00  0.85           O  
ATOM    238  ND2 ASN A  33      55.485   7.263  48.207  1.00  0.85           N  
ATOM    239  N   ARG A  34      51.609   4.869  47.008  1.00  0.78           N  
ATOM    240  CA  ARG A  34      51.325   3.540  46.508  1.00  0.78           C  
ATOM    241  C   ARG A  34      51.092   3.487  45.003  1.00  0.78           C  
ATOM    242  O   ARG A  34      51.603   2.617  44.302  1.00  0.78           O  
ATOM    243  CB  ARG A  34      50.067   2.985  47.232  1.00  0.78           C  
ATOM    244  CG  ARG A  34      49.749   1.517  46.906  1.00  0.78           C  
ATOM    245  CD  ARG A  34      48.525   0.907  47.597  1.00  0.78           C  
ATOM    246  NE  ARG A  34      47.315   1.791  47.454  1.00  0.78           N  
ATOM    247  CZ  ARG A  34      46.629   2.028  46.320  1.00  0.78           C  
ATOM    248  NH1 ARG A  34      47.004   1.542  45.144  1.00  0.78           N  
ATOM    249  NH2 ARG A  34      45.504   2.744  46.395  1.00  0.78           N  
ATOM    250  N   HIS A  35      50.314   4.432  44.448  1.00  0.84           N  
ATOM    251  CA  HIS A  35      50.129   4.537  43.014  1.00  0.84           C  
ATOM    252  C   HIS A  35      51.394   4.931  42.249  1.00  0.84           C  
ATOM    253  O   HIS A  35      51.678   4.369  41.193  1.00  0.84           O  
ATOM    254  CB  HIS A  35      48.962   5.485  42.660  1.00  0.84           C  
ATOM    255  CG  HIS A  35      47.603   4.904  42.962  1.00  0.84           C  
ATOM    256  ND1 HIS A  35      47.182   3.777  42.271  1.00  0.84           N  
ATOM    257  CD2 HIS A  35      46.594   5.375  43.740  1.00  0.84           C  
ATOM    258  CE1 HIS A  35      45.922   3.602  42.631  1.00  0.84           C  
ATOM    259  NE2 HIS A  35      45.522   4.534  43.524  1.00  0.84           N  
ATOM    260  N   LEU A  36      52.216   5.876  42.758  1.00  0.87           N  
ATOM    261  CA  LEU A  36      53.454   6.291  42.106  1.00  0.87           C  
ATOM    262  C   LEU A  36      54.429   5.144  41.943  1.00  0.87           C  
ATOM    263  O   LEU A  36      54.977   4.894  40.869  1.00  0.87           O  
ATOM    264  CB  LEU A  36      54.115   7.441  42.926  1.00  0.87           C  
ATOM    265  CG  LEU A  36      55.345   8.162  42.312  1.00  0.87           C  
ATOM    266  CD1 LEU A  36      56.658   7.383  42.484  1.00  0.87           C  
ATOM    267  CD2 LEU A  36      55.144   8.539  40.839  1.00  0.87           C  
ATOM    268  N   HIS A  37      54.646   4.364  43.006  1.00  0.82           N  
ATOM    269  CA  HIS A  37      55.525   3.233  42.894  1.00  0.82           C  
ATOM    270  C   HIS A  37      54.915   2.036  42.202  1.00  0.82           C  
ATOM    271  O   HIS A  37      55.533   1.448  41.320  1.00  0.82           O  
ATOM    272  CB  HIS A  37      56.090   2.846  44.266  1.00  0.82           C  
ATOM    273  CG  HIS A  37      56.923   3.941  44.855  1.00  0.82           C  
ATOM    274  ND1 HIS A  37      56.350   4.865  45.698  1.00  0.82           N  
ATOM    275  CD2 HIS A  37      58.237   4.229  44.680  1.00  0.82           C  
ATOM    276  CE1 HIS A  37      57.314   5.688  46.026  1.00  0.82           C  
ATOM    277  NE2 HIS A  37      58.484   5.352  45.439  1.00  0.82           N  
ATOM    278  N   PHE A  38      53.687   1.619  42.548  1.00  0.83           N  
ATOM    279  CA  PHE A  38      53.269   0.272  42.180  1.00  0.83           C  
ATOM    280  C   PHE A  38      52.421   0.244  40.937  1.00  0.83           C  
ATOM    281  O   PHE A  38      52.602  -0.613  40.072  1.00  0.83           O  
ATOM    282  CB  PHE A  38      52.563  -0.437  43.366  1.00  0.83           C  
ATOM    283  CG  PHE A  38      53.397  -0.285  44.629  1.00  0.83           C  
ATOM    284  CD1 PHE A  38      54.802  -0.313  44.611  1.00  0.83           C  
ATOM    285  CD2 PHE A  38      52.765  -0.024  45.853  1.00  0.83           C  
ATOM    286  CE1 PHE A  38      55.550  -0.029  45.764  1.00  0.83           C  
ATOM    287  CE2 PHE A  38      53.500   0.287  47.010  1.00  0.83           C  
ATOM    288  CZ  PHE A  38      54.899   0.306  46.952  1.00  0.83           C  
ATOM    289  N   THR A  39      51.514   1.220  40.777  1.00  0.83           N  
ATOM    290  CA  THR A  39      50.719   1.406  39.569  1.00  0.83           C  
ATOM    291  C   THR A  39      51.553   1.929  38.416  1.00  0.83           C  
ATOM    292  O   THR A  39      51.482   1.431  37.288  1.00  0.83           O  
ATOM    293  CB  THR A  39      49.553   2.352  39.817  1.00  0.83           C  
ATOM    294  OG1 THR A  39      48.749   1.831  40.864  1.00  0.83           O  
ATOM    295  CG2 THR A  39      48.662   2.502  38.582  1.00  0.83           C  
ATOM    296  N   LEU A  40      52.400   2.943  38.673  1.00  0.83           N  
ATOM    297  CA  LEU A  40      53.198   3.578  37.638  1.00  0.83           C  
ATOM    298  C   LEU A  40      54.542   2.910  37.399  1.00  0.83           C  
ATOM    299  O   LEU A  40      55.133   3.092  36.332  1.00  0.83           O  
ATOM    300  CB  LEU A  40      53.452   5.062  37.977  1.00  0.83           C  
ATOM    301  CG  LEU A  40      52.360   6.053  37.543  1.00  0.83           C  
ATOM    302  CD1 LEU A  40      50.944   5.674  37.984  1.00  0.83           C  
ATOM    303  CD2 LEU A  40      52.715   7.424  38.112  1.00  0.83           C  
ATOM    304  N   VAL A  41      55.042   2.094  38.351  1.00  0.81           N  
ATOM    305  CA  VAL A  41      56.335   1.414  38.258  1.00  0.81           C  
ATOM    306  C   VAL A  41      57.472   2.432  38.184  1.00  0.81           C  
ATOM    307  O   VAL A  41      58.275   2.452  37.245  1.00  0.81           O  
ATOM    308  CB  VAL A  41      56.399   0.342  37.168  1.00  0.81           C  
ATOM    309  CG1 VAL A  41      57.610  -0.584  37.373  1.00  0.81           C  
ATOM    310  CG2 VAL A  41      55.124  -0.518  37.203  1.00  0.81           C  
ATOM    311  N   LYS A  42      57.486   3.356  39.161  1.00  0.80           N  
ATOM    312  CA  LYS A  42      58.347   4.522  39.242  1.00  0.80           C  
ATOM    313  C   LYS A  42      58.815   4.720  40.674  1.00  0.80           C  
ATOM    314  O   LYS A  42      58.440   3.991  41.586  1.00  0.80           O  
ATOM    315  CB  LYS A  42      57.606   5.831  38.851  1.00  0.80           C  
ATOM    316  CG  LYS A  42      57.155   5.921  37.392  1.00  0.80           C  
ATOM    317  CD  LYS A  42      58.320   6.028  36.405  1.00  0.80           C  
ATOM    318  CE  LYS A  42      57.812   6.333  34.998  1.00  0.80           C  
ATOM    319  NZ  LYS A  42      58.934   6.572  34.088  1.00  0.80           N  
ATOM    320  N   ASP A  43      59.663   5.733  40.901  1.00  0.81           N  
ATOM    321  CA  ASP A  43      60.124   6.152  42.198  1.00  0.81           C  
ATOM    322  C   ASP A  43      60.483   7.625  42.083  1.00  0.81           C  
ATOM    323  O   ASP A  43      60.402   8.215  41.007  1.00  0.81           O  
ATOM    324  CB  ASP A  43      61.303   5.281  42.697  1.00  0.81           C  
ATOM    325  CG  ASP A  43      62.514   5.306  41.775  1.00  0.81           C  
ATOM    326  OD1 ASP A  43      62.699   6.301  41.028  1.00  0.81           O  
ATOM    327  OD2 ASP A  43      63.303   4.338  41.869  1.00  0.81           O  
ATOM    328  N   ARG A  44      60.915   8.281  43.177  1.00  0.75           N  
ATOM    329  CA  ARG A  44      61.271   9.685  43.095  1.00  0.75           C  
ATOM    330  C   ARG A  44      62.568   9.966  42.359  1.00  0.75           C  
ATOM    331  O   ARG A  44      62.881  11.114  42.053  1.00  0.75           O  
ATOM    332  CB  ARG A  44      61.352  10.329  44.495  1.00  0.75           C  
ATOM    333  CG  ARG A  44      62.560   9.903  45.353  1.00  0.75           C  
ATOM    334  CD  ARG A  44      62.607  10.674  46.672  1.00  0.75           C  
ATOM    335  NE  ARG A  44      63.839  10.254  47.415  1.00  0.75           N  
ATOM    336  CZ  ARG A  44      63.879   9.180  48.211  1.00  0.75           C  
ATOM    337  NH1 ARG A  44      62.835   8.372  48.340  1.00  0.75           N  
ATOM    338  NH2 ARG A  44      64.990   8.906  48.892  1.00  0.75           N  
ATOM    339  N   ASN A  45      63.374   8.929  42.068  1.00  0.78           N  
ATOM    340  CA  ASN A  45      64.609   9.087  41.339  1.00  0.78           C  
ATOM    341  C   ASN A  45      64.372   9.393  39.864  1.00  0.78           C  
ATOM    342  O   ASN A  45      65.140  10.123  39.238  1.00  0.78           O  
ATOM    343  CB  ASN A  45      65.493   7.825  41.499  1.00  0.78           C  
ATOM    344  CG  ASN A  45      65.834   7.586  42.966  1.00  0.78           C  
ATOM    345  OD1 ASN A  45      65.590   6.544  43.569  1.00  0.78           O  
ATOM    346  ND2 ASN A  45      66.449   8.605  43.611  1.00  0.78           N  
ATOM    347  N   VAL A  46      63.294   8.838  39.272  1.00  0.81           N  
ATOM    348  CA  VAL A  46      62.973   9.063  37.868  1.00  0.81           C  
ATOM    349  C   VAL A  46      61.640   9.771  37.608  1.00  0.81           C  
ATOM    350  O   VAL A  46      61.389  10.232  36.491  1.00  0.81           O  
ATOM    351  CB  VAL A  46      63.065   7.725  37.131  1.00  0.81           C  
ATOM    352  CG1 VAL A  46      61.949   6.769  37.583  1.00  0.81           C  
ATOM    353  CG2 VAL A  46      63.049   7.906  35.604  1.00  0.81           C  
ATOM    354  N   ALA A  47      60.762   9.920  38.621  1.00  0.87           N  
ATOM    355  CA  ALA A  47      59.443  10.516  38.461  1.00  0.87           C  
ATOM    356  C   ALA A  47      59.386  11.948  37.928  1.00  0.87           C  
ATOM    357  O   ALA A  47      59.968  12.892  38.467  1.00  0.87           O  
ATOM    358  CB  ALA A  47      58.665  10.475  39.784  1.00  0.87           C  
ATOM    359  N   THR A  48      58.632  12.138  36.834  1.00  0.84           N  
ATOM    360  CA  THR A  48      58.439  13.428  36.194  1.00  0.84           C  
ATOM    361  C   THR A  48      57.207  14.131  36.751  1.00  0.84           C  
ATOM    362  O   THR A  48      56.416  13.501  37.456  1.00  0.84           O  
ATOM    363  CB  THR A  48      58.344  13.323  34.667  1.00  0.84           C  
ATOM    364  OG1 THR A  48      57.150  12.715  34.200  1.00  0.84           O  
ATOM    365  CG2 THR A  48      59.524  12.511  34.117  1.00  0.84           C  
ATOM    366  N   PRO A  49      56.938  15.415  36.468  1.00  0.88           N  
ATOM    367  CA  PRO A  49      55.660  16.050  36.806  1.00  0.88           C  
ATOM    368  C   PRO A  49      54.470  15.304  36.235  1.00  0.88           C  
ATOM    369  O   PRO A  49      53.407  15.258  36.848  1.00  0.88           O  
ATOM    370  CB  PRO A  49      55.796  17.474  36.251  1.00  0.88           C  
ATOM    371  CG  PRO A  49      57.302  17.745  36.321  1.00  0.88           C  
ATOM    372  CD  PRO A  49      57.909  16.392  35.962  1.00  0.88           C  
ATOM    373  N   ARG A  50      54.641  14.668  35.063  1.00  0.82           N  
ATOM    374  CA  ARG A  50      53.635  13.812  34.483  1.00  0.82           C  
ATOM    375  C   ARG A  50      53.347  12.561  35.296  1.00  0.82           C  
ATOM    376  O   ARG A  50      52.187  12.210  35.510  1.00  0.82           O  
ATOM    377  CB  ARG A  50      54.016  13.454  33.032  1.00  0.82           C  
ATOM    378  CG  ARG A  50      52.925  12.670  32.285  1.00  0.82           C  
ATOM    379  CD  ARG A  50      53.326  12.214  30.877  1.00  0.82           C  
ATOM    380  NE  ARG A  50      53.682  13.410  30.042  1.00  0.82           N  
ATOM    381  CZ  ARG A  50      52.804  14.281  29.523  1.00  0.82           C  
ATOM    382  NH1 ARG A  50      51.493  14.174  29.710  1.00  0.82           N  
ATOM    383  NH2 ARG A  50      53.263  15.288  28.783  1.00  0.82           N  
ATOM    384  N   ASP A  51      54.388  11.887  35.820  1.00  0.88           N  
ATOM    385  CA  ASP A  51      54.226  10.756  36.715  1.00  0.88           C  
ATOM    386  C   ASP A  51      53.487  11.129  37.998  1.00  0.88           C  
ATOM    387  O   ASP A  51      52.572  10.445  38.452  1.00  0.88           O  
ATOM    388  CB  ASP A  51      55.606  10.167  37.094  1.00  0.88           C  
ATOM    389  CG  ASP A  51      56.290   9.616  35.863  1.00  0.88           C  
ATOM    390  OD1 ASP A  51      55.619   8.883  35.099  1.00  0.88           O  
ATOM    391  OD2 ASP A  51      57.504   9.899  35.666  1.00  0.88           O  
ATOM    392  N   TYR A  52      53.823  12.278  38.601  1.00  0.87           N  
ATOM    393  CA  TYR A  52      53.109  12.797  39.751  1.00  0.87           C  
ATOM    394  C   TYR A  52      51.654  13.163  39.475  1.00  0.87           C  
ATOM    395  O   TYR A  52      50.777  12.894  40.297  1.00  0.87           O  
ATOM    396  CB  TYR A  52      53.884  13.984  40.362  1.00  0.87           C  
ATOM    397  CG  TYR A  52      55.221  13.544  40.912  1.00  0.87           C  
ATOM    398  CD1 TYR A  52      55.347  12.406  41.733  1.00  0.87           C  
ATOM    399  CD2 TYR A  52      56.372  14.302  40.639  1.00  0.87           C  
ATOM    400  CE1 TYR A  52      56.585  12.054  42.280  1.00  0.87           C  
ATOM    401  CE2 TYR A  52      57.613  13.954  41.194  1.00  0.87           C  
ATOM    402  CZ  TYR A  52      57.714  12.837  42.029  1.00  0.87           C  
ATOM    403  OH  TYR A  52      58.957  12.479  42.591  1.00  0.87           O  
ATOM    404  N   PHE A  53      51.332  13.728  38.290  1.00  0.90           N  
ATOM    405  CA  PHE A  53      49.955  13.917  37.856  1.00  0.90           C  
ATOM    406  C   PHE A  53      49.197  12.591  37.795  1.00  0.90           C  
ATOM    407  O   PHE A  53      48.093  12.471  38.318  1.00  0.90           O  
ATOM    408  CB  PHE A  53      49.920  14.636  36.471  1.00  0.90           C  
ATOM    409  CG  PHE A  53      48.546  14.600  35.840  1.00  0.90           C  
ATOM    410  CD1 PHE A  53      48.234  13.591  34.909  1.00  0.90           C  
ATOM    411  CD2 PHE A  53      47.521  15.443  36.291  1.00  0.90           C  
ATOM    412  CE1 PHE A  53      46.925  13.431  34.440  1.00  0.90           C  
ATOM    413  CE2 PHE A  53      46.219  15.301  35.803  1.00  0.90           C  
ATOM    414  CZ  PHE A  53      45.918  14.286  34.893  1.00  0.90           C  
ATOM    415  N   PHE A  54      49.792  11.548  37.189  1.00  0.89           N  
ATOM    416  CA  PHE A  54      49.185  10.234  37.115  1.00  0.89           C  
ATOM    417  C   PHE A  54      48.987   9.579  38.469  1.00  0.89           C  
ATOM    418  O   PHE A  54      47.944   8.981  38.725  1.00  0.89           O  
ATOM    419  CB  PHE A  54      50.019   9.291  36.220  1.00  0.89           C  
ATOM    420  CG  PHE A  54      49.768   9.539  34.765  1.00  0.89           C  
ATOM    421  CD1 PHE A  54      48.466   9.469  34.240  1.00  0.89           C  
ATOM    422  CD2 PHE A  54      50.842   9.781  33.893  1.00  0.89           C  
ATOM    423  CE1 PHE A  54      48.244   9.668  32.874  1.00  0.89           C  
ATOM    424  CE2 PHE A  54      50.618   9.959  32.522  1.00  0.89           C  
ATOM    425  CZ  PHE A  54      49.317   9.911  32.015  1.00  0.89           C  
ATOM    426  N   ALA A  55      49.956   9.711  39.393  1.00  0.92           N  
ATOM    427  CA  ALA A  55      49.812   9.251  40.758  1.00  0.92           C  
ATOM    428  C   ALA A  55      48.631   9.901  41.472  1.00  0.92           C  
ATOM    429  O   ALA A  55      47.816   9.222  42.091  1.00  0.92           O  
ATOM    430  CB  ALA A  55      51.115   9.547  41.516  1.00  0.92           C  
ATOM    431  N   LEU A  56      48.461  11.232  41.329  1.00  0.90           N  
ATOM    432  CA  LEU A  56      47.290  11.939  41.816  1.00  0.90           C  
ATOM    433  C   LEU A  56      45.999  11.541  41.129  1.00  0.90           C  
ATOM    434  O   LEU A  56      44.975  11.338  41.782  1.00  0.90           O  
ATOM    435  CB  LEU A  56      47.480  13.463  41.664  1.00  0.90           C  
ATOM    436  CG  LEU A  56      46.355  14.341  42.251  1.00  0.90           C  
ATOM    437  CD1 LEU A  56      46.067  14.046  43.730  1.00  0.90           C  
ATOM    438  CD2 LEU A  56      46.721  15.818  42.072  1.00  0.90           C  
ATOM    439  N   ALA A  57      46.018  11.385  39.790  1.00  0.94           N  
ATOM    440  CA  ALA A  57      44.866  10.974  39.021  1.00  0.94           C  
ATOM    441  C   ALA A  57      44.344   9.622  39.452  1.00  0.94           C  
ATOM    442  O   ALA A  57      43.164   9.495  39.746  1.00  0.94           O  
ATOM    443  CB  ALA A  57      45.202  10.919  37.520  1.00  0.94           C  
ATOM    444  N   HIS A  58      45.227   8.612  39.598  1.00  0.86           N  
ATOM    445  CA  HIS A  58      44.880   7.308  40.142  1.00  0.86           C  
ATOM    446  C   HIS A  58      44.386   7.353  41.580  1.00  0.86           C  
ATOM    447  O   HIS A  58      43.408   6.693  41.920  1.00  0.86           O  
ATOM    448  CB  HIS A  58      46.064   6.328  40.060  1.00  0.86           C  
ATOM    449  CG  HIS A  58      46.307   5.815  38.672  1.00  0.86           C  
ATOM    450  ND1 HIS A  58      45.438   4.888  38.127  1.00  0.86           N  
ATOM    451  CD2 HIS A  58      47.296   6.100  37.787  1.00  0.86           C  
ATOM    452  CE1 HIS A  58      45.916   4.627  36.930  1.00  0.86           C  
ATOM    453  NE2 HIS A  58      47.041   5.336  36.670  1.00  0.86           N  
ATOM    454  N   THR A  59      45.006   8.169  42.459  1.00  0.86           N  
ATOM    455  CA  THR A  59      44.516   8.375  43.824  1.00  0.86           C  
ATOM    456  C   THR A  59      43.103   8.905  43.883  1.00  0.86           C  
ATOM    457  O   THR A  59      42.239   8.326  44.535  1.00  0.86           O  
ATOM    458  CB  THR A  59      45.378   9.372  44.585  1.00  0.86           C  
ATOM    459  OG1 THR A  59      46.660   8.811  44.764  1.00  0.86           O  
ATOM    460  CG2 THR A  59      44.833   9.672  45.986  1.00  0.86           C  
ATOM    461  N   VAL A  60      42.799   9.995  43.152  1.00  0.88           N  
ATOM    462  CA  VAL A  60      41.452  10.542  43.032  1.00  0.88           C  
ATOM    463  C   VAL A  60      40.509   9.567  42.350  1.00  0.88           C  
ATOM    464  O   VAL A  60      39.334   9.456  42.705  1.00  0.88           O  
ATOM    465  CB  VAL A  60      41.434  11.876  42.293  1.00  0.88           C  
ATOM    466  CG1 VAL A  60      39.999  12.420  42.174  1.00  0.88           C  
ATOM    467  CG2 VAL A  60      42.284  12.914  43.047  1.00  0.88           C  
ATOM    468  N   ARG A  61      41.010   8.807  41.358  1.00  0.83           N  
ATOM    469  CA  ARG A  61      40.256   7.801  40.653  1.00  0.83           C  
ATOM    470  C   ARG A  61      39.711   6.728  41.558  1.00  0.83           C  
ATOM    471  O   ARG A  61      38.548   6.364  41.403  1.00  0.83           O  
ATOM    472  CB  ARG A  61      41.061   7.117  39.540  1.00  0.83           C  
ATOM    473  CG  ARG A  61      40.150   6.612  38.418  1.00  0.83           C  
ATOM    474  CD  ARG A  61      40.813   5.573  37.533  1.00  0.83           C  
ATOM    475  NE  ARG A  61      40.621   4.217  38.121  1.00  0.83           N  
ATOM    476  CZ  ARG A  61      41.093   3.134  37.497  1.00  0.83           C  
ATOM    477  NH1 ARG A  61      41.828   3.249  36.391  1.00  0.83           N  
ATOM    478  NH2 ARG A  61      40.808   1.917  37.947  1.00  0.83           N  
ATOM    479  N   ASP A  62      40.483   6.248  42.567  1.00  0.82           N  
ATOM    480  CA  ASP A  62      39.949   5.418  43.630  1.00  0.82           C  
ATOM    481  C   ASP A  62      38.703   6.111  44.234  1.00  0.82           C  
ATOM    482  O   ASP A  62      37.593   5.672  44.065  1.00  0.82           O  
ATOM    483  CB  ASP A  62      41.012   5.095  44.735  1.00  0.82           C  
ATOM    484  CG  ASP A  62      42.153   4.176  44.296  1.00  0.82           C  
ATOM    485  OD1 ASP A  62      41.971   3.402  43.328  1.00  0.82           O  
ATOM    486  OD2 ASP A  62      43.223   4.176  44.979  1.00  0.82           O  
ATOM    487  N   HIS A  63      38.815   7.331  44.802  1.00  0.80           N  
ATOM    488  CA  HIS A  63      37.643   7.984  45.393  1.00  0.80           C  
ATOM    489  C   HIS A  63      36.433   8.139  44.465  1.00  0.80           C  
ATOM    490  O   HIS A  63      35.297   8.068  44.912  1.00  0.80           O  
ATOM    491  CB  HIS A  63      37.997   9.374  45.943  1.00  0.80           C  
ATOM    492  CG  HIS A  63      39.031   9.362  47.033  1.00  0.80           C  
ATOM    493  ND1 HIS A  63      38.686   9.303  48.368  1.00  0.80           N  
ATOM    494  CD2 HIS A  63      40.373   9.293  46.905  1.00  0.80           C  
ATOM    495  CE1 HIS A  63      39.829   9.187  49.019  1.00  0.80           C  
ATOM    496  NE2 HIS A  63      40.884   9.168  48.177  1.00  0.80           N  
ATOM    497  N   LEU A  64      36.662   8.312  43.148  1.00  0.83           N  
ATOM    498  CA  LEU A  64      35.645   8.194  42.115  1.00  0.83           C  
ATOM    499  C   LEU A  64      35.030   6.795  41.922  1.00  0.83           C  
ATOM    500  O   LEU A  64      33.808   6.630  41.925  1.00  0.83           O  
ATOM    501  CB  LEU A  64      36.318   8.612  40.778  1.00  0.83           C  
ATOM    502  CG  LEU A  64      35.602   9.668  39.925  1.00  0.83           C  
ATOM    503  CD1 LEU A  64      36.281   9.735  38.549  1.00  0.83           C  
ATOM    504  CD2 LEU A  64      34.100   9.451  39.780  1.00  0.83           C  
ATOM    505  N   VAL A  65      35.850   5.732  41.768  1.00  0.80           N  
ATOM    506  CA  VAL A  65      35.406   4.383  41.422  1.00  0.80           C  
ATOM    507  C   VAL A  65      34.500   3.756  42.463  1.00  0.80           C  
ATOM    508  O   VAL A  65      33.499   3.121  42.143  1.00  0.80           O  
ATOM    509  CB  VAL A  65      36.576   3.433  41.139  1.00  0.80           C  
ATOM    510  CG1 VAL A  65      36.122   1.967  40.983  1.00  0.80           C  
ATOM    511  CG2 VAL A  65      37.286   3.837  39.835  1.00  0.80           C  
ATOM    512  N   GLY A  66      34.794   3.924  43.763  1.00  0.82           N  
ATOM    513  CA  GLY A  66      33.948   3.323  44.795  1.00  0.82           C  
ATOM    514  C   GLY A  66      32.575   3.940  44.919  1.00  0.82           C  
ATOM    515  O   GLY A  66      31.602   3.256  45.234  1.00  0.82           O  
ATOM    516  N   ARG A  67      32.452   5.252  44.625  1.00  0.78           N  
ATOM    517  CA  ARG A  67      31.174   5.925  44.455  1.00  0.78           C  
ATOM    518  C   ARG A  67      30.432   5.423  43.222  1.00  0.78           C  
ATOM    519  O   ARG A  67      29.215   5.243  43.245  1.00  0.78           O  
ATOM    520  CB  ARG A  67      31.345   7.447  44.248  1.00  0.78           C  
ATOM    521  CG  ARG A  67      32.181   8.231  45.271  1.00  0.78           C  
ATOM    522  CD  ARG A  67      31.500   8.507  46.611  1.00  0.78           C  
ATOM    523  NE  ARG A  67      32.034   9.799  47.178  1.00  0.78           N  
ATOM    524  CZ  ARG A  67      33.273  10.010  47.647  1.00  0.78           C  
ATOM    525  NH1 ARG A  67      34.236   9.107  47.533  1.00  0.78           N  
ATOM    526  NH2 ARG A  67      33.569  11.182  48.208  1.00  0.78           N  
ATOM    527  N   TRP A  68      31.164   5.172  42.111  1.00  0.85           N  
ATOM    528  CA  TRP A  68      30.624   4.604  40.886  1.00  0.85           C  
ATOM    529  C   TRP A  68      30.018   3.232  41.095  1.00  0.85           C  
ATOM    530  O   TRP A  68      28.874   2.993  40.716  1.00  0.85           O  
ATOM    531  CB  TRP A  68      31.719   4.525  39.786  1.00  0.85           C  
ATOM    532  CG  TRP A  68      31.214   4.118  38.412  1.00  0.85           C  
ATOM    533  CD1 TRP A  68      30.643   4.904  37.455  1.00  0.85           C  
ATOM    534  CD2 TRP A  68      31.169   2.770  37.907  1.00  0.85           C  
ATOM    535  NE1 TRP A  68      30.282   4.146  36.371  1.00  0.85           N  
ATOM    536  CE2 TRP A  68      30.594   2.837  36.620  1.00  0.85           C  
ATOM    537  CE3 TRP A  68      31.551   1.550  38.457  1.00  0.85           C  
ATOM    538  CZ2 TRP A  68      30.403   1.691  35.862  1.00  0.85           C  
ATOM    539  CZ3 TRP A  68      31.288   0.384  37.721  1.00  0.85           C  
ATOM    540  CH2 TRP A  68      30.733   0.454  36.434  1.00  0.85           C  
ATOM    541  N   ILE A  69      30.736   2.319  41.780  1.00  0.85           N  
ATOM    542  CA  ILE A  69      30.243   0.980  42.071  1.00  0.85           C  
ATOM    543  C   ILE A  69      28.976   1.029  42.910  1.00  0.85           C  
ATOM    544  O   ILE A  69      27.967   0.424  42.565  1.00  0.85           O  
ATOM    545  CB  ILE A  69      31.308   0.119  42.754  1.00  0.85           C  
ATOM    546  CG1 ILE A  69      32.522  -0.092  41.820  1.00  0.85           C  
ATOM    547  CG2 ILE A  69      30.709  -1.250  43.142  1.00  0.85           C  
ATOM    548  CD1 ILE A  69      33.727  -0.726  42.518  1.00  0.85           C  
ATOM    549  N   ARG A  70      28.944   1.830  43.993  1.00  0.79           N  
ATOM    550  CA  ARG A  70      27.737   2.003  44.786  1.00  0.79           C  
ATOM    551  C   ARG A  70      26.576   2.652  44.040  1.00  0.79           C  
ATOM    552  O   ARG A  70      25.439   2.202  44.155  1.00  0.79           O  
ATOM    553  CB  ARG A  70      28.037   2.785  46.088  1.00  0.79           C  
ATOM    554  CG  ARG A  70      28.905   2.013  47.109  1.00  0.79           C  
ATOM    555  CD  ARG A  70      28.348   0.622  47.442  1.00  0.79           C  
ATOM    556  NE  ARG A  70      29.047   0.107  48.662  1.00  0.79           N  
ATOM    557  CZ  ARG A  70      29.021  -1.181  49.025  1.00  0.79           C  
ATOM    558  NH1 ARG A  70      28.484  -2.127  48.260  1.00  0.79           N  
ATOM    559  NH2 ARG A  70      29.588  -1.545  50.177  1.00  0.79           N  
ATOM    560  N   THR A  71      26.838   3.687  43.215  1.00  0.87           N  
ATOM    561  CA  THR A  71      25.837   4.307  42.342  1.00  0.87           C  
ATOM    562  C   THR A  71      25.237   3.310  41.366  1.00  0.87           C  
ATOM    563  O   THR A  71      24.020   3.189  41.231  1.00  0.87           O  
ATOM    564  CB  THR A  71      26.403   5.451  41.507  1.00  0.87           C  
ATOM    565  OG1 THR A  71      26.939   6.464  42.353  1.00  0.87           O  
ATOM    566  CG2 THR A  71      25.302   6.083  40.638  1.00  0.87           C  
ATOM    567  N   GLN A  72      26.078   2.511  40.681  1.00  0.83           N  
ATOM    568  CA  GLN A  72      25.597   1.502  39.759  1.00  0.83           C  
ATOM    569  C   GLN A  72      24.845   0.363  40.437  1.00  0.83           C  
ATOM    570  O   GLN A  72      23.785  -0.038  39.958  1.00  0.83           O  
ATOM    571  CB  GLN A  72      26.719   0.958  38.846  1.00  0.83           C  
ATOM    572  CG  GLN A  72      27.394   2.022  37.941  1.00  0.83           C  
ATOM    573  CD  GLN A  72      26.414   2.845  37.099  1.00  0.83           C  
ATOM    574  OE1 GLN A  72      25.619   2.336  36.299  1.00  0.83           O  
ATOM    575  NE2 GLN A  72      26.471   4.188  37.278  1.00  0.83           N  
ATOM    576  N   GLN A  73      25.321  -0.136  41.601  1.00  0.79           N  
ATOM    577  CA  GLN A  73      24.622  -1.119  42.423  1.00  0.79           C  
ATOM    578  C   GLN A  73      23.250  -0.630  42.880  1.00  0.79           C  
ATOM    579  O   GLN A  73      22.257  -1.350  42.789  1.00  0.79           O  
ATOM    580  CB  GLN A  73      25.458  -1.480  43.681  1.00  0.79           C  
ATOM    581  CG  GLN A  73      26.712  -2.333  43.377  1.00  0.79           C  
ATOM    582  CD  GLN A  73      27.548  -2.623  44.626  1.00  0.79           C  
ATOM    583  OE1 GLN A  73      27.408  -2.052  45.716  1.00  0.79           O  
ATOM    584  NE2 GLN A  73      28.509  -3.557  44.466  1.00  0.79           N  
ATOM    585  N   HIS A  74      23.150   0.646  43.305  1.00  0.80           N  
ATOM    586  CA  HIS A  74      21.900   1.307  43.663  1.00  0.80           C  
ATOM    587  C   HIS A  74      20.865   1.328  42.536  1.00  0.80           C  
ATOM    588  O   HIS A  74      19.671   1.116  42.732  1.00  0.80           O  
ATOM    589  CB  HIS A  74      22.204   2.760  44.097  1.00  0.80           C  
ATOM    590  CG  HIS A  74      21.009   3.571  44.497  1.00  0.80           C  
ATOM    591  ND1 HIS A  74      20.351   3.280  45.672  1.00  0.80           N  
ATOM    592  CD2 HIS A  74      20.399   4.604  43.862  1.00  0.80           C  
ATOM    593  CE1 HIS A  74      19.358   4.137  45.736  1.00  0.80           C  
ATOM    594  NE2 HIS A  74      19.336   4.964  44.664  1.00  0.80           N  
ATOM    595  N   TYR A  75      21.290   1.554  41.278  1.00  0.83           N  
ATOM    596  CA  TYR A  75      20.397   1.474  40.132  1.00  0.83           C  
ATOM    597  C   TYR A  75      19.867   0.081  39.831  1.00  0.83           C  
ATOM    598  O   TYR A  75      18.748  -0.080  39.355  1.00  0.83           O  
ATOM    599  CB  TYR A  75      21.059   2.037  38.851  1.00  0.83           C  
ATOM    600  CG  TYR A  75      21.416   3.498  38.962  1.00  0.83           C  
ATOM    601  CD1 TYR A  75      20.720   4.391  39.806  1.00  0.83           C  
ATOM    602  CD2 TYR A  75      22.483   3.996  38.189  1.00  0.83           C  
ATOM    603  CE1 TYR A  75      21.111   5.728  39.910  1.00  0.83           C  
ATOM    604  CE2 TYR A  75      22.861   5.341  38.280  1.00  0.83           C  
ATOM    605  CZ  TYR A  75      22.178   6.192  39.154  1.00  0.83           C  
ATOM    606  OH  TYR A  75      22.555   7.530  39.281  1.00  0.83           O  
ATOM    607  N   TYR A  76      20.643  -0.985  40.071  1.00  0.80           N  
ATOM    608  CA  TYR A  76      20.102  -2.338  40.027  1.00  0.80           C  
ATOM    609  C   TYR A  76      19.166  -2.639  41.194  1.00  0.80           C  
ATOM    610  O   TYR A  76      18.162  -3.322  41.026  1.00  0.80           O  
ATOM    611  CB  TYR A  76      21.224  -3.396  39.913  1.00  0.80           C  
ATOM    612  CG  TYR A  76      21.743  -3.418  38.494  1.00  0.80           C  
ATOM    613  CD1 TYR A  76      22.815  -2.604  38.090  1.00  0.80           C  
ATOM    614  CD2 TYR A  76      21.146  -4.260  37.541  1.00  0.80           C  
ATOM    615  CE1 TYR A  76      23.297  -2.638  36.773  1.00  0.80           C  
ATOM    616  CE2 TYR A  76      21.632  -4.305  36.226  1.00  0.80           C  
ATOM    617  CZ  TYR A  76      22.720  -3.512  35.850  1.00  0.80           C  
ATOM    618  OH  TYR A  76      23.258  -3.644  34.555  1.00  0.80           O  
ATOM    619  N   GLU A  77      19.446  -2.107  42.401  1.00  0.76           N  
ATOM    620  CA  GLU A  77      18.577  -2.238  43.564  1.00  0.76           C  
ATOM    621  C   GLU A  77      17.206  -1.605  43.361  1.00  0.76           C  
ATOM    622  O   GLU A  77      16.170  -2.173  43.702  1.00  0.76           O  
ATOM    623  CB  GLU A  77      19.249  -1.584  44.800  1.00  0.76           C  
ATOM    624  CG  GLU A  77      18.468  -1.743  46.132  1.00  0.76           C  
ATOM    625  CD  GLU A  77      18.961  -0.781  47.212  1.00  0.76           C  
ATOM    626  OE1 GLU A  77      20.108  -0.967  47.683  1.00  0.76           O  
ATOM    627  OE2 GLU A  77      18.188   0.155  47.576  1.00  0.76           O  
ATOM    628  N   ARG A  78      17.159  -0.395  42.775  1.00  0.77           N  
ATOM    629  CA  ARG A  78      15.910   0.332  42.664  1.00  0.77           C  
ATOM    630  C   ARG A  78      15.231   0.242  41.316  1.00  0.77           C  
ATOM    631  O   ARG A  78      14.072   0.636  41.200  1.00  0.77           O  
ATOM    632  CB  ARG A  78      16.184   1.833  42.936  1.00  0.77           C  
ATOM    633  CG  ARG A  78      16.667   2.130  44.370  1.00  0.77           C  
ATOM    634  CD  ARG A  78      15.648   1.749  45.444  1.00  0.77           C  
ATOM    635  NE  ARG A  78      16.251   2.096  46.762  1.00  0.77           N  
ATOM    636  CZ  ARG A  78      15.571   2.016  47.911  1.00  0.77           C  
ATOM    637  NH1 ARG A  78      16.181   2.351  49.043  1.00  0.77           N  
ATOM    638  NH2 ARG A  78      14.303   1.615  47.944  1.00  0.77           N  
ATOM    639  N   ASP A  79      15.926  -0.255  40.271  1.00  0.85           N  
ATOM    640  CA  ASP A  79      15.452  -0.289  38.891  1.00  0.85           C  
ATOM    641  C   ASP A  79      14.797   1.033  38.399  1.00  0.85           C  
ATOM    642  O   ASP A  79      13.656   1.040  37.923  1.00  0.85           O  
ATOM    643  CB  ASP A  79      14.595  -1.574  38.715  1.00  0.85           C  
ATOM    644  CG  ASP A  79      14.049  -1.794  37.321  1.00  0.85           C  
ATOM    645  OD1 ASP A  79      14.788  -2.062  36.336  1.00  0.85           O  
ATOM    646  OD2 ASP A  79      12.799  -1.712  37.188  1.00  0.85           O  
ATOM    647  N   PRO A  80      15.426   2.201  38.498  1.00  0.92           N  
ATOM    648  CA  PRO A  80      14.848   3.429  37.979  1.00  0.92           C  
ATOM    649  C   PRO A  80      14.844   3.447  36.466  1.00  0.92           C  
ATOM    650  O   PRO A  80      15.539   2.660  35.820  1.00  0.92           O  
ATOM    651  CB  PRO A  80      15.792   4.500  38.532  1.00  0.92           C  
ATOM    652  CG  PRO A  80      17.160   3.820  38.472  1.00  0.92           C  
ATOM    653  CD  PRO A  80      16.844   2.367  38.821  1.00  0.92           C  
ATOM    654  N   LYS A  81      14.060   4.358  35.866  1.00  0.90           N  
ATOM    655  CA  LYS A  81      14.122   4.588  34.443  1.00  0.90           C  
ATOM    656  C   LYS A  81      15.485   5.107  34.005  1.00  0.90           C  
ATOM    657  O   LYS A  81      15.977   6.123  34.493  1.00  0.90           O  
ATOM    658  CB  LYS A  81      12.996   5.542  33.993  1.00  0.90           C  
ATOM    659  CG  LYS A  81      12.963   5.790  32.479  1.00  0.90           C  
ATOM    660  CD  LYS A  81      11.674   6.478  32.010  1.00  0.90           C  
ATOM    661  CE  LYS A  81      11.665   6.628  30.488  1.00  0.90           C  
ATOM    662  NZ  LYS A  81      10.387   7.182  30.000  1.00  0.90           N  
ATOM    663  N   ARG A  82      16.142   4.380  33.085  1.00  0.89           N  
ATOM    664  CA  ARG A  82      17.488   4.680  32.665  1.00  0.89           C  
ATOM    665  C   ARG A  82      17.512   5.548  31.433  1.00  0.89           C  
ATOM    666  O   ARG A  82      16.789   5.332  30.461  1.00  0.89           O  
ATOM    667  CB  ARG A  82      18.283   3.390  32.389  1.00  0.89           C  
ATOM    668  CG  ARG A  82      18.588   2.606  33.678  1.00  0.89           C  
ATOM    669  CD  ARG A  82      19.429   1.363  33.400  1.00  0.89           C  
ATOM    670  NE  ARG A  82      20.141   0.952  34.651  1.00  0.89           N  
ATOM    671  CZ  ARG A  82      19.656   0.076  35.544  1.00  0.89           C  
ATOM    672  NH1 ARG A  82      18.388  -0.324  35.527  1.00  0.89           N  
ATOM    673  NH2 ARG A  82      20.477  -0.427  36.461  1.00  0.89           N  
ATOM    674  N   ILE A  83      18.368   6.576  31.454  1.00  0.96           N  
ATOM    675  CA  ILE A  83      18.383   7.593  30.426  1.00  0.96           C  
ATOM    676  C   ILE A  83      19.657   7.480  29.646  1.00  0.96           C  
ATOM    677  O   ILE A  83      20.763   7.564  30.174  1.00  0.96           O  
ATOM    678  CB  ILE A  83      18.253   8.988  31.010  1.00  0.96           C  
ATOM    679  CG1 ILE A  83      16.917   9.102  31.771  1.00  0.96           C  
ATOM    680  CG2 ILE A  83      18.340  10.052  29.889  1.00  0.96           C  
ATOM    681  CD1 ILE A  83      16.873  10.314  32.691  1.00  0.96           C  
ATOM    682  N   TYR A  84      19.527   7.283  28.333  1.00  0.97           N  
ATOM    683  CA  TYR A  84      20.649   7.055  27.470  1.00  0.97           C  
ATOM    684  C   TYR A  84      20.780   8.214  26.518  1.00  0.97           C  
ATOM    685  O   TYR A  84      19.967   8.434  25.620  1.00  0.97           O  
ATOM    686  CB  TYR A  84      20.449   5.743  26.688  1.00  0.97           C  
ATOM    687  CG  TYR A  84      20.452   4.580  27.647  1.00  0.97           C  
ATOM    688  CD1 TYR A  84      21.670   4.063  28.100  1.00  0.97           C  
ATOM    689  CD2 TYR A  84      19.262   3.993  28.105  1.00  0.97           C  
ATOM    690  CE1 TYR A  84      21.713   2.955  28.958  1.00  0.97           C  
ATOM    691  CE2 TYR A  84      19.295   2.877  28.959  1.00  0.97           C  
ATOM    692  CZ  TYR A  84      20.526   2.342  29.362  1.00  0.97           C  
ATOM    693  OH  TYR A  84      20.580   1.141  30.101  1.00  0.97           O  
ATOM    694  N   TYR A  85      21.848   9.003  26.700  1.00  0.97           N  
ATOM    695  CA  TYR A  85      22.138  10.129  25.850  1.00  0.97           C  
ATOM    696  C   TYR A  85      23.090   9.662  24.770  1.00  0.97           C  
ATOM    697  O   TYR A  85      24.269   9.399  25.014  1.00  0.97           O  
ATOM    698  CB  TYR A  85      22.751  11.279  26.687  1.00  0.97           C  
ATOM    699  CG  TYR A  85      22.646  12.594  25.964  1.00  0.97           C  
ATOM    700  CD1 TYR A  85      21.452  13.327  26.040  1.00  0.97           C  
ATOM    701  CD2 TYR A  85      23.717  13.108  25.212  1.00  0.97           C  
ATOM    702  CE1 TYR A  85      21.329  14.554  25.376  1.00  0.97           C  
ATOM    703  CE2 TYR A  85      23.593  14.339  24.547  1.00  0.97           C  
ATOM    704  CZ  TYR A  85      22.398  15.064  24.636  1.00  0.97           C  
ATOM    705  OH  TYR A  85      22.243  16.325  24.025  1.00  0.97           O  
ATOM    706  N   LEU A  86      22.581   9.518  23.536  1.00  0.97           N  
ATOM    707  CA  LEU A  86      23.373   9.019  22.433  1.00  0.97           C  
ATOM    708  C   LEU A  86      23.935  10.193  21.674  1.00  0.97           C  
ATOM    709  O   LEU A  86      23.215  11.084  21.218  1.00  0.97           O  
ATOM    710  CB  LEU A  86      22.571   8.131  21.447  1.00  0.97           C  
ATOM    711  CG  LEU A  86      22.500   6.636  21.817  1.00  0.97           C  
ATOM    712  CD1 LEU A  86      21.886   6.416  23.204  1.00  0.97           C  
ATOM    713  CD2 LEU A  86      21.730   5.857  20.738  1.00  0.97           C  
ATOM    714  N   SER A  87      25.263  10.220  21.519  1.00  0.98           N  
ATOM    715  CA  SER A  87      25.927  11.328  20.870  1.00  0.98           C  
ATOM    716  C   SER A  87      27.153  10.821  20.167  1.00  0.98           C  
ATOM    717  O   SER A  87      27.825   9.896  20.612  1.00  0.98           O  
ATOM    718  CB  SER A  87      26.353  12.426  21.880  1.00  0.98           C  
ATOM    719  OG  SER A  87      26.939  13.560  21.234  1.00  0.98           O  
ATOM    720  N   LEU A  88      27.517  11.450  19.040  1.00  0.96           N  
ATOM    721  CA  LEU A  88      28.729  11.096  18.333  1.00  0.96           C  
ATOM    722  C   LEU A  88      29.870  11.950  18.853  1.00  0.96           C  
ATOM    723  O   LEU A  88      31.007  11.809  18.409  1.00  0.96           O  
ATOM    724  CB  LEU A  88      28.558  11.358  16.812  1.00  0.96           C  
ATOM    725  CG  LEU A  88      27.984  10.184  15.988  1.00  0.96           C  
ATOM    726  CD1 LEU A  88      28.997   9.041  15.863  1.00  0.96           C  
ATOM    727  CD2 LEU A  88      26.647   9.658  16.524  1.00  0.96           C  
ATOM    728  N   GLU A  89      29.594  12.834  19.829  1.00  0.94           N  
ATOM    729  CA  GLU A  89      30.575  13.727  20.401  1.00  0.94           C  
ATOM    730  C   GLU A  89      30.382  13.912  21.898  1.00  0.94           C  
ATOM    731  O   GLU A  89      29.270  14.079  22.399  1.00  0.94           O  
ATOM    732  CB  GLU A  89      30.495  15.129  19.766  1.00  0.94           C  
ATOM    733  CG  GLU A  89      30.911  15.176  18.283  1.00  0.94           C  
ATOM    734  CD  GLU A  89      30.851  16.592  17.741  1.00  0.94           C  
ATOM    735  OE1 GLU A  89      30.933  17.564  18.542  1.00  0.94           O  
ATOM    736  OE2 GLU A  89      30.785  16.723  16.495  1.00  0.94           O  
ATOM    737  N   PHE A  90      31.497  13.914  22.645  1.00  0.94           N  
ATOM    738  CA  PHE A  90      31.532  14.168  24.069  1.00  0.94           C  
ATOM    739  C   PHE A  90      32.763  15.007  24.365  1.00  0.94           C  
ATOM    740  O   PHE A  90      33.867  14.501  24.557  1.00  0.94           O  
ATOM    741  CB  PHE A  90      31.613  12.845  24.872  1.00  0.94           C  
ATOM    742  CG  PHE A  90      30.241  12.265  25.044  1.00  0.94           C  
ATOM    743  CD1 PHE A  90      29.385  12.802  26.018  1.00  0.94           C  
ATOM    744  CD2 PHE A  90      29.781  11.212  24.237  1.00  0.94           C  
ATOM    745  CE1 PHE A  90      28.080  12.317  26.165  1.00  0.94           C  
ATOM    746  CE2 PHE A  90      28.480  10.718  24.391  1.00  0.94           C  
ATOM    747  CZ  PHE A  90      27.623  11.278  25.348  1.00  0.94           C  
ATOM    748  N   TYR A  91      32.608  16.343  24.412  1.00  0.92           N  
ATOM    749  CA  TYR A  91      33.709  17.285  24.540  1.00  0.92           C  
ATOM    750  C   TYR A  91      34.020  17.549  26.008  1.00  0.92           C  
ATOM    751  O   TYR A  91      33.776  18.624  26.566  1.00  0.92           O  
ATOM    752  CB  TYR A  91      33.333  18.596  23.797  1.00  0.92           C  
ATOM    753  CG  TYR A  91      34.450  19.410  23.198  1.00  0.92           C  
ATOM    754  CD1 TYR A  91      35.818  19.124  23.354  1.00  0.92           C  
ATOM    755  CD2 TYR A  91      34.079  20.506  22.399  1.00  0.92           C  
ATOM    756  CE1 TYR A  91      36.788  19.906  22.706  1.00  0.92           C  
ATOM    757  CE2 TYR A  91      35.044  21.289  21.755  1.00  0.92           C  
ATOM    758  CZ  TYR A  91      36.398  20.981  21.902  1.00  0.92           C  
ATOM    759  OH  TYR A  91      37.357  21.755  21.224  1.00  0.92           O  
ATOM    760  N   MET A  92      34.518  16.513  26.694  1.00  0.92           N  
ATOM    761  CA  MET A  92      34.670  16.483  28.133  1.00  0.92           C  
ATOM    762  C   MET A  92      35.684  17.456  28.710  1.00  0.92           C  
ATOM    763  O   MET A  92      35.409  18.103  29.723  1.00  0.92           O  
ATOM    764  CB  MET A  92      34.993  15.051  28.604  1.00  0.92           C  
ATOM    765  CG  MET A  92      33.934  14.004  28.208  1.00  0.92           C  
ATOM    766  SD  MET A  92      32.265  14.342  28.842  1.00  0.92           S  
ATOM    767  CE  MET A  92      32.550  13.753  30.536  1.00  0.92           C  
ATOM    768  N   GLY A  93      36.856  17.609  28.058  1.00  0.96           N  
ATOM    769  CA  GLY A  93      37.952  18.422  28.582  1.00  0.96           C  
ATOM    770  C   GLY A  93      38.794  17.658  29.569  1.00  0.96           C  
ATOM    771  O   GLY A  93      38.958  16.450  29.442  1.00  0.96           O  
ATOM    772  N   ARG A  94      39.378  18.357  30.559  1.00  0.89           N  
ATOM    773  CA  ARG A  94      40.134  17.746  31.644  1.00  0.89           C  
ATOM    774  C   ARG A  94      39.240  17.182  32.747  1.00  0.89           C  
ATOM    775  O   ARG A  94      38.147  17.693  33.008  1.00  0.89           O  
ATOM    776  CB  ARG A  94      41.065  18.791  32.301  1.00  0.89           C  
ATOM    777  CG  ARG A  94      42.209  19.279  31.393  1.00  0.89           C  
ATOM    778  CD  ARG A  94      43.027  20.376  32.076  1.00  0.89           C  
ATOM    779  NE  ARG A  94      44.209  20.696  31.220  1.00  0.89           N  
ATOM    780  CZ  ARG A  94      44.944  21.796  31.416  1.00  0.89           C  
ATOM    781  NH1 ARG A  94      44.579  22.710  32.316  1.00  0.89           N  
ATOM    782  NH2 ARG A  94      46.049  22.016  30.713  1.00  0.89           N  
ATOM    783  N   THR A  95      39.690  16.133  33.457  1.00  0.95           N  
ATOM    784  CA  THR A  95      38.875  15.461  34.466  1.00  0.95           C  
ATOM    785  C   THR A  95      39.386  15.663  35.882  1.00  0.95           C  
ATOM    786  O   THR A  95      38.579  15.667  36.814  1.00  0.95           O  
ATOM    787  CB  THR A  95      38.805  13.957  34.204  1.00  0.95           C  
ATOM    788  OG1 THR A  95      38.187  13.697  32.952  1.00  0.95           O  
ATOM    789  CG2 THR A  95      37.992  13.185  35.254  1.00  0.95           C  
ATOM    790  N   LEU A  96      40.703  15.880  36.134  1.00  0.93           N  
ATOM    791  CA  LEU A  96      41.249  15.829  37.498  1.00  0.93           C  
ATOM    792  C   LEU A  96      40.620  16.819  38.475  1.00  0.93           C  
ATOM    793  O   LEU A  96      40.060  16.441  39.507  1.00  0.93           O  
ATOM    794  CB  LEU A  96      42.794  16.062  37.516  1.00  0.93           C  
ATOM    795  CG  LEU A  96      43.635  15.277  38.565  1.00  0.93           C  
ATOM    796  CD1 LEU A  96      44.898  16.060  38.964  1.00  0.93           C  
ATOM    797  CD2 LEU A  96      42.902  14.888  39.855  1.00  0.93           C  
ATOM    798  N   GLN A  97      40.617  18.123  38.126  1.00  0.91           N  
ATOM    799  CA  GLN A  97      40.020  19.152  38.955  1.00  0.91           C  
ATOM    800  C   GLN A  97      38.520  18.991  39.111  1.00  0.91           C  
ATOM    801  O   GLN A  97      37.971  19.109  40.204  1.00  0.91           O  
ATOM    802  CB  GLN A  97      40.335  20.572  38.432  1.00  0.91           C  
ATOM    803  CG  GLN A  97      39.739  21.665  39.345  1.00  0.91           C  
ATOM    804  CD  GLN A  97      40.137  23.086  38.945  1.00  0.91           C  
ATOM    805  OE1 GLN A  97      40.190  23.454  37.775  1.00  0.91           O  
ATOM    806  NE2 GLN A  97      40.342  23.937  39.978  1.00  0.91           N  
ATOM    807  N   ASN A  98      37.807  18.661  38.015  1.00  0.93           N  
ATOM    808  CA  ASN A  98      36.366  18.478  38.037  1.00  0.93           C  
ATOM    809  C   ASN A  98      35.944  17.357  38.977  1.00  0.93           C  
ATOM    810  O   ASN A  98      35.011  17.510  39.763  1.00  0.93           O  
ATOM    811  CB  ASN A  98      35.846  18.234  36.595  1.00  0.93           C  
ATOM    812  CG  ASN A  98      34.321  18.170  36.488  1.00  0.93           C  
ATOM    813  OD1 ASN A  98      33.773  17.134  36.126  1.00  0.93           O  
ATOM    814  ND2 ASN A  98      33.620  19.293  36.765  1.00  0.93           N  
ATOM    815  N   THR A  99      36.671  16.227  38.964  1.00  0.94           N  
ATOM    816  CA  THR A  99      36.465  15.146  39.915  1.00  0.94           C  
ATOM    817  C   THR A  99      36.726  15.566  41.347  1.00  0.94           C  
ATOM    818  O   THR A  99      35.920  15.312  42.240  1.00  0.94           O  
ATOM    819  CB  THR A  99      37.343  13.939  39.626  1.00  0.94           C  
ATOM    820  OG1 THR A  99      37.030  13.421  38.345  1.00  0.94           O  
ATOM    821  CG2 THR A  99      37.030  12.819  40.615  1.00  0.94           C  
ATOM    822  N   MET A 100      37.844  16.269  41.619  1.00  0.89           N  
ATOM    823  CA  MET A 100      38.151  16.736  42.960  1.00  0.89           C  
ATOM    824  C   MET A 100      37.142  17.719  43.533  1.00  0.89           C  
ATOM    825  O   MET A 100      36.778  17.602  44.700  1.00  0.89           O  
ATOM    826  CB  MET A 100      39.568  17.346  43.060  1.00  0.89           C  
ATOM    827  CG  MET A 100      40.690  16.303  42.909  1.00  0.89           C  
ATOM    828  SD  MET A 100      42.363  16.940  43.214  1.00  0.89           S  
ATOM    829  CE  MET A 100      42.341  18.172  41.888  1.00  0.89           C  
ATOM    830  N   VAL A 101      36.634  18.702  42.763  1.00  0.92           N  
ATOM    831  CA  VAL A 101      35.592  19.594  43.272  1.00  0.92           C  
ATOM    832  C   VAL A 101      34.266  18.894  43.506  1.00  0.92           C  
ATOM    833  O   VAL A 101      33.621  19.095  44.535  1.00  0.92           O  
ATOM    834  CB  VAL A 101      35.376  20.865  42.462  1.00  0.92           C  
ATOM    835  CG1 VAL A 101      36.741  21.536  42.246  1.00  0.92           C  
ATOM    836  CG2 VAL A 101      34.658  20.613  41.125  1.00  0.92           C  
ATOM    837  N   ASN A 102      33.845  18.008  42.576  1.00  0.92           N  
ATOM    838  CA  ASN A 102      32.592  17.284  42.671  1.00  0.92           C  
ATOM    839  C   ASN A 102      32.558  16.339  43.863  1.00  0.92           C  
ATOM    840  O   ASN A 102      31.520  16.163  44.496  1.00  0.92           O  
ATOM    841  CB  ASN A 102      32.269  16.527  41.355  1.00  0.92           C  
ATOM    842  CG  ASN A 102      31.635  17.472  40.333  1.00  0.92           C  
ATOM    843  OD1 ASN A 102      30.758  18.270  40.658  1.00  0.92           O  
ATOM    844  ND2 ASN A 102      32.061  17.385  39.058  1.00  0.92           N  
ATOM    845  N   LEU A 103      33.703  15.732  44.229  1.00  0.87           N  
ATOM    846  CA  LEU A 103      33.774  14.840  45.369  1.00  0.87           C  
ATOM    847  C   LEU A 103      34.285  15.513  46.638  1.00  0.87           C  
ATOM    848  O   LEU A 103      34.431  14.856  47.668  1.00  0.87           O  
ATOM    849  CB  LEU A 103      34.704  13.647  45.046  1.00  0.87           C  
ATOM    850  CG  LEU A 103      34.321  12.818  43.801  1.00  0.87           C  
ATOM    851  CD1 LEU A 103      35.133  11.519  43.781  1.00  0.87           C  
ATOM    852  CD2 LEU A 103      32.824  12.491  43.705  1.00  0.87           C  
ATOM    853  N   GLY A 104      34.549  16.840  46.606  1.00  0.87           N  
ATOM    854  CA  GLY A 104      35.014  17.618  47.758  1.00  0.87           C  
ATOM    855  C   GLY A 104      36.424  17.343  48.215  1.00  0.87           C  
ATOM    856  O   GLY A 104      36.773  17.565  49.371  1.00  0.87           O  
ATOM    857  N   LEU A 105      37.291  16.868  47.314  1.00  0.85           N  
ATOM    858  CA  LEU A 105      38.624  16.416  47.659  1.00  0.85           C  
ATOM    859  C   LEU A 105      39.699  17.439  47.383  1.00  0.85           C  
ATOM    860  O   LEU A 105      40.851  17.237  47.755  1.00  0.85           O  
ATOM    861  CB  LEU A 105      38.983  15.190  46.793  1.00  0.85           C  
ATOM    862  CG  LEU A 105      38.164  13.933  47.112  1.00  0.85           C  
ATOM    863  CD1 LEU A 105      38.411  12.871  46.039  1.00  0.85           C  
ATOM    864  CD2 LEU A 105      38.507  13.366  48.496  1.00  0.85           C  
ATOM    865  N   GLN A 106      39.368  18.580  46.745  1.00  0.83           N  
ATOM    866  CA  GLN A 106      40.363  19.536  46.273  1.00  0.83           C  
ATOM    867  C   GLN A 106      41.290  20.077  47.351  1.00  0.83           C  
ATOM    868  O   GLN A 106      42.505  20.035  47.202  1.00  0.83           O  
ATOM    869  CB  GLN A 106      39.652  20.717  45.560  1.00  0.83           C  
ATOM    870  CG  GLN A 106      40.598  21.814  44.998  1.00  0.83           C  
ATOM    871  CD  GLN A 106      39.816  22.966  44.362  1.00  0.83           C  
ATOM    872  OE1 GLN A 106      38.613  23.119  44.568  1.00  0.83           O  
ATOM    873  NE2 GLN A 106      40.512  23.811  43.566  1.00  0.83           N  
ATOM    874  N   ASN A 107      40.743  20.523  48.498  1.00  0.81           N  
ATOM    875  CA  ASN A 107      41.543  21.022  49.608  1.00  0.81           C  
ATOM    876  C   ASN A 107      42.435  19.955  50.244  1.00  0.81           C  
ATOM    877  O   ASN A 107      43.607  20.176  50.530  1.00  0.81           O  
ATOM    878  CB  ASN A 107      40.627  21.621  50.704  1.00  0.81           C  
ATOM    879  CG  ASN A 107      39.796  22.756  50.115  1.00  0.81           C  
ATOM    880  OD1 ASN A 107      40.305  23.676  49.485  1.00  0.81           O  
ATOM    881  ND2 ASN A 107      38.457  22.691  50.305  1.00  0.81           N  
ATOM    882  N   ALA A 108      41.897  18.737  50.459  1.00  0.87           N  
ATOM    883  CA  ALA A 108      42.648  17.628  51.015  1.00  0.87           C  
ATOM    884  C   ALA A 108      43.770  17.147  50.104  1.00  0.87           C  
ATOM    885  O   ALA A 108      44.893  16.888  50.535  1.00  0.87           O  
ATOM    886  CB  ALA A 108      41.681  16.470  51.317  1.00  0.87           C  
ATOM    887  N   CYS A 109      43.490  17.049  48.792  1.00  0.86           N  
ATOM    888  CA  CYS A 109      44.490  16.735  47.794  1.00  0.86           C  
ATOM    889  C   CYS A 109      45.558  17.798  47.651  1.00  0.86           C  
ATOM    890  O   CYS A 109      46.733  17.461  47.573  1.00  0.86           O  
ATOM    891  CB  CYS A 109      43.851  16.470  46.416  1.00  0.86           C  
ATOM    892  SG  CYS A 109      42.985  14.863  46.395  1.00  0.86           S  
ATOM    893  N   ASP A 110      45.205  19.099  47.652  1.00  0.86           N  
ATOM    894  CA  ASP A 110      46.171  20.190  47.587  1.00  0.86           C  
ATOM    895  C   ASP A 110      47.181  20.154  48.740  1.00  0.86           C  
ATOM    896  O   ASP A 110      48.396  20.148  48.537  1.00  0.86           O  
ATOM    897  CB  ASP A 110      45.374  21.519  47.576  1.00  0.86           C  
ATOM    898  CG  ASP A 110      46.271  22.730  47.396  1.00  0.86           C  
ATOM    899  OD1 ASP A 110      47.132  22.679  46.486  1.00  0.86           O  
ATOM    900  OD2 ASP A 110      46.090  23.703  48.170  1.00  0.86           O  
ATOM    901  N   GLU A 111      46.686  19.993  49.979  1.00  0.82           N  
ATOM    902  CA  GLU A 111      47.506  19.826  51.164  1.00  0.82           C  
ATOM    903  C   GLU A 111      48.397  18.585  51.134  1.00  0.82           C  
ATOM    904  O   GLU A 111      49.589  18.626  51.434  1.00  0.82           O  
ATOM    905  CB  GLU A 111      46.562  19.784  52.384  1.00  0.82           C  
ATOM    906  CG  GLU A 111      47.257  19.760  53.763  1.00  0.82           C  
ATOM    907  CD  GLU A 111      48.223  20.924  53.966  1.00  0.82           C  
ATOM    908  OE1 GLU A 111      47.786  22.089  53.815  1.00  0.82           O  
ATOM    909  OE2 GLU A 111      49.403  20.649  54.314  1.00  0.82           O  
ATOM    910  N   ALA A 112      47.859  17.428  50.693  1.00  0.87           N  
ATOM    911  CA  ALA A 112      48.638  16.213  50.538  1.00  0.87           C  
ATOM    912  C   ALA A 112      49.782  16.334  49.535  1.00  0.87           C  
ATOM    913  O   ALA A 112      50.910  15.916  49.793  1.00  0.87           O  
ATOM    914  CB  ALA A 112      47.701  15.066  50.121  1.00  0.87           C  
ATOM    915  N   ILE A 113      49.524  16.959  48.371  1.00  0.85           N  
ATOM    916  CA  ILE A 113      50.527  17.256  47.360  1.00  0.85           C  
ATOM    917  C   ILE A 113      51.551  18.278  47.861  1.00  0.85           C  
ATOM    918  O   ILE A 113      52.758  18.102  47.689  1.00  0.85           O  
ATOM    919  CB  ILE A 113      49.824  17.680  46.063  1.00  0.85           C  
ATOM    920  CG1 ILE A 113      48.948  16.545  45.481  1.00  0.85           C  
ATOM    921  CG2 ILE A 113      50.780  18.185  44.977  1.00  0.85           C  
ATOM    922  CD1 ILE A 113      49.652  15.214  45.214  1.00  0.85           C  
ATOM    923  N   TYR A 114      51.110  19.339  48.573  1.00  0.85           N  
ATOM    924  CA  TYR A 114      51.972  20.342  49.188  1.00  0.85           C  
ATOM    925  C   TYR A 114      52.942  19.758  50.220  1.00  0.85           C  
ATOM    926  O   TYR A 114      54.119  20.136  50.296  1.00  0.85           O  
ATOM    927  CB  TYR A 114      51.101  21.459  49.839  1.00  0.85           C  
ATOM    928  CG  TYR A 114      51.949  22.516  50.500  1.00  0.85           C  
ATOM    929  CD1 TYR A 114      52.778  23.348  49.731  1.00  0.85           C  
ATOM    930  CD2 TYR A 114      52.026  22.576  51.903  1.00  0.85           C  
ATOM    931  CE1 TYR A 114      53.712  24.186  50.354  1.00  0.85           C  
ATOM    932  CE2 TYR A 114      52.957  23.417  52.528  1.00  0.85           C  
ATOM    933  CZ  TYR A 114      53.807  24.210  51.748  1.00  0.85           C  
ATOM    934  OH  TYR A 114      54.838  24.958  52.345  1.00  0.85           O  
ATOM    935  N   GLN A 115      52.477  18.799  51.040  1.00  0.80           N  
ATOM    936  CA  GLN A 115      53.299  18.100  52.007  1.00  0.80           C  
ATOM    937  C   GLN A 115      54.321  17.175  51.371  1.00  0.80           C  
ATOM    938  O   GLN A 115      55.344  16.880  51.981  1.00  0.80           O  
ATOM    939  CB  GLN A 115      52.411  17.303  52.985  1.00  0.80           C  
ATOM    940  CG  GLN A 115      51.746  18.223  54.030  1.00  0.80           C  
ATOM    941  CD  GLN A 115      50.799  17.457  54.955  1.00  0.80           C  
ATOM    942  OE1 GLN A 115      50.930  16.258  55.206  1.00  0.80           O  
ATOM    943  NE2 GLN A 115      49.808  18.197  55.498  1.00  0.80           N  
ATOM    944  N   LEU A 116      54.110  16.754  50.111  1.00  0.83           N  
ATOM    945  CA  LEU A 116      55.062  15.955  49.362  1.00  0.83           C  
ATOM    946  C   LEU A 116      55.962  16.787  48.465  1.00  0.83           C  
ATOM    947  O   LEU A 116      56.789  16.241  47.746  1.00  0.83           O  
ATOM    948  CB  LEU A 116      54.329  14.926  48.470  1.00  0.83           C  
ATOM    949  CG  LEU A 116      53.587  13.830  49.256  1.00  0.83           C  
ATOM    950  CD1 LEU A 116      52.753  12.969  48.301  1.00  0.83           C  
ATOM    951  CD2 LEU A 116      54.561  12.953  50.054  1.00  0.83           C  
ATOM    952  N   GLY A 117      55.873  18.134  48.502  1.00  0.82           N  
ATOM    953  CA  GLY A 117      56.796  19.003  47.766  1.00  0.82           C  
ATOM    954  C   GLY A 117      56.515  19.067  46.300  1.00  0.82           C  
ATOM    955  O   GLY A 117      57.407  19.069  45.449  1.00  0.82           O  
ATOM    956  N   LEU A 118      55.227  19.089  45.974  1.00  0.84           N  
ATOM    957  CA  LEU A 118      54.715  19.106  44.634  1.00  0.84           C  
ATOM    958  C   LEU A 118      53.688  20.220  44.596  1.00  0.84           C  
ATOM    959  O   LEU A 118      53.137  20.590  45.632  1.00  0.84           O  
ATOM    960  CB  LEU A 118      54.028  17.754  44.335  1.00  0.84           C  
ATOM    961  CG  LEU A 118      54.949  16.528  44.306  1.00  0.84           C  
ATOM    962  CD1 LEU A 118      54.131  15.231  44.276  1.00  0.84           C  
ATOM    963  CD2 LEU A 118      55.886  16.574  43.103  1.00  0.84           C  
ATOM    964  N   ASP A 119      53.391  20.778  43.410  1.00  0.84           N  
ATOM    965  CA  ASP A 119      52.335  21.764  43.256  1.00  0.84           C  
ATOM    966  C   ASP A 119      51.183  21.087  42.535  1.00  0.84           C  
ATOM    967  O   ASP A 119      51.354  20.502  41.469  1.00  0.84           O  
ATOM    968  CB  ASP A 119      52.837  22.991  42.446  1.00  0.84           C  
ATOM    969  CG  ASP A 119      51.712  23.924  42.008  1.00  0.84           C  
ATOM    970  OD1 ASP A 119      50.673  23.970  42.712  1.00  0.84           O  
ATOM    971  OD2 ASP A 119      51.836  24.511  40.908  1.00  0.84           O  
ATOM    972  N   LEU A 120      49.964  21.149  43.094  1.00  0.87           N  
ATOM    973  CA  LEU A 120      48.795  20.563  42.474  1.00  0.87           C  
ATOM    974  C   LEU A 120      48.366  21.253  41.188  1.00  0.87           C  
ATOM    975  O   LEU A 120      48.014  20.570  40.226  1.00  0.87           O  
ATOM    976  CB  LEU A 120      47.645  20.473  43.499  1.00  0.87           C  
ATOM    977  CG  LEU A 120      46.372  19.745  43.011  1.00  0.87           C  
ATOM    978  CD1 LEU A 120      45.927  18.656  43.993  1.00  0.87           C  
ATOM    979  CD2 LEU A 120      45.223  20.738  42.812  1.00  0.87           C  
ATOM    980  N   GLU A 121      48.451  22.600  41.112  1.00  0.81           N  
ATOM    981  CA  GLU A 121      48.123  23.372  39.917  1.00  0.81           C  
ATOM    982  C   GLU A 121      49.027  23.014  38.732  1.00  0.81           C  
ATOM    983  O   GLU A 121      48.567  22.807  37.608  1.00  0.81           O  
ATOM    984  CB  GLU A 121      48.237  24.904  40.169  1.00  0.81           C  
ATOM    985  CG  GLU A 121      47.150  25.512  41.095  1.00  0.81           C  
ATOM    986  CD  GLU A 121      47.206  27.046  41.172  1.00  0.81           C  
ATOM    987  OE1 GLU A 121      47.102  27.724  40.105  1.00  0.81           O  
ATOM    988  OE2 GLU A 121      47.295  27.579  42.308  1.00  0.81           O  
ATOM    989  N   GLU A 122      50.352  22.863  38.973  1.00  0.83           N  
ATOM    990  CA  GLU A 122      51.310  22.358  37.997  1.00  0.83           C  
ATOM    991  C   GLU A 122      50.955  20.972  37.474  1.00  0.83           C  
ATOM    992  O   GLU A 122      50.974  20.716  36.269  1.00  0.83           O  
ATOM    993  CB  GLU A 122      52.728  22.281  38.626  1.00  0.83           C  
ATOM    994  CG  GLU A 122      53.870  21.889  37.648  1.00  0.83           C  
ATOM    995  CD  GLU A 122      55.167  21.500  38.364  1.00  0.83           C  
ATOM    996  OE1 GLU A 122      55.679  22.303  39.181  1.00  0.83           O  
ATOM    997  OE2 GLU A 122      55.672  20.376  38.090  1.00  0.83           O  
ATOM    998  N   LEU A 123      50.558  20.038  38.368  1.00  0.89           N  
ATOM    999  CA  LEU A 123      50.122  18.715  37.959  1.00  0.89           C  
ATOM   1000  C   LEU A 123      48.869  18.744  37.089  1.00  0.89           C  
ATOM   1001  O   LEU A 123      48.823  18.088  36.055  1.00  0.89           O  
ATOM   1002  CB  LEU A 123      49.873  17.764  39.163  1.00  0.89           C  
ATOM   1003  CG  LEU A 123      51.080  17.520  40.095  1.00  0.89           C  
ATOM   1004  CD1 LEU A 123      50.732  16.505  41.196  1.00  0.89           C  
ATOM   1005  CD2 LEU A 123      52.354  17.100  39.355  1.00  0.89           C  
ATOM   1006  N   GLU A 124      47.839  19.543  37.437  1.00  0.89           N  
ATOM   1007  CA  GLU A 124      46.596  19.668  36.678  1.00  0.89           C  
ATOM   1008  C   GLU A 124      46.799  20.144  35.243  1.00  0.89           C  
ATOM   1009  O   GLU A 124      46.120  19.692  34.322  1.00  0.89           O  
ATOM   1010  CB  GLU A 124      45.581  20.594  37.396  1.00  0.89           C  
ATOM   1011  CG  GLU A 124      45.082  20.030  38.752  1.00  0.89           C  
ATOM   1012  CD  GLU A 124      44.150  20.985  39.497  1.00  0.89           C  
ATOM   1013  OE1 GLU A 124      44.400  22.214  39.484  1.00  0.89           O  
ATOM   1014  OE2 GLU A 124      43.168  20.477  40.101  1.00  0.89           O  
ATOM   1015  N   GLU A 125      47.779  21.037  34.992  1.00  0.86           N  
ATOM   1016  CA  GLU A 125      48.100  21.474  33.644  1.00  0.86           C  
ATOM   1017  C   GLU A 125      48.707  20.414  32.733  1.00  0.86           C  
ATOM   1018  O   GLU A 125      48.626  20.524  31.511  1.00  0.86           O  
ATOM   1019  CB  GLU A 125      49.021  22.716  33.655  1.00  0.86           C  
ATOM   1020  CG  GLU A 125      48.290  24.024  34.048  1.00  0.86           C  
ATOM   1021  CD  GLU A 125      47.057  24.284  33.205  1.00  0.86           C  
ATOM   1022  OE1 GLU A 125      47.089  24.204  31.950  1.00  0.86           O  
ATOM   1023  OE2 GLU A 125      45.961  24.568  33.753  1.00  0.86           O  
ATOM   1024  N   ILE A 126      49.276  19.329  33.292  1.00  0.89           N  
ATOM   1025  CA  ILE A 126      49.755  18.179  32.535  1.00  0.89           C  
ATOM   1026  C   ILE A 126      48.643  17.480  31.754  1.00  0.89           C  
ATOM   1027  O   ILE A 126      48.874  16.947  30.665  1.00  0.89           O  
ATOM   1028  CB  ILE A 126      50.451  17.175  33.458  1.00  0.89           C  
ATOM   1029  CG1 ILE A 126      51.690  17.780  34.169  1.00  0.89           C  
ATOM   1030  CG2 ILE A 126      50.821  15.866  32.732  1.00  0.89           C  
ATOM   1031  CD1 ILE A 126      52.824  18.248  33.246  1.00  0.89           C  
ATOM   1032  N   GLU A 127      47.413  17.439  32.308  1.00  0.89           N  
ATOM   1033  CA  GLU A 127      46.276  16.772  31.697  1.00  0.89           C  
ATOM   1034  C   GLU A 127      45.856  17.300  30.325  1.00  0.89           C  
ATOM   1035  O   GLU A 127      45.631  18.498  30.118  1.00  0.89           O  
ATOM   1036  CB  GLU A 127      45.054  16.779  32.649  1.00  0.89           C  
ATOM   1037  CG  GLU A 127      43.909  15.821  32.222  1.00  0.89           C  
ATOM   1038  CD  GLU A 127      42.845  15.613  33.292  1.00  0.89           C  
ATOM   1039  OE1 GLU A 127      42.674  16.472  34.193  1.00  0.89           O  
ATOM   1040  OE2 GLU A 127      42.129  14.584  33.221  1.00  0.89           O  
ATOM   1041  N   GLU A 128      45.711  16.383  29.347  1.00  0.88           N  
ATOM   1042  CA  GLU A 128      45.216  16.693  28.020  1.00  0.88           C  
ATOM   1043  C   GLU A 128      43.696  16.703  27.987  1.00  0.88           C  
ATOM   1044  O   GLU A 128      43.021  16.000  28.739  1.00  0.88           O  
ATOM   1045  CB  GLU A 128      45.795  15.721  26.948  1.00  0.88           C  
ATOM   1046  CG  GLU A 128      47.284  16.051  26.640  1.00  0.88           C  
ATOM   1047  CD  GLU A 128      47.989  15.231  25.551  1.00  0.88           C  
ATOM   1048  OE1 GLU A 128      47.562  15.279  24.373  1.00  0.88           O  
ATOM   1049  OE2 GLU A 128      49.046  14.622  25.890  1.00  0.88           O  
ATOM   1050  N   ASP A 129      43.097  17.542  27.123  1.00  0.91           N  
ATOM   1051  CA  ASP A 129      41.671  17.550  26.895  1.00  0.91           C  
ATOM   1052  C   ASP A 129      41.162  16.237  26.306  1.00  0.91           C  
ATOM   1053  O   ASP A 129      41.685  15.728  25.317  1.00  0.91           O  
ATOM   1054  CB  ASP A 129      41.276  18.665  25.889  1.00  0.91           C  
ATOM   1055  CG  ASP A 129      41.475  20.048  26.456  1.00  0.91           C  
ATOM   1056  OD1 ASP A 129      42.646  20.428  26.708  1.00  0.91           O  
ATOM   1057  OD2 ASP A 129      40.468  20.790  26.605  1.00  0.91           O  
ATOM   1058  N   ALA A 130      40.056  15.685  26.832  1.00  0.95           N  
ATOM   1059  CA  ALA A 130      39.321  14.654  26.133  1.00  0.95           C  
ATOM   1060  C   ALA A 130      38.469  15.301  25.035  1.00  0.95           C  
ATOM   1061  O   ALA A 130      37.270  15.552  25.191  1.00  0.95           O  
ATOM   1062  CB  ALA A 130      38.491  13.843  27.140  1.00  0.95           C  
ATOM   1063  N   GLY A 131      39.107  15.649  23.896  1.00  0.84           N  
ATOM   1064  CA  GLY A 131      38.540  16.476  22.835  1.00  0.84           C  
ATOM   1065  C   GLY A 131      37.751  15.730  21.809  1.00  0.84           C  
ATOM   1066  O   GLY A 131      37.899  15.931  20.607  1.00  0.84           O  
ATOM   1067  N   LEU A 132      36.834  14.861  22.252  1.00  0.89           N  
ATOM   1068  CA  LEU A 132      36.039  14.029  21.377  1.00  0.89           C  
ATOM   1069  C   LEU A 132      34.796  14.767  20.913  1.00  0.89           C  
ATOM   1070  O   LEU A 132      33.692  14.230  20.931  1.00  0.89           O  
ATOM   1071  CB  LEU A 132      35.639  12.714  22.089  1.00  0.89           C  
ATOM   1072  CG  LEU A 132      36.805  11.957  22.758  1.00  0.89           C  
ATOM   1073  CD1 LEU A 132      36.333  10.580  23.237  1.00  0.89           C  
ATOM   1074  CD2 LEU A 132      38.024  11.785  21.845  1.00  0.89           C  
ATOM   1075  N   GLY A 133      34.950  16.038  20.500  1.00  0.93           N  
ATOM   1076  CA  GLY A 133      33.855  16.865  20.034  1.00  0.93           C  
ATOM   1077  C   GLY A 133      34.315  18.032  19.215  1.00  0.93           C  
ATOM   1078  O   GLY A 133      35.426  18.535  19.365  1.00  0.93           O  
ATOM   1079  N   ASN A 134      33.453  18.499  18.306  1.00  0.85           N  
ATOM   1080  CA  ASN A 134      33.719  19.605  17.420  1.00  0.85           C  
ATOM   1081  C   ASN A 134      33.507  20.955  18.072  1.00  0.85           C  
ATOM   1082  O   ASN A 134      34.286  21.889  17.857  1.00  0.85           O  
ATOM   1083  CB  ASN A 134      32.788  19.500  16.191  1.00  0.85           C  
ATOM   1084  CG  ASN A 134      33.466  18.605  15.169  1.00  0.85           C  
ATOM   1085  OD1 ASN A 134      34.442  19.045  14.551  1.00  0.85           O  
ATOM   1086  ND2 ASN A 134      32.976  17.365  15.005  1.00  0.85           N  
ATOM   1087  N   GLY A 135      32.428  21.099  18.859  1.00  0.93           N  
ATOM   1088  CA  GLY A 135      32.068  22.396  19.398  1.00  0.93           C  
ATOM   1089  C   GLY A 135      30.915  22.344  20.352  1.00  0.93           C  
ATOM   1090  O   GLY A 135      30.907  21.599  21.330  1.00  0.93           O  
ATOM   1091  N   GLY A 136      29.900  23.198  20.105  1.00  0.94           N  
ATOM   1092  CA  GLY A 136      28.711  23.357  20.943  1.00  0.94           C  
ATOM   1093  C   GLY A 136      27.972  22.095  21.284  1.00  0.94           C  
ATOM   1094  O   GLY A 136      27.685  21.840  22.449  1.00  0.94           O  
ATOM   1095  N   LEU A 137      27.675  21.275  20.262  1.00  0.91           N  
ATOM   1096  CA  LEU A 137      26.946  20.019  20.356  1.00  0.91           C  
ATOM   1097  C   LEU A 137      27.620  19.000  21.263  1.00  0.91           C  
ATOM   1098  O   LEU A 137      27.001  18.409  22.151  1.00  0.91           O  
ATOM   1099  CB  LEU A 137      26.816  19.490  18.903  1.00  0.91           C  
ATOM   1100  CG  LEU A 137      26.143  18.121  18.665  1.00  0.91           C  
ATOM   1101  CD1 LEU A 137      25.543  18.087  17.255  1.00  0.91           C  
ATOM   1102  CD2 LEU A 137      27.123  16.944  18.780  1.00  0.91           C  
ATOM   1103  N   GLY A 138      28.945  18.804  21.104  1.00  0.95           N  
ATOM   1104  CA  GLY A 138      29.704  17.897  21.951  1.00  0.95           C  
ATOM   1105  C   GLY A 138      29.920  18.404  23.346  1.00  0.95           C  
ATOM   1106  O   GLY A 138      29.979  17.636  24.306  1.00  0.95           O  
ATOM   1107  N   ARG A 139      30.068  19.730  23.516  1.00  0.90           N  
ATOM   1108  CA  ARG A 139      30.222  20.323  24.828  1.00  0.90           C  
ATOM   1109  C   ARG A 139      28.940  20.330  25.625  1.00  0.90           C  
ATOM   1110  O   ARG A 139      28.948  20.189  26.849  1.00  0.90           O  
ATOM   1111  CB  ARG A 139      30.819  21.751  24.742  1.00  0.90           C  
ATOM   1112  CG  ARG A 139      31.144  22.376  26.115  1.00  0.90           C  
ATOM   1113  CD  ARG A 139      32.120  21.526  26.945  1.00  0.90           C  
ATOM   1114  NE  ARG A 139      31.463  21.234  28.255  1.00  0.90           N  
ATOM   1115  CZ  ARG A 139      32.038  20.489  29.209  1.00  0.90           C  
ATOM   1116  NH1 ARG A 139      33.249  19.962  29.040  1.00  0.90           N  
ATOM   1117  NH2 ARG A 139      31.374  20.272  30.342  1.00  0.90           N  
ATOM   1118  N   LEU A 140      27.797  20.462  24.935  1.00  0.95           N  
ATOM   1119  CA  LEU A 140      26.486  20.338  25.530  1.00  0.95           C  
ATOM   1120  C   LEU A 140      26.275  18.973  26.149  1.00  0.95           C  
ATOM   1121  O   LEU A 140      25.870  18.865  27.303  1.00  0.95           O  
ATOM   1122  CB  LEU A 140      25.404  20.578  24.457  1.00  0.95           C  
ATOM   1123  CG  LEU A 140      23.974  20.708  25.004  1.00  0.95           C  
ATOM   1124  CD1 LEU A 140      23.831  21.997  25.824  1.00  0.95           C  
ATOM   1125  CD2 LEU A 140      22.972  20.669  23.842  1.00  0.95           C  
ATOM   1126  N   ALA A 141      26.668  17.902  25.432  1.00  0.98           N  
ATOM   1127  CA  ALA A 141      26.631  16.547  25.934  1.00  0.98           C  
ATOM   1128  C   ALA A 141      27.458  16.349  27.201  1.00  0.98           C  
ATOM   1129  O   ALA A 141      27.003  15.763  28.178  1.00  0.98           O  
ATOM   1130  CB  ALA A 141      27.135  15.616  24.819  1.00  0.98           C  
ATOM   1131  N   ALA A 142      28.678  16.914  27.242  1.00  0.98           N  
ATOM   1132  CA  ALA A 142      29.518  16.942  28.421  1.00  0.98           C  
ATOM   1133  C   ALA A 142      28.954  17.719  29.612  1.00  0.98           C  
ATOM   1134  O   ALA A 142      29.058  17.292  30.760  1.00  0.98           O  
ATOM   1135  CB  ALA A 142      30.876  17.532  28.022  1.00  0.98           C  
ATOM   1136  N   CYS A 143      28.332  18.896  29.383  1.00  0.97           N  
ATOM   1137  CA  CYS A 143      27.613  19.622  30.427  1.00  0.97           C  
ATOM   1138  C   CYS A 143      26.419  18.846  30.945  1.00  0.97           C  
ATOM   1139  O   CYS A 143      26.158  18.793  32.144  1.00  0.97           O  
ATOM   1140  CB  CYS A 143      27.118  21.007  29.941  1.00  0.97           C  
ATOM   1141  SG  CYS A 143      28.498  22.147  29.588  1.00  0.97           S  
ATOM   1142  N   PHE A 144      25.684  18.191  30.036  1.00  0.97           N  
ATOM   1143  CA  PHE A 144      24.538  17.369  30.350  1.00  0.97           C  
ATOM   1144  C   PHE A 144      24.880  16.174  31.224  1.00  0.97           C  
ATOM   1145  O   PHE A 144      24.148  15.887  32.165  1.00  0.97           O  
ATOM   1146  CB  PHE A 144      23.829  16.901  29.049  1.00  0.97           C  
ATOM   1147  CG  PHE A 144      22.937  17.943  28.400  1.00  0.97           C  
ATOM   1148  CD1 PHE A 144      22.874  19.297  28.791  1.00  0.97           C  
ATOM   1149  CD2 PHE A 144      22.082  17.515  27.369  1.00  0.97           C  
ATOM   1150  CE1 PHE A 144      21.976  20.181  28.182  1.00  0.97           C  
ATOM   1151  CE2 PHE A 144      21.181  18.394  26.755  1.00  0.97           C  
ATOM   1152  CZ  PHE A 144      21.129  19.730  27.165  1.00  0.97           C  
ATOM   1153  N   LEU A 145      26.007  15.467  30.990  1.00  0.96           N  
ATOM   1154  CA  LEU A 145      26.426  14.374  31.864  1.00  0.96           C  
ATOM   1155  C   LEU A 145      26.683  14.805  33.317  1.00  0.96           C  
ATOM   1156  O   LEU A 145      26.226  14.142  34.248  1.00  0.96           O  
ATOM   1157  CB  LEU A 145      27.685  13.626  31.345  1.00  0.96           C  
ATOM   1158  CG  LEU A 145      27.639  13.009  29.931  1.00  0.96           C  
ATOM   1159  CD1 LEU A 145      28.865  12.107  29.731  1.00  0.96           C  
ATOM   1160  CD2 LEU A 145      26.361  12.209  29.656  1.00  0.96           C  
ATOM   1161  N   ASP A 146      27.369  15.954  33.540  1.00  0.96           N  
ATOM   1162  CA  ASP A 146      27.592  16.559  34.855  1.00  0.96           C  
ATOM   1163  C   ASP A 146      26.273  16.889  35.556  1.00  0.96           C  
ATOM   1164  O   ASP A 146      26.019  16.502  36.697  1.00  0.96           O  
ATOM   1165  CB  ASP A 146      28.442  17.849  34.601  1.00  0.96           C  
ATOM   1166  CG  ASP A 146      28.797  18.730  35.796  1.00  0.96           C  
ATOM   1167  OD1 ASP A 146      27.884  19.377  36.374  1.00  0.96           O  
ATOM   1168  OD2 ASP A 146      30.011  18.914  36.065  1.00  0.96           O  
ATOM   1169  N   SER A 147      25.356  17.562  34.837  1.00  0.97           N  
ATOM   1170  CA  SER A 147      24.035  17.906  35.335  1.00  0.97           C  
ATOM   1171  C   SER A 147      23.135  16.725  35.636  1.00  0.97           C  
ATOM   1172  O   SER A 147      22.461  16.704  36.658  1.00  0.97           O  
ATOM   1173  CB  SER A 147      23.261  18.779  34.336  1.00  0.97           C  
ATOM   1174  OG  SER A 147      23.905  20.033  34.154  1.00  0.97           O  
ATOM   1175  N   MET A 148      23.083  15.684  34.778  1.00  0.95           N  
ATOM   1176  CA  MET A 148      22.297  14.487  35.049  1.00  0.95           C  
ATOM   1177  C   MET A 148      22.773  13.728  36.280  1.00  0.95           C  
ATOM   1178  O   MET A 148      21.962  13.300  37.099  1.00  0.95           O  
ATOM   1179  CB  MET A 148      22.237  13.539  33.826  1.00  0.95           C  
ATOM   1180  CG  MET A 148      21.466  14.131  32.625  1.00  0.95           C  
ATOM   1181  SD  MET A 148      21.220  13.016  31.210  1.00  0.95           S  
ATOM   1182  CE  MET A 148      22.960  12.857  30.722  1.00  0.95           C  
ATOM   1183  N   ALA A 149      24.100  13.597  36.473  1.00  0.97           N  
ATOM   1184  CA  ALA A 149      24.656  13.038  37.686  1.00  0.97           C  
ATOM   1185  C   ALA A 149      24.386  13.874  38.936  1.00  0.97           C  
ATOM   1186  O   ALA A 149      24.007  13.336  39.972  1.00  0.97           O  
ATOM   1187  CB  ALA A 149      26.160  12.801  37.483  1.00  0.97           C  
ATOM   1188  N   THR A 150      24.525  15.216  38.851  1.00  0.94           N  
ATOM   1189  CA  THR A 150      24.202  16.186  39.908  1.00  0.94           C  
ATOM   1190  C   THR A 150      22.745  16.169  40.313  1.00  0.94           C  
ATOM   1191  O   THR A 150      22.397  16.387  41.469  1.00  0.94           O  
ATOM   1192  CB  THR A 150      24.590  17.603  39.493  1.00  0.94           C  
ATOM   1193  OG1 THR A 150      26.005  17.728  39.523  1.00  0.94           O  
ATOM   1194  CG2 THR A 150      24.041  18.698  40.419  1.00  0.94           C  
ATOM   1195  N   LEU A 151      21.840  15.899  39.362  1.00  0.93           N  
ATOM   1196  CA  LEU A 151      20.424  15.788  39.631  1.00  0.93           C  
ATOM   1197  C   LEU A 151      19.982  14.357  39.868  1.00  0.93           C  
ATOM   1198  O   LEU A 151      18.792  14.050  39.796  1.00  0.93           O  
ATOM   1199  CB  LEU A 151      19.617  16.374  38.454  1.00  0.93           C  
ATOM   1200  CG  LEU A 151      19.814  17.887  38.236  1.00  0.93           C  
ATOM   1201  CD1 LEU A 151      18.845  18.375  37.160  1.00  0.93           C  
ATOM   1202  CD2 LEU A 151      19.621  18.710  39.517  1.00  0.93           C  
ATOM   1203  N   GLY A 152      20.929  13.440  40.167  1.00  0.94           N  
ATOM   1204  CA  GLY A 152      20.637  12.088  40.634  1.00  0.94           C  
ATOM   1205  C   GLY A 152      19.903  11.204  39.668  1.00  0.94           C  
ATOM   1206  O   GLY A 152      19.221  10.260  40.064  1.00  0.94           O  
ATOM   1207  N   LEU A 153      20.013  11.481  38.361  1.00  0.94           N  
ATOM   1208  CA  LEU A 153      19.360  10.685  37.353  1.00  0.94           C  
ATOM   1209  C   LEU A 153      20.184   9.445  37.045  1.00  0.94           C  
ATOM   1210  O   LEU A 153      21.416   9.458  37.047  1.00  0.94           O  
ATOM   1211  CB  LEU A 153      19.136  11.485  36.042  1.00  0.94           C  
ATOM   1212  CG  LEU A 153      18.316  12.791  36.168  1.00  0.94           C  
ATOM   1213  CD1 LEU A 153      18.102  13.410  34.779  1.00  0.94           C  
ATOM   1214  CD2 LEU A 153      16.957  12.584  36.845  1.00  0.94           C  
ATOM   1215  N   ALA A 154      19.520   8.314  36.729  1.00  0.95           N  
ATOM   1216  CA  ALA A 154      20.189   7.119  36.259  1.00  0.95           C  
ATOM   1217  C   ALA A 154      20.561   7.243  34.792  1.00  0.95           C  
ATOM   1218  O   ALA A 154      20.027   6.567  33.910  1.00  0.95           O  
ATOM   1219  CB  ALA A 154      19.319   5.881  36.512  1.00  0.95           C  
ATOM   1220  N   ALA A 155      21.481   8.172  34.508  1.00  0.97           N  
ATOM   1221  CA  ALA A 155      21.821   8.563  33.174  1.00  0.97           C  
ATOM   1222  C   ALA A 155      23.140   7.997  32.704  1.00  0.97           C  
ATOM   1223  O   ALA A 155      24.029   7.618  33.467  1.00  0.97           O  
ATOM   1224  CB  ALA A 155      21.851  10.090  33.069  1.00  0.97           C  
ATOM   1225  N   TYR A 156      23.263   7.909  31.377  1.00  0.95           N  
ATOM   1226  CA  TYR A 156      24.385   7.302  30.723  1.00  0.95           C  
ATOM   1227  C   TYR A 156      24.679   8.100  29.466  1.00  0.95           C  
ATOM   1228  O   TYR A 156      23.768   8.536  28.760  1.00  0.95           O  
ATOM   1229  CB  TYR A 156      24.067   5.856  30.245  1.00  0.95           C  
ATOM   1230  CG  TYR A 156      23.776   4.846  31.336  1.00  0.95           C  
ATOM   1231  CD1 TYR A 156      22.536   4.825  32.000  1.00  0.95           C  
ATOM   1232  CD2 TYR A 156      24.712   3.841  31.641  1.00  0.95           C  
ATOM   1233  CE1 TYR A 156      22.266   3.873  32.994  1.00  0.95           C  
ATOM   1234  CE2 TYR A 156      24.443   2.884  32.634  1.00  0.95           C  
ATOM   1235  CZ  TYR A 156      23.228   2.916  33.334  1.00  0.95           C  
ATOM   1236  OH  TYR A 156      22.994   2.015  34.403  1.00  0.95           O  
ATOM   1237  N   GLY A 157      25.966   8.292  29.128  1.00  0.98           N  
ATOM   1238  CA  GLY A 157      26.350   8.860  27.838  1.00  0.98           C  
ATOM   1239  C   GLY A 157      26.936   7.788  26.980  1.00  0.98           C  
ATOM   1240  O   GLY A 157      27.843   7.093  27.420  1.00  0.98           O  
ATOM   1241  N   TYR A 158      26.448   7.618  25.740  1.00  0.96           N  
ATOM   1242  CA  TYR A 158      26.953   6.595  24.840  1.00  0.96           C  
ATOM   1243  C   TYR A 158      27.447   7.216  23.547  1.00  0.96           C  
ATOM   1244  O   TYR A 158      26.733   7.958  22.869  1.00  0.96           O  
ATOM   1245  CB  TYR A 158      25.884   5.532  24.498  1.00  0.96           C  
ATOM   1246  CG  TYR A 158      25.786   4.449  25.538  1.00  0.96           C  
ATOM   1247  CD1 TYR A 158      25.143   4.653  26.769  1.00  0.96           C  
ATOM   1248  CD2 TYR A 158      26.274   3.165  25.242  1.00  0.96           C  
ATOM   1249  CE1 TYR A 158      24.992   3.586  27.667  1.00  0.96           C  
ATOM   1250  CE2 TYR A 158      26.075   2.093  26.117  1.00  0.96           C  
ATOM   1251  CZ  TYR A 158      25.451   2.318  27.339  1.00  0.96           C  
ATOM   1252  OH  TYR A 158      25.301   1.275  28.258  1.00  0.96           O  
ATOM   1253  N   GLY A 159      28.713   6.923  23.184  1.00  0.99           N  
ATOM   1254  CA  GLY A 159      29.352   7.498  22.009  1.00  0.99           C  
ATOM   1255  C   GLY A 159      30.479   6.655  21.495  1.00  0.99           C  
ATOM   1256  O   GLY A 159      30.592   5.467  21.789  1.00  0.99           O  
ATOM   1257  N   ILE A 160      31.381   7.262  20.708  1.00  0.96           N  
ATOM   1258  CA  ILE A 160      32.537   6.578  20.150  1.00  0.96           C  
ATOM   1259  C   ILE A 160      33.778   7.042  20.863  1.00  0.96           C  
ATOM   1260  O   ILE A 160      33.997   8.229  21.104  1.00  0.96           O  
ATOM   1261  CB  ILE A 160      32.709   6.805  18.649  1.00  0.96           C  
ATOM   1262  CG1 ILE A 160      31.477   6.244  17.919  1.00  0.96           C  
ATOM   1263  CG2 ILE A 160      33.998   6.134  18.114  1.00  0.96           C  
ATOM   1264  CD1 ILE A 160      31.525   6.456  16.411  1.00  0.96           C  
ATOM   1265  N   ARG A 161      34.654   6.085  21.216  1.00  0.90           N  
ATOM   1266  CA  ARG A 161      35.969   6.388  21.722  1.00  0.90           C  
ATOM   1267  C   ARG A 161      36.896   6.590  20.555  1.00  0.90           C  
ATOM   1268  O   ARG A 161      37.578   5.669  20.103  1.00  0.90           O  
ATOM   1269  CB  ARG A 161      36.498   5.236  22.595  1.00  0.90           C  
ATOM   1270  CG  ARG A 161      37.885   5.495  23.216  1.00  0.90           C  
ATOM   1271  CD  ARG A 161      38.282   4.349  24.139  1.00  0.90           C  
ATOM   1272  NE  ARG A 161      39.652   4.583  24.682  1.00  0.90           N  
ATOM   1273  CZ  ARG A 161      40.774   4.126  24.118  1.00  0.90           C  
ATOM   1274  NH1 ARG A 161      40.814   3.740  22.843  1.00  0.90           N  
ATOM   1275  NH2 ARG A 161      41.881   4.056  24.846  1.00  0.90           N  
ATOM   1276  N   TYR A 162      36.928   7.822  20.018  1.00  0.90           N  
ATOM   1277  CA  TYR A 162      37.860   8.159  18.971  1.00  0.90           C  
ATOM   1278  C   TYR A 162      39.285   8.083  19.479  1.00  0.90           C  
ATOM   1279  O   TYR A 162      39.613   8.608  20.540  1.00  0.90           O  
ATOM   1280  CB  TYR A 162      37.626   9.555  18.355  1.00  0.90           C  
ATOM   1281  CG  TYR A 162      36.210   9.733  17.893  1.00  0.90           C  
ATOM   1282  CD1 TYR A 162      35.749   9.115  16.718  1.00  0.90           C  
ATOM   1283  CD2 TYR A 162      35.339  10.569  18.608  1.00  0.90           C  
ATOM   1284  CE1 TYR A 162      34.448   9.358  16.252  1.00  0.90           C  
ATOM   1285  CE2 TYR A 162      34.039  10.803  18.150  1.00  0.90           C  
ATOM   1286  CZ  TYR A 162      33.596  10.206  16.965  1.00  0.90           C  
ATOM   1287  OH  TYR A 162      32.297  10.468  16.491  1.00  0.90           O  
ATOM   1288  N   GLU A 163      40.175   7.417  18.732  1.00  0.86           N  
ATOM   1289  CA  GLU A 163      41.590   7.387  19.041  1.00  0.86           C  
ATOM   1290  C   GLU A 163      42.214   8.757  18.855  1.00  0.86           C  
ATOM   1291  O   GLU A 163      43.066   9.199  19.621  1.00  0.86           O  
ATOM   1292  CB  GLU A 163      42.276   6.309  18.188  1.00  0.86           C  
ATOM   1293  CG  GLU A 163      43.763   6.082  18.530  1.00  0.86           C  
ATOM   1294  CD  GLU A 163      44.292   4.779  17.941  1.00  0.86           C  
ATOM   1295  OE1 GLU A 163      45.520   4.565  18.034  1.00  0.86           O  
ATOM   1296  OE2 GLU A 163      43.494   3.974  17.381  1.00  0.86           O  
ATOM   1297  N   PHE A 164      41.720   9.483  17.840  1.00  0.86           N  
ATOM   1298  CA  PHE A 164      42.090  10.848  17.561  1.00  0.86           C  
ATOM   1299  C   PHE A 164      40.855  11.738  17.623  1.00  0.86           C  
ATOM   1300  O   PHE A 164      39.889  11.551  16.880  1.00  0.86           O  
ATOM   1301  CB  PHE A 164      42.764  10.954  16.169  1.00  0.86           C  
ATOM   1302  CG  PHE A 164      43.970  10.050  16.132  1.00  0.86           C  
ATOM   1303  CD1 PHE A 164      45.184  10.455  16.706  1.00  0.86           C  
ATOM   1304  CD2 PHE A 164      43.884   8.756  15.590  1.00  0.86           C  
ATOM   1305  CE1 PHE A 164      46.266   9.568  16.788  1.00  0.86           C  
ATOM   1306  CE2 PHE A 164      44.975   7.884  15.617  1.00  0.86           C  
ATOM   1307  CZ  PHE A 164      46.159   8.280  16.245  1.00  0.86           C  
ATOM   1308  N   GLY A 165      40.839  12.735  18.534  1.00  0.90           N  
ATOM   1309  CA  GLY A 165      39.716  13.659  18.677  1.00  0.90           C  
ATOM   1310  C   GLY A 165      39.707  14.756  17.641  1.00  0.90           C  
ATOM   1311  O   GLY A 165      40.116  14.579  16.493  1.00  0.90           O  
ATOM   1312  N   ILE A 166      39.211  15.957  18.001  1.00  0.85           N  
ATOM   1313  CA  ILE A 166      39.381  17.134  17.160  1.00  0.85           C  
ATOM   1314  C   ILE A 166      40.857  17.489  17.023  1.00  0.85           C  
ATOM   1315  O   ILE A 166      41.596  17.520  18.001  1.00  0.85           O  
ATOM   1316  CB  ILE A 166      38.573  18.346  17.642  1.00  0.85           C  
ATOM   1317  CG1 ILE A 166      38.572  19.511  16.622  1.00  0.85           C  
ATOM   1318  CG2 ILE A 166      39.089  18.837  19.012  1.00  0.85           C  
ATOM   1319  CD1 ILE A 166      37.857  19.167  15.314  1.00  0.85           C  
ATOM   1320  N   PHE A 167      41.355  17.781  15.807  1.00  0.87           N  
ATOM   1321  CA  PHE A 167      42.765  18.051  15.587  1.00  0.87           C  
ATOM   1322  C   PHE A 167      43.349  19.160  16.458  1.00  0.87           C  
ATOM   1323  O   PHE A 167      42.699  20.160  16.775  1.00  0.87           O  
ATOM   1324  CB  PHE A 167      43.065  18.326  14.085  1.00  0.87           C  
ATOM   1325  CG  PHE A 167      42.393  19.577  13.579  1.00  0.87           C  
ATOM   1326  CD1 PHE A 167      43.030  20.821  13.729  1.00  0.87           C  
ATOM   1327  CD2 PHE A 167      41.129  19.531  12.968  1.00  0.87           C  
ATOM   1328  CE1 PHE A 167      42.401  22.000  13.327  1.00  0.87           C  
ATOM   1329  CE2 PHE A 167      40.493  20.712  12.566  1.00  0.87           C  
ATOM   1330  CZ  PHE A 167      41.125  21.945  12.763  1.00  0.87           C  
ATOM   1331  N   ASN A 168      44.623  19.027  16.856  1.00  0.87           N  
ATOM   1332  CA  ASN A 168      45.325  20.115  17.486  1.00  0.87           C  
ATOM   1333  C   ASN A 168      45.711  21.097  16.401  1.00  0.87           C  
ATOM   1334  O   ASN A 168      46.420  20.777  15.450  1.00  0.87           O  
ATOM   1335  CB  ASN A 168      46.559  19.636  18.286  1.00  0.87           C  
ATOM   1336  CG  ASN A 168      46.075  19.126  19.641  1.00  0.87           C  
ATOM   1337  OD1 ASN A 168      45.558  19.924  20.424  1.00  0.87           O  
ATOM   1338  ND2 ASN A 168      46.257  17.818  19.917  1.00  0.87           N  
ATOM   1339  N   GLN A 169      45.187  22.323  16.493  1.00  0.86           N  
ATOM   1340  CA  GLN A 169      45.450  23.348  15.515  1.00  0.86           C  
ATOM   1341  C   GLN A 169      46.775  23.991  15.798  1.00  0.86           C  
ATOM   1342  O   GLN A 169      47.042  24.412  16.916  1.00  0.86           O  
ATOM   1343  CB  GLN A 169      44.339  24.418  15.562  1.00  0.86           C  
ATOM   1344  CG  GLN A 169      44.530  25.642  14.637  1.00  0.86           C  
ATOM   1345  CD  GLN A 169      43.456  26.681  14.947  1.00  0.86           C  
ATOM   1346  OE1 GLN A 169      43.383  27.181  16.072  1.00  0.86           O  
ATOM   1347  NE2 GLN A 169      42.587  26.993  13.963  1.00  0.86           N  
ATOM   1348  N   LYS A 170      47.627  24.066  14.778  1.00  0.85           N  
ATOM   1349  CA  LYS A 170      48.852  24.814  14.843  1.00  0.85           C  
ATOM   1350  C   LYS A 170      48.706  25.986  13.906  1.00  0.85           C  
ATOM   1351  O   LYS A 170      47.952  25.919  12.933  1.00  0.85           O  
ATOM   1352  CB  LYS A 170      50.035  23.936  14.386  1.00  0.85           C  
ATOM   1353  CG  LYS A 170      50.326  22.755  15.324  1.00  0.85           C  
ATOM   1354  CD  LYS A 170      50.723  23.225  16.737  1.00  0.85           C  
ATOM   1355  CE  LYS A 170      51.465  22.187  17.576  1.00  0.85           C  
ATOM   1356  NZ  LYS A 170      50.649  20.978  17.690  1.00  0.85           N  
ATOM   1357  N   ILE A 171      49.407  27.102  14.170  1.00  0.88           N  
ATOM   1358  CA  ILE A 171      49.403  28.233  13.257  1.00  0.88           C  
ATOM   1359  C   ILE A 171      50.798  28.437  12.710  1.00  0.88           C  
ATOM   1360  O   ILE A 171      51.751  28.735  13.426  1.00  0.88           O  
ATOM   1361  CB  ILE A 171      48.870  29.515  13.890  1.00  0.88           C  
ATOM   1362  CG1 ILE A 171      47.381  29.365  14.291  1.00  0.88           C  
ATOM   1363  CG2 ILE A 171      49.049  30.720  12.937  1.00  0.88           C  
ATOM   1364  CD1 ILE A 171      46.400  29.266  13.115  1.00  0.88           C  
ATOM   1365  N   VAL A 172      50.966  28.284  11.383  1.00  0.89           N  
ATOM   1366  CA  VAL A 172      52.257  28.482  10.738  1.00  0.89           C  
ATOM   1367  C   VAL A 172      52.026  29.362   9.534  1.00  0.89           C  
ATOM   1368  O   VAL A 172      51.114  29.123   8.744  1.00  0.89           O  
ATOM   1369  CB  VAL A 172      52.940  27.184  10.313  1.00  0.89           C  
ATOM   1370  CG1 VAL A 172      54.329  27.467   9.706  1.00  0.89           C  
ATOM   1371  CG2 VAL A 172      53.103  26.253  11.530  1.00  0.89           C  
ATOM   1372  N   ASN A 173      52.802  30.467   9.396  1.00  0.88           N  
ATOM   1373  CA  ASN A 173      52.646  31.472   8.343  1.00  0.88           C  
ATOM   1374  C   ASN A 173      51.293  32.179   8.392  1.00  0.88           C  
ATOM   1375  O   ASN A 173      50.819  32.749   7.413  1.00  0.88           O  
ATOM   1376  CB  ASN A 173      52.868  30.871   6.930  1.00  0.88           C  
ATOM   1377  CG  ASN A 173      54.255  30.265   6.817  1.00  0.88           C  
ATOM   1378  OD1 ASN A 173      55.257  30.897   7.146  1.00  0.88           O  
ATOM   1379  ND2 ASN A 173      54.331  29.004   6.330  1.00  0.88           N  
ATOM   1380  N   GLY A 174      50.629  32.141   9.562  1.00  0.92           N  
ATOM   1381  CA  GLY A 174      49.282  32.649   9.757  1.00  0.92           C  
ATOM   1382  C   GLY A 174      48.168  31.729   9.324  1.00  0.92           C  
ATOM   1383  O   GLY A 174      47.001  32.074   9.477  1.00  0.92           O  
ATOM   1384  N   TRP A 175      48.478  30.535   8.793  1.00  0.88           N  
ATOM   1385  CA  TRP A 175      47.480  29.581   8.337  1.00  0.88           C  
ATOM   1386  C   TRP A 175      47.213  28.507   9.377  1.00  0.88           C  
ATOM   1387  O   TRP A 175      48.114  28.093  10.103  1.00  0.88           O  
ATOM   1388  CB  TRP A 175      47.941  28.843   7.051  1.00  0.88           C  
ATOM   1389  CG  TRP A 175      48.177  29.722   5.839  1.00  0.88           C  
ATOM   1390  CD1 TRP A 175      49.351  30.285   5.426  1.00  0.88           C  
ATOM   1391  CD2 TRP A 175      47.187  30.095   4.861  1.00  0.88           C  
ATOM   1392  NE1 TRP A 175      49.166  30.993   4.260  1.00  0.88           N  
ATOM   1393  CE2 TRP A 175      47.844  30.895   3.901  1.00  0.88           C  
ATOM   1394  CE3 TRP A 175      45.825  29.811   4.752  1.00  0.88           C  
ATOM   1395  CZ2 TRP A 175      47.155  31.440   2.830  1.00  0.88           C  
ATOM   1396  CZ3 TRP A 175      45.126  30.372   3.670  1.00  0.88           C  
ATOM   1397  CH2 TRP A 175      45.780  31.180   2.727  1.00  0.88           C  
ATOM   1398  N   GLN A 176      45.961  27.991   9.449  1.00  0.88           N  
ATOM   1399  CA  GLN A 176      45.680  26.763  10.181  1.00  0.88           C  
ATOM   1400  C   GLN A 176      46.414  25.565   9.604  1.00  0.88           C  
ATOM   1401  O   GLN A 176      46.294  25.251   8.420  1.00  0.88           O  
ATOM   1402  CB  GLN A 176      44.162  26.420  10.233  1.00  0.88           C  
ATOM   1403  CG  GLN A 176      43.841  24.957  10.660  1.00  0.88           C  
ATOM   1404  CD  GLN A 176      42.345  24.724  10.845  1.00  0.88           C  
ATOM   1405  OE1 GLN A 176      41.686  25.409  11.636  1.00  0.88           O  
ATOM   1406  NE2 GLN A 176      41.786  23.723  10.129  1.00  0.88           N  
ATOM   1407  N   VAL A 177      47.146  24.851  10.470  1.00  0.85           N  
ATOM   1408  CA  VAL A 177      47.808  23.611  10.144  1.00  0.85           C  
ATOM   1409  C   VAL A 177      47.230  22.587  11.092  1.00  0.85           C  
ATOM   1410  O   VAL A 177      47.327  22.717  12.314  1.00  0.85           O  
ATOM   1411  CB  VAL A 177      49.315  23.714  10.352  1.00  0.85           C  
ATOM   1412  CG1 VAL A 177      50.034  22.398   9.993  1.00  0.85           C  
ATOM   1413  CG2 VAL A 177      49.868  24.875   9.507  1.00  0.85           C  
ATOM   1414  N   GLU A 178      46.556  21.553  10.573  1.00  0.82           N  
ATOM   1415  CA  GLU A 178      45.934  20.550  11.410  1.00  0.82           C  
ATOM   1416  C   GLU A 178      46.900  19.432  11.799  1.00  0.82           C  
ATOM   1417  O   GLU A 178      47.621  18.867  10.979  1.00  0.82           O  
ATOM   1418  CB  GLU A 178      44.614  20.003  10.800  1.00  0.82           C  
ATOM   1419  CG  GLU A 178      44.568  19.852   9.262  1.00  0.82           C  
ATOM   1420  CD  GLU A 178      44.286  21.175   8.562  1.00  0.82           C  
ATOM   1421  OE1 GLU A 178      43.147  21.709   8.657  1.00  0.82           O  
ATOM   1422  OE2 GLU A 178      45.188  21.717   7.880  1.00  0.82           O  
ATOM   1423  N   GLU A 179      46.950  19.090  13.105  1.00  0.81           N  
ATOM   1424  CA  GLU A 179      47.857  18.091  13.642  1.00  0.81           C  
ATOM   1425  C   GLU A 179      47.093  17.085  14.492  1.00  0.81           C  
ATOM   1426  O   GLU A 179      46.233  17.453  15.287  1.00  0.81           O  
ATOM   1427  CB  GLU A 179      48.923  18.779  14.504  1.00  0.81           C  
ATOM   1428  CG  GLU A 179      50.119  17.878  14.840  1.00  0.81           C  
ATOM   1429  CD  GLU A 179      50.907  18.497  15.958  1.00  0.81           C  
ATOM   1430  OE1 GLU A 179      50.907  17.970  17.107  1.00  0.81           O  
ATOM   1431  OE2 GLU A 179      51.435  19.603  15.707  1.00  0.81           O  
ATOM   1432  N   ALA A 180      47.332  15.761  14.349  1.00  0.85           N  
ATOM   1433  CA  ALA A 180      46.512  14.774  15.039  1.00  0.85           C  
ATOM   1434  C   ALA A 180      46.513  14.866  16.563  1.00  0.85           C  
ATOM   1435  O   ALA A 180      47.533  15.050  17.240  1.00  0.85           O  
ATOM   1436  CB  ALA A 180      46.818  13.314  14.653  1.00  0.85           C  
ATOM   1437  N   ASP A 181      45.313  14.724  17.128  1.00  0.86           N  
ATOM   1438  CA  ASP A 181      45.076  14.757  18.546  1.00  0.86           C  
ATOM   1439  C   ASP A 181      45.250  13.378  19.153  1.00  0.86           C  
ATOM   1440  O   ASP A 181      44.313  12.621  19.383  1.00  0.86           O  
ATOM   1441  CB  ASP A 181      43.682  15.361  18.766  1.00  0.86           C  
ATOM   1442  CG  ASP A 181      43.325  15.452  20.235  1.00  0.86           C  
ATOM   1443  OD1 ASP A 181      44.146  16.057  20.969  1.00  0.86           O  
ATOM   1444  OD2 ASP A 181      42.263  14.899  20.616  1.00  0.86           O  
ATOM   1445  N   ASP A 182      46.513  13.019  19.403  1.00  0.85           N  
ATOM   1446  CA  ASP A 182      46.930  11.789  20.034  1.00  0.85           C  
ATOM   1447  C   ASP A 182      46.784  11.911  21.546  1.00  0.85           C  
ATOM   1448  O   ASP A 182      47.750  11.874  22.308  1.00  0.85           O  
ATOM   1449  CB  ASP A 182      48.377  11.526  19.555  1.00  0.85           C  
ATOM   1450  CG  ASP A 182      48.935  10.174  19.947  1.00  0.85           C  
ATOM   1451  OD1 ASP A 182      48.152   9.220  20.139  1.00  0.85           O  
ATOM   1452  OD2 ASP A 182      50.192  10.106  19.998  1.00  0.85           O  
ATOM   1453  N   TRP A 183      45.527  12.072  21.998  1.00  0.84           N  
ATOM   1454  CA  TRP A 183      45.163  12.361  23.373  1.00  0.84           C  
ATOM   1455  C   TRP A 183      45.366  11.158  24.284  1.00  0.84           C  
ATOM   1456  O   TRP A 183      45.417  11.247  25.509  1.00  0.84           O  
ATOM   1457  CB  TRP A 183      43.681  12.837  23.442  1.00  0.84           C  
ATOM   1458  CG  TRP A 183      42.618  11.800  23.101  1.00  0.84           C  
ATOM   1459  CD1 TRP A 183      42.289  11.279  21.882  1.00  0.84           C  
ATOM   1460  CD2 TRP A 183      41.767  11.144  24.062  1.00  0.84           C  
ATOM   1461  NE1 TRP A 183      41.312  10.319  22.022  1.00  0.84           N  
ATOM   1462  CE2 TRP A 183      40.981  10.221  23.347  1.00  0.84           C  
ATOM   1463  CE3 TRP A 183      41.635  11.284  25.443  1.00  0.84           C  
ATOM   1464  CZ2 TRP A 183      40.057   9.413  23.991  1.00  0.84           C  
ATOM   1465  CZ3 TRP A 183      40.694  10.471  26.096  1.00  0.84           C  
ATOM   1466  CH2 TRP A 183      39.917   9.545  25.381  1.00  0.84           C  
ATOM   1467  N   LEU A 184      45.514   9.970  23.674  1.00  0.86           N  
ATOM   1468  CA  LEU A 184      45.715   8.729  24.376  1.00  0.86           C  
ATOM   1469  C   LEU A 184      47.176   8.349  24.475  1.00  0.86           C  
ATOM   1470  O   LEU A 184      47.496   7.275  24.986  1.00  0.86           O  
ATOM   1471  CB  LEU A 184      44.980   7.593  23.631  1.00  0.86           C  
ATOM   1472  CG  LEU A 184      43.447   7.700  23.677  1.00  0.86           C  
ATOM   1473  CD1 LEU A 184      42.822   6.708  22.691  1.00  0.86           C  
ATOM   1474  CD2 LEU A 184      42.911   7.471  25.095  1.00  0.86           C  
ATOM   1475  N   ARG A 185      48.112   9.222  24.044  1.00  0.79           N  
ATOM   1476  CA  ARG A 185      49.531   8.909  23.963  1.00  0.79           C  
ATOM   1477  C   ARG A 185      50.148   8.444  25.268  1.00  0.79           C  
ATOM   1478  O   ARG A 185      50.893   7.470  25.319  1.00  0.79           O  
ATOM   1479  CB  ARG A 185      50.318  10.158  23.515  1.00  0.79           C  
ATOM   1480  CG  ARG A 185      51.783   9.868  23.132  1.00  0.79           C  
ATOM   1481  CD  ARG A 185      52.657  11.116  23.061  1.00  0.79           C  
ATOM   1482  NE  ARG A 185      51.977  12.085  22.157  1.00  0.79           N  
ATOM   1483  CZ  ARG A 185      52.332  13.369  22.055  1.00  0.79           C  
ATOM   1484  NH1 ARG A 185      53.489  13.804  22.550  1.00  0.79           N  
ATOM   1485  NH2 ARG A 185      51.497  14.238  21.489  1.00  0.79           N  
ATOM   1486  N   TYR A 186      49.809   9.115  26.381  1.00  0.83           N  
ATOM   1487  CA  TYR A 186      50.338   8.769  27.684  1.00  0.83           C  
ATOM   1488  C   TYR A 186      49.364   7.903  28.464  1.00  0.83           C  
ATOM   1489  O   TYR A 186      49.525   7.670  29.660  1.00  0.83           O  
ATOM   1490  CB  TYR A 186      50.688  10.039  28.491  1.00  0.83           C  
ATOM   1491  CG  TYR A 186      51.722  10.859  27.764  1.00  0.83           C  
ATOM   1492  CD1 TYR A 186      53.066  10.444  27.717  1.00  0.83           C  
ATOM   1493  CD2 TYR A 186      51.361  12.053  27.118  1.00  0.83           C  
ATOM   1494  CE1 TYR A 186      54.026  11.202  27.031  1.00  0.83           C  
ATOM   1495  CE2 TYR A 186      52.321  12.821  26.447  1.00  0.83           C  
ATOM   1496  CZ  TYR A 186      53.653  12.396  26.407  1.00  0.83           C  
ATOM   1497  OH  TYR A 186      54.611  13.177  25.731  1.00  0.83           O  
ATOM   1498  N   GLY A 187      48.336   7.375  27.774  1.00  0.86           N  
ATOM   1499  CA  GLY A 187      47.221   6.661  28.366  1.00  0.86           C  
ATOM   1500  C   GLY A 187      46.194   7.566  28.995  1.00  0.86           C  
ATOM   1501  O   GLY A 187      46.417   8.743  29.264  1.00  0.86           O  
ATOM   1502  N   ASN A 188      45.008   7.004  29.266  1.00  0.88           N  
ATOM   1503  CA  ASN A 188      43.903   7.705  29.879  1.00  0.88           C  
ATOM   1504  C   ASN A 188      43.619   6.971  31.190  1.00  0.88           C  
ATOM   1505  O   ASN A 188      43.274   5.791  31.148  1.00  0.88           O  
ATOM   1506  CB  ASN A 188      42.689   7.684  28.911  1.00  0.88           C  
ATOM   1507  CG  ASN A 188      41.426   8.334  29.473  1.00  0.88           C  
ATOM   1508  OD1 ASN A 188      41.407   8.926  30.553  1.00  0.88           O  
ATOM   1509  ND2 ASN A 188      40.312   8.209  28.717  1.00  0.88           N  
ATOM   1510  N   PRO A 189      43.753   7.569  32.370  1.00  0.90           N  
ATOM   1511  CA  PRO A 189      43.640   6.826  33.617  1.00  0.90           C  
ATOM   1512  C   PRO A 189      42.200   6.704  34.015  1.00  0.90           C  
ATOM   1513  O   PRO A 189      41.891   5.837  34.830  1.00  0.90           O  
ATOM   1514  CB  PRO A 189      44.404   7.699  34.631  1.00  0.90           C  
ATOM   1515  CG  PRO A 189      44.322   9.120  34.064  1.00  0.90           C  
ATOM   1516  CD  PRO A 189      44.374   8.880  32.559  1.00  0.90           C  
ATOM   1517  N   TRP A 190      41.334   7.593  33.501  1.00  0.87           N  
ATOM   1518  CA  TRP A 190      39.950   7.714  33.898  1.00  0.87           C  
ATOM   1519  C   TRP A 190      39.038   6.713  33.228  1.00  0.87           C  
ATOM   1520  O   TRP A 190      37.969   6.403  33.747  1.00  0.87           O  
ATOM   1521  CB  TRP A 190      39.422   9.123  33.533  1.00  0.87           C  
ATOM   1522  CG  TRP A 190      40.313  10.263  33.984  1.00  0.87           C  
ATOM   1523  CD1 TRP A 190      41.109  11.073  33.220  1.00  0.87           C  
ATOM   1524  CD2 TRP A 190      40.488  10.673  35.347  1.00  0.87           C  
ATOM   1525  NE1 TRP A 190      41.788  11.957  34.026  1.00  0.87           N  
ATOM   1526  CE2 TRP A 190      41.439  11.726  35.332  1.00  0.87           C  
ATOM   1527  CE3 TRP A 190      39.919  10.236  36.541  1.00  0.87           C  
ATOM   1528  CZ2 TRP A 190      41.837  12.331  36.508  1.00  0.87           C  
ATOM   1529  CZ3 TRP A 190      40.326  10.855  37.732  1.00  0.87           C  
ATOM   1530  CH2 TRP A 190      41.287  11.880  37.716  1.00  0.87           C  
ATOM   1531  N   GLU A 191      39.444   6.173  32.069  1.00  0.89           N  
ATOM   1532  CA  GLU A 191      38.673   5.163  31.385  1.00  0.89           C  
ATOM   1533  C   GLU A 191      39.003   3.774  31.892  1.00  0.89           C  
ATOM   1534  O   GLU A 191      40.108   3.472  32.349  1.00  0.89           O  
ATOM   1535  CB  GLU A 191      38.894   5.188  29.854  1.00  0.89           C  
ATOM   1536  CG  GLU A 191      40.342   4.843  29.428  1.00  0.89           C  
ATOM   1537  CD  GLU A 191      40.578   4.948  27.929  1.00  0.89           C  
ATOM   1538  OE1 GLU A 191      39.770   5.591  27.208  1.00  0.89           O  
ATOM   1539  OE2 GLU A 191      41.592   4.392  27.434  1.00  0.89           O  
ATOM   1540  N   LYS A 192      38.033   2.857  31.800  1.00  0.84           N  
ATOM   1541  CA  LYS A 192      38.274   1.460  32.014  1.00  0.84           C  
ATOM   1542  C   LYS A 192      37.770   0.658  30.837  1.00  0.84           C  
ATOM   1543  O   LYS A 192      36.572   0.529  30.593  1.00  0.84           O  
ATOM   1544  CB  LYS A 192      37.615   0.958  33.321  1.00  0.84           C  
ATOM   1545  CG  LYS A 192      37.938  -0.507  33.658  1.00  0.84           C  
ATOM   1546  CD  LYS A 192      39.437  -0.737  33.914  1.00  0.84           C  
ATOM   1547  CE  LYS A 192      39.812  -2.208  34.088  1.00  0.84           C  
ATOM   1548  NZ  LYS A 192      39.603  -2.975  32.839  1.00  0.84           N  
ATOM   1549  N   ALA A 193      38.705   0.047  30.087  1.00  0.89           N  
ATOM   1550  CA  ALA A 193      38.411  -0.911  29.047  1.00  0.89           C  
ATOM   1551  C   ALA A 193      37.652  -2.137  29.531  1.00  0.89           C  
ATOM   1552  O   ALA A 193      37.998  -2.725  30.565  1.00  0.89           O  
ATOM   1553  CB  ALA A 193      39.742  -1.386  28.442  1.00  0.89           C  
ATOM   1554  N   ARG A 194      36.616  -2.554  28.781  1.00  0.83           N  
ATOM   1555  CA  ARG A 194      35.865  -3.767  29.053  1.00  0.83           C  
ATOM   1556  C   ARG A 194      35.980  -4.755  27.897  1.00  0.83           C  
ATOM   1557  O   ARG A 194      35.013  -4.942  27.151  1.00  0.83           O  
ATOM   1558  CB  ARG A 194      34.370  -3.463  29.283  1.00  0.83           C  
ATOM   1559  CG  ARG A 194      34.075  -2.355  30.308  1.00  0.83           C  
ATOM   1560  CD  ARG A 194      34.681  -2.649  31.674  1.00  0.83           C  
ATOM   1561  NE  ARG A 194      34.025  -1.736  32.644  1.00  0.83           N  
ATOM   1562  CZ  ARG A 194      34.142  -1.840  33.966  1.00  0.83           C  
ATOM   1563  NH1 ARG A 194      34.934  -2.735  34.541  1.00  0.83           N  
ATOM   1564  NH2 ARG A 194      33.409  -1.027  34.712  1.00  0.83           N  
ATOM   1565  N   PRO A 195      37.113  -5.417  27.683  1.00  0.83           N  
ATOM   1566  CA  PRO A 195      37.286  -6.364  26.582  1.00  0.83           C  
ATOM   1567  C   PRO A 195      36.418  -7.601  26.708  1.00  0.83           C  
ATOM   1568  O   PRO A 195      36.290  -8.354  25.747  1.00  0.83           O  
ATOM   1569  CB  PRO A 195      38.774  -6.718  26.671  1.00  0.83           C  
ATOM   1570  CG  PRO A 195      39.123  -6.550  28.152  1.00  0.83           C  
ATOM   1571  CD  PRO A 195      38.293  -5.346  28.552  1.00  0.83           C  
ATOM   1572  N   GLU A 196      35.801  -7.844  27.870  1.00  0.81           N  
ATOM   1573  CA  GLU A 196      34.896  -8.940  28.089  1.00  0.81           C  
ATOM   1574  C   GLU A 196      33.482  -8.665  27.598  1.00  0.81           C  
ATOM   1575  O   GLU A 196      32.689  -9.588  27.433  1.00  0.81           O  
ATOM   1576  CB  GLU A 196      34.886  -9.318  29.594  1.00  0.81           C  
ATOM   1577  CG  GLU A 196      34.166  -8.337  30.565  1.00  0.81           C  
ATOM   1578  CD  GLU A 196      34.888  -7.020  30.850  1.00  0.81           C  
ATOM   1579  OE1 GLU A 196      34.321  -6.226  31.655  1.00  0.81           O  
ATOM   1580  OE2 GLU A 196      35.990  -6.766  30.314  1.00  0.81           O  
ATOM   1581  N   TYR A 197      33.129  -7.391  27.320  1.00  0.84           N  
ATOM   1582  CA  TYR A 197      31.784  -7.008  26.903  1.00  0.84           C  
ATOM   1583  C   TYR A 197      31.716  -6.530  25.461  1.00  0.84           C  
ATOM   1584  O   TYR A 197      30.883  -5.698  25.103  1.00  0.84           O  
ATOM   1585  CB  TYR A 197      31.176  -5.922  27.838  1.00  0.84           C  
ATOM   1586  CG  TYR A 197      30.607  -6.538  29.089  1.00  0.84           C  
ATOM   1587  CD1 TYR A 197      29.432  -7.311  29.028  1.00  0.84           C  
ATOM   1588  CD2 TYR A 197      31.223  -6.345  30.334  1.00  0.84           C  
ATOM   1589  CE1 TYR A 197      28.914  -7.919  30.182  1.00  0.84           C  
ATOM   1590  CE2 TYR A 197      30.711  -6.958  31.487  1.00  0.84           C  
ATOM   1591  CZ  TYR A 197      29.562  -7.754  31.409  1.00  0.84           C  
ATOM   1592  OH  TYR A 197      29.061  -8.389  32.564  1.00  0.84           O  
ATOM   1593  N   MET A 198      32.591  -7.035  24.574  1.00  0.83           N  
ATOM   1594  CA  MET A 198      32.490  -6.757  23.154  1.00  0.83           C  
ATOM   1595  C   MET A 198      31.209  -7.257  22.486  1.00  0.83           C  
ATOM   1596  O   MET A 198      30.733  -8.361  22.742  1.00  0.83           O  
ATOM   1597  CB  MET A 198      33.693  -7.323  22.372  1.00  0.83           C  
ATOM   1598  CG  MET A 198      35.046  -6.737  22.806  1.00  0.83           C  
ATOM   1599  SD  MET A 198      36.423  -7.210  21.719  1.00  0.83           S  
ATOM   1600  CE  MET A 198      36.529  -8.934  22.280  1.00  0.83           C  
ATOM   1601  N   LEU A 199      30.633  -6.439  21.585  1.00  0.89           N  
ATOM   1602  CA  LEU A 199      29.388  -6.757  20.910  1.00  0.89           C  
ATOM   1603  C   LEU A 199      29.558  -6.747  19.397  1.00  0.89           C  
ATOM   1604  O   LEU A 199      30.313  -5.921  18.883  1.00  0.89           O  
ATOM   1605  CB  LEU A 199      28.287  -5.740  21.291  1.00  0.89           C  
ATOM   1606  CG  LEU A 199      27.885  -5.781  22.779  1.00  0.89           C  
ATOM   1607  CD1 LEU A 199      26.957  -4.609  23.101  1.00  0.89           C  
ATOM   1608  CD2 LEU A 199      27.206  -7.107  23.149  1.00  0.89           C  
ATOM   1609  N   PRO A 200      28.923  -7.625  18.623  1.00  0.90           N  
ATOM   1610  CA  PRO A 200      29.035  -7.615  17.171  1.00  0.90           C  
ATOM   1611  C   PRO A 200      28.206  -6.527  16.511  1.00  0.90           C  
ATOM   1612  O   PRO A 200      27.058  -6.287  16.881  1.00  0.90           O  
ATOM   1613  CB  PRO A 200      28.527  -9.011  16.778  1.00  0.90           C  
ATOM   1614  CG  PRO A 200      27.473  -9.334  17.840  1.00  0.90           C  
ATOM   1615  CD  PRO A 200      28.064  -8.712  19.106  1.00  0.90           C  
ATOM   1616  N   VAL A 201      28.777  -5.869  15.492  1.00  0.93           N  
ATOM   1617  CA  VAL A 201      28.095  -4.897  14.663  1.00  0.93           C  
ATOM   1618  C   VAL A 201      28.176  -5.381  13.230  1.00  0.93           C  
ATOM   1619  O   VAL A 201      29.249  -5.706  12.726  1.00  0.93           O  
ATOM   1620  CB  VAL A 201      28.703  -3.503  14.766  1.00  0.93           C  
ATOM   1621  CG1 VAL A 201      27.910  -2.504  13.901  1.00  0.93           C  
ATOM   1622  CG2 VAL A 201      28.700  -3.061  16.243  1.00  0.93           C  
ATOM   1623  N   HIS A 202      27.021  -5.464  12.546  1.00  0.89           N  
ATOM   1624  CA  HIS A 202      26.919  -5.994  11.197  1.00  0.89           C  
ATOM   1625  C   HIS A 202      26.886  -4.918  10.131  1.00  0.89           C  
ATOM   1626  O   HIS A 202      26.295  -3.859  10.304  1.00  0.89           O  
ATOM   1627  CB  HIS A 202      25.629  -6.819  11.036  1.00  0.89           C  
ATOM   1628  CG  HIS A 202      25.587  -7.983  11.967  1.00  0.89           C  
ATOM   1629  ND1 HIS A 202      26.371  -9.081  11.692  1.00  0.89           N  
ATOM   1630  CD2 HIS A 202      24.948  -8.144  13.154  1.00  0.89           C  
ATOM   1631  CE1 HIS A 202      26.203  -9.892  12.719  1.00  0.89           C  
ATOM   1632  NE2 HIS A 202      25.349  -9.372  13.635  1.00  0.89           N  
ATOM   1633  N   PHE A 203      27.505  -5.187   8.978  1.00  0.90           N  
ATOM   1634  CA  PHE A 203      27.530  -4.274   7.854  1.00  0.90           C  
ATOM   1635  C   PHE A 203      27.374  -5.057   6.563  1.00  0.90           C  
ATOM   1636  O   PHE A 203      27.702  -6.240   6.501  1.00  0.90           O  
ATOM   1637  CB  PHE A 203      28.889  -3.523   7.781  1.00  0.90           C  
ATOM   1638  CG  PHE A 203      29.051  -2.522   8.891  1.00  0.90           C  
ATOM   1639  CD1 PHE A 203      28.339  -1.314   8.854  1.00  0.90           C  
ATOM   1640  CD2 PHE A 203      29.955  -2.746   9.944  1.00  0.90           C  
ATOM   1641  CE1 PHE A 203      28.547  -0.332   9.829  1.00  0.90           C  
ATOM   1642  CE2 PHE A 203      30.162  -1.768  10.926  1.00  0.90           C  
ATOM   1643  CZ  PHE A 203      29.458  -0.558  10.868  1.00  0.90           C  
ATOM   1644  N   TYR A 204      26.900  -4.406   5.483  1.00  0.88           N  
ATOM   1645  CA  TYR A 204      26.705  -5.001   4.164  1.00  0.88           C  
ATOM   1646  C   TYR A 204      25.769  -6.200   4.140  1.00  0.88           C  
ATOM   1647  O   TYR A 204      24.685  -6.166   4.712  1.00  0.88           O  
ATOM   1648  CB  TYR A 204      28.044  -5.355   3.465  1.00  0.88           C  
ATOM   1649  CG  TYR A 204      28.985  -4.186   3.484  1.00  0.88           C  
ATOM   1650  CD1 TYR A 204      28.806  -3.069   2.648  1.00  0.88           C  
ATOM   1651  CD2 TYR A 204      30.080  -4.209   4.357  1.00  0.88           C  
ATOM   1652  CE1 TYR A 204      29.729  -2.008   2.672  1.00  0.88           C  
ATOM   1653  CE2 TYR A 204      31.000  -3.159   4.379  1.00  0.88           C  
ATOM   1654  CZ  TYR A 204      30.846  -2.084   3.510  1.00  0.88           C  
ATOM   1655  OH  TYR A 204      31.895  -1.158   3.418  1.00  0.88           O  
ATOM   1656  N   GLY A 205      26.148  -7.291   3.439  1.00  0.89           N  
ATOM   1657  CA  GLY A 205      25.290  -8.445   3.225  1.00  0.89           C  
ATOM   1658  C   GLY A 205      24.006  -8.147   2.510  1.00  0.89           C  
ATOM   1659  O   GLY A 205      23.904  -7.224   1.705  1.00  0.89           O  
ATOM   1660  N   ARG A 206      22.977  -8.953   2.777  1.00  0.81           N  
ATOM   1661  CA  ARG A 206      21.687  -8.733   2.177  1.00  0.81           C  
ATOM   1662  C   ARG A 206      20.605  -9.354   3.014  1.00  0.81           C  
ATOM   1663  O   ARG A 206      20.851 -10.031   4.009  1.00  0.81           O  
ATOM   1664  CB  ARG A 206      21.578  -9.254   0.723  1.00  0.81           C  
ATOM   1665  CG  ARG A 206      21.710 -10.778   0.561  1.00  0.81           C  
ATOM   1666  CD  ARG A 206      21.174 -11.261  -0.790  1.00  0.81           C  
ATOM   1667  NE  ARG A 206      21.333 -12.739  -0.822  1.00  0.81           N  
ATOM   1668  CZ  ARG A 206      22.486 -13.401  -0.976  1.00  0.81           C  
ATOM   1669  NH1 ARG A 206      22.476 -14.715  -0.794  1.00  0.81           N  
ATOM   1670  NH2 ARG A 206      23.623 -12.789  -1.284  1.00  0.81           N  
ATOM   1671  N   VAL A 207      19.351  -9.103   2.632  1.00  0.89           N  
ATOM   1672  CA  VAL A 207      18.203  -9.571   3.365  1.00  0.89           C  
ATOM   1673  C   VAL A 207      17.514 -10.698   2.632  1.00  0.89           C  
ATOM   1674  O   VAL A 207      17.212 -10.604   1.444  1.00  0.89           O  
ATOM   1675  CB  VAL A 207      17.231  -8.436   3.600  1.00  0.89           C  
ATOM   1676  CG1 VAL A 207      16.016  -8.937   4.371  1.00  0.89           C  
ATOM   1677  CG2 VAL A 207      17.942  -7.329   4.399  1.00  0.89           C  
ATOM   1678  N   GLU A 208      17.242 -11.792   3.363  1.00  0.84           N  
ATOM   1679  CA  GLU A 208      16.453 -12.906   2.899  1.00  0.84           C  
ATOM   1680  C   GLU A 208      15.157 -12.905   3.705  1.00  0.84           C  
ATOM   1681  O   GLU A 208      15.159 -13.013   4.934  1.00  0.84           O  
ATOM   1682  CB  GLU A 208      17.195 -14.249   3.118  1.00  0.84           C  
ATOM   1683  CG  GLU A 208      18.556 -14.386   2.377  1.00  0.84           C  
ATOM   1684  CD  GLU A 208      18.467 -14.525   0.859  1.00  0.84           C  
ATOM   1685  OE1 GLU A 208      17.366 -14.822   0.339  1.00  0.84           O  
ATOM   1686  OE2 GLU A 208      19.540 -14.370   0.204  1.00  0.84           O  
ATOM   1687  N   HIS A 209      13.995 -12.756   3.041  1.00  0.83           N  
ATOM   1688  CA  HIS A 209      12.698 -12.742   3.706  1.00  0.83           C  
ATOM   1689  C   HIS A 209      12.176 -14.163   3.850  1.00  0.83           C  
ATOM   1690  O   HIS A 209      11.915 -14.833   2.852  1.00  0.83           O  
ATOM   1691  CB  HIS A 209      11.672 -11.900   2.904  1.00  0.83           C  
ATOM   1692  CG  HIS A 209      12.032 -10.440   2.873  1.00  0.83           C  
ATOM   1693  ND1 HIS A 209      11.940  -9.717   4.046  1.00  0.83           N  
ATOM   1694  CD2 HIS A 209      12.575  -9.673   1.889  1.00  0.83           C  
ATOM   1695  CE1 HIS A 209      12.436  -8.528   3.755  1.00  0.83           C  
ATOM   1696  NE2 HIS A 209      12.836  -8.448   2.466  1.00  0.83           N  
ATOM   1697  N   THR A 210      12.018 -14.686   5.089  1.00  0.85           N  
ATOM   1698  CA  THR A 210      11.711 -16.105   5.296  1.00  0.85           C  
ATOM   1699  C   THR A 210      10.464 -16.290   6.148  1.00  0.85           C  
ATOM   1700  O   THR A 210      10.002 -15.333   6.774  1.00  0.85           O  
ATOM   1701  CB  THR A 210      12.866 -16.931   5.905  1.00  0.85           C  
ATOM   1702  OG1 THR A 210      13.027 -16.755   7.309  1.00  0.85           O  
ATOM   1703  CG2 THR A 210      14.200 -16.562   5.242  1.00  0.85           C  
ATOM   1704  N   PRO A 211       9.873 -17.496   6.230  1.00  0.83           N  
ATOM   1705  CA  PRO A 211       8.706 -17.736   7.078  1.00  0.83           C  
ATOM   1706  C   PRO A 211       8.974 -17.559   8.562  1.00  0.83           C  
ATOM   1707  O   PRO A 211       8.018 -17.435   9.323  1.00  0.83           O  
ATOM   1708  CB  PRO A 211       8.273 -19.175   6.744  1.00  0.83           C  
ATOM   1709  CG  PRO A 211       8.764 -19.403   5.313  1.00  0.83           C  
ATOM   1710  CD  PRO A 211      10.045 -18.573   5.246  1.00  0.83           C  
ATOM   1711  N   ASP A 212      10.250 -17.525   8.985  1.00  0.76           N  
ATOM   1712  CA  ASP A 212      10.647 -17.388  10.372  1.00  0.76           C  
ATOM   1713  C   ASP A 212      11.296 -16.037  10.630  1.00  0.76           C  
ATOM   1714  O   ASP A 212      12.118 -15.857  11.543  1.00  0.76           O  
ATOM   1715  CB  ASP A 212      11.634 -18.497  10.771  1.00  0.76           C  
ATOM   1716  CG  ASP A 212      10.899 -19.817  10.820  1.00  0.76           C  
ATOM   1717  OD1 ASP A 212      10.103 -19.989  11.778  1.00  0.76           O  
ATOM   1718  OD2 ASP A 212      11.169 -20.663   9.933  1.00  0.76           O  
ATOM   1719  N   GLY A 213      10.949 -15.036   9.805  1.00  0.84           N  
ATOM   1720  CA  GLY A 213      11.358 -13.657   9.993  1.00  0.84           C  
ATOM   1721  C   GLY A 213      12.278 -13.174   8.918  1.00  0.84           C  
ATOM   1722  O   GLY A 213      12.700 -13.893   8.019  1.00  0.84           O  
ATOM   1723  N   VAL A 214      12.650 -11.895   8.994  1.00  0.88           N  
ATOM   1724  CA  VAL A 214      13.577 -11.312   8.051  1.00  0.88           C  
ATOM   1725  C   VAL A 214      14.998 -11.620   8.494  1.00  0.88           C  
ATOM   1726  O   VAL A 214      15.365 -11.439   9.656  1.00  0.88           O  
ATOM   1727  CB  VAL A 214      13.348  -9.816   7.929  1.00  0.88           C  
ATOM   1728  CG1 VAL A 214      14.274  -9.231   6.871  1.00  0.88           C  
ATOM   1729  CG2 VAL A 214      11.881  -9.552   7.544  1.00  0.88           C  
ATOM   1730  N   LYS A 215      15.840 -12.159   7.591  1.00  0.85           N  
ATOM   1731  CA  LYS A 215      17.188 -12.561   7.941  1.00  0.85           C  
ATOM   1732  C   LYS A 215      18.202 -11.725   7.200  1.00  0.85           C  
ATOM   1733  O   LYS A 215      18.297 -11.747   5.977  1.00  0.85           O  
ATOM   1734  CB  LYS A 215      17.456 -14.061   7.652  1.00  0.85           C  
ATOM   1735  CG  LYS A 215      16.450 -15.026   8.302  1.00  0.85           C  
ATOM   1736  CD  LYS A 215      16.367 -14.911   9.835  1.00  0.85           C  
ATOM   1737  CE  LYS A 215      15.174 -15.695  10.384  1.00  0.85           C  
ATOM   1738  NZ  LYS A 215      14.978 -15.439  11.827  1.00  0.85           N  
ATOM   1739  N   TRP A 216      19.016 -10.966   7.953  1.00  0.82           N  
ATOM   1740  CA  TRP A 216      20.123 -10.213   7.412  1.00  0.82           C  
ATOM   1741  C   TRP A 216      21.346 -11.113   7.415  1.00  0.82           C  
ATOM   1742  O   TRP A 216      21.875 -11.456   8.472  1.00  0.82           O  
ATOM   1743  CB  TRP A 216      20.341  -8.933   8.265  1.00  0.82           C  
ATOM   1744  CG  TRP A 216      21.305  -7.894   7.720  1.00  0.82           C  
ATOM   1745  CD1 TRP A 216      21.807  -7.764   6.456  1.00  0.82           C  
ATOM   1746  CD2 TRP A 216      21.854  -6.809   8.490  1.00  0.82           C  
ATOM   1747  NE1 TRP A 216      22.635  -6.677   6.392  1.00  0.82           N  
ATOM   1748  CE2 TRP A 216      22.696  -6.077   7.616  1.00  0.82           C  
ATOM   1749  CE3 TRP A 216      21.696  -6.423   9.818  1.00  0.82           C  
ATOM   1750  CZ2 TRP A 216      23.399  -4.972   8.063  1.00  0.82           C  
ATOM   1751  CZ3 TRP A 216      22.400  -5.295  10.265  1.00  0.82           C  
ATOM   1752  CH2 TRP A 216      23.244  -4.580   9.398  1.00  0.82           C  
ATOM   1753  N   LEU A 217      21.778 -11.551   6.222  1.00  0.86           N  
ATOM   1754  CA  LEU A 217      22.805 -12.561   6.058  1.00  0.86           C  
ATOM   1755  C   LEU A 217      23.958 -12.048   5.221  1.00  0.86           C  
ATOM   1756  O   LEU A 217      23.888 -10.980   4.613  1.00  0.86           O  
ATOM   1757  CB  LEU A 217      22.270 -13.839   5.355  1.00  0.86           C  
ATOM   1758  CG  LEU A 217      21.162 -14.620   6.092  1.00  0.86           C  
ATOM   1759  CD1 LEU A 217      20.742 -15.834   5.251  1.00  0.86           C  
ATOM   1760  CD2 LEU A 217      21.596 -15.093   7.486  1.00  0.86           C  
ATOM   1761  N   ASP A 218      25.073 -12.813   5.221  1.00  0.82           N  
ATOM   1762  CA  ASP A 218      26.305 -12.552   4.495  1.00  0.82           C  
ATOM   1763  C   ASP A 218      26.932 -11.210   4.872  1.00  0.82           C  
ATOM   1764  O   ASP A 218      27.498 -10.486   4.053  1.00  0.82           O  
ATOM   1765  CB  ASP A 218      26.119 -12.701   2.957  1.00  0.82           C  
ATOM   1766  CG  ASP A 218      25.527 -14.044   2.551  1.00  0.82           C  
ATOM   1767  OD1 ASP A 218      25.601 -15.004   3.360  1.00  0.82           O  
ATOM   1768  OD2 ASP A 218      25.002 -14.120   1.402  1.00  0.82           O  
ATOM   1769  N   THR A 219      26.831 -10.846   6.162  1.00  0.85           N  
ATOM   1770  CA  THR A 219      27.295  -9.577   6.691  1.00  0.85           C  
ATOM   1771  C   THR A 219      28.778  -9.560   7.012  1.00  0.85           C  
ATOM   1772  O   THR A 219      29.420 -10.563   7.321  1.00  0.85           O  
ATOM   1773  CB  THR A 219      26.533  -9.114   7.933  1.00  0.85           C  
ATOM   1774  OG1 THR A 219      26.606 -10.079   8.978  1.00  0.85           O  
ATOM   1775  CG2 THR A 219      25.052  -8.944   7.573  1.00  0.85           C  
ATOM   1776  N   GLN A 220      29.372  -8.358   6.975  1.00  0.79           N  
ATOM   1777  CA  GLN A 220      30.687  -8.100   7.514  1.00  0.79           C  
ATOM   1778  C   GLN A 220      30.509  -7.741   8.972  1.00  0.79           C  
ATOM   1779  O   GLN A 220      29.661  -6.918   9.309  1.00  0.79           O  
ATOM   1780  CB  GLN A 220      31.353  -6.901   6.797  1.00  0.79           C  
ATOM   1781  CG  GLN A 220      32.692  -6.420   7.410  1.00  0.79           C  
ATOM   1782  CD  GLN A 220      33.094  -5.063   6.838  1.00  0.79           C  
ATOM   1783  OE1 GLN A 220      33.476  -4.911   5.681  1.00  0.79           O  
ATOM   1784  NE2 GLN A 220      32.988  -4.005   7.679  1.00  0.79           N  
ATOM   1785  N   VAL A 221      31.306  -8.328   9.877  1.00  0.85           N  
ATOM   1786  CA  VAL A 221      31.206  -8.024  11.292  1.00  0.85           C  
ATOM   1787  C   VAL A 221      32.384  -7.179  11.725  1.00  0.85           C  
ATOM   1788  O   VAL A 221      33.526  -7.399  11.330  1.00  0.85           O  
ATOM   1789  CB  VAL A 221      31.092  -9.288  12.139  1.00  0.85           C  
ATOM   1790  CG1 VAL A 221      31.114  -8.981  13.651  1.00  0.85           C  
ATOM   1791  CG2 VAL A 221      29.765  -9.984  11.790  1.00  0.85           C  
ATOM   1792  N   VAL A 222      32.123  -6.159  12.554  1.00  0.88           N  
ATOM   1793  CA  VAL A 222      33.133  -5.409  13.271  1.00  0.88           C  
ATOM   1794  C   VAL A 222      32.701  -5.507  14.716  1.00  0.88           C  
ATOM   1795  O   VAL A 222      31.506  -5.489  15.004  1.00  0.88           O  
ATOM   1796  CB  VAL A 222      33.230  -3.958  12.817  1.00  0.88           C  
ATOM   1797  CG1 VAL A 222      34.243  -3.181  13.679  1.00  0.88           C  
ATOM   1798  CG2 VAL A 222      33.673  -3.929  11.341  1.00  0.88           C  
ATOM   1799  N   LEU A 223      33.624  -5.676  15.679  1.00  0.87           N  
ATOM   1800  CA  LEU A 223      33.235  -5.760  17.074  1.00  0.87           C  
ATOM   1801  C   LEU A 223      33.335  -4.417  17.764  1.00  0.87           C  
ATOM   1802  O   LEU A 223      34.196  -3.597  17.457  1.00  0.87           O  
ATOM   1803  CB  LEU A 223      34.091  -6.774  17.863  1.00  0.87           C  
ATOM   1804  CG  LEU A 223      34.002  -8.228  17.364  1.00  0.87           C  
ATOM   1805  CD1 LEU A 223      34.886  -9.129  18.237  1.00  0.87           C  
ATOM   1806  CD2 LEU A 223      32.563  -8.756  17.356  1.00  0.87           C  
ATOM   1807  N   ALA A 224      32.444  -4.162  18.732  1.00  0.93           N  
ATOM   1808  CA  ALA A 224      32.429  -2.941  19.495  1.00  0.93           C  
ATOM   1809  C   ALA A 224      32.796  -3.207  20.936  1.00  0.93           C  
ATOM   1810  O   ALA A 224      32.083  -3.889  21.667  1.00  0.93           O  
ATOM   1811  CB  ALA A 224      31.034  -2.303  19.425  1.00  0.93           C  
ATOM   1812  N   MET A 225      33.937  -2.659  21.381  1.00  0.90           N  
ATOM   1813  CA  MET A 225      34.456  -2.832  22.718  1.00  0.90           C  
ATOM   1814  C   MET A 225      34.180  -1.598  23.566  1.00  0.90           C  
ATOM   1815  O   MET A 225      34.634  -0.516  23.186  1.00  0.90           O  
ATOM   1816  CB  MET A 225      35.979  -3.067  22.635  1.00  0.90           C  
ATOM   1817  CG  MET A 225      36.663  -3.256  23.997  1.00  0.90           C  
ATOM   1818  SD  MET A 225      38.345  -3.915  23.838  1.00  0.90           S  
ATOM   1819  CE  MET A 225      38.905  -3.196  25.398  1.00  0.90           C  
ATOM   1820  N   PRO A 226      33.452  -1.652  24.676  1.00  0.95           N  
ATOM   1821  CA  PRO A 226      33.164  -0.470  25.461  1.00  0.95           C  
ATOM   1822  C   PRO A 226      34.266  -0.100  26.427  1.00  0.95           C  
ATOM   1823  O   PRO A 226      34.964  -0.950  26.985  1.00  0.95           O  
ATOM   1824  CB  PRO A 226      31.883  -0.844  26.207  1.00  0.95           C  
ATOM   1825  CG  PRO A 226      31.935  -2.360  26.385  1.00  0.95           C  
ATOM   1826  CD  PRO A 226      32.778  -2.845  25.204  1.00  0.95           C  
ATOM   1827  N   TYR A 227      34.424   1.210  26.629  1.00  0.93           N  
ATOM   1828  CA  TYR A 227      35.296   1.778  27.623  1.00  0.93           C  
ATOM   1829  C   TYR A 227      34.420   2.615  28.543  1.00  0.93           C  
ATOM   1830  O   TYR A 227      33.678   3.484  28.080  1.00  0.93           O  
ATOM   1831  CB  TYR A 227      36.376   2.682  26.973  1.00  0.93           C  
ATOM   1832  CG  TYR A 227      37.507   1.897  26.340  1.00  0.93           C  
ATOM   1833  CD1 TYR A 227      37.315   1.129  25.176  1.00  0.93           C  
ATOM   1834  CD2 TYR A 227      38.811   2.010  26.856  1.00  0.93           C  
ATOM   1835  CE1 TYR A 227      38.399   0.496  24.549  1.00  0.93           C  
ATOM   1836  CE2 TYR A 227      39.898   1.393  26.218  1.00  0.93           C  
ATOM   1837  CZ  TYR A 227      39.689   0.637  25.061  1.00  0.93           C  
ATOM   1838  OH  TYR A 227      40.773   0.019  24.403  1.00  0.93           O  
ATOM   1839  N   ASP A 228      34.472   2.352  29.863  1.00  0.93           N  
ATOM   1840  CA  ASP A 228      33.663   3.044  30.852  1.00  0.93           C  
ATOM   1841  C   ASP A 228      34.460   4.165  31.506  1.00  0.93           C  
ATOM   1842  O   ASP A 228      35.540   3.936  32.043  1.00  0.93           O  
ATOM   1843  CB  ASP A 228      33.239   2.094  32.012  1.00  0.93           C  
ATOM   1844  CG  ASP A 228      32.228   1.037  31.641  1.00  0.93           C  
ATOM   1845  OD1 ASP A 228      31.624   1.080  30.547  1.00  0.93           O  
ATOM   1846  OD2 ASP A 228      32.051   0.098  32.470  1.00  0.93           O  
ATOM   1847  N   THR A 229      33.925   5.396  31.521  1.00  0.93           N  
ATOM   1848  CA  THR A 229      34.529   6.529  32.222  1.00  0.93           C  
ATOM   1849  C   THR A 229      33.548   7.007  33.284  1.00  0.93           C  
ATOM   1850  O   THR A 229      32.392   7.267  32.937  1.00  0.93           O  
ATOM   1851  CB  THR A 229      34.848   7.703  31.304  1.00  0.93           C  
ATOM   1852  OG1 THR A 229      35.866   7.345  30.381  1.00  0.93           O  
ATOM   1853  CG2 THR A 229      35.366   8.929  32.076  1.00  0.93           C  
ATOM   1854  N   PRO A 230      33.893   7.151  34.568  1.00  0.96           N  
ATOM   1855  CA  PRO A 230      32.962   7.628  35.585  1.00  0.96           C  
ATOM   1856  C   PRO A 230      32.658   9.115  35.473  1.00  0.96           C  
ATOM   1857  O   PRO A 230      33.553   9.910  35.197  1.00  0.96           O  
ATOM   1858  CB  PRO A 230      33.678   7.327  36.915  1.00  0.96           C  
ATOM   1859  CG  PRO A 230      34.728   6.269  36.585  1.00  0.96           C  
ATOM   1860  CD  PRO A 230      35.131   6.650  35.168  1.00  0.96           C  
ATOM   1861  N   VAL A 231      31.394   9.508  35.703  1.00  0.97           N  
ATOM   1862  CA  VAL A 231      30.956  10.895  35.656  1.00  0.97           C  
ATOM   1863  C   VAL A 231      30.407  11.304  37.018  1.00  0.97           C  
ATOM   1864  O   VAL A 231      29.318  10.848  37.373  1.00  0.97           O  
ATOM   1865  CB  VAL A 231      29.847  11.074  34.628  1.00  0.97           C  
ATOM   1866  CG1 VAL A 231      29.307  12.519  34.644  1.00  0.97           C  
ATOM   1867  CG2 VAL A 231      30.391  10.709  33.234  1.00  0.97           C  
ATOM   1868  N   PRO A 232      31.057  12.129  37.829  1.00  0.97           N  
ATOM   1869  CA  PRO A 232      30.553  12.477  39.150  1.00  0.97           C  
ATOM   1870  C   PRO A 232      29.580  13.639  39.156  1.00  0.97           C  
ATOM   1871  O   PRO A 232      29.807  14.659  38.512  1.00  0.97           O  
ATOM   1872  CB  PRO A 232      31.840  12.855  39.896  1.00  0.97           C  
ATOM   1873  CG  PRO A 232      32.709  13.517  38.821  1.00  0.97           C  
ATOM   1874  CD  PRO A 232      32.373  12.719  37.559  1.00  0.97           C  
ATOM   1875  N   GLY A 233      28.489  13.522  39.933  1.00  0.96           N  
ATOM   1876  CA  GLY A 233      27.656  14.674  40.241  1.00  0.96           C  
ATOM   1877  C   GLY A 233      28.207  15.443  41.414  1.00  0.96           C  
ATOM   1878  O   GLY A 233      29.042  14.946  42.171  1.00  0.96           O  
ATOM   1879  N   TYR A 234      27.717  16.668  41.647  1.00  0.92           N  
ATOM   1880  CA  TYR A 234      28.267  17.535  42.675  1.00  0.92           C  
ATOM   1881  C   TYR A 234      27.833  17.184  44.094  1.00  0.92           C  
ATOM   1882  O   TYR A 234      26.685  17.374  44.485  1.00  0.92           O  
ATOM   1883  CB  TYR A 234      27.902  19.006  42.351  1.00  0.92           C  
ATOM   1884  CG  TYR A 234      28.575  20.000  43.269  1.00  0.92           C  
ATOM   1885  CD1 TYR A 234      29.911  20.377  43.083  1.00  0.92           C  
ATOM   1886  CD2 TYR A 234      27.872  20.548  44.350  1.00  0.92           C  
ATOM   1887  CE1 TYR A 234      30.522  21.305  43.937  1.00  0.92           C  
ATOM   1888  CE2 TYR A 234      28.464  21.491  45.199  1.00  0.92           C  
ATOM   1889  CZ  TYR A 234      29.791  21.870  44.986  1.00  0.92           C  
ATOM   1890  OH  TYR A 234      30.404  22.795  45.850  1.00  0.92           O  
ATOM   1891  N   LYS A 235      28.784  16.674  44.908  1.00  0.87           N  
ATOM   1892  CA  LYS A 235      28.682  16.443  46.343  1.00  0.87           C  
ATOM   1893  C   LYS A 235      27.551  15.513  46.781  1.00  0.87           C  
ATOM   1894  O   LYS A 235      27.184  15.447  47.949  1.00  0.87           O  
ATOM   1895  CB  LYS A 235      28.696  17.770  47.162  1.00  0.87           C  
ATOM   1896  CG  LYS A 235      29.993  18.605  47.035  1.00  0.87           C  
ATOM   1897  CD  LYS A 235      30.015  19.820  47.997  1.00  0.87           C  
ATOM   1898  CE  LYS A 235      31.313  20.654  47.970  1.00  0.87           C  
ATOM   1899  NZ  LYS A 235      31.155  21.930  48.730  1.00  0.87           N  
ATOM   1900  N   ASN A 236      27.002  14.721  45.846  1.00  0.87           N  
ATOM   1901  CA  ASN A 236      25.870  13.848  46.113  1.00  0.87           C  
ATOM   1902  C   ASN A 236      26.230  12.373  46.108  1.00  0.87           C  
ATOM   1903  O   ASN A 236      25.385  11.504  46.296  1.00  0.87           O  
ATOM   1904  CB  ASN A 236      24.716  14.131  45.111  1.00  0.87           C  
ATOM   1905  CG  ASN A 236      25.002  13.902  43.624  1.00  0.87           C  
ATOM   1906  OD1 ASN A 236      24.096  13.990  42.803  1.00  0.87           O  
ATOM   1907  ND2 ASN A 236      26.255  13.585  43.222  1.00  0.87           N  
ATOM   1908  N   ASN A 237      27.514  12.062  45.841  1.00  0.83           N  
ATOM   1909  CA  ASN A 237      28.050  10.712  45.752  1.00  0.83           C  
ATOM   1910  C   ASN A 237      27.497   9.883  44.593  1.00  0.83           C  
ATOM   1911  O   ASN A 237      27.834   8.712  44.447  1.00  0.83           O  
ATOM   1912  CB  ASN A 237      27.948   9.961  47.106  1.00  0.83           C  
ATOM   1913  CG  ASN A 237      28.677  10.779  48.168  1.00  0.83           C  
ATOM   1914  OD1 ASN A 237      29.828  11.187  47.965  1.00  0.83           O  
ATOM   1915  ND2 ASN A 237      27.998  11.055  49.299  1.00  0.83           N  
ATOM   1916  N   THR A 238      26.705  10.507  43.699  1.00  0.91           N  
ATOM   1917  CA  THR A 238      26.183   9.921  42.476  1.00  0.91           C  
ATOM   1918  C   THR A 238      27.239   9.976  41.409  1.00  0.91           C  
ATOM   1919  O   THR A 238      27.704  11.055  41.042  1.00  0.91           O  
ATOM   1920  CB  THR A 238      24.974  10.670  41.914  1.00  0.91           C  
ATOM   1921  OG1 THR A 238      23.936  10.714  42.877  1.00  0.91           O  
ATOM   1922  CG2 THR A 238      24.407  10.010  40.648  1.00  0.91           C  
ATOM   1923  N   VAL A 239      27.662   8.819  40.878  1.00  0.94           N  
ATOM   1924  CA  VAL A 239      28.621   8.763  39.793  1.00  0.94           C  
ATOM   1925  C   VAL A 239      28.074   7.896  38.668  1.00  0.94           C  
ATOM   1926  O   VAL A 239      27.848   6.692  38.790  1.00  0.94           O  
ATOM   1927  CB  VAL A 239      29.982   8.286  40.264  1.00  0.94           C  
ATOM   1928  CG1 VAL A 239      31.004   8.322  39.121  1.00  0.94           C  
ATOM   1929  CG2 VAL A 239      30.483   9.182  41.412  1.00  0.94           C  
ATOM   1930  N   ASN A 240      27.818   8.519  37.508  1.00  0.95           N  
ATOM   1931  CA  ASN A 240      27.231   7.880  36.348  1.00  0.95           C  
ATOM   1932  C   ASN A 240      28.301   7.352  35.408  1.00  0.95           C  
ATOM   1933  O   ASN A 240      29.494   7.415  35.693  1.00  0.95           O  
ATOM   1934  CB  ASN A 240      26.309   8.854  35.574  1.00  0.95           C  
ATOM   1935  CG  ASN A 240      25.052   9.283  36.322  1.00  0.95           C  
ATOM   1936  OD1 ASN A 240      24.418  10.262  35.939  1.00  0.95           O  
ATOM   1937  ND2 ASN A 240      24.635   8.555  37.377  1.00  0.95           N  
ATOM   1938  N   THR A 241      27.887   6.788  34.259  1.00  0.95           N  
ATOM   1939  CA  THR A 241      28.800   6.137  33.329  1.00  0.95           C  
ATOM   1940  C   THR A 241      28.780   6.812  31.982  1.00  0.95           C  
ATOM   1941  O   THR A 241      27.733   6.954  31.348  1.00  0.95           O  
ATOM   1942  CB  THR A 241      28.423   4.680  33.072  1.00  0.95           C  
ATOM   1943  OG1 THR A 241      28.296   3.986  34.300  1.00  0.95           O  
ATOM   1944  CG2 THR A 241      29.496   3.947  32.255  1.00  0.95           C  
ATOM   1945  N   MET A 242      29.956   7.200  31.465  1.00  0.94           N  
ATOM   1946  CA  MET A 242      30.104   7.505  30.060  1.00  0.94           C  
ATOM   1947  C   MET A 242      30.669   6.259  29.405  1.00  0.94           C  
ATOM   1948  O   MET A 242      31.690   5.729  29.836  1.00  0.94           O  
ATOM   1949  CB  MET A 242      31.014   8.730  29.830  1.00  0.94           C  
ATOM   1950  CG  MET A 242      31.205   9.083  28.342  1.00  0.94           C  
ATOM   1951  SD  MET A 242      32.099  10.634  28.038  1.00  0.94           S  
ATOM   1952  CE  MET A 242      33.749  10.027  28.487  1.00  0.94           C  
ATOM   1953  N   ARG A 243      29.985   5.731  28.381  1.00  0.91           N  
ATOM   1954  CA  ARG A 243      30.329   4.492  27.726  1.00  0.91           C  
ATOM   1955  C   ARG A 243      30.719   4.791  26.299  1.00  0.91           C  
ATOM   1956  O   ARG A 243      29.899   5.208  25.482  1.00  0.91           O  
ATOM   1957  CB  ARG A 243      29.093   3.566  27.686  1.00  0.91           C  
ATOM   1958  CG  ARG A 243      29.362   2.130  27.192  1.00  0.91           C  
ATOM   1959  CD  ARG A 243      29.744   1.203  28.342  1.00  0.91           C  
ATOM   1960  NE  ARG A 243      29.025  -0.112  28.221  1.00  0.91           N  
ATOM   1961  CZ  ARG A 243      29.314  -1.144  29.019  1.00  0.91           C  
ATOM   1962  NH1 ARG A 243      30.299  -1.098  29.910  1.00  0.91           N  
ATOM   1963  NH2 ARG A 243      28.601  -2.264  28.937  1.00  0.91           N  
ATOM   1964  N   LEU A 244      31.991   4.591  25.938  1.00  0.96           N  
ATOM   1965  CA  LEU A 244      32.433   4.925  24.601  1.00  0.96           C  
ATOM   1966  C   LEU A 244      32.954   3.696  23.888  1.00  0.96           C  
ATOM   1967  O   LEU A 244      33.778   2.949  24.416  1.00  0.96           O  
ATOM   1968  CB  LEU A 244      33.519   6.015  24.620  1.00  0.96           C  
ATOM   1969  CG  LEU A 244      33.156   7.334  25.324  1.00  0.96           C  
ATOM   1970  CD1 LEU A 244      34.335   8.300  25.173  1.00  0.96           C  
ATOM   1971  CD2 LEU A 244      31.888   8.002  24.772  1.00  0.96           C  
ATOM   1972  N   TRP A 245      32.471   3.434  22.660  1.00  0.93           N  
ATOM   1973  CA  TRP A 245      32.792   2.217  21.938  1.00  0.93           C  
ATOM   1974  C   TRP A 245      34.038   2.331  21.071  1.00  0.93           C  
ATOM   1975  O   TRP A 245      34.308   3.354  20.440  1.00  0.93           O  
ATOM   1976  CB  TRP A 245      31.618   1.762  21.037  1.00  0.93           C  
ATOM   1977  CG  TRP A 245      30.299   1.570  21.759  1.00  0.93           C  
ATOM   1978  CD1 TRP A 245      29.246   2.437  21.838  1.00  0.93           C  
ATOM   1979  CD2 TRP A 245      29.907   0.390  22.481  1.00  0.93           C  
ATOM   1980  NE1 TRP A 245      28.227   1.880  22.570  1.00  0.93           N  
ATOM   1981  CE2 TRP A 245      28.616   0.639  22.999  1.00  0.93           C  
ATOM   1982  CE3 TRP A 245      30.541  -0.828  22.698  1.00  0.93           C  
ATOM   1983  CZ2 TRP A 245      27.963  -0.309  23.769  1.00  0.93           C  
ATOM   1984  CZ3 TRP A 245      29.848  -1.810  23.423  1.00  0.93           C  
ATOM   1985  CH2 TRP A 245      28.588  -1.544  23.973  1.00  0.93           C  
ATOM   1986  N   SER A 246      34.829   1.248  21.023  1.00  0.93           N  
ATOM   1987  CA  SER A 246      36.066   1.146  20.269  1.00  0.93           C  
ATOM   1988  C   SER A 246      35.973  -0.048  19.346  1.00  0.93           C  
ATOM   1989  O   SER A 246      35.665  -1.158  19.779  1.00  0.93           O  
ATOM   1990  CB  SER A 246      37.251   0.973  21.251  1.00  0.93           C  
ATOM   1991  OG  SER A 246      38.538   1.074  20.637  1.00  0.93           O  
ATOM   1992  N   ALA A 247      36.166   0.162  18.034  1.00  0.92           N  
ATOM   1993  CA  ALA A 247      36.106  -0.870  17.020  1.00  0.92           C  
ATOM   1994  C   ALA A 247      37.253  -1.863  17.106  1.00  0.92           C  
ATOM   1995  O   ALA A 247      38.402  -1.473  17.296  1.00  0.92           O  
ATOM   1996  CB  ALA A 247      36.004  -0.238  15.618  1.00  0.92           C  
ATOM   1997  N   LYS A 248      36.952  -3.173  16.989  1.00  0.82           N  
ATOM   1998  CA  LYS A 248      37.945  -4.230  17.029  1.00  0.82           C  
ATOM   1999  C   LYS A 248      37.686  -5.231  15.924  1.00  0.82           C  
ATOM   2000  O   LYS A 248      36.544  -5.517  15.553  1.00  0.82           O  
ATOM   2001  CB  LYS A 248      37.963  -4.999  18.381  1.00  0.82           C  
ATOM   2002  CG  LYS A 248      38.137  -4.102  19.618  1.00  0.82           C  
ATOM   2003  CD  LYS A 248      39.490  -3.373  19.626  1.00  0.82           C  
ATOM   2004  CE  LYS A 248      39.546  -2.232  20.632  1.00  0.82           C  
ATOM   2005  NZ  LYS A 248      40.787  -1.463  20.419  1.00  0.82           N  
ATOM   2006  N   ALA A 249      38.757  -5.806  15.348  1.00  0.82           N  
ATOM   2007  CA  ALA A 249      38.625  -6.891  14.400  1.00  0.82           C  
ATOM   2008  C   ALA A 249      38.027  -8.173  15.002  1.00  0.82           C  
ATOM   2009  O   ALA A 249      38.505  -8.607  16.054  1.00  0.82           O  
ATOM   2010  CB  ALA A 249      39.998  -7.237  13.826  1.00  0.82           C  
ATOM   2011  N   PRO A 250      37.032  -8.841  14.414  1.00  0.76           N  
ATOM   2012  CA  PRO A 250      36.456 -10.054  14.983  1.00  0.76           C  
ATOM   2013  C   PRO A 250      37.429 -11.205  15.141  1.00  0.76           C  
ATOM   2014  O   PRO A 250      38.482 -11.228  14.500  1.00  0.76           O  
ATOM   2015  CB  PRO A 250      35.289 -10.421  14.055  1.00  0.76           C  
ATOM   2016  CG  PRO A 250      34.995  -9.147  13.266  1.00  0.76           C  
ATOM   2017  CD  PRO A 250      36.330  -8.413  13.207  1.00  0.76           C  
ATOM   2018  N   ASN A 251      37.086 -12.192  15.991  1.00  0.68           N  
ATOM   2019  CA  ASN A 251      37.891 -13.384  16.183  1.00  0.68           C  
ATOM   2020  C   ASN A 251      38.021 -14.216  14.912  1.00  0.68           C  
ATOM   2021  O   ASN A 251      39.099 -14.687  14.565  1.00  0.68           O  
ATOM   2022  CB  ASN A 251      37.344 -14.264  17.343  1.00  0.68           C  
ATOM   2023  CG  ASN A 251      37.612 -13.591  18.683  1.00  0.68           C  
ATOM   2024  OD1 ASN A 251      38.608 -12.891  18.864  1.00  0.68           O  
ATOM   2025  ND2 ASN A 251      36.746 -13.839  19.691  1.00  0.68           N  
ATOM   2026  N   ASP A 252      36.948 -14.387  14.141  1.00  0.70           N  
ATOM   2027  CA  ASP A 252      37.000 -15.258  12.983  1.00  0.70           C  
ATOM   2028  C   ASP A 252      37.707 -14.609  11.784  1.00  0.70           C  
ATOM   2029  O   ASP A 252      38.294 -15.260  10.923  1.00  0.70           O  
ATOM   2030  CB  ASP A 252      35.554 -15.664  12.647  1.00  0.70           C  
ATOM   2031  CG  ASP A 252      34.908 -16.348  13.846  1.00  0.70           C  
ATOM   2032  OD1 ASP A 252      35.638 -16.933  14.686  1.00  0.70           O  
ATOM   2033  OD2 ASP A 252      33.666 -16.205  13.970  1.00  0.70           O  
ATOM   2034  N   PHE A 253      37.769 -13.264  11.771  1.00  0.62           N  
ATOM   2035  CA  PHE A 253      38.470 -12.468  10.771  1.00  0.62           C  
ATOM   2036  C   PHE A 253      39.870 -12.119  11.244  1.00  0.62           C  
ATOM   2037  O   PHE A 253      40.442 -11.074  10.950  1.00  0.62           O  
ATOM   2038  CB  PHE A 253      37.737 -11.140  10.478  1.00  0.62           C  
ATOM   2039  CG  PHE A 253      36.485 -11.354   9.679  1.00  0.62           C  
ATOM   2040  CD1 PHE A 253      36.557 -11.433   8.280  1.00  0.62           C  
ATOM   2041  CD2 PHE A 253      35.226 -11.404  10.294  1.00  0.62           C  
ATOM   2042  CE1 PHE A 253      35.390 -11.548   7.512  1.00  0.62           C  
ATOM   2043  CE2 PHE A 253      34.056 -11.527   9.537  1.00  0.62           C  
ATOM   2044  CZ  PHE A 253      34.139 -11.595   8.141  1.00  0.62           C  
ATOM   2045  N   LYS A 254      40.478 -12.993  12.050  1.00  0.62           N  
ATOM   2046  CA  LYS A 254      41.868 -12.869  12.401  1.00  0.62           C  
ATOM   2047  C   LYS A 254      42.822 -13.045  11.247  1.00  0.62           C  
ATOM   2048  O   LYS A 254      43.816 -12.324  11.168  1.00  0.62           O  
ATOM   2049  CB  LYS A 254      42.200 -13.881  13.501  1.00  0.62           C  
ATOM   2050  CG  LYS A 254      41.793 -13.409  14.904  1.00  0.62           C  
ATOM   2051  CD  LYS A 254      41.919 -14.578  15.863  1.00  0.62           C  
ATOM   2052  CE  LYS A 254      41.487 -14.324  17.289  1.00  0.62           C  
ATOM   2053  NZ  LYS A 254      41.817 -15.530  18.062  1.00  0.62           N  
ATOM   2054  N   LEU A 255      42.561 -14.032  10.387  1.00  0.64           N  
ATOM   2055  CA  LEU A 255      43.529 -14.494   9.424  1.00  0.64           C  
ATOM   2056  C   LEU A 255      42.858 -15.245   8.274  1.00  0.64           C  
ATOM   2057  O   LEU A 255      43.434 -15.542   7.241  1.00  0.64           O  
ATOM   2058  CB  LEU A 255      44.486 -15.504  10.110  1.00  0.64           C  
ATOM   2059  CG  LEU A 255      45.633 -14.918  10.953  1.00  0.64           C  
ATOM   2060  CD1 LEU A 255      46.538 -16.037  11.460  1.00  0.64           C  
ATOM   2061  CD2 LEU A 255      46.498 -13.888  10.237  1.00  0.64           C  
ATOM   2062  N   GLN A 256      41.564 -15.573   8.348  1.00  0.63           N  
ATOM   2063  CA  GLN A 256      40.961 -16.400   7.308  1.00  0.63           C  
ATOM   2064  C   GLN A 256      40.569 -15.601   6.074  1.00  0.63           C  
ATOM   2065  O   GLN A 256      40.000 -16.117   5.116  1.00  0.63           O  
ATOM   2066  CB  GLN A 256      39.681 -17.064   7.859  1.00  0.63           C  
ATOM   2067  CG  GLN A 256      39.943 -18.119   8.959  1.00  0.63           C  
ATOM   2068  CD  GLN A 256      38.621 -18.682   9.484  1.00  0.63           C  
ATOM   2069  OE1 GLN A 256      37.539 -18.150   9.243  1.00  0.63           O  
ATOM   2070  NE2 GLN A 256      38.683 -19.820  10.211  1.00  0.63           N  
ATOM   2071  N   ASP A 257      40.925 -14.318   6.051  1.00  0.55           N  
ATOM   2072  CA  ASP A 257      40.758 -13.428   4.944  1.00  0.55           C  
ATOM   2073  C   ASP A 257      41.957 -13.457   3.978  1.00  0.55           C  
ATOM   2074  O   ASP A 257      41.889 -12.926   2.870  1.00  0.55           O  
ATOM   2075  CB  ASP A 257      40.477 -12.019   5.537  1.00  0.55           C  
ATOM   2076  CG  ASP A 257      41.488 -11.537   6.580  1.00  0.55           C  
ATOM   2077  OD1 ASP A 257      42.391 -12.315   6.990  1.00  0.55           O  
ATOM   2078  OD2 ASP A 257      41.304 -10.382   7.027  1.00  0.55           O  
ATOM   2079  N   PHE A 258      43.069 -14.132   4.346  1.00  0.60           N  
ATOM   2080  CA  PHE A 258      44.299 -14.156   3.565  1.00  0.60           C  
ATOM   2081  C   PHE A 258      44.541 -15.434   2.737  1.00  0.60           C  
ATOM   2082  O   PHE A 258      44.036 -16.518   3.037  1.00  0.60           O  
ATOM   2083  CB  PHE A 258      45.475 -13.786   4.510  1.00  0.60           C  
ATOM   2084  CG  PHE A 258      46.105 -14.900   5.343  1.00  0.60           C  
ATOM   2085  CD1 PHE A 258      46.898 -15.795   4.660  1.00  0.60           C  
ATOM   2086  CD2 PHE A 258      46.045 -15.067   6.733  1.00  0.60           C  
ATOM   2087  CE1 PHE A 258      47.487 -16.907   5.260  1.00  0.60           C  
ATOM   2088  CE2 PHE A 258      46.635 -16.173   7.366  1.00  0.60           C  
ATOM   2089  CZ  PHE A 258      47.324 -17.123   6.623  1.00  0.60           C  
ATOM   2090  N   ASN A 259      45.394 -15.366   1.683  1.00  0.44           N  
ATOM   2091  CA  ASN A 259      45.906 -16.533   0.956  1.00  0.44           C  
ATOM   2092  C   ASN A 259      47.072 -17.206   1.670  1.00  0.44           C  
ATOM   2093  O   ASN A 259      48.021 -16.479   1.960  1.00  0.44           O  
ATOM   2094  CB  ASN A 259      46.599 -16.104  -0.372  1.00  0.44           C  
ATOM   2095  CG  ASN A 259      45.715 -15.399  -1.393  1.00  0.44           C  
ATOM   2096  OD1 ASN A 259      44.691 -15.919  -1.837  1.00  0.44           O  
ATOM   2097  ND2 ASN A 259      46.176 -14.209  -1.841  1.00  0.44           N  
ATOM   2098  N   VAL A 260      47.171 -18.517   1.925  1.00  0.42           N  
ATOM   2099  CA  VAL A 260      48.254 -19.208   2.675  1.00  0.42           C  
ATOM   2100  C   VAL A 260      49.672 -18.546   2.788  1.00  0.42           C  
ATOM   2101  O   VAL A 260      50.229 -18.435   3.876  1.00  0.42           O  
ATOM   2102  CB  VAL A 260      48.372 -20.672   2.266  1.00  0.42           C  
ATOM   2103  CG1 VAL A 260      49.437 -21.398   3.110  1.00  0.42           C  
ATOM   2104  CG2 VAL A 260      47.022 -21.390   2.481  1.00  0.42           C  
ATOM   2105  N   GLY A 261      50.280 -18.040   1.683  1.00  0.40           N  
ATOM   2106  CA  GLY A 261      51.522 -17.254   1.749  1.00  0.40           C  
ATOM   2107  C   GLY A 261      51.447 -15.873   2.370  1.00  0.40           C  
ATOM   2108  O   GLY A 261      52.424 -15.360   2.895  1.00  0.40           O  
ATOM   2109  N   ASP A 262      50.266 -15.247   2.368  1.00  0.54           N  
ATOM   2110  CA  ASP A 262      50.055 -13.863   2.728  1.00  0.54           C  
ATOM   2111  C   ASP A 262      49.634 -13.728   4.195  1.00  0.54           C  
ATOM   2112  O   ASP A 262      48.922 -12.806   4.592  1.00  0.54           O  
ATOM   2113  CB  ASP A 262      48.981 -13.239   1.804  1.00  0.54           C  
ATOM   2114  CG  ASP A 262      49.391 -13.293   0.339  1.00  0.54           C  
ATOM   2115  OD1 ASP A 262      50.611 -13.251   0.043  1.00  0.54           O  
ATOM   2116  OD2 ASP A 262      48.469 -13.448  -0.506  1.00  0.54           O  
ATOM   2117  N   TYR A 263      50.115 -14.652   5.063  1.00  0.45           N  
ATOM   2118  CA  TYR A 263      49.814 -14.751   6.495  1.00  0.45           C  
ATOM   2119  C   TYR A 263      50.050 -13.448   7.235  1.00  0.45           C  
ATOM   2120  O   TYR A 263      49.252 -13.015   8.061  1.00  0.45           O  
ATOM   2121  CB  TYR A 263      50.629 -15.932   7.133  1.00  0.45           C  
ATOM   2122  CG  TYR A 263      50.719 -15.876   8.648  1.00  0.45           C  
ATOM   2123  CD1 TYR A 263      49.708 -16.376   9.485  1.00  0.45           C  
ATOM   2124  CD2 TYR A 263      51.823 -15.235   9.237  1.00  0.45           C  
ATOM   2125  CE1 TYR A 263      49.825 -16.260  10.879  1.00  0.45           C  
ATOM   2126  CE2 TYR A 263      51.908 -15.073  10.626  1.00  0.45           C  
ATOM   2127  CZ  TYR A 263      50.912 -15.594  11.443  1.00  0.45           C  
ATOM   2128  OH  TYR A 263      51.027 -15.445  12.835  1.00  0.45           O  
ATOM   2129  N   ILE A 264      51.180 -12.796   6.939  1.00  0.57           N  
ATOM   2130  CA  ILE A 264      51.548 -11.532   7.536  1.00  0.57           C  
ATOM   2131  C   ILE A 264      50.606 -10.408   7.158  1.00  0.57           C  
ATOM   2132  O   ILE A 264      50.151  -9.686   8.040  1.00  0.57           O  
ATOM   2133  CB  ILE A 264      52.994 -11.184   7.201  1.00  0.57           C  
ATOM   2134  CG1 ILE A 264      53.960 -12.293   7.690  1.00  0.57           C  
ATOM   2135  CG2 ILE A 264      53.384  -9.818   7.805  1.00  0.57           C  
ATOM   2136  CD1 ILE A 264      54.012 -12.470   9.214  1.00  0.57           C  
ATOM   2137  N   GLU A 265      50.229 -10.275   5.865  1.00  0.56           N  
ATOM   2138  CA  GLU A 265      49.399  -9.191   5.356  1.00  0.56           C  
ATOM   2139  C   GLU A 265      48.038  -9.150   6.028  1.00  0.56           C  
ATOM   2140  O   GLU A 265      47.581  -8.107   6.476  1.00  0.56           O  
ATOM   2141  CB  GLU A 265      49.274  -9.278   3.813  1.00  0.56           C  
ATOM   2142  CG  GLU A 265      50.605  -8.921   3.095  1.00  0.56           C  
ATOM   2143  CD  GLU A 265      50.527  -8.772   1.572  1.00  0.56           C  
ATOM   2144  OE1 GLU A 265      49.438  -8.963   0.983  1.00  0.56           O  
ATOM   2145  OE2 GLU A 265      51.603  -8.433   1.007  1.00  0.56           O  
ATOM   2146  N   ALA A 266      47.427 -10.318   6.254  1.00  0.62           N  
ATOM   2147  CA  ALA A 266      46.211 -10.455   7.039  1.00  0.62           C  
ATOM   2148  C   ALA A 266      46.250  -9.933   8.469  1.00  0.62           C  
ATOM   2149  O   ALA A 266      45.333  -9.284   8.967  1.00  0.62           O  
ATOM   2150  CB  ALA A 266      45.994 -11.936   7.179  1.00  0.62           C  
ATOM   2151  N   VAL A 267      47.350 -10.192   9.204  1.00  0.57           N  
ATOM   2152  CA  VAL A 267      47.510  -9.684  10.553  1.00  0.57           C  
ATOM   2153  C   VAL A 267      47.592  -8.161  10.584  1.00  0.57           C  
ATOM   2154  O   VAL A 267      47.056  -7.492  11.468  1.00  0.57           O  
ATOM   2155  CB  VAL A 267      48.753 -10.242  11.228  1.00  0.57           C  
ATOM   2156  CG1 VAL A 267      48.770  -9.754  12.672  1.00  0.57           C  
ATOM   2157  CG2 VAL A 267      48.773 -11.767  11.225  1.00  0.57           C  
ATOM   2158  N   LEU A 268      48.276  -7.576   9.584  1.00  0.56           N  
ATOM   2159  CA  LEU A 268      48.316  -6.148   9.344  1.00  0.56           C  
ATOM   2160  C   LEU A 268      46.931  -5.590   8.969  1.00  0.56           C  
ATOM   2161  O   LEU A 268      46.495  -4.564   9.501  1.00  0.56           O  
ATOM   2162  CB  LEU A 268      49.381  -5.836   8.253  1.00  0.56           C  
ATOM   2163  CG  LEU A 268      50.790  -6.458   8.453  1.00  0.56           C  
ATOM   2164  CD1 LEU A 268      51.776  -5.894   7.421  1.00  0.56           C  
ATOM   2165  CD2 LEU A 268      51.351  -6.308   9.871  1.00  0.56           C  
ATOM   2166  N   ASP A 269      46.182  -6.299   8.100  1.00  0.59           N  
ATOM   2167  CA  ASP A 269      44.842  -5.953   7.659  1.00  0.59           C  
ATOM   2168  C   ASP A 269      43.751  -6.069   8.719  1.00  0.59           C  
ATOM   2169  O   ASP A 269      42.760  -5.344   8.647  1.00  0.59           O  
ATOM   2170  CB  ASP A 269      44.426  -6.789   6.425  1.00  0.59           C  
ATOM   2171  CG  ASP A 269      45.135  -6.323   5.163  1.00  0.59           C  
ATOM   2172  OD1 ASP A 269      45.840  -5.281   5.209  1.00  0.59           O  
ATOM   2173  OD2 ASP A 269      44.919  -6.985   4.116  1.00  0.59           O  
ATOM   2174  N   ARG A 270      43.912  -6.893   9.789  1.00  0.58           N  
ATOM   2175  CA  ARG A 270      42.984  -6.940  10.928  1.00  0.58           C  
ATOM   2176  C   ARG A 270      42.688  -5.556  11.474  1.00  0.58           C  
ATOM   2177  O   ARG A 270      41.543  -5.167  11.693  1.00  0.58           O  
ATOM   2178  CB  ARG A 270      43.581  -7.692  12.149  1.00  0.58           C  
ATOM   2179  CG  ARG A 270      43.472  -9.221  12.107  1.00  0.58           C  
ATOM   2180  CD  ARG A 270      44.125  -9.901  13.323  1.00  0.58           C  
ATOM   2181  NE  ARG A 270      43.600  -9.341  14.620  1.00  0.58           N  
ATOM   2182  CZ  ARG A 270      42.401  -9.561  15.178  1.00  0.58           C  
ATOM   2183  NH1 ARG A 270      41.417 -10.174  14.526  1.00  0.58           N  
ATOM   2184  NH2 ARG A 270      42.182  -9.119  16.414  1.00  0.58           N  
ATOM   2185  N   ASN A 271      43.747  -4.745  11.636  1.00  0.70           N  
ATOM   2186  CA  ASN A 271      43.650  -3.390  12.123  1.00  0.70           C  
ATOM   2187  C   ASN A 271      42.722  -2.508  11.271  1.00  0.70           C  
ATOM   2188  O   ASN A 271      42.133  -1.548  11.762  1.00  0.70           O  
ATOM   2189  CB  ASN A 271      45.084  -2.795  12.224  1.00  0.70           C  
ATOM   2190  CG  ASN A 271      45.029  -1.286  12.410  1.00  0.70           C  
ATOM   2191  OD1 ASN A 271      44.942  -0.717  13.492  1.00  0.70           O  
ATOM   2192  ND2 ASN A 271      44.930  -0.590  11.249  1.00  0.70           N  
ATOM   2193  N   LEU A 272      42.609  -2.754   9.956  1.00  0.69           N  
ATOM   2194  CA  LEU A 272      41.823  -1.915   9.069  1.00  0.69           C  
ATOM   2195  C   LEU A 272      40.347  -1.861   9.447  1.00  0.69           C  
ATOM   2196  O   LEU A 272      39.676  -0.848   9.251  1.00  0.69           O  
ATOM   2197  CB  LEU A 272      41.949  -2.375   7.601  1.00  0.69           C  
ATOM   2198  CG  LEU A 272      43.333  -2.162   6.956  1.00  0.69           C  
ATOM   2199  CD1 LEU A 272      43.385  -2.880   5.602  1.00  0.69           C  
ATOM   2200  CD2 LEU A 272      43.654  -0.674   6.767  1.00  0.69           C  
ATOM   2201  N   ALA A 273      39.827  -2.934  10.075  1.00  0.74           N  
ATOM   2202  CA  ALA A 273      38.491  -2.991  10.632  1.00  0.74           C  
ATOM   2203  C   ALA A 273      38.264  -2.025  11.797  1.00  0.74           C  
ATOM   2204  O   ALA A 273      37.142  -1.610  12.082  1.00  0.74           O  
ATOM   2205  CB  ALA A 273      38.237  -4.438  11.087  1.00  0.74           C  
ATOM   2206  N   GLU A 274      39.351  -1.587  12.458  1.00  0.82           N  
ATOM   2207  CA  GLU A 274      39.300  -0.702  13.602  1.00  0.82           C  
ATOM   2208  C   GLU A 274      39.339   0.765  13.209  1.00  0.82           C  
ATOM   2209  O   GLU A 274      39.226   1.665  14.039  1.00  0.82           O  
ATOM   2210  CB  GLU A 274      40.491  -0.975  14.546  1.00  0.82           C  
ATOM   2211  CG  GLU A 274      40.725  -2.479  14.814  1.00  0.82           C  
ATOM   2212  CD  GLU A 274      41.639  -2.714  16.009  1.00  0.82           C  
ATOM   2213  OE1 GLU A 274      42.568  -1.899  16.229  1.00  0.82           O  
ATOM   2214  OE2 GLU A 274      41.382  -3.720  16.725  1.00  0.82           O  
ATOM   2215  N   ASN A 275      39.408   1.066  11.892  1.00  0.83           N  
ATOM   2216  CA  ASN A 275      39.441   2.428  11.387  1.00  0.83           C  
ATOM   2217  C   ASN A 275      38.134   3.183  11.581  1.00  0.83           C  
ATOM   2218  O   ASN A 275      38.086   4.406  11.477  1.00  0.83           O  
ATOM   2219  CB  ASN A 275      39.864   2.483   9.900  1.00  0.83           C  
ATOM   2220  CG  ASN A 275      41.366   2.253   9.750  1.00  0.83           C  
ATOM   2221  OD1 ASN A 275      42.172   2.473  10.657  1.00  0.83           O  
ATOM   2222  ND2 ASN A 275      41.781   1.842   8.531  1.00  0.83           N  
ATOM   2223  N   ILE A 276      37.048   2.471  11.929  1.00  0.88           N  
ATOM   2224  CA  ILE A 276      35.763   3.053  12.280  1.00  0.88           C  
ATOM   2225  C   ILE A 276      35.840   3.981  13.489  1.00  0.88           C  
ATOM   2226  O   ILE A 276      35.298   5.082  13.478  1.00  0.88           O  
ATOM   2227  CB  ILE A 276      34.731   1.945  12.478  1.00  0.88           C  
ATOM   2228  CG1 ILE A 276      34.497   1.235  11.122  1.00  0.88           C  
ATOM   2229  CG2 ILE A 276      33.409   2.504  13.051  1.00  0.88           C  
ATOM   2230  CD1 ILE A 276      33.624  -0.018  11.213  1.00  0.88           C  
ATOM   2231  N   SER A 277      36.567   3.608  14.556  1.00  0.90           N  
ATOM   2232  CA  SER A 277      36.696   4.462  15.735  1.00  0.90           C  
ATOM   2233  C   SER A 277      38.025   5.188  15.802  1.00  0.90           C  
ATOM   2234  O   SER A 277      38.434   5.668  16.854  1.00  0.90           O  
ATOM   2235  CB  SER A 277      36.488   3.697  17.065  1.00  0.90           C  
ATOM   2236  OG  SER A 277      37.366   2.580  17.194  1.00  0.90           O  
ATOM   2237  N   ARG A 278      38.762   5.307  14.684  1.00  0.82           N  
ATOM   2238  CA  ARG A 278      40.024   6.030  14.674  1.00  0.82           C  
ATOM   2239  C   ARG A 278      39.916   7.528  14.875  1.00  0.82           C  
ATOM   2240  O   ARG A 278      40.665   8.093  15.662  1.00  0.82           O  
ATOM   2241  CB  ARG A 278      40.772   5.809  13.339  1.00  0.82           C  
ATOM   2242  CG  ARG A 278      41.616   4.528  13.323  1.00  0.82           C  
ATOM   2243  CD  ARG A 278      43.004   4.691  13.945  1.00  0.82           C  
ATOM   2244  NE  ARG A 278      43.338   3.496  14.771  1.00  0.82           N  
ATOM   2245  CZ  ARG A 278      43.467   2.216  14.398  1.00  0.82           C  
ATOM   2246  NH1 ARG A 278      43.288   1.762  13.162  1.00  0.82           N  
ATOM   2247  NH2 ARG A 278      43.792   1.344  15.349  1.00  0.82           N  
ATOM   2248  N   VAL A 279      39.007   8.229  14.182  1.00  0.87           N  
ATOM   2249  CA  VAL A 279      39.054   9.682  14.191  1.00  0.87           C  
ATOM   2250  C   VAL A 279      37.691  10.320  14.119  1.00  0.87           C  
ATOM   2251  O   VAL A 279      36.803   9.909  13.370  1.00  0.87           O  
ATOM   2252  CB  VAL A 279      39.974  10.236  13.105  1.00  0.87           C  
ATOM   2253  CG1 VAL A 279      39.552   9.786  11.696  1.00  0.87           C  
ATOM   2254  CG2 VAL A 279      40.080  11.771  13.197  1.00  0.87           C  
ATOM   2255  N   LEU A 280      37.489  11.372  14.932  1.00  0.89           N  
ATOM   2256  CA  LEU A 280      36.342  12.241  14.848  1.00  0.89           C  
ATOM   2257  C   LEU A 280      36.299  13.015  13.540  1.00  0.89           C  
ATOM   2258  O   LEU A 280      37.262  13.669  13.139  1.00  0.89           O  
ATOM   2259  CB  LEU A 280      36.391  13.226  16.035  1.00  0.89           C  
ATOM   2260  CG  LEU A 280      35.358  14.367  16.028  1.00  0.89           C  
ATOM   2261  CD1 LEU A 280      33.911  13.865  16.105  1.00  0.89           C  
ATOM   2262  CD2 LEU A 280      35.648  15.310  17.195  1.00  0.89           C  
ATOM   2263  N   TYR A 281      35.153  12.997  12.833  1.00  0.86           N  
ATOM   2264  CA  TYR A 281      34.967  13.860  11.686  1.00  0.86           C  
ATOM   2265  C   TYR A 281      34.935  15.338  12.103  1.00  0.86           C  
ATOM   2266  O   TYR A 281      34.080  15.709  12.908  1.00  0.86           O  
ATOM   2267  CB  TYR A 281      33.666  13.515  10.920  1.00  0.86           C  
ATOM   2268  CG  TYR A 281      33.964  12.508   9.844  1.00  0.86           C  
ATOM   2269  CD1 TYR A 281      34.112  11.140  10.126  1.00  0.86           C  
ATOM   2270  CD2 TYR A 281      34.151  12.952   8.527  1.00  0.86           C  
ATOM   2271  CE1 TYR A 281      34.435  10.232   9.105  1.00  0.86           C  
ATOM   2272  CE2 TYR A 281      34.474  12.052   7.505  1.00  0.86           C  
ATOM   2273  CZ  TYR A 281      34.619  10.693   7.796  1.00  0.86           C  
ATOM   2274  OH  TYR A 281      34.969   9.804   6.765  1.00  0.86           O  
ATOM   2275  N   PRO A 282      35.803  16.217  11.610  1.00  0.89           N  
ATOM   2276  CA  PRO A 282      36.016  17.551  12.180  1.00  0.89           C  
ATOM   2277  C   PRO A 282      35.027  18.570  11.649  1.00  0.89           C  
ATOM   2278  O   PRO A 282      35.351  19.759  11.554  1.00  0.89           O  
ATOM   2279  CB  PRO A 282      37.435  17.877  11.694  1.00  0.89           C  
ATOM   2280  CG  PRO A 282      37.511  17.191  10.332  1.00  0.89           C  
ATOM   2281  CD  PRO A 282      36.808  15.879  10.603  1.00  0.89           C  
ATOM   2282  N   ASN A 283      33.797  18.149  11.346  1.00  0.85           N  
ATOM   2283  CA  ASN A 283      32.780  19.003  10.789  1.00  0.85           C  
ATOM   2284  C   ASN A 283      31.862  19.550  11.870  1.00  0.85           C  
ATOM   2285  O   ASN A 283      31.264  18.815  12.648  1.00  0.85           O  
ATOM   2286  CB  ASN A 283      31.944  18.234   9.745  1.00  0.85           C  
ATOM   2287  CG  ASN A 283      32.846  17.813   8.589  1.00  0.85           C  
ATOM   2288  OD1 ASN A 283      33.615  18.616   8.062  1.00  0.85           O  
ATOM   2289  ND2 ASN A 283      32.740  16.524   8.195  1.00  0.85           N  
ATOM   2290  N   ASP A 284      31.706  20.882  11.917  1.00  0.84           N  
ATOM   2291  CA  ASP A 284      30.828  21.552  12.852  1.00  0.84           C  
ATOM   2292  C   ASP A 284      29.761  22.190  12.000  1.00  0.84           C  
ATOM   2293  O   ASP A 284      30.086  22.918  11.065  1.00  0.84           O  
ATOM   2294  CB  ASP A 284      31.621  22.630  13.633  1.00  0.84           C  
ATOM   2295  CG  ASP A 284      30.781  23.342  14.676  1.00  0.84           C  
ATOM   2296  OD1 ASP A 284      30.706  22.864  15.834  1.00  0.84           O  
ATOM   2297  OD2 ASP A 284      30.213  24.407  14.319  1.00  0.84           O  
ATOM   2298  N   ASN A 285      28.469  21.891  12.263  1.00  0.79           N  
ATOM   2299  CA  ASN A 285      27.346  22.419  11.495  1.00  0.79           C  
ATOM   2300  C   ASN A 285      27.465  22.177   9.990  1.00  0.79           C  
ATOM   2301  O   ASN A 285      27.128  23.029   9.172  1.00  0.79           O  
ATOM   2302  CB  ASN A 285      27.142  23.931  11.767  1.00  0.79           C  
ATOM   2303  CG  ASN A 285      26.598  24.144  13.165  1.00  0.79           C  
ATOM   2304  OD1 ASN A 285      25.386  24.080  13.369  1.00  0.79           O  
ATOM   2305  ND2 ASN A 285      27.473  24.437  14.153  1.00  0.79           N  
ATOM   2306  N   PHE A 286      27.956  20.993   9.595  1.00  0.81           N  
ATOM   2307  CA  PHE A 286      28.135  20.674   8.198  1.00  0.81           C  
ATOM   2308  C   PHE A 286      27.976  19.180   8.001  1.00  0.81           C  
ATOM   2309  O   PHE A 286      28.571  18.374   8.717  1.00  0.81           O  
ATOM   2310  CB  PHE A 286      29.530  21.154   7.709  1.00  0.81           C  
ATOM   2311  CG  PHE A 286      29.702  20.963   6.230  1.00  0.81           C  
ATOM   2312  CD1 PHE A 286      29.007  21.786   5.332  1.00  0.81           C  
ATOM   2313  CD2 PHE A 286      30.525  19.941   5.729  1.00  0.81           C  
ATOM   2314  CE1 PHE A 286      29.112  21.579   3.951  1.00  0.81           C  
ATOM   2315  CE2 PHE A 286      30.630  19.727   4.349  1.00  0.81           C  
ATOM   2316  CZ  PHE A 286      29.918  20.542   3.460  1.00  0.81           C  
ATOM   2317  N   PHE A 287      27.175  18.777   7.002  1.00  0.83           N  
ATOM   2318  CA  PHE A 287      26.966  17.394   6.650  1.00  0.83           C  
ATOM   2319  C   PHE A 287      27.937  16.987   5.552  1.00  0.83           C  
ATOM   2320  O   PHE A 287      27.880  17.456   4.416  1.00  0.83           O  
ATOM   2321  CB  PHE A 287      25.492  17.164   6.199  1.00  0.83           C  
ATOM   2322  CG  PHE A 287      25.220  15.771   5.686  1.00  0.83           C  
ATOM   2323  CD1 PHE A 287      25.472  14.651   6.489  1.00  0.83           C  
ATOM   2324  CD2 PHE A 287      24.725  15.576   4.385  1.00  0.83           C  
ATOM   2325  CE1 PHE A 287      25.224  13.361   6.011  1.00  0.83           C  
ATOM   2326  CE2 PHE A 287      24.484  14.285   3.897  1.00  0.83           C  
ATOM   2327  CZ  PHE A 287      24.731  13.174   4.714  1.00  0.83           C  
ATOM   2328  N   GLU A 288      28.833  16.039   5.869  1.00  0.78           N  
ATOM   2329  CA  GLU A 288      29.725  15.459   4.894  1.00  0.78           C  
ATOM   2330  C   GLU A 288      29.334  14.009   4.732  1.00  0.78           C  
ATOM   2331  O   GLU A 288      29.436  13.192   5.648  1.00  0.78           O  
ATOM   2332  CB  GLU A 288      31.197  15.553   5.334  1.00  0.78           C  
ATOM   2333  CG  GLU A 288      32.227  15.059   4.290  1.00  0.78           C  
ATOM   2334  CD  GLU A 288      33.599  14.831   4.919  1.00  0.78           C  
ATOM   2335  OE1 GLU A 288      33.790  15.178   6.105  1.00  0.78           O  
ATOM   2336  OE2 GLU A 288      34.478  14.256   4.213  1.00  0.78           O  
ATOM   2337  N   GLY A 289      28.848  13.640   3.534  1.00  0.87           N  
ATOM   2338  CA  GLY A 289      28.211  12.346   3.321  1.00  0.87           C  
ATOM   2339  C   GLY A 289      29.148  11.213   3.029  1.00  0.87           C  
ATOM   2340  O   GLY A 289      29.033  10.546   2.005  1.00  0.87           O  
ATOM   2341  N   LYS A 290      30.103  10.939   3.928  1.00  0.84           N  
ATOM   2342  CA  LYS A 290      31.030   9.842   3.750  1.00  0.84           C  
ATOM   2343  C   LYS A 290      30.549   8.549   4.387  1.00  0.84           C  
ATOM   2344  O   LYS A 290      30.008   8.529   5.489  1.00  0.84           O  
ATOM   2345  CB  LYS A 290      32.433  10.180   4.314  1.00  0.84           C  
ATOM   2346  CG  LYS A 290      33.114  11.414   3.700  1.00  0.84           C  
ATOM   2347  CD  LYS A 290      33.206  11.391   2.166  1.00  0.84           C  
ATOM   2348  CE  LYS A 290      33.761  12.677   1.528  1.00  0.84           C  
ATOM   2349  NZ  LYS A 290      35.125  12.999   2.001  1.00  0.84           N  
ATOM   2350  N   GLU A 291      30.794   7.401   3.716  1.00  0.86           N  
ATOM   2351  CA  GLU A 291      30.450   6.079   4.222  1.00  0.86           C  
ATOM   2352  C   GLU A 291      31.090   5.765   5.566  1.00  0.86           C  
ATOM   2353  O   GLU A 291      30.468   5.183   6.448  1.00  0.86           O  
ATOM   2354  CB  GLU A 291      30.864   4.969   3.226  1.00  0.86           C  
ATOM   2355  CG  GLU A 291      30.347   3.559   3.621  1.00  0.86           C  
ATOM   2356  CD  GLU A 291      31.063   2.424   2.889  1.00  0.86           C  
ATOM   2357  OE1 GLU A 291      32.270   2.196   3.196  1.00  0.86           O  
ATOM   2358  OE2 GLU A 291      30.404   1.723   2.084  1.00  0.86           O  
ATOM   2359  N   LEU A 292      32.354   6.184   5.791  1.00  0.89           N  
ATOM   2360  CA  LEU A 292      33.026   5.972   7.061  1.00  0.89           C  
ATOM   2361  C   LEU A 292      32.301   6.634   8.227  1.00  0.89           C  
ATOM   2362  O   LEU A 292      32.049   5.996   9.242  1.00  0.89           O  
ATOM   2363  CB  LEU A 292      34.483   6.494   7.021  1.00  0.89           C  
ATOM   2364  CG  LEU A 292      35.542   5.672   7.791  1.00  0.89           C  
ATOM   2365  CD1 LEU A 292      36.690   6.598   8.217  1.00  0.89           C  
ATOM   2366  CD2 LEU A 292      35.031   4.923   9.028  1.00  0.89           C  
ATOM   2367  N   ARG A 293      31.856   7.900   8.064  1.00  0.86           N  
ATOM   2368  CA  ARG A 293      31.027   8.597   9.034  1.00  0.86           C  
ATOM   2369  C   ARG A 293      29.720   7.870   9.299  1.00  0.86           C  
ATOM   2370  O   ARG A 293      29.326   7.676  10.444  1.00  0.86           O  
ATOM   2371  CB  ARG A 293      30.705  10.028   8.537  1.00  0.86           C  
ATOM   2372  CG  ARG A 293      29.693  10.806   9.406  1.00  0.86           C  
ATOM   2373  CD  ARG A 293      30.133  10.974  10.863  1.00  0.86           C  
ATOM   2374  NE  ARG A 293      29.045  11.738  11.516  1.00  0.86           N  
ATOM   2375  CZ  ARG A 293      29.141  12.454  12.639  1.00  0.86           C  
ATOM   2376  NH1 ARG A 293      30.265  12.517  13.341  1.00  0.86           N  
ATOM   2377  NH2 ARG A 293      28.044  13.084  13.039  1.00  0.86           N  
ATOM   2378  N   LEU A 294      29.058   7.374   8.244  1.00  0.93           N  
ATOM   2379  CA  LEU A 294      27.866   6.559   8.380  1.00  0.93           C  
ATOM   2380  C   LEU A 294      28.095   5.250   9.136  1.00  0.93           C  
ATOM   2381  O   LEU A 294      27.302   4.832   9.981  1.00  0.93           O  
ATOM   2382  CB  LEU A 294      27.301   6.250   6.981  1.00  0.93           C  
ATOM   2383  CG  LEU A 294      25.972   5.488   6.991  1.00  0.93           C  
ATOM   2384  CD1 LEU A 294      24.872   6.255   7.723  1.00  0.93           C  
ATOM   2385  CD2 LEU A 294      25.534   5.189   5.555  1.00  0.93           C  
ATOM   2386  N   LYS A 295      29.232   4.566   8.890  1.00  0.92           N  
ATOM   2387  CA  LYS A 295      29.630   3.409   9.667  1.00  0.92           C  
ATOM   2388  C   LYS A 295      29.830   3.720  11.127  1.00  0.92           C  
ATOM   2389  O   LYS A 295      29.438   2.925  11.973  1.00  0.92           O  
ATOM   2390  CB  LYS A 295      30.939   2.765   9.173  1.00  0.92           C  
ATOM   2391  CG  LYS A 295      30.800   2.101   7.811  1.00  0.92           C  
ATOM   2392  CD  LYS A 295      32.110   1.435   7.374  1.00  0.92           C  
ATOM   2393  CE  LYS A 295      31.949   0.919   5.954  1.00  0.92           C  
ATOM   2394  NZ  LYS A 295      33.219   0.523   5.323  1.00  0.92           N  
ATOM   2395  N   GLN A 296      30.412   4.890  11.465  1.00  0.93           N  
ATOM   2396  CA  GLN A 296      30.547   5.340  12.838  1.00  0.93           C  
ATOM   2397  C   GLN A 296      29.206   5.470  13.534  1.00  0.93           C  
ATOM   2398  O   GLN A 296      29.016   4.972  14.642  1.00  0.93           O  
ATOM   2399  CB  GLN A 296      31.246   6.724  12.912  1.00  0.93           C  
ATOM   2400  CG  GLN A 296      32.687   6.715  12.375  1.00  0.93           C  
ATOM   2401  CD  GLN A 296      33.424   8.031  12.627  1.00  0.93           C  
ATOM   2402  OE1 GLN A 296      32.869   9.128  12.533  1.00  0.93           O  
ATOM   2403  NE2 GLN A 296      34.737   7.907  12.928  1.00  0.93           N  
ATOM   2404  N   GLU A 297      28.225   6.090  12.863  1.00  0.95           N  
ATOM   2405  CA  GLU A 297      26.879   6.273  13.356  1.00  0.95           C  
ATOM   2406  C   GLU A 297      26.130   4.975  13.564  1.00  0.95           C  
ATOM   2407  O   GLU A 297      25.533   4.748  14.614  1.00  0.95           O  
ATOM   2408  CB  GLU A 297      26.146   7.230  12.409  1.00  0.95           C  
ATOM   2409  CG  GLU A 297      26.838   8.609  12.439  1.00  0.95           C  
ATOM   2410  CD  GLU A 297      26.258   9.589  11.441  1.00  0.95           C  
ATOM   2411  OE1 GLU A 297      25.561   9.163  10.490  1.00  0.95           O  
ATOM   2412  OE2 GLU A 297      26.615  10.786  11.617  1.00  0.95           O  
ATOM   2413  N   TYR A 298      26.202   4.024  12.617  1.00  0.96           N  
ATOM   2414  CA  TYR A 298      25.651   2.704  12.857  1.00  0.96           C  
ATOM   2415  C   TYR A 298      26.378   1.929  13.960  1.00  0.96           C  
ATOM   2416  O   TYR A 298      25.751   1.274  14.790  1.00  0.96           O  
ATOM   2417  CB  TYR A 298      25.581   1.887  11.547  1.00  0.96           C  
ATOM   2418  CG  TYR A 298      24.819   0.615  11.788  1.00  0.96           C  
ATOM   2419  CD1 TYR A 298      23.471   0.662  12.177  1.00  0.96           C  
ATOM   2420  CD2 TYR A 298      25.482  -0.621  11.769  1.00  0.96           C  
ATOM   2421  CE1 TYR A 298      22.804  -0.511  12.551  1.00  0.96           C  
ATOM   2422  CE2 TYR A 298      24.810  -1.791  12.137  1.00  0.96           C  
ATOM   2423  CZ  TYR A 298      23.469  -1.738  12.514  1.00  0.96           C  
ATOM   2424  OH  TYR A 298      22.809  -2.922  12.883  1.00  0.96           O  
ATOM   2425  N   PHE A 299      27.720   2.016  14.013  1.00  0.95           N  
ATOM   2426  CA  PHE A 299      28.549   1.350  14.999  1.00  0.95           C  
ATOM   2427  C   PHE A 299      28.194   1.725  16.431  1.00  0.95           C  
ATOM   2428  O   PHE A 299      27.968   0.856  17.274  1.00  0.95           O  
ATOM   2429  CB  PHE A 299      30.028   1.695  14.671  1.00  0.95           C  
ATOM   2430  CG  PHE A 299      31.019   1.131  15.637  1.00  0.95           C  
ATOM   2431  CD1 PHE A 299      31.387  -0.220  15.575  1.00  0.95           C  
ATOM   2432  CD2 PHE A 299      31.574   1.959  16.625  1.00  0.95           C  
ATOM   2433  CE1 PHE A 299      32.278  -0.747  16.515  1.00  0.95           C  
ATOM   2434  CE2 PHE A 299      32.462   1.435  17.568  1.00  0.95           C  
ATOM   2435  CZ  PHE A 299      32.797   0.079  17.520  1.00  0.95           C  
ATOM   2436  N   VAL A 300      28.067   3.034  16.727  1.00  0.97           N  
ATOM   2437  CA  VAL A 300      27.621   3.481  18.036  1.00  0.97           C  
ATOM   2438  C   VAL A 300      26.192   3.067  18.333  1.00  0.97           C  
ATOM   2439  O   VAL A 300      25.877   2.617  19.430  1.00  0.97           O  
ATOM   2440  CB  VAL A 300      27.817   4.981  18.237  1.00  0.97           C  
ATOM   2441  CG1 VAL A 300      27.064   5.816  17.192  1.00  0.97           C  
ATOM   2442  CG2 VAL A 300      27.381   5.420  19.645  1.00  0.97           C  
ATOM   2443  N   VAL A 301      25.275   3.177  17.358  1.00  0.98           N  
ATOM   2444  CA  VAL A 301      23.886   2.804  17.539  1.00  0.98           C  
ATOM   2445  C   VAL A 301      23.664   1.324  17.829  1.00  0.98           C  
ATOM   2446  O   VAL A 301      22.997   0.969  18.800  1.00  0.98           O  
ATOM   2447  CB  VAL A 301      23.103   3.238  16.307  1.00  0.98           C  
ATOM   2448  CG1 VAL A 301      21.748   2.526  16.208  1.00  0.98           C  
ATOM   2449  CG2 VAL A 301      22.898   4.764  16.370  1.00  0.98           C  
ATOM   2450  N   ALA A 302      24.245   0.415  17.026  1.00  0.98           N  
ATOM   2451  CA  ALA A 302      24.046  -1.011  17.182  1.00  0.98           C  
ATOM   2452  C   ALA A 302      24.608  -1.568  18.476  1.00  0.98           C  
ATOM   2453  O   ALA A 302      23.970  -2.347  19.180  1.00  0.98           O  
ATOM   2454  CB  ALA A 302      24.697  -1.730  15.994  1.00  0.98           C  
ATOM   2455  N   ALA A 303      25.830  -1.156  18.851  1.00  0.97           N  
ATOM   2456  CA  ALA A 303      26.433  -1.548  20.105  1.00  0.97           C  
ATOM   2457  C   ALA A 303      25.687  -1.024  21.330  1.00  0.97           C  
ATOM   2458  O   ALA A 303      25.396  -1.756  22.277  1.00  0.97           O  
ATOM   2459  CB  ALA A 303      27.884  -1.058  20.092  1.00  0.97           C  
ATOM   2460  N   THR A 304      25.299   0.266  21.305  1.00  0.97           N  
ATOM   2461  CA  THR A 304      24.540   0.906  22.370  1.00  0.97           C  
ATOM   2462  C   THR A 304      23.191   0.281  22.605  1.00  0.97           C  
ATOM   2463  O   THR A 304      22.847  -0.048  23.734  1.00  0.97           O  
ATOM   2464  CB  THR A 304      24.322   2.375  22.063  1.00  0.97           C  
ATOM   2465  OG1 THR A 304      25.564   3.057  22.128  1.00  0.97           O  
ATOM   2466  CG2 THR A 304      23.409   3.063  23.077  1.00  0.97           C  
ATOM   2467  N   LEU A 305      22.390   0.046  21.550  1.00  0.96           N  
ATOM   2468  CA  LEU A 305      21.064  -0.533  21.693  1.00  0.96           C  
ATOM   2469  C   LEU A 305      21.090  -1.969  22.206  1.00  0.96           C  
ATOM   2470  O   LEU A 305      20.280  -2.338  23.056  1.00  0.96           O  
ATOM   2471  CB  LEU A 305      20.244  -0.389  20.391  1.00  0.96           C  
ATOM   2472  CG  LEU A 305      19.464   0.944  20.266  1.00  0.96           C  
ATOM   2473  CD1 LEU A 305      20.321   2.212  20.398  1.00  0.96           C  
ATOM   2474  CD2 LEU A 305      18.720   0.975  18.930  1.00  0.96           C  
ATOM   2475  N   GLN A 306      22.065  -2.799  21.769  1.00  0.93           N  
ATOM   2476  CA  GLN A 306      22.291  -4.115  22.353  1.00  0.93           C  
ATOM   2477  C   GLN A 306      22.617  -4.061  23.858  1.00  0.93           C  
ATOM   2478  O   GLN A 306      22.032  -4.795  24.654  1.00  0.93           O  
ATOM   2479  CB  GLN A 306      23.450  -4.843  21.623  1.00  0.93           C  
ATOM   2480  CG  GLN A 306      23.157  -5.279  20.167  1.00  0.93           C  
ATOM   2481  CD  GLN A 306      24.391  -5.946  19.544  1.00  0.93           C  
ATOM   2482  OE1 GLN A 306      24.624  -7.145  19.691  1.00  0.93           O  
ATOM   2483  NE2 GLN A 306      25.212  -5.146  18.827  1.00  0.93           N  
ATOM   2484  N   ASP A 307      23.517  -3.149  24.303  1.00  0.94           N  
ATOM   2485  CA  ASP A 307      23.859  -2.948  25.711  1.00  0.94           C  
ATOM   2486  C   ASP A 307      22.669  -2.437  26.541  1.00  0.94           C  
ATOM   2487  O   ASP A 307      22.444  -2.886  27.667  1.00  0.94           O  
ATOM   2488  CB  ASP A 307      25.111  -2.017  25.801  1.00  0.94           C  
ATOM   2489  CG  ASP A 307      25.918  -2.063  27.092  1.00  0.94           C  
ATOM   2490  OD1 ASP A 307      26.383  -3.142  27.537  1.00  0.94           O  
ATOM   2491  OD2 ASP A 307      26.206  -0.981  27.667  1.00  0.94           O  
ATOM   2492  N   ILE A 308      21.844  -1.512  25.984  1.00  0.95           N  
ATOM   2493  CA  ILE A 308      20.607  -1.032  26.602  1.00  0.95           C  
ATOM   2494  C   ILE A 308      19.602  -2.148  26.841  1.00  0.95           C  
ATOM   2495  O   ILE A 308      19.093  -2.310  27.951  1.00  0.95           O  
ATOM   2496  CB  ILE A 308      19.916   0.055  25.760  1.00  0.95           C  
ATOM   2497  CG1 ILE A 308      20.768   1.343  25.714  1.00  0.95           C  
ATOM   2498  CG2 ILE A 308      18.506   0.386  26.309  1.00  0.95           C  
ATOM   2499  CD1 ILE A 308      20.196   2.443  24.810  1.00  0.95           C  
ATOM   2500  N   ILE A 309      19.314  -2.977  25.815  1.00  0.91           N  
ATOM   2501  CA  ILE A 309      18.388  -4.098  25.919  1.00  0.91           C  
ATOM   2502  C   ILE A 309      18.896  -5.176  26.856  1.00  0.91           C  
ATOM   2503  O   ILE A 309      18.154  -5.696  27.686  1.00  0.91           O  
ATOM   2504  CB  ILE A 309      18.047  -4.672  24.547  1.00  0.91           C  
ATOM   2505  CG1 ILE A 309      17.234  -3.624  23.749  1.00  0.91           C  
ATOM   2506  CG2 ILE A 309      17.261  -5.998  24.672  1.00  0.91           C  
ATOM   2507  CD1 ILE A 309      17.030  -3.995  22.280  1.00  0.91           C  
ATOM   2508  N   ARG A 310      20.199  -5.507  26.797  1.00  0.81           N  
ATOM   2509  CA  ARG A 310      20.816  -6.448  27.714  1.00  0.81           C  
ATOM   2510  C   ARG A 310      20.702  -6.008  29.169  1.00  0.81           C  
ATOM   2511  O   ARG A 310      20.327  -6.787  30.039  1.00  0.81           O  
ATOM   2512  CB  ARG A 310      22.313  -6.582  27.360  1.00  0.81           C  
ATOM   2513  CG  ARG A 310      23.094  -7.606  28.209  1.00  0.81           C  
ATOM   2514  CD  ARG A 310      24.512  -7.139  28.538  1.00  0.81           C  
ATOM   2515  NE  ARG A 310      24.372  -5.992  29.483  1.00  0.81           N  
ATOM   2516  CZ  ARG A 310      25.340  -5.096  29.696  1.00  0.81           C  
ATOM   2517  NH1 ARG A 310      26.570  -5.259  29.229  1.00  0.81           N  
ATOM   2518  NH2 ARG A 310      25.068  -3.988  30.378  1.00  0.81           N  
ATOM   2519  N   ARG A 311      20.988  -4.719  29.454  1.00  0.81           N  
ATOM   2520  CA  ARG A 311      20.811  -4.120  30.765  1.00  0.81           C  
ATOM   2521  C   ARG A 311      19.371  -4.069  31.232  1.00  0.81           C  
ATOM   2522  O   ARG A 311      19.083  -4.259  32.410  1.00  0.81           O  
ATOM   2523  CB  ARG A 311      21.414  -2.694  30.801  1.00  0.81           C  
ATOM   2524  CG  ARG A 311      21.373  -2.069  32.212  1.00  0.81           C  
ATOM   2525  CD  ARG A 311      22.182  -0.790  32.453  1.00  0.81           C  
ATOM   2526  NE  ARG A 311      23.617  -1.024  32.095  1.00  0.81           N  
ATOM   2527  CZ  ARG A 311      24.170  -0.575  30.958  1.00  0.81           C  
ATOM   2528  NH1 ARG A 311      23.447   0.009  30.010  1.00  0.81           N  
ATOM   2529  NH2 ARG A 311      25.475  -0.738  30.756  1.00  0.81           N  
ATOM   2530  N   PHE A 312      18.418  -3.806  30.317  1.00  0.84           N  
ATOM   2531  CA  PHE A 312      17.006  -3.875  30.625  1.00  0.84           C  
ATOM   2532  C   PHE A 312      16.610  -5.267  31.086  1.00  0.84           C  
ATOM   2533  O   PHE A 312      16.000  -5.389  32.143  1.00  0.84           O  
ATOM   2534  CB  PHE A 312      16.194  -3.450  29.370  1.00  0.84           C  
ATOM   2535  CG  PHE A 312      14.702  -3.606  29.500  1.00  0.84           C  
ATOM   2536  CD1 PHE A 312      13.937  -2.689  30.237  1.00  0.84           C  
ATOM   2537  CD2 PHE A 312      14.054  -4.662  28.834  1.00  0.84           C  
ATOM   2538  CE1 PHE A 312      12.542  -2.815  30.287  1.00  0.84           C  
ATOM   2539  CE2 PHE A 312      12.659  -4.780  28.870  1.00  0.84           C  
ATOM   2540  CZ  PHE A 312      11.901  -3.850  29.592  1.00  0.84           C  
ATOM   2541  N   LYS A 313      17.001  -6.324  30.340  1.00  0.76           N  
ATOM   2542  CA  LYS A 313      16.657  -7.704  30.640  1.00  0.76           C  
ATOM   2543  C   LYS A 313      17.207  -8.243  31.961  1.00  0.76           C  
ATOM   2544  O   LYS A 313      16.489  -8.906  32.712  1.00  0.76           O  
ATOM   2545  CB  LYS A 313      17.091  -8.668  29.498  1.00  0.76           C  
ATOM   2546  CG  LYS A 313      16.329  -8.485  28.172  1.00  0.76           C  
ATOM   2547  CD  LYS A 313      16.559  -9.633  27.165  1.00  0.76           C  
ATOM   2548  CE  LYS A 313      15.731  -9.439  25.883  1.00  0.76           C  
ATOM   2549  NZ  LYS A 313      15.836 -10.586  24.959  1.00  0.76           N  
ATOM   2550  N   SER A 314      18.486  -7.976  32.295  1.00  0.75           N  
ATOM   2551  CA  SER A 314      19.102  -8.421  33.546  1.00  0.75           C  
ATOM   2552  C   SER A 314      18.863  -7.472  34.706  1.00  0.75           C  
ATOM   2553  O   SER A 314      19.776  -6.914  35.309  1.00  0.75           O  
ATOM   2554  CB  SER A 314      20.619  -8.709  33.413  1.00  0.75           C  
ATOM   2555  OG  SER A 314      21.346  -7.605  32.860  1.00  0.75           O  
ATOM   2556  N   SER A 315      17.590  -7.259  35.062  1.00  0.73           N  
ATOM   2557  CA  SER A 315      17.196  -6.256  36.042  1.00  0.73           C  
ATOM   2558  C   SER A 315      17.357  -6.612  37.503  1.00  0.73           C  
ATOM   2559  O   SER A 315      17.437  -5.726  38.350  1.00  0.73           O  
ATOM   2560  CB  SER A 315      15.714  -5.853  35.851  1.00  0.73           C  
ATOM   2561  OG  SER A 315      14.825  -6.976  35.904  1.00  0.73           O  
ATOM   2562  N   LYS A 316      17.393  -7.905  37.862  1.00  0.57           N  
ATOM   2563  CA  LYS A 316      17.459  -8.315  39.252  1.00  0.57           C  
ATOM   2564  C   LYS A 316      18.812  -8.067  39.912  1.00  0.57           C  
ATOM   2565  O   LYS A 316      19.854  -8.509  39.439  1.00  0.57           O  
ATOM   2566  CB  LYS A 316      17.077  -9.811  39.402  1.00  0.57           C  
ATOM   2567  CG  LYS A 316      17.048 -10.311  40.859  1.00  0.57           C  
ATOM   2568  CD  LYS A 316      16.509 -11.743  41.015  1.00  0.57           C  
ATOM   2569  CE  LYS A 316      16.490 -12.179  42.485  1.00  0.57           C  
ATOM   2570  NZ  LYS A 316      15.925 -13.541  42.630  1.00  0.57           N  
ATOM   2571  N   PHE A 317      18.834  -7.386  41.078  1.00  0.54           N  
ATOM   2572  CA  PHE A 317      20.050  -7.202  41.856  1.00  0.54           C  
ATOM   2573  C   PHE A 317      20.741  -8.518  42.228  1.00  0.54           C  
ATOM   2574  O   PHE A 317      20.137  -9.457  42.750  1.00  0.54           O  
ATOM   2575  CB  PHE A 317      19.760  -6.357  43.132  1.00  0.54           C  
ATOM   2576  CG  PHE A 317      21.009  -5.991  43.903  1.00  0.54           C  
ATOM   2577  CD1 PHE A 317      21.615  -6.917  44.773  1.00  0.54           C  
ATOM   2578  CD2 PHE A 317      21.581  -4.719  43.775  1.00  0.54           C  
ATOM   2579  CE1 PHE A 317      22.790  -6.594  45.461  1.00  0.54           C  
ATOM   2580  CE2 PHE A 317      22.741  -4.381  44.479  1.00  0.54           C  
ATOM   2581  CZ  PHE A 317      23.356  -5.322  45.313  1.00  0.54           C  
ATOM   2582  N   GLY A 318      22.060  -8.596  41.954  1.00  0.66           N  
ATOM   2583  CA  GLY A 318      22.890  -9.745  42.292  1.00  0.66           C  
ATOM   2584  C   GLY A 318      22.754 -10.910  41.364  1.00  0.66           C  
ATOM   2585  O   GLY A 318      23.379 -11.945  41.569  1.00  0.66           O  
ATOM   2586  N   CYS A 319      21.939 -10.768  40.317  1.00  0.67           N  
ATOM   2587  CA  CYS A 319      21.653 -11.828  39.388  1.00  0.67           C  
ATOM   2588  C   CYS A 319      21.843 -11.294  37.989  1.00  0.67           C  
ATOM   2589  O   CYS A 319      21.424 -10.191  37.664  1.00  0.67           O  
ATOM   2590  CB  CYS A 319      20.201 -12.307  39.601  1.00  0.67           C  
ATOM   2591  SG  CYS A 319      19.662 -13.571  38.415  1.00  0.67           S  
ATOM   2592  N   ARG A 320      22.496 -12.063  37.103  1.00  0.55           N  
ATOM   2593  CA  ARG A 320      22.724 -11.587  35.752  1.00  0.55           C  
ATOM   2594  C   ARG A 320      21.875 -12.295  34.727  1.00  0.55           C  
ATOM   2595  O   ARG A 320      22.020 -12.053  33.528  1.00  0.55           O  
ATOM   2596  CB  ARG A 320      24.209 -11.717  35.368  1.00  0.55           C  
ATOM   2597  CG  ARG A 320      25.100 -10.733  36.145  1.00  0.55           C  
ATOM   2598  CD  ARG A 320      26.509 -10.605  35.572  1.00  0.55           C  
ATOM   2599  NE  ARG A 320      27.165 -11.939  35.697  1.00  0.55           N  
ATOM   2600  CZ  ARG A 320      28.351 -12.253  35.163  1.00  0.55           C  
ATOM   2601  NH1 ARG A 320      29.028 -11.405  34.398  1.00  0.55           N  
ATOM   2602  NH2 ARG A 320      28.856 -13.462  35.393  1.00  0.55           N  
ATOM   2603  N   ASP A 321      20.948 -13.161  35.170  1.00  0.58           N  
ATOM   2604  CA  ASP A 321      20.026 -13.841  34.295  1.00  0.58           C  
ATOM   2605  C   ASP A 321      19.089 -12.873  33.560  1.00  0.58           C  
ATOM   2606  O   ASP A 321      18.667 -11.868  34.146  1.00  0.58           O  
ATOM   2607  CB  ASP A 321      19.174 -14.893  35.038  1.00  0.58           C  
ATOM   2608  CG  ASP A 321      20.043 -15.934  35.722  1.00  0.58           C  
ATOM   2609  OD1 ASP A 321      21.099 -16.300  35.150  1.00  0.58           O  
ATOM   2610  OD2 ASP A 321      19.642 -16.367  36.832  1.00  0.58           O  
ATOM   2611  N   PRO A 322      18.707 -13.107  32.303  1.00  0.62           N  
ATOM   2612  CA  PRO A 322      17.775 -12.223  31.609  1.00  0.62           C  
ATOM   2613  C   PRO A 322      16.342 -12.474  32.060  1.00  0.62           C  
ATOM   2614  O   PRO A 322      15.532 -13.018  31.311  1.00  0.62           O  
ATOM   2615  CB  PRO A 322      17.999 -12.560  30.119  1.00  0.62           C  
ATOM   2616  CG  PRO A 322      19.411 -13.143  30.070  1.00  0.62           C  
ATOM   2617  CD  PRO A 322      19.474 -13.932  31.367  1.00  0.62           C  
ATOM   2618  N   VAL A 323      16.019 -12.092  33.304  1.00  0.64           N  
ATOM   2619  CA  VAL A 323      14.749 -12.346  33.962  1.00  0.64           C  
ATOM   2620  C   VAL A 323      13.577 -11.617  33.338  1.00  0.64           C  
ATOM   2621  O   VAL A 323      12.449 -12.104  33.305  1.00  0.64           O  
ATOM   2622  CB  VAL A 323      14.794 -12.063  35.464  1.00  0.64           C  
ATOM   2623  CG1 VAL A 323      15.835 -13.000  36.100  1.00  0.64           C  
ATOM   2624  CG2 VAL A 323      15.137 -10.592  35.775  1.00  0.64           C  
ATOM   2625  N   ARG A 324      13.817 -10.397  32.837  1.00  0.54           N  
ATOM   2626  CA  ARG A 324      12.803  -9.550  32.265  1.00  0.54           C  
ATOM   2627  C   ARG A 324      12.805  -9.664  30.752  1.00  0.54           C  
ATOM   2628  O   ARG A 324      13.519  -8.970  30.033  1.00  0.54           O  
ATOM   2629  CB  ARG A 324      13.102  -8.117  32.727  1.00  0.54           C  
ATOM   2630  CG  ARG A 324      12.220  -6.989  32.168  1.00  0.54           C  
ATOM   2631  CD  ARG A 324      12.943  -5.665  32.394  1.00  0.54           C  
ATOM   2632  NE  ARG A 324      12.353  -4.944  33.546  1.00  0.54           N  
ATOM   2633  CZ  ARG A 324      12.969  -3.929  34.166  1.00  0.54           C  
ATOM   2634  NH1 ARG A 324      14.200  -3.526  33.876  1.00  0.54           N  
ATOM   2635  NH2 ARG A 324      12.329  -3.327  35.159  1.00  0.54           N  
ATOM   2636  N   THR A 325      11.964 -10.561  30.223  1.00  0.67           N  
ATOM   2637  CA  THR A 325      11.879 -10.834  28.793  1.00  0.67           C  
ATOM   2638  C   THR A 325      10.722 -10.111  28.143  1.00  0.67           C  
ATOM   2639  O   THR A 325      10.625 -10.022  26.922  1.00  0.67           O  
ATOM   2640  CB  THR A 325      11.697 -12.326  28.543  1.00  0.67           C  
ATOM   2641  OG1 THR A 325      10.668 -12.852  29.375  1.00  0.67           O  
ATOM   2642  CG2 THR A 325      12.998 -13.050  28.918  1.00  0.67           C  
ATOM   2643  N   CYS A 326       9.826  -9.517  28.949  1.00  0.70           N  
ATOM   2644  CA  CYS A 326       8.701  -8.763  28.446  1.00  0.70           C  
ATOM   2645  C   CYS A 326       9.046  -7.293  28.255  1.00  0.70           C  
ATOM   2646  O   CYS A 326       9.547  -6.614  29.149  1.00  0.70           O  
ATOM   2647  CB  CYS A 326       7.474  -8.895  29.380  1.00  0.70           C  
ATOM   2648  SG  CYS A 326       5.957  -8.161  28.648  1.00  0.70           S  
ATOM   2649  N   PHE A 327       8.735  -6.752  27.064  1.00  0.80           N  
ATOM   2650  CA  PHE A 327       9.073  -5.391  26.692  1.00  0.80           C  
ATOM   2651  C   PHE A 327       7.970  -4.385  26.964  1.00  0.80           C  
ATOM   2652  O   PHE A 327       8.058  -3.242  26.523  1.00  0.80           O  
ATOM   2653  CB  PHE A 327       9.385  -5.313  25.176  1.00  0.80           C  
ATOM   2654  CG  PHE A 327      10.781  -5.774  24.892  1.00  0.80           C  
ATOM   2655  CD1 PHE A 327      11.842  -4.855  24.940  1.00  0.80           C  
ATOM   2656  CD2 PHE A 327      11.048  -7.104  24.539  1.00  0.80           C  
ATOM   2657  CE1 PHE A 327      13.152  -5.255  24.649  1.00  0.80           C  
ATOM   2658  CE2 PHE A 327      12.355  -7.510  24.251  1.00  0.80           C  
ATOM   2659  CZ  PHE A 327      13.408  -6.587  24.302  1.00  0.80           C  
ATOM   2660  N   GLU A 328       6.911  -4.743  27.715  1.00  0.75           N  
ATOM   2661  CA  GLU A 328       5.826  -3.821  28.037  1.00  0.75           C  
ATOM   2662  C   GLU A 328       6.302  -2.591  28.789  1.00  0.75           C  
ATOM   2663  O   GLU A 328       5.949  -1.459  28.478  1.00  0.75           O  
ATOM   2664  CB  GLU A 328       4.760  -4.554  28.877  1.00  0.75           C  
ATOM   2665  CG  GLU A 328       3.514  -3.708  29.247  1.00  0.75           C  
ATOM   2666  CD  GLU A 328       2.471  -4.523  30.010  1.00  0.75           C  
ATOM   2667  OE1 GLU A 328       1.421  -3.928  30.355  1.00  0.75           O  
ATOM   2668  OE2 GLU A 328       2.712  -5.740  30.228  1.00  0.75           O  
ATOM   2669  N   THR A 329       7.220  -2.799  29.745  1.00  0.80           N  
ATOM   2670  CA  THR A 329       7.758  -1.736  30.572  1.00  0.80           C  
ATOM   2671  C   THR A 329       9.023  -1.124  30.006  1.00  0.80           C  
ATOM   2672  O   THR A 329       9.685  -0.334  30.673  1.00  0.80           O  
ATOM   2673  CB  THR A 329       8.073  -2.228  31.980  1.00  0.80           C  
ATOM   2674  OG1 THR A 329       8.956  -3.347  31.973  1.00  0.80           O  
ATOM   2675  CG2 THR A 329       6.783  -2.696  32.670  1.00  0.80           C  
ATOM   2676  N   PHE A 330       9.400  -1.429  28.746  1.00  0.89           N  
ATOM   2677  CA  PHE A 330      10.584  -0.846  28.120  1.00  0.89           C  
ATOM   2678  C   PHE A 330      10.546   0.681  28.009  1.00  0.89           C  
ATOM   2679  O   PHE A 330      11.544   1.298  28.388  1.00  0.89           O  
ATOM   2680  CB  PHE A 330      10.892  -1.531  26.755  1.00  0.89           C  
ATOM   2681  CG  PHE A 330      12.254  -1.195  26.189  1.00  0.89           C  
ATOM   2682  CD1 PHE A 330      13.368  -1.970  26.536  1.00  0.89           C  
ATOM   2683  CD2 PHE A 330      12.428  -0.147  25.270  1.00  0.89           C  
ATOM   2684  CE1 PHE A 330      14.631  -1.715  25.990  1.00  0.89           C  
ATOM   2685  CE2 PHE A 330      13.689   0.116  24.714  1.00  0.89           C  
ATOM   2686  CZ  PHE A 330      14.792  -0.668  25.075  1.00  0.89           C  
ATOM   2687  N   PRO A 331       9.475   1.375  27.607  1.00  0.95           N  
ATOM   2688  CA  PRO A 331       9.508   2.834  27.523  1.00  0.95           C  
ATOM   2689  C   PRO A 331       9.475   3.496  28.881  1.00  0.95           C  
ATOM   2690  O   PRO A 331       9.755   4.689  28.985  1.00  0.95           O  
ATOM   2691  CB  PRO A 331       8.258   3.177  26.700  1.00  0.95           C  
ATOM   2692  CG  PRO A 331       7.990   1.913  25.886  1.00  0.95           C  
ATOM   2693  CD  PRO A 331       8.309   0.827  26.901  1.00  0.95           C  
ATOM   2694  N   ASP A 332       9.150   2.753  29.947  1.00  0.90           N  
ATOM   2695  CA  ASP A 332       9.121   3.291  31.287  1.00  0.90           C  
ATOM   2696  C   ASP A 332      10.394   2.955  32.043  1.00  0.90           C  
ATOM   2697  O   ASP A 332      10.593   3.377  33.180  1.00  0.90           O  
ATOM   2698  CB  ASP A 332       7.914   2.722  32.049  1.00  0.90           C  
ATOM   2699  CG  ASP A 332       6.649   3.162  31.341  1.00  0.90           C  
ATOM   2700  OD1 ASP A 332       6.506   4.389  31.106  1.00  0.90           O  
ATOM   2701  OD2 ASP A 332       5.835   2.266  31.009  1.00  0.90           O  
ATOM   2702  N   LYS A 333      11.321   2.208  31.415  1.00  0.88           N  
ATOM   2703  CA  LYS A 333      12.599   1.887  32.018  1.00  0.88           C  
ATOM   2704  C   LYS A 333      13.766   2.338  31.172  1.00  0.88           C  
ATOM   2705  O   LYS A 333      14.914   2.268  31.611  1.00  0.88           O  
ATOM   2706  CB  LYS A 333      12.713   0.370  32.264  1.00  0.88           C  
ATOM   2707  CG  LYS A 333      11.686  -0.163  33.276  1.00  0.88           C  
ATOM   2708  CD  LYS A 333      11.869   0.433  34.680  1.00  0.88           C  
ATOM   2709  CE  LYS A 333      10.799  -0.030  35.667  1.00  0.88           C  
ATOM   2710  NZ  LYS A 333      11.172   0.390  37.027  1.00  0.88           N  
ATOM   2711  N   VAL A 334      13.498   2.858  29.963  1.00  0.95           N  
ATOM   2712  CA  VAL A 334      14.521   3.277  29.025  1.00  0.95           C  
ATOM   2713  C   VAL A 334      14.081   4.562  28.345  1.00  0.95           C  
ATOM   2714  O   VAL A 334      12.944   4.704  27.901  1.00  0.95           O  
ATOM   2715  CB  VAL A 334      14.782   2.220  27.948  1.00  0.95           C  
ATOM   2716  CG1 VAL A 334      15.897   2.659  26.980  1.00  0.95           C  
ATOM   2717  CG2 VAL A 334      15.164   0.877  28.603  1.00  0.95           C  
ATOM   2718  N   ALA A 335      14.983   5.552  28.247  1.00  0.97           N  
ATOM   2719  CA  ALA A 335      14.810   6.711  27.398  1.00  0.97           C  
ATOM   2720  C   ALA A 335      16.032   6.826  26.516  1.00  0.97           C  
ATOM   2721  O   ALA A 335      17.155   6.699  27.000  1.00  0.97           O  
ATOM   2722  CB  ALA A 335      14.671   8.014  28.209  1.00  0.97           C  
ATOM   2723  N   ILE A 336      15.859   7.064  25.204  1.00  0.96           N  
ATOM   2724  CA  ILE A 336      16.975   7.274  24.294  1.00  0.96           C  
ATOM   2725  C   ILE A 336      16.867   8.681  23.736  1.00  0.96           C  
ATOM   2726  O   ILE A 336      15.956   9.015  22.982  1.00  0.96           O  
ATOM   2727  CB  ILE A 336      17.037   6.236  23.167  1.00  0.96           C  
ATOM   2728  CG1 ILE A 336      17.259   4.819  23.749  1.00  0.96           C  
ATOM   2729  CG2 ILE A 336      18.177   6.569  22.184  1.00  0.96           C  
ATOM   2730  CD1 ILE A 336      17.252   3.701  22.696  1.00  0.96           C  
ATOM   2731  N   GLN A 337      17.821   9.560  24.088  1.00  0.96           N  
ATOM   2732  CA  GLN A 337      17.838  10.919  23.593  1.00  0.96           C  
ATOM   2733  C   GLN A 337      18.838  11.030  22.468  1.00  0.96           C  
ATOM   2734  O   GLN A 337      20.021  10.719  22.620  1.00  0.96           O  
ATOM   2735  CB  GLN A 337      18.208  11.927  24.705  1.00  0.96           C  
ATOM   2736  CG  GLN A 337      18.007  13.416  24.324  1.00  0.96           C  
ATOM   2737  CD  GLN A 337      16.527  13.751  24.140  1.00  0.96           C  
ATOM   2738  OE1 GLN A 337      15.689  13.357  24.952  1.00  0.96           O  
ATOM   2739  NE2 GLN A 337      16.195  14.504  23.070  1.00  0.96           N  
ATOM   2740  N   LEU A 338      18.371  11.470  21.290  1.00  0.97           N  
ATOM   2741  CA  LEU A 338      19.203  11.605  20.116  1.00  0.97           C  
ATOM   2742  C   LEU A 338      19.770  13.001  20.073  1.00  0.97           C  
ATOM   2743  O   LEU A 338      19.060  13.990  19.872  1.00  0.97           O  
ATOM   2744  CB  LEU A 338      18.431  11.333  18.792  1.00  0.97           C  
ATOM   2745  CG  LEU A 338      18.158   9.854  18.423  1.00  0.97           C  
ATOM   2746  CD1 LEU A 338      18.580   8.860  19.506  1.00  0.97           C  
ATOM   2747  CD2 LEU A 338      16.681   9.643  18.064  1.00  0.97           C  
ATOM   2748  N   ASN A 339      21.100  13.103  20.253  1.00  0.96           N  
ATOM   2749  CA  ASN A 339      21.815  14.344  20.077  1.00  0.96           C  
ATOM   2750  C   ASN A 339      22.047  14.561  18.590  1.00  0.96           C  
ATOM   2751  O   ASN A 339      22.915  13.922  17.995  1.00  0.96           O  
ATOM   2752  CB  ASN A 339      23.158  14.292  20.853  1.00  0.96           C  
ATOM   2753  CG  ASN A 339      23.732  15.678  21.101  1.00  0.96           C  
ATOM   2754  OD1 ASN A 339      22.992  16.635  21.335  1.00  0.96           O  
ATOM   2755  ND2 ASN A 339      25.073  15.797  21.147  1.00  0.96           N  
ATOM   2756  N   ASP A 340      21.238  15.454  17.982  1.00  0.94           N  
ATOM   2757  CA  ASP A 340      21.158  15.665  16.549  1.00  0.94           C  
ATOM   2758  C   ASP A 340      20.675  14.428  15.774  1.00  0.94           C  
ATOM   2759  O   ASP A 340      20.129  13.483  16.346  1.00  0.94           O  
ATOM   2760  CB  ASP A 340      22.501  16.236  16.023  1.00  0.94           C  
ATOM   2761  CG  ASP A 340      22.261  17.272  14.944  1.00  0.94           C  
ATOM   2762  OD1 ASP A 340      21.682  16.889  13.899  1.00  0.94           O  
ATOM   2763  OD2 ASP A 340      22.599  18.460  15.167  1.00  0.94           O  
ATOM   2764  N   THR A 341      20.831  14.400  14.433  1.00  0.95           N  
ATOM   2765  CA  THR A 341      20.402  13.271  13.610  1.00  0.95           C  
ATOM   2766  C   THR A 341      21.460  12.223  13.453  1.00  0.95           C  
ATOM   2767  O   THR A 341      21.188  11.135  12.961  1.00  0.95           O  
ATOM   2768  CB  THR A 341      19.837  13.593  12.235  1.00  0.95           C  
ATOM   2769  OG1 THR A 341      20.747  14.298  11.368  1.00  0.95           O  
ATOM   2770  CG2 THR A 341      18.542  14.381  12.454  1.00  0.95           C  
ATOM   2771  N   HIS A 342      22.667  12.469  13.982  1.00  0.94           N  
ATOM   2772  CA  HIS A 342      23.786  11.541  13.922  1.00  0.94           C  
ATOM   2773  C   HIS A 342      23.513  10.163  14.554  1.00  0.94           C  
ATOM   2774  O   HIS A 342      24.009   9.165  14.042  1.00  0.94           O  
ATOM   2775  CB  HIS A 342      25.057  12.152  14.558  1.00  0.94           C  
ATOM   2776  CG  HIS A 342      25.319  13.597  14.245  1.00  0.94           C  
ATOM   2777  ND1 HIS A 342      26.166  14.303  15.089  1.00  0.94           N  
ATOM   2778  CD2 HIS A 342      24.827  14.418  13.282  1.00  0.94           C  
ATOM   2779  CE1 HIS A 342      26.151  15.542  14.626  1.00  0.94           C  
ATOM   2780  NE2 HIS A 342      25.358  15.663  13.535  1.00  0.94           N  
ATOM   2781  N   PRO A 343      22.734   9.966  15.627  1.00  0.99           N  
ATOM   2782  CA  PRO A 343      22.429   8.606  16.067  1.00  0.99           C  
ATOM   2783  C   PRO A 343      21.008   8.247  15.675  1.00  0.99           C  
ATOM   2784  O   PRO A 343      20.423   7.363  16.300  1.00  0.99           O  
ATOM   2785  CB  PRO A 343      22.574   8.718  17.591  1.00  0.99           C  
ATOM   2786  CG  PRO A 343      22.064  10.123  17.902  1.00  0.99           C  
ATOM   2787  CD  PRO A 343      22.597  10.936  16.727  1.00  0.99           C  
ATOM   2788  N   ALA A 344      20.446   8.847  14.602  1.00  0.98           N  
ATOM   2789  CA  ALA A 344      19.083   8.617  14.137  1.00  0.98           C  
ATOM   2790  C   ALA A 344      18.779   7.195  13.723  1.00  0.98           C  
ATOM   2791  O   ALA A 344      17.637   6.740  13.770  1.00  0.98           O  
ATOM   2792  CB  ALA A 344      18.760   9.496  12.920  1.00  0.98           C  
ATOM   2793  N   LEU A 345      19.816   6.427  13.342  1.00  0.97           N  
ATOM   2794  CA  LEU A 345      19.691   5.025  13.010  1.00  0.97           C  
ATOM   2795  C   LEU A 345      19.236   4.159  14.172  1.00  0.97           C  
ATOM   2796  O   LEU A 345      18.860   3.006  13.979  1.00  0.97           O  
ATOM   2797  CB  LEU A 345      21.018   4.478  12.447  1.00  0.97           C  
ATOM   2798  CG  LEU A 345      21.344   4.986  11.031  1.00  0.97           C  
ATOM   2799  CD1 LEU A 345      22.730   4.484  10.618  1.00  0.97           C  
ATOM   2800  CD2 LEU A 345      20.294   4.533  10.004  1.00  0.97           C  
ATOM   2801  N   SER A 346      19.181   4.708  15.402  1.00  0.98           N  
ATOM   2802  CA  SER A 346      18.592   4.053  16.561  1.00  0.98           C  
ATOM   2803  C   SER A 346      17.142   3.665  16.361  1.00  0.98           C  
ATOM   2804  O   SER A 346      16.721   2.587  16.760  1.00  0.98           O  
ATOM   2805  CB  SER A 346      18.703   4.928  17.831  1.00  0.98           C  
ATOM   2806  OG  SER A 346      17.911   6.106  17.717  1.00  0.98           O  
ATOM   2807  N   ILE A 347      16.350   4.523  15.700  1.00  0.96           N  
ATOM   2808  CA  ILE A 347      14.958   4.270  15.381  1.00  0.96           C  
ATOM   2809  C   ILE A 347      14.735   3.058  14.470  1.00  0.96           C  
ATOM   2810  O   ILE A 347      13.938   2.194  14.850  1.00  0.96           O  
ATOM   2811  CB  ILE A 347      14.336   5.540  14.805  1.00  0.96           C  
ATOM   2812  CG1 ILE A 347      14.372   6.670  15.859  1.00  0.96           C  
ATOM   2813  CG2 ILE A 347      12.896   5.279  14.315  1.00  0.96           C  
ATOM   2814  CD1 ILE A 347      13.989   8.035  15.292  1.00  0.96           C  
ATOM   2815  N   PRO A 348      15.394   2.845  13.325  1.00  0.98           N  
ATOM   2816  CA  PRO A 348      15.204   1.614  12.573  1.00  0.98           C  
ATOM   2817  C   PRO A 348      15.977   0.460  13.181  1.00  0.98           C  
ATOM   2818  O   PRO A 348      15.545  -0.674  13.001  1.00  0.98           O  
ATOM   2819  CB  PRO A 348      15.672   1.972  11.152  1.00  0.98           C  
ATOM   2820  CG  PRO A 348      16.677   3.102  11.361  1.00  0.98           C  
ATOM   2821  CD  PRO A 348      16.042   3.878  12.511  1.00  0.98           C  
ATOM   2822  N   GLU A 349      17.102   0.681  13.891  1.00  0.95           N  
ATOM   2823  CA  GLU A 349      17.803  -0.391  14.585  1.00  0.95           C  
ATOM   2824  C   GLU A 349      17.018  -0.991  15.735  1.00  0.95           C  
ATOM   2825  O   GLU A 349      16.929  -2.207  15.887  1.00  0.95           O  
ATOM   2826  CB  GLU A 349      19.194   0.074  15.080  1.00  0.95           C  
ATOM   2827  CG  GLU A 349      20.013  -0.956  15.916  1.00  0.95           C  
ATOM   2828  CD  GLU A 349      20.331  -2.259  15.196  1.00  0.95           C  
ATOM   2829  OE1 GLU A 349      19.970  -2.407  14.003  1.00  0.95           O  
ATOM   2830  OE2 GLU A 349      20.932  -3.177  15.812  1.00  0.95           O  
ATOM   2831  N   LEU A 350      16.354  -0.157  16.558  1.00  0.95           N  
ATOM   2832  CA  LEU A 350      15.486  -0.624  17.622  1.00  0.95           C  
ATOM   2833  C   LEU A 350      14.315  -1.417  17.076  1.00  0.95           C  
ATOM   2834  O   LEU A 350      14.000  -2.504  17.552  1.00  0.95           O  
ATOM   2835  CB  LEU A 350      14.987   0.561  18.480  1.00  0.95           C  
ATOM   2836  CG  LEU A 350      14.119   0.188  19.700  1.00  0.95           C  
ATOM   2837  CD1 LEU A 350      14.770  -0.878  20.594  1.00  0.95           C  
ATOM   2838  CD2 LEU A 350      13.815   1.445  20.526  1.00  0.95           C  
ATOM   2839  N   MET A 351      13.704  -0.935  15.975  1.00  0.92           N  
ATOM   2840  CA  MET A 351      12.712  -1.697  15.245  1.00  0.92           C  
ATOM   2841  C   MET A 351      13.224  -3.014  14.694  1.00  0.92           C  
ATOM   2842  O   MET A 351      12.558  -4.037  14.823  1.00  0.92           O  
ATOM   2843  CB  MET A 351      12.131  -0.860  14.083  1.00  0.92           C  
ATOM   2844  CG  MET A 351      11.138   0.200  14.572  1.00  0.92           C  
ATOM   2845  SD  MET A 351       9.750  -0.525  15.486  1.00  0.92           S  
ATOM   2846  CE  MET A 351       8.856  -1.220  14.072  1.00  0.92           C  
ATOM   2847  N   ARG A 352      14.440  -3.040  14.118  1.00  0.90           N  
ATOM   2848  CA  ARG A 352      15.070  -4.259  13.650  1.00  0.90           C  
ATOM   2849  C   ARG A 352      15.290  -5.283  14.754  1.00  0.90           C  
ATOM   2850  O   ARG A 352      14.964  -6.458  14.612  1.00  0.90           O  
ATOM   2851  CB  ARG A 352      16.445  -3.931  13.025  1.00  0.90           C  
ATOM   2852  CG  ARG A 352      17.076  -5.120  12.279  1.00  0.90           C  
ATOM   2853  CD  ARG A 352      18.478  -4.818  11.751  1.00  0.90           C  
ATOM   2854  NE  ARG A 352      19.401  -4.721  12.918  1.00  0.90           N  
ATOM   2855  CZ  ARG A 352      20.063  -5.731  13.483  1.00  0.90           C  
ATOM   2856  NH1 ARG A 352      19.894  -6.993  13.095  1.00  0.90           N  
ATOM   2857  NH2 ARG A 352      20.916  -5.470  14.467  1.00  0.90           N  
ATOM   2858  N   ILE A 353      15.813  -4.854  15.920  1.00  0.92           N  
ATOM   2859  CA  ILE A 353      15.999  -5.735  17.065  1.00  0.92           C  
ATOM   2860  C   ILE A 353      14.675  -6.271  17.596  1.00  0.92           C  
ATOM   2861  O   ILE A 353      14.504  -7.473  17.791  1.00  0.92           O  
ATOM   2862  CB  ILE A 353      16.783  -5.056  18.191  1.00  0.92           C  
ATOM   2863  CG1 ILE A 353      18.211  -4.685  17.720  1.00  0.92           C  
ATOM   2864  CG2 ILE A 353      16.847  -6.003  19.412  1.00  0.92           C  
ATOM   2865  CD1 ILE A 353      18.987  -3.818  18.722  1.00  0.92           C  
ATOM   2866  N   LEU A 354      13.668  -5.405  17.802  1.00  0.89           N  
ATOM   2867  CA  LEU A 354      12.384  -5.849  18.314  1.00  0.89           C  
ATOM   2868  C   LEU A 354      11.622  -6.763  17.356  1.00  0.89           C  
ATOM   2869  O   LEU A 354      11.116  -7.809  17.755  1.00  0.89           O  
ATOM   2870  CB  LEU A 354      11.490  -4.644  18.706  1.00  0.89           C  
ATOM   2871  CG  LEU A 354      12.046  -3.754  19.839  1.00  0.89           C  
ATOM   2872  CD1 LEU A 354      11.123  -2.545  20.057  1.00  0.89           C  
ATOM   2873  CD2 LEU A 354      12.245  -4.522  21.152  1.00  0.89           C  
ATOM   2874  N   VAL A 355      11.542  -6.412  16.059  1.00  0.89           N  
ATOM   2875  CA  VAL A 355      10.778  -7.188  15.090  1.00  0.89           C  
ATOM   2876  C   VAL A 355      11.491  -8.451  14.632  1.00  0.89           C  
ATOM   2877  O   VAL A 355      10.946  -9.553  14.703  1.00  0.89           O  
ATOM   2878  CB  VAL A 355      10.402  -6.314  13.889  1.00  0.89           C  
ATOM   2879  CG1 VAL A 355       9.717  -7.124  12.770  1.00  0.89           C  
ATOM   2880  CG2 VAL A 355       9.453  -5.198  14.371  1.00  0.89           C  
ATOM   2881  N   ASP A 356      12.751  -8.348  14.175  1.00  0.89           N  
ATOM   2882  CA  ASP A 356      13.439  -9.479  13.583  1.00  0.89           C  
ATOM   2883  C   ASP A 356      14.045 -10.426  14.612  1.00  0.89           C  
ATOM   2884  O   ASP A 356      14.061 -11.645  14.425  1.00  0.89           O  
ATOM   2885  CB  ASP A 356      14.547  -8.992  12.621  1.00  0.89           C  
ATOM   2886  CG  ASP A 356      13.976  -8.163  11.489  1.00  0.89           C  
ATOM   2887  OD1 ASP A 356      12.819  -8.372  11.048  1.00  0.89           O  
ATOM   2888  OD2 ASP A 356      14.725  -7.279  10.997  1.00  0.89           O  
ATOM   2889  N   VAL A 357      14.600  -9.887  15.717  1.00  0.87           N  
ATOM   2890  CA  VAL A 357      15.261 -10.701  16.730  1.00  0.87           C  
ATOM   2891  C   VAL A 357      14.326 -11.132  17.850  1.00  0.87           C  
ATOM   2892  O   VAL A 357      14.259 -12.316  18.184  1.00  0.87           O  
ATOM   2893  CB  VAL A 357      16.505 -10.000  17.271  1.00  0.87           C  
ATOM   2894  CG1 VAL A 357      17.197 -10.825  18.371  1.00  0.87           C  
ATOM   2895  CG2 VAL A 357      17.486  -9.754  16.107  1.00  0.87           C  
ATOM   2896  N   GLU A 358      13.538 -10.210  18.439  1.00  0.79           N  
ATOM   2897  CA  GLU A 358      12.687 -10.549  19.577  1.00  0.79           C  
ATOM   2898  C   GLU A 358      11.289 -10.988  19.156  1.00  0.79           C  
ATOM   2899  O   GLU A 358      10.482 -11.390  19.993  1.00  0.79           O  
ATOM   2900  CB  GLU A 358      12.535  -9.341  20.536  1.00  0.79           C  
ATOM   2901  CG  GLU A 358      13.860  -8.834  21.175  1.00  0.79           C  
ATOM   2902  CD  GLU A 358      14.508  -9.662  22.287  1.00  0.79           C  
ATOM   2903  OE1 GLU A 358      13.864 -10.472  22.998  1.00  0.79           O  
ATOM   2904  OE2 GLU A 358      15.717  -9.419  22.560  1.00  0.79           O  
ATOM   2905  N   LYS A 359      10.976 -10.947  17.840  1.00  0.80           N  
ATOM   2906  CA  LYS A 359       9.738 -11.440  17.244  1.00  0.80           C  
ATOM   2907  C   LYS A 359       8.493 -10.663  17.653  1.00  0.80           C  
ATOM   2908  O   LYS A 359       7.370 -11.165  17.608  1.00  0.80           O  
ATOM   2909  CB  LYS A 359       9.512 -12.958  17.495  1.00  0.80           C  
ATOM   2910  CG  LYS A 359      10.683 -13.860  17.072  1.00  0.80           C  
ATOM   2911  CD  LYS A 359      10.429 -15.332  17.439  1.00  0.80           C  
ATOM   2912  CE  LYS A 359      11.587 -16.257  17.064  1.00  0.80           C  
ATOM   2913  NZ  LYS A 359      11.243 -17.649  17.430  1.00  0.80           N  
ATOM   2914  N   VAL A 360       8.664  -9.392  18.046  1.00  0.81           N  
ATOM   2915  CA  VAL A 360       7.579  -8.485  18.359  1.00  0.81           C  
ATOM   2916  C   VAL A 360       6.885  -8.070  17.073  1.00  0.81           C  
ATOM   2917  O   VAL A 360       7.523  -7.871  16.039  1.00  0.81           O  
ATOM   2918  CB  VAL A 360       8.111  -7.275  19.126  1.00  0.81           C  
ATOM   2919  CG1 VAL A 360       6.995  -6.300  19.541  1.00  0.81           C  
ATOM   2920  CG2 VAL A 360       8.861  -7.754  20.386  1.00  0.81           C  
ATOM   2921  N   ASP A 361       5.546  -7.923  17.072  1.00  0.82           N  
ATOM   2922  CA  ASP A 361       4.845  -7.394  15.927  1.00  0.82           C  
ATOM   2923  C   ASP A 361       5.238  -5.945  15.631  1.00  0.82           C  
ATOM   2924  O   ASP A 361       5.698  -5.204  16.502  1.00  0.82           O  
ATOM   2925  CB  ASP A 361       3.318  -7.590  16.063  1.00  0.82           C  
ATOM   2926  CG  ASP A 361       2.769  -6.661  17.127  1.00  0.82           C  
ATOM   2927  OD1 ASP A 361       2.773  -7.071  18.316  1.00  0.82           O  
ATOM   2928  OD2 ASP A 361       2.430  -5.501  16.771  1.00  0.82           O  
ATOM   2929  N   TRP A 362       5.098  -5.502  14.369  1.00  0.83           N  
ATOM   2930  CA  TRP A 362       5.557  -4.182  13.989  1.00  0.83           C  
ATOM   2931  C   TRP A 362       4.897  -3.053  14.760  1.00  0.83           C  
ATOM   2932  O   TRP A 362       5.570  -2.120  15.192  1.00  0.83           O  
ATOM   2933  CB  TRP A 362       5.330  -3.945  12.468  1.00  0.83           C  
ATOM   2934  CG  TRP A 362       5.731  -2.562  11.957  1.00  0.83           C  
ATOM   2935  CD1 TRP A 362       5.054  -1.381  12.118  1.00  0.83           C  
ATOM   2936  CD2 TRP A 362       6.963  -2.226  11.301  1.00  0.83           C  
ATOM   2937  NE1 TRP A 362       5.751  -0.342  11.557  1.00  0.83           N  
ATOM   2938  CE2 TRP A 362       6.924  -0.836  11.056  1.00  0.83           C  
ATOM   2939  CE3 TRP A 362       8.068  -2.994  10.939  1.00  0.83           C  
ATOM   2940  CZ2 TRP A 362       7.974  -0.193  10.433  1.00  0.83           C  
ATOM   2941  CZ3 TRP A 362       9.147  -2.332  10.331  1.00  0.83           C  
ATOM   2942  CH2 TRP A 362       9.095  -0.952  10.077  1.00  0.83           C  
ATOM   2943  N   ASP A 363       3.571  -3.102  14.927  1.00  0.86           N  
ATOM   2944  CA  ASP A 363       2.823  -1.989  15.456  1.00  0.86           C  
ATOM   2945  C   ASP A 363       3.132  -1.784  16.937  1.00  0.86           C  
ATOM   2946  O   ASP A 363       3.461  -0.677  17.365  1.00  0.86           O  
ATOM   2947  CB  ASP A 363       1.320  -2.185  15.137  1.00  0.86           C  
ATOM   2948  CG  ASP A 363       1.075  -2.262  13.634  1.00  0.86           C  
ATOM   2949  OD1 ASP A 363       1.860  -1.665  12.845  1.00  0.86           O  
ATOM   2950  OD2 ASP A 363       0.099  -2.926  13.218  1.00  0.86           O  
ATOM   2951  N   LYS A 364       3.173  -2.877  17.727  1.00  0.81           N  
ATOM   2952  CA  LYS A 364       3.633  -2.845  19.107  1.00  0.81           C  
ATOM   2953  C   LYS A 364       5.090  -2.426  19.271  1.00  0.81           C  
ATOM   2954  O   LYS A 364       5.447  -1.650  20.159  1.00  0.81           O  
ATOM   2955  CB  LYS A 364       3.443  -4.235  19.746  1.00  0.81           C  
ATOM   2956  CG  LYS A 364       3.789  -4.301  21.241  1.00  0.81           C  
ATOM   2957  CD  LYS A 364       3.538  -5.706  21.806  1.00  0.81           C  
ATOM   2958  CE  LYS A 364       3.987  -5.852  23.258  1.00  0.81           C  
ATOM   2959  NZ  LYS A 364       3.761  -7.242  23.709  1.00  0.81           N  
ATOM   2960  N   ALA A 365       5.996  -2.911  18.401  1.00  0.90           N  
ATOM   2961  CA  ALA A 365       7.377  -2.475  18.389  1.00  0.90           C  
ATOM   2962  C   ALA A 365       7.533  -0.991  18.081  1.00  0.90           C  
ATOM   2963  O   ALA A 365       8.342  -0.291  18.686  1.00  0.90           O  
ATOM   2964  CB  ALA A 365       8.170  -3.299  17.364  1.00  0.90           C  
ATOM   2965  N   TRP A 366       6.738  -0.467  17.134  1.00  0.85           N  
ATOM   2966  CA  TRP A 366       6.703   0.935  16.776  1.00  0.85           C  
ATOM   2967  C   TRP A 366       6.220   1.834  17.902  1.00  0.85           C  
ATOM   2968  O   TRP A 366       6.798   2.893  18.155  1.00  0.85           O  
ATOM   2969  CB  TRP A 366       5.865   1.123  15.489  1.00  0.85           C  
ATOM   2970  CG  TRP A 366       5.910   2.507  14.873  1.00  0.85           C  
ATOM   2971  CD1 TRP A 366       4.869   3.354  14.617  1.00  0.85           C  
ATOM   2972  CD2 TRP A 366       7.105   3.183  14.449  1.00  0.85           C  
ATOM   2973  NE1 TRP A 366       5.338   4.520  14.051  1.00  0.85           N  
ATOM   2974  CE2 TRP A 366       6.711   4.449  13.977  1.00  0.85           C  
ATOM   2975  CE3 TRP A 366       8.444   2.804  14.437  1.00  0.85           C  
ATOM   2976  CZ2 TRP A 366       7.652   5.360  13.532  1.00  0.85           C  
ATOM   2977  CZ3 TRP A 366       9.399   3.721  13.979  1.00  0.85           C  
ATOM   2978  CH2 TRP A 366       9.008   4.991  13.536  1.00  0.85           C  
ATOM   2979  N   GLU A 367       5.184   1.407  18.651  1.00  0.85           N  
ATOM   2980  CA  GLU A 367       4.748   2.084  19.858  1.00  0.85           C  
ATOM   2981  C   GLU A 367       5.831   2.154  20.926  1.00  0.85           C  
ATOM   2982  O   GLU A 367       6.045   3.200  21.537  1.00  0.85           O  
ATOM   2983  CB  GLU A 367       3.544   1.369  20.506  1.00  0.85           C  
ATOM   2984  CG  GLU A 367       2.216   1.448  19.722  1.00  0.85           C  
ATOM   2985  CD  GLU A 367       1.067   0.822  20.514  1.00  0.85           C  
ATOM   2986  OE1 GLU A 367       1.301   0.391  21.677  1.00  0.85           O  
ATOM   2987  OE2 GLU A 367      -0.068   0.839  19.981  1.00  0.85           O  
ATOM   2988  N   ILE A 368       6.570   1.047  21.157  1.00  0.89           N  
ATOM   2989  CA  ILE A 368       7.721   1.031  22.053  1.00  0.89           C  
ATOM   2990  C   ILE A 368       8.824   1.966  21.575  1.00  0.89           C  
ATOM   2991  O   ILE A 368       9.329   2.784  22.336  1.00  0.89           O  
ATOM   2992  CB  ILE A 368       8.277  -0.390  22.204  1.00  0.89           C  
ATOM   2993  CG1 ILE A 368       7.271  -1.305  22.942  1.00  0.89           C  
ATOM   2994  CG2 ILE A 368       9.648  -0.397  22.923  1.00  0.89           C  
ATOM   2995  CD1 ILE A 368       7.619  -2.795  22.823  1.00  0.89           C  
ATOM   2996  N   THR A 369       9.191   1.913  20.280  1.00  0.92           N  
ATOM   2997  CA  THR A 369      10.235   2.748  19.689  1.00  0.92           C  
ATOM   2998  C   THR A 369       9.952   4.230  19.798  1.00  0.92           C  
ATOM   2999  O   THR A 369      10.808   4.997  20.238  1.00  0.92           O  
ATOM   3000  CB  THR A 369      10.446   2.392  18.222  1.00  0.92           C  
ATOM   3001  OG1 THR A 369      11.018   1.094  18.138  1.00  0.92           O  
ATOM   3002  CG2 THR A 369      11.413   3.341  17.502  1.00  0.92           C  
ATOM   3003  N   LYS A 370       8.718   4.669  19.468  1.00  0.90           N  
ATOM   3004  CA  LYS A 370       8.319   6.060  19.596  1.00  0.90           C  
ATOM   3005  C   LYS A 370       8.327   6.574  21.020  1.00  0.90           C  
ATOM   3006  O   LYS A 370       8.706   7.710  21.248  1.00  0.90           O  
ATOM   3007  CB  LYS A 370       6.932   6.351  18.955  1.00  0.90           C  
ATOM   3008  CG  LYS A 370       6.952   6.301  17.417  1.00  0.90           C  
ATOM   3009  CD  LYS A 370       5.596   6.606  16.744  1.00  0.90           C  
ATOM   3010  CE  LYS A 370       5.119   8.058  16.879  1.00  0.90           C  
ATOM   3011  NZ  LYS A 370       3.869   8.286  16.104  1.00  0.90           N  
ATOM   3012  N   LYS A 371       7.908   5.770  22.015  1.00  0.90           N  
ATOM   3013  CA  LYS A 371       7.875   6.222  23.398  1.00  0.90           C  
ATOM   3014  C   LYS A 371       9.241   6.189  24.083  1.00  0.90           C  
ATOM   3015  O   LYS A 371       9.449   6.803  25.130  1.00  0.90           O  
ATOM   3016  CB  LYS A 371       6.891   5.334  24.197  1.00  0.90           C  
ATOM   3017  CG  LYS A 371       5.414   5.473  23.792  1.00  0.90           C  
ATOM   3018  CD  LYS A 371       4.525   4.488  24.575  1.00  0.90           C  
ATOM   3019  CE  LYS A 371       3.054   4.529  24.148  1.00  0.90           C  
ATOM   3020  NZ  LYS A 371       2.262   3.547  24.923  1.00  0.90           N  
ATOM   3021  N   THR A 372      10.208   5.452  23.512  1.00  0.94           N  
ATOM   3022  CA  THR A 372      11.583   5.421  23.993  1.00  0.94           C  
ATOM   3023  C   THR A 372      12.400   6.592  23.481  1.00  0.94           C  
ATOM   3024  O   THR A 372      13.208   7.167  24.214  1.00  0.94           O  
ATOM   3025  CB  THR A 372      12.303   4.135  23.598  1.00  0.94           C  
ATOM   3026  OG1 THR A 372      11.616   3.010  24.125  1.00  0.94           O  
ATOM   3027  CG2 THR A 372      13.705   4.066  24.208  1.00  0.94           C  
ATOM   3028  N   CYS A 373      12.248   6.953  22.192  1.00  0.96           N  
ATOM   3029  CA  CYS A 373      13.149   7.875  21.521  1.00  0.96           C  
ATOM   3030  C   CYS A 373      12.679   9.320  21.496  1.00  0.96           C  
ATOM   3031  O   CYS A 373      11.514   9.643  21.277  1.00  0.96           O  
ATOM   3032  CB  CYS A 373      13.453   7.431  20.067  1.00  0.96           C  
ATOM   3033  SG  CYS A 373      14.281   5.799  20.014  1.00  0.96           S  
ATOM   3034  N   ALA A 374      13.628  10.250  21.690  1.00  0.98           N  
ATOM   3035  CA  ALA A 374      13.382  11.667  21.575  1.00  0.98           C  
ATOM   3036  C   ALA A 374      14.522  12.323  20.811  1.00  0.98           C  
ATOM   3037  O   ALA A 374      15.668  11.883  20.875  1.00  0.98           O  
ATOM   3038  CB  ALA A 374      13.211  12.299  22.964  1.00  0.98           C  
ATOM   3039  N   TYR A 375      14.235  13.387  20.035  1.00  0.96           N  
ATOM   3040  CA  TYR A 375      15.194  13.998  19.125  1.00  0.96           C  
ATOM   3041  C   TYR A 375      15.450  15.466  19.432  1.00  0.96           C  
ATOM   3042  O   TYR A 375      14.537  16.282  19.547  1.00  0.96           O  
ATOM   3043  CB  TYR A 375      14.692  13.793  17.661  1.00  0.96           C  
ATOM   3044  CG  TYR A 375      15.282  14.695  16.590  1.00  0.96           C  
ATOM   3045  CD1 TYR A 375      16.668  14.837  16.396  1.00  0.96           C  
ATOM   3046  CD2 TYR A 375      14.408  15.386  15.734  1.00  0.96           C  
ATOM   3047  CE1 TYR A 375      17.159  15.715  15.416  1.00  0.96           C  
ATOM   3048  CE2 TYR A 375      14.896  16.235  14.733  1.00  0.96           C  
ATOM   3049  CZ  TYR A 375      16.273  16.413  14.588  1.00  0.96           C  
ATOM   3050  OH  TYR A 375      16.751  17.287  13.593  1.00  0.96           O  
ATOM   3051  N   THR A 376      16.742  15.834  19.507  1.00  0.97           N  
ATOM   3052  CA  THR A 376      17.172  17.211  19.718  1.00  0.97           C  
ATOM   3053  C   THR A 376      17.744  17.789  18.440  1.00  0.97           C  
ATOM   3054  O   THR A 376      18.730  17.286  17.912  1.00  0.97           O  
ATOM   3055  CB  THR A 376      18.255  17.343  20.785  1.00  0.97           C  
ATOM   3056  OG1 THR A 376      17.806  16.784  22.011  1.00  0.97           O  
ATOM   3057  CG2 THR A 376      18.587  18.820  21.048  1.00  0.97           C  
ATOM   3058  N   ASN A 377      17.160  18.884  17.908  1.00  0.93           N  
ATOM   3059  CA  ASN A 377      17.674  19.574  16.732  1.00  0.93           C  
ATOM   3060  C   ASN A 377      18.543  20.765  17.128  1.00  0.93           C  
ATOM   3061  O   ASN A 377      18.147  21.611  17.931  1.00  0.93           O  
ATOM   3062  CB  ASN A 377      16.491  20.042  15.837  1.00  0.93           C  
ATOM   3063  CG  ASN A 377      16.919  20.927  14.666  1.00  0.93           C  
ATOM   3064  OD1 ASN A 377      16.999  22.145  14.813  1.00  0.93           O  
ATOM   3065  ND2 ASN A 377      17.243  20.333  13.504  1.00  0.93           N  
ATOM   3066  N   HIS A 378      19.738  20.882  16.513  1.00  0.90           N  
ATOM   3067  CA  HIS A 378      20.686  21.927  16.865  1.00  0.90           C  
ATOM   3068  C   HIS A 378      20.955  22.928  15.762  1.00  0.90           C  
ATOM   3069  O   HIS A 378      21.841  23.764  15.905  1.00  0.90           O  
ATOM   3070  CB  HIS A 378      22.049  21.299  17.209  1.00  0.90           C  
ATOM   3071  CG  HIS A 378      21.960  20.299  18.311  1.00  0.90           C  
ATOM   3072  ND1 HIS A 378      22.256  20.657  19.614  1.00  0.90           N  
ATOM   3073  CD2 HIS A 378      21.646  18.983  18.240  1.00  0.90           C  
ATOM   3074  CE1 HIS A 378      22.122  19.543  20.305  1.00  0.90           C  
ATOM   3075  NE2 HIS A 378      21.754  18.503  19.522  1.00  0.90           N  
ATOM   3076  N   THR A 379      20.219  22.890  14.636  1.00  0.87           N  
ATOM   3077  CA  THR A 379      20.487  23.805  13.527  1.00  0.87           C  
ATOM   3078  C   THR A 379      19.366  23.790  12.505  1.00  0.87           C  
ATOM   3079  O   THR A 379      18.692  22.784  12.288  1.00  0.87           O  
ATOM   3080  CB  THR A 379      21.831  23.555  12.824  1.00  0.87           C  
ATOM   3081  OG1 THR A 379      22.070  24.448  11.737  1.00  0.87           O  
ATOM   3082  CG2 THR A 379      21.920  22.111  12.309  1.00  0.87           C  
ATOM   3083  N   VAL A 380      19.153  24.934  11.825  1.00  0.86           N  
ATOM   3084  CA  VAL A 380      18.181  25.055  10.748  1.00  0.86           C  
ATOM   3085  C   VAL A 380      18.872  25.185   9.401  1.00  0.86           C  
ATOM   3086  O   VAL A 380      18.225  25.295   8.360  1.00  0.86           O  
ATOM   3087  CB  VAL A 380      17.254  26.255  10.936  1.00  0.86           C  
ATOM   3088  CG1 VAL A 380      16.560  26.164  12.306  1.00  0.86           C  
ATOM   3089  CG2 VAL A 380      18.023  27.587  10.832  1.00  0.86           C  
ATOM   3090  N   LEU A 381      20.222  25.189   9.381  1.00  0.81           N  
ATOM   3091  CA  LEU A 381      20.993  25.465   8.185  1.00  0.81           C  
ATOM   3092  C   LEU A 381      21.021  24.277   7.216  1.00  0.81           C  
ATOM   3093  O   LEU A 381      21.401  23.186   7.645  1.00  0.81           O  
ATOM   3094  CB  LEU A 381      22.450  25.876   8.515  1.00  0.81           C  
ATOM   3095  CG  LEU A 381      22.605  27.187   9.317  1.00  0.81           C  
ATOM   3096  CD1 LEU A 381      24.091  27.458   9.594  1.00  0.81           C  
ATOM   3097  CD2 LEU A 381      21.996  28.391   8.584  1.00  0.81           C  
ATOM   3098  N   PRO A 382      20.657  24.389   5.928  1.00  0.85           N  
ATOM   3099  CA  PRO A 382      20.458  23.240   5.041  1.00  0.85           C  
ATOM   3100  C   PRO A 382      21.660  22.349   4.852  1.00  0.85           C  
ATOM   3101  O   PRO A 382      21.499  21.142   4.673  1.00  0.85           O  
ATOM   3102  CB  PRO A 382      20.045  23.879   3.706  1.00  0.85           C  
ATOM   3103  CG  PRO A 382      19.311  25.147   4.129  1.00  0.85           C  
ATOM   3104  CD  PRO A 382      20.131  25.618   5.326  1.00  0.85           C  
ATOM   3105  N   GLU A 383      22.875  22.914   4.879  1.00  0.82           N  
ATOM   3106  CA  GLU A 383      24.094  22.166   4.692  1.00  0.82           C  
ATOM   3107  C   GLU A 383      24.495  21.335   5.895  1.00  0.82           C  
ATOM   3108  O   GLU A 383      25.371  20.481   5.802  1.00  0.82           O  
ATOM   3109  CB  GLU A 383      25.259  23.107   4.308  1.00  0.82           C  
ATOM   3110  CG  GLU A 383      25.671  24.152   5.384  1.00  0.82           C  
ATOM   3111  CD  GLU A 383      24.918  25.482   5.323  1.00  0.82           C  
ATOM   3112  OE1 GLU A 383      23.845  25.599   4.672  1.00  0.82           O  
ATOM   3113  OE2 GLU A 383      25.438  26.477   5.892  1.00  0.82           O  
ATOM   3114  N   ALA A 384      23.859  21.550   7.059  1.00  0.88           N  
ATOM   3115  CA  ALA A 384      24.185  20.840   8.274  1.00  0.88           C  
ATOM   3116  C   ALA A 384      23.287  19.646   8.533  1.00  0.88           C  
ATOM   3117  O   ALA A 384      23.526  18.862   9.447  1.00  0.88           O  
ATOM   3118  CB  ALA A 384      24.016  21.824   9.439  1.00  0.88           C  
ATOM   3119  N   LEU A 385      22.237  19.470   7.717  1.00  0.87           N  
ATOM   3120  CA  LEU A 385      21.219  18.468   7.954  1.00  0.87           C  
ATOM   3121  C   LEU A 385      21.531  17.204   7.192  1.00  0.87           C  
ATOM   3122  O   LEU A 385      21.813  17.213   5.992  1.00  0.87           O  
ATOM   3123  CB  LEU A 385      19.824  18.959   7.494  1.00  0.87           C  
ATOM   3124  CG  LEU A 385      19.035  19.845   8.487  1.00  0.87           C  
ATOM   3125  CD1 LEU A 385      19.901  20.677   9.439  1.00  0.87           C  
ATOM   3126  CD2 LEU A 385      18.093  20.768   7.704  1.00  0.87           C  
ATOM   3127  N   GLU A 386      21.466  16.057   7.883  1.00  0.88           N  
ATOM   3128  CA  GLU A 386      21.796  14.788   7.288  1.00  0.88           C  
ATOM   3129  C   GLU A 386      20.785  14.224   6.317  1.00  0.88           C  
ATOM   3130  O   GLU A 386      19.611  13.979   6.614  1.00  0.88           O  
ATOM   3131  CB  GLU A 386      22.113  13.747   8.352  1.00  0.88           C  
ATOM   3132  CG  GLU A 386      23.228  14.262   9.275  1.00  0.88           C  
ATOM   3133  CD  GLU A 386      23.801  13.139  10.098  1.00  0.88           C  
ATOM   3134  OE1 GLU A 386      22.974  12.482  10.781  1.00  0.88           O  
ATOM   3135  OE2 GLU A 386      25.047  13.005  10.103  1.00  0.88           O  
ATOM   3136  N   ARG A 387      21.267  13.993   5.089  1.00  0.83           N  
ATOM   3137  CA  ARG A 387      20.467  13.512   3.995  1.00  0.83           C  
ATOM   3138  C   ARG A 387      21.289  12.497   3.226  1.00  0.83           C  
ATOM   3139  O   ARG A 387      21.937  12.790   2.212  1.00  0.83           O  
ATOM   3140  CB  ARG A 387      20.034  14.649   3.053  1.00  0.83           C  
ATOM   3141  CG  ARG A 387      19.340  15.846   3.734  1.00  0.83           C  
ATOM   3142  CD  ARG A 387      18.869  16.879   2.715  1.00  0.83           C  
ATOM   3143  NE  ARG A 387      20.091  17.348   1.985  1.00  0.83           N  
ATOM   3144  CZ  ARG A 387      20.097  17.647   0.680  1.00  0.83           C  
ATOM   3145  NH1 ARG A 387      18.979  17.729  -0.025  1.00  0.83           N  
ATOM   3146  NH2 ARG A 387      21.256  17.884   0.067  1.00  0.83           N  
ATOM   3147  N   TRP A 388      21.305  11.256   3.729  1.00  0.88           N  
ATOM   3148  CA  TRP A 388      22.129  10.192   3.192  1.00  0.88           C  
ATOM   3149  C   TRP A 388      21.565   9.634   1.891  1.00  0.88           C  
ATOM   3150  O   TRP A 388      20.389   9.268   1.870  1.00  0.88           O  
ATOM   3151  CB  TRP A 388      22.294   9.034   4.196  1.00  0.88           C  
ATOM   3152  CG  TRP A 388      23.042   9.393   5.467  1.00  0.88           C  
ATOM   3153  CD1 TRP A 388      22.547   9.640   6.716  1.00  0.88           C  
ATOM   3154  CD2 TRP A 388      24.469   9.503   5.571  1.00  0.88           C  
ATOM   3155  NE1 TRP A 388      23.568   9.935   7.588  1.00  0.88           N  
ATOM   3156  CE2 TRP A 388      24.756   9.844   6.913  1.00  0.88           C  
ATOM   3157  CE3 TRP A 388      25.485   9.330   4.638  1.00  0.88           C  
ATOM   3158  CZ2 TRP A 388      26.060  10.026   7.338  1.00  0.88           C  
ATOM   3159  CZ3 TRP A 388      26.804   9.501   5.075  1.00  0.88           C  
ATOM   3160  CH2 TRP A 388      27.090   9.858   6.402  1.00  0.88           C  
ATOM   3161  N   PRO A 389      22.305   9.570   0.780  1.00  0.93           N  
ATOM   3162  CA  PRO A 389      21.846   8.909  -0.437  1.00  0.93           C  
ATOM   3163  C   PRO A 389      21.411   7.464  -0.233  1.00  0.93           C  
ATOM   3164  O   PRO A 389      22.073   6.717   0.488  1.00  0.93           O  
ATOM   3165  CB  PRO A 389      23.015   9.067  -1.416  1.00  0.93           C  
ATOM   3166  CG  PRO A 389      24.249   9.181  -0.525  1.00  0.93           C  
ATOM   3167  CD  PRO A 389      23.720   9.949   0.683  1.00  0.93           C  
ATOM   3168  N   VAL A 390      20.290   7.047  -0.852  1.00  0.91           N  
ATOM   3169  CA  VAL A 390      19.720   5.717  -0.664  1.00  0.91           C  
ATOM   3170  C   VAL A 390      20.620   4.579  -1.095  1.00  0.91           C  
ATOM   3171  O   VAL A 390      20.661   3.548  -0.436  1.00  0.91           O  
ATOM   3172  CB  VAL A 390      18.347   5.519  -1.300  1.00  0.91           C  
ATOM   3173  CG1 VAL A 390      17.343   6.488  -0.657  1.00  0.91           C  
ATOM   3174  CG2 VAL A 390      18.387   5.708  -2.826  1.00  0.91           C  
ATOM   3175  N   SER A 391      21.399   4.749  -2.181  1.00  0.89           N  
ATOM   3176  CA  SER A 391      22.333   3.750  -2.685  1.00  0.89           C  
ATOM   3177  C   SER A 391      23.421   3.378  -1.692  1.00  0.89           C  
ATOM   3178  O   SER A 391      23.837   2.226  -1.581  1.00  0.89           O  
ATOM   3179  CB  SER A 391      23.001   4.224  -4.000  1.00  0.89           C  
ATOM   3180  OG  SER A 391      23.701   5.462  -3.826  1.00  0.89           O  
ATOM   3181  N   MET A 392      23.903   4.367  -0.916  1.00  0.88           N  
ATOM   3182  CA  MET A 392      24.824   4.138   0.178  1.00  0.88           C  
ATOM   3183  C   MET A 392      24.218   3.318   1.308  1.00  0.88           C  
ATOM   3184  O   MET A 392      24.790   2.329   1.765  1.00  0.88           O  
ATOM   3185  CB  MET A 392      25.282   5.503   0.742  1.00  0.88           C  
ATOM   3186  CG  MET A 392      26.437   5.414   1.754  1.00  0.88           C  
ATOM   3187  SD  MET A 392      27.944   4.684   1.056  1.00  0.88           S  
ATOM   3188  CE  MET A 392      28.438   6.121   0.063  1.00  0.88           C  
ATOM   3189  N   PHE A 393      22.991   3.679   1.748  1.00  0.91           N  
ATOM   3190  CA  PHE A 393      22.270   2.937   2.768  1.00  0.91           C  
ATOM   3191  C   PHE A 393      21.928   1.530   2.333  1.00  0.91           C  
ATOM   3192  O   PHE A 393      22.069   0.590   3.103  1.00  0.91           O  
ATOM   3193  CB  PHE A 393      20.934   3.630   3.162  1.00  0.91           C  
ATOM   3194  CG  PHE A 393      21.071   4.567   4.324  1.00  0.91           C  
ATOM   3195  CD1 PHE A 393      21.812   4.209   5.462  1.00  0.91           C  
ATOM   3196  CD2 PHE A 393      20.362   5.781   4.333  1.00  0.91           C  
ATOM   3197  CE1 PHE A 393      21.867   5.060   6.562  1.00  0.91           C  
ATOM   3198  CE2 PHE A 393      20.393   6.614   5.458  1.00  0.91           C  
ATOM   3199  CZ  PHE A 393      21.178   6.271   6.561  1.00  0.91           C  
ATOM   3200  N   GLU A 394      21.496   1.359   1.078  1.00  0.87           N  
ATOM   3201  CA  GLU A 394      21.161   0.086   0.475  1.00  0.87           C  
ATOM   3202  C   GLU A 394      22.319  -0.882   0.445  1.00  0.87           C  
ATOM   3203  O   GLU A 394      22.193  -2.049   0.811  1.00  0.87           O  
ATOM   3204  CB  GLU A 394      20.693   0.377  -0.964  1.00  0.87           C  
ATOM   3205  CG  GLU A 394      20.282  -0.848  -1.810  1.00  0.87           C  
ATOM   3206  CD  GLU A 394      19.297  -0.431  -2.900  1.00  0.87           C  
ATOM   3207  OE1 GLU A 394      19.478   0.677  -3.473  1.00  0.87           O  
ATOM   3208  OE2 GLU A 394      18.336  -1.204  -3.143  1.00  0.87           O  
ATOM   3209  N   LYS A 395      23.513  -0.404   0.058  1.00  0.86           N  
ATOM   3210  CA  LYS A 395      24.703  -1.220   0.127  1.00  0.86           C  
ATOM   3211  C   LYS A 395      25.188  -1.527   1.541  1.00  0.86           C  
ATOM   3212  O   LYS A 395      25.506  -2.668   1.865  1.00  0.86           O  
ATOM   3213  CB  LYS A 395      25.838  -0.528  -0.662  1.00  0.86           C  
ATOM   3214  CG  LYS A 395      27.092  -1.398  -0.830  1.00  0.86           C  
ATOM   3215  CD  LYS A 395      28.135  -0.742  -1.744  1.00  0.86           C  
ATOM   3216  CE  LYS A 395      29.384  -1.606  -1.904  1.00  0.86           C  
ATOM   3217  NZ  LYS A 395      30.351  -0.911  -2.777  1.00  0.86           N  
ATOM   3218  N   LEU A 396      25.277  -0.512   2.423  1.00  0.91           N  
ATOM   3219  CA  LEU A 396      25.821  -0.682   3.759  1.00  0.91           C  
ATOM   3220  C   LEU A 396      24.889  -1.328   4.763  1.00  0.91           C  
ATOM   3221  O   LEU A 396      25.323  -2.120   5.599  1.00  0.91           O  
ATOM   3222  CB  LEU A 396      26.298   0.683   4.308  1.00  0.91           C  
ATOM   3223  CG  LEU A 396      27.078   0.626   5.638  1.00  0.91           C  
ATOM   3224  CD1 LEU A 396      28.381  -0.169   5.501  1.00  0.91           C  
ATOM   3225  CD2 LEU A 396      27.369   2.042   6.141  1.00  0.91           C  
ATOM   3226  N   LEU A 397      23.590  -0.997   4.720  1.00  0.92           N  
ATOM   3227  CA  LEU A 397      22.620  -1.402   5.715  1.00  0.92           C  
ATOM   3228  C   LEU A 397      21.279  -1.740   5.055  1.00  0.92           C  
ATOM   3229  O   LEU A 397      20.285  -1.048   5.309  1.00  0.92           O  
ATOM   3230  CB  LEU A 397      22.376  -0.264   6.746  1.00  0.92           C  
ATOM   3231  CG  LEU A 397      23.615   0.265   7.493  1.00  0.92           C  
ATOM   3232  CD1 LEU A 397      23.240   1.493   8.330  1.00  0.92           C  
ATOM   3233  CD2 LEU A 397      24.252  -0.794   8.402  1.00  0.92           C  
ATOM   3234  N   PRO A 398      21.168  -2.771   4.204  1.00  0.92           N  
ATOM   3235  CA  PRO A 398      19.986  -3.022   3.367  1.00  0.92           C  
ATOM   3236  C   PRO A 398      18.708  -3.192   4.161  1.00  0.92           C  
ATOM   3237  O   PRO A 398      17.665  -2.664   3.784  1.00  0.92           O  
ATOM   3238  CB  PRO A 398      20.345  -4.312   2.601  1.00  0.92           C  
ATOM   3239  CG  PRO A 398      21.419  -4.990   3.458  1.00  0.92           C  
ATOM   3240  CD  PRO A 398      22.197  -3.800   4.011  1.00  0.92           C  
ATOM   3241  N   ARG A 399      18.785  -3.909   5.291  1.00  0.87           N  
ATOM   3242  CA  ARG A 399      17.689  -4.124   6.206  1.00  0.87           C  
ATOM   3243  C   ARG A 399      17.148  -2.848   6.823  1.00  0.87           C  
ATOM   3244  O   ARG A 399      15.944  -2.612   6.867  1.00  0.87           O  
ATOM   3245  CB  ARG A 399      18.210  -5.035   7.330  1.00  0.87           C  
ATOM   3246  CG  ARG A 399      17.222  -5.289   8.477  1.00  0.87           C  
ATOM   3247  CD  ARG A 399      16.089  -6.296   8.239  1.00  0.87           C  
ATOM   3248  NE  ARG A 399      14.974  -5.731   7.405  1.00  0.87           N  
ATOM   3249  CZ  ARG A 399      13.676  -5.875   7.722  1.00  0.87           C  
ATOM   3250  NH1 ARG A 399      13.249  -6.295   8.910  1.00  0.87           N  
ATOM   3251  NH2 ARG A 399      12.788  -5.669   6.747  1.00  0.87           N  
ATOM   3252  N   HIS A 400      18.032  -1.949   7.290  1.00  0.93           N  
ATOM   3253  CA  HIS A 400      17.632  -0.664   7.819  1.00  0.93           C  
ATOM   3254  C   HIS A 400      16.943   0.191   6.786  1.00  0.93           C  
ATOM   3255  O   HIS A 400      15.965   0.856   7.099  1.00  0.93           O  
ATOM   3256  CB  HIS A 400      18.819   0.112   8.416  1.00  0.93           C  
ATOM   3257  CG  HIS A 400      19.390  -0.598   9.599  1.00  0.93           C  
ATOM   3258  ND1 HIS A 400      20.269  -1.653   9.422  1.00  0.93           N  
ATOM   3259  CD2 HIS A 400      19.107  -0.433  10.914  1.00  0.93           C  
ATOM   3260  CE1 HIS A 400      20.512  -2.096  10.639  1.00  0.93           C  
ATOM   3261  NE2 HIS A 400      19.825  -1.400  11.569  1.00  0.93           N  
ATOM   3262  N   LEU A 401      17.390   0.157   5.516  1.00  0.92           N  
ATOM   3263  CA  LEU A 401      16.702   0.833   4.431  1.00  0.92           C  
ATOM   3264  C   LEU A 401      15.282   0.302   4.198  1.00  0.92           C  
ATOM   3265  O   LEU A 401      14.331   1.072   4.084  1.00  0.92           O  
ATOM   3266  CB  LEU A 401      17.534   0.718   3.131  1.00  0.92           C  
ATOM   3267  CG  LEU A 401      17.489   1.918   2.153  1.00  0.92           C  
ATOM   3268  CD1 LEU A 401      17.523   1.397   0.714  1.00  0.92           C  
ATOM   3269  CD2 LEU A 401      16.306   2.878   2.330  1.00  0.92           C  
ATOM   3270  N   GLU A 402      15.082  -1.039   4.213  1.00  0.89           N  
ATOM   3271  CA  GLU A 402      13.757  -1.652   4.146  1.00  0.89           C  
ATOM   3272  C   GLU A 402      12.843  -1.183   5.280  1.00  0.89           C  
ATOM   3273  O   GLU A 402      11.685  -0.820   5.076  1.00  0.89           O  
ATOM   3274  CB  GLU A 402      13.819  -3.201   4.279  1.00  0.89           C  
ATOM   3275  CG  GLU A 402      14.497  -3.987   3.129  1.00  0.89           C  
ATOM   3276  CD  GLU A 402      14.531  -5.480   3.430  1.00  0.89           C  
ATOM   3277  OE1 GLU A 402      14.487  -5.834   4.644  1.00  0.89           O  
ATOM   3278  OE2 GLU A 402      14.560  -6.289   2.471  1.00  0.89           O  
ATOM   3279  N   ILE A 403      13.373  -1.140   6.519  1.00  0.93           N  
ATOM   3280  CA  ILE A 403      12.681  -0.626   7.691  1.00  0.93           C  
ATOM   3281  C   ILE A 403      12.356   0.858   7.567  1.00  0.93           C  
ATOM   3282  O   ILE A 403      11.235   1.272   7.846  1.00  0.93           O  
ATOM   3283  CB  ILE A 403      13.478  -0.929   8.959  1.00  0.93           C  
ATOM   3284  CG1 ILE A 403      13.556  -2.460   9.171  1.00  0.93           C  
ATOM   3285  CG2 ILE A 403      12.862  -0.248  10.202  1.00  0.93           C  
ATOM   3286  CD1 ILE A 403      14.459  -2.872  10.335  1.00  0.93           C  
ATOM   3287  N   ILE A 404      13.296   1.698   7.084  1.00  0.93           N  
ATOM   3288  CA  ILE A 404      13.077   3.116   6.804  1.00  0.93           C  
ATOM   3289  C   ILE A 404      11.980   3.328   5.764  1.00  0.93           C  
ATOM   3290  O   ILE A 404      11.094   4.168   5.934  1.00  0.93           O  
ATOM   3291  CB  ILE A 404      14.376   3.797   6.354  1.00  0.93           C  
ATOM   3292  CG1 ILE A 404      15.387   3.901   7.521  1.00  0.93           C  
ATOM   3293  CG2 ILE A 404      14.111   5.205   5.779  1.00  0.93           C  
ATOM   3294  CD1 ILE A 404      16.819   4.193   7.047  1.00  0.93           C  
ATOM   3295  N   TYR A 405      11.972   2.533   4.674  1.00  0.92           N  
ATOM   3296  CA  TYR A 405      10.912   2.549   3.681  1.00  0.92           C  
ATOM   3297  C   TYR A 405       9.546   2.167   4.244  1.00  0.92           C  
ATOM   3298  O   TYR A 405       8.545   2.832   3.971  1.00  0.92           O  
ATOM   3299  CB  TYR A 405      11.250   1.612   2.486  1.00  0.92           C  
ATOM   3300  CG  TYR A 405      12.279   2.160   1.521  1.00  0.92           C  
ATOM   3301  CD1 TYR A 405      12.357   3.521   1.171  1.00  0.92           C  
ATOM   3302  CD2 TYR A 405      13.123   1.255   0.855  1.00  0.92           C  
ATOM   3303  CE1 TYR A 405      13.248   3.962   0.178  1.00  0.92           C  
ATOM   3304  CE2 TYR A 405      14.008   1.690  -0.142  1.00  0.92           C  
ATOM   3305  CZ  TYR A 405      14.073   3.046  -0.478  1.00  0.92           C  
ATOM   3306  OH  TYR A 405      14.967   3.492  -1.475  1.00  0.92           O  
ATOM   3307  N   ALA A 406       9.472   1.120   5.090  1.00  0.93           N  
ATOM   3308  CA  ALA A 406       8.256   0.751   5.786  1.00  0.93           C  
ATOM   3309  C   ALA A 406       7.752   1.819   6.747  1.00  0.93           C  
ATOM   3310  O   ALA A 406       6.570   2.152   6.735  1.00  0.93           O  
ATOM   3311  CB  ALA A 406       8.475  -0.568   6.544  1.00  0.93           C  
ATOM   3312  N   ILE A 407       8.647   2.439   7.551  1.00  0.92           N  
ATOM   3313  CA  ILE A 407       8.329   3.556   8.443  1.00  0.92           C  
ATOM   3314  C   ILE A 407       7.759   4.730   7.666  1.00  0.92           C  
ATOM   3315  O   ILE A 407       6.753   5.325   8.055  1.00  0.92           O  
ATOM   3316  CB  ILE A 407       9.566   4.027   9.224  1.00  0.92           C  
ATOM   3317  CG1 ILE A 407      10.010   2.969  10.259  1.00  0.92           C  
ATOM   3318  CG2 ILE A 407       9.303   5.372   9.938  1.00  0.92           C  
ATOM   3319  CD1 ILE A 407      11.362   3.289  10.914  1.00  0.92           C  
ATOM   3320  N   ASN A 408       8.369   5.059   6.508  1.00  0.90           N  
ATOM   3321  CA  ASN A 408       7.896   6.107   5.630  1.00  0.90           C  
ATOM   3322  C   ASN A 408       6.497   5.873   5.105  1.00  0.90           C  
ATOM   3323  O   ASN A 408       5.673   6.774   5.167  1.00  0.90           O  
ATOM   3324  CB  ASN A 408       8.847   6.244   4.422  1.00  0.90           C  
ATOM   3325  CG  ASN A 408       8.559   7.538   3.671  1.00  0.90           C  
ATOM   3326  OD1 ASN A 408       8.449   8.604   4.272  1.00  0.90           O  
ATOM   3327  ND2 ASN A 408       8.427   7.455   2.332  1.00  0.90           N  
ATOM   3328  N   GLN A 409       6.181   4.656   4.617  1.00  0.86           N  
ATOM   3329  CA  GLN A 409       4.847   4.333   4.141  1.00  0.86           C  
ATOM   3330  C   GLN A 409       3.799   4.469   5.236  1.00  0.86           C  
ATOM   3331  O   GLN A 409       2.809   5.167   5.067  1.00  0.86           O  
ATOM   3332  CB  GLN A 409       4.839   2.902   3.554  1.00  0.86           C  
ATOM   3333  CG  GLN A 409       3.470   2.447   2.990  1.00  0.86           C  
ATOM   3334  CD  GLN A 409       3.542   0.998   2.511  1.00  0.86           C  
ATOM   3335  OE1 GLN A 409       4.234   0.651   1.555  1.00  0.86           O  
ATOM   3336  NE2 GLN A 409       2.823   0.096   3.220  1.00  0.86           N  
ATOM   3337  N   ARG A 410       4.061   3.912   6.442  1.00  0.82           N  
ATOM   3338  CA  ARG A 410       3.148   4.035   7.572  1.00  0.82           C  
ATOM   3339  C   ARG A 410       2.905   5.490   7.984  1.00  0.82           C  
ATOM   3340  O   ARG A 410       1.786   5.908   8.276  1.00  0.82           O  
ATOM   3341  CB  ARG A 410       3.689   3.289   8.825  1.00  0.82           C  
ATOM   3342  CG  ARG A 410       3.968   1.777   8.674  1.00  0.82           C  
ATOM   3343  CD  ARG A 410       2.795   0.920   8.197  1.00  0.82           C  
ATOM   3344  NE  ARG A 410       3.235  -0.511   8.360  1.00  0.82           N  
ATOM   3345  CZ  ARG A 410       2.934  -1.262   9.431  1.00  0.82           C  
ATOM   3346  NH1 ARG A 410       2.189  -0.792  10.423  1.00  0.82           N  
ATOM   3347  NH2 ARG A 410       3.394  -2.505   9.518  1.00  0.82           N  
ATOM   3348  N   HIS A 411       3.973   6.308   8.007  1.00  0.87           N  
ATOM   3349  CA  HIS A 411       3.877   7.737   8.242  1.00  0.87           C  
ATOM   3350  C   HIS A 411       3.125   8.503   7.163  1.00  0.87           C  
ATOM   3351  O   HIS A 411       2.242   9.304   7.455  1.00  0.87           O  
ATOM   3352  CB  HIS A 411       5.308   8.299   8.363  1.00  0.87           C  
ATOM   3353  CG  HIS A 411       5.422   9.789   8.331  1.00  0.87           C  
ATOM   3354  ND1 HIS A 411       4.869  10.557   9.335  1.00  0.87           N  
ATOM   3355  CD2 HIS A 411       6.013  10.579   7.399  1.00  0.87           C  
ATOM   3356  CE1 HIS A 411       5.141  11.803   8.997  1.00  0.87           C  
ATOM   3357  NE2 HIS A 411       5.831  11.872   7.831  1.00  0.87           N  
ATOM   3358  N   LEU A 412       3.421   8.257   5.877  1.00  0.87           N  
ATOM   3359  CA  LEU A 412       2.771   8.912   4.755  1.00  0.87           C  
ATOM   3360  C   LEU A 412       1.287   8.611   4.654  1.00  0.87           C  
ATOM   3361  O   LEU A 412       0.497   9.510   4.373  1.00  0.87           O  
ATOM   3362  CB  LEU A 412       3.515   8.593   3.431  1.00  0.87           C  
ATOM   3363  CG  LEU A 412       4.284   9.765   2.775  1.00  0.87           C  
ATOM   3364  CD1 LEU A 412       5.007  10.699   3.758  1.00  0.87           C  
ATOM   3365  CD2 LEU A 412       5.304   9.210   1.772  1.00  0.87           C  
ATOM   3366  N   ASP A 413       0.864   7.367   4.958  1.00  0.87           N  
ATOM   3367  CA  ASP A 413      -0.533   6.992   5.099  1.00  0.87           C  
ATOM   3368  C   ASP A 413      -1.238   7.820   6.187  1.00  0.87           C  
ATOM   3369  O   ASP A 413      -2.344   8.324   5.999  1.00  0.87           O  
ATOM   3370  CB  ASP A 413      -0.647   5.480   5.442  1.00  0.87           C  
ATOM   3371  CG  ASP A 413      -0.152   4.576   4.319  1.00  0.87           C  
ATOM   3372  OD1 ASP A 413      -0.097   5.036   3.152  1.00  0.87           O  
ATOM   3373  OD2 ASP A 413       0.152   3.391   4.632  1.00  0.87           O  
ATOM   3374  N   HIS A 414      -0.578   8.048   7.346  1.00  0.83           N  
ATOM   3375  CA  HIS A 414      -1.060   8.965   8.375  1.00  0.83           C  
ATOM   3376  C   HIS A 414      -1.133  10.426   7.919  1.00  0.83           C  
ATOM   3377  O   HIS A 414      -2.112  11.126   8.165  1.00  0.83           O  
ATOM   3378  CB  HIS A 414      -0.199   8.848   9.656  1.00  0.83           C  
ATOM   3379  CG  HIS A 414      -0.751   9.555  10.859  1.00  0.83           C  
ATOM   3380  ND1 HIS A 414      -1.912   9.089  11.442  1.00  0.83           N  
ATOM   3381  CD2 HIS A 414      -0.294  10.644  11.531  1.00  0.83           C  
ATOM   3382  CE1 HIS A 414      -2.141   9.902  12.453  1.00  0.83           C  
ATOM   3383  NE2 HIS A 414      -1.191  10.864  12.554  1.00  0.83           N  
ATOM   3384  N   VAL A 415      -0.122  10.931   7.177  1.00  0.86           N  
ATOM   3385  CA  VAL A 415      -0.158  12.263   6.570  1.00  0.86           C  
ATOM   3386  C   VAL A 415      -1.320  12.417   5.592  1.00  0.86           C  
ATOM   3387  O   VAL A 415      -2.051  13.405   5.623  1.00  0.86           O  
ATOM   3388  CB  VAL A 415       1.139  12.609   5.830  1.00  0.86           C  
ATOM   3389  CG1 VAL A 415       1.053  14.008   5.183  1.00  0.86           C  
ATOM   3390  CG2 VAL A 415       2.333  12.603   6.798  1.00  0.86           C  
ATOM   3391  N   ALA A 416      -1.546  11.408   4.729  1.00  0.88           N  
ATOM   3392  CA  ALA A 416      -2.649  11.351   3.793  1.00  0.88           C  
ATOM   3393  C   ALA A 416      -4.016  11.329   4.462  1.00  0.88           C  
ATOM   3394  O   ALA A 416      -4.955  11.976   4.008  1.00  0.88           O  
ATOM   3395  CB  ALA A 416      -2.482  10.108   2.901  1.00  0.88           C  
ATOM   3396  N   ALA A 417      -4.153  10.586   5.574  1.00  0.87           N  
ATOM   3397  CA  ALA A 417      -5.352  10.570   6.379  1.00  0.87           C  
ATOM   3398  C   ALA A 417      -5.691  11.903   7.037  1.00  0.87           C  
ATOM   3399  O   ALA A 417      -6.840  12.336   7.042  1.00  0.87           O  
ATOM   3400  CB  ALA A 417      -5.188   9.492   7.463  1.00  0.87           C  
ATOM   3401  N   LEU A 418      -4.687  12.590   7.614  1.00  0.86           N  
ATOM   3402  CA  LEU A 418      -4.880  13.883   8.246  1.00  0.86           C  
ATOM   3403  C   LEU A 418      -5.108  15.015   7.252  1.00  0.86           C  
ATOM   3404  O   LEU A 418      -5.889  15.929   7.509  1.00  0.86           O  
ATOM   3405  CB  LEU A 418      -3.693  14.225   9.187  1.00  0.86           C  
ATOM   3406  CG  LEU A 418      -3.802  13.686  10.636  1.00  0.86           C  
ATOM   3407  CD1 LEU A 418      -4.948  14.349  11.406  1.00  0.86           C  
ATOM   3408  CD2 LEU A 418      -3.919  12.161  10.720  1.00  0.86           C  
ATOM   3409  N   PHE A 419      -4.433  14.990   6.086  1.00  0.86           N  
ATOM   3410  CA  PHE A 419      -4.573  16.026   5.074  1.00  0.86           C  
ATOM   3411  C   PHE A 419      -5.020  15.428   3.737  1.00  0.86           C  
ATOM   3412  O   PHE A 419      -4.232  15.407   2.784  1.00  0.86           O  
ATOM   3413  CB  PHE A 419      -3.243  16.805   4.878  1.00  0.86           C  
ATOM   3414  CG  PHE A 419      -2.755  17.417   6.171  1.00  0.86           C  
ATOM   3415  CD1 PHE A 419      -1.955  16.667   7.053  1.00  0.86           C  
ATOM   3416  CD2 PHE A 419      -3.059  18.748   6.506  1.00  0.86           C  
ATOM   3417  CE1 PHE A 419      -1.498  17.218   8.256  1.00  0.86           C  
ATOM   3418  CE2 PHE A 419      -2.603  19.305   7.710  1.00  0.86           C  
ATOM   3419  CZ  PHE A 419      -1.829  18.536   8.589  1.00  0.86           C  
ATOM   3420  N   PRO A 420      -6.249  14.916   3.597  1.00  0.88           N  
ATOM   3421  CA  PRO A 420      -6.731  14.288   2.370  1.00  0.88           C  
ATOM   3422  C   PRO A 420      -6.644  15.172   1.138  1.00  0.88           C  
ATOM   3423  O   PRO A 420      -7.184  16.275   1.112  1.00  0.88           O  
ATOM   3424  CB  PRO A 420      -8.173  13.869   2.703  1.00  0.88           C  
ATOM   3425  CG  PRO A 420      -8.604  14.862   3.782  1.00  0.88           C  
ATOM   3426  CD  PRO A 420      -7.322  15.030   4.592  1.00  0.88           C  
ATOM   3427  N   GLY A 421      -5.972  14.682   0.080  1.00  0.87           N  
ATOM   3428  CA  GLY A 421      -5.800  15.420  -1.166  1.00  0.87           C  
ATOM   3429  C   GLY A 421      -4.641  16.387  -1.211  1.00  0.87           C  
ATOM   3430  O   GLY A 421      -4.399  16.996  -2.251  1.00  0.87           O  
ATOM   3431  N   ASP A 422      -3.854  16.542  -0.125  1.00  0.86           N  
ATOM   3432  CA  ASP A 422      -2.693  17.423  -0.122  1.00  0.86           C  
ATOM   3433  C   ASP A 422      -1.477  16.735  -0.756  1.00  0.86           C  
ATOM   3434  O   ASP A 422      -0.615  16.158  -0.097  1.00  0.86           O  
ATOM   3435  CB  ASP A 422      -2.415  17.943   1.315  1.00  0.86           C  
ATOM   3436  CG  ASP A 422      -1.514  19.171   1.358  1.00  0.86           C  
ATOM   3437  OD1 ASP A 422      -0.768  19.422   0.373  1.00  0.86           O  
ATOM   3438  OD2 ASP A 422      -1.494  19.840   2.427  1.00  0.86           O  
ATOM   3439  N   VAL A 423      -1.408  16.776  -2.103  1.00  0.82           N  
ATOM   3440  CA  VAL A 423      -0.392  16.115  -2.916  1.00  0.82           C  
ATOM   3441  C   VAL A 423       1.036  16.569  -2.629  1.00  0.82           C  
ATOM   3442  O   VAL A 423       1.946  15.751  -2.485  1.00  0.82           O  
ATOM   3443  CB  VAL A 423      -0.689  16.316  -4.407  1.00  0.82           C  
ATOM   3444  CG1 VAL A 423       0.406  15.692  -5.298  1.00  0.82           C  
ATOM   3445  CG2 VAL A 423      -2.049  15.685  -4.761  1.00  0.82           C  
ATOM   3446  N   ASP A 424       1.288  17.891  -2.514  1.00  0.86           N  
ATOM   3447  CA  ASP A 424       2.625  18.396  -2.243  1.00  0.86           C  
ATOM   3448  C   ASP A 424       3.099  18.054  -0.837  1.00  0.86           C  
ATOM   3449  O   ASP A 424       4.273  17.792  -0.597  1.00  0.86           O  
ATOM   3450  CB  ASP A 424       2.727  19.918  -2.524  1.00  0.86           C  
ATOM   3451  CG  ASP A 424       4.179  20.365  -2.511  1.00  0.86           C  
ATOM   3452  OD1 ASP A 424       4.937  19.930  -3.412  1.00  0.86           O  
ATOM   3453  OD2 ASP A 424       4.603  21.106  -1.587  1.00  0.86           O  
ATOM   3454  N   ARG A 425       2.188  18.001   0.141  1.00  0.82           N  
ATOM   3455  CA  ARG A 425       2.522  17.623   1.494  1.00  0.82           C  
ATOM   3456  C   ARG A 425       3.088  16.223   1.658  1.00  0.82           C  
ATOM   3457  O   ARG A 425       4.021  16.014   2.433  1.00  0.82           O  
ATOM   3458  CB  ARG A 425       1.271  17.773   2.342  1.00  0.82           C  
ATOM   3459  CG  ARG A 425       1.517  17.739   3.845  1.00  0.82           C  
ATOM   3460  CD  ARG A 425       0.230  18.032   4.596  1.00  0.82           C  
ATOM   3461  NE  ARG A 425       0.638  18.535   5.930  1.00  0.82           N  
ATOM   3462  CZ  ARG A 425       0.560  19.819   6.287  1.00  0.82           C  
ATOM   3463  NH1 ARG A 425      -0.012  20.752   5.533  1.00  0.82           N  
ATOM   3464  NH2 ARG A 425       1.054  20.173   7.463  1.00  0.82           N  
ATOM   3465  N   LEU A 426       2.588  15.226   0.890  1.00  0.86           N  
ATOM   3466  CA  LEU A 426       3.216  13.912   0.834  1.00  0.86           C  
ATOM   3467  C   LEU A 426       4.663  13.984   0.343  1.00  0.86           C  
ATOM   3468  O   LEU A 426       5.541  13.313   0.873  1.00  0.86           O  
ATOM   3469  CB  LEU A 426       2.463  12.911  -0.095  1.00  0.86           C  
ATOM   3470  CG  LEU A 426       1.173  12.232   0.434  1.00  0.86           C  
ATOM   3471  CD1 LEU A 426       1.095  12.140   1.961  1.00  0.86           C  
ATOM   3472  CD2 LEU A 426      -0.101  12.880  -0.114  1.00  0.86           C  
ATOM   3473  N   ARG A 427       4.955  14.831  -0.666  1.00  0.81           N  
ATOM   3474  CA  ARG A 427       6.312  15.089  -1.122  1.00  0.81           C  
ATOM   3475  C   ARG A 427       7.200  15.756  -0.071  1.00  0.81           C  
ATOM   3476  O   ARG A 427       8.349  15.369   0.122  1.00  0.81           O  
ATOM   3477  CB  ARG A 427       6.265  15.973  -2.393  1.00  0.81           C  
ATOM   3478  CG  ARG A 427       7.623  16.230  -3.079  1.00  0.81           C  
ATOM   3479  CD  ARG A 427       7.542  17.291  -4.184  1.00  0.81           C  
ATOM   3480  NE  ARG A 427       7.195  18.602  -3.552  1.00  0.81           N  
ATOM   3481  CZ  ARG A 427       8.025  19.443  -2.931  1.00  0.81           C  
ATOM   3482  NH1 ARG A 427       9.318  19.184  -2.779  1.00  0.81           N  
ATOM   3483  NH2 ARG A 427       7.512  20.573  -2.455  1.00  0.81           N  
ATOM   3484  N   ARG A 428       6.694  16.784   0.637  1.00  0.83           N  
ATOM   3485  CA  ARG A 428       7.445  17.495   1.662  1.00  0.83           C  
ATOM   3486  C   ARG A 428       7.761  16.704   2.924  1.00  0.83           C  
ATOM   3487  O   ARG A 428       8.853  16.822   3.479  1.00  0.83           O  
ATOM   3488  CB  ARG A 428       6.732  18.801   2.079  1.00  0.83           C  
ATOM   3489  CG  ARG A 428       6.494  19.783   0.919  1.00  0.83           C  
ATOM   3490  CD  ARG A 428       6.142  21.207   1.372  1.00  0.83           C  
ATOM   3491  NE  ARG A 428       4.978  21.165   2.314  1.00  0.83           N  
ATOM   3492  CZ  ARG A 428       3.695  21.321   1.969  1.00  0.83           C  
ATOM   3493  NH1 ARG A 428       3.303  21.476   0.708  1.00  0.83           N  
ATOM   3494  NH2 ARG A 428       2.762  21.324   2.920  1.00  0.83           N  
ATOM   3495  N   MET A 429       6.809  15.890   3.421  1.00  0.88           N  
ATOM   3496  CA  MET A 429       6.959  15.200   4.693  1.00  0.88           C  
ATOM   3497  C   MET A 429       7.486  13.787   4.559  1.00  0.88           C  
ATOM   3498  O   MET A 429       7.630  13.074   5.555  1.00  0.88           O  
ATOM   3499  CB  MET A 429       5.594  15.088   5.415  1.00  0.88           C  
ATOM   3500  CG  MET A 429       4.941  16.440   5.728  1.00  0.88           C  
ATOM   3501  SD  MET A 429       3.397  16.290   6.681  1.00  0.88           S  
ATOM   3502  CE  MET A 429       4.213  15.897   8.245  1.00  0.88           C  
ATOM   3503  N   SER A 430       7.770  13.341   3.327  1.00  0.91           N  
ATOM   3504  CA  SER A 430       8.380  12.048   3.068  1.00  0.91           C  
ATOM   3505  C   SER A 430       9.776  11.927   3.642  1.00  0.91           C  
ATOM   3506  O   SER A 430      10.604  12.821   3.515  1.00  0.91           O  
ATOM   3507  CB  SER A 430       8.465  11.761   1.549  1.00  0.91           C  
ATOM   3508  OG  SER A 430       8.941  10.443   1.247  1.00  0.91           O  
ATOM   3509  N   VAL A 431      10.115  10.761   4.223  1.00  0.93           N  
ATOM   3510  CA  VAL A 431      11.467  10.481   4.676  1.00  0.93           C  
ATOM   3511  C   VAL A 431      12.401  10.319   3.492  1.00  0.93           C  
ATOM   3512  O   VAL A 431      13.614  10.469   3.596  1.00  0.93           O  
ATOM   3513  CB  VAL A 431      11.516   9.234   5.564  1.00  0.93           C  
ATOM   3514  CG1 VAL A 431      11.894   7.938   4.817  1.00  0.93           C  
ATOM   3515  CG2 VAL A 431      12.520   9.462   6.696  1.00  0.93           C  
ATOM   3516  N   ILE A 432      11.823  10.009   2.317  1.00  0.90           N  
ATOM   3517  CA  ILE A 432      12.534   9.864   1.070  1.00  0.90           C  
ATOM   3518  C   ILE A 432      12.528  11.196   0.338  1.00  0.90           C  
ATOM   3519  O   ILE A 432      11.476  11.733  -0.011  1.00  0.90           O  
ATOM   3520  CB  ILE A 432      11.895   8.810   0.167  1.00  0.90           C  
ATOM   3521  CG1 ILE A 432      11.683   7.452   0.876  1.00  0.90           C  
ATOM   3522  CG2 ILE A 432      12.736   8.640  -1.111  1.00  0.90           C  
ATOM   3523  CD1 ILE A 432      10.760   6.508   0.091  1.00  0.90           C  
ATOM   3524  N   GLU A 433      13.723  11.743   0.065  1.00  0.84           N  
ATOM   3525  CA  GLU A 433      13.892  12.955  -0.704  1.00  0.84           C  
ATOM   3526  C   GLU A 433      14.316  12.620  -2.124  1.00  0.84           C  
ATOM   3527  O   GLU A 433      15.334  11.965  -2.357  1.00  0.84           O  
ATOM   3528  CB  GLU A 433      14.956  13.877  -0.054  1.00  0.84           C  
ATOM   3529  CG  GLU A 433      15.230  15.184  -0.842  1.00  0.84           C  
ATOM   3530  CD  GLU A 433      16.517  15.873  -0.436  1.00  0.84           C  
ATOM   3531  OE1 GLU A 433      16.540  16.584   0.602  1.00  0.84           O  
ATOM   3532  OE2 GLU A 433      17.536  15.746  -1.167  1.00  0.84           O  
ATOM   3533  N   GLU A 434      13.536  13.089  -3.114  1.00  0.78           N  
ATOM   3534  CA  GLU A 434      13.889  13.023  -4.516  1.00  0.78           C  
ATOM   3535  C   GLU A 434      14.673  14.265  -4.934  1.00  0.78           C  
ATOM   3536  O   GLU A 434      14.685  15.286  -4.247  1.00  0.78           O  
ATOM   3537  CB  GLU A 434      12.632  12.942  -5.413  1.00  0.78           C  
ATOM   3538  CG  GLU A 434      11.617  11.831  -5.033  1.00  0.78           C  
ATOM   3539  CD  GLU A 434      12.159  10.401  -5.095  1.00  0.78           C  
ATOM   3540  OE1 GLU A 434      12.838  10.041  -6.091  1.00  0.78           O  
ATOM   3541  OE2 GLU A 434      11.866   9.624  -4.148  1.00  0.78           O  
ATOM   3542  N   GLY A 435      15.330  14.236  -6.106  1.00  0.74           N  
ATOM   3543  CA  GLY A 435      16.146  15.347  -6.583  1.00  0.74           C  
ATOM   3544  C   GLY A 435      17.239  14.809  -7.449  1.00  0.74           C  
ATOM   3545  O   GLY A 435      17.084  13.748  -8.046  1.00  0.74           O  
ATOM   3546  N   ASP A 436      18.395  15.500  -7.509  1.00  0.66           N  
ATOM   3547  CA  ASP A 436      19.586  15.071  -8.229  1.00  0.66           C  
ATOM   3548  C   ASP A 436      20.104  13.720  -7.741  1.00  0.66           C  
ATOM   3549  O   ASP A 436      20.582  12.874  -8.493  1.00  0.66           O  
ATOM   3550  CB  ASP A 436      20.716  16.105  -8.010  1.00  0.66           C  
ATOM   3551  CG  ASP A 436      20.357  17.478  -8.551  1.00  0.66           C  
ATOM   3552  OD1 ASP A 436      19.364  17.599  -9.307  1.00  0.66           O  
ATOM   3553  OD2 ASP A 436      21.077  18.428  -8.156  1.00  0.66           O  
ATOM   3554  N   CYS A 437      20.003  13.493  -6.419  1.00  0.82           N  
ATOM   3555  CA  CYS A 437      20.324  12.226  -5.813  1.00  0.82           C  
ATOM   3556  C   CYS A 437      19.231  11.897  -4.830  1.00  0.82           C  
ATOM   3557  O   CYS A 437      18.869  12.738  -4.013  1.00  0.82           O  
ATOM   3558  CB  CYS A 437      21.673  12.278  -5.060  1.00  0.82           C  
ATOM   3559  SG  CYS A 437      22.241  10.617  -4.552  1.00  0.82           S  
ATOM   3560  N   LYS A 438      18.689  10.669  -4.887  1.00  0.83           N  
ATOM   3561  CA  LYS A 438      17.665  10.206  -3.976  1.00  0.83           C  
ATOM   3562  C   LYS A 438      18.225   9.900  -2.595  1.00  0.83           C  
ATOM   3563  O   LYS A 438      19.203   9.163  -2.451  1.00  0.83           O  
ATOM   3564  CB  LYS A 438      16.984   8.955  -4.562  1.00  0.83           C  
ATOM   3565  CG  LYS A 438      15.712   8.515  -3.828  1.00  0.83           C  
ATOM   3566  CD  LYS A 438      15.092   7.278  -4.492  1.00  0.83           C  
ATOM   3567  CE  LYS A 438      13.787   6.871  -3.819  1.00  0.83           C  
ATOM   3568  NZ  LYS A 438      13.202   5.694  -4.483  1.00  0.83           N  
ATOM   3569  N   ARG A 439      17.633  10.478  -1.536  1.00  0.86           N  
ATOM   3570  CA  ARG A 439      18.199  10.444  -0.202  1.00  0.86           C  
ATOM   3571  C   ARG A 439      17.163  10.121   0.848  1.00  0.86           C  
ATOM   3572  O   ARG A 439      15.960  10.180   0.614  1.00  0.86           O  
ATOM   3573  CB  ARG A 439      18.813  11.810   0.199  1.00  0.86           C  
ATOM   3574  CG  ARG A 439      19.850  12.369  -0.788  1.00  0.86           C  
ATOM   3575  CD  ARG A 439      20.153  13.841  -0.521  1.00  0.86           C  
ATOM   3576  NE  ARG A 439      21.087  14.326  -1.578  1.00  0.86           N  
ATOM   3577  CZ  ARG A 439      22.417  14.206  -1.507  1.00  0.86           C  
ATOM   3578  NH1 ARG A 439      23.018  13.645  -0.459  1.00  0.86           N  
ATOM   3579  NH2 ARG A 439      23.163  14.676  -2.505  1.00  0.86           N  
ATOM   3580  N   ILE A 440      17.626   9.795   2.066  1.00  0.93           N  
ATOM   3581  CA  ILE A 440      16.776   9.681   3.236  1.00  0.93           C  
ATOM   3582  C   ILE A 440      17.030  10.890   4.112  1.00  0.93           C  
ATOM   3583  O   ILE A 440      18.164  11.164   4.505  1.00  0.93           O  
ATOM   3584  CB  ILE A 440      17.034   8.414   4.044  1.00  0.93           C  
ATOM   3585  CG1 ILE A 440      16.828   7.145   3.182  1.00  0.93           C  
ATOM   3586  CG2 ILE A 440      16.139   8.382   5.304  1.00  0.93           C  
ATOM   3587  CD1 ILE A 440      15.411   6.971   2.612  1.00  0.93           C  
ATOM   3588  N   ASN A 441      15.974  11.654   4.449  1.00  0.93           N  
ATOM   3589  CA  ASN A 441      16.053  12.779   5.356  1.00  0.93           C  
ATOM   3590  C   ASN A 441      16.016  12.277   6.796  1.00  0.93           C  
ATOM   3591  O   ASN A 441      15.003  11.783   7.297  1.00  0.93           O  
ATOM   3592  CB  ASN A 441      14.883  13.758   5.067  1.00  0.93           C  
ATOM   3593  CG  ASN A 441      15.027  15.082   5.814  1.00  0.93           C  
ATOM   3594  OD1 ASN A 441      15.190  15.128   7.035  1.00  0.93           O  
ATOM   3595  ND2 ASN A 441      14.982  16.206   5.065  1.00  0.93           N  
ATOM   3596  N   MET A 442      17.143  12.401   7.519  1.00  0.94           N  
ATOM   3597  CA  MET A 442      17.255  11.823   8.844  1.00  0.94           C  
ATOM   3598  C   MET A 442      16.547  12.626   9.910  1.00  0.94           C  
ATOM   3599  O   MET A 442      16.117  12.093  10.932  1.00  0.94           O  
ATOM   3600  CB  MET A 442      18.729  11.645   9.248  1.00  0.94           C  
ATOM   3601  CG  MET A 442      19.559  10.867   8.216  1.00  0.94           C  
ATOM   3602  SD  MET A 442      18.826   9.295   7.661  1.00  0.94           S  
ATOM   3603  CE  MET A 442      19.495   8.280   9.003  1.00  0.94           C  
ATOM   3604  N   ALA A 443      16.337  13.935   9.675  1.00  0.96           N  
ATOM   3605  CA  ALA A 443      15.524  14.757  10.542  1.00  0.96           C  
ATOM   3606  C   ALA A 443      14.077  14.332  10.501  1.00  0.96           C  
ATOM   3607  O   ALA A 443      13.427  14.179  11.529  1.00  0.96           O  
ATOM   3608  CB  ALA A 443      15.662  16.235  10.151  1.00  0.96           C  
ATOM   3609  N   HIS A 444      13.562  14.052   9.292  1.00  0.93           N  
ATOM   3610  CA  HIS A 444      12.233  13.507   9.113  1.00  0.93           C  
ATOM   3611  C   HIS A 444      12.074  12.137   9.756  1.00  0.93           C  
ATOM   3612  O   HIS A 444      11.101  11.900  10.466  1.00  0.93           O  
ATOM   3613  CB  HIS A 444      11.868  13.440   7.619  1.00  0.93           C  
ATOM   3614  CG  HIS A 444      11.829  14.787   6.953  1.00  0.93           C  
ATOM   3615  ND1 HIS A 444      11.440  14.835   5.638  1.00  0.93           N  
ATOM   3616  CD2 HIS A 444      12.025  16.048   7.424  1.00  0.93           C  
ATOM   3617  CE1 HIS A 444      11.391  16.112   5.321  1.00  0.93           C  
ATOM   3618  NE2 HIS A 444      11.742  16.895   6.371  1.00  0.93           N  
ATOM   3619  N   LEU A 445      13.067  11.228   9.614  1.00  0.95           N  
ATOM   3620  CA  LEU A 445      13.082   9.935  10.296  1.00  0.95           C  
ATOM   3621  C   LEU A 445      13.007  10.068  11.812  1.00  0.95           C  
ATOM   3622  O   LEU A 445      12.208   9.410  12.481  1.00  0.95           O  
ATOM   3623  CB  LEU A 445      14.372   9.156   9.921  1.00  0.95           C  
ATOM   3624  CG  LEU A 445      14.603   7.807  10.642  1.00  0.95           C  
ATOM   3625  CD1 LEU A 445      13.440   6.821  10.457  1.00  0.95           C  
ATOM   3626  CD2 LEU A 445      15.917   7.175  10.159  1.00  0.95           C  
ATOM   3627  N   CYS A 446      13.802  10.990  12.385  1.00  0.96           N  
ATOM   3628  CA  CYS A 446      13.752  11.306  13.795  1.00  0.96           C  
ATOM   3629  C   CYS A 446      12.434  11.872  14.282  1.00  0.96           C  
ATOM   3630  O   CYS A 446      11.961  11.507  15.352  1.00  0.96           O  
ATOM   3631  CB  CYS A 446      14.855  12.299  14.190  1.00  0.96           C  
ATOM   3632  SG  CYS A 446      16.478  11.513  14.361  1.00  0.96           S  
ATOM   3633  N   VAL A 447      11.791  12.780  13.528  1.00  0.95           N  
ATOM   3634  CA  VAL A 447      10.476  13.304  13.887  1.00  0.95           C  
ATOM   3635  C   VAL A 447       9.414  12.216  13.895  1.00  0.95           C  
ATOM   3636  O   VAL A 447       8.596  12.121  14.811  1.00  0.95           O  
ATOM   3637  CB  VAL A 447      10.033  14.426  12.952  1.00  0.95           C  
ATOM   3638  CG1 VAL A 447       8.594  14.887  13.255  1.00  0.95           C  
ATOM   3639  CG2 VAL A 447      10.973  15.639  13.093  1.00  0.95           C  
ATOM   3640  N   ILE A 448       9.421  11.333  12.882  1.00  0.93           N  
ATOM   3641  CA  ILE A 448       8.484  10.230  12.743  1.00  0.93           C  
ATOM   3642  C   ILE A 448       8.583   9.216  13.879  1.00  0.93           C  
ATOM   3643  O   ILE A 448       7.568   8.775  14.431  1.00  0.93           O  
ATOM   3644  CB  ILE A 448       8.723   9.554  11.392  1.00  0.93           C  
ATOM   3645  CG1 ILE A 448       8.335  10.499  10.231  1.00  0.93           C  
ATOM   3646  CG2 ILE A 448       7.973   8.211  11.280  1.00  0.93           C  
ATOM   3647  CD1 ILE A 448       8.865  10.054   8.858  1.00  0.93           C  
ATOM   3648  N   GLY A 449       9.818   8.847  14.277  1.00  0.96           N  
ATOM   3649  CA  GLY A 449      10.070   7.810  15.275  1.00  0.96           C  
ATOM   3650  C   GLY A 449      10.301   8.238  16.696  1.00  0.96           C  
ATOM   3651  O   GLY A 449      10.673   7.406  17.514  1.00  0.96           O  
ATOM   3652  N   SER A 450      10.086   9.517  17.034  1.00  0.96           N  
ATOM   3653  CA  SER A 450      10.296  10.042  18.384  1.00  0.96           C  
ATOM   3654  C   SER A 450       9.016  10.599  18.956  1.00  0.96           C  
ATOM   3655  O   SER A 450       8.202  11.144  18.215  1.00  0.96           O  
ATOM   3656  CB  SER A 450      11.289  11.228  18.389  1.00  0.96           C  
ATOM   3657  OG  SER A 450      12.623  10.765  18.188  1.00  0.96           O  
ATOM   3658  N   HIS A 451       8.783  10.517  20.287  1.00  0.92           N  
ATOM   3659  CA  HIS A 451       7.611  11.129  20.913  1.00  0.92           C  
ATOM   3660  C   HIS A 451       7.803  12.597  21.219  1.00  0.92           C  
ATOM   3661  O   HIS A 451       6.848  13.312  21.511  1.00  0.92           O  
ATOM   3662  CB  HIS A 451       7.186  10.454  22.239  1.00  0.92           C  
ATOM   3663  CG  HIS A 451       8.143  10.620  23.386  1.00  0.92           C  
ATOM   3664  ND1 HIS A 451       9.260   9.825  23.432  1.00  0.92           N  
ATOM   3665  CD2 HIS A 451       8.104  11.433  24.476  1.00  0.92           C  
ATOM   3666  CE1 HIS A 451       9.882  10.149  24.542  1.00  0.92           C  
ATOM   3667  NE2 HIS A 451       9.226  11.123  25.219  1.00  0.92           N  
ATOM   3668  N   ALA A 452       9.049  13.078  21.146  1.00  0.96           N  
ATOM   3669  CA  ALA A 452       9.367  14.455  21.406  1.00  0.96           C  
ATOM   3670  C   ALA A 452      10.457  14.919  20.469  1.00  0.96           C  
ATOM   3671  O   ALA A 452      11.436  14.216  20.204  1.00  0.96           O  
ATOM   3672  CB  ALA A 452       9.828  14.646  22.861  1.00  0.96           C  
ATOM   3673  N   VAL A 453      10.293  16.136  19.936  1.00  0.96           N  
ATOM   3674  CA  VAL A 453      11.277  16.789  19.105  1.00  0.96           C  
ATOM   3675  C   VAL A 453      11.496  18.132  19.729  1.00  0.96           C  
ATOM   3676  O   VAL A 453      10.554  18.903  19.909  1.00  0.96           O  
ATOM   3677  CB  VAL A 453      10.829  16.992  17.664  1.00  0.96           C  
ATOM   3678  CG1 VAL A 453      11.907  17.756  16.863  1.00  0.96           C  
ATOM   3679  CG2 VAL A 453      10.567  15.614  17.037  1.00  0.96           C  
ATOM   3680  N   ASN A 454      12.736  18.469  20.107  1.00  0.94           N  
ATOM   3681  CA  ASN A 454      12.986  19.751  20.715  1.00  0.94           C  
ATOM   3682  C   ASN A 454      14.021  20.570  19.995  1.00  0.94           C  
ATOM   3683  O   ASN A 454      15.054  20.083  19.537  1.00  0.94           O  
ATOM   3684  CB  ASN A 454      13.272  19.662  22.237  1.00  0.94           C  
ATOM   3685  CG  ASN A 454      14.606  19.012  22.591  1.00  0.94           C  
ATOM   3686  OD1 ASN A 454      14.698  17.804  22.794  1.00  0.94           O  
ATOM   3687  ND2 ASN A 454      15.650  19.859  22.738  1.00  0.94           N  
ATOM   3688  N   GLY A 455      13.762  21.886  19.921  1.00  0.96           N  
ATOM   3689  CA  GLY A 455      14.819  22.843  19.662  1.00  0.96           C  
ATOM   3690  C   GLY A 455      15.516  23.221  20.952  1.00  0.96           C  
ATOM   3691  O   GLY A 455      15.146  22.804  22.052  1.00  0.96           O  
ATOM   3692  N   VAL A 456      16.562  24.037  20.831  1.00  0.95           N  
ATOM   3693  CA  VAL A 456      17.632  24.140  21.801  1.00  0.95           C  
ATOM   3694  C   VAL A 456      17.820  25.579  22.326  1.00  0.95           C  
ATOM   3695  O   VAL A 456      18.708  25.892  23.125  1.00  0.95           O  
ATOM   3696  CB  VAL A 456      18.844  23.524  21.088  1.00  0.95           C  
ATOM   3697  CG1 VAL A 456      19.736  24.575  20.420  1.00  0.95           C  
ATOM   3698  CG2 VAL A 456      19.615  22.594  22.026  1.00  0.95           C  
ATOM   3699  N   ALA A 457      16.912  26.484  21.907  1.00  0.95           N  
ATOM   3700  CA  ALA A 457      16.703  27.822  22.436  1.00  0.95           C  
ATOM   3701  C   ALA A 457      15.334  28.253  21.967  1.00  0.95           C  
ATOM   3702  O   ALA A 457      14.823  27.695  20.990  1.00  0.95           O  
ATOM   3703  CB  ALA A 457      17.728  28.860  21.961  1.00  0.95           C  
ATOM   3704  N   ARG A 458      14.686  29.218  22.649  1.00  0.87           N  
ATOM   3705  CA  ARG A 458      13.296  29.576  22.403  1.00  0.87           C  
ATOM   3706  C   ARG A 458      13.016  30.061  20.991  1.00  0.87           C  
ATOM   3707  O   ARG A 458      12.085  29.606  20.331  1.00  0.87           O  
ATOM   3708  CB  ARG A 458      12.831  30.639  23.434  1.00  0.87           C  
ATOM   3709  CG  ARG A 458      11.347  31.054  23.329  1.00  0.87           C  
ATOM   3710  CD  ARG A 458      10.819  31.799  24.563  1.00  0.87           C  
ATOM   3711  NE  ARG A 458      11.543  33.101  24.600  1.00  0.87           N  
ATOM   3712  CZ  ARG A 458      11.816  33.814  25.698  1.00  0.87           C  
ATOM   3713  NH1 ARG A 458      11.387  33.499  26.911  1.00  0.87           N  
ATOM   3714  NH2 ARG A 458      12.530  34.922  25.551  1.00  0.87           N  
ATOM   3715  N   ILE A 459      13.867  30.958  20.457  1.00  0.88           N  
ATOM   3716  CA  ILE A 459      13.735  31.460  19.098  1.00  0.88           C  
ATOM   3717  C   ILE A 459      13.911  30.379  18.044  1.00  0.88           C  
ATOM   3718  O   ILE A 459      13.151  30.291  17.088  1.00  0.88           O  
ATOM   3719  CB  ILE A 459      14.666  32.643  18.870  1.00  0.88           C  
ATOM   3720  CG1 ILE A 459      14.329  33.370  17.554  1.00  0.88           C  
ATOM   3721  CG2 ILE A 459      16.146  32.216  18.920  1.00  0.88           C  
ATOM   3722  CD1 ILE A 459      15.032  34.724  17.435  1.00  0.88           C  
ATOM   3723  N   HIS A 460      14.889  29.476  18.233  1.00  0.88           N  
ATOM   3724  CA  HIS A 460      15.143  28.339  17.372  1.00  0.88           C  
ATOM   3725  C   HIS A 460      14.004  27.331  17.339  1.00  0.88           C  
ATOM   3726  O   HIS A 460      13.567  26.914  16.272  1.00  0.88           O  
ATOM   3727  CB  HIS A 460      16.468  27.683  17.804  1.00  0.88           C  
ATOM   3728  CG  HIS A 460      16.803  26.396  17.124  1.00  0.88           C  
ATOM   3729  ND1 HIS A 460      16.933  26.339  15.756  1.00  0.88           N  
ATOM   3730  CD2 HIS A 460      16.955  25.162  17.653  1.00  0.88           C  
ATOM   3731  CE1 HIS A 460      17.153  25.067  15.484  1.00  0.88           C  
ATOM   3732  NE2 HIS A 460      17.175  24.311  16.604  1.00  0.88           N  
ATOM   3733  N   SER A 461      13.418  26.957  18.497  1.00  0.92           N  
ATOM   3734  CA  SER A 461      12.245  26.082  18.516  1.00  0.92           C  
ATOM   3735  C   SER A 461      11.050  26.661  17.788  1.00  0.92           C  
ATOM   3736  O   SER A 461      10.361  25.963  17.045  1.00  0.92           O  
ATOM   3737  CB  SER A 461      11.759  25.748  19.942  1.00  0.92           C  
ATOM   3738  OG  SER A 461      12.731  24.976  20.641  1.00  0.92           O  
ATOM   3739  N   GLU A 462      10.792  27.969  17.953  1.00  0.85           N  
ATOM   3740  CA  GLU A 462       9.768  28.654  17.193  1.00  0.85           C  
ATOM   3741  C   GLU A 462      10.056  28.718  15.698  1.00  0.85           C  
ATOM   3742  O   GLU A 462       9.171  28.466  14.884  1.00  0.85           O  
ATOM   3743  CB  GLU A 462       9.485  30.060  17.772  1.00  0.85           C  
ATOM   3744  CG  GLU A 462       8.810  30.034  19.171  1.00  0.85           C  
ATOM   3745  CD  GLU A 462       7.650  29.054  19.261  1.00  0.85           C  
ATOM   3746  OE1 GLU A 462       6.663  29.157  18.488  1.00  0.85           O  
ATOM   3747  OE2 GLU A 462       7.717  28.103  20.086  1.00  0.85           O  
ATOM   3748  N   ILE A 463      11.317  28.976  15.281  1.00  0.82           N  
ATOM   3749  CA  ILE A 463      11.725  28.899  13.879  1.00  0.82           C  
ATOM   3750  C   ILE A 463      11.494  27.507  13.303  1.00  0.82           C  
ATOM   3751  O   ILE A 463      10.927  27.371  12.223  1.00  0.82           O  
ATOM   3752  CB  ILE A 463      13.188  29.307  13.671  1.00  0.82           C  
ATOM   3753  CG1 ILE A 463      13.390  30.811  13.976  1.00  0.82           C  
ATOM   3754  CG2 ILE A 463      13.652  29.004  12.226  1.00  0.82           C  
ATOM   3755  CD1 ILE A 463      14.867  31.213  14.087  1.00  0.82           C  
ATOM   3756  N   VAL A 464      11.844  26.432  14.037  1.00  0.88           N  
ATOM   3757  CA  VAL A 464      11.612  25.045  13.644  1.00  0.88           C  
ATOM   3758  C   VAL A 464      10.142  24.750  13.354  1.00  0.88           C  
ATOM   3759  O   VAL A 464       9.805  24.150  12.333  1.00  0.88           O  
ATOM   3760  CB  VAL A 464      12.124  24.111  14.750  1.00  0.88           C  
ATOM   3761  CG1 VAL A 464      11.544  22.692  14.671  1.00  0.88           C  
ATOM   3762  CG2 VAL A 464      13.662  24.037  14.694  1.00  0.88           C  
ATOM   3763  N   LYS A 465       9.224  25.219  14.224  1.00  0.84           N  
ATOM   3764  CA  LYS A 465       7.788  25.057  14.067  1.00  0.84           C  
ATOM   3765  C   LYS A 465       7.195  25.892  12.936  1.00  0.84           C  
ATOM   3766  O   LYS A 465       6.111  25.587  12.444  1.00  0.84           O  
ATOM   3767  CB  LYS A 465       7.076  25.482  15.376  1.00  0.84           C  
ATOM   3768  CG  LYS A 465       7.220  24.504  16.558  1.00  0.84           C  
ATOM   3769  CD  LYS A 465       6.945  25.172  17.922  1.00  0.84           C  
ATOM   3770  CE  LYS A 465       5.645  25.984  17.976  1.00  0.84           C  
ATOM   3771  NZ  LYS A 465       5.588  26.766  19.218  1.00  0.84           N  
ATOM   3772  N   GLN A 466       7.873  26.969  12.499  1.00  0.78           N  
ATOM   3773  CA  GLN A 466       7.357  27.832  11.451  1.00  0.78           C  
ATOM   3774  C   GLN A 466       8.040  27.639  10.106  1.00  0.78           C  
ATOM   3775  O   GLN A 466       7.504  28.062   9.084  1.00  0.78           O  
ATOM   3776  CB  GLN A 466       7.506  29.319  11.862  1.00  0.78           C  
ATOM   3777  CG  GLN A 466       6.686  29.727  13.112  1.00  0.78           C  
ATOM   3778  CD  GLN A 466       5.185  29.499  12.929  1.00  0.78           C  
ATOM   3779  OE1 GLN A 466       4.569  29.890  11.938  1.00  0.78           O  
ATOM   3780  NE2 GLN A 466       4.553  28.842  13.930  1.00  0.78           N  
ATOM   3781  N   SER A 467       9.211  26.976  10.040  1.00  0.83           N  
ATOM   3782  CA  SER A 467       9.907  26.750   8.775  1.00  0.83           C  
ATOM   3783  C   SER A 467      10.051  25.277   8.426  1.00  0.83           C  
ATOM   3784  O   SER A 467       9.132  24.653   7.903  1.00  0.83           O  
ATOM   3785  CB  SER A 467      11.275  27.510   8.698  1.00  0.83           C  
ATOM   3786  OG  SER A 467      12.265  27.036   9.621  1.00  0.83           O  
ATOM   3787  N   VAL A 468      11.218  24.667   8.684  1.00  0.82           N  
ATOM   3788  CA  VAL A 468      11.591  23.338   8.222  1.00  0.82           C  
ATOM   3789  C   VAL A 468      10.730  22.198   8.734  1.00  0.82           C  
ATOM   3790  O   VAL A 468      10.460  21.237   8.015  1.00  0.82           O  
ATOM   3791  CB  VAL A 468      13.074  23.070   8.468  1.00  0.82           C  
ATOM   3792  CG1 VAL A 468      13.432  23.092   9.969  1.00  0.82           C  
ATOM   3793  CG2 VAL A 468      13.523  21.752   7.801  1.00  0.82           C  
ATOM   3794  N   PHE A 469      10.256  22.261   9.991  1.00  0.89           N  
ATOM   3795  CA  PHE A 469       9.434  21.206  10.556  1.00  0.89           C  
ATOM   3796  C   PHE A 469       7.995  21.668  10.712  1.00  0.89           C  
ATOM   3797  O   PHE A 469       7.224  21.072  11.462  1.00  0.89           O  
ATOM   3798  CB  PHE A 469       9.982  20.693  11.917  1.00  0.89           C  
ATOM   3799  CG  PHE A 469      11.355  20.051  11.860  1.00  0.89           C  
ATOM   3800  CD1 PHE A 469      11.985  19.637  10.670  1.00  0.89           C  
ATOM   3801  CD2 PHE A 469      12.053  19.863  13.066  1.00  0.89           C  
ATOM   3802  CE1 PHE A 469      13.310  19.188  10.676  1.00  0.89           C  
ATOM   3803  CE2 PHE A 469      13.373  19.405  13.087  1.00  0.89           C  
ATOM   3804  CZ  PHE A 469      14.011  19.094  11.883  1.00  0.89           C  
ATOM   3805  N   LYS A 470       7.574  22.716   9.968  1.00  0.87           N  
ATOM   3806  CA  LYS A 470       6.221  23.254  10.019  1.00  0.87           C  
ATOM   3807  C   LYS A 470       5.148  22.251   9.653  1.00  0.87           C  
ATOM   3808  O   LYS A 470       4.169  22.095  10.376  1.00  0.87           O  
ATOM   3809  CB  LYS A 470       6.071  24.472   9.075  1.00  0.87           C  
ATOM   3810  CG  LYS A 470       4.714  25.195   9.173  1.00  0.87           C  
ATOM   3811  CD  LYS A 470       4.585  26.314   8.130  1.00  0.87           C  
ATOM   3812  CE  LYS A 470       3.301  27.140   8.251  1.00  0.87           C  
ATOM   3813  NZ  LYS A 470       2.111  26.311   7.981  1.00  0.87           N  
ATOM   3814  N   ASP A 471       5.329  21.478   8.562  1.00  0.92           N  
ATOM   3815  CA  ASP A 471       4.376  20.458   8.169  1.00  0.92           C  
ATOM   3816  C   ASP A 471       4.173  19.382   9.230  1.00  0.92           C  
ATOM   3817  O   ASP A 471       3.059  18.916   9.484  1.00  0.92           O  
ATOM   3818  CB  ASP A 471       4.824  19.752   6.875  1.00  0.92           C  
ATOM   3819  CG  ASP A 471       4.701  20.663   5.676  1.00  0.92           C  
ATOM   3820  OD1 ASP A 471       3.603  21.238   5.464  1.00  0.92           O  
ATOM   3821  OD2 ASP A 471       5.667  20.749   4.882  1.00  0.92           O  
ATOM   3822  N   PHE A 472       5.280  18.975   9.871  1.00  0.93           N  
ATOM   3823  CA  PHE A 472       5.315  18.018  10.952  1.00  0.93           C  
ATOM   3824  C   PHE A 472       4.659  18.525  12.221  1.00  0.93           C  
ATOM   3825  O   PHE A 472       3.921  17.796  12.878  1.00  0.93           O  
ATOM   3826  CB  PHE A 472       6.769  17.608  11.262  1.00  0.93           C  
ATOM   3827  CG  PHE A 472       7.409  16.910  10.090  1.00  0.93           C  
ATOM   3828  CD1 PHE A 472       8.095  17.648   9.110  1.00  0.93           C  
ATOM   3829  CD2 PHE A 472       7.350  15.510   9.966  1.00  0.93           C  
ATOM   3830  CE1 PHE A 472       8.693  17.006   8.020  1.00  0.93           C  
ATOM   3831  CE2 PHE A 472       7.958  14.862   8.882  1.00  0.93           C  
ATOM   3832  CZ  PHE A 472       8.626  15.613   7.908  1.00  0.93           C  
ATOM   3833  N   TYR A 473       4.879  19.806  12.578  1.00  0.91           N  
ATOM   3834  CA  TYR A 473       4.210  20.460  13.689  1.00  0.91           C  
ATOM   3835  C   TYR A 473       2.697  20.488  13.516  1.00  0.91           C  
ATOM   3836  O   TYR A 473       1.948  20.250  14.454  1.00  0.91           O  
ATOM   3837  CB  TYR A 473       4.799  21.888  13.868  1.00  0.91           C  
ATOM   3838  CG  TYR A 473       4.062  22.722  14.885  1.00  0.91           C  
ATOM   3839  CD1 TYR A 473       4.077  22.380  16.246  1.00  0.91           C  
ATOM   3840  CD2 TYR A 473       3.295  23.821  14.464  1.00  0.91           C  
ATOM   3841  CE1 TYR A 473       3.339  23.126  17.175  1.00  0.91           C  
ATOM   3842  CE2 TYR A 473       2.547  24.563  15.388  1.00  0.91           C  
ATOM   3843  CZ  TYR A 473       2.567  24.210  16.742  1.00  0.91           C  
ATOM   3844  OH  TYR A 473       1.823  24.960  17.672  1.00  0.91           O  
ATOM   3845  N   GLU A 474       2.204  20.752  12.300  1.00  0.88           N  
ATOM   3846  CA  GLU A 474       0.786  20.680  12.010  1.00  0.88           C  
ATOM   3847  C   GLU A 474       0.191  19.281  12.156  1.00  0.88           C  
ATOM   3848  O   GLU A 474      -0.920  19.111  12.647  1.00  0.88           O  
ATOM   3849  CB  GLU A 474       0.516  21.254  10.610  1.00  0.88           C  
ATOM   3850  CG  GLU A 474       0.959  22.732  10.517  1.00  0.88           C  
ATOM   3851  CD  GLU A 474       0.710  23.371   9.161  1.00  0.88           C  
ATOM   3852  OE1 GLU A 474       0.791  22.675   8.117  1.00  0.88           O  
ATOM   3853  OE2 GLU A 474       0.509  24.614   9.136  1.00  0.88           O  
ATOM   3854  N   LEU A 475       0.926  18.230  11.736  1.00  0.88           N  
ATOM   3855  CA  LEU A 475       0.513  16.849  11.930  1.00  0.88           C  
ATOM   3856  C   LEU A 475       0.511  16.363  13.378  1.00  0.88           C  
ATOM   3857  O   LEU A 475      -0.439  15.729  13.834  1.00  0.88           O  
ATOM   3858  CB  LEU A 475       1.448  15.928  11.111  1.00  0.88           C  
ATOM   3859  CG  LEU A 475       1.046  14.438  11.062  1.00  0.88           C  
ATOM   3860  CD1 LEU A 475      -0.228  14.204  10.251  1.00  0.88           C  
ATOM   3861  CD2 LEU A 475       2.193  13.598  10.496  1.00  0.88           C  
ATOM   3862  N   GLU A 476       1.585  16.648  14.139  1.00  0.87           N  
ATOM   3863  CA  GLU A 476       1.755  16.143  15.491  1.00  0.87           C  
ATOM   3864  C   GLU A 476       2.253  17.267  16.407  1.00  0.87           C  
ATOM   3865  O   GLU A 476       3.417  17.242  16.817  1.00  0.87           O  
ATOM   3866  CB  GLU A 476       2.749  14.936  15.529  1.00  0.87           C  
ATOM   3867  CG  GLU A 476       2.262  13.656  14.780  1.00  0.87           C  
ATOM   3868  CD  GLU A 476       3.315  12.553  14.679  1.00  0.87           C  
ATOM   3869  OE1 GLU A 476       4.379  12.801  14.049  1.00  0.87           O  
ATOM   3870  OE2 GLU A 476       3.158  11.445  15.278  1.00  0.87           O  
ATOM   3871  N   PRO A 477       1.437  18.272  16.773  1.00  0.92           N  
ATOM   3872  CA  PRO A 477       1.891  19.474  17.483  1.00  0.92           C  
ATOM   3873  C   PRO A 477       2.452  19.192  18.854  1.00  0.92           C  
ATOM   3874  O   PRO A 477       3.363  19.892  19.290  1.00  0.92           O  
ATOM   3875  CB  PRO A 477       0.633  20.365  17.549  1.00  0.92           C  
ATOM   3876  CG  PRO A 477      -0.541  19.395  17.392  1.00  0.92           C  
ATOM   3877  CD  PRO A 477       0.018  18.374  16.405  1.00  0.92           C  
ATOM   3878  N   GLU A 478       1.927  18.163  19.535  1.00  0.86           N  
ATOM   3879  CA  GLU A 478       2.304  17.729  20.863  1.00  0.86           C  
ATOM   3880  C   GLU A 478       3.761  17.314  21.006  1.00  0.86           C  
ATOM   3881  O   GLU A 478       4.366  17.453  22.066  1.00  0.86           O  
ATOM   3882  CB  GLU A 478       1.405  16.536  21.249  1.00  0.86           C  
ATOM   3883  CG  GLU A 478      -0.074  16.929  21.480  1.00  0.86           C  
ATOM   3884  CD  GLU A 478      -0.959  15.729  21.816  1.00  0.86           C  
ATOM   3885  OE1 GLU A 478      -0.469  14.575  21.738  1.00  0.86           O  
ATOM   3886  OE2 GLU A 478      -2.149  15.982  22.134  1.00  0.86           O  
ATOM   3887  N   LYS A 479       4.380  16.797  19.927  1.00  0.90           N  
ATOM   3888  CA  LYS A 479       5.781  16.420  19.930  1.00  0.90           C  
ATOM   3889  C   LYS A 479       6.752  17.568  20.131  1.00  0.90           C  
ATOM   3890  O   LYS A 479       7.845  17.387  20.668  1.00  0.90           O  
ATOM   3891  CB  LYS A 479       6.163  15.742  18.596  1.00  0.90           C  
ATOM   3892  CG  LYS A 479       5.583  14.335  18.445  1.00  0.90           C  
ATOM   3893  CD  LYS A 479       6.135  13.660  17.185  1.00  0.90           C  
ATOM   3894  CE  LYS A 479       5.631  12.232  17.011  1.00  0.90           C  
ATOM   3895  NZ  LYS A 479       6.093  11.707  15.715  1.00  0.90           N  
ATOM   3896  N   PHE A 480       6.414  18.771  19.645  1.00  0.92           N  
ATOM   3897  CA  PHE A 480       7.379  19.837  19.525  1.00  0.92           C  
ATOM   3898  C   PHE A 480       7.539  20.654  20.786  1.00  0.92           C  
ATOM   3899  O   PHE A 480       6.627  21.316  21.278  1.00  0.92           O  
ATOM   3900  CB  PHE A 480       7.058  20.771  18.340  1.00  0.92           C  
ATOM   3901  CG  PHE A 480       7.294  20.023  17.061  1.00  0.92           C  
ATOM   3902  CD1 PHE A 480       6.312  19.170  16.533  1.00  0.92           C  
ATOM   3903  CD2 PHE A 480       8.536  20.116  16.415  1.00  0.92           C  
ATOM   3904  CE1 PHE A 480       6.578  18.388  15.404  1.00  0.92           C  
ATOM   3905  CE2 PHE A 480       8.803  19.340  15.281  1.00  0.92           C  
ATOM   3906  CZ  PHE A 480       7.827  18.472  14.778  1.00  0.92           C  
ATOM   3907  N   GLN A 481       8.768  20.642  21.318  1.00  0.91           N  
ATOM   3908  CA  GLN A 481       9.100  21.282  22.564  1.00  0.91           C  
ATOM   3909  C   GLN A 481      10.288  22.214  22.398  1.00  0.91           C  
ATOM   3910  O   GLN A 481      10.990  22.269  21.388  1.00  0.91           O  
ATOM   3911  CB  GLN A 481       9.446  20.240  23.662  1.00  0.91           C  
ATOM   3912  CG  GLN A 481       8.270  19.319  24.069  1.00  0.91           C  
ATOM   3913  CD  GLN A 481       8.675  18.419  25.239  1.00  0.91           C  
ATOM   3914  OE1 GLN A 481       9.562  18.764  26.023  1.00  0.91           O  
ATOM   3915  NE2 GLN A 481       8.012  17.249  25.364  1.00  0.91           N  
ATOM   3916  N   ASN A 482      10.556  23.003  23.444  1.00  0.93           N  
ATOM   3917  CA  ASN A 482      11.753  23.794  23.566  1.00  0.93           C  
ATOM   3918  C   ASN A 482      12.486  23.302  24.790  1.00  0.93           C  
ATOM   3919  O   ASN A 482      11.873  22.994  25.808  1.00  0.93           O  
ATOM   3920  CB  ASN A 482      11.409  25.308  23.664  1.00  0.93           C  
ATOM   3921  CG  ASN A 482      12.611  26.193  23.991  1.00  0.93           C  
ATOM   3922  OD1 ASN A 482      12.535  27.047  24.868  1.00  0.93           O  
ATOM   3923  ND2 ASN A 482      13.749  25.972  23.301  1.00  0.93           N  
ATOM   3924  N   LYS A 483      13.817  23.192  24.687  1.00  0.93           N  
ATOM   3925  CA  LYS A 483      14.678  23.002  25.827  1.00  0.93           C  
ATOM   3926  C   LYS A 483      15.869  23.916  25.651  1.00  0.93           C  
ATOM   3927  O   LYS A 483      16.882  23.522  25.078  1.00  0.93           O  
ATOM   3928  CB  LYS A 483      15.175  21.537  25.918  1.00  0.93           C  
ATOM   3929  CG  LYS A 483      14.069  20.511  26.214  1.00  0.93           C  
ATOM   3930  CD  LYS A 483      13.549  20.636  27.653  1.00  0.93           C  
ATOM   3931  CE  LYS A 483      12.208  19.947  27.904  1.00  0.93           C  
ATOM   3932  NZ  LYS A 483      11.107  20.705  27.304  1.00  0.93           N  
ATOM   3933  N   THR A 484      15.783  25.182  26.119  1.00  0.95           N  
ATOM   3934  CA  THR A 484      16.877  26.149  26.018  1.00  0.95           C  
ATOM   3935  C   THR A 484      18.133  25.649  26.682  1.00  0.95           C  
ATOM   3936  O   THR A 484      18.109  25.250  27.841  1.00  0.95           O  
ATOM   3937  CB  THR A 484      16.514  27.520  26.583  1.00  0.95           C  
ATOM   3938  OG1 THR A 484      15.418  28.021  25.836  1.00  0.95           O  
ATOM   3939  CG2 THR A 484      17.659  28.543  26.470  1.00  0.95           C  
ATOM   3940  N   ASN A 485      19.264  25.620  25.951  1.00  0.94           N  
ATOM   3941  CA  ASN A 485      20.560  25.203  26.457  1.00  0.94           C  
ATOM   3942  C   ASN A 485      21.015  25.782  27.785  1.00  0.94           C  
ATOM   3943  O   ASN A 485      20.513  26.778  28.304  1.00  0.94           O  
ATOM   3944  CB  ASN A 485      21.694  25.411  25.419  1.00  0.94           C  
ATOM   3945  CG  ASN A 485      21.631  24.311  24.383  1.00  0.94           C  
ATOM   3946  OD1 ASN A 485      21.156  23.221  24.689  1.00  0.94           O  
ATOM   3947  ND2 ASN A 485      22.181  24.570  23.176  1.00  0.94           N  
ATOM   3948  N   GLY A 486      22.008  25.102  28.376  1.00  0.97           N  
ATOM   3949  CA  GLY A 486      22.663  25.583  29.567  1.00  0.97           C  
ATOM   3950  C   GLY A 486      24.064  25.073  29.605  1.00  0.97           C  
ATOM   3951  O   GLY A 486      24.466  24.232  28.801  1.00  0.97           O  
ATOM   3952  N   ILE A 487      24.836  25.546  30.584  1.00  0.96           N  
ATOM   3953  CA  ILE A 487      26.202  25.133  30.819  1.00  0.96           C  
ATOM   3954  C   ILE A 487      26.315  24.726  32.267  1.00  0.96           C  
ATOM   3955  O   ILE A 487      25.556  25.184  33.118  1.00  0.96           O  
ATOM   3956  CB  ILE A 487      27.198  26.244  30.527  1.00  0.96           C  
ATOM   3957  CG1 ILE A 487      26.889  27.491  31.388  1.00  0.96           C  
ATOM   3958  CG2 ILE A 487      27.133  26.545  29.015  1.00  0.96           C  
ATOM   3959  CD1 ILE A 487      27.849  28.645  31.155  1.00  0.96           C  
ATOM   3960  N   THR A 488      27.254  23.827  32.617  1.00  0.97           N  
ATOM   3961  CA  THR A 488      27.408  23.436  34.019  1.00  0.97           C  
ATOM   3962  C   THR A 488      28.121  24.520  34.828  1.00  0.97           C  
ATOM   3963  O   THR A 488      29.224  24.932  34.454  1.00  0.97           O  
ATOM   3964  CB  THR A 488      28.068  22.071  34.262  1.00  0.97           C  
ATOM   3965  OG1 THR A 488      28.456  21.870  35.623  1.00  0.97           O  
ATOM   3966  CG2 THR A 488      29.336  21.920  33.423  1.00  0.97           C  
ATOM   3967  N   PRO A 489      27.580  25.001  35.948  1.00  0.98           N  
ATOM   3968  CA  PRO A 489      28.240  26.011  36.763  1.00  0.98           C  
ATOM   3969  C   PRO A 489      29.372  25.435  37.580  1.00  0.98           C  
ATOM   3970  O   PRO A 489      30.129  26.198  38.178  1.00  0.98           O  
ATOM   3971  CB  PRO A 489      27.110  26.504  37.673  1.00  0.98           C  
ATOM   3972  CG  PRO A 489      26.201  25.289  37.847  1.00  0.98           C  
ATOM   3973  CD  PRO A 489      26.245  24.659  36.461  1.00  0.98           C  
ATOM   3974  N   ARG A 490      29.544  24.101  37.647  1.00  0.92           N  
ATOM   3975  CA  ARG A 490      30.719  23.560  38.306  1.00  0.92           C  
ATOM   3976  C   ARG A 490      31.950  23.814  37.456  1.00  0.92           C  
ATOM   3977  O   ARG A 490      32.890  24.482  37.867  1.00  0.92           O  
ATOM   3978  CB  ARG A 490      30.602  22.037  38.561  1.00  0.92           C  
ATOM   3979  CG  ARG A 490      29.838  21.660  39.847  1.00  0.92           C  
ATOM   3980  CD  ARG A 490      28.351  22.012  39.883  1.00  0.92           C  
ATOM   3981  NE  ARG A 490      27.684  21.219  38.811  1.00  0.92           N  
ATOM   3982  CZ  ARG A 490      26.369  21.281  38.577  1.00  0.92           C  
ATOM   3983  NH1 ARG A 490      25.570  22.102  39.246  1.00  0.92           N  
ATOM   3984  NH2 ARG A 490      25.854  20.493  37.644  1.00  0.92           N  
ATOM   3985  N   ARG A 491      31.951  23.352  36.196  1.00  0.92           N  
ATOM   3986  CA  ARG A 491      33.055  23.628  35.296  1.00  0.92           C  
ATOM   3987  C   ARG A 491      33.164  25.072  34.847  1.00  0.92           C  
ATOM   3988  O   ARG A 491      34.249  25.650  34.839  1.00  0.92           O  
ATOM   3989  CB  ARG A 491      33.023  22.664  34.099  1.00  0.92           C  
ATOM   3990  CG  ARG A 491      33.921  23.072  32.922  1.00  0.92           C  
ATOM   3991  CD  ARG A 491      34.021  21.970  31.874  1.00  0.92           C  
ATOM   3992  NE  ARG A 491      35.390  21.428  31.954  1.00  0.92           N  
ATOM   3993  CZ  ARG A 491      35.819  20.259  32.431  1.00  0.92           C  
ATOM   3994  NH1 ARG A 491      35.029  19.292  32.879  1.00  0.92           N  
ATOM   3995  NH2 ARG A 491      37.135  20.098  32.460  1.00  0.92           N  
ATOM   3996  N   TRP A 492      32.043  25.716  34.489  1.00  0.93           N  
ATOM   3997  CA  TRP A 492      32.094  27.021  33.855  1.00  0.93           C  
ATOM   3998  C   TRP A 492      31.947  28.174  34.826  1.00  0.93           C  
ATOM   3999  O   TRP A 492      31.683  29.305  34.425  1.00  0.93           O  
ATOM   4000  CB  TRP A 492      31.079  27.123  32.695  1.00  0.93           C  
ATOM   4001  CG  TRP A 492      31.345  26.091  31.617  1.00  0.93           C  
ATOM   4002  CD1 TRP A 492      30.656  24.945  31.336  1.00  0.93           C  
ATOM   4003  CD2 TRP A 492      32.492  26.095  30.749  1.00  0.93           C  
ATOM   4004  NE1 TRP A 492      31.273  24.247  30.317  1.00  0.93           N  
ATOM   4005  CE2 TRP A 492      32.413  24.931  29.960  1.00  0.93           C  
ATOM   4006  CE3 TRP A 492      33.557  26.985  30.619  1.00  0.93           C  
ATOM   4007  CZ2 TRP A 492      33.396  24.631  29.029  1.00  0.93           C  
ATOM   4008  CZ3 TRP A 492      34.560  26.671  29.689  1.00  0.93           C  
ATOM   4009  CH2 TRP A 492      34.483  25.509  28.908  1.00  0.93           C  
ATOM   4010  N   LEU A 493      32.186  27.912  36.121  1.00  0.96           N  
ATOM   4011  CA  LEU A 493      32.323  28.949  37.119  1.00  0.96           C  
ATOM   4012  C   LEU A 493      33.309  28.507  38.187  1.00  0.96           C  
ATOM   4013  O   LEU A 493      34.380  29.086  38.325  1.00  0.96           O  
ATOM   4014  CB  LEU A 493      30.950  29.257  37.753  1.00  0.96           C  
ATOM   4015  CG  LEU A 493      30.729  30.698  38.247  1.00  0.96           C  
ATOM   4016  CD1 LEU A 493      29.450  30.698  39.085  1.00  0.96           C  
ATOM   4017  CD2 LEU A 493      31.886  31.289  39.059  1.00  0.96           C  
ATOM   4018  N   LEU A 494      32.991  27.445  38.964  1.00  0.95           N  
ATOM   4019  CA  LEU A 494      33.816  27.003  40.086  1.00  0.95           C  
ATOM   4020  C   LEU A 494      35.228  26.591  39.692  1.00  0.95           C  
ATOM   4021  O   LEU A 494      36.198  26.950  40.355  1.00  0.95           O  
ATOM   4022  CB  LEU A 494      33.110  25.845  40.847  1.00  0.95           C  
ATOM   4023  CG  LEU A 494      33.819  25.290  42.104  1.00  0.95           C  
ATOM   4024  CD1 LEU A 494      33.977  26.348  43.203  1.00  0.95           C  
ATOM   4025  CD2 LEU A 494      33.053  24.077  42.659  1.00  0.95           C  
ATOM   4026  N   LEU A 495      35.390  25.844  38.583  1.00  0.92           N  
ATOM   4027  CA  LEU A 495      36.714  25.476  38.116  1.00  0.92           C  
ATOM   4028  C   LEU A 495      37.448  26.587  37.398  1.00  0.92           C  
ATOM   4029  O   LEU A 495      38.587  26.916  37.718  1.00  0.92           O  
ATOM   4030  CB  LEU A 495      36.647  24.301  37.111  1.00  0.92           C  
ATOM   4031  CG  LEU A 495      35.950  23.028  37.605  1.00  0.92           C  
ATOM   4032  CD1 LEU A 495      36.286  21.876  36.651  1.00  0.92           C  
ATOM   4033  CD2 LEU A 495      36.301  22.708  39.049  1.00  0.92           C  
ATOM   4034  N   CYS A 496      36.803  27.211  36.394  1.00  0.94           N  
ATOM   4035  CA  CYS A 496      37.494  28.146  35.528  1.00  0.94           C  
ATOM   4036  C   CYS A 496      37.742  29.497  36.170  1.00  0.94           C  
ATOM   4037  O   CYS A 496      38.690  30.208  35.842  1.00  0.94           O  
ATOM   4038  CB  CYS A 496      36.725  28.305  34.191  1.00  0.94           C  
ATOM   4039  SG  CYS A 496      35.098  29.113  34.310  1.00  0.94           S  
ATOM   4040  N   ASN A 497      36.900  29.872  37.143  1.00  0.93           N  
ATOM   4041  CA  ASN A 497      36.955  31.177  37.752  1.00  0.93           C  
ATOM   4042  C   ASN A 497      36.741  31.079  39.257  1.00  0.93           C  
ATOM   4043  O   ASN A 497      35.744  31.596  39.773  1.00  0.93           O  
ATOM   4044  CB  ASN A 497      35.865  32.033  37.080  1.00  0.93           C  
ATOM   4045  CG  ASN A 497      36.091  33.527  37.236  1.00  0.93           C  
ATOM   4046  OD1 ASN A 497      36.880  34.026  38.040  1.00  0.93           O  
ATOM   4047  ND2 ASN A 497      35.351  34.300  36.408  1.00  0.93           N  
ATOM   4048  N   PRO A 498      37.649  30.450  40.013  1.00  0.94           N  
ATOM   4049  CA  PRO A 498      37.528  30.313  41.461  1.00  0.94           C  
ATOM   4050  C   PRO A 498      37.473  31.651  42.153  1.00  0.94           C  
ATOM   4051  O   PRO A 498      36.735  31.787  43.117  1.00  0.94           O  
ATOM   4052  CB  PRO A 498      38.770  29.501  41.861  1.00  0.94           C  
ATOM   4053  CG  PRO A 498      39.796  29.810  40.767  1.00  0.94           C  
ATOM   4054  CD  PRO A 498      38.917  29.895  39.525  1.00  0.94           C  
ATOM   4055  N   GLY A 499      38.188  32.677  41.651  1.00  0.93           N  
ATOM   4056  CA  GLY A 499      38.153  34.003  42.256  1.00  0.93           C  
ATOM   4057  C   GLY A 499      36.804  34.672  42.177  1.00  0.93           C  
ATOM   4058  O   GLY A 499      36.366  35.331  43.111  1.00  0.93           O  
ATOM   4059  N   LEU A 500      36.054  34.494  41.069  1.00  0.93           N  
ATOM   4060  CA  LEU A 500      34.681  34.965  41.007  1.00  0.93           C  
ATOM   4061  C   LEU A 500      33.768  34.151  41.892  1.00  0.93           C  
ATOM   4062  O   LEU A 500      32.922  34.695  42.596  1.00  0.93           O  
ATOM   4063  CB  LEU A 500      34.129  34.983  39.565  1.00  0.93           C  
ATOM   4064  CG  LEU A 500      32.759  35.671  39.391  1.00  0.93           C  
ATOM   4065  CD1 LEU A 500      32.798  37.156  39.783  1.00  0.93           C  
ATOM   4066  CD2 LEU A 500      32.270  35.519  37.946  1.00  0.93           C  
ATOM   4067  N   ALA A 501      33.949  32.815  41.905  1.00  0.94           N  
ATOM   4068  CA  ALA A 501      33.174  31.924  42.739  1.00  0.94           C  
ATOM   4069  C   ALA A 501      33.310  32.236  44.218  1.00  0.94           C  
ATOM   4070  O   ALA A 501      32.302  32.386  44.899  1.00  0.94           O  
ATOM   4071  CB  ALA A 501      33.591  30.467  42.474  1.00  0.94           C  
ATOM   4072  N   ASP A 502      34.538  32.450  44.713  1.00  0.89           N  
ATOM   4073  CA  ASP A 502      34.831  32.861  46.071  1.00  0.89           C  
ATOM   4074  C   ASP A 502      34.196  34.206  46.438  1.00  0.89           C  
ATOM   4075  O   ASP A 502      33.481  34.306  47.435  1.00  0.89           O  
ATOM   4076  CB  ASP A 502      36.369  32.934  46.231  1.00  0.89           C  
ATOM   4077  CG  ASP A 502      37.009  31.551  46.265  1.00  0.89           C  
ATOM   4078  OD1 ASP A 502      36.275  30.544  46.427  1.00  0.89           O  
ATOM   4079  OD2 ASP A 502      38.261  31.499  46.143  1.00  0.89           O  
ATOM   4080  N   THR A 503      34.331  35.248  45.580  1.00  0.87           N  
ATOM   4081  CA  THR A 503      33.691  36.557  45.774  1.00  0.87           C  
ATOM   4082  C   THR A 503      32.173  36.455  45.843  1.00  0.87           C  
ATOM   4083  O   THR A 503      31.513  37.122  46.639  1.00  0.87           O  
ATOM   4084  CB  THR A 503      34.061  37.555  44.669  1.00  0.87           C  
ATOM   4085  OG1 THR A 503      35.460  37.781  44.671  1.00  0.87           O  
ATOM   4086  CG2 THR A 503      33.421  38.939  44.855  1.00  0.87           C  
ATOM   4087  N   ILE A 504      31.544  35.596  45.014  1.00  0.89           N  
ATOM   4088  CA  ILE A 504      30.124  35.282  45.129  1.00  0.89           C  
ATOM   4089  C   ILE A 504      29.769  34.537  46.422  1.00  0.89           C  
ATOM   4090  O   ILE A 504      28.818  34.906  47.115  1.00  0.89           O  
ATOM   4091  CB  ILE A 504      29.646  34.499  43.903  1.00  0.89           C  
ATOM   4092  CG1 ILE A 504      29.749  35.379  42.631  1.00  0.89           C  
ATOM   4093  CG2 ILE A 504      28.202  33.986  44.096  1.00  0.89           C  
ATOM   4094  CD1 ILE A 504      29.348  34.649  41.342  1.00  0.89           C  
ATOM   4095  N   VAL A 505      30.541  33.495  46.810  1.00  0.88           N  
ATOM   4096  CA  VAL A 505      30.296  32.660  47.989  1.00  0.88           C  
ATOM   4097  C   VAL A 505      30.298  33.463  49.270  1.00  0.88           C  
ATOM   4098  O   VAL A 505      29.416  33.298  50.112  1.00  0.88           O  
ATOM   4099  CB  VAL A 505      31.318  31.525  48.125  1.00  0.88           C  
ATOM   4100  CG1 VAL A 505      31.234  30.805  49.488  1.00  0.88           C  
ATOM   4101  CG2 VAL A 505      31.092  30.481  47.021  1.00  0.88           C  
ATOM   4102  N   GLU A 506      31.242  34.414  49.414  1.00  0.83           N  
ATOM   4103  CA  GLU A 506      31.337  35.319  50.549  1.00  0.83           C  
ATOM   4104  C   GLU A 506      30.051  36.080  50.828  1.00  0.83           C  
ATOM   4105  O   GLU A 506      29.719  36.402  51.966  1.00  0.83           O  
ATOM   4106  CB  GLU A 506      32.428  36.375  50.273  1.00  0.83           C  
ATOM   4107  CG  GLU A 506      33.875  35.861  50.427  1.00  0.83           C  
ATOM   4108  CD  GLU A 506      34.876  36.965  50.093  1.00  0.83           C  
ATOM   4109  OE1 GLU A 506      34.508  38.162  50.250  1.00  0.83           O  
ATOM   4110  OE2 GLU A 506      36.016  36.617  49.700  1.00  0.83           O  
ATOM   4111  N   LYS A 507      29.299  36.406  49.767  1.00  0.84           N  
ATOM   4112  CA  LYS A 507      28.054  37.117  49.886  1.00  0.84           C  
ATOM   4113  C   LYS A 507      26.824  36.233  50.056  1.00  0.84           C  
ATOM   4114  O   LYS A 507      25.964  36.532  50.880  1.00  0.84           O  
ATOM   4115  CB  LYS A 507      27.878  38.003  48.637  1.00  0.84           C  
ATOM   4116  CG  LYS A 507      29.083  38.913  48.317  1.00  0.84           C  
ATOM   4117  CD  LYS A 507      29.489  39.913  49.422  1.00  0.84           C  
ATOM   4118  CE  LYS A 507      30.650  40.813  48.971  1.00  0.84           C  
ATOM   4119  NZ  LYS A 507      31.065  41.760  50.026  1.00  0.84           N  
ATOM   4120  N   ILE A 508      26.675  35.144  49.265  1.00  0.88           N  
ATOM   4121  CA  ILE A 508      25.417  34.387  49.245  1.00  0.88           C  
ATOM   4122  C   ILE A 508      25.536  32.924  49.630  1.00  0.88           C  
ATOM   4123  O   ILE A 508      24.562  32.175  49.548  1.00  0.88           O  
ATOM   4124  CB  ILE A 508      24.709  34.465  47.890  1.00  0.88           C  
ATOM   4125  CG1 ILE A 508      25.531  33.829  46.745  1.00  0.88           C  
ATOM   4126  CG2 ILE A 508      24.393  35.946  47.599  1.00  0.88           C  
ATOM   4127  CD1 ILE A 508      24.735  33.637  45.450  1.00  0.88           C  
ATOM   4128  N   GLY A 509      26.714  32.461  50.088  1.00  0.89           N  
ATOM   4129  CA  GLY A 509      26.950  31.044  50.361  1.00  0.89           C  
ATOM   4130  C   GLY A 509      27.123  30.190  49.127  1.00  0.89           C  
ATOM   4131  O   GLY A 509      27.076  30.667  48.001  1.00  0.89           O  
ATOM   4132  N   GLU A 510      27.349  28.873  49.297  1.00  0.83           N  
ATOM   4133  CA  GLU A 510      27.713  27.992  48.188  1.00  0.83           C  
ATOM   4134  C   GLU A 510      26.540  27.290  47.509  1.00  0.83           C  
ATOM   4135  O   GLU A 510      26.736  26.493  46.593  1.00  0.83           O  
ATOM   4136  CB  GLU A 510      28.677  26.871  48.666  1.00  0.83           C  
ATOM   4137  CG  GLU A 510      30.151  27.282  48.876  1.00  0.83           C  
ATOM   4138  CD  GLU A 510      30.977  26.100  49.398  1.00  0.83           C  
ATOM   4139  OE1 GLU A 510      30.873  24.963  48.838  1.00  0.83           O  
ATOM   4140  OE2 GLU A 510      31.702  26.310  50.399  1.00  0.83           O  
ATOM   4141  N   GLU A 511      25.281  27.586  47.886  1.00  0.82           N  
ATOM   4142  CA  GLU A 511      24.097  26.948  47.317  1.00  0.82           C  
ATOM   4143  C   GLU A 511      23.947  27.139  45.807  1.00  0.82           C  
ATOM   4144  O   GLU A 511      23.512  26.243  45.090  1.00  0.82           O  
ATOM   4145  CB  GLU A 511      22.814  27.435  48.035  1.00  0.82           C  
ATOM   4146  CG  GLU A 511      22.708  26.974  49.514  1.00  0.82           C  
ATOM   4147  CD  GLU A 511      21.529  27.580  50.280  1.00  0.82           C  
ATOM   4148  OE1 GLU A 511      20.946  28.587  49.809  1.00  0.82           O  
ATOM   4149  OE2 GLU A 511      21.242  27.056  51.384  1.00  0.82           O  
ATOM   4150  N   PHE A 512      24.377  28.299  45.263  1.00  0.89           N  
ATOM   4151  CA  PHE A 512      24.301  28.611  43.843  1.00  0.89           C  
ATOM   4152  C   PHE A 512      24.988  27.626  42.903  1.00  0.89           C  
ATOM   4153  O   PHE A 512      24.609  27.476  41.743  1.00  0.89           O  
ATOM   4154  CB  PHE A 512      24.771  30.063  43.545  1.00  0.89           C  
ATOM   4155  CG  PHE A 512      26.253  30.244  43.670  1.00  0.89           C  
ATOM   4156  CD1 PHE A 512      26.830  30.522  44.911  1.00  0.89           C  
ATOM   4157  CD2 PHE A 512      27.081  30.090  42.548  1.00  0.89           C  
ATOM   4158  CE1 PHE A 512      28.218  30.600  45.045  1.00  0.89           C  
ATOM   4159  CE2 PHE A 512      28.471  30.181  42.681  1.00  0.89           C  
ATOM   4160  CZ  PHE A 512      29.045  30.429  43.930  1.00  0.89           C  
ATOM   4161  N   LEU A 513      26.012  26.905  43.393  1.00  0.91           N  
ATOM   4162  CA  LEU A 513      26.745  25.908  42.642  1.00  0.91           C  
ATOM   4163  C   LEU A 513      25.865  24.769  42.139  1.00  0.91           C  
ATOM   4164  O   LEU A 513      26.155  24.148  41.113  1.00  0.91           O  
ATOM   4165  CB  LEU A 513      27.886  25.339  43.522  1.00  0.91           C  
ATOM   4166  CG  LEU A 513      29.000  26.359  43.846  1.00  0.91           C  
ATOM   4167  CD1 LEU A 513      29.976  25.792  44.882  1.00  0.91           C  
ATOM   4168  CD2 LEU A 513      29.787  26.777  42.598  1.00  0.91           C  
ATOM   4169  N   THR A 514      24.762  24.469  42.848  1.00  0.89           N  
ATOM   4170  CA  THR A 514      23.798  23.453  42.438  1.00  0.89           C  
ATOM   4171  C   THR A 514      22.408  24.012  42.242  1.00  0.89           C  
ATOM   4172  O   THR A 514      21.465  23.264  42.003  1.00  0.89           O  
ATOM   4173  CB  THR A 514      23.705  22.303  43.416  1.00  0.89           C  
ATOM   4174  OG1 THR A 514      23.623  22.768  44.760  1.00  0.89           O  
ATOM   4175  CG2 THR A 514      24.993  21.498  43.311  1.00  0.89           C  
ATOM   4176  N   ASP A 515      22.268  25.346  42.275  1.00  0.87           N  
ATOM   4177  CA  ASP A 515      21.008  26.032  42.079  1.00  0.87           C  
ATOM   4178  C   ASP A 515      21.318  27.436  41.597  1.00  0.87           C  
ATOM   4179  O   ASP A 515      21.365  28.411  42.340  1.00  0.87           O  
ATOM   4180  CB  ASP A 515      20.160  26.088  43.371  1.00  0.87           C  
ATOM   4181  CG  ASP A 515      18.763  26.632  43.098  1.00  0.87           C  
ATOM   4182  OD1 ASP A 515      18.372  26.736  41.899  1.00  0.87           O  
ATOM   4183  OD2 ASP A 515      18.079  26.981  44.087  1.00  0.87           O  
ATOM   4184  N   LEU A 516      21.584  27.600  40.296  1.00  0.91           N  
ATOM   4185  CA  LEU A 516      22.177  28.821  39.784  1.00  0.91           C  
ATOM   4186  C   LEU A 516      21.233  30.017  39.806  1.00  0.91           C  
ATOM   4187  O   LEU A 516      21.654  31.167  39.689  1.00  0.91           O  
ATOM   4188  CB  LEU A 516      22.756  28.562  38.376  1.00  0.91           C  
ATOM   4189  CG  LEU A 516      23.890  29.511  37.935  1.00  0.91           C  
ATOM   4190  CD1 LEU A 516      25.142  29.308  38.798  1.00  0.91           C  
ATOM   4191  CD2 LEU A 516      24.221  29.332  36.444  1.00  0.91           C  
ATOM   4192  N   SER A 517      19.917  29.801  40.041  1.00  0.90           N  
ATOM   4193  CA  SER A 517      18.946  30.882  40.181  1.00  0.90           C  
ATOM   4194  C   SER A 517      19.189  31.743  41.404  1.00  0.90           C  
ATOM   4195  O   SER A 517      18.857  32.930  41.435  1.00  0.90           O  
ATOM   4196  CB  SER A 517      17.467  30.403  40.114  1.00  0.90           C  
ATOM   4197  OG  SER A 517      16.951  29.787  41.287  1.00  0.90           O  
ATOM   4198  N   GLN A 518      19.901  31.168  42.388  1.00  0.84           N  
ATOM   4199  CA  GLN A 518      20.398  31.785  43.595  1.00  0.84           C  
ATOM   4200  C   GLN A 518      21.254  33.020  43.347  1.00  0.84           C  
ATOM   4201  O   GLN A 518      21.291  33.944  44.158  1.00  0.84           O  
ATOM   4202  CB  GLN A 518      21.230  30.731  44.354  1.00  0.84           C  
ATOM   4203  CG  GLN A 518      21.419  30.951  45.865  1.00  0.84           C  
ATOM   4204  CD  GLN A 518      20.163  30.628  46.658  1.00  0.84           C  
ATOM   4205  OE1 GLN A 518      19.027  30.589  46.162  1.00  0.84           O  
ATOM   4206  NE2 GLN A 518      20.322  30.467  47.978  1.00  0.84           N  
ATOM   4207  N   LEU A 519      21.926  33.098  42.172  1.00  0.89           N  
ATOM   4208  CA  LEU A 519      22.693  34.257  41.748  1.00  0.89           C  
ATOM   4209  C   LEU A 519      21.884  35.546  41.659  1.00  0.89           C  
ATOM   4210  O   LEU A 519      22.446  36.632  41.763  1.00  0.89           O  
ATOM   4211  CB  LEU A 519      23.373  34.025  40.376  1.00  0.89           C  
ATOM   4212  CG  LEU A 519      24.500  32.973  40.353  1.00  0.89           C  
ATOM   4213  CD1 LEU A 519      25.106  32.900  38.946  1.00  0.89           C  
ATOM   4214  CD2 LEU A 519      25.615  33.291  41.354  1.00  0.89           C  
ATOM   4215  N   LYS A 520      20.534  35.483  41.558  1.00  0.83           N  
ATOM   4216  CA  LYS A 520      19.669  36.656  41.614  1.00  0.83           C  
ATOM   4217  C   LYS A 520      19.834  37.450  42.906  1.00  0.83           C  
ATOM   4218  O   LYS A 520      19.633  38.661  42.945  1.00  0.83           O  
ATOM   4219  CB  LYS A 520      18.175  36.276  41.441  1.00  0.83           C  
ATOM   4220  CG  LYS A 520      17.830  35.744  40.038  1.00  0.83           C  
ATOM   4221  CD  LYS A 520      16.340  35.380  39.897  1.00  0.83           C  
ATOM   4222  CE  LYS A 520      15.970  34.858  38.502  1.00  0.83           C  
ATOM   4223  NZ  LYS A 520      14.525  34.539  38.448  1.00  0.83           N  
ATOM   4224  N   LYS A 521      20.280  36.796  43.998  1.00  0.80           N  
ATOM   4225  CA  LYS A 521      20.685  37.464  45.220  1.00  0.80           C  
ATOM   4226  C   LYS A 521      21.925  38.368  45.106  1.00  0.80           C  
ATOM   4227  O   LYS A 521      22.337  38.966  46.104  1.00  0.80           O  
ATOM   4228  CB  LYS A 521      20.979  36.431  46.330  1.00  0.80           C  
ATOM   4229  CG  LYS A 521      19.800  35.536  46.752  1.00  0.80           C  
ATOM   4230  CD  LYS A 521      20.268  34.556  47.847  1.00  0.80           C  
ATOM   4231  CE  LYS A 521      19.234  33.560  48.383  1.00  0.80           C  
ATOM   4232  NZ  LYS A 521      18.202  34.268  49.164  1.00  0.80           N  
ATOM   4233  N   LEU A 522      22.531  38.564  43.919  1.00  0.83           N  
ATOM   4234  CA  LEU A 522      23.621  39.515  43.727  1.00  0.83           C  
ATOM   4235  C   LEU A 522      23.103  40.872  43.255  1.00  0.83           C  
ATOM   4236  O   LEU A 522      23.805  41.877  43.336  1.00  0.83           O  
ATOM   4237  CB  LEU A 522      24.643  38.966  42.697  1.00  0.83           C  
ATOM   4238  CG  LEU A 522      25.730  38.012  43.242  1.00  0.83           C  
ATOM   4239  CD1 LEU A 522      25.269  37.067  44.353  1.00  0.83           C  
ATOM   4240  CD2 LEU A 522      26.310  37.193  42.082  1.00  0.83           C  
ATOM   4241  N   LEU A 523      21.816  40.970  42.852  1.00  0.83           N  
ATOM   4242  CA  LEU A 523      21.122  42.235  42.614  1.00  0.83           C  
ATOM   4243  C   LEU A 523      21.080  43.152  43.847  1.00  0.83           C  
ATOM   4244  O   LEU A 523      21.274  44.356  43.663  1.00  0.83           O  
ATOM   4245  CB  LEU A 523      19.667  41.985  42.113  1.00  0.83           C  
ATOM   4246  CG  LEU A 523      19.366  42.103  40.600  1.00  0.83           C  
ATOM   4247  CD1 LEU A 523      20.564  41.894  39.674  1.00  0.83           C  
ATOM   4248  CD2 LEU A 523      18.269  41.093  40.229  1.00  0.83           C  
ATOM   4249  N   PRO A 524      20.881  42.697  45.101  1.00  0.83           N  
ATOM   4250  CA  PRO A 524      21.023  43.518  46.297  1.00  0.83           C  
ATOM   4251  C   PRO A 524      22.376  44.172  46.470  1.00  0.83           C  
ATOM   4252  O   PRO A 524      22.482  45.113  47.248  1.00  0.83           O  
ATOM   4253  CB  PRO A 524      20.711  42.582  47.480  1.00  0.83           C  
ATOM   4254  CG  PRO A 524      19.823  41.486  46.892  1.00  0.83           C  
ATOM   4255  CD  PRO A 524      20.219  41.436  45.417  1.00  0.83           C  
ATOM   4256  N   LEU A 525      23.426  43.676  45.794  1.00  0.83           N  
ATOM   4257  CA  LEU A 525      24.767  44.194  45.941  1.00  0.83           C  
ATOM   4258  C   LEU A 525      25.223  44.979  44.730  1.00  0.83           C  
ATOM   4259  O   LEU A 525      26.398  45.312  44.595  1.00  0.83           O  
ATOM   4260  CB  LEU A 525      25.771  43.050  46.173  1.00  0.83           C  
ATOM   4261  CG  LEU A 525      25.552  42.248  47.465  1.00  0.83           C  
ATOM   4262  CD1 LEU A 525      26.553  41.098  47.504  1.00  0.83           C  
ATOM   4263  CD2 LEU A 525      25.717  43.098  48.732  1.00  0.83           C  
ATOM   4264  N   VAL A 526      24.306  45.379  43.828  1.00  0.82           N  
ATOM   4265  CA  VAL A 526      24.658  46.164  42.650  1.00  0.82           C  
ATOM   4266  C   VAL A 526      25.141  47.573  43.005  1.00  0.82           C  
ATOM   4267  O   VAL A 526      25.791  48.265  42.225  1.00  0.82           O  
ATOM   4268  CB  VAL A 526      23.485  46.212  41.675  1.00  0.82           C  
ATOM   4269  CG1 VAL A 526      22.393  47.195  42.147  1.00  0.82           C  
ATOM   4270  CG2 VAL A 526      24.001  46.555  40.267  1.00  0.82           C  
ATOM   4271  N   SER A 527      24.832  48.027  44.231  1.00  0.79           N  
ATOM   4272  CA  SER A 527      25.275  49.291  44.783  1.00  0.79           C  
ATOM   4273  C   SER A 527      26.241  49.131  45.944  1.00  0.79           C  
ATOM   4274  O   SER A 527      26.598  50.115  46.586  1.00  0.79           O  
ATOM   4275  CB  SER A 527      24.061  50.110  45.278  1.00  0.79           C  
ATOM   4276  OG  SER A 527      23.224  49.322  46.129  1.00  0.79           O  
ATOM   4277  N   ASP A 528      26.722  47.903  46.224  1.00  0.79           N  
ATOM   4278  CA  ASP A 528      27.717  47.664  47.256  1.00  0.79           C  
ATOM   4279  C   ASP A 528      29.102  47.997  46.717  1.00  0.79           C  
ATOM   4280  O   ASP A 528      29.622  47.344  45.813  1.00  0.79           O  
ATOM   4281  CB  ASP A 528      27.634  46.191  47.754  1.00  0.79           C  
ATOM   4282  CG  ASP A 528      28.571  45.870  48.912  1.00  0.79           C  
ATOM   4283  OD1 ASP A 528      28.402  46.481  49.991  1.00  0.79           O  
ATOM   4284  OD2 ASP A 528      29.479  45.009  48.745  1.00  0.79           O  
ATOM   4285  N   GLU A 529      29.748  49.033  47.287  1.00  0.76           N  
ATOM   4286  CA  GLU A 529      31.054  49.513  46.862  1.00  0.76           C  
ATOM   4287  C   GLU A 529      32.136  48.449  46.970  1.00  0.76           C  
ATOM   4288  O   GLU A 529      33.004  48.306  46.108  1.00  0.76           O  
ATOM   4289  CB  GLU A 529      31.483  50.753  47.685  1.00  0.76           C  
ATOM   4290  CG  GLU A 529      30.625  52.024  47.430  1.00  0.76           C  
ATOM   4291  CD  GLU A 529      30.821  52.676  46.052  1.00  0.76           C  
ATOM   4292  OE1 GLU A 529      30.062  53.633  45.746  1.00  0.76           O  
ATOM   4293  OE2 GLU A 529      31.737  52.264  45.292  1.00  0.76           O  
ATOM   4294  N   VAL A 530      32.093  47.628  48.041  1.00  0.83           N  
ATOM   4295  CA  VAL A 530      32.993  46.501  48.199  1.00  0.83           C  
ATOM   4296  C   VAL A 530      32.798  45.452  47.113  1.00  0.83           C  
ATOM   4297  O   VAL A 530      33.749  45.091  46.430  1.00  0.83           O  
ATOM   4298  CB  VAL A 530      32.823  45.906  49.595  1.00  0.83           C  
ATOM   4299  CG1 VAL A 530      33.605  44.594  49.779  1.00  0.83           C  
ATOM   4300  CG2 VAL A 530      33.300  46.942  50.631  1.00  0.83           C  
ATOM   4301  N   PHE A 531      31.552  45.010  46.843  1.00  0.81           N  
ATOM   4302  CA  PHE A 531      31.259  44.051  45.791  1.00  0.81           C  
ATOM   4303  C   PHE A 531      31.636  44.530  44.398  1.00  0.81           C  
ATOM   4304  O   PHE A 531      32.256  43.794  43.634  1.00  0.81           O  
ATOM   4305  CB  PHE A 531      29.754  43.687  45.832  1.00  0.81           C  
ATOM   4306  CG  PHE A 531      29.418  42.456  45.041  1.00  0.81           C  
ATOM   4307  CD1 PHE A 531      30.024  41.223  45.329  1.00  0.81           C  
ATOM   4308  CD2 PHE A 531      28.458  42.519  44.021  1.00  0.81           C  
ATOM   4309  CE1 PHE A 531      29.680  40.071  44.614  1.00  0.81           C  
ATOM   4310  CE2 PHE A 531      28.112  41.371  43.301  1.00  0.81           C  
ATOM   4311  CZ  PHE A 531      28.732  40.150  43.590  1.00  0.81           C  
ATOM   4312  N   ILE A 532      31.337  45.799  44.046  1.00  0.83           N  
ATOM   4313  CA  ILE A 532      31.734  46.388  42.771  1.00  0.83           C  
ATOM   4314  C   ILE A 532      33.247  46.360  42.601  1.00  0.83           C  
ATOM   4315  O   ILE A 532      33.780  45.944  41.570  1.00  0.83           O  
ATOM   4316  CB  ILE A 532      31.230  47.828  42.654  1.00  0.83           C  
ATOM   4317  CG1 ILE A 532      29.685  47.863  42.620  1.00  0.83           C  
ATOM   4318  CG2 ILE A 532      31.813  48.535  41.405  1.00  0.83           C  
ATOM   4319  CD1 ILE A 532      29.130  49.275  42.825  1.00  0.83           C  
ATOM   4320  N   ARG A 533      33.989  46.747  43.654  1.00  0.76           N  
ATOM   4321  CA  ARG A 533      35.433  46.676  43.665  1.00  0.76           C  
ATOM   4322  C   ARG A 533      35.983  45.258  43.559  1.00  0.76           C  
ATOM   4323  O   ARG A 533      36.892  44.994  42.772  1.00  0.76           O  
ATOM   4324  CB  ARG A 533      35.950  47.354  44.953  1.00  0.76           C  
ATOM   4325  CG  ARG A 533      37.482  47.376  45.088  1.00  0.76           C  
ATOM   4326  CD  ARG A 533      37.994  48.007  46.395  1.00  0.76           C  
ATOM   4327  NE  ARG A 533      37.341  47.368  47.592  1.00  0.76           N  
ATOM   4328  CZ  ARG A 533      37.502  46.087  47.966  1.00  0.76           C  
ATOM   4329  NH1 ARG A 533      38.241  45.243  47.261  1.00  0.76           N  
ATOM   4330  NH2 ARG A 533      36.927  45.641  49.076  1.00  0.76           N  
ATOM   4331  N   ASP A 534      35.442  44.300  44.332  1.00  0.87           N  
ATOM   4332  CA  ASP A 534      35.869  42.917  44.297  1.00  0.87           C  
ATOM   4333  C   ASP A 534      35.566  42.200  42.973  1.00  0.87           C  
ATOM   4334  O   ASP A 534      36.403  41.462  42.458  1.00  0.87           O  
ATOM   4335  CB  ASP A 534      35.335  42.152  45.533  1.00  0.87           C  
ATOM   4336  CG  ASP A 534      35.973  42.695  46.806  1.00  0.87           C  
ATOM   4337  OD1 ASP A 534      37.221  42.903  46.826  1.00  0.87           O  
ATOM   4338  OD2 ASP A 534      35.241  42.953  47.792  1.00  0.87           O  
ATOM   4339  N   VAL A 535      34.397  42.431  42.332  1.00  0.90           N  
ATOM   4340  CA  VAL A 535      34.095  41.897  40.999  1.00  0.90           C  
ATOM   4341  C   VAL A 535      35.060  42.395  39.925  1.00  0.90           C  
ATOM   4342  O   VAL A 535      35.575  41.624  39.112  1.00  0.90           O  
ATOM   4343  CB  VAL A 535      32.663  42.237  40.581  1.00  0.90           C  
ATOM   4344  CG1 VAL A 535      32.383  41.891  39.102  1.00  0.90           C  
ATOM   4345  CG2 VAL A 535      31.672  41.455  41.461  1.00  0.90           C  
ATOM   4346  N   ALA A 536      35.368  43.708  39.919  1.00  0.88           N  
ATOM   4347  CA  ALA A 536      36.341  44.292  39.015  1.00  0.88           C  
ATOM   4348  C   ALA A 536      37.755  43.761  39.228  1.00  0.88           C  
ATOM   4349  O   ALA A 536      38.504  43.507  38.284  1.00  0.88           O  
ATOM   4350  CB  ALA A 536      36.329  45.821  39.179  1.00  0.88           C  
ATOM   4351  N   LYS A 537      38.143  43.561  40.500  1.00  0.85           N  
ATOM   4352  CA  LYS A 537      39.416  42.990  40.880  1.00  0.85           C  
ATOM   4353  C   LYS A 537      39.644  41.573  40.396  1.00  0.85           C  
ATOM   4354  O   LYS A 537      40.690  41.288  39.819  1.00  0.85           O  
ATOM   4355  CB  LYS A 537      39.537  43.019  42.412  1.00  0.85           C  
ATOM   4356  CG  LYS A 537      40.893  42.541  42.935  1.00  0.85           C  
ATOM   4357  CD  LYS A 537      40.959  42.637  44.460  1.00  0.85           C  
ATOM   4358  CE  LYS A 537      42.302  42.150  44.993  1.00  0.85           C  
ATOM   4359  NZ  LYS A 537      42.306  42.231  46.464  1.00  0.85           N  
ATOM   4360  N   VAL A 538      38.642  40.675  40.533  1.00  0.90           N  
ATOM   4361  CA  VAL A 538      38.707  39.314  40.004  1.00  0.90           C  
ATOM   4362  C   VAL A 538      38.927  39.330  38.507  1.00  0.90           C  
ATOM   4363  O   VAL A 538      39.716  38.575  37.940  1.00  0.90           O  
ATOM   4364  CB  VAL A 538      37.411  38.551  40.259  1.00  0.90           C  
ATOM   4365  CG1 VAL A 538      37.410  37.195  39.526  1.00  0.90           C  
ATOM   4366  CG2 VAL A 538      37.245  38.304  41.767  1.00  0.90           C  
ATOM   4367  N   LYS A 539      38.231  40.242  37.805  1.00  0.90           N  
ATOM   4368  CA  LYS A 539      38.399  40.392  36.383  1.00  0.90           C  
ATOM   4369  C   LYS A 539      39.801  40.813  35.985  1.00  0.90           C  
ATOM   4370  O   LYS A 539      40.409  40.215  35.102  1.00  0.90           O  
ATOM   4371  CB  LYS A 539      37.353  41.385  35.825  1.00  0.90           C  
ATOM   4372  CG  LYS A 539      36.996  41.099  34.366  1.00  0.90           C  
ATOM   4373  CD  LYS A 539      36.228  39.775  34.228  1.00  0.90           C  
ATOM   4374  CE  LYS A 539      35.931  39.477  32.775  1.00  0.90           C  
ATOM   4375  NZ  LYS A 539      35.393  38.115  32.605  1.00  0.90           N  
ATOM   4376  N   GLN A 540      40.374  41.799  36.699  1.00  0.86           N  
ATOM   4377  CA  GLN A 540      41.741  42.242  36.514  1.00  0.86           C  
ATOM   4378  C   GLN A 540      42.763  41.143  36.806  1.00  0.86           C  
ATOM   4379  O   GLN A 540      43.690  40.911  36.029  1.00  0.86           O  
ATOM   4380  CB  GLN A 540      41.980  43.517  37.366  1.00  0.86           C  
ATOM   4381  CG  GLN A 540      43.227  44.343  36.969  1.00  0.86           C  
ATOM   4382  CD  GLN A 540      43.129  44.882  35.539  1.00  0.86           C  
ATOM   4383  OE1 GLN A 540      43.454  44.212  34.562  1.00  0.86           O  
ATOM   4384  NE2 GLN A 540      42.660  46.144  35.400  1.00  0.86           N  
ATOM   4385  N   GLU A 541      42.567  40.367  37.891  1.00  0.85           N  
ATOM   4386  CA  GLU A 541      43.363  39.190  38.207  1.00  0.85           C  
ATOM   4387  C   GLU A 541      43.326  38.133  37.110  1.00  0.85           C  
ATOM   4388  O   GLU A 541      44.364  37.639  36.665  1.00  0.85           O  
ATOM   4389  CB  GLU A 541      42.860  38.553  39.525  1.00  0.85           C  
ATOM   4390  CG  GLU A 541      43.333  39.311  40.788  1.00  0.85           C  
ATOM   4391  CD  GLU A 541      42.704  38.780  42.074  1.00  0.85           C  
ATOM   4392  OE1 GLU A 541      42.310  37.589  42.114  1.00  0.85           O  
ATOM   4393  OE2 GLU A 541      42.634  39.581  43.045  1.00  0.85           O  
ATOM   4394  N   ASN A 542      42.129  37.809  36.582  1.00  0.90           N  
ATOM   4395  CA  ASN A 542      41.973  36.901  35.460  1.00  0.90           C  
ATOM   4396  C   ASN A 542      42.637  37.397  34.186  1.00  0.90           C  
ATOM   4397  O   ASN A 542      43.270  36.622  33.472  1.00  0.90           O  
ATOM   4398  CB  ASN A 542      40.485  36.624  35.159  1.00  0.90           C  
ATOM   4399  CG  ASN A 542      39.884  35.749  36.251  1.00  0.90           C  
ATOM   4400  OD1 ASN A 542      40.557  34.963  36.914  1.00  0.90           O  
ATOM   4401  ND2 ASN A 542      38.543  35.843  36.397  1.00  0.90           N  
ATOM   4402  N   LYS A 543      42.547  38.704  33.872  1.00  0.89           N  
ATOM   4403  CA  LYS A 543      43.265  39.285  32.751  1.00  0.89           C  
ATOM   4404  C   LYS A 543      44.771  39.150  32.851  1.00  0.89           C  
ATOM   4405  O   LYS A 543      45.420  38.691  31.917  1.00  0.89           O  
ATOM   4406  CB  LYS A 543      42.990  40.793  32.655  1.00  0.89           C  
ATOM   4407  CG  LYS A 543      41.593  41.127  32.150  1.00  0.89           C  
ATOM   4408  CD  LYS A 543      41.453  42.640  32.022  1.00  0.89           C  
ATOM   4409  CE  LYS A 543      40.254  43.012  31.184  1.00  0.89           C  
ATOM   4410  NZ  LYS A 543      40.263  44.439  30.841  1.00  0.89           N  
ATOM   4411  N   LEU A 544      45.361  39.488  34.014  1.00  0.87           N  
ATOM   4412  CA  LEU A 544      46.779  39.315  34.286  1.00  0.87           C  
ATOM   4413  C   LEU A 544      47.216  37.863  34.204  1.00  0.87           C  
ATOM   4414  O   LEU A 544      48.246  37.532  33.616  1.00  0.87           O  
ATOM   4415  CB  LEU A 544      47.118  39.826  35.706  1.00  0.87           C  
ATOM   4416  CG  LEU A 544      47.020  41.351  35.888  1.00  0.87           C  
ATOM   4417  CD1 LEU A 544      47.069  41.709  37.378  1.00  0.87           C  
ATOM   4418  CD2 LEU A 544      48.150  42.066  35.145  1.00  0.87           C  
ATOM   4419  N   LYS A 545      46.411  36.945  34.768  1.00  0.83           N  
ATOM   4420  CA  LYS A 545      46.650  35.519  34.697  1.00  0.83           C  
ATOM   4421  C   LYS A 545      46.618  34.971  33.278  1.00  0.83           C  
ATOM   4422  O   LYS A 545      47.492  34.204  32.875  1.00  0.83           O  
ATOM   4423  CB  LYS A 545      45.603  34.771  35.553  1.00  0.83           C  
ATOM   4424  CG  LYS A 545      45.857  33.261  35.679  1.00  0.83           C  
ATOM   4425  CD  LYS A 545      44.750  32.573  36.489  1.00  0.83           C  
ATOM   4426  CE  LYS A 545      44.957  31.064  36.686  1.00  0.83           C  
ATOM   4427  NZ  LYS A 545      46.141  30.774  37.538  1.00  0.83           N  
ATOM   4428  N   PHE A 546      45.620  35.375  32.469  1.00  0.88           N  
ATOM   4429  CA  PHE A 546      45.528  34.984  31.079  1.00  0.88           C  
ATOM   4430  C   PHE A 546      46.667  35.524  30.247  1.00  0.88           C  
ATOM   4431  O   PHE A 546      47.276  34.775  29.489  1.00  0.88           O  
ATOM   4432  CB  PHE A 546      44.175  35.439  30.490  1.00  0.88           C  
ATOM   4433  CG  PHE A 546      43.950  34.860  29.125  1.00  0.88           C  
ATOM   4434  CD1 PHE A 546      43.847  33.470  28.955  1.00  0.88           C  
ATOM   4435  CD2 PHE A 546      43.884  35.695  28.004  1.00  0.88           C  
ATOM   4436  CE1 PHE A 546      43.700  32.916  27.677  1.00  0.88           C  
ATOM   4437  CE2 PHE A 546      43.718  35.142  26.733  1.00  0.88           C  
ATOM   4438  CZ  PHE A 546      43.632  33.759  26.562  1.00  0.88           C  
ATOM   4439  N   SER A 547      47.029  36.808  30.443  1.00  0.86           N  
ATOM   4440  CA  SER A 547      48.166  37.475  29.833  1.00  0.86           C  
ATOM   4441  C   SER A 547      49.460  36.740  30.101  1.00  0.86           C  
ATOM   4442  O   SER A 547      50.253  36.471  29.202  1.00  0.86           O  
ATOM   4443  CB  SER A 547      48.358  38.885  30.455  1.00  0.86           C  
ATOM   4444  OG  SER A 547      47.310  39.790  30.096  1.00  0.86           O  
ATOM   4445  N   ALA A 548      49.674  36.341  31.369  1.00  0.85           N  
ATOM   4446  CA  ALA A 548      50.805  35.542  31.767  1.00  0.85           C  
ATOM   4447  C   ALA A 548      50.841  34.167  31.132  1.00  0.85           C  
ATOM   4448  O   ALA A 548      51.881  33.747  30.639  1.00  0.85           O  
ATOM   4449  CB  ALA A 548      50.797  35.397  33.298  1.00  0.85           C  
ATOM   4450  N   PHE A 549      49.716  33.430  31.088  1.00  0.80           N  
ATOM   4451  CA  PHE A 549      49.659  32.131  30.434  1.00  0.80           C  
ATOM   4452  C   PHE A 549      49.965  32.239  28.939  1.00  0.80           C  
ATOM   4453  O   PHE A 549      50.762  31.492  28.377  1.00  0.80           O  
ATOM   4454  CB  PHE A 549      48.266  31.495  30.709  1.00  0.80           C  
ATOM   4455  CG  PHE A 549      48.121  30.128  30.094  1.00  0.80           C  
ATOM   4456  CD1 PHE A 549      47.396  29.978  28.901  1.00  0.80           C  
ATOM   4457  CD2 PHE A 549      48.738  29.004  30.666  1.00  0.80           C  
ATOM   4458  CE1 PHE A 549      47.313  28.731  28.269  1.00  0.80           C  
ATOM   4459  CE2 PHE A 549      48.655  27.753  30.039  1.00  0.80           C  
ATOM   4460  CZ  PHE A 549      47.950  27.620  28.835  1.00  0.80           C  
ATOM   4461  N   LEU A 550      49.382  33.251  28.285  1.00  0.78           N  
ATOM   4462  CA  LEU A 550      49.581  33.560  26.891  1.00  0.78           C  
ATOM   4463  C   LEU A 550      51.015  33.891  26.503  1.00  0.78           C  
ATOM   4464  O   LEU A 550      51.478  33.421  25.471  1.00  0.78           O  
ATOM   4465  CB  LEU A 550      48.647  34.733  26.533  1.00  0.78           C  
ATOM   4466  CG  LEU A 550      47.580  34.490  25.464  1.00  0.78           C  
ATOM   4467  CD1 LEU A 550      46.727  33.276  25.790  1.00  0.78           C  
ATOM   4468  CD2 LEU A 550      46.693  35.744  25.379  1.00  0.78           C  
ATOM   4469  N   GLU A 551      51.774  34.680  27.300  1.00  0.73           N  
ATOM   4470  CA  GLU A 551      53.144  35.014  26.915  1.00  0.73           C  
ATOM   4471  C   GLU A 551      54.175  34.018  27.439  1.00  0.73           C  
ATOM   4472  O   GLU A 551      55.362  34.086  27.126  1.00  0.73           O  
ATOM   4473  CB  GLU A 551      53.532  36.462  27.326  1.00  0.73           C  
ATOM   4474  CG  GLU A 551      54.743  36.997  26.512  1.00  0.73           C  
ATOM   4475  CD  GLU A 551      54.909  38.510  26.482  1.00  0.73           C  
ATOM   4476  OE1 GLU A 551      55.885  38.947  25.802  1.00  0.73           O  
ATOM   4477  OE2 GLU A 551      54.055  39.252  27.024  1.00  0.73           O  
ATOM   4478  N   LYS A 552      53.748  33.018  28.233  1.00  0.74           N  
ATOM   4479  CA  LYS A 552      54.652  31.987  28.712  1.00  0.74           C  
ATOM   4480  C   LYS A 552      54.489  30.660  27.986  1.00  0.74           C  
ATOM   4481  O   LYS A 552      55.443  29.891  27.916  1.00  0.74           O  
ATOM   4482  CB  LYS A 552      54.430  31.765  30.227  1.00  0.74           C  
ATOM   4483  CG  LYS A 552      54.848  32.977  31.079  1.00  0.74           C  
ATOM   4484  CD  LYS A 552      54.509  32.787  32.566  1.00  0.74           C  
ATOM   4485  CE  LYS A 552      54.799  34.034  33.402  1.00  0.74           C  
ATOM   4486  NZ  LYS A 552      54.546  33.733  34.828  1.00  0.74           N  
ATOM   4487  N   GLU A 553      53.308  30.375  27.398  1.00  0.72           N  
ATOM   4488  CA  GLU A 553      53.081  29.151  26.632  1.00  0.72           C  
ATOM   4489  C   GLU A 553      53.096  29.425  25.126  1.00  0.72           C  
ATOM   4490  O   GLU A 553      53.162  28.536  24.280  1.00  0.72           O  
ATOM   4491  CB  GLU A 553      51.707  28.570  27.052  1.00  0.72           C  
ATOM   4492  CG  GLU A 553      51.445  27.106  26.616  1.00  0.72           C  
ATOM   4493  CD  GLU A 553      52.383  26.103  27.288  1.00  0.72           C  
ATOM   4494  OE1 GLU A 553      52.368  26.050  28.546  1.00  0.72           O  
ATOM   4495  OE2 GLU A 553      53.077  25.353  26.556  1.00  0.72           O  
ATOM   4496  N   TYR A 554      53.090  30.714  24.744  1.00  0.77           N  
ATOM   4497  CA  TYR A 554      53.092  31.172  23.368  1.00  0.77           C  
ATOM   4498  C   TYR A 554      53.803  32.517  23.344  1.00  0.77           C  
ATOM   4499  O   TYR A 554      54.280  33.003  24.365  1.00  0.77           O  
ATOM   4500  CB  TYR A 554      51.669  31.414  22.787  1.00  0.77           C  
ATOM   4501  CG  TYR A 554      50.791  30.200  22.846  1.00  0.77           C  
ATOM   4502  CD1 TYR A 554      50.939  29.145  21.928  1.00  0.77           C  
ATOM   4503  CD2 TYR A 554      49.768  30.131  23.805  1.00  0.77           C  
ATOM   4504  CE1 TYR A 554      50.077  28.037  21.970  1.00  0.77           C  
ATOM   4505  CE2 TYR A 554      48.910  29.026  23.852  1.00  0.77           C  
ATOM   4506  CZ  TYR A 554      49.066  27.981  22.933  1.00  0.77           C  
ATOM   4507  OH  TYR A 554      48.175  26.894  22.998  1.00  0.77           O  
ATOM   4508  N   LYS A 555      53.903  33.192  22.179  1.00  0.63           N  
ATOM   4509  CA  LYS A 555      54.303  34.589  22.178  1.00  0.63           C  
ATOM   4510  C   LYS A 555      53.060  35.470  22.257  1.00  0.63           C  
ATOM   4511  O   LYS A 555      52.163  35.370  21.421  1.00  0.63           O  
ATOM   4512  CB  LYS A 555      55.122  34.978  20.914  1.00  0.63           C  
ATOM   4513  CG  LYS A 555      56.187  36.086  21.102  1.00  0.63           C  
ATOM   4514  CD  LYS A 555      55.714  37.325  21.875  1.00  0.63           C  
ATOM   4515  CE  LYS A 555      56.811  38.320  22.222  1.00  0.63           C  
ATOM   4516  NZ  LYS A 555      56.308  39.259  23.240  1.00  0.63           N  
ATOM   4517  N   VAL A 556      52.991  36.389  23.236  1.00  0.71           N  
ATOM   4518  CA  VAL A 556      51.907  37.340  23.335  1.00  0.71           C  
ATOM   4519  C   VAL A 556      52.395  38.747  23.596  1.00  0.71           C  
ATOM   4520  O   VAL A 556      53.593  38.996  23.752  1.00  0.71           O  
ATOM   4521  CB  VAL A 556      50.845  36.822  24.295  1.00  0.71           C  
ATOM   4522  CG1 VAL A 556      50.491  37.756  25.479  1.00  0.71           C  
ATOM   4523  CG2 VAL A 556      49.642  36.505  23.397  1.00  0.71           C  
ATOM   4524  N   LYS A 557      51.501  39.748  23.557  1.00  0.70           N  
ATOM   4525  CA  LYS A 557      51.796  41.023  24.169  1.00  0.70           C  
ATOM   4526  C   LYS A 557      50.545  41.569  24.786  1.00  0.70           C  
ATOM   4527  O   LYS A 557      49.468  41.518  24.194  1.00  0.70           O  
ATOM   4528  CB  LYS A 557      52.256  42.113  23.177  1.00  0.70           C  
ATOM   4529  CG  LYS A 557      53.586  41.796  22.502  1.00  0.70           C  
ATOM   4530  CD  LYS A 557      53.969  42.858  21.477  1.00  0.70           C  
ATOM   4531  CE  LYS A 557      55.267  42.492  20.773  1.00  0.70           C  
ATOM   4532  NZ  LYS A 557      55.573  43.525  19.769  1.00  0.70           N  
ATOM   4533  N   ILE A 558      50.640  42.173  25.973  1.00  0.80           N  
ATOM   4534  CA  ILE A 558      49.454  42.598  26.683  1.00  0.80           C  
ATOM   4535  C   ILE A 558      49.546  44.004  27.178  1.00  0.80           C  
ATOM   4536  O   ILE A 558      50.597  44.633  27.225  1.00  0.80           O  
ATOM   4537  CB  ILE A 558      49.096  41.706  27.850  1.00  0.80           C  
ATOM   4538  CG1 ILE A 558      50.209  41.624  28.935  1.00  0.80           C  
ATOM   4539  CG2 ILE A 558      48.698  40.353  27.237  1.00  0.80           C  
ATOM   4540  CD1 ILE A 558      51.439  40.758  28.628  1.00  0.80           C  
ATOM   4541  N   ASN A 559      48.384  44.571  27.474  1.00  0.84           N  
ATOM   4542  CA  ASN A 559      48.269  45.774  28.240  1.00  0.84           C  
ATOM   4543  C   ASN A 559      47.030  45.460  29.039  1.00  0.84           C  
ATOM   4544  O   ASN A 559      45.957  45.766  28.535  1.00  0.84           O  
ATOM   4545  CB  ASN A 559      48.081  46.983  27.289  1.00  0.84           C  
ATOM   4546  CG  ASN A 559      47.570  48.220  28.021  1.00  0.84           C  
ATOM   4547  OD1 ASN A 559      47.998  48.493  29.143  1.00  0.84           O  
ATOM   4548  ND2 ASN A 559      46.605  48.930  27.399  1.00  0.84           N  
ATOM   4549  N   PRO A 560      47.054  44.821  30.198  1.00  0.89           N  
ATOM   4550  CA  PRO A 560      45.855  44.236  30.813  1.00  0.89           C  
ATOM   4551  C   PRO A 560      44.807  45.255  31.225  1.00  0.89           C  
ATOM   4552  O   PRO A 560      43.691  44.892  31.558  1.00  0.89           O  
ATOM   4553  CB  PRO A 560      46.413  43.465  32.027  1.00  0.89           C  
ATOM   4554  CG  PRO A 560      47.847  43.982  32.211  1.00  0.89           C  
ATOM   4555  CD  PRO A 560      48.279  44.297  30.796  1.00  0.89           C  
ATOM   4556  N   SER A 561      45.110  46.557  31.161  1.00  0.89           N  
ATOM   4557  CA  SER A 561      44.098  47.580  31.318  1.00  0.89           C  
ATOM   4558  C   SER A 561      43.189  47.715  30.105  1.00  0.89           C  
ATOM   4559  O   SER A 561      42.055  48.190  30.215  1.00  0.89           O  
ATOM   4560  CB  SER A 561      44.777  48.928  31.642  1.00  0.89           C  
ATOM   4561  OG  SER A 561      45.587  49.390  30.563  1.00  0.89           O  
ATOM   4562  N   SER A 562      43.638  47.237  28.926  1.00  0.94           N  
ATOM   4563  CA  SER A 562      42.856  47.208  27.708  1.00  0.94           C  
ATOM   4564  C   SER A 562      41.591  46.392  27.815  1.00  0.94           C  
ATOM   4565  O   SER A 562      41.485  45.431  28.578  1.00  0.94           O  
ATOM   4566  CB  SER A 562      43.619  46.735  26.439  1.00  0.94           C  
ATOM   4567  OG  SER A 562      43.919  45.340  26.451  1.00  0.94           O  
ATOM   4568  N   MET A 563      40.575  46.782  27.037  1.00  0.93           N  
ATOM   4569  CA  MET A 563      39.346  46.038  26.938  1.00  0.93           C  
ATOM   4570  C   MET A 563      39.567  44.743  26.170  1.00  0.93           C  
ATOM   4571  O   MET A 563      40.046  44.735  25.035  1.00  0.93           O  
ATOM   4572  CB  MET A 563      38.237  46.921  26.320  1.00  0.93           C  
ATOM   4573  CG  MET A 563      36.803  46.486  26.673  1.00  0.93           C  
ATOM   4574  SD  MET A 563      36.208  45.027  25.785  1.00  0.93           S  
ATOM   4575  CE  MET A 563      35.881  45.811  24.197  1.00  0.93           C  
ATOM   4576  N   PHE A 564      39.262  43.600  26.802  1.00  0.95           N  
ATOM   4577  CA  PHE A 564      39.473  42.291  26.218  1.00  0.95           C  
ATOM   4578  C   PHE A 564      38.227  41.879  25.453  1.00  0.95           C  
ATOM   4579  O   PHE A 564      37.238  41.409  26.017  1.00  0.95           O  
ATOM   4580  CB  PHE A 564      39.834  41.211  27.283  1.00  0.95           C  
ATOM   4581  CG  PHE A 564      41.289  41.182  27.710  1.00  0.95           C  
ATOM   4582  CD1 PHE A 564      42.171  42.270  27.563  1.00  0.95           C  
ATOM   4583  CD2 PHE A 564      41.789  40.001  28.294  1.00  0.95           C  
ATOM   4584  CE1 PHE A 564      43.511  42.173  27.959  1.00  0.95           C  
ATOM   4585  CE2 PHE A 564      43.132  39.893  28.681  1.00  0.95           C  
ATOM   4586  CZ  PHE A 564      43.995  40.980  28.507  1.00  0.95           C  
ATOM   4587  N   ASP A 565      38.287  42.054  24.124  1.00  0.97           N  
ATOM   4588  CA  ASP A 565      37.241  41.778  23.171  1.00  0.97           C  
ATOM   4589  C   ASP A 565      37.476  40.392  22.603  1.00  0.97           C  
ATOM   4590  O   ASP A 565      38.466  40.149  21.913  1.00  0.97           O  
ATOM   4591  CB  ASP A 565      37.337  42.875  22.079  1.00  0.97           C  
ATOM   4592  CG  ASP A 565      36.183  42.890  21.101  1.00  0.97           C  
ATOM   4593  OD1 ASP A 565      35.266  42.048  21.221  1.00  0.97           O  
ATOM   4594  OD2 ASP A 565      36.163  43.819  20.246  1.00  0.97           O  
ATOM   4595  N   VAL A 566      36.609  39.423  22.937  1.00  0.99           N  
ATOM   4596  CA  VAL A 566      36.900  38.029  22.656  1.00  0.99           C  
ATOM   4597  C   VAL A 566      35.787  37.358  21.878  1.00  0.99           C  
ATOM   4598  O   VAL A 566      34.629  37.277  22.299  1.00  0.99           O  
ATOM   4599  CB  VAL A 566      37.211  37.231  23.927  1.00  0.99           C  
ATOM   4600  CG1 VAL A 566      37.499  35.750  23.612  1.00  0.99           C  
ATOM   4601  CG2 VAL A 566      38.434  37.821  24.659  1.00  0.99           C  
ATOM   4602  N   HIS A 567      36.146  36.790  20.711  1.00  0.97           N  
ATOM   4603  CA  HIS A 567      35.254  35.949  19.941  1.00  0.97           C  
ATOM   4604  C   HIS A 567      35.864  34.568  19.830  1.00  0.97           C  
ATOM   4605  O   HIS A 567      36.735  34.317  18.997  1.00  0.97           O  
ATOM   4606  CB  HIS A 567      35.042  36.518  18.517  1.00  0.97           C  
ATOM   4607  CG  HIS A 567      33.986  35.823  17.691  1.00  0.97           C  
ATOM   4608  ND1 HIS A 567      32.702  36.323  17.617  1.00  0.97           N  
ATOM   4609  CD2 HIS A 567      34.119  34.786  16.831  1.00  0.97           C  
ATOM   4610  CE1 HIS A 567      32.085  35.606  16.711  1.00  0.97           C  
ATOM   4611  NE2 HIS A 567      32.896  34.656  16.199  1.00  0.97           N  
ATOM   4612  N   VAL A 568      35.400  33.609  20.653  1.00  0.97           N  
ATOM   4613  CA  VAL A 568      35.902  32.242  20.600  1.00  0.97           C  
ATOM   4614  C   VAL A 568      34.776  31.260  20.358  1.00  0.97           C  
ATOM   4615  O   VAL A 568      33.747  31.265  21.038  1.00  0.97           O  
ATOM   4616  CB  VAL A 568      36.727  31.789  21.799  1.00  0.97           C  
ATOM   4617  CG1 VAL A 568      38.100  32.483  21.786  1.00  0.97           C  
ATOM   4618  CG2 VAL A 568      35.995  32.057  23.120  1.00  0.97           C  
ATOM   4619  N   LYS A 569      34.964  30.388  19.347  1.00  0.89           N  
ATOM   4620  CA  LYS A 569      33.965  29.485  18.802  1.00  0.89           C  
ATOM   4621  C   LYS A 569      34.490  28.987  17.476  1.00  0.89           C  
ATOM   4622  O   LYS A 569      35.422  29.556  16.919  1.00  0.89           O  
ATOM   4623  CB  LYS A 569      32.551  30.103  18.588  1.00  0.89           C  
ATOM   4624  CG  LYS A 569      32.532  31.411  17.777  1.00  0.89           C  
ATOM   4625  CD  LYS A 569      31.145  32.076  17.773  1.00  0.89           C  
ATOM   4626  CE  LYS A 569      30.774  32.795  19.075  1.00  0.89           C  
ATOM   4627  NZ  LYS A 569      29.301  32.887  19.179  1.00  0.89           N  
ATOM   4628  N   ARG A 570      33.939  27.883  16.930  1.00  0.87           N  
ATOM   4629  CA  ARG A 570      34.329  27.393  15.616  1.00  0.87           C  
ATOM   4630  C   ARG A 570      34.164  28.432  14.511  1.00  0.87           C  
ATOM   4631  O   ARG A 570      33.279  29.286  14.554  1.00  0.87           O  
ATOM   4632  CB  ARG A 570      33.546  26.109  15.239  1.00  0.87           C  
ATOM   4633  CG  ARG A 570      33.916  24.870  16.081  1.00  0.87           C  
ATOM   4634  CD  ARG A 570      35.342  24.346  15.873  1.00  0.87           C  
ATOM   4635  NE  ARG A 570      35.472  23.855  14.463  1.00  0.87           N  
ATOM   4636  CZ  ARG A 570      35.344  22.570  14.101  1.00  0.87           C  
ATOM   4637  NH1 ARG A 570      35.088  21.625  14.991  1.00  0.87           N  
ATOM   4638  NH2 ARG A 570      35.492  22.238  12.821  1.00  0.87           N  
ATOM   4639  N   ILE A 571      35.065  28.412  13.514  1.00  0.95           N  
ATOM   4640  CA  ILE A 571      35.080  29.409  12.461  1.00  0.95           C  
ATOM   4641  C   ILE A 571      34.015  29.096  11.432  1.00  0.95           C  
ATOM   4642  O   ILE A 571      33.999  28.025  10.828  1.00  0.95           O  
ATOM   4643  CB  ILE A 571      36.438  29.544  11.789  1.00  0.95           C  
ATOM   4644  CG1 ILE A 571      37.590  29.679  12.813  1.00  0.95           C  
ATOM   4645  CG2 ILE A 571      36.428  30.737  10.807  1.00  0.95           C  
ATOM   4646  CD1 ILE A 571      37.534  30.907  13.729  1.00  0.95           C  
ATOM   4647  N   HIS A 572      33.074  30.033  11.239  1.00  0.92           N  
ATOM   4648  CA  HIS A 572      31.947  29.836  10.357  1.00  0.92           C  
ATOM   4649  C   HIS A 572      31.520  31.165   9.808  1.00  0.92           C  
ATOM   4650  O   HIS A 572      31.468  32.162  10.526  1.00  0.92           O  
ATOM   4651  CB  HIS A 572      30.712  29.294  11.112  1.00  0.92           C  
ATOM   4652  CG  HIS A 572      30.621  27.811  11.143  1.00  0.92           C  
ATOM   4653  ND1 HIS A 572      30.156  27.158  10.017  1.00  0.92           N  
ATOM   4654  CD2 HIS A 572      30.852  26.931  12.147  1.00  0.92           C  
ATOM   4655  CE1 HIS A 572      30.119  25.882  10.361  1.00  0.92           C  
ATOM   4656  NE2 HIS A 572      30.527  25.697  11.640  1.00  0.92           N  
ATOM   4657  N   GLU A 573      31.093  31.203   8.537  1.00  0.93           N  
ATOM   4658  CA  GLU A 573      30.512  32.390   7.942  1.00  0.93           C  
ATOM   4659  C   GLU A 573      29.262  32.879   8.675  1.00  0.93           C  
ATOM   4660  O   GLU A 573      29.092  34.070   8.917  1.00  0.93           O  
ATOM   4661  CB  GLU A 573      30.187  32.109   6.467  1.00  0.93           C  
ATOM   4662  CG  GLU A 573      31.444  31.818   5.617  1.00  0.93           C  
ATOM   4663  CD  GLU A 573      31.065  31.462   4.183  1.00  0.93           C  
ATOM   4664  OE1 GLU A 573      30.344  32.265   3.545  1.00  0.93           O  
ATOM   4665  OE2 GLU A 573      31.505  30.380   3.715  1.00  0.93           O  
ATOM   4666  N   TYR A 574      28.392  31.950   9.134  1.00  0.89           N  
ATOM   4667  CA  TYR A 574      27.213  32.272   9.929  1.00  0.89           C  
ATOM   4668  C   TYR A 574      27.486  32.948  11.269  1.00  0.89           C  
ATOM   4669  O   TYR A 574      26.731  33.806  11.718  1.00  0.89           O  
ATOM   4670  CB  TYR A 574      26.258  31.045  10.062  1.00  0.89           C  
ATOM   4671  CG  TYR A 574      26.474  30.114  11.233  1.00  0.89           C  
ATOM   4672  CD1 TYR A 574      25.952  30.443  12.497  1.00  0.89           C  
ATOM   4673  CD2 TYR A 574      27.100  28.868  11.066  1.00  0.89           C  
ATOM   4674  CE1 TYR A 574      26.035  29.543  13.564  1.00  0.89           C  
ATOM   4675  CE2 TYR A 574      27.179  27.960  12.135  1.00  0.89           C  
ATOM   4676  CZ  TYR A 574      26.623  28.293  13.379  1.00  0.89           C  
ATOM   4677  OH  TYR A 574      26.653  27.395  14.466  1.00  0.89           O  
ATOM   4678  N   LYS A 575      28.594  32.563  11.934  1.00  0.90           N  
ATOM   4679  CA  LYS A 575      29.023  33.110  13.208  1.00  0.90           C  
ATOM   4680  C   LYS A 575      29.767  34.424  13.034  1.00  0.90           C  
ATOM   4681  O   LYS A 575      30.001  35.143  14.004  1.00  0.90           O  
ATOM   4682  CB  LYS A 575      29.953  32.110  13.937  1.00  0.90           C  
ATOM   4683  CG  LYS A 575      29.233  30.831  14.403  1.00  0.90           C  
ATOM   4684  CD  LYS A 575      30.201  29.794  14.990  1.00  0.90           C  
ATOM   4685  CE  LYS A 575      29.572  28.458  15.407  1.00  0.90           C  
ATOM   4686  NZ  LYS A 575      28.559  28.617  16.467  1.00  0.90           N  
ATOM   4687  N   ARG A 576      30.129  34.752  11.777  1.00  0.91           N  
ATOM   4688  CA  ARG A 576      30.611  36.042  11.333  1.00  0.91           C  
ATOM   4689  C   ARG A 576      31.877  36.572  11.982  1.00  0.91           C  
ATOM   4690  O   ARG A 576      31.964  37.750  12.326  1.00  0.91           O  
ATOM   4691  CB  ARG A 576      29.520  37.135  11.436  1.00  0.91           C  
ATOM   4692  CG  ARG A 576      28.270  36.952  10.554  1.00  0.91           C  
ATOM   4693  CD  ARG A 576      27.098  37.726  11.155  1.00  0.91           C  
ATOM   4694  NE  ARG A 576      26.365  38.538  10.139  1.00  0.91           N  
ATOM   4695  CZ  ARG A 576      25.425  39.398  10.537  1.00  0.91           C  
ATOM   4696  NH1 ARG A 576      25.162  39.615  11.825  1.00  0.91           N  
ATOM   4697  NH2 ARG A 576      24.718  40.090   9.653  1.00  0.91           N  
ATOM   4698  N   GLN A 577      32.958  35.768  12.055  1.00  0.95           N  
ATOM   4699  CA  GLN A 577      34.273  36.274  12.434  1.00  0.95           C  
ATOM   4700  C   GLN A 577      34.725  37.415  11.509  1.00  0.95           C  
ATOM   4701  O   GLN A 577      35.352  38.381  11.929  1.00  0.95           O  
ATOM   4702  CB  GLN A 577      35.337  35.144  12.452  1.00  0.95           C  
ATOM   4703  CG  GLN A 577      35.237  34.160  13.647  1.00  0.95           C  
ATOM   4704  CD  GLN A 577      34.199  33.047  13.480  1.00  0.95           C  
ATOM   4705  OE1 GLN A 577      33.568  32.867  12.440  1.00  0.95           O  
ATOM   4706  NE2 GLN A 577      34.010  32.241  14.553  1.00  0.95           N  
ATOM   4707  N   LEU A 578      34.315  37.371  10.224  1.00  0.97           N  
ATOM   4708  CA  LEU A 578      34.487  38.452   9.270  1.00  0.97           C  
ATOM   4709  C   LEU A 578      33.851  39.782   9.651  1.00  0.97           C  
ATOM   4710  O   LEU A 578      34.452  40.829   9.435  1.00  0.97           O  
ATOM   4711  CB  LEU A 578      33.927  38.042   7.890  1.00  0.97           C  
ATOM   4712  CG  LEU A 578      34.784  36.987   7.177  1.00  0.97           C  
ATOM   4713  CD1 LEU A 578      34.066  36.440   5.943  1.00  0.97           C  
ATOM   4714  CD2 LEU A 578      36.145  37.566   6.774  1.00  0.97           C  
ATOM   4715  N   LEU A 579      32.643  39.803  10.254  1.00  0.97           N  
ATOM   4716  CA  LEU A 579      32.041  41.039  10.746  1.00  0.97           C  
ATOM   4717  C   LEU A 579      32.894  41.687  11.835  1.00  0.97           C  
ATOM   4718  O   LEU A 579      33.151  42.892  11.827  1.00  0.97           O  
ATOM   4719  CB  LEU A 579      30.593  40.789  11.243  1.00  0.97           C  
ATOM   4720  CG  LEU A 579      29.833  42.024  11.772  1.00  0.97           C  
ATOM   4721  CD1 LEU A 579      29.708  43.153  10.738  1.00  0.97           C  
ATOM   4722  CD2 LEU A 579      28.437  41.632  12.274  1.00  0.97           C  
ATOM   4723  N   ASN A 580      33.440  40.865  12.760  1.00  0.97           N  
ATOM   4724  CA  ASN A 580      34.409  41.295  13.750  1.00  0.97           C  
ATOM   4725  C   ASN A 580      35.681  41.832  13.110  1.00  0.97           C  
ATOM   4726  O   ASN A 580      36.143  42.905  13.484  1.00  0.97           O  
ATOM   4727  CB  ASN A 580      34.722  40.122  14.717  1.00  0.97           C  
ATOM   4728  CG  ASN A 580      35.446  40.481  16.021  1.00  0.97           C  
ATOM   4729  OD1 ASN A 580      35.692  39.586  16.827  1.00  0.97           O  
ATOM   4730  ND2 ASN A 580      35.783  41.769  16.255  1.00  0.97           N  
ATOM   4731  N   CYS A 581      36.227  41.143  12.090  1.00  0.97           N  
ATOM   4732  CA  CYS A 581      37.388  41.601  11.340  1.00  0.97           C  
ATOM   4733  C   CYS A 581      37.182  42.941  10.653  1.00  0.97           C  
ATOM   4734  O   CYS A 581      38.068  43.792  10.692  1.00  0.97           O  
ATOM   4735  CB  CYS A 581      37.847  40.577  10.272  1.00  0.97           C  
ATOM   4736  SG  CYS A 581      38.442  39.022  11.022  1.00  0.97           S  
ATOM   4737  N   LEU A 582      35.999  43.199  10.052  1.00  0.96           N  
ATOM   4738  CA  LEU A 582      35.689  44.508   9.496  1.00  0.96           C  
ATOM   4739  C   LEU A 582      35.734  45.613  10.541  1.00  0.96           C  
ATOM   4740  O   LEU A 582      36.359  46.644  10.324  1.00  0.96           O  
ATOM   4741  CB  LEU A 582      34.305  44.536   8.794  1.00  0.96           C  
ATOM   4742  CG  LEU A 582      34.180  43.668   7.523  1.00  0.96           C  
ATOM   4743  CD1 LEU A 582      32.808  43.893   6.873  1.00  0.96           C  
ATOM   4744  CD2 LEU A 582      35.287  43.946   6.496  1.00  0.96           C  
ATOM   4745  N   HIS A 583      35.157  45.398  11.745  1.00  0.95           N  
ATOM   4746  CA  HIS A 583      35.266  46.362  12.838  1.00  0.95           C  
ATOM   4747  C   HIS A 583      36.691  46.641  13.292  1.00  0.95           C  
ATOM   4748  O   HIS A 583      37.054  47.794  13.522  1.00  0.95           O  
ATOM   4749  CB  HIS A 583      34.436  45.935  14.069  1.00  0.95           C  
ATOM   4750  CG  HIS A 583      34.634  46.794  15.287  1.00  0.95           C  
ATOM   4751  ND1 HIS A 583      35.140  46.214  16.432  1.00  0.95           N  
ATOM   4752  CD2 HIS A 583      34.512  48.137  15.456  1.00  0.95           C  
ATOM   4753  CE1 HIS A 583      35.320  47.210  17.277  1.00  0.95           C  
ATOM   4754  NE2 HIS A 583      34.958  48.399  16.736  1.00  0.95           N  
ATOM   4755  N   VAL A 584      37.542  45.602  13.395  1.00  0.96           N  
ATOM   4756  CA  VAL A 584      38.947  45.738  13.752  1.00  0.96           C  
ATOM   4757  C   VAL A 584      39.706  46.629  12.779  1.00  0.96           C  
ATOM   4758  O   VAL A 584      40.428  47.547  13.173  1.00  0.96           O  
ATOM   4759  CB  VAL A 584      39.611  44.365  13.782  1.00  0.96           C  
ATOM   4760  CG1 VAL A 584      41.124  44.474  14.013  1.00  0.96           C  
ATOM   4761  CG2 VAL A 584      39.013  43.533  14.925  1.00  0.96           C  
ATOM   4762  N   VAL A 585      39.515  46.413  11.463  1.00  0.95           N  
ATOM   4763  CA  VAL A 585      40.119  47.232  10.424  1.00  0.95           C  
ATOM   4764  C   VAL A 585      39.612  48.669  10.450  1.00  0.95           C  
ATOM   4765  O   VAL A 585      40.391  49.623  10.397  1.00  0.95           O  
ATOM   4766  CB  VAL A 585      39.908  46.604   9.053  1.00  0.95           C  
ATOM   4767  CG1 VAL A 585      40.441  47.505   7.926  1.00  0.95           C  
ATOM   4768  CG2 VAL A 585      40.637  45.248   9.007  1.00  0.95           C  
ATOM   4769  N   THR A 586      38.289  48.867  10.618  1.00  0.93           N  
ATOM   4770  CA  THR A 586      37.660  50.180  10.751  1.00  0.93           C  
ATOM   4771  C   THR A 586      38.208  50.959  11.930  1.00  0.93           C  
ATOM   4772  O   THR A 586      38.523  52.145  11.832  1.00  0.93           O  
ATOM   4773  CB  THR A 586      36.148  50.058  10.912  1.00  0.93           C  
ATOM   4774  OG1 THR A 586      35.619  49.409   9.770  1.00  0.93           O  
ATOM   4775  CG2 THR A 586      35.448  51.418  11.021  1.00  0.93           C  
ATOM   4776  N   LEU A 587      38.390  50.296  13.089  1.00  0.93           N  
ATOM   4777  CA  LEU A 587      39.003  50.882  14.265  1.00  0.93           C  
ATOM   4778  C   LEU A 587      40.462  51.270  14.065  1.00  0.93           C  
ATOM   4779  O   LEU A 587      40.871  52.373  14.421  1.00  0.93           O  
ATOM   4780  CB  LEU A 587      38.836  49.919  15.463  1.00  0.93           C  
ATOM   4781  CG  LEU A 587      39.124  50.514  16.856  1.00  0.93           C  
ATOM   4782  CD1 LEU A 587      38.332  51.804  17.117  1.00  0.93           C  
ATOM   4783  CD2 LEU A 587      38.788  49.479  17.939  1.00  0.93           C  
ATOM   4784  N   TYR A 588      41.265  50.409  13.406  1.00  0.93           N  
ATOM   4785  CA  TYR A 588      42.640  50.697  13.013  1.00  0.93           C  
ATOM   4786  C   TYR A 588      42.751  51.933  12.122  1.00  0.93           C  
ATOM   4787  O   TYR A 588      43.557  52.834  12.359  1.00  0.93           O  
ATOM   4788  CB  TYR A 588      43.184  49.439  12.269  1.00  0.93           C  
ATOM   4789  CG  TYR A 588      44.530  49.618  11.611  1.00  0.93           C  
ATOM   4790  CD1 TYR A 588      45.700  49.655  12.379  1.00  0.93           C  
ATOM   4791  CD2 TYR A 588      44.626  49.764  10.215  1.00  0.93           C  
ATOM   4792  CE1 TYR A 588      46.950  49.833  11.765  1.00  0.93           C  
ATOM   4793  CE2 TYR A 588      45.871  49.949   9.601  1.00  0.93           C  
ATOM   4794  CZ  TYR A 588      47.027  49.985  10.379  1.00  0.93           C  
ATOM   4795  OH  TYR A 588      48.266  50.189   9.755  1.00  0.93           O  
ATOM   4796  N   ASN A 589      41.892  52.029  11.091  1.00  0.91           N  
ATOM   4797  CA  ASN A 589      41.837  53.188  10.226  1.00  0.91           C  
ATOM   4798  C   ASN A 589      41.427  54.453  10.966  1.00  0.91           C  
ATOM   4799  O   ASN A 589      42.000  55.515  10.739  1.00  0.91           O  
ATOM   4800  CB  ASN A 589      40.890  52.947   9.027  1.00  0.91           C  
ATOM   4801  CG  ASN A 589      41.333  51.796   8.124  1.00  0.91           C  
ATOM   4802  OD1 ASN A 589      40.494  51.110   7.544  1.00  0.91           O  
ATOM   4803  ND2 ASN A 589      42.660  51.606   7.938  1.00  0.91           N  
ATOM   4804  N   ARG A 590      40.460  54.370  11.900  1.00  0.85           N  
ATOM   4805  CA  ARG A 590      40.064  55.484  12.744  1.00  0.85           C  
ATOM   4806  C   ARG A 590      41.162  56.024  13.653  1.00  0.85           C  
ATOM   4807  O   ARG A 590      41.344  57.236  13.746  1.00  0.85           O  
ATOM   4808  CB  ARG A 590      38.824  55.099  13.599  1.00  0.85           C  
ATOM   4809  CG  ARG A 590      37.527  55.774  13.118  1.00  0.85           C  
ATOM   4810  CD  ARG A 590      36.457  54.824  12.564  1.00  0.85           C  
ATOM   4811  NE  ARG A 590      35.705  54.238  13.722  1.00  0.85           N  
ATOM   4812  CZ  ARG A 590      34.366  54.212  13.777  1.00  0.85           C  
ATOM   4813  NH1 ARG A 590      33.593  54.582  12.761  1.00  0.85           N  
ATOM   4814  NH2 ARG A 590      33.771  53.832  14.911  1.00  0.85           N  
ATOM   4815  N   ILE A 591      41.937  55.138  14.314  1.00  0.86           N  
ATOM   4816  CA  ILE A 591      43.069  55.515  15.159  1.00  0.86           C  
ATOM   4817  C   ILE A 591      44.161  56.223  14.371  1.00  0.86           C  
ATOM   4818  O   ILE A 591      44.740  57.216  14.808  1.00  0.86           O  
ATOM   4819  CB  ILE A 591      43.645  54.296  15.885  1.00  0.86           C  
ATOM   4820  CG1 ILE A 591      42.600  53.719  16.871  1.00  0.86           C  
ATOM   4821  CG2 ILE A 591      44.943  54.672  16.636  1.00  0.86           C  
ATOM   4822  CD1 ILE A 591      43.024  52.402  17.531  1.00  0.86           C  
ATOM   4823  N   LYS A 592      44.458  55.726  13.157  1.00  0.84           N  
ATOM   4824  CA  LYS A 592      45.364  56.375  12.232  1.00  0.84           C  
ATOM   4825  C   LYS A 592      44.903  57.732  11.732  1.00  0.84           C  
ATOM   4826  O   LYS A 592      45.707  58.647  11.577  1.00  0.84           O  
ATOM   4827  CB  LYS A 592      45.611  55.463  11.011  1.00  0.84           C  
ATOM   4828  CG  LYS A 592      46.757  54.479  11.256  1.00  0.84           C  
ATOM   4829  CD  LYS A 592      47.166  53.772   9.959  1.00  0.84           C  
ATOM   4830  CE  LYS A 592      48.587  53.218   9.979  1.00  0.84           C  
ATOM   4831  NZ  LYS A 592      49.606  54.273  10.144  1.00  0.84           N  
ATOM   4832  N   ARG A 593      43.599  57.876  11.434  1.00  0.80           N  
ATOM   4833  CA  ARG A 593      43.021  59.091  10.897  1.00  0.80           C  
ATOM   4834  C   ARG A 593      43.118  60.275  11.838  1.00  0.80           C  
ATOM   4835  O   ARG A 593      43.447  61.386  11.430  1.00  0.80           O  
ATOM   4836  CB  ARG A 593      41.527  58.854  10.569  1.00  0.80           C  
ATOM   4837  CG  ARG A 593      41.059  59.549   9.280  1.00  0.80           C  
ATOM   4838  CD  ARG A 593      39.534  59.717   9.161  1.00  0.80           C  
ATOM   4839  NE  ARG A 593      38.796  58.485   9.624  1.00  0.80           N  
ATOM   4840  CZ  ARG A 593      38.714  57.309   8.985  1.00  0.80           C  
ATOM   4841  NH1 ARG A 593      39.403  57.040   7.884  1.00  0.80           N  
ATOM   4842  NH2 ARG A 593      37.924  56.361   9.474  1.00  0.80           N  
ATOM   4843  N   ASP A 594      42.835  60.033  13.130  1.00  0.81           N  
ATOM   4844  CA  ASP A 594      42.866  61.052  14.150  1.00  0.81           C  
ATOM   4845  C   ASP A 594      43.823  60.610  15.255  1.00  0.81           C  
ATOM   4846  O   ASP A 594      43.410  60.038  16.268  1.00  0.81           O  
ATOM   4847  CB  ASP A 594      41.425  61.258  14.668  1.00  0.81           C  
ATOM   4848  CG  ASP A 594      41.251  62.563  15.419  1.00  0.81           C  
ATOM   4849  OD1 ASP A 594      42.269  63.226  15.741  1.00  0.81           O  
ATOM   4850  OD2 ASP A 594      40.063  62.876  15.706  1.00  0.81           O  
ATOM   4851  N   PRO A 595      45.132  60.836  15.135  1.00  0.77           N  
ATOM   4852  CA  PRO A 595      46.098  60.282  16.072  1.00  0.77           C  
ATOM   4853  C   PRO A 595      46.033  61.004  17.393  1.00  0.77           C  
ATOM   4854  O   PRO A 595      46.516  60.457  18.384  1.00  0.77           O  
ATOM   4855  CB  PRO A 595      47.451  60.508  15.374  1.00  0.77           C  
ATOM   4856  CG  PRO A 595      47.205  61.698  14.443  1.00  0.77           C  
ATOM   4857  CD  PRO A 595      45.778  61.445  13.971  1.00  0.77           C  
ATOM   4858  N   ALA A 596      45.433  62.205  17.421  1.00  0.67           N  
ATOM   4859  CA  ALA A 596      45.353  63.060  18.580  1.00  0.67           C  
ATOM   4860  C   ALA A 596      44.027  62.921  19.310  1.00  0.67           C  
ATOM   4861  O   ALA A 596      43.668  63.732  20.165  1.00  0.67           O  
ATOM   4862  CB  ALA A 596      45.597  64.509  18.134  1.00  0.67           C  
ATOM   4863  N   LYS A 597      43.291  61.839  19.024  1.00  0.72           N  
ATOM   4864  CA  LYS A 597      42.041  61.521  19.665  1.00  0.72           C  
ATOM   4865  C   LYS A 597      42.190  60.356  20.629  1.00  0.72           C  
ATOM   4866  O   LYS A 597      42.936  59.393  20.417  1.00  0.72           O  
ATOM   4867  CB  LYS A 597      40.984  61.198  18.596  1.00  0.72           C  
ATOM   4868  CG  LYS A 597      39.558  60.969  19.113  1.00  0.72           C  
ATOM   4869  CD  LYS A 597      38.579  60.831  17.940  1.00  0.72           C  
ATOM   4870  CE  LYS A 597      37.117  60.886  18.359  1.00  0.72           C  
ATOM   4871  NZ  LYS A 597      36.268  60.880  17.150  1.00  0.72           N  
ATOM   4872  N   ALA A 598      41.469  60.431  21.767  1.00  0.79           N  
ATOM   4873  CA  ALA A 598      41.428  59.372  22.743  1.00  0.79           C  
ATOM   4874  C   ALA A 598      40.575  58.182  22.322  1.00  0.79           C  
ATOM   4875  O   ALA A 598      39.362  58.271  22.098  1.00  0.79           O  
ATOM   4876  CB  ALA A 598      40.933  59.896  24.100  1.00  0.79           C  
ATOM   4877  N   PHE A 599      41.218  57.011  22.255  1.00  0.86           N  
ATOM   4878  CA  PHE A 599      40.589  55.762  21.904  1.00  0.86           C  
ATOM   4879  C   PHE A 599      40.759  54.842  23.078  1.00  0.86           C  
ATOM   4880  O   PHE A 599      41.813  54.817  23.713  1.00  0.86           O  
ATOM   4881  CB  PHE A 599      41.239  55.110  20.662  1.00  0.86           C  
ATOM   4882  CG  PHE A 599      40.906  55.908  19.434  1.00  0.86           C  
ATOM   4883  CD1 PHE A 599      39.683  55.724  18.768  1.00  0.86           C  
ATOM   4884  CD2 PHE A 599      41.819  56.837  18.921  1.00  0.86           C  
ATOM   4885  CE1 PHE A 599      39.377  56.465  17.617  1.00  0.86           C  
ATOM   4886  CE2 PHE A 599      41.513  57.592  17.786  1.00  0.86           C  
ATOM   4887  CZ  PHE A 599      40.294  57.405  17.127  1.00  0.86           C  
ATOM   4888  N   VAL A 600      39.707  54.080  23.424  1.00  0.90           N  
ATOM   4889  CA  VAL A 600      39.778  53.108  24.494  1.00  0.90           C  
ATOM   4890  C   VAL A 600      40.733  51.983  24.099  1.00  0.90           C  
ATOM   4891  O   VAL A 600      40.525  51.390  23.039  1.00  0.90           O  
ATOM   4892  CB  VAL A 600      38.388  52.582  24.815  1.00  0.90           C  
ATOM   4893  CG1 VAL A 600      38.422  51.375  25.769  1.00  0.90           C  
ATOM   4894  CG2 VAL A 600      37.574  53.729  25.445  1.00  0.90           C  
ATOM   4895  N   PRO A 601      41.803  51.670  24.841  1.00  0.94           N  
ATOM   4896  CA  PRO A 601      42.694  50.568  24.508  1.00  0.94           C  
ATOM   4897  C   PRO A 601      41.976  49.238  24.430  1.00  0.94           C  
ATOM   4898  O   PRO A 601      41.247  48.887  25.357  1.00  0.94           O  
ATOM   4899  CB  PRO A 601      43.778  50.605  25.596  1.00  0.94           C  
ATOM   4900  CG  PRO A 601      43.092  51.284  26.782  1.00  0.94           C  
ATOM   4901  CD  PRO A 601      42.199  52.316  26.097  1.00  0.94           C  
ATOM   4902  N   ARG A 602      42.165  48.477  23.341  1.00  0.90           N  
ATOM   4903  CA  ARG A 602      41.417  47.257  23.126  1.00  0.90           C  
ATOM   4904  C   ARG A 602      42.300  46.123  22.622  1.00  0.90           C  
ATOM   4905  O   ARG A 602      43.116  46.279  21.717  1.00  0.90           O  
ATOM   4906  CB  ARG A 602      40.242  47.524  22.147  1.00  0.90           C  
ATOM   4907  CG  ARG A 602      39.194  46.399  22.103  1.00  0.90           C  
ATOM   4908  CD  ARG A 602      38.099  46.572  21.039  1.00  0.90           C  
ATOM   4909  NE  ARG A 602      37.068  47.568  21.493  1.00  0.90           N  
ATOM   4910  CZ  ARG A 602      35.760  47.421  21.244  1.00  0.90           C  
ATOM   4911  NH1 ARG A 602      35.246  46.330  20.690  1.00  0.90           N  
ATOM   4912  NH2 ARG A 602      34.927  48.403  21.562  1.00  0.90           N  
ATOM   4913  N   THR A 603      42.147  44.920  23.201  1.00  0.94           N  
ATOM   4914  CA  THR A 603      42.813  43.713  22.719  1.00  0.94           C  
ATOM   4915  C   THR A 603      41.739  42.856  22.109  1.00  0.94           C  
ATOM   4916  O   THR A 603      40.869  42.348  22.815  1.00  0.94           O  
ATOM   4917  CB  THR A 603      43.511  42.887  23.794  1.00  0.94           C  
ATOM   4918  OG1 THR A 603      44.540  43.648  24.411  1.00  0.94           O  
ATOM   4919  CG2 THR A 603      44.220  41.667  23.187  1.00  0.94           C  
ATOM   4920  N   VAL A 604      41.756  42.675  20.778  1.00  0.96           N  
ATOM   4921  CA  VAL A 604      40.774  41.867  20.082  1.00  0.96           C  
ATOM   4922  C   VAL A 604      41.344  40.488  19.860  1.00  0.96           C  
ATOM   4923  O   VAL A 604      42.374  40.303  19.210  1.00  0.96           O  
ATOM   4924  CB  VAL A 604      40.336  42.461  18.750  1.00  0.96           C  
ATOM   4925  CG1 VAL A 604      39.304  41.535  18.071  1.00  0.96           C  
ATOM   4926  CG2 VAL A 604      39.705  43.844  18.993  1.00  0.96           C  
ATOM   4927  N   MET A 605      40.680  39.467  20.414  1.00  0.93           N  
ATOM   4928  CA  MET A 605      41.121  38.101  20.317  1.00  0.93           C  
ATOM   4929  C   MET A 605      40.072  37.265  19.628  1.00  0.93           C  
ATOM   4930  O   MET A 605      38.925  37.163  20.060  1.00  0.93           O  
ATOM   4931  CB  MET A 605      41.367  37.485  21.705  1.00  0.93           C  
ATOM   4932  CG  MET A 605      42.429  38.214  22.534  1.00  0.93           C  
ATOM   4933  SD  MET A 605      42.674  37.408  24.124  1.00  0.93           S  
ATOM   4934  CE  MET A 605      42.536  38.881  25.160  1.00  0.93           C  
ATOM   4935  N   ILE A 606      40.458  36.612  18.528  1.00  0.96           N  
ATOM   4936  CA  ILE A 606      39.565  35.759  17.774  1.00  0.96           C  
ATOM   4937  C   ILE A 606      40.183  34.385  17.810  1.00  0.96           C  
ATOM   4938  O   ILE A 606      41.372  34.225  17.565  1.00  0.96           O  
ATOM   4939  CB  ILE A 606      39.382  36.263  16.346  1.00  0.96           C  
ATOM   4940  CG1 ILE A 606      38.759  37.682  16.383  1.00  0.96           C  
ATOM   4941  CG2 ILE A 606      38.517  35.274  15.533  1.00  0.96           C  
ATOM   4942  CD1 ILE A 606      38.584  38.343  15.012  1.00  0.96           C  
ATOM   4943  N   GLY A 607      39.426  33.336  18.165  1.00  0.98           N  
ATOM   4944  CA  GLY A 607      39.997  31.995  18.225  1.00  0.98           C  
ATOM   4945  C   GLY A 607      39.004  30.944  17.860  1.00  0.98           C  
ATOM   4946  O   GLY A 607      37.815  31.046  18.151  1.00  0.98           O  
ATOM   4947  N   GLY A 608      39.468  29.863  17.221  1.00  0.98           N  
ATOM   4948  CA  GLY A 608      38.549  28.843  16.758  1.00  0.98           C  
ATOM   4949  C   GLY A 608      39.144  27.972  15.710  1.00  0.98           C  
ATOM   4950  O   GLY A 608      40.089  28.327  15.017  1.00  0.98           O  
ATOM   4951  N   LYS A 609      38.582  26.772  15.547  1.00  0.92           N  
ATOM   4952  CA  LYS A 609      39.025  25.859  14.518  1.00  0.92           C  
ATOM   4953  C   LYS A 609      38.111  25.890  13.314  1.00  0.92           C  
ATOM   4954  O   LYS A 609      36.898  26.102  13.409  1.00  0.92           O  
ATOM   4955  CB  LYS A 609      39.140  24.424  15.073  1.00  0.92           C  
ATOM   4956  CG  LYS A 609      40.300  24.293  16.065  1.00  0.92           C  
ATOM   4957  CD  LYS A 609      40.311  22.954  16.813  1.00  0.92           C  
ATOM   4958  CE  LYS A 609      41.457  22.936  17.820  1.00  0.92           C  
ATOM   4959  NZ  LYS A 609      41.485  21.702  18.628  1.00  0.92           N  
ATOM   4960  N   ALA A 610      38.692  25.647  12.135  1.00  0.94           N  
ATOM   4961  CA  ALA A 610      37.981  25.513  10.892  1.00  0.94           C  
ATOM   4962  C   ALA A 610      38.018  24.054  10.487  1.00  0.94           C  
ATOM   4963  O   ALA A 610      38.993  23.352  10.740  1.00  0.94           O  
ATOM   4964  CB  ALA A 610      38.684  26.365   9.826  1.00  0.94           C  
ATOM   4965  N   ALA A 611      36.950  23.512   9.870  1.00  0.91           N  
ATOM   4966  CA  ALA A 611      37.035  22.172   9.313  1.00  0.91           C  
ATOM   4967  C   ALA A 611      38.079  22.092   8.181  1.00  0.91           C  
ATOM   4968  O   ALA A 611      38.192  23.072   7.443  1.00  0.91           O  
ATOM   4969  CB  ALA A 611      35.650  21.700   8.840  1.00  0.91           C  
ATOM   4970  N   PRO A 612      38.860  21.025   7.978  1.00  0.88           N  
ATOM   4971  CA  PRO A 612      39.948  21.000   7.002  1.00  0.88           C  
ATOM   4972  C   PRO A 612      39.548  21.334   5.584  1.00  0.88           C  
ATOM   4973  O   PRO A 612      40.307  22.008   4.889  1.00  0.88           O  
ATOM   4974  CB  PRO A 612      40.536  19.594   7.133  1.00  0.88           C  
ATOM   4975  CG  PRO A 612      40.362  19.308   8.622  1.00  0.88           C  
ATOM   4976  CD  PRO A 612      38.995  19.919   8.921  1.00  0.88           C  
ATOM   4977  N   GLY A 613      38.354  20.882   5.152  1.00  0.84           N  
ATOM   4978  CA  GLY A 613      37.800  21.192   3.840  1.00  0.84           C  
ATOM   4979  C   GLY A 613      37.092  22.521   3.723  1.00  0.84           C  
ATOM   4980  O   GLY A 613      36.667  22.910   2.638  1.00  0.84           O  
ATOM   4981  N   TYR A 614      36.931  23.281   4.822  1.00  0.88           N  
ATOM   4982  CA  TYR A 614      36.210  24.541   4.797  1.00  0.88           C  
ATOM   4983  C   TYR A 614      37.158  25.671   4.439  1.00  0.88           C  
ATOM   4984  O   TYR A 614      37.729  26.354   5.290  1.00  0.88           O  
ATOM   4985  CB  TYR A 614      35.528  24.784   6.170  1.00  0.88           C  
ATOM   4986  CG  TYR A 614      34.440  25.835   6.243  1.00  0.88           C  
ATOM   4987  CD1 TYR A 614      34.021  26.674   5.186  1.00  0.88           C  
ATOM   4988  CD2 TYR A 614      33.793  25.956   7.484  1.00  0.88           C  
ATOM   4989  CE1 TYR A 614      32.975  27.596   5.378  1.00  0.88           C  
ATOM   4990  CE2 TYR A 614      32.752  26.869   7.671  1.00  0.88           C  
ATOM   4991  CZ  TYR A 614      32.332  27.680   6.618  1.00  0.88           C  
ATOM   4992  OH  TYR A 614      31.236  28.539   6.826  1.00  0.88           O  
ATOM   4993  N   HIS A 615      37.319  25.898   3.121  1.00  0.86           N  
ATOM   4994  CA  HIS A 615      38.248  26.871   2.566  1.00  0.86           C  
ATOM   4995  C   HIS A 615      38.026  28.289   3.062  1.00  0.86           C  
ATOM   4996  O   HIS A 615      38.955  28.954   3.513  1.00  0.86           O  
ATOM   4997  CB  HIS A 615      38.155  26.852   1.020  1.00  0.86           C  
ATOM   4998  CG  HIS A 615      39.031  27.848   0.319  1.00  0.86           C  
ATOM   4999  ND1 HIS A 615      40.391  27.850   0.555  1.00  0.86           N  
ATOM   5000  CD2 HIS A 615      38.700  28.830  -0.558  1.00  0.86           C  
ATOM   5001  CE1 HIS A 615      40.861  28.839  -0.189  1.00  0.86           C  
ATOM   5002  NE2 HIS A 615      39.878  29.461  -0.883  1.00  0.86           N  
ATOM   5003  N   MET A 616      36.765  28.769   3.079  1.00  0.90           N  
ATOM   5004  CA  MET A 616      36.465  30.108   3.553  1.00  0.90           C  
ATOM   5005  C   MET A 616      36.831  30.341   5.009  1.00  0.90           C  
ATOM   5006  O   MET A 616      37.460  31.334   5.355  1.00  0.90           O  
ATOM   5007  CB  MET A 616      34.979  30.446   3.325  1.00  0.90           C  
ATOM   5008  CG  MET A 616      34.614  31.919   3.607  1.00  0.90           C  
ATOM   5009  SD  MET A 616      35.591  33.148   2.691  1.00  0.90           S  
ATOM   5010  CE  MET A 616      34.892  32.786   1.058  1.00  0.90           C  
ATOM   5011  N   ALA A 617      36.529  29.383   5.901  1.00  0.96           N  
ATOM   5012  CA  ALA A 617      36.927  29.448   7.288  1.00  0.96           C  
ATOM   5013  C   ALA A 617      38.439  29.494   7.507  1.00  0.96           C  
ATOM   5014  O   ALA A 617      38.940  30.248   8.340  1.00  0.96           O  
ATOM   5015  CB  ALA A 617      36.299  28.261   8.024  1.00  0.96           C  
ATOM   5016  N   LYS A 618      39.223  28.727   6.724  1.00  0.91           N  
ATOM   5017  CA  LYS A 618      40.674  28.835   6.728  1.00  0.91           C  
ATOM   5018  C   LYS A 618      41.199  30.193   6.284  1.00  0.91           C  
ATOM   5019  O   LYS A 618      42.109  30.749   6.899  1.00  0.91           O  
ATOM   5020  CB  LYS A 618      41.325  27.751   5.841  1.00  0.91           C  
ATOM   5021  CG  LYS A 618      41.158  26.346   6.423  1.00  0.91           C  
ATOM   5022  CD  LYS A 618      42.159  25.334   5.840  1.00  0.91           C  
ATOM   5023  CE  LYS A 618      42.252  24.108   6.747  1.00  0.91           C  
ATOM   5024  NZ  LYS A 618      43.329  23.180   6.368  1.00  0.91           N  
ATOM   5025  N   LEU A 619      40.606  30.786   5.229  1.00  0.93           N  
ATOM   5026  CA  LEU A 619      40.914  32.141   4.803  1.00  0.93           C  
ATOM   5027  C   LEU A 619      40.614  33.173   5.882  1.00  0.93           C  
ATOM   5028  O   LEU A 619      41.379  34.110   6.090  1.00  0.93           O  
ATOM   5029  CB  LEU A 619      40.110  32.546   3.549  1.00  0.93           C  
ATOM   5030  CG  LEU A 619      40.398  31.753   2.265  1.00  0.93           C  
ATOM   5031  CD1 LEU A 619      39.363  32.167   1.219  1.00  0.93           C  
ATOM   5032  CD2 LEU A 619      41.815  31.982   1.722  1.00  0.93           C  
ATOM   5033  N   ILE A 620      39.498  33.017   6.623  1.00  0.95           N  
ATOM   5034  CA  ILE A 620      39.149  33.867   7.754  1.00  0.95           C  
ATOM   5035  C   ILE A 620      40.189  33.811   8.870  1.00  0.95           C  
ATOM   5036  O   ILE A 620      40.600  34.848   9.385  1.00  0.95           O  
ATOM   5037  CB  ILE A 620      37.758  33.533   8.294  1.00  0.95           C  
ATOM   5038  CG1 ILE A 620      36.674  33.813   7.227  1.00  0.95           C  
ATOM   5039  CG2 ILE A 620      37.458  34.359   9.562  1.00  0.95           C  
ATOM   5040  CD1 ILE A 620      35.277  33.286   7.588  1.00  0.95           C  
ATOM   5041  N   ILE A 621      40.703  32.612   9.230  1.00  0.95           N  
ATOM   5042  CA  ILE A 621      41.807  32.459  10.185  1.00  0.95           C  
ATOM   5043  C   ILE A 621      43.060  33.184   9.714  1.00  0.95           C  
ATOM   5044  O   ILE A 621      43.705  33.924  10.459  1.00  0.95           O  
ATOM   5045  CB  ILE A 621      42.140  30.981  10.415  1.00  0.95           C  
ATOM   5046  CG1 ILE A 621      40.958  30.293  11.129  1.00  0.95           C  
ATOM   5047  CG2 ILE A 621      43.448  30.828  11.231  1.00  0.95           C  
ATOM   5048  CD1 ILE A 621      41.119  28.776  11.277  1.00  0.95           C  
ATOM   5049  N   LYS A 622      43.390  33.031   8.418  1.00  0.92           N  
ATOM   5050  CA  LYS A 622      44.480  33.731   7.771  1.00  0.92           C  
ATOM   5051  C   LYS A 622      44.320  35.246   7.766  1.00  0.92           C  
ATOM   5052  O   LYS A 622      45.285  35.999   7.877  1.00  0.92           O  
ATOM   5053  CB  LYS A 622      44.660  33.210   6.326  1.00  0.92           C  
ATOM   5054  CG  LYS A 622      45.856  33.809   5.569  1.00  0.92           C  
ATOM   5055  CD  LYS A 622      47.197  33.440   6.215  1.00  0.92           C  
ATOM   5056  CE  LYS A 622      48.405  34.057   5.516  1.00  0.92           C  
ATOM   5057  NZ  LYS A 622      48.597  35.443   5.977  1.00  0.92           N  
ATOM   5058  N   LEU A 623      43.079  35.743   7.635  1.00  0.94           N  
ATOM   5059  CA  LEU A 623      42.761  37.151   7.732  1.00  0.94           C  
ATOM   5060  C   LEU A 623      43.078  37.734   9.108  1.00  0.94           C  
ATOM   5061  O   LEU A 623      43.690  38.793   9.218  1.00  0.94           O  
ATOM   5062  CB  LEU A 623      41.268  37.379   7.378  1.00  0.94           C  
ATOM   5063  CG  LEU A 623      40.905  38.683   6.625  1.00  0.94           C  
ATOM   5064  CD1 LEU A 623      39.504  39.146   7.040  1.00  0.94           C  
ATOM   5065  CD2 LEU A 623      41.884  39.842   6.812  1.00  0.94           C  
ATOM   5066  N   VAL A 624      42.726  37.026  10.204  1.00  0.94           N  
ATOM   5067  CA  VAL A 624      42.994  37.483  11.569  1.00  0.94           C  
ATOM   5068  C   VAL A 624      44.479  37.671  11.843  1.00  0.94           C  
ATOM   5069  O   VAL A 624      44.909  38.697  12.370  1.00  0.94           O  
ATOM   5070  CB  VAL A 624      42.434  36.526  12.625  1.00  0.94           C  
ATOM   5071  CG1 VAL A 624      42.693  37.055  14.052  1.00  0.94           C  
ATOM   5072  CG2 VAL A 624      40.917  36.361  12.438  1.00  0.94           C  
ATOM   5073  N   THR A 625      45.315  36.694  11.441  1.00  0.92           N  
ATOM   5074  CA  THR A 625      46.765  36.785  11.575  1.00  0.92           C  
ATOM   5075  C   THR A 625      47.371  37.878  10.718  1.00  0.92           C  
ATOM   5076  O   THR A 625      48.135  38.696  11.215  1.00  0.92           O  
ATOM   5077  CB  THR A 625      47.461  35.460  11.304  1.00  0.92           C  
ATOM   5078  OG1 THR A 625      47.046  34.907  10.062  1.00  0.92           O  
ATOM   5079  CG2 THR A 625      47.070  34.456  12.400  1.00  0.92           C  
ATOM   5080  N   SER A 626      46.955  37.995   9.439  1.00  0.93           N  
ATOM   5081  CA  SER A 626      47.372  39.065   8.537  1.00  0.93           C  
ATOM   5082  C   SER A 626      47.035  40.465   9.043  1.00  0.93           C  
ATOM   5083  O   SER A 626      47.831  41.396   8.924  1.00  0.93           O  
ATOM   5084  CB  SER A 626      46.685  38.949   7.154  1.00  0.93           C  
ATOM   5085  OG  SER A 626      47.170  37.865   6.353  1.00  0.93           O  
ATOM   5086  N   ILE A 627      45.836  40.672   9.636  1.00  0.93           N  
ATOM   5087  CA  ILE A 627      45.494  41.930  10.296  1.00  0.93           C  
ATOM   5088  C   ILE A 627      46.410  42.184  11.476  1.00  0.93           C  
ATOM   5089  O   ILE A 627      46.952  43.278  11.619  1.00  0.93           O  
ATOM   5090  CB  ILE A 627      44.036  41.970  10.761  1.00  0.93           C  
ATOM   5091  CG1 ILE A 627      43.080  41.970   9.551  1.00  0.93           C  
ATOM   5092  CG2 ILE A 627      43.756  43.219  11.625  1.00  0.93           C  
ATOM   5093  CD1 ILE A 627      41.609  41.763   9.947  1.00  0.93           C  
ATOM   5094  N   GLY A 628      46.641  41.152  12.318  1.00  0.92           N  
ATOM   5095  CA  GLY A 628      47.601  41.170  13.418  1.00  0.92           C  
ATOM   5096  C   GLY A 628      48.972  41.655  13.056  1.00  0.92           C  
ATOM   5097  O   GLY A 628      49.468  42.597  13.665  1.00  0.92           O  
ATOM   5098  N   ASP A 629      49.584  41.062  12.020  1.00  0.88           N  
ATOM   5099  CA  ASP A 629      50.905  41.403  11.523  1.00  0.88           C  
ATOM   5100  C   ASP A 629      51.035  42.883  11.130  1.00  0.88           C  
ATOM   5101  O   ASP A 629      52.076  43.512  11.298  1.00  0.88           O  
ATOM   5102  CB  ASP A 629      51.252  40.504  10.303  1.00  0.88           C  
ATOM   5103  CG  ASP A 629      51.330  39.021  10.652  1.00  0.88           C  
ATOM   5104  OD1 ASP A 629      51.472  38.679  11.853  1.00  0.88           O  
ATOM   5105  OD2 ASP A 629      51.266  38.209   9.687  1.00  0.88           O  
ATOM   5106  N   VAL A 630      49.960  43.501  10.598  1.00  0.91           N  
ATOM   5107  CA  VAL A 630      49.949  44.936  10.334  1.00  0.91           C  
ATOM   5108  C   VAL A 630      49.665  45.783  11.575  1.00  0.91           C  
ATOM   5109  O   VAL A 630      50.397  46.719  11.892  1.00  0.91           O  
ATOM   5110  CB  VAL A 630      48.921  45.258   9.250  1.00  0.91           C  
ATOM   5111  CG1 VAL A 630      48.714  46.776   9.070  1.00  0.91           C  
ATOM   5112  CG2 VAL A 630      49.399  44.647   7.919  1.00  0.91           C  
ATOM   5113  N   VAL A 631      48.582  45.486  12.323  1.00  0.91           N  
ATOM   5114  CA  VAL A 631      48.138  46.287  13.462  1.00  0.91           C  
ATOM   5115  C   VAL A 631      49.100  46.277  14.634  1.00  0.91           C  
ATOM   5116  O   VAL A 631      49.406  47.314  15.222  1.00  0.91           O  
ATOM   5117  CB  VAL A 631      46.754  45.852  13.948  1.00  0.91           C  
ATOM   5118  CG1 VAL A 631      46.319  46.652  15.193  1.00  0.91           C  
ATOM   5119  CG2 VAL A 631      45.719  46.071  12.830  1.00  0.91           C  
ATOM   5120  N   ASN A 632      49.646  45.101  14.989  1.00  0.87           N  
ATOM   5121  CA  ASN A 632      50.403  44.907  16.215  1.00  0.87           C  
ATOM   5122  C   ASN A 632      51.796  45.504  16.146  1.00  0.87           C  
ATOM   5123  O   ASN A 632      52.527  45.546  17.141  1.00  0.87           O  
ATOM   5124  CB  ASN A 632      50.559  43.398  16.518  1.00  0.87           C  
ATOM   5125  CG  ASN A 632      49.202  42.756  16.774  1.00  0.87           C  
ATOM   5126  OD1 ASN A 632      48.213  43.390  17.139  1.00  0.87           O  
ATOM   5127  ND2 ASN A 632      49.156  41.412  16.627  1.00  0.87           N  
ATOM   5128  N   HIS A 633      52.193  45.948  14.947  1.00  0.85           N  
ATOM   5129  CA  HIS A 633      53.481  46.538  14.704  1.00  0.85           C  
ATOM   5130  C   HIS A 633      53.401  47.946  14.148  1.00  0.85           C  
ATOM   5131  O   HIS A 633      54.429  48.495  13.752  1.00  0.85           O  
ATOM   5132  CB  HIS A 633      54.276  45.643  13.735  1.00  0.85           C  
ATOM   5133  CG  HIS A 633      54.544  44.276  14.307  1.00  0.85           C  
ATOM   5134  ND1 HIS A 633      53.639  43.255  14.102  1.00  0.85           N  
ATOM   5135  CD2 HIS A 633      55.602  43.814  15.026  1.00  0.85           C  
ATOM   5136  CE1 HIS A 633      54.157  42.195  14.673  1.00  0.85           C  
ATOM   5137  NE2 HIS A 633      55.349  42.475  15.257  1.00  0.85           N  
ATOM   5138  N   ASP A 634      52.217  48.600  14.139  1.00  0.88           N  
ATOM   5139  CA  ASP A 634      52.124  49.986  13.712  1.00  0.88           C  
ATOM   5140  C   ASP A 634      52.420  50.932  14.893  1.00  0.88           C  
ATOM   5141  O   ASP A 634      51.732  50.894  15.919  1.00  0.88           O  
ATOM   5142  CB  ASP A 634      50.762  50.324  13.046  1.00  0.88           C  
ATOM   5143  CG  ASP A 634      50.797  51.674  12.344  1.00  0.88           C  
ATOM   5144  OD1 ASP A 634      50.765  52.706  13.057  1.00  0.88           O  
ATOM   5145  OD2 ASP A 634      50.867  51.748  11.091  1.00  0.88           O  
ATOM   5146  N   PRO A 635      53.416  51.812  14.816  1.00  0.88           N  
ATOM   5147  CA  PRO A 635      53.782  52.692  15.920  1.00  0.88           C  
ATOM   5148  C   PRO A 635      52.775  53.801  16.148  1.00  0.88           C  
ATOM   5149  O   PRO A 635      52.750  54.362  17.239  1.00  0.88           O  
ATOM   5150  CB  PRO A 635      55.141  53.262  15.475  1.00  0.88           C  
ATOM   5151  CG  PRO A 635      55.098  53.207  13.946  1.00  0.88           C  
ATOM   5152  CD  PRO A 635      54.361  51.901  13.701  1.00  0.88           C  
ATOM   5153  N   VAL A 636      51.949  54.167  15.152  1.00  0.84           N  
ATOM   5154  CA  VAL A 636      50.908  55.175  15.308  1.00  0.84           C  
ATOM   5155  C   VAL A 636      49.778  54.634  16.178  1.00  0.84           C  
ATOM   5156  O   VAL A 636      49.170  55.336  16.993  1.00  0.84           O  
ATOM   5157  CB  VAL A 636      50.408  55.645  13.940  1.00  0.84           C  
ATOM   5158  CG1 VAL A 636      49.259  56.663  14.034  1.00  0.84           C  
ATOM   5159  CG2 VAL A 636      51.597  56.234  13.154  1.00  0.84           C  
ATOM   5160  N   VAL A 637      49.485  53.331  16.033  1.00  0.88           N  
ATOM   5161  CA  VAL A 637      48.557  52.585  16.866  1.00  0.88           C  
ATOM   5162  C   VAL A 637      49.031  52.346  18.295  1.00  0.88           C  
ATOM   5163  O   VAL A 637      48.238  52.404  19.233  1.00  0.88           O  
ATOM   5164  CB  VAL A 637      48.182  51.273  16.205  1.00  0.88           C  
ATOM   5165  CG1 VAL A 637      47.154  50.501  17.049  1.00  0.88           C  
ATOM   5166  CG2 VAL A 637      47.566  51.587  14.832  1.00  0.88           C  
ATOM   5167  N   GLY A 638      50.330  52.069  18.531  1.00  0.87           N  
ATOM   5168  CA  GLY A 638      50.833  51.690  19.858  1.00  0.87           C  
ATOM   5169  C   GLY A 638      50.127  50.493  20.449  1.00  0.87           C  
ATOM   5170  O   GLY A 638      49.810  49.531  19.758  1.00  0.87           O  
ATOM   5171  N   ASP A 639      49.832  50.517  21.757  1.00  0.86           N  
ATOM   5172  CA  ASP A 639      49.094  49.456  22.418  1.00  0.86           C  
ATOM   5173  C   ASP A 639      47.616  49.799  22.599  1.00  0.86           C  
ATOM   5174  O   ASP A 639      46.893  49.160  23.370  1.00  0.86           O  
ATOM   5175  CB  ASP A 639      49.760  49.056  23.755  1.00  0.86           C  
ATOM   5176  CG  ASP A 639      50.262  50.257  24.528  1.00  0.86           C  
ATOM   5177  OD1 ASP A 639      49.511  51.257  24.631  1.00  0.86           O  
ATOM   5178  OD2 ASP A 639      51.427  50.173  24.984  1.00  0.86           O  
ATOM   5179  N   ARG A 640      47.117  50.784  21.821  1.00  0.85           N  
ATOM   5180  CA  ARG A 640      45.718  51.183  21.789  1.00  0.85           C  
ATOM   5181  C   ARG A 640      44.857  50.138  21.080  1.00  0.85           C  
ATOM   5182  O   ARG A 640      43.656  50.033  21.319  1.00  0.85           O  
ATOM   5183  CB  ARG A 640      45.540  52.565  21.086  1.00  0.85           C  
ATOM   5184  CG  ARG A 640      46.317  53.722  21.760  1.00  0.85           C  
ATOM   5185  CD  ARG A 640      46.884  54.802  20.813  1.00  0.85           C  
ATOM   5186  NE  ARG A 640      45.827  55.757  20.328  1.00  0.85           N  
ATOM   5187  CZ  ARG A 640      46.101  56.706  19.416  1.00  0.85           C  
ATOM   5188  NH1 ARG A 640      47.230  56.685  18.710  1.00  0.85           N  
ATOM   5189  NH2 ARG A 640      45.257  57.716  19.201  1.00  0.85           N  
ATOM   5190  N   LEU A 641      45.463  49.308  20.211  1.00  0.92           N  
ATOM   5191  CA  LEU A 641      44.783  48.198  19.582  1.00  0.92           C  
ATOM   5192  C   LEU A 641      45.751  47.048  19.384  1.00  0.92           C  
ATOM   5193  O   LEU A 641      46.868  47.232  18.911  1.00  0.92           O  
ATOM   5194  CB  LEU A 641      44.185  48.640  18.227  1.00  0.92           C  
ATOM   5195  CG  LEU A 641      43.377  47.592  17.438  1.00  0.92           C  
ATOM   5196  CD1 LEU A 641      42.143  47.109  18.210  1.00  0.92           C  
ATOM   5197  CD2 LEU A 641      42.958  48.193  16.088  1.00  0.92           C  
ATOM   5198  N   LYS A 642      45.343  45.820  19.751  1.00  0.90           N  
ATOM   5199  CA  LYS A 642      46.110  44.614  19.497  1.00  0.90           C  
ATOM   5200  C   LYS A 642      45.169  43.560  18.954  1.00  0.90           C  
ATOM   5201  O   LYS A 642      44.055  43.409  19.450  1.00  0.90           O  
ATOM   5202  CB  LYS A 642      46.801  44.058  20.773  1.00  0.90           C  
ATOM   5203  CG  LYS A 642      47.865  45.012  21.338  1.00  0.90           C  
ATOM   5204  CD  LYS A 642      48.564  44.502  22.608  1.00  0.90           C  
ATOM   5205  CE  LYS A 642      49.550  45.553  23.121  1.00  0.90           C  
ATOM   5206  NZ  LYS A 642      50.201  45.109  24.362  1.00  0.90           N  
ATOM   5207  N   VAL A 643      45.576  42.817  17.909  1.00  0.93           N  
ATOM   5208  CA  VAL A 643      44.739  41.801  17.283  1.00  0.93           C  
ATOM   5209  C   VAL A 643      45.443  40.467  17.341  1.00  0.93           C  
ATOM   5210  O   VAL A 643      46.535  40.292  16.800  1.00  0.93           O  
ATOM   5211  CB  VAL A 643      44.404  42.103  15.829  1.00  0.93           C  
ATOM   5212  CG1 VAL A 643      43.346  41.107  15.307  1.00  0.93           C  
ATOM   5213  CG2 VAL A 643      43.881  43.544  15.723  1.00  0.93           C  
ATOM   5214  N   ILE A 644      44.838  39.482  18.025  1.00  0.91           N  
ATOM   5215  CA  ILE A 644      45.453  38.188  18.255  1.00  0.91           C  
ATOM   5216  C   ILE A 644      44.554  37.081  17.749  1.00  0.91           C  
ATOM   5217  O   ILE A 644      43.348  37.062  17.993  1.00  0.91           O  
ATOM   5218  CB  ILE A 644      45.759  37.980  19.742  1.00  0.91           C  
ATOM   5219  CG1 ILE A 644      46.760  39.036  20.279  1.00  0.91           C  
ATOM   5220  CG2 ILE A 644      46.274  36.554  20.035  1.00  0.91           C  
ATOM   5221  CD1 ILE A 644      48.142  39.004  19.611  1.00  0.91           C  
ATOM   5222  N   PHE A 645      45.129  36.085  17.041  1.00  0.92           N  
ATOM   5223  CA  PHE A 645      44.434  34.843  16.789  1.00  0.92           C  
ATOM   5224  C   PHE A 645      44.794  33.862  17.897  1.00  0.92           C  
ATOM   5225  O   PHE A 645      45.966  33.555  18.110  1.00  0.92           O  
ATOM   5226  CB  PHE A 645      44.795  34.257  15.402  1.00  0.92           C  
ATOM   5227  CG  PHE A 645      43.945  33.055  15.093  1.00  0.92           C  
ATOM   5228  CD1 PHE A 645      42.597  33.203  14.729  1.00  0.92           C  
ATOM   5229  CD2 PHE A 645      44.477  31.765  15.234  1.00  0.92           C  
ATOM   5230  CE1 PHE A 645      41.786  32.081  14.527  1.00  0.92           C  
ATOM   5231  CE2 PHE A 645      43.672  30.639  15.029  1.00  0.92           C  
ATOM   5232  CZ  PHE A 645      42.329  30.800  14.675  1.00  0.92           C  
ATOM   5233  N   LEU A 646      43.804  33.349  18.647  1.00  0.92           N  
ATOM   5234  CA  LEU A 646      44.078  32.423  19.729  1.00  0.92           C  
ATOM   5235  C   LEU A 646      44.160  30.997  19.213  1.00  0.92           C  
ATOM   5236  O   LEU A 646      43.151  30.357  18.910  1.00  0.92           O  
ATOM   5237  CB  LEU A 646      43.032  32.493  20.870  1.00  0.92           C  
ATOM   5238  CG  LEU A 646      42.951  33.843  21.608  1.00  0.92           C  
ATOM   5239  CD1 LEU A 646      41.866  33.788  22.690  1.00  0.92           C  
ATOM   5240  CD2 LEU A 646      44.284  34.244  22.255  1.00  0.92           C  
ATOM   5241  N   GLU A 647      45.403  30.482  19.107  1.00  0.90           N  
ATOM   5242  CA  GLU A 647      45.715  29.151  18.627  1.00  0.90           C  
ATOM   5243  C   GLU A 647      45.097  28.014  19.439  1.00  0.90           C  
ATOM   5244  O   GLU A 647      45.122  27.993  20.671  1.00  0.90           O  
ATOM   5245  CB  GLU A 647      47.253  28.932  18.574  1.00  0.90           C  
ATOM   5246  CG  GLU A 647      47.679  27.633  17.838  1.00  0.90           C  
ATOM   5247  CD  GLU A 647      49.185  27.381  17.808  1.00  0.90           C  
ATOM   5248  OE1 GLU A 647      49.922  28.262  17.300  1.00  0.90           O  
ATOM   5249  OE2 GLU A 647      49.601  26.265  18.216  1.00  0.90           O  
ATOM   5250  N   ASN A 648      44.533  27.010  18.733  1.00  0.92           N  
ATOM   5251  CA  ASN A 648      44.085  25.752  19.289  1.00  0.92           C  
ATOM   5252  C   ASN A 648      43.008  25.872  20.352  1.00  0.92           C  
ATOM   5253  O   ASN A 648      43.099  25.263  21.420  1.00  0.92           O  
ATOM   5254  CB  ASN A 648      45.292  24.894  19.762  1.00  0.92           C  
ATOM   5255  CG  ASN A 648      44.941  23.417  19.881  1.00  0.92           C  
ATOM   5256  OD1 ASN A 648      44.063  22.890  19.192  1.00  0.92           O  
ATOM   5257  ND2 ASN A 648      45.629  22.705  20.799  1.00  0.92           N  
ATOM   5258  N   TYR A 649      41.939  26.637  20.053  1.00  0.93           N  
ATOM   5259  CA  TYR A 649      40.777  26.760  20.915  1.00  0.93           C  
ATOM   5260  C   TYR A 649      40.121  25.407  21.217  1.00  0.93           C  
ATOM   5261  O   TYR A 649      39.856  24.589  20.332  1.00  0.93           O  
ATOM   5262  CB  TYR A 649      39.766  27.783  20.324  1.00  0.93           C  
ATOM   5263  CG  TYR A 649      38.591  28.036  21.239  1.00  0.93           C  
ATOM   5264  CD1 TYR A 649      38.781  28.618  22.504  1.00  0.93           C  
ATOM   5265  CD2 TYR A 649      37.293  27.657  20.855  1.00  0.93           C  
ATOM   5266  CE1 TYR A 649      37.699  28.792  23.377  1.00  0.93           C  
ATOM   5267  CE2 TYR A 649      36.207  27.843  21.723  1.00  0.93           C  
ATOM   5268  CZ  TYR A 649      36.411  28.410  22.986  1.00  0.93           C  
ATOM   5269  OH  TYR A 649      35.307  28.654  23.828  1.00  0.93           O  
ATOM   5270  N   ARG A 650      39.897  25.156  22.515  1.00  0.90           N  
ATOM   5271  CA  ARG A 650      39.479  23.884  23.059  1.00  0.90           C  
ATOM   5272  C   ARG A 650      38.929  24.152  24.446  1.00  0.90           C  
ATOM   5273  O   ARG A 650      38.990  25.287  24.923  1.00  0.90           O  
ATOM   5274  CB  ARG A 650      40.635  22.853  23.112  1.00  0.90           C  
ATOM   5275  CG  ARG A 650      41.692  23.159  24.188  1.00  0.90           C  
ATOM   5276  CD  ARG A 650      43.001  22.375  24.037  1.00  0.90           C  
ATOM   5277  NE  ARG A 650      44.035  23.328  23.537  1.00  0.90           N  
ATOM   5278  CZ  ARG A 650      44.616  24.252  24.309  1.00  0.90           C  
ATOM   5279  NH1 ARG A 650      44.418  24.324  25.624  1.00  0.90           N  
ATOM   5280  NH2 ARG A 650      45.418  25.143  23.733  1.00  0.90           N  
ATOM   5281  N   VAL A 651      38.374  23.134  25.136  1.00  0.95           N  
ATOM   5282  CA  VAL A 651      37.740  23.283  26.442  1.00  0.95           C  
ATOM   5283  C   VAL A 651      38.661  23.841  27.517  1.00  0.95           C  
ATOM   5284  O   VAL A 651      38.321  24.821  28.176  1.00  0.95           O  
ATOM   5285  CB  VAL A 651      37.155  21.947  26.897  1.00  0.95           C  
ATOM   5286  CG1 VAL A 651      36.487  22.046  28.281  1.00  0.95           C  
ATOM   5287  CG2 VAL A 651      36.113  21.477  25.869  1.00  0.95           C  
ATOM   5288  N   SER A 652      39.888  23.311  27.660  1.00  0.94           N  
ATOM   5289  CA  SER A 652      40.863  23.833  28.609  1.00  0.94           C  
ATOM   5290  C   SER A 652      41.337  25.252  28.318  1.00  0.94           C  
ATOM   5291  O   SER A 652      41.700  25.994  29.226  1.00  0.94           O  
ATOM   5292  CB  SER A 652      42.098  22.911  28.724  1.00  0.94           C  
ATOM   5293  OG  SER A 652      42.839  22.837  27.500  1.00  0.94           O  
ATOM   5294  N   LEU A 653      41.365  25.690  27.036  1.00  0.93           N  
ATOM   5295  CA  LEU A 653      41.625  27.084  26.706  1.00  0.93           C  
ATOM   5296  C   LEU A 653      40.454  27.993  27.029  1.00  0.93           C  
ATOM   5297  O   LEU A 653      40.629  29.092  27.551  1.00  0.93           O  
ATOM   5298  CB  LEU A 653      42.041  27.280  25.228  1.00  0.93           C  
ATOM   5299  CG  LEU A 653      42.652  28.668  24.912  1.00  0.93           C  
ATOM   5300  CD1 LEU A 653      43.948  28.931  25.694  1.00  0.93           C  
ATOM   5301  CD2 LEU A 653      42.931  28.825  23.412  1.00  0.93           C  
ATOM   5302  N   ALA A 654      39.214  27.531  26.767  1.00  0.97           N  
ATOM   5303  CA  ALA A 654      37.986  28.229  27.084  1.00  0.97           C  
ATOM   5304  C   ALA A 654      37.853  28.523  28.567  1.00  0.97           C  
ATOM   5305  O   ALA A 654      37.480  29.623  28.969  1.00  0.97           O  
ATOM   5306  CB  ALA A 654      36.798  27.386  26.595  1.00  0.97           C  
ATOM   5307  N   GLU A 655      38.260  27.554  29.408  1.00  0.93           N  
ATOM   5308  CA  GLU A 655      38.362  27.703  30.845  1.00  0.93           C  
ATOM   5309  C   GLU A 655      39.375  28.770  31.284  1.00  0.93           C  
ATOM   5310  O   GLU A 655      39.326  29.261  32.404  1.00  0.93           O  
ATOM   5311  CB  GLU A 655      38.722  26.336  31.491  1.00  0.93           C  
ATOM   5312  CG  GLU A 655      37.594  25.268  31.414  1.00  0.93           C  
ATOM   5313  CD  GLU A 655      38.031  23.889  31.917  1.00  0.93           C  
ATOM   5314  OE1 GLU A 655      38.908  23.798  32.805  1.00  0.93           O  
ATOM   5315  OE2 GLU A 655      37.469  22.871  31.424  1.00  0.93           O  
ATOM   5316  N   LYS A 656      40.318  29.199  30.421  1.00  0.91           N  
ATOM   5317  CA  LYS A 656      41.249  30.262  30.772  1.00  0.91           C  
ATOM   5318  C   LYS A 656      40.915  31.611  30.145  1.00  0.91           C  
ATOM   5319  O   LYS A 656      41.029  32.644  30.800  1.00  0.91           O  
ATOM   5320  CB  LYS A 656      42.692  29.865  30.369  1.00  0.91           C  
ATOM   5321  CG  LYS A 656      43.161  28.547  31.006  1.00  0.91           C  
ATOM   5322  CD  LYS A 656      44.604  28.195  30.617  1.00  0.91           C  
ATOM   5323  CE  LYS A 656      44.999  26.744  30.920  1.00  0.91           C  
ATOM   5324  NZ  LYS A 656      44.858  26.481  32.359  1.00  0.91           N  
ATOM   5325  N   VAL A 657      40.487  31.665  28.866  1.00  0.95           N  
ATOM   5326  CA  VAL A 657      40.186  32.933  28.201  1.00  0.95           C  
ATOM   5327  C   VAL A 657      38.865  33.575  28.596  1.00  0.95           C  
ATOM   5328  O   VAL A 657      38.773  34.785  28.799  1.00  0.95           O  
ATOM   5329  CB  VAL A 657      40.313  32.839  26.682  1.00  0.95           C  
ATOM   5330  CG1 VAL A 657      39.250  31.932  26.041  1.00  0.95           C  
ATOM   5331  CG2 VAL A 657      40.268  34.251  26.067  1.00  0.95           C  
ATOM   5332  N   ILE A 658      37.784  32.789  28.748  1.00  0.96           N  
ATOM   5333  CA  ILE A 658      36.463  33.305  29.088  1.00  0.96           C  
ATOM   5334  C   ILE A 658      36.404  34.036  30.441  1.00  0.96           C  
ATOM   5335  O   ILE A 658      35.802  35.116  30.504  1.00  0.96           O  
ATOM   5336  CB  ILE A 658      35.406  32.206  28.960  1.00  0.96           C  
ATOM   5337  CG1 ILE A 658      35.323  31.720  27.491  1.00  0.96           C  
ATOM   5338  CG2 ILE A 658      34.035  32.710  29.444  1.00  0.96           C  
ATOM   5339  CD1 ILE A 658      34.368  30.539  27.274  1.00  0.96           C  
ATOM   5340  N   PRO A 659      37.027  33.593  31.541  1.00  0.97           N  
ATOM   5341  CA  PRO A 659      37.112  34.368  32.777  1.00  0.97           C  
ATOM   5342  C   PRO A 659      37.807  35.703  32.624  1.00  0.97           C  
ATOM   5343  O   PRO A 659      37.540  36.608  33.417  1.00  0.97           O  
ATOM   5344  CB  PRO A 659      37.794  33.418  33.769  1.00  0.97           C  
ATOM   5345  CG  PRO A 659      37.389  32.040  33.253  1.00  0.97           C  
ATOM   5346  CD  PRO A 659      37.502  32.222  31.752  1.00  0.97           C  
ATOM   5347  N   ALA A 660      38.672  35.875  31.616  1.00  0.96           N  
ATOM   5348  CA  ALA A 660      39.447  37.079  31.428  1.00  0.96           C  
ATOM   5349  C   ALA A 660      38.864  38.064  30.433  1.00  0.96           C  
ATOM   5350  O   ALA A 660      39.356  39.179  30.286  1.00  0.96           O  
ATOM   5351  CB  ALA A 660      40.825  36.641  30.919  1.00  0.96           C  
ATOM   5352  N   ALA A 661      37.772  37.712  29.747  1.00  0.98           N  
ATOM   5353  CA  ALA A 661      37.214  38.570  28.726  1.00  0.98           C  
ATOM   5354  C   ALA A 661      36.232  39.612  29.225  1.00  0.98           C  
ATOM   5355  O   ALA A 661      35.333  39.298  30.002  1.00  0.98           O  
ATOM   5356  CB  ALA A 661      36.461  37.700  27.732  1.00  0.98           C  
ATOM   5357  N   ASP A 662      36.361  40.866  28.764  1.00  0.97           N  
ATOM   5358  CA  ASP A 662      35.418  41.929  29.070  1.00  0.97           C  
ATOM   5359  C   ASP A 662      34.210  41.929  28.154  1.00  0.97           C  
ATOM   5360  O   ASP A 662      33.078  42.112  28.594  1.00  0.97           O  
ATOM   5361  CB  ASP A 662      36.051  43.309  28.877  1.00  0.97           C  
ATOM   5362  CG  ASP A 662      37.179  43.519  29.830  1.00  0.97           C  
ATOM   5363  OD1 ASP A 662      37.050  43.257  31.047  1.00  0.97           O  
ATOM   5364  OD2 ASP A 662      38.231  43.978  29.315  1.00  0.97           O  
ATOM   5365  N   LEU A 663      34.437  41.742  26.840  1.00  0.98           N  
ATOM   5366  CA  LEU A 663      33.393  41.776  25.840  1.00  0.98           C  
ATOM   5367  C   LEU A 663      33.291  40.440  25.149  1.00  0.98           C  
ATOM   5368  O   LEU A 663      34.267  39.845  24.694  1.00  0.98           O  
ATOM   5369  CB  LEU A 663      33.616  42.891  24.792  1.00  0.98           C  
ATOM   5370  CG  LEU A 663      32.483  43.107  23.767  1.00  0.98           C  
ATOM   5371  CD1 LEU A 663      31.200  43.605  24.442  1.00  0.98           C  
ATOM   5372  CD2 LEU A 663      32.928  44.107  22.693  1.00  0.98           C  
ATOM   5373  N   SER A 664      32.053  39.939  25.087  1.00  0.99           N  
ATOM   5374  CA  SER A 664      31.680  38.689  24.475  1.00  0.99           C  
ATOM   5375  C   SER A 664      31.055  38.958  23.135  1.00  0.99           C  
ATOM   5376  O   SER A 664      29.993  39.577  23.043  1.00  0.99           O  
ATOM   5377  CB  SER A 664      30.625  37.994  25.359  1.00  0.99           C  
ATOM   5378  OG  SER A 664      30.190  36.735  24.846  1.00  0.99           O  
ATOM   5379  N   GLN A 665      31.702  38.490  22.058  1.00  0.96           N  
ATOM   5380  CA  GLN A 665      31.179  38.614  20.716  1.00  0.96           C  
ATOM   5381  C   GLN A 665      30.261  37.459  20.344  1.00  0.96           C  
ATOM   5382  O   GLN A 665      30.655  36.295  20.227  1.00  0.96           O  
ATOM   5383  CB  GLN A 665      32.334  38.634  19.710  1.00  0.96           C  
ATOM   5384  CG  GLN A 665      33.226  39.885  19.773  1.00  0.96           C  
ATOM   5385  CD  GLN A 665      32.477  41.119  19.293  1.00  0.96           C  
ATOM   5386  OE1 GLN A 665      31.440  41.059  18.632  1.00  0.96           O  
ATOM   5387  NE2 GLN A 665      33.013  42.303  19.646  1.00  0.96           N  
ATOM   5388  N   GLN A 666      28.968  37.750  20.135  1.00  0.95           N  
ATOM   5389  CA  GLN A 666      27.972  36.739  19.847  1.00  0.95           C  
ATOM   5390  C   GLN A 666      27.151  37.229  18.672  1.00  0.95           C  
ATOM   5391  O   GLN A 666      25.953  37.479  18.760  1.00  0.95           O  
ATOM   5392  CB  GLN A 666      27.098  36.432  21.086  1.00  0.95           C  
ATOM   5393  CG  GLN A 666      27.915  36.058  22.352  1.00  0.95           C  
ATOM   5394  CD  GLN A 666      28.780  34.806  22.174  1.00  0.95           C  
ATOM   5395  OE1 GLN A 666      28.433  33.843  21.483  1.00  0.95           O  
ATOM   5396  NE2 GLN A 666      29.954  34.777  22.840  1.00  0.95           N  
ATOM   5397  N   ILE A 667      27.833  37.436  17.534  1.00  0.97           N  
ATOM   5398  CA  ILE A 667      27.367  38.272  16.433  1.00  0.97           C  
ATOM   5399  C   ILE A 667      26.810  37.557  15.217  1.00  0.97           C  
ATOM   5400  O   ILE A 667      26.721  38.130  14.129  1.00  0.97           O  
ATOM   5401  CB  ILE A 667      28.498  39.181  15.979  1.00  0.97           C  
ATOM   5402  CG1 ILE A 667      29.737  38.387  15.504  1.00  0.97           C  
ATOM   5403  CG2 ILE A 667      28.861  40.089  17.165  1.00  0.97           C  
ATOM   5404  CD1 ILE A 667      30.891  39.293  15.067  1.00  0.97           C  
ATOM   5405  N   SER A 668      26.381  36.295  15.363  1.00  0.96           N  
ATOM   5406  CA  SER A 668      25.747  35.508  14.315  1.00  0.96           C  
ATOM   5407  C   SER A 668      24.536  36.141  13.658  1.00  0.96           C  
ATOM   5408  O   SER A 668      23.823  36.963  14.228  1.00  0.96           O  
ATOM   5409  CB  SER A 668      25.287  34.131  14.835  1.00  0.96           C  
ATOM   5410  OG  SER A 668      24.492  34.276  16.014  1.00  0.96           O  
ATOM   5411  N   THR A 669      24.288  35.820  12.379  1.00  0.94           N  
ATOM   5412  CA  THR A 669      23.151  36.376  11.654  1.00  0.94           C  
ATOM   5413  C   THR A 669      21.837  35.945  12.259  1.00  0.94           C  
ATOM   5414  O   THR A 669      21.629  34.761  12.471  1.00  0.94           O  
ATOM   5415  CB  THR A 669      23.115  35.961  10.193  1.00  0.94           C  
ATOM   5416  OG1 THR A 669      24.394  36.106   9.611  1.00  0.94           O  
ATOM   5417  CG2 THR A 669      22.137  36.824   9.390  1.00  0.94           C  
ATOM   5418  N   ALA A 670      20.902  36.876  12.541  1.00  0.94           N  
ATOM   5419  CA  ALA A 670      19.641  36.546  13.180  1.00  0.94           C  
ATOM   5420  C   ALA A 670      18.868  35.386  12.551  1.00  0.94           C  
ATOM   5421  O   ALA A 670      18.436  35.443  11.398  1.00  0.94           O  
ATOM   5422  CB  ALA A 670      18.754  37.797  13.262  1.00  0.94           C  
ATOM   5423  N   GLY A 671      18.712  34.293  13.323  1.00  0.90           N  
ATOM   5424  CA  GLY A 671      18.110  33.047  12.893  1.00  0.90           C  
ATOM   5425  C   GLY A 671      19.070  31.948  12.514  1.00  0.90           C  
ATOM   5426  O   GLY A 671      18.613  30.888  12.090  1.00  0.90           O  
ATOM   5427  N   THR A 672      20.405  32.132  12.622  1.00  0.91           N  
ATOM   5428  CA  THR A 672      21.362  31.094  12.218  1.00  0.91           C  
ATOM   5429  C   THR A 672      22.012  30.338  13.358  1.00  0.91           C  
ATOM   5430  O   THR A 672      22.268  29.141  13.221  1.00  0.91           O  
ATOM   5431  CB  THR A 672      22.496  31.585  11.312  1.00  0.91           C  
ATOM   5432  OG1 THR A 672      23.346  32.535  11.939  1.00  0.91           O  
ATOM   5433  CG2 THR A 672      21.918  32.245  10.052  1.00  0.91           C  
ATOM   5434  N   GLU A 673      22.278  30.956  14.524  1.00  0.90           N  
ATOM   5435  CA  GLU A 673      22.830  30.237  15.659  1.00  0.90           C  
ATOM   5436  C   GLU A 673      21.663  29.703  16.466  1.00  0.90           C  
ATOM   5437  O   GLU A 673      20.878  30.434  17.064  1.00  0.90           O  
ATOM   5438  CB  GLU A 673      23.757  31.156  16.507  1.00  0.90           C  
ATOM   5439  CG  GLU A 673      24.542  30.557  17.716  1.00  0.90           C  
ATOM   5440  CD  GLU A 673      25.903  29.909  17.453  1.00  0.90           C  
ATOM   5441  OE1 GLU A 673      26.020  28.661  17.564  1.00  0.90           O  
ATOM   5442  OE2 GLU A 673      26.920  30.629  17.220  1.00  0.90           O  
ATOM   5443  N   ALA A 674      21.502  28.364  16.514  1.00  0.94           N  
ATOM   5444  CA  ALA A 674      20.370  27.721  17.154  1.00  0.94           C  
ATOM   5445  C   ALA A 674      20.269  28.029  18.637  1.00  0.94           C  
ATOM   5446  O   ALA A 674      19.191  28.032  19.223  1.00  0.94           O  
ATOM   5447  CB  ALA A 674      20.475  26.205  16.971  1.00  0.94           C  
ATOM   5448  N   SER A 675      21.417  28.314  19.274  1.00  0.94           N  
ATOM   5449  CA  SER A 675      21.432  28.725  20.663  1.00  0.94           C  
ATOM   5450  C   SER A 675      22.737  29.366  21.035  1.00  0.94           C  
ATOM   5451  O   SER A 675      22.778  30.510  21.489  1.00  0.94           O  
ATOM   5452  CB  SER A 675      21.193  27.521  21.594  1.00  0.94           C  
ATOM   5453  OG  SER A 675      21.189  27.845  22.980  1.00  0.94           O  
ATOM   5454  N   GLY A 676      23.844  28.623  20.843  1.00  0.95           N  
ATOM   5455  CA  GLY A 676      25.134  28.970  21.409  1.00  0.95           C  
ATOM   5456  C   GLY A 676      25.233  28.530  22.851  1.00  0.95           C  
ATOM   5457  O   GLY A 676      24.246  28.380  23.557  1.00  0.95           O  
ATOM   5458  N   THR A 677      26.459  28.286  23.338  1.00  0.95           N  
ATOM   5459  CA  THR A 677      26.673  28.002  24.760  1.00  0.95           C  
ATOM   5460  C   THR A 677      27.858  28.772  25.277  1.00  0.95           C  
ATOM   5461  O   THR A 677      28.020  28.949  26.480  1.00  0.95           O  
ATOM   5462  CB  THR A 677      26.903  26.531  25.108  1.00  0.95           C  
ATOM   5463  OG1 THR A 677      27.943  25.941  24.333  1.00  0.95           O  
ATOM   5464  CG2 THR A 677      25.616  25.732  24.853  1.00  0.95           C  
ATOM   5465  N   GLY A 678      28.733  29.304  24.385  1.00  0.98           N  
ATOM   5466  CA  GLY A 678      29.831  30.176  24.795  1.00  0.98           C  
ATOM   5467  C   GLY A 678      29.329  31.458  25.372  1.00  0.98           C  
ATOM   5468  O   GLY A 678      29.831  31.923  26.386  1.00  0.98           O  
ATOM   5469  N   ASN A 679      28.244  31.992  24.797  1.00  0.95           N  
ATOM   5470  CA  ASN A 679      27.563  33.198  25.225  1.00  0.95           C  
ATOM   5471  C   ASN A 679      27.154  33.188  26.694  1.00  0.95           C  
ATOM   5472  O   ASN A 679      27.393  34.144  27.432  1.00  0.95           O  
ATOM   5473  CB  ASN A 679      26.331  33.453  24.306  1.00  0.95           C  
ATOM   5474  CG  ASN A 679      25.370  32.269  24.149  1.00  0.95           C  
ATOM   5475  OD1 ASN A 679      25.603  31.159  24.623  1.00  0.95           O  
ATOM   5476  ND2 ASN A 679      24.276  32.507  23.395  1.00  0.95           N  
ATOM   5477  N   MET A 680      26.600  32.058  27.155  1.00  0.95           N  
ATOM   5478  CA  MET A 680      26.294  31.791  28.540  1.00  0.95           C  
ATOM   5479  C   MET A 680      27.521  31.791  29.443  1.00  0.95           C  
ATOM   5480  O   MET A 680      27.511  32.384  30.518  1.00  0.95           O  
ATOM   5481  CB  MET A 680      25.612  30.409  28.642  1.00  0.95           C  
ATOM   5482  CG  MET A 680      24.328  30.285  27.803  1.00  0.95           C  
ATOM   5483  SD  MET A 680      23.713  28.584  27.711  1.00  0.95           S  
ATOM   5484  CE  MET A 680      22.484  28.995  26.447  1.00  0.95           C  
ATOM   5485  N   LYS A 681      28.633  31.153  29.011  1.00  0.95           N  
ATOM   5486  CA  LYS A 681      29.872  31.078  29.777  1.00  0.95           C  
ATOM   5487  C   LYS A 681      30.481  32.446  30.008  1.00  0.95           C  
ATOM   5488  O   LYS A 681      30.907  32.782  31.110  1.00  0.95           O  
ATOM   5489  CB  LYS A 681      30.933  30.195  29.070  1.00  0.95           C  
ATOM   5490  CG  LYS A 681      30.485  28.758  28.771  1.00  0.95           C  
ATOM   5491  CD  LYS A 681      31.438  28.065  27.786  1.00  0.95           C  
ATOM   5492  CE  LYS A 681      30.843  26.808  27.152  1.00  0.95           C  
ATOM   5493  NZ  LYS A 681      31.760  26.295  26.110  1.00  0.95           N  
ATOM   5494  N   PHE A 682      30.489  33.291  28.964  1.00  0.96           N  
ATOM   5495  CA  PHE A 682      30.944  34.664  29.036  1.00  0.96           C  
ATOM   5496  C   PHE A 682      30.150  35.515  30.015  1.00  0.96           C  
ATOM   5497  O   PHE A 682      30.721  36.220  30.846  1.00  0.96           O  
ATOM   5498  CB  PHE A 682      30.801  35.303  27.639  1.00  0.96           C  
ATOM   5499  CG  PHE A 682      32.007  35.039  26.781  1.00  0.96           C  
ATOM   5500  CD1 PHE A 682      33.156  35.828  26.932  1.00  0.96           C  
ATOM   5501  CD2 PHE A 682      31.987  34.082  25.754  1.00  0.96           C  
ATOM   5502  CE1 PHE A 682      34.259  35.631  26.096  1.00  0.96           C  
ATOM   5503  CE2 PHE A 682      33.101  33.852  24.944  1.00  0.96           C  
ATOM   5504  CZ  PHE A 682      34.240  34.634  25.123  1.00  0.96           C  
ATOM   5505  N   MET A 683      28.807  35.425  29.966  1.00  0.95           N  
ATOM   5506  CA  MET A 683      27.922  36.118  30.886  1.00  0.95           C  
ATOM   5507  C   MET A 683      28.102  35.693  32.334  1.00  0.95           C  
ATOM   5508  O   MET A 683      28.190  36.519  33.242  1.00  0.95           O  
ATOM   5509  CB  MET A 683      26.456  35.875  30.460  1.00  0.95           C  
ATOM   5510  CG  MET A 683      25.409  36.512  31.397  1.00  0.95           C  
ATOM   5511  SD  MET A 683      23.705  36.516  30.780  1.00  0.95           S  
ATOM   5512  CE  MET A 683      23.586  34.720  30.616  1.00  0.95           C  
ATOM   5513  N   LEU A 684      28.228  34.373  32.583  1.00  0.96           N  
ATOM   5514  CA  LEU A 684      28.449  33.811  33.904  1.00  0.96           C  
ATOM   5515  C   LEU A 684      29.749  34.316  34.528  1.00  0.96           C  
ATOM   5516  O   LEU A 684      29.865  34.547  35.728  1.00  0.96           O  
ATOM   5517  CB  LEU A 684      28.492  32.259  33.800  1.00  0.96           C  
ATOM   5518  CG  LEU A 684      27.791  31.449  34.914  1.00  0.96           C  
ATOM   5519  CD1 LEU A 684      28.372  30.028  34.966  1.00  0.96           C  
ATOM   5520  CD2 LEU A 684      27.877  32.092  36.299  1.00  0.96           C  
ATOM   5521  N   ASN A 685      30.775  34.523  33.686  1.00  0.96           N  
ATOM   5522  CA  ASN A 685      32.108  34.877  34.122  1.00  0.96           C  
ATOM   5523  C   ASN A 685      32.418  36.361  34.070  1.00  0.96           C  
ATOM   5524  O   ASN A 685      33.572  36.783  34.191  1.00  0.96           O  
ATOM   5525  CB  ASN A 685      33.119  34.121  33.244  1.00  0.96           C  
ATOM   5526  CG  ASN A 685      33.209  32.705  33.779  1.00  0.96           C  
ATOM   5527  OD1 ASN A 685      33.957  32.473  34.724  1.00  0.96           O  
ATOM   5528  ND2 ASN A 685      32.431  31.771  33.204  1.00  0.96           N  
ATOM   5529  N   GLY A 686      31.398  37.213  33.922  1.00  0.98           N  
ATOM   5530  CA  GLY A 686      31.568  38.646  34.092  1.00  0.98           C  
ATOM   5531  C   GLY A 686      32.005  39.407  32.881  1.00  0.98           C  
ATOM   5532  O   GLY A 686      32.671  40.430  33.005  1.00  0.98           O  
ATOM   5533  N   ALA A 687      31.663  38.928  31.681  1.00  0.99           N  
ATOM   5534  CA  ALA A 687      31.790  39.707  30.471  1.00  0.99           C  
ATOM   5535  C   ALA A 687      30.452  40.327  30.097  1.00  0.99           C  
ATOM   5536  O   ALA A 687      29.388  39.766  30.360  1.00  0.99           O  
ATOM   5537  CB  ALA A 687      32.265  38.814  29.314  1.00  0.99           C  
ATOM   5538  N   LEU A 688      30.471  41.503  29.447  1.00  0.96           N  
ATOM   5539  CA  LEU A 688      29.292  42.064  28.819  1.00  0.96           C  
ATOM   5540  C   LEU A 688      29.189  41.523  27.405  1.00  0.96           C  
ATOM   5541  O   LEU A 688      30.181  41.112  26.806  1.00  0.96           O  
ATOM   5542  CB  LEU A 688      29.313  43.614  28.793  1.00  0.96           C  
ATOM   5543  CG  LEU A 688      29.334  44.270  30.191  1.00  0.96           C  
ATOM   5544  CD1 LEU A 688      29.226  45.797  30.103  1.00  0.96           C  
ATOM   5545  CD2 LEU A 688      28.201  43.756  31.083  1.00  0.96           C  
ATOM   5546  N   THR A 689      27.980  41.485  26.820  1.00  0.97           N  
ATOM   5547  CA  THR A 689      27.774  40.820  25.532  1.00  0.97           C  
ATOM   5548  C   THR A 689      27.347  41.803  24.479  1.00  0.97           C  
ATOM   5549  O   THR A 689      26.390  42.556  24.660  1.00  0.97           O  
ATOM   5550  CB  THR A 689      26.736  39.695  25.595  1.00  0.97           C  
ATOM   5551  OG1 THR A 689      27.186  38.661  26.460  1.00  0.97           O  
ATOM   5552  CG2 THR A 689      26.493  39.038  24.226  1.00  0.97           C  
ATOM   5553  N   ILE A 690      28.041  41.781  23.321  1.00  0.96           N  
ATOM   5554  CA  ILE A 690      27.609  42.442  22.109  1.00  0.96           C  
ATOM   5555  C   ILE A 690      27.129  41.351  21.173  1.00  0.96           C  
ATOM   5556  O   ILE A 690      27.782  40.333  20.931  1.00  0.96           O  
ATOM   5557  CB  ILE A 690      28.666  43.342  21.480  1.00  0.96           C  
ATOM   5558  CG1 ILE A 690      28.131  44.072  20.232  1.00  0.96           C  
ATOM   5559  CG2 ILE A 690      29.921  42.522  21.150  1.00  0.96           C  
ATOM   5560  CD1 ILE A 690      29.060  45.189  19.755  1.00  0.96           C  
ATOM   5561  N   GLY A 691      25.898  41.480  20.667  1.00  0.98           N  
ATOM   5562  CA  GLY A 691      25.344  40.384  19.905  1.00  0.98           C  
ATOM   5563  C   GLY A 691      24.074  40.755  19.238  1.00  0.98           C  
ATOM   5564  O   GLY A 691      23.473  41.799  19.481  1.00  0.98           O  
ATOM   5565  N   THR A 692      23.625  39.870  18.359  1.00  0.95           N  
ATOM   5566  CA  THR A 692      22.365  39.976  17.661  1.00  0.95           C  
ATOM   5567  C   THR A 692      21.285  39.302  18.477  1.00  0.95           C  
ATOM   5568  O   THR A 692      21.550  38.517  19.391  1.00  0.95           O  
ATOM   5569  CB  THR A 692      22.450  39.290  16.311  1.00  0.95           C  
ATOM   5570  OG1 THR A 692      22.999  37.991  16.495  1.00  0.95           O  
ATOM   5571  CG2 THR A 692      23.415  40.074  15.412  1.00  0.95           C  
ATOM   5572  N   MET A 693      20.005  39.578  18.169  1.00  0.91           N  
ATOM   5573  CA  MET A 693      18.908  38.820  18.743  1.00  0.91           C  
ATOM   5574  C   MET A 693      18.764  37.467  18.063  1.00  0.91           C  
ATOM   5575  O   MET A 693      17.860  37.246  17.261  1.00  0.91           O  
ATOM   5576  CB  MET A 693      17.575  39.593  18.659  1.00  0.91           C  
ATOM   5577  CG  MET A 693      17.529  40.802  19.605  1.00  0.91           C  
ATOM   5578  SD  MET A 693      17.477  40.346  21.363  1.00  0.91           S  
ATOM   5579  CE  MET A 693      15.857  41.104  21.668  1.00  0.91           C  
ATOM   5580  N   ASP A 694      19.678  36.540  18.380  1.00  0.91           N  
ATOM   5581  CA  ASP A 694      19.750  35.235  17.774  1.00  0.91           C  
ATOM   5582  C   ASP A 694      19.940  34.207  18.873  1.00  0.91           C  
ATOM   5583  O   ASP A 694      20.392  34.540  19.971  1.00  0.91           O  
ATOM   5584  CB  ASP A 694      20.931  35.235  16.770  1.00  0.91           C  
ATOM   5585  CG  ASP A 694      20.924  34.018  15.875  1.00  0.91           C  
ATOM   5586  OD1 ASP A 694      19.820  33.453  15.682  1.00  0.91           O  
ATOM   5587  OD2 ASP A 694      22.008  33.646  15.361  1.00  0.91           O  
ATOM   5588  N   GLY A 695      19.568  32.936  18.621  1.00  0.94           N  
ATOM   5589  CA  GLY A 695      19.639  31.830  19.574  1.00  0.94           C  
ATOM   5590  C   GLY A 695      19.289  32.140  21.012  1.00  0.94           C  
ATOM   5591  O   GLY A 695      18.229  32.677  21.332  1.00  0.94           O  
ATOM   5592  N   ALA A 696      20.200  31.810  21.940  1.00  0.94           N  
ATOM   5593  CA  ALA A 696      19.998  32.042  23.349  1.00  0.94           C  
ATOM   5594  C   ALA A 696      20.288  33.470  23.769  1.00  0.94           C  
ATOM   5595  O   ALA A 696      19.905  33.880  24.864  1.00  0.94           O  
ATOM   5596  CB  ALA A 696      20.854  31.064  24.163  1.00  0.94           C  
ATOM   5597  N   ASN A 697      20.899  34.300  22.887  1.00  0.93           N  
ATOM   5598  CA  ASN A 697      21.185  35.706  23.154  1.00  0.93           C  
ATOM   5599  C   ASN A 697      19.914  36.471  23.504  1.00  0.93           C  
ATOM   5600  O   ASN A 697      19.908  37.336  24.374  1.00  0.93           O  
ATOM   5601  CB  ASN A 697      21.818  36.463  21.955  1.00  0.93           C  
ATOM   5602  CG  ASN A 697      23.131  35.862  21.462  1.00  0.93           C  
ATOM   5603  OD1 ASN A 697      23.830  35.101  22.136  1.00  0.93           O  
ATOM   5604  ND2 ASN A 697      23.505  36.285  20.230  1.00  0.93           N  
ATOM   5605  N   VAL A 698      18.787  36.123  22.847  1.00  0.94           N  
ATOM   5606  CA  VAL A 698      17.470  36.681  23.115  1.00  0.94           C  
ATOM   5607  C   VAL A 698      16.992  36.450  24.540  1.00  0.94           C  
ATOM   5608  O   VAL A 698      16.509  37.349  25.221  1.00  0.94           O  
ATOM   5609  CB  VAL A 698      16.432  36.051  22.189  1.00  0.94           C  
ATOM   5610  CG1 VAL A 698      15.057  36.724  22.372  1.00  0.94           C  
ATOM   5611  CG2 VAL A 698      16.887  36.186  20.728  1.00  0.94           C  
ATOM   5612  N   GLU A 699      17.142  35.215  25.045  1.00  0.93           N  
ATOM   5613  CA  GLU A 699      16.786  34.872  26.405  1.00  0.93           C  
ATOM   5614  C   GLU A 699      17.726  35.474  27.426  1.00  0.93           C  
ATOM   5615  O   GLU A 699      17.299  35.919  28.484  1.00  0.93           O  
ATOM   5616  CB  GLU A 699      16.673  33.345  26.559  1.00  0.93           C  
ATOM   5617  CG  GLU A 699      15.466  32.814  25.755  1.00  0.93           C  
ATOM   5618  CD  GLU A 699      15.430  31.302  25.708  1.00  0.93           C  
ATOM   5619  OE1 GLU A 699      14.990  30.689  26.719  1.00  0.93           O  
ATOM   5620  OE2 GLU A 699      15.813  30.731  24.660  1.00  0.93           O  
ATOM   5621  N   MET A 700      19.038  35.549  27.124  1.00  0.93           N  
ATOM   5622  CA  MET A 700      20.009  36.260  27.943  1.00  0.93           C  
ATOM   5623  C   MET A 700      19.654  37.742  28.078  1.00  0.93           C  
ATOM   5624  O   MET A 700      19.739  38.328  29.156  1.00  0.93           O  
ATOM   5625  CB  MET A 700      21.431  36.115  27.343  1.00  0.93           C  
ATOM   5626  CG  MET A 700      21.971  34.669  27.313  1.00  0.93           C  
ATOM   5627  SD  MET A 700      23.444  34.442  26.275  1.00  0.93           S  
ATOM   5628  CE  MET A 700      24.533  35.704  26.998  1.00  0.93           C  
ATOM   5629  N   ALA A 701      19.189  38.360  26.973  1.00  0.93           N  
ATOM   5630  CA  ALA A 701      18.667  39.710  26.935  1.00  0.93           C  
ATOM   5631  C   ALA A 701      17.440  39.961  27.760  1.00  0.93           C  
ATOM   5632  O   ALA A 701      17.341  40.970  28.459  1.00  0.93           O  
ATOM   5633  CB  ALA A 701      18.468  40.124  25.453  1.00  0.93           C  
ATOM   5634  N   GLU A 702      16.498  39.023  27.730  1.00  0.90           N  
ATOM   5635  CA  GLU A 702      15.320  39.025  28.573  1.00  0.90           C  
ATOM   5636  C   GLU A 702      15.634  38.909  30.061  1.00  0.90           C  
ATOM   5637  O   GLU A 702      15.148  39.701  30.861  1.00  0.90           O  
ATOM   5638  CB  GLU A 702      14.397  37.877  28.093  1.00  0.90           C  
ATOM   5639  CG  GLU A 702      13.042  37.689  28.827  1.00  0.90           C  
ATOM   5640  CD  GLU A 702      12.184  36.706  28.050  1.00  0.90           C  
ATOM   5641  OE1 GLU A 702      11.739  37.053  26.926  1.00  0.90           O  
ATOM   5642  OE2 GLU A 702      12.032  35.525  28.465  1.00  0.90           O  
ATOM   5643  N   GLU A 703      16.513  37.962  30.461  1.00  0.92           N  
ATOM   5644  CA  GLU A 703      16.904  37.793  31.854  1.00  0.92           C  
ATOM   5645  C   GLU A 703      17.708  38.960  32.437  1.00  0.92           C  
ATOM   5646  O   GLU A 703      17.416  39.452  33.527  1.00  0.92           O  
ATOM   5647  CB  GLU A 703      17.754  36.508  32.041  1.00  0.92           C  
ATOM   5648  CG  GLU A 703      17.060  35.155  31.723  1.00  0.92           C  
ATOM   5649  CD  GLU A 703      15.967  34.687  32.687  1.00  0.92           C  
ATOM   5650  OE1 GLU A 703      16.199  34.648  33.925  1.00  0.92           O  
ATOM   5651  OE2 GLU A 703      14.914  34.235  32.160  1.00  0.92           O  
ATOM   5652  N   ALA A 704      18.750  39.461  31.736  1.00  0.93           N  
ATOM   5653  CA  ALA A 704      19.591  40.518  32.279  1.00  0.93           C  
ATOM   5654  C   ALA A 704      19.016  41.905  32.103  1.00  0.93           C  
ATOM   5655  O   ALA A 704      19.451  42.855  32.753  1.00  0.93           O  
ATOM   5656  CB  ALA A 704      20.976  40.495  31.603  1.00  0.93           C  
ATOM   5657  N   GLY A 705      18.026  42.046  31.209  1.00  0.91           N  
ATOM   5658  CA  GLY A 705      17.517  43.328  30.760  1.00  0.91           C  
ATOM   5659  C   GLY A 705      18.301  43.845  29.580  1.00  0.91           C  
ATOM   5660  O   GLY A 705      19.529  43.773  29.514  1.00  0.91           O  
ATOM   5661  N   ALA A 706      17.599  44.425  28.593  1.00  0.90           N  
ATOM   5662  CA  ALA A 706      18.188  44.886  27.355  1.00  0.90           C  
ATOM   5663  C   ALA A 706      19.106  46.093  27.519  1.00  0.90           C  
ATOM   5664  O   ALA A 706      20.025  46.299  26.731  1.00  0.90           O  
ATOM   5665  CB  ALA A 706      17.067  45.188  26.343  1.00  0.90           C  
ATOM   5666  N   GLU A 707      18.929  46.883  28.595  1.00  0.86           N  
ATOM   5667  CA  GLU A 707      19.771  48.025  28.927  1.00  0.86           C  
ATOM   5668  C   GLU A 707      21.116  47.614  29.491  1.00  0.86           C  
ATOM   5669  O   GLU A 707      22.002  48.442  29.722  1.00  0.86           O  
ATOM   5670  CB  GLU A 707      19.142  48.983  29.980  1.00  0.86           C  
ATOM   5671  CG  GLU A 707      17.663  48.722  30.327  1.00  0.86           C  
ATOM   5672  CD  GLU A 707      17.516  47.452  31.159  1.00  0.86           C  
ATOM   5673  OE1 GLU A 707      18.083  47.395  32.281  1.00  0.86           O  
ATOM   5674  OE2 GLU A 707      16.908  46.497  30.612  1.00  0.86           O  
ATOM   5675  N   ASN A 708      21.280  46.320  29.798  1.00  0.89           N  
ATOM   5676  CA  ASN A 708      22.496  45.801  30.377  1.00  0.89           C  
ATOM   5677  C   ASN A 708      23.282  45.012  29.343  1.00  0.89           C  
ATOM   5678  O   ASN A 708      24.254  44.331  29.671  1.00  0.89           O  
ATOM   5679  CB  ASN A 708      22.154  44.972  31.638  1.00  0.89           C  
ATOM   5680  CG  ASN A 708      21.415  45.891  32.612  1.00  0.89           C  
ATOM   5681  OD1 ASN A 708      21.884  46.984  32.955  1.00  0.89           O  
ATOM   5682  ND2 ASN A 708      20.223  45.470  33.075  1.00  0.89           N  
ATOM   5683  N   LEU A 709      22.899  45.145  28.058  1.00  0.89           N  
ATOM   5684  CA  LEU A 709      23.500  44.454  26.939  1.00  0.89           C  
ATOM   5685  C   LEU A 709      23.711  45.374  25.753  1.00  0.89           C  
ATOM   5686  O   LEU A 709      23.140  46.456  25.646  1.00  0.89           O  
ATOM   5687  CB  LEU A 709      22.581  43.348  26.380  1.00  0.89           C  
ATOM   5688  CG  LEU A 709      22.233  42.180  27.296  1.00  0.89           C  
ATOM   5689  CD1 LEU A 709      21.377  41.262  26.452  1.00  0.89           C  
ATOM   5690  CD2 LEU A 709      23.439  41.418  27.839  1.00  0.89           C  
ATOM   5691  N   PHE A 710      24.536  44.917  24.796  1.00  0.93           N  
ATOM   5692  CA  PHE A 710      24.833  45.614  23.565  1.00  0.93           C  
ATOM   5693  C   PHE A 710      24.215  44.878  22.378  1.00  0.93           C  
ATOM   5694  O   PHE A 710      24.888  44.299  21.523  1.00  0.93           O  
ATOM   5695  CB  PHE A 710      26.365  45.741  23.441  1.00  0.93           C  
ATOM   5696  CG  PHE A 710      26.880  46.628  24.533  1.00  0.93           C  
ATOM   5697  CD1 PHE A 710      26.670  48.015  24.463  1.00  0.93           C  
ATOM   5698  CD2 PHE A 710      27.583  46.094  25.628  1.00  0.93           C  
ATOM   5699  CE1 PHE A 710      27.175  48.860  25.457  1.00  0.93           C  
ATOM   5700  CE2 PHE A 710      28.098  46.939  26.618  1.00  0.93           C  
ATOM   5701  CZ  PHE A 710      27.900  48.322  26.526  1.00  0.93           C  
ATOM   5702  N   ILE A 711      22.870  44.866  22.314  1.00  0.93           N  
ATOM   5703  CA  ILE A 711      22.109  44.328  21.192  1.00  0.93           C  
ATOM   5704  C   ILE A 711      22.215  45.200  19.950  1.00  0.93           C  
ATOM   5705  O   ILE A 711      22.051  46.417  20.004  1.00  0.93           O  
ATOM   5706  CB  ILE A 711      20.637  44.095  21.551  1.00  0.93           C  
ATOM   5707  CG1 ILE A 711      20.486  43.001  22.638  1.00  0.93           C  
ATOM   5708  CG2 ILE A 711      19.791  43.737  20.305  1.00  0.93           C  
ATOM   5709  CD1 ILE A 711      20.952  41.602  22.203  1.00  0.93           C  
ATOM   5710  N   PHE A 712      22.438  44.587  18.772  1.00  0.93           N  
ATOM   5711  CA  PHE A 712      22.519  45.316  17.523  1.00  0.93           C  
ATOM   5712  C   PHE A 712      21.955  44.503  16.373  1.00  0.93           C  
ATOM   5713  O   PHE A 712      21.562  43.346  16.527  1.00  0.93           O  
ATOM   5714  CB  PHE A 712      23.966  45.802  17.198  1.00  0.93           C  
ATOM   5715  CG  PHE A 712      24.885  44.693  16.753  1.00  0.93           C  
ATOM   5716  CD1 PHE A 712      25.460  43.825  17.689  1.00  0.93           C  
ATOM   5717  CD2 PHE A 712      25.110  44.468  15.383  1.00  0.93           C  
ATOM   5718  CE1 PHE A 712      26.211  42.726  17.262  1.00  0.93           C  
ATOM   5719  CE2 PHE A 712      25.848  43.361  14.954  1.00  0.93           C  
ATOM   5720  CZ  PHE A 712      26.395  42.486  15.895  1.00  0.93           C  
ATOM   5721  N   GLY A 713      21.932  45.126  15.178  1.00  0.95           N  
ATOM   5722  CA  GLY A 713      21.674  44.436  13.923  1.00  0.95           C  
ATOM   5723  C   GLY A 713      20.260  44.041  13.633  1.00  0.95           C  
ATOM   5724  O   GLY A 713      19.332  44.268  14.413  1.00  0.95           O  
ATOM   5725  N   LEU A 714      20.087  43.429  12.454  1.00  0.91           N  
ATOM   5726  CA  LEU A 714      18.843  42.878  11.967  1.00  0.91           C  
ATOM   5727  C   LEU A 714      18.239  41.838  12.905  1.00  0.91           C  
ATOM   5728  O   LEU A 714      18.926  41.044  13.552  1.00  0.91           O  
ATOM   5729  CB  LEU A 714      19.045  42.208  10.579  1.00  0.91           C  
ATOM   5730  CG  LEU A 714      19.488  43.137   9.423  1.00  0.91           C  
ATOM   5731  CD1 LEU A 714      19.749  42.313   8.150  1.00  0.91           C  
ATOM   5732  CD2 LEU A 714      18.494  44.258   9.095  1.00  0.91           C  
ATOM   5733  N   ARG A 715      16.903  41.827  13.008  1.00  0.84           N  
ATOM   5734  CA  ARG A 715      16.144  40.784  13.655  1.00  0.84           C  
ATOM   5735  C   ARG A 715      15.830  39.711  12.624  1.00  0.84           C  
ATOM   5736  O   ARG A 715      16.140  39.857  11.441  1.00  0.84           O  
ATOM   5737  CB  ARG A 715      14.845  41.361  14.262  1.00  0.84           C  
ATOM   5738  CG  ARG A 715      15.072  42.484  15.295  1.00  0.84           C  
ATOM   5739  CD  ARG A 715      15.776  42.003  16.557  1.00  0.84           C  
ATOM   5740  NE  ARG A 715      15.828  43.146  17.529  1.00  0.84           N  
ATOM   5741  CZ  ARG A 715      16.875  43.972  17.664  1.00  0.84           C  
ATOM   5742  NH1 ARG A 715      17.923  43.924  16.851  1.00  0.84           N  
ATOM   5743  NH2 ARG A 715      16.880  44.850  18.667  1.00  0.84           N  
ATOM   5744  N   VAL A 716      15.218  38.579  13.028  1.00  0.84           N  
ATOM   5745  CA  VAL A 716      14.900  37.466  12.133  1.00  0.84           C  
ATOM   5746  C   VAL A 716      13.977  37.917  11.006  1.00  0.84           C  
ATOM   5747  O   VAL A 716      14.165  37.595   9.832  1.00  0.84           O  
ATOM   5748  CB  VAL A 716      14.255  36.319  12.917  1.00  0.84           C  
ATOM   5749  CG1 VAL A 716      13.735  35.204  11.987  1.00  0.84           C  
ATOM   5750  CG2 VAL A 716      15.291  35.726  13.889  1.00  0.84           C  
ATOM   5751  N   GLU A 717      12.990  38.753  11.359  1.00  0.78           N  
ATOM   5752  CA  GLU A 717      12.022  39.369  10.487  1.00  0.78           C  
ATOM   5753  C   GLU A 717      12.658  40.203   9.381  1.00  0.78           C  
ATOM   5754  O   GLU A 717      12.316  40.082   8.203  1.00  0.78           O  
ATOM   5755  CB  GLU A 717      11.096  40.302  11.319  1.00  0.78           C  
ATOM   5756  CG  GLU A 717      10.530  39.717  12.647  1.00  0.78           C  
ATOM   5757  CD  GLU A 717      11.462  39.847  13.860  1.00  0.78           C  
ATOM   5758  OE1 GLU A 717      12.425  39.040  13.962  1.00  0.78           O  
ATOM   5759  OE2 GLU A 717      11.223  40.744  14.703  1.00  0.78           O  
ATOM   5760  N   ASP A 718      13.649  41.042   9.740  1.00  0.84           N  
ATOM   5761  CA  ASP A 718      14.382  41.876   8.815  1.00  0.84           C  
ATOM   5762  C   ASP A 718      15.211  41.065   7.825  1.00  0.84           C  
ATOM   5763  O   ASP A 718      15.251  41.361   6.629  1.00  0.84           O  
ATOM   5764  CB  ASP A 718      15.300  42.869   9.556  1.00  0.84           C  
ATOM   5765  CG  ASP A 718      14.598  43.596  10.683  1.00  0.84           C  
ATOM   5766  OD1 ASP A 718      13.540  44.213  10.423  1.00  0.84           O  
ATOM   5767  OD2 ASP A 718      15.148  43.546  11.815  1.00  0.84           O  
ATOM   5768  N   VAL A 719      15.866  39.977   8.294  1.00  0.87           N  
ATOM   5769  CA  VAL A 719      16.631  39.071   7.443  1.00  0.87           C  
ATOM   5770  C   VAL A 719      15.756  38.443   6.365  1.00  0.87           C  
ATOM   5771  O   VAL A 719      16.086  38.500   5.182  1.00  0.87           O  
ATOM   5772  CB  VAL A 719      17.294  37.964   8.264  1.00  0.87           C  
ATOM   5773  CG1 VAL A 719      18.023  36.939   7.376  1.00  0.87           C  
ATOM   5774  CG2 VAL A 719      18.323  38.559   9.241  1.00  0.87           C  
ATOM   5775  N   GLU A 720      14.569  37.935   6.750  1.00  0.79           N  
ATOM   5776  CA  GLU A 720      13.562  37.395   5.849  1.00  0.79           C  
ATOM   5777  C   GLU A 720      13.020  38.408   4.849  1.00  0.79           C  
ATOM   5778  O   GLU A 720      12.867  38.132   3.658  1.00  0.79           O  
ATOM   5779  CB  GLU A 720      12.406  36.835   6.709  1.00  0.79           C  
ATOM   5780  CG  GLU A 720      11.192  36.255   5.946  1.00  0.79           C  
ATOM   5781  CD  GLU A 720      11.444  34.925   5.247  1.00  0.79           C  
ATOM   5782  OE1 GLU A 720      10.470  34.486   4.567  1.00  0.79           O  
ATOM   5783  OE2 GLU A 720      12.528  34.328   5.384  1.00  0.79           O  
ATOM   5784  N   ALA A 721      12.750  39.659   5.283  1.00  0.85           N  
ATOM   5785  CA  ALA A 721      12.322  40.724   4.395  1.00  0.85           C  
ATOM   5786  C   ALA A 721      13.331  41.014   3.290  1.00  0.85           C  
ATOM   5787  O   ALA A 721      12.980  41.265   2.136  1.00  0.85           O  
ATOM   5788  CB  ALA A 721      12.079  42.007   5.210  1.00  0.85           C  
ATOM   5789  N   LEU A 722      14.623  40.964   3.645  1.00  0.82           N  
ATOM   5790  CA  LEU A 722      15.732  41.058   2.728  1.00  0.82           C  
ATOM   5791  C   LEU A 722      15.868  39.846   1.816  1.00  0.82           C  
ATOM   5792  O   LEU A 722      16.063  39.993   0.614  1.00  0.82           O  
ATOM   5793  CB  LEU A 722      17.006  41.304   3.571  1.00  0.82           C  
ATOM   5794  CG  LEU A 722      18.063  42.261   2.990  1.00  0.82           C  
ATOM   5795  CD1 LEU A 722      17.459  43.602   2.550  1.00  0.82           C  
ATOM   5796  CD2 LEU A 722      19.118  42.518   4.075  1.00  0.82           C  
ATOM   5797  N   ASP A 723      15.718  38.611   2.337  1.00  0.81           N  
ATOM   5798  CA  ASP A 723      15.758  37.399   1.533  1.00  0.81           C  
ATOM   5799  C   ASP A 723      14.658  37.288   0.478  1.00  0.81           C  
ATOM   5800  O   ASP A 723      14.919  36.902  -0.660  1.00  0.81           O  
ATOM   5801  CB  ASP A 723      15.804  36.145   2.438  1.00  0.81           C  
ATOM   5802  CG  ASP A 723      17.207  36.008   2.974  1.00  0.81           C  
ATOM   5803  OD1 ASP A 723      18.176  36.010   2.164  1.00  0.81           O  
ATOM   5804  OD2 ASP A 723      17.426  35.948   4.208  1.00  0.81           O  
ATOM   5805  N   ARG A 724      13.407  37.677   0.789  1.00  0.72           N  
ATOM   5806  CA  ARG A 724      12.335  37.731  -0.196  1.00  0.72           C  
ATOM   5807  C   ARG A 724      12.541  38.737  -1.326  1.00  0.72           C  
ATOM   5808  O   ARG A 724      12.089  38.522  -2.447  1.00  0.72           O  
ATOM   5809  CB  ARG A 724      10.980  38.039   0.478  1.00  0.72           C  
ATOM   5810  CG  ARG A 724      10.516  36.945   1.455  1.00  0.72           C  
ATOM   5811  CD  ARG A 724       9.166  37.279   2.085  1.00  0.72           C  
ATOM   5812  NE  ARG A 724       8.933  36.261   3.146  1.00  0.72           N  
ATOM   5813  CZ  ARG A 724       8.009  36.341   4.108  1.00  0.72           C  
ATOM   5814  NH1 ARG A 724       8.083  35.438   5.077  1.00  0.72           N  
ATOM   5815  NH2 ARG A 724       7.073  37.280   4.131  1.00  0.72           N  
ATOM   5816  N   LYS A 725      13.199  39.883  -1.064  1.00  0.73           N  
ATOM   5817  CA  LYS A 725      13.498  40.842  -2.116  1.00  0.73           C  
ATOM   5818  C   LYS A 725      14.779  40.514  -2.861  1.00  0.73           C  
ATOM   5819  O   LYS A 725      14.963  40.902  -4.012  1.00  0.73           O  
ATOM   5820  CB  LYS A 725      13.657  42.251  -1.500  1.00  0.73           C  
ATOM   5821  CG  LYS A 725      12.353  42.786  -0.893  1.00  0.73           C  
ATOM   5822  CD  LYS A 725      12.529  44.183  -0.281  1.00  0.73           C  
ATOM   5823  CE  LYS A 725      11.234  44.719   0.326  1.00  0.73           C  
ATOM   5824  NZ  LYS A 725      11.477  46.060   0.898  1.00  0.73           N  
ATOM   5825  N   GLY A 726      15.688  39.772  -2.207  1.00  0.82           N  
ATOM   5826  CA  GLY A 726      17.023  39.500  -2.703  1.00  0.82           C  
ATOM   5827  C   GLY A 726      18.040  40.397  -2.050  1.00  0.82           C  
ATOM   5828  O   GLY A 726      17.989  41.620  -2.127  1.00  0.82           O  
ATOM   5829  N   TYR A 727      19.039  39.798  -1.382  1.00  0.84           N  
ATOM   5830  CA  TYR A 727      20.133  40.536  -0.781  1.00  0.84           C  
ATOM   5831  C   TYR A 727      21.138  41.033  -1.814  1.00  0.84           C  
ATOM   5832  O   TYR A 727      21.684  40.263  -2.602  1.00  0.84           O  
ATOM   5833  CB  TYR A 727      20.852  39.640   0.264  1.00  0.84           C  
ATOM   5834  CG  TYR A 727      22.056  40.281   0.916  1.00  0.84           C  
ATOM   5835  CD1 TYR A 727      21.946  41.435   1.711  1.00  0.84           C  
ATOM   5836  CD2 TYR A 727      23.326  39.716   0.714  1.00  0.84           C  
ATOM   5837  CE1 TYR A 727      23.088  42.000   2.305  1.00  0.84           C  
ATOM   5838  CE2 TYR A 727      24.460  40.278   1.312  1.00  0.84           C  
ATOM   5839  CZ  TYR A 727      24.342  41.414   2.112  1.00  0.84           C  
ATOM   5840  OH  TYR A 727      25.487  41.943   2.739  1.00  0.84           O  
ATOM   5841  N   ASN A 728      21.440  42.340  -1.797  1.00  0.86           N  
ATOM   5842  CA  ASN A 728      22.465  42.909  -2.643  1.00  0.86           C  
ATOM   5843  C   ASN A 728      23.446  43.676  -1.773  1.00  0.86           C  
ATOM   5844  O   ASN A 728      23.189  44.780  -1.300  1.00  0.86           O  
ATOM   5845  CB  ASN A 728      21.748  43.803  -3.683  1.00  0.86           C  
ATOM   5846  CG  ASN A 728      22.610  44.414  -4.779  1.00  0.86           C  
ATOM   5847  OD1 ASN A 728      23.782  44.112  -5.019  1.00  0.86           O  
ATOM   5848  ND2 ASN A 728      21.974  45.340  -5.537  1.00  0.86           N  
ATOM   5849  N   ALA A 729      24.648  43.110  -1.556  1.00  0.91           N  
ATOM   5850  CA  ALA A 729      25.671  43.698  -0.714  1.00  0.91           C  
ATOM   5851  C   ALA A 729      26.200  45.024  -1.243  1.00  0.91           C  
ATOM   5852  O   ALA A 729      26.579  45.918  -0.486  1.00  0.91           O  
ATOM   5853  CB  ALA A 729      26.810  42.693  -0.536  1.00  0.91           C  
ATOM   5854  N   ARG A 730      26.159  45.200  -2.577  1.00  0.80           N  
ATOM   5855  CA  ARG A 730      26.546  46.421  -3.258  1.00  0.80           C  
ATOM   5856  C   ARG A 730      25.813  47.662  -2.763  1.00  0.80           C  
ATOM   5857  O   ARG A 730      26.404  48.720  -2.617  1.00  0.80           O  
ATOM   5858  CB  ARG A 730      26.312  46.304  -4.781  1.00  0.80           C  
ATOM   5859  CG  ARG A 730      27.108  45.163  -5.447  1.00  0.80           C  
ATOM   5860  CD  ARG A 730      26.901  45.058  -6.962  1.00  0.80           C  
ATOM   5861  NE  ARG A 730      25.454  44.759  -7.204  1.00  0.80           N  
ATOM   5862  CZ  ARG A 730      24.841  44.919  -8.384  1.00  0.80           C  
ATOM   5863  NH1 ARG A 730      23.522  44.763  -8.451  1.00  0.80           N  
ATOM   5864  NH2 ARG A 730      25.518  45.234  -9.485  1.00  0.80           N  
ATOM   5865  N   GLU A 731      24.518  47.556  -2.415  1.00  0.79           N  
ATOM   5866  CA  GLU A 731      23.726  48.676  -1.933  1.00  0.79           C  
ATOM   5867  C   GLU A 731      24.271  49.324  -0.663  1.00  0.79           C  
ATOM   5868  O   GLU A 731      24.321  50.540  -0.518  1.00  0.79           O  
ATOM   5869  CB  GLU A 731      22.268  48.205  -1.714  1.00  0.79           C  
ATOM   5870  CG  GLU A 731      21.703  47.530  -2.984  1.00  0.79           C  
ATOM   5871  CD  GLU A 731      20.280  46.997  -2.869  1.00  0.79           C  
ATOM   5872  OE1 GLU A 731      19.813  46.705  -1.743  1.00  0.79           O  
ATOM   5873  OE2 GLU A 731      19.710  46.766  -3.971  1.00  0.79           O  
ATOM   5874  N   TYR A 732      24.749  48.515   0.295  1.00  0.86           N  
ATOM   5875  CA  TYR A 732      25.446  48.997   1.477  1.00  0.86           C  
ATOM   5876  C   TYR A 732      26.823  49.547   1.140  1.00  0.86           C  
ATOM   5877  O   TYR A 732      27.260  50.569   1.656  1.00  0.86           O  
ATOM   5878  CB  TYR A 732      25.605  47.874   2.531  1.00  0.86           C  
ATOM   5879  CG  TYR A 732      24.282  47.207   2.767  1.00  0.86           C  
ATOM   5880  CD1 TYR A 732      23.352  47.748   3.668  1.00  0.86           C  
ATOM   5881  CD2 TYR A 732      23.931  46.069   2.022  1.00  0.86           C  
ATOM   5882  CE1 TYR A 732      22.078  47.174   3.799  1.00  0.86           C  
ATOM   5883  CE2 TYR A 732      22.654  45.510   2.134  1.00  0.86           C  
ATOM   5884  CZ  TYR A 732      21.730  46.065   3.020  1.00  0.86           C  
ATOM   5885  OH  TYR A 732      20.441  45.517   3.094  1.00  0.86           O  
ATOM   5886  N   TYR A 733      27.546  48.884   0.221  1.00  0.84           N  
ATOM   5887  CA  TYR A 733      28.875  49.281  -0.214  1.00  0.84           C  
ATOM   5888  C   TYR A 733      28.915  50.676  -0.818  1.00  0.84           C  
ATOM   5889  O   TYR A 733      29.761  51.503  -0.474  1.00  0.84           O  
ATOM   5890  CB  TYR A 733      29.344  48.260  -1.278  1.00  0.84           C  
ATOM   5891  CG  TYR A 733      30.801  48.385  -1.583  1.00  0.84           C  
ATOM   5892  CD1 TYR A 733      31.705  47.811  -0.690  1.00  0.84           C  
ATOM   5893  CD2 TYR A 733      31.278  48.997  -2.760  1.00  0.84           C  
ATOM   5894  CE1 TYR A 733      33.062  47.795  -0.996  1.00  0.84           C  
ATOM   5895  CE2 TYR A 733      32.654  48.984  -3.058  1.00  0.84           C  
ATOM   5896  CZ  TYR A 733      33.542  48.353  -2.178  1.00  0.84           C  
ATOM   5897  OH  TYR A 733      34.917  48.182  -2.433  1.00  0.84           O  
ATOM   5898  N   ASP A 734      27.938  50.972  -1.685  1.00  0.81           N  
ATOM   5899  CA  ASP A 734      27.852  52.204  -2.426  1.00  0.81           C  
ATOM   5900  C   ASP A 734      27.484  53.396  -1.538  1.00  0.81           C  
ATOM   5901  O   ASP A 734      27.730  54.548  -1.891  1.00  0.81           O  
ATOM   5902  CB  ASP A 734      26.798  52.007  -3.549  1.00  0.81           C  
ATOM   5903  CG  ASP A 734      27.226  50.963  -4.579  1.00  0.81           C  
ATOM   5904  OD1 ASP A 734      28.424  50.576  -4.608  1.00  0.81           O  
ATOM   5905  OD2 ASP A 734      26.336  50.539  -5.364  1.00  0.81           O  
ATOM   5906  N   HIS A 735      26.926  53.147  -0.332  1.00  0.80           N  
ATOM   5907  CA  HIS A 735      26.551  54.212   0.589  1.00  0.80           C  
ATOM   5908  C   HIS A 735      27.423  54.337   1.824  1.00  0.80           C  
ATOM   5909  O   HIS A 735      27.253  55.281   2.592  1.00  0.80           O  
ATOM   5910  CB  HIS A 735      25.101  54.015   1.088  1.00  0.80           C  
ATOM   5911  CG  HIS A 735      24.087  54.352   0.044  1.00  0.80           C  
ATOM   5912  ND1 HIS A 735      23.948  55.671  -0.344  1.00  0.80           N  
ATOM   5913  CD2 HIS A 735      23.250  53.562  -0.674  1.00  0.80           C  
ATOM   5914  CE1 HIS A 735      23.039  55.656  -1.293  1.00  0.80           C  
ATOM   5915  NE2 HIS A 735      22.581  54.404  -1.535  1.00  0.80           N  
ATOM   5916  N   LEU A 736      28.390  53.432   2.071  1.00  0.87           N  
ATOM   5917  CA  LEU A 736      29.166  53.464   3.310  1.00  0.87           C  
ATOM   5918  C   LEU A 736      30.664  53.663   3.023  1.00  0.87           C  
ATOM   5919  O   LEU A 736      31.373  52.686   2.764  1.00  0.87           O  
ATOM   5920  CB  LEU A 736      29.008  52.117   4.074  1.00  0.87           C  
ATOM   5921  CG  LEU A 736      27.724  51.881   4.914  1.00  0.87           C  
ATOM   5922  CD1 LEU A 736      26.418  52.402   4.307  1.00  0.87           C  
ATOM   5923  CD2 LEU A 736      27.568  50.379   5.188  1.00  0.87           C  
ATOM   5924  N   PRO A 737      31.238  54.874   3.123  1.00  0.88           N  
ATOM   5925  CA  PRO A 737      32.629  55.122   2.726  1.00  0.88           C  
ATOM   5926  C   PRO A 737      33.667  54.402   3.560  1.00  0.88           C  
ATOM   5927  O   PRO A 737      34.671  53.946   3.015  1.00  0.88           O  
ATOM   5928  CB  PRO A 737      32.779  56.647   2.826  1.00  0.88           C  
ATOM   5929  CG  PRO A 737      31.378  57.163   2.499  1.00  0.88           C  
ATOM   5930  CD  PRO A 737      30.464  56.122   3.142  1.00  0.88           C  
ATOM   5931  N   GLU A 738      33.450  54.276   4.882  1.00  0.87           N  
ATOM   5932  CA  GLU A 738      34.331  53.525   5.762  1.00  0.87           C  
ATOM   5933  C   GLU A 738      34.393  52.043   5.421  1.00  0.87           C  
ATOM   5934  O   GLU A 738      35.448  51.417   5.459  1.00  0.87           O  
ATOM   5935  CB  GLU A 738      33.924  53.672   7.247  1.00  0.87           C  
ATOM   5936  CG  GLU A 738      34.147  55.096   7.810  1.00  0.87           C  
ATOM   5937  CD  GLU A 738      34.410  55.117   9.312  1.00  0.87           C  
ATOM   5938  OE1 GLU A 738      33.663  54.477  10.094  1.00  0.87           O  
ATOM   5939  OE2 GLU A 738      35.391  55.790   9.725  1.00  0.87           O  
ATOM   5940  N   LEU A 739      33.246  51.439   5.045  1.00  0.90           N  
ATOM   5941  CA  LEU A 739      33.204  50.057   4.602  1.00  0.90           C  
ATOM   5942  C   LEU A 739      33.954  49.842   3.308  1.00  0.90           C  
ATOM   5943  O   LEU A 739      34.749  48.912   3.187  1.00  0.90           O  
ATOM   5944  CB  LEU A 739      31.744  49.593   4.419  1.00  0.90           C  
ATOM   5945  CG  LEU A 739      31.558  48.144   3.925  1.00  0.90           C  
ATOM   5946  CD1 LEU A 739      32.238  47.122   4.845  1.00  0.90           C  
ATOM   5947  CD2 LEU A 739      30.063  47.836   3.795  1.00  0.90           C  
ATOM   5948  N   LYS A 740      33.774  50.748   2.325  1.00  0.85           N  
ATOM   5949  CA  LYS A 740      34.527  50.698   1.088  1.00  0.85           C  
ATOM   5950  C   LYS A 740      36.034  50.788   1.325  1.00  0.85           C  
ATOM   5951  O   LYS A 740      36.806  50.010   0.776  1.00  0.85           O  
ATOM   5952  CB  LYS A 740      34.057  51.802   0.111  1.00  0.85           C  
ATOM   5953  CG  LYS A 740      34.791  51.740  -1.238  1.00  0.85           C  
ATOM   5954  CD  LYS A 740      34.266  52.722  -2.293  1.00  0.85           C  
ATOM   5955  CE  LYS A 740      34.884  52.492  -3.679  1.00  0.85           C  
ATOM   5956  NZ  LYS A 740      36.351  52.636  -3.623  1.00  0.85           N  
ATOM   5957  N   GLN A 741      36.477  51.680   2.240  1.00  0.86           N  
ATOM   5958  CA  GLN A 741      37.864  51.773   2.671  1.00  0.86           C  
ATOM   5959  C   GLN A 741      38.413  50.469   3.250  1.00  0.86           C  
ATOM   5960  O   GLN A 741      39.513  50.035   2.908  1.00  0.86           O  
ATOM   5961  CB  GLN A 741      38.005  52.916   3.721  1.00  0.86           C  
ATOM   5962  CG  GLN A 741      39.433  53.098   4.301  1.00  0.86           C  
ATOM   5963  CD  GLN A 741      39.609  54.371   5.145  1.00  0.86           C  
ATOM   5964  OE1 GLN A 741      39.023  54.631   6.200  1.00  0.86           O  
ATOM   5965  NE2 GLN A 741      40.531  55.244   4.669  1.00  0.86           N  
ATOM   5966  N   ALA A 742      37.648  49.775   4.113  1.00  0.93           N  
ATOM   5967  CA  ALA A 742      38.034  48.477   4.629  1.00  0.93           C  
ATOM   5968  C   ALA A 742      38.145  47.381   3.570  1.00  0.93           C  
ATOM   5969  O   ALA A 742      39.140  46.660   3.508  1.00  0.93           O  
ATOM   5970  CB  ALA A 742      37.055  48.052   5.736  1.00  0.93           C  
ATOM   5971  N   VAL A 743      37.146  47.263   2.676  1.00  0.89           N  
ATOM   5972  CA  VAL A 743      37.139  46.293   1.588  1.00  0.89           C  
ATOM   5973  C   VAL A 743      38.229  46.522   0.560  1.00  0.89           C  
ATOM   5974  O   VAL A 743      38.921  45.581   0.167  1.00  0.89           O  
ATOM   5975  CB  VAL A 743      35.789  46.278   0.894  1.00  0.89           C  
ATOM   5976  CG1 VAL A 743      35.762  45.349  -0.339  1.00  0.89           C  
ATOM   5977  CG2 VAL A 743      34.699  45.832   1.888  1.00  0.89           C  
ATOM   5978  N   ASP A 744      38.465  47.778   0.132  1.00  0.88           N  
ATOM   5979  CA  ASP A 744      39.524  48.106  -0.797  1.00  0.88           C  
ATOM   5980  C   ASP A 744      40.910  47.760  -0.240  1.00  0.88           C  
ATOM   5981  O   ASP A 744      41.754  47.270  -0.978  1.00  0.88           O  
ATOM   5982  CB  ASP A 744      39.451  49.597  -1.224  1.00  0.88           C  
ATOM   5983  CG  ASP A 744      38.289  49.925  -2.158  1.00  0.88           C  
ATOM   5984  OD1 ASP A 744      37.748  49.034  -2.853  1.00  0.88           O  
ATOM   5985  OD2 ASP A 744      37.944  51.138  -2.247  1.00  0.88           O  
ATOM   5986  N   GLN A 745      41.177  47.931   1.079  1.00  0.87           N  
ATOM   5987  CA  GLN A 745      42.405  47.433   1.703  1.00  0.87           C  
ATOM   5988  C   GLN A 745      42.582  45.914   1.631  1.00  0.87           C  
ATOM   5989  O   GLN A 745      43.675  45.415   1.366  1.00  0.87           O  
ATOM   5990  CB  GLN A 745      42.486  47.810   3.204  1.00  0.87           C  
ATOM   5991  CG  GLN A 745      42.672  49.320   3.467  1.00  0.87           C  
ATOM   5992  CD  GLN A 745      42.582  49.635   4.960  1.00  0.87           C  
ATOM   5993  OE1 GLN A 745      43.518  50.089   5.617  1.00  0.87           O  
ATOM   5994  NE2 GLN A 745      41.381  49.398   5.525  1.00  0.87           N  
ATOM   5995  N   ILE A 746      41.508  45.130   1.872  1.00  0.90           N  
ATOM   5996  CA  ILE A 746      41.529  43.674   1.741  1.00  0.90           C  
ATOM   5997  C   ILE A 746      41.792  43.260   0.298  1.00  0.90           C  
ATOM   5998  O   ILE A 746      42.608  42.388   0.015  1.00  0.90           O  
ATOM   5999  CB  ILE A 746      40.197  43.069   2.209  1.00  0.90           C  
ATOM   6000  CG1 ILE A 746      39.908  43.389   3.694  1.00  0.90           C  
ATOM   6001  CG2 ILE A 746      40.151  41.539   2.007  1.00  0.90           C  
ATOM   6002  CD1 ILE A 746      38.455  43.099   4.096  1.00  0.90           C  
ATOM   6003  N   SER A 747      41.099  43.919  -0.647  1.00  0.86           N  
ATOM   6004  CA  SER A 747      41.201  43.695  -2.082  1.00  0.86           C  
ATOM   6005  C   SER A 747      42.524  44.096  -2.717  1.00  0.86           C  
ATOM   6006  O   SER A 747      43.039  43.419  -3.599  1.00  0.86           O  
ATOM   6007  CB  SER A 747      40.047  44.441  -2.794  1.00  0.86           C  
ATOM   6008  OG  SER A 747      39.879  44.007  -4.144  1.00  0.86           O  
ATOM   6009  N   SER A 748      43.130  45.221  -2.288  1.00  0.88           N  
ATOM   6010  CA  SER A 748      44.345  45.739  -2.906  1.00  0.88           C  
ATOM   6011  C   SER A 748      45.626  45.153  -2.348  1.00  0.88           C  
ATOM   6012  O   SER A 748      46.709  45.407  -2.872  1.00  0.88           O  
ATOM   6013  CB  SER A 748      44.440  47.287  -2.770  1.00  0.88           C  
ATOM   6014  OG  SER A 748      44.617  47.720  -1.414  1.00  0.88           O  
ATOM   6015  N   GLY A 749      45.537  44.333  -1.281  1.00  0.90           N  
ATOM   6016  CA  GLY A 749      46.701  43.672  -0.705  1.00  0.90           C  
ATOM   6017  C   GLY A 749      47.383  44.400   0.412  1.00  0.90           C  
ATOM   6018  O   GLY A 749      48.529  44.109   0.739  1.00  0.90           O  
ATOM   6019  N   PHE A 750      46.701  45.341   1.088  1.00  0.90           N  
ATOM   6020  CA  PHE A 750      47.248  46.050   2.239  1.00  0.90           C  
ATOM   6021  C   PHE A 750      47.600  45.105   3.386  1.00  0.90           C  
ATOM   6022  O   PHE A 750      48.639  45.211   4.032  1.00  0.90           O  
ATOM   6023  CB  PHE A 750      46.217  47.108   2.710  1.00  0.90           C  
ATOM   6024  CG  PHE A 750      46.712  47.933   3.865  1.00  0.90           C  
ATOM   6025  CD1 PHE A 750      47.793  48.814   3.714  1.00  0.90           C  
ATOM   6026  CD2 PHE A 750      46.122  47.789   5.128  1.00  0.90           C  
ATOM   6027  CE1 PHE A 750      48.288  49.527   4.815  1.00  0.90           C  
ATOM   6028  CE2 PHE A 750      46.612  48.493   6.232  1.00  0.90           C  
ATOM   6029  CZ  PHE A 750      47.700  49.361   6.076  1.00  0.90           C  
ATOM   6030  N   PHE A 751      46.742  44.099   3.618  1.00  0.89           N  
ATOM   6031  CA  PHE A 751      46.969  43.101   4.645  1.00  0.89           C  
ATOM   6032  C   PHE A 751      47.676  41.875   4.091  1.00  0.89           C  
ATOM   6033  O   PHE A 751      47.758  40.828   4.726  1.00  0.89           O  
ATOM   6034  CB  PHE A 751      45.629  42.667   5.281  1.00  0.89           C  
ATOM   6035  CG  PHE A 751      45.070  43.793   6.095  1.00  0.89           C  
ATOM   6036  CD1 PHE A 751      45.704  44.160   7.292  1.00  0.89           C  
ATOM   6037  CD2 PHE A 751      43.923  44.492   5.686  1.00  0.89           C  
ATOM   6038  CE1 PHE A 751      45.218  45.224   8.061  1.00  0.89           C  
ATOM   6039  CE2 PHE A 751      43.430  45.556   6.453  1.00  0.89           C  
ATOM   6040  CZ  PHE A 751      44.083  45.927   7.637  1.00  0.89           C  
ATOM   6041  N   SER A 752      48.246  41.974   2.888  1.00  0.87           N  
ATOM   6042  CA  SER A 752      48.994  40.878   2.300  1.00  0.87           C  
ATOM   6043  C   SER A 752      49.976  41.365   1.245  1.00  0.87           C  
ATOM   6044  O   SER A 752      49.830  40.983   0.089  1.00  0.87           O  
ATOM   6045  CB  SER A 752      48.068  39.770   1.706  1.00  0.87           C  
ATOM   6046  OG  SER A 752      46.928  40.302   1.024  1.00  0.87           O  
ATOM   6047  N   PRO A 753      51.023  42.159   1.544  1.00  0.87           N  
ATOM   6048  CA  PRO A 753      51.860  42.801   0.521  1.00  0.87           C  
ATOM   6049  C   PRO A 753      52.571  41.838  -0.403  1.00  0.87           C  
ATOM   6050  O   PRO A 753      52.789  42.139  -1.571  1.00  0.87           O  
ATOM   6051  CB  PRO A 753      52.880  43.615   1.336  1.00  0.87           C  
ATOM   6052  CG  PRO A 753      52.133  43.955   2.623  1.00  0.87           C  
ATOM   6053  CD  PRO A 753      51.316  42.694   2.883  1.00  0.87           C  
ATOM   6054  N   LYS A 754      52.966  40.670   0.128  1.00  0.79           N  
ATOM   6055  CA  LYS A 754      53.591  39.606  -0.628  1.00  0.79           C  
ATOM   6056  C   LYS A 754      52.654  38.946  -1.629  1.00  0.79           C  
ATOM   6057  O   LYS A 754      53.071  38.500  -2.693  1.00  0.79           O  
ATOM   6058  CB  LYS A 754      54.128  38.520   0.332  1.00  0.79           C  
ATOM   6059  CG  LYS A 754      55.175  39.042   1.330  1.00  0.79           C  
ATOM   6060  CD  LYS A 754      55.858  37.889   2.087  1.00  0.79           C  
ATOM   6061  CE  LYS A 754      56.985  38.355   3.014  1.00  0.79           C  
ATOM   6062  NZ  LYS A 754      57.725  37.189   3.551  1.00  0.79           N  
ATOM   6063  N   GLU A 755      51.356  38.880  -1.291  1.00  0.82           N  
ATOM   6064  CA  GLU A 755      50.350  38.208  -2.084  1.00  0.82           C  
ATOM   6065  C   GLU A 755      49.121  39.099  -2.186  1.00  0.82           C  
ATOM   6066  O   GLU A 755      48.168  38.902  -1.422  1.00  0.82           O  
ATOM   6067  CB  GLU A 755      49.912  36.895  -1.390  1.00  0.82           C  
ATOM   6068  CG  GLU A 755      51.002  35.803  -1.287  1.00  0.82           C  
ATOM   6069  CD  GLU A 755      50.503  34.594  -0.498  1.00  0.82           C  
ATOM   6070  OE1 GLU A 755      50.380  33.506  -1.113  1.00  0.82           O  
ATOM   6071  OE2 GLU A 755      50.250  34.754   0.728  1.00  0.82           O  
ATOM   6072  N   PRO A 756      49.060  40.078  -3.095  1.00  0.88           N  
ATOM   6073  CA  PRO A 756      47.984  41.071  -3.120  1.00  0.88           C  
ATOM   6074  C   PRO A 756      46.598  40.473  -3.223  1.00  0.88           C  
ATOM   6075  O   PRO A 756      45.673  40.952  -2.572  1.00  0.88           O  
ATOM   6076  CB  PRO A 756      48.352  41.973  -4.304  1.00  0.88           C  
ATOM   6077  CG  PRO A 756      49.882  41.954  -4.294  1.00  0.88           C  
ATOM   6078  CD  PRO A 756      50.202  40.509  -3.915  1.00  0.88           C  
ATOM   6079  N   ASP A 757      46.468  39.367  -3.966  1.00  0.86           N  
ATOM   6080  CA  ASP A 757      45.201  38.742  -4.249  1.00  0.86           C  
ATOM   6081  C   ASP A 757      44.802  37.692  -3.210  1.00  0.86           C  
ATOM   6082  O   ASP A 757      43.805  36.991  -3.382  1.00  0.86           O  
ATOM   6083  CB  ASP A 757      45.287  38.014  -5.616  1.00  0.86           C  
ATOM   6084  CG  ASP A 757      45.486  38.933  -6.811  1.00  0.86           C  
ATOM   6085  OD1 ASP A 757      45.362  38.387  -7.939  1.00  0.86           O  
ATOM   6086  OD2 ASP A 757      45.760  40.143  -6.639  1.00  0.86           O  
ATOM   6087  N   CYS A 758      45.529  37.568  -2.074  1.00  0.88           N  
ATOM   6088  CA  CYS A 758      45.316  36.529  -1.063  1.00  0.88           C  
ATOM   6089  C   CYS A 758      43.893  36.438  -0.529  1.00  0.88           C  
ATOM   6090  O   CYS A 758      43.366  35.362  -0.258  1.00  0.88           O  
ATOM   6091  CB  CYS A 758      46.267  36.761   0.144  1.00  0.88           C  
ATOM   6092  SG  CYS A 758      46.190  35.468   1.449  1.00  0.88           S  
ATOM   6093  N   PHE A 759      43.224  37.586  -0.366  1.00  0.90           N  
ATOM   6094  CA  PHE A 759      41.893  37.620   0.195  1.00  0.90           C  
ATOM   6095  C   PHE A 759      40.813  37.873  -0.832  1.00  0.90           C  
ATOM   6096  O   PHE A 759      39.706  38.290  -0.490  1.00  0.90           O  
ATOM   6097  CB  PHE A 759      41.824  38.686   1.303  1.00  0.90           C  
ATOM   6098  CG  PHE A 759      42.738  38.336   2.441  1.00  0.90           C  
ATOM   6099  CD1 PHE A 759      42.685  37.058   3.025  1.00  0.90           C  
ATOM   6100  CD2 PHE A 759      43.647  39.281   2.949  1.00  0.90           C  
ATOM   6101  CE1 PHE A 759      43.525  36.724   4.086  1.00  0.90           C  
ATOM   6102  CE2 PHE A 759      44.489  38.953   4.020  1.00  0.90           C  
ATOM   6103  CZ  PHE A 759      44.422  37.670   4.579  1.00  0.90           C  
ATOM   6104  N   LYS A 760      41.077  37.572  -2.118  1.00  0.84           N  
ATOM   6105  CA  LYS A 760      40.117  37.748  -3.193  1.00  0.84           C  
ATOM   6106  C   LYS A 760      38.805  37.004  -2.984  1.00  0.84           C  
ATOM   6107  O   LYS A 760      37.724  37.574  -3.147  1.00  0.84           O  
ATOM   6108  CB  LYS A 760      40.736  37.277  -4.528  1.00  0.84           C  
ATOM   6109  CG  LYS A 760      39.799  37.462  -5.727  1.00  0.84           C  
ATOM   6110  CD  LYS A 760      40.384  36.907  -7.028  1.00  0.84           C  
ATOM   6111  CE  LYS A 760      39.382  37.045  -8.170  1.00  0.84           C  
ATOM   6112  NZ  LYS A 760      39.969  36.517  -9.415  1.00  0.84           N  
ATOM   6113  N   ASP A 761      38.868  35.730  -2.556  1.00  0.89           N  
ATOM   6114  CA  ASP A 761      37.709  34.904  -2.286  1.00  0.89           C  
ATOM   6115  C   ASP A 761      36.808  35.496  -1.203  1.00  0.89           C  
ATOM   6116  O   ASP A 761      35.587  35.545  -1.346  1.00  0.89           O  
ATOM   6117  CB  ASP A 761      38.156  33.498  -1.825  1.00  0.89           C  
ATOM   6118  CG  ASP A 761      39.024  32.775  -2.841  1.00  0.89           C  
ATOM   6119  OD1 ASP A 761      39.102  33.224  -4.010  1.00  0.89           O  
ATOM   6120  OD2 ASP A 761      39.633  31.754  -2.423  1.00  0.89           O  
ATOM   6121  N   ILE A 762      37.406  36.024  -0.106  1.00  0.91           N  
ATOM   6122  CA  ILE A 762      36.682  36.709   0.960  1.00  0.91           C  
ATOM   6123  C   ILE A 762      35.957  37.942   0.443  1.00  0.91           C  
ATOM   6124  O   ILE A 762      34.770  38.130   0.698  1.00  0.91           O  
ATOM   6125  CB  ILE A 762      37.607  37.110   2.122  1.00  0.91           C  
ATOM   6126  CG1 ILE A 762      38.140  35.853   2.848  1.00  0.91           C  
ATOM   6127  CG2 ILE A 762      36.870  38.032   3.124  1.00  0.91           C  
ATOM   6128  CD1 ILE A 762      39.091  36.153   4.016  1.00  0.91           C  
ATOM   6129  N   VAL A 763      36.634  38.799  -0.351  1.00  0.90           N  
ATOM   6130  CA  VAL A 763      36.012  39.983  -0.933  1.00  0.90           C  
ATOM   6131  C   VAL A 763      34.900  39.625  -1.903  1.00  0.90           C  
ATOM   6132  O   VAL A 763      33.792  40.146  -1.828  1.00  0.90           O  
ATOM   6133  CB  VAL A 763      37.021  40.864  -1.665  1.00  0.90           C  
ATOM   6134  CG1 VAL A 763      36.333  42.110  -2.256  1.00  0.90           C  
ATOM   6135  CG2 VAL A 763      38.117  41.315  -0.688  1.00  0.90           C  
ATOM   6136  N   ASN A 764      35.140  38.672  -2.821  1.00  0.86           N  
ATOM   6137  CA  ASN A 764      34.145  38.226  -3.780  1.00  0.86           C  
ATOM   6138  C   ASN A 764      32.918  37.595  -3.133  1.00  0.86           C  
ATOM   6139  O   ASN A 764      31.800  37.841  -3.582  1.00  0.86           O  
ATOM   6140  CB  ASN A 764      34.773  37.282  -4.843  1.00  0.86           C  
ATOM   6141  CG  ASN A 764      35.675  37.998  -5.858  1.00  0.86           C  
ATOM   6142  OD1 ASN A 764      36.425  37.370  -6.604  1.00  0.86           O  
ATOM   6143  ND2 ASN A 764      35.584  39.345  -5.953  1.00  0.86           N  
ATOM   6144  N   MET A 765      33.078  36.811  -2.048  1.00  0.88           N  
ATOM   6145  CA  MET A 765      31.949  36.359  -1.248  1.00  0.88           C  
ATOM   6146  C   MET A 765      31.174  37.490  -0.589  1.00  0.88           C  
ATOM   6147  O   MET A 765      29.971  37.610  -0.801  1.00  0.88           O  
ATOM   6148  CB  MET A 765      32.440  35.343  -0.190  1.00  0.88           C  
ATOM   6149  CG  MET A 765      31.341  34.702   0.691  1.00  0.88           C  
ATOM   6150  SD  MET A 765      30.790  35.686   2.120  1.00  0.88           S  
ATOM   6151  CE  MET A 765      32.328  35.583   3.071  1.00  0.88           C  
ATOM   6152  N   LEU A 766      31.846  38.410   0.140  1.00  0.91           N  
ATOM   6153  CA  LEU A 766      31.183  39.501   0.847  1.00  0.91           C  
ATOM   6154  C   LEU A 766      30.401  40.428  -0.076  1.00  0.91           C  
ATOM   6155  O   LEU A 766      29.273  40.826   0.202  1.00  0.91           O  
ATOM   6156  CB  LEU A 766      32.210  40.355   1.633  1.00  0.91           C  
ATOM   6157  CG  LEU A 766      32.867  39.656   2.841  1.00  0.91           C  
ATOM   6158  CD1 LEU A 766      34.009  40.524   3.385  1.00  0.91           C  
ATOM   6159  CD2 LEU A 766      31.859  39.358   3.957  1.00  0.91           C  
ATOM   6160  N   MET A 767      31.000  40.772  -1.228  1.00  0.88           N  
ATOM   6161  CA  MET A 767      30.384  41.569  -2.265  1.00  0.88           C  
ATOM   6162  C   MET A 767      29.261  40.889  -3.038  1.00  0.88           C  
ATOM   6163  O   MET A 767      28.289  41.549  -3.405  1.00  0.88           O  
ATOM   6164  CB  MET A 767      31.469  42.022  -3.270  1.00  0.88           C  
ATOM   6165  CG  MET A 767      32.574  42.903  -2.651  1.00  0.88           C  
ATOM   6166  SD  MET A 767      32.032  44.526  -2.069  1.00  0.88           S  
ATOM   6167  CE  MET A 767      31.759  45.282  -3.692  1.00  0.88           C  
ATOM   6168  N   HIS A 768      29.374  39.576  -3.351  1.00  0.85           N  
ATOM   6169  CA  HIS A 768      28.482  38.985  -4.347  1.00  0.85           C  
ATOM   6170  C   HIS A 768      27.727  37.725  -3.957  1.00  0.85           C  
ATOM   6171  O   HIS A 768      26.812  37.330  -4.674  1.00  0.85           O  
ATOM   6172  CB  HIS A 768      29.273  38.624  -5.628  1.00  0.85           C  
ATOM   6173  CG  HIS A 768      30.153  39.726  -6.143  1.00  0.85           C  
ATOM   6174  ND1 HIS A 768      29.613  40.948  -6.501  1.00  0.85           N  
ATOM   6175  CD2 HIS A 768      31.496  39.731  -6.347  1.00  0.85           C  
ATOM   6176  CE1 HIS A 768      30.634  41.670  -6.907  1.00  0.85           C  
ATOM   6177  NE2 HIS A 768      31.801  40.984  -6.837  1.00  0.85           N  
ATOM   6178  N   HIS A 769      28.045  37.045  -2.838  1.00  0.85           N  
ATOM   6179  CA  HIS A 769      27.339  35.809  -2.502  1.00  0.85           C  
ATOM   6180  C   HIS A 769      27.289  35.516  -1.019  1.00  0.85           C  
ATOM   6181  O   HIS A 769      27.138  34.373  -0.585  1.00  0.85           O  
ATOM   6182  CB  HIS A 769      27.821  34.575  -3.313  1.00  0.85           C  
ATOM   6183  CG  HIS A 769      29.291  34.271  -3.305  1.00  0.85           C  
ATOM   6184  ND1 HIS A 769      29.812  33.443  -2.334  1.00  0.85           N  
ATOM   6185  CD2 HIS A 769      30.246  34.563  -4.227  1.00  0.85           C  
ATOM   6186  CE1 HIS A 769      31.066  33.246  -2.673  1.00  0.85           C  
ATOM   6187  NE2 HIS A 769      31.387  33.903  -3.814  1.00  0.85           N  
ATOM   6188  N   ASP A 770      27.346  36.564  -0.188  1.00  0.92           N  
ATOM   6189  CA  ASP A 770      27.206  36.471   1.245  1.00  0.92           C  
ATOM   6190  C   ASP A 770      25.798  36.045   1.668  1.00  0.92           C  
ATOM   6191  O   ASP A 770      24.818  36.789   1.578  1.00  0.92           O  
ATOM   6192  CB  ASP A 770      27.641  37.822   1.860  1.00  0.92           C  
ATOM   6193  CG  ASP A 770      27.627  37.867   3.372  1.00  0.92           C  
ATOM   6194  OD1 ASP A 770      27.339  36.834   4.027  1.00  0.92           O  
ATOM   6195  OD2 ASP A 770      27.817  38.993   3.901  1.00  0.92           O  
ATOM   6196  N   ARG A 771      25.675  34.807   2.182  1.00  0.84           N  
ATOM   6197  CA  ARG A 771      24.419  34.280   2.671  1.00  0.84           C  
ATOM   6198  C   ARG A 771      24.054  34.862   4.029  1.00  0.84           C  
ATOM   6199  O   ARG A 771      22.893  34.849   4.444  1.00  0.84           O  
ATOM   6200  CB  ARG A 771      24.487  32.732   2.788  1.00  0.84           C  
ATOM   6201  CG  ARG A 771      24.737  32.007   1.448  1.00  0.84           C  
ATOM   6202  CD  ARG A 771      24.340  30.518   1.444  1.00  0.84           C  
ATOM   6203  NE  ARG A 771      25.204  29.820   2.448  1.00  0.84           N  
ATOM   6204  CZ  ARG A 771      24.851  28.837   3.294  1.00  0.84           C  
ATOM   6205  NH1 ARG A 771      23.630  28.323   3.381  1.00  0.84           N  
ATOM   6206  NH2 ARG A 771      25.797  28.350   4.090  1.00  0.84           N  
ATOM   6207  N   PHE A 772      25.047  35.417   4.745  1.00  0.91           N  
ATOM   6208  CA  PHE A 772      24.928  35.762   6.146  1.00  0.91           C  
ATOM   6209  C   PHE A 772      24.941  37.253   6.386  1.00  0.91           C  
ATOM   6210  O   PHE A 772      24.779  37.727   7.514  1.00  0.91           O  
ATOM   6211  CB  PHE A 772      26.069  35.067   6.916  1.00  0.91           C  
ATOM   6212  CG  PHE A 772      25.851  33.584   6.802  1.00  0.91           C  
ATOM   6213  CD1 PHE A 772      24.731  32.992   7.409  1.00  0.91           C  
ATOM   6214  CD2 PHE A 772      26.712  32.785   6.037  1.00  0.91           C  
ATOM   6215  CE1 PHE A 772      24.467  31.626   7.243  1.00  0.91           C  
ATOM   6216  CE2 PHE A 772      26.467  31.415   5.886  1.00  0.91           C  
ATOM   6217  CZ  PHE A 772      25.341  30.836   6.486  1.00  0.91           C  
ATOM   6218  N   LYS A 773      25.032  38.022   5.298  1.00  0.91           N  
ATOM   6219  CA  LYS A 773      24.717  39.427   5.203  1.00  0.91           C  
ATOM   6220  C   LYS A 773      25.522  40.308   6.145  1.00  0.91           C  
ATOM   6221  O   LYS A 773      24.985  41.039   6.978  1.00  0.91           O  
ATOM   6222  CB  LYS A 773      23.190  39.666   5.355  1.00  0.91           C  
ATOM   6223  CG  LYS A 773      22.292  38.759   4.485  1.00  0.91           C  
ATOM   6224  CD  LYS A 773      20.823  38.856   4.933  1.00  0.91           C  
ATOM   6225  CE  LYS A 773      19.789  38.160   4.038  1.00  0.91           C  
ATOM   6226  NZ  LYS A 773      19.995  36.701   3.986  1.00  0.91           N  
ATOM   6227  N   VAL A 774      26.858  40.240   6.058  1.00  0.97           N  
ATOM   6228  CA  VAL A 774      27.786  40.978   6.898  1.00  0.97           C  
ATOM   6229  C   VAL A 774      27.631  42.478   6.742  1.00  0.97           C  
ATOM   6230  O   VAL A 774      27.587  43.227   7.715  1.00  0.97           O  
ATOM   6231  CB  VAL A 774      29.225  40.569   6.589  1.00  0.97           C  
ATOM   6232  CG1 VAL A 774      30.235  41.402   7.397  1.00  0.97           C  
ATOM   6233  CG2 VAL A 774      29.404  39.078   6.929  1.00  0.97           C  
ATOM   6234  N   PHE A 775      27.498  42.961   5.493  1.00  0.94           N  
ATOM   6235  CA  PHE A 775      27.376  44.377   5.204  1.00  0.94           C  
ATOM   6236  C   PHE A 775      26.091  44.999   5.728  1.00  0.94           C  
ATOM   6237  O   PHE A 775      26.084  46.158   6.134  1.00  0.94           O  
ATOM   6238  CB  PHE A 775      27.481  44.660   3.688  1.00  0.94           C  
ATOM   6239  CG  PHE A 775      28.835  44.412   3.067  1.00  0.94           C  
ATOM   6240  CD1 PHE A 775      29.968  43.913   3.744  1.00  0.94           C  
ATOM   6241  CD2 PHE A 775      28.972  44.766   1.717  1.00  0.94           C  
ATOM   6242  CE1 PHE A 775      31.191  43.766   3.076  1.00  0.94           C  
ATOM   6243  CE2 PHE A 775      30.188  44.620   1.047  1.00  0.94           C  
ATOM   6244  CZ  PHE A 775      31.301  44.115   1.726  1.00  0.94           C  
ATOM   6245  N   ALA A 776      24.983  44.233   5.769  1.00  0.94           N  
ATOM   6246  CA  ALA A 776      23.716  44.684   6.315  1.00  0.94           C  
ATOM   6247  C   ALA A 776      23.768  45.098   7.786  1.00  0.94           C  
ATOM   6248  O   ALA A 776      23.143  46.075   8.189  1.00  0.94           O  
ATOM   6249  CB  ALA A 776      22.647  43.598   6.098  1.00  0.94           C  
ATOM   6250  N   ASP A 777      24.562  44.393   8.615  1.00  0.94           N  
ATOM   6251  CA  ASP A 777      24.704  44.740  10.017  1.00  0.94           C  
ATOM   6252  C   ASP A 777      25.930  45.599  10.308  1.00  0.94           C  
ATOM   6253  O   ASP A 777      26.146  45.984  11.456  1.00  0.94           O  
ATOM   6254  CB  ASP A 777      24.825  43.454  10.873  1.00  0.94           C  
ATOM   6255  CG  ASP A 777      23.474  42.813  11.103  1.00  0.94           C  
ATOM   6256  OD1 ASP A 777      22.441  43.509  11.043  1.00  0.94           O  
ATOM   6257  OD2 ASP A 777      23.460  41.593  11.410  1.00  0.94           O  
ATOM   6258  N   TYR A 778      26.763  45.956   9.305  1.00  0.94           N  
ATOM   6259  CA  TYR A 778      28.032  46.643   9.532  1.00  0.94           C  
ATOM   6260  C   TYR A 778      27.911  47.978  10.267  1.00  0.94           C  
ATOM   6261  O   TYR A 778      28.610  48.217  11.253  1.00  0.94           O  
ATOM   6262  CB  TYR A 778      28.767  46.828   8.163  1.00  0.94           C  
ATOM   6263  CG  TYR A 778      29.998  47.704   8.238  1.00  0.94           C  
ATOM   6264  CD1 TYR A 778      31.250  47.203   8.631  1.00  0.94           C  
ATOM   6265  CD2 TYR A 778      29.863  49.081   7.993  1.00  0.94           C  
ATOM   6266  CE1 TYR A 778      32.339  48.076   8.801  1.00  0.94           C  
ATOM   6267  CE2 TYR A 778      30.938  49.955   8.175  1.00  0.94           C  
ATOM   6268  CZ  TYR A 778      32.172  49.451   8.585  1.00  0.94           C  
ATOM   6269  OH  TYR A 778      33.231  50.348   8.790  1.00  0.94           O  
ATOM   6270  N   GLU A 779      27.007  48.873   9.825  1.00  0.88           N  
ATOM   6271  CA  GLU A 779      26.872  50.183  10.439  1.00  0.88           C  
ATOM   6272  C   GLU A 779      26.404  50.119  11.876  1.00  0.88           C  
ATOM   6273  O   GLU A 779      27.009  50.697  12.777  1.00  0.88           O  
ATOM   6274  CB  GLU A 779      25.875  51.048   9.644  1.00  0.88           C  
ATOM   6275  CG  GLU A 779      26.545  51.818   8.491  1.00  0.88           C  
ATOM   6276  CD  GLU A 779      25.538  52.726   7.797  1.00  0.88           C  
ATOM   6277  OE1 GLU A 779      24.528  52.189   7.277  1.00  0.88           O  
ATOM   6278  OE2 GLU A 779      25.784  53.958   7.788  1.00  0.88           O  
ATOM   6279  N   ALA A 780      25.348  49.329  12.130  1.00  0.93           N  
ATOM   6280  CA  ALA A 780      24.812  49.119  13.452  1.00  0.93           C  
ATOM   6281  C   ALA A 780      25.797  48.441  14.394  1.00  0.93           C  
ATOM   6282  O   ALA A 780      25.910  48.804  15.562  1.00  0.93           O  
ATOM   6283  CB  ALA A 780      23.502  48.323  13.332  1.00  0.93           C  
ATOM   6284  N   TYR A 781      26.581  47.465  13.894  1.00  0.93           N  
ATOM   6285  CA  TYR A 781      27.664  46.853  14.641  1.00  0.93           C  
ATOM   6286  C   TYR A 781      28.751  47.845  15.048  1.00  0.93           C  
ATOM   6287  O   TYR A 781      29.161  47.892  16.205  1.00  0.93           O  
ATOM   6288  CB  TYR A 781      28.285  45.719  13.780  1.00  0.93           C  
ATOM   6289  CG  TYR A 781      29.362  44.941  14.493  1.00  0.93           C  
ATOM   6290  CD1 TYR A 781      29.164  44.433  15.790  1.00  0.93           C  
ATOM   6291  CD2 TYR A 781      30.601  44.734  13.867  1.00  0.93           C  
ATOM   6292  CE1 TYR A 781      30.191  43.746  16.452  1.00  0.93           C  
ATOM   6293  CE2 TYR A 781      31.620  44.035  14.524  1.00  0.93           C  
ATOM   6294  CZ  TYR A 781      31.420  43.558  15.817  1.00  0.93           C  
ATOM   6295  OH  TYR A 781      32.471  42.919  16.490  1.00  0.93           O  
ATOM   6296  N   MET A 782      29.210  48.710  14.118  1.00  0.89           N  
ATOM   6297  CA  MET A 782      30.187  49.745  14.418  1.00  0.89           C  
ATOM   6298  C   MET A 782      29.688  50.747  15.447  1.00  0.89           C  
ATOM   6299  O   MET A 782      30.401  51.103  16.388  1.00  0.89           O  
ATOM   6300  CB  MET A 782      30.613  50.463  13.110  1.00  0.89           C  
ATOM   6301  CG  MET A 782      31.587  51.649  13.281  1.00  0.89           C  
ATOM   6302  SD  MET A 782      30.779  53.251  13.639  1.00  0.89           S  
ATOM   6303  CE  MET A 782      30.182  53.579  11.958  1.00  0.89           C  
ATOM   6304  N   GLN A 783      28.426  51.199  15.316  1.00  0.84           N  
ATOM   6305  CA  GLN A 783      27.796  52.088  16.273  1.00  0.84           C  
ATOM   6306  C   GLN A 783      27.659  51.464  17.653  1.00  0.84           C  
ATOM   6307  O   GLN A 783      27.972  52.086  18.665  1.00  0.84           O  
ATOM   6308  CB  GLN A 783      26.399  52.507  15.759  1.00  0.84           C  
ATOM   6309  CG  GLN A 783      26.443  53.440  14.525  1.00  0.84           C  
ATOM   6310  CD  GLN A 783      25.030  53.716  14.006  1.00  0.84           C  
ATOM   6311  OE1 GLN A 783      24.096  52.944  14.214  1.00  0.84           O  
ATOM   6312  NE2 GLN A 783      24.853  54.865  13.312  1.00  0.84           N  
ATOM   6313  N   CYS A 784      27.249  50.186  17.719  1.00  0.91           N  
ATOM   6314  CA  CYS A 784      27.168  49.428  18.952  1.00  0.91           C  
ATOM   6315  C   CYS A 784      28.517  49.250  19.637  1.00  0.91           C  
ATOM   6316  O   CYS A 784      28.657  49.409  20.845  1.00  0.91           O  
ATOM   6317  CB  CYS A 784      26.536  48.054  18.662  1.00  0.91           C  
ATOM   6318  SG  CYS A 784      25.963  47.244  20.183  1.00  0.91           S  
ATOM   6319  N   GLN A 785      29.580  48.976  18.862  1.00  0.90           N  
ATOM   6320  CA  GLN A 785      30.940  48.929  19.369  1.00  0.90           C  
ATOM   6321  C   GLN A 785      31.421  50.235  19.983  1.00  0.90           C  
ATOM   6322  O   GLN A 785      32.086  50.234  21.017  1.00  0.90           O  
ATOM   6323  CB  GLN A 785      31.923  48.488  18.262  1.00  0.90           C  
ATOM   6324  CG  GLN A 785      31.819  46.984  17.922  1.00  0.90           C  
ATOM   6325  CD  GLN A 785      32.514  46.132  18.983  1.00  0.90           C  
ATOM   6326  OE1 GLN A 785      32.578  46.447  20.174  1.00  0.90           O  
ATOM   6327  NE2 GLN A 785      33.131  45.018  18.541  1.00  0.90           N  
ATOM   6328  N   ALA A 786      31.056  51.389  19.391  1.00  0.89           N  
ATOM   6329  CA  ALA A 786      31.319  52.686  19.979  1.00  0.89           C  
ATOM   6330  C   ALA A 786      30.637  52.873  21.331  1.00  0.89           C  
ATOM   6331  O   ALA A 786      31.249  53.356  22.282  1.00  0.89           O  
ATOM   6332  CB  ALA A 786      30.883  53.789  18.998  1.00  0.89           C  
ATOM   6333  N   GLN A 787      29.373  52.420  21.464  1.00  0.82           N  
ATOM   6334  CA  GLN A 787      28.644  52.392  22.724  1.00  0.82           C  
ATOM   6335  C   GLN A 787      29.329  51.531  23.792  1.00  0.82           C  
ATOM   6336  O   GLN A 787      29.394  51.903  24.965  1.00  0.82           O  
ATOM   6337  CB  GLN A 787      27.188  51.896  22.511  1.00  0.82           C  
ATOM   6338  CG  GLN A 787      26.326  52.810  21.603  1.00  0.82           C  
ATOM   6339  CD  GLN A 787      24.958  52.182  21.317  1.00  0.82           C  
ATOM   6340  OE1 GLN A 787      24.783  50.965  21.294  1.00  0.82           O  
ATOM   6341  NE2 GLN A 787      23.935  53.033  21.071  1.00  0.82           N  
ATOM   6342  N   VAL A 788      29.907  50.370  23.407  1.00  0.90           N  
ATOM   6343  CA  VAL A 788      30.715  49.544  24.299  1.00  0.90           C  
ATOM   6344  C   VAL A 788      31.938  50.269  24.851  1.00  0.90           C  
ATOM   6345  O   VAL A 788      32.160  50.302  26.064  1.00  0.90           O  
ATOM   6346  CB  VAL A 788      31.197  48.270  23.605  1.00  0.90           C  
ATOM   6347  CG1 VAL A 788      32.085  47.443  24.550  1.00  0.90           C  
ATOM   6348  CG2 VAL A 788      30.001  47.400  23.198  1.00  0.90           C  
ATOM   6349  N   ASP A 789      32.738  50.928  23.985  1.00  0.89           N  
ATOM   6350  CA  ASP A 789      33.901  51.692  24.412  1.00  0.89           C  
ATOM   6351  C   ASP A 789      33.534  52.860  25.326  1.00  0.89           C  
ATOM   6352  O   ASP A 789      34.222  53.150  26.302  1.00  0.89           O  
ATOM   6353  CB  ASP A 789      34.696  52.247  23.205  1.00  0.89           C  
ATOM   6354  CG  ASP A 789      35.483  51.160  22.517  1.00  0.89           C  
ATOM   6355  OD1 ASP A 789      35.498  51.142  21.263  1.00  0.89           O  
ATOM   6356  OD2 ASP A 789      36.064  50.278  23.197  1.00  0.89           O  
ATOM   6357  N   GLN A 790      32.413  53.555  25.049  1.00  0.81           N  
ATOM   6358  CA  GLN A 790      31.890  54.613  25.896  1.00  0.81           C  
ATOM   6359  C   GLN A 790      31.545  54.164  27.310  1.00  0.81           C  
ATOM   6360  O   GLN A 790      31.915  54.829  28.276  1.00  0.81           O  
ATOM   6361  CB  GLN A 790      30.617  55.222  25.264  1.00  0.81           C  
ATOM   6362  CG  GLN A 790      30.882  56.049  23.985  1.00  0.81           C  
ATOM   6363  CD  GLN A 790      29.564  56.453  23.319  1.00  0.81           C  
ATOM   6364  OE1 GLN A 790      28.492  55.907  23.572  1.00  0.81           O  
ATOM   6365  NE2 GLN A 790      29.630  57.466  22.424  1.00  0.81           N  
ATOM   6366  N   LEU A 791      30.873  53.006  27.484  1.00  0.85           N  
ATOM   6367  CA  LEU A 791      30.626  52.449  28.806  1.00  0.85           C  
ATOM   6368  C   LEU A 791      31.907  52.041  29.520  1.00  0.85           C  
ATOM   6369  O   LEU A 791      32.052  52.244  30.722  1.00  0.85           O  
ATOM   6370  CB  LEU A 791      29.638  51.260  28.761  1.00  0.85           C  
ATOM   6371  CG  LEU A 791      29.257  50.680  30.145  1.00  0.85           C  
ATOM   6372  CD1 LEU A 791      28.531  51.692  31.042  1.00  0.85           C  
ATOM   6373  CD2 LEU A 791      28.409  49.414  29.994  1.00  0.85           C  
ATOM   6374  N   TYR A 792      32.901  51.494  28.791  1.00  0.87           N  
ATOM   6375  CA  TYR A 792      34.175  51.074  29.361  1.00  0.87           C  
ATOM   6376  C   TYR A 792      34.994  52.236  29.937  1.00  0.87           C  
ATOM   6377  O   TYR A 792      35.806  52.072  30.843  1.00  0.87           O  
ATOM   6378  CB  TYR A 792      34.986  50.294  28.293  1.00  0.87           C  
ATOM   6379  CG  TYR A 792      36.062  49.441  28.925  1.00  0.87           C  
ATOM   6380  CD1 TYR A 792      35.751  48.214  29.536  1.00  0.87           C  
ATOM   6381  CD2 TYR A 792      37.395  49.877  28.933  1.00  0.87           C  
ATOM   6382  CE1 TYR A 792      36.750  47.447  30.159  1.00  0.87           C  
ATOM   6383  CE2 TYR A 792      38.398  49.113  29.546  1.00  0.87           C  
ATOM   6384  CZ  TYR A 792      38.076  47.900  30.164  1.00  0.87           C  
ATOM   6385  OH  TYR A 792      39.109  47.159  30.778  1.00  0.87           O  
ATOM   6386  N   ARG A 793      34.737  53.478  29.475  1.00  0.78           N  
ATOM   6387  CA  ARG A 793      35.296  54.677  30.076  1.00  0.78           C  
ATOM   6388  C   ARG A 793      34.738  54.988  31.460  1.00  0.78           C  
ATOM   6389  O   ARG A 793      35.285  55.827  32.172  1.00  0.78           O  
ATOM   6390  CB  ARG A 793      35.024  55.925  29.205  1.00  0.78           C  
ATOM   6391  CG  ARG A 793      35.678  55.871  27.816  1.00  0.78           C  
ATOM   6392  CD  ARG A 793      35.313  57.085  26.964  1.00  0.78           C  
ATOM   6393  NE  ARG A 793      35.984  56.905  25.641  1.00  0.78           N  
ATOM   6394  CZ  ARG A 793      35.897  57.785  24.636  1.00  0.78           C  
ATOM   6395  NH1 ARG A 793      36.579  57.561  23.515  1.00  0.78           N  
ATOM   6396  NH2 ARG A 793      35.153  58.881  24.738  1.00  0.78           N  
ATOM   6397  N   ASN A 794      33.648  54.323  31.891  1.00  0.80           N  
ATOM   6398  CA  ASN A 794      33.143  54.425  33.243  1.00  0.80           C  
ATOM   6399  C   ASN A 794      33.284  53.063  33.933  1.00  0.80           C  
ATOM   6400  O   ASN A 794      32.368  52.240  33.847  1.00  0.80           O  
ATOM   6401  CB  ASN A 794      31.659  54.870  33.161  1.00  0.80           C  
ATOM   6402  CG  ASN A 794      31.108  55.324  34.509  1.00  0.80           C  
ATOM   6403  OD1 ASN A 794      31.492  54.857  35.584  1.00  0.80           O  
ATOM   6404  ND2 ASN A 794      30.146  56.276  34.454  1.00  0.80           N  
ATOM   6405  N   PRO A 795      34.371  52.778  34.665  1.00  0.84           N  
ATOM   6406  CA  PRO A 795      34.603  51.450  35.226  1.00  0.84           C  
ATOM   6407  C   PRO A 795      33.593  51.036  36.261  1.00  0.84           C  
ATOM   6408  O   PRO A 795      33.291  49.852  36.381  1.00  0.84           O  
ATOM   6409  CB  PRO A 795      36.001  51.553  35.850  1.00  0.84           C  
ATOM   6410  CG  PRO A 795      36.722  52.533  34.933  1.00  0.84           C  
ATOM   6411  CD  PRO A 795      35.626  53.539  34.591  1.00  0.84           C  
ATOM   6412  N   LYS A 796      33.069  51.995  37.045  1.00  0.79           N  
ATOM   6413  CA  LYS A 796      32.053  51.700  38.031  1.00  0.79           C  
ATOM   6414  C   LYS A 796      30.761  51.235  37.390  1.00  0.79           C  
ATOM   6415  O   LYS A 796      30.223  50.190  37.746  1.00  0.79           O  
ATOM   6416  CB  LYS A 796      31.743  52.959  38.876  1.00  0.79           C  
ATOM   6417  CG  LYS A 796      32.886  53.379  39.812  1.00  0.79           C  
ATOM   6418  CD  LYS A 796      32.528  54.633  40.630  1.00  0.79           C  
ATOM   6419  CE  LYS A 796      33.632  55.040  41.611  1.00  0.79           C  
ATOM   6420  NZ  LYS A 796      33.218  56.240  42.372  1.00  0.79           N  
ATOM   6421  N   GLU A 797      30.262  51.975  36.383  1.00  0.80           N  
ATOM   6422  CA  GLU A 797      29.054  51.595  35.683  1.00  0.80           C  
ATOM   6423  C   GLU A 797      29.212  50.353  34.826  1.00  0.80           C  
ATOM   6424  O   GLU A 797      28.315  49.516  34.799  1.00  0.80           O  
ATOM   6425  CB  GLU A 797      28.432  52.770  34.901  1.00  0.80           C  
ATOM   6426  CG  GLU A 797      27.882  53.893  35.818  1.00  0.80           C  
ATOM   6427  CD  GLU A 797      26.964  53.405  36.930  1.00  0.80           C  
ATOM   6428  OE1 GLU A 797      25.973  52.675  36.675  1.00  0.80           O  
ATOM   6429  OE2 GLU A 797      27.273  53.756  38.101  1.00  0.80           O  
ATOM   6430  N   TRP A 798      30.371  50.139  34.159  1.00  0.86           N  
ATOM   6431  CA  TRP A 798      30.656  48.881  33.472  1.00  0.86           C  
ATOM   6432  C   TRP A 798      30.542  47.672  34.399  1.00  0.86           C  
ATOM   6433  O   TRP A 798      29.825  46.717  34.107  1.00  0.86           O  
ATOM   6434  CB  TRP A 798      32.082  48.904  32.839  1.00  0.86           C  
ATOM   6435  CG  TRP A 798      32.510  47.620  32.120  1.00  0.86           C  
ATOM   6436  CD1 TRP A 798      33.013  46.467  32.668  1.00  0.86           C  
ATOM   6437  CD2 TRP A 798      32.404  47.374  30.704  1.00  0.86           C  
ATOM   6438  NE1 TRP A 798      33.202  45.512  31.691  1.00  0.86           N  
ATOM   6439  CE2 TRP A 798      32.833  46.052  30.482  1.00  0.86           C  
ATOM   6440  CE3 TRP A 798      31.986  48.177  29.646  1.00  0.86           C  
ATOM   6441  CZ2 TRP A 798      32.844  45.511  29.206  1.00  0.86           C  
ATOM   6442  CZ3 TRP A 798      32.025  47.640  28.349  1.00  0.86           C  
ATOM   6443  CH2 TRP A 798      32.446  46.320  28.131  1.00  0.86           C  
ATOM   6444  N   THR A 799      31.187  47.710  35.578  1.00  0.88           N  
ATOM   6445  CA  THR A 799      31.086  46.648  36.572  1.00  0.88           C  
ATOM   6446  C   THR A 799      29.695  46.477  37.158  1.00  0.88           C  
ATOM   6447  O   THR A 799      29.230  45.357  37.353  1.00  0.88           O  
ATOM   6448  CB  THR A 799      32.110  46.784  37.680  1.00  0.88           C  
ATOM   6449  OG1 THR A 799      33.410  46.735  37.110  1.00  0.88           O  
ATOM   6450  CG2 THR A 799      32.024  45.607  38.659  1.00  0.88           C  
ATOM   6451  N   LYS A 800      28.936  47.559  37.424  1.00  0.86           N  
ATOM   6452  CA  LYS A 800      27.542  47.430  37.837  1.00  0.86           C  
ATOM   6453  C   LYS A 800      26.671  46.737  36.790  1.00  0.86           C  
ATOM   6454  O   LYS A 800      25.838  45.892  37.115  1.00  0.86           O  
ATOM   6455  CB  LYS A 800      26.915  48.794  38.190  1.00  0.86           C  
ATOM   6456  CG  LYS A 800      27.502  49.443  39.453  1.00  0.86           C  
ATOM   6457  CD  LYS A 800      26.868  50.820  39.684  1.00  0.86           C  
ATOM   6458  CE  LYS A 800      27.641  51.724  40.641  1.00  0.86           C  
ATOM   6459  NZ  LYS A 800      27.064  53.069  40.555  1.00  0.86           N  
ATOM   6460  N   LYS A 801      26.870  47.035  35.491  1.00  0.89           N  
ATOM   6461  CA  LYS A 801      26.247  46.304  34.400  1.00  0.89           C  
ATOM   6462  C   LYS A 801      26.665  44.832  34.356  1.00  0.89           C  
ATOM   6463  O   LYS A 801      25.835  43.953  34.124  1.00  0.89           O  
ATOM   6464  CB  LYS A 801      26.509  46.995  33.038  1.00  0.89           C  
ATOM   6465  CG  LYS A 801      25.967  48.438  32.934  1.00  0.89           C  
ATOM   6466  CD  LYS A 801      24.440  48.533  32.972  1.00  0.89           C  
ATOM   6467  CE  LYS A 801      23.881  49.942  32.754  1.00  0.89           C  
ATOM   6468  NZ  LYS A 801      22.403  49.868  32.740  1.00  0.89           N  
ATOM   6469  N   VAL A 802      27.950  44.517  34.641  1.00  0.94           N  
ATOM   6470  CA  VAL A 802      28.445  43.149  34.783  1.00  0.94           C  
ATOM   6471  C   VAL A 802      27.712  42.391  35.885  1.00  0.94           C  
ATOM   6472  O   VAL A 802      27.246  41.272  35.677  1.00  0.94           O  
ATOM   6473  CB  VAL A 802      29.950  43.111  35.056  1.00  0.94           C  
ATOM   6474  CG1 VAL A 802      30.415  41.696  35.427  1.00  0.94           C  
ATOM   6475  CG2 VAL A 802      30.723  43.554  33.802  1.00  0.94           C  
ATOM   6476  N   ILE A 803      27.514  43.011  37.067  1.00  0.91           N  
ATOM   6477  CA  ILE A 803      26.779  42.430  38.190  1.00  0.91           C  
ATOM   6478  C   ILE A 803      25.344  42.089  37.811  1.00  0.91           C  
ATOM   6479  O   ILE A 803      24.851  40.999  38.097  1.00  0.91           O  
ATOM   6480  CB  ILE A 803      26.807  43.357  39.407  1.00  0.91           C  
ATOM   6481  CG1 ILE A 803      28.257  43.514  39.922  1.00  0.91           C  
ATOM   6482  CG2 ILE A 803      25.892  42.818  40.531  1.00  0.91           C  
ATOM   6483  CD1 ILE A 803      28.430  44.670  40.914  1.00  0.91           C  
ATOM   6484  N   ARG A 804      24.666  42.991  37.073  1.00  0.86           N  
ATOM   6485  CA  ARG A 804      23.341  42.751  36.521  1.00  0.86           C  
ATOM   6486  C   ARG A 804      23.283  41.571  35.549  1.00  0.86           C  
ATOM   6487  O   ARG A 804      22.296  40.845  35.501  1.00  0.86           O  
ATOM   6488  CB  ARG A 804      22.776  44.034  35.853  1.00  0.86           C  
ATOM   6489  CG  ARG A 804      22.579  45.197  36.850  1.00  0.86           C  
ATOM   6490  CD  ARG A 804      21.961  46.450  36.214  1.00  0.86           C  
ATOM   6491  NE  ARG A 804      22.009  47.591  37.197  1.00  0.86           N  
ATOM   6492  CZ  ARG A 804      21.183  47.740  38.243  1.00  0.86           C  
ATOM   6493  NH1 ARG A 804      20.294  46.813  38.577  1.00  0.86           N  
ATOM   6494  NH2 ARG A 804      21.267  48.846  38.981  1.00  0.86           N  
ATOM   6495  N   ASN A 805      24.346  41.327  34.759  1.00  0.93           N  
ATOM   6496  CA  ASN A 805      24.442  40.140  33.922  1.00  0.93           C  
ATOM   6497  C   ASN A 805      24.701  38.844  34.694  1.00  0.93           C  
ATOM   6498  O   ASN A 805      24.015  37.845  34.489  1.00  0.93           O  
ATOM   6499  CB  ASN A 805      25.575  40.318  32.882  1.00  0.93           C  
ATOM   6500  CG  ASN A 805      25.079  41.074  31.658  1.00  0.93           C  
ATOM   6501  OD1 ASN A 805      24.803  40.468  30.624  1.00  0.93           O  
ATOM   6502  ND2 ASN A 805      24.982  42.418  31.753  1.00  0.93           N  
ATOM   6503  N   ILE A 806      25.678  38.824  35.630  1.00  0.94           N  
ATOM   6504  CA  ILE A 806      26.035  37.635  36.411  1.00  0.94           C  
ATOM   6505  C   ILE A 806      24.874  37.157  37.262  1.00  0.94           C  
ATOM   6506  O   ILE A 806      24.560  35.972  37.336  1.00  0.94           O  
ATOM   6507  CB  ILE A 806      27.241  37.888  37.320  1.00  0.94           C  
ATOM   6508  CG1 ILE A 806      28.495  38.193  36.473  1.00  0.94           C  
ATOM   6509  CG2 ILE A 806      27.522  36.671  38.238  1.00  0.94           C  
ATOM   6510  CD1 ILE A 806      29.665  38.706  37.320  1.00  0.94           C  
ATOM   6511  N   ALA A 807      24.160  38.096  37.897  1.00  0.93           N  
ATOM   6512  CA  ALA A 807      23.067  37.792  38.787  1.00  0.93           C  
ATOM   6513  C   ALA A 807      21.832  37.241  38.086  1.00  0.93           C  
ATOM   6514  O   ALA A 807      20.987  36.575  38.679  1.00  0.93           O  
ATOM   6515  CB  ALA A 807      22.712  39.083  39.525  1.00  0.93           C  
ATOM   6516  N   CYS A 808      21.721  37.467  36.772  1.00  0.92           N  
ATOM   6517  CA  CYS A 808      20.600  36.994  35.988  1.00  0.92           C  
ATOM   6518  C   CYS A 808      21.000  35.874  35.050  1.00  0.92           C  
ATOM   6519  O   CYS A 808      20.282  35.522  34.118  1.00  0.92           O  
ATOM   6520  CB  CYS A 808      19.965  38.146  35.192  1.00  0.92           C  
ATOM   6521  SG  CYS A 808      19.274  39.423  36.308  1.00  0.92           S  
ATOM   6522  N   SER A 809      22.146  35.211  35.293  1.00  0.94           N  
ATOM   6523  CA  SER A 809      22.596  34.126  34.430  1.00  0.94           C  
ATOM   6524  C   SER A 809      22.066  32.778  34.874  1.00  0.94           C  
ATOM   6525  O   SER A 809      22.263  31.763  34.209  1.00  0.94           O  
ATOM   6526  CB  SER A 809      24.145  34.056  34.359  1.00  0.94           C  
ATOM   6527  OG  SER A 809      24.731  33.638  35.591  1.00  0.94           O  
ATOM   6528  N   GLY A 810      21.319  32.751  35.998  1.00  0.94           N  
ATOM   6529  CA  GLY A 810      20.855  31.542  36.667  1.00  0.94           C  
ATOM   6530  C   GLY A 810      19.995  30.602  35.874  1.00  0.94           C  
ATOM   6531  O   GLY A 810      20.011  29.391  36.087  1.00  0.94           O  
ATOM   6532  N   LYS A 811      19.241  31.126  34.896  1.00  0.90           N  
ATOM   6533  CA  LYS A 811      18.486  30.330  33.950  1.00  0.90           C  
ATOM   6534  C   LYS A 811      19.362  29.435  33.084  1.00  0.90           C  
ATOM   6535  O   LYS A 811      18.957  28.364  32.636  1.00  0.90           O  
ATOM   6536  CB  LYS A 811      17.654  31.266  33.044  1.00  0.90           C  
ATOM   6537  CG  LYS A 811      16.974  30.559  31.861  1.00  0.90           C  
ATOM   6538  CD  LYS A 811      16.039  31.481  31.077  1.00  0.90           C  
ATOM   6539  CE  LYS A 811      15.443  30.774  29.865  1.00  0.90           C  
ATOM   6540  NZ  LYS A 811      14.511  31.654  29.142  1.00  0.90           N  
ATOM   6541  N   PHE A 812      20.610  29.834  32.825  1.00  0.95           N  
ATOM   6542  CA  PHE A 812      21.461  29.181  31.852  1.00  0.95           C  
ATOM   6543  C   PHE A 812      22.358  28.127  32.459  1.00  0.95           C  
ATOM   6544  O   PHE A 812      23.270  27.614  31.815  1.00  0.95           O  
ATOM   6545  CB  PHE A 812      22.298  30.224  31.085  1.00  0.95           C  
ATOM   6546  CG  PHE A 812      21.348  31.189  30.435  1.00  0.95           C  
ATOM   6547  CD1 PHE A 812      20.604  30.820  29.302  1.00  0.95           C  
ATOM   6548  CD2 PHE A 812      21.112  32.435  31.029  1.00  0.95           C  
ATOM   6549  CE1 PHE A 812      19.618  31.677  28.793  1.00  0.95           C  
ATOM   6550  CE2 PHE A 812      20.133  33.295  30.528  1.00  0.95           C  
ATOM   6551  CZ  PHE A 812      19.378  32.907  29.418  1.00  0.95           C  
ATOM   6552  N   SER A 813      22.082  27.703  33.703  1.00  0.95           N  
ATOM   6553  CA  SER A 813      22.582  26.426  34.187  1.00  0.95           C  
ATOM   6554  C   SER A 813      22.045  25.245  33.391  1.00  0.95           C  
ATOM   6555  O   SER A 813      20.854  25.159  33.090  1.00  0.95           O  
ATOM   6556  CB  SER A 813      22.230  26.174  35.674  1.00  0.95           C  
ATOM   6557  OG  SER A 813      22.763  24.922  36.118  1.00  0.95           O  
ATOM   6558  N   SER A 814      22.904  24.253  33.090  1.00  0.96           N  
ATOM   6559  CA  SER A 814      22.470  23.002  32.490  1.00  0.96           C  
ATOM   6560  C   SER A 814      21.710  22.125  33.449  1.00  0.96           C  
ATOM   6561  O   SER A 814      20.994  21.224  33.019  1.00  0.96           O  
ATOM   6562  CB  SER A 814      23.581  22.181  31.776  1.00  0.96           C  
ATOM   6563  OG  SER A 814      24.752  21.975  32.564  1.00  0.96           O  
ATOM   6564  N   ASP A 815      21.760  22.397  34.770  1.00  0.94           N  
ATOM   6565  CA  ASP A 815      20.870  21.749  35.715  1.00  0.94           C  
ATOM   6566  C   ASP A 815      19.404  22.093  35.444  1.00  0.94           C  
ATOM   6567  O   ASP A 815      18.529  21.232  35.439  1.00  0.94           O  
ATOM   6568  CB  ASP A 815      21.192  22.127  37.176  1.00  0.94           C  
ATOM   6569  CG  ASP A 815      22.668  21.937  37.458  1.00  0.94           C  
ATOM   6570  OD1 ASP A 815      23.245  20.889  37.065  1.00  0.94           O  
ATOM   6571  OD2 ASP A 815      23.285  22.859  38.054  1.00  0.94           O  
ATOM   6572  N   ARG A 816      19.097  23.377  35.148  1.00  0.89           N  
ATOM   6573  CA  ARG A 816      17.757  23.803  34.757  1.00  0.89           C  
ATOM   6574  C   ARG A 816      17.306  23.135  33.473  1.00  0.89           C  
ATOM   6575  O   ARG A 816      16.204  22.598  33.392  1.00  0.89           O  
ATOM   6576  CB  ARG A 816      17.698  25.351  34.622  1.00  0.89           C  
ATOM   6577  CG  ARG A 816      16.315  25.978  34.301  1.00  0.89           C  
ATOM   6578  CD  ARG A 816      15.868  25.969  32.825  1.00  0.89           C  
ATOM   6579  NE  ARG A 816      16.908  26.685  32.024  1.00  0.89           N  
ATOM   6580  CZ  ARG A 816      17.177  26.419  30.741  1.00  0.89           C  
ATOM   6581  NH1 ARG A 816      16.438  25.621  29.990  1.00  0.89           N  
ATOM   6582  NH2 ARG A 816      18.250  26.990  30.192  1.00  0.89           N  
ATOM   6583  N   THR A 817      18.188  23.093  32.458  1.00  0.96           N  
ATOM   6584  CA  THR A 817      17.931  22.443  31.180  1.00  0.96           C  
ATOM   6585  C   THR A 817      17.620  20.965  31.320  1.00  0.96           C  
ATOM   6586  O   THR A 817      16.610  20.464  30.832  1.00  0.96           O  
ATOM   6587  CB  THR A 817      19.150  22.582  30.273  1.00  0.96           C  
ATOM   6588  OG1 THR A 817      19.545  23.941  30.209  1.00  0.96           O  
ATOM   6589  CG2 THR A 817      18.850  22.118  28.846  1.00  0.96           C  
ATOM   6590  N   ILE A 818      18.455  20.217  32.067  1.00  0.95           N  
ATOM   6591  CA  ILE A 818      18.249  18.804  32.349  1.00  0.95           C  
ATOM   6592  C   ILE A 818      17.001  18.536  33.161  1.00  0.95           C  
ATOM   6593  O   ILE A 818      16.277  17.582  32.886  1.00  0.95           O  
ATOM   6594  CB  ILE A 818      19.486  18.188  32.986  1.00  0.95           C  
ATOM   6595  CG1 ILE A 818      20.632  18.068  31.952  1.00  0.95           C  
ATOM   6596  CG2 ILE A 818      19.195  16.807  33.608  1.00  0.95           C  
ATOM   6597  CD1 ILE A 818      20.324  17.193  30.730  1.00  0.95           C  
ATOM   6598  N   THR A 819      16.673  19.397  34.143  1.00  0.93           N  
ATOM   6599  CA  THR A 819      15.431  19.331  34.912  1.00  0.93           C  
ATOM   6600  C   THR A 819      14.207  19.360  34.017  1.00  0.93           C  
ATOM   6601  O   THR A 819      13.292  18.549  34.169  1.00  0.93           O  
ATOM   6602  CB  THR A 819      15.348  20.496  35.899  1.00  0.93           C  
ATOM   6603  OG1 THR A 819      16.191  20.258  37.015  1.00  0.93           O  
ATOM   6604  CG2 THR A 819      13.964  20.709  36.502  1.00  0.93           C  
ATOM   6605  N   GLU A 820      14.177  20.257  33.016  1.00  0.91           N  
ATOM   6606  CA  GLU A 820      13.135  20.268  32.010  1.00  0.91           C  
ATOM   6607  C   GLU A 820      13.132  19.030  31.109  1.00  0.91           C  
ATOM   6608  O   GLU A 820      12.084  18.433  30.874  1.00  0.91           O  
ATOM   6609  CB  GLU A 820      13.266  21.545  31.161  1.00  0.91           C  
ATOM   6610  CG  GLU A 820      13.004  22.848  31.953  1.00  0.91           C  
ATOM   6611  CD  GLU A 820      13.541  24.080  31.235  1.00  0.91           C  
ATOM   6612  OE1 GLU A 820      14.413  23.947  30.333  1.00  0.91           O  
ATOM   6613  OE2 GLU A 820      13.177  25.207  31.655  1.00  0.91           O  
ATOM   6614  N   TYR A 821      14.297  18.549  30.603  1.00  0.94           N  
ATOM   6615  CA  TYR A 821      14.377  17.309  29.812  1.00  0.94           C  
ATOM   6616  C   TYR A 821      13.845  16.103  30.593  1.00  0.94           C  
ATOM   6617  O   TYR A 821      13.075  15.285  30.090  1.00  0.94           O  
ATOM   6618  CB  TYR A 821      15.844  16.952  29.403  1.00  0.94           C  
ATOM   6619  CG  TYR A 821      16.310  17.542  28.091  1.00  0.94           C  
ATOM   6620  CD1 TYR A 821      16.093  16.865  26.875  1.00  0.94           C  
ATOM   6621  CD2 TYR A 821      17.076  18.716  28.067  1.00  0.94           C  
ATOM   6622  CE1 TYR A 821      16.608  17.369  25.667  1.00  0.94           C  
ATOM   6623  CE2 TYR A 821      17.585  19.225  26.865  1.00  0.94           C  
ATOM   6624  CZ  TYR A 821      17.356  18.551  25.665  1.00  0.94           C  
ATOM   6625  OH  TYR A 821      17.905  19.072  24.473  1.00  0.94           O  
ATOM   6626  N   ALA A 822      14.223  15.997  31.877  1.00  0.94           N  
ATOM   6627  CA  ALA A 822      13.780  14.965  32.780  1.00  0.94           C  
ATOM   6628  C   ALA A 822      12.280  14.937  33.006  1.00  0.94           C  
ATOM   6629  O   ALA A 822      11.639  13.904  32.826  1.00  0.94           O  
ATOM   6630  CB  ALA A 822      14.518  15.180  34.113  1.00  0.94           C  
ATOM   6631  N   ARG A 823      11.682  16.090  33.341  1.00  0.85           N  
ATOM   6632  CA  ARG A 823      10.259  16.194  33.592  1.00  0.85           C  
ATOM   6633  C   ARG A 823       9.380  16.155  32.345  1.00  0.85           C  
ATOM   6634  O   ARG A 823       8.360  15.472  32.320  1.00  0.85           O  
ATOM   6635  CB  ARG A 823       9.992  17.478  34.414  1.00  0.85           C  
ATOM   6636  CG  ARG A 823      10.478  17.350  35.875  1.00  0.85           C  
ATOM   6637  CD  ARG A 823      10.552  18.692  36.610  1.00  0.85           C  
ATOM   6638  NE  ARG A 823      10.919  18.417  38.035  1.00  0.85           N  
ATOM   6639  CZ  ARG A 823      11.453  19.308  38.877  1.00  0.85           C  
ATOM   6640  NH1 ARG A 823      11.639  20.578  38.528  1.00  0.85           N  
ATOM   6641  NH2 ARG A 823      11.809  18.934  40.098  1.00  0.85           N  
ATOM   6642  N   GLU A 824       9.749  16.875  31.269  1.00  0.89           N  
ATOM   6643  CA  GLU A 824       8.865  17.077  30.129  1.00  0.89           C  
ATOM   6644  C   GLU A 824       9.118  16.125  28.972  1.00  0.89           C  
ATOM   6645  O   GLU A 824       8.327  16.061  28.031  1.00  0.89           O  
ATOM   6646  CB  GLU A 824       9.070  18.512  29.591  1.00  0.89           C  
ATOM   6647  CG  GLU A 824       8.595  19.625  30.553  1.00  0.89           C  
ATOM   6648  CD  GLU A 824       9.241  20.953  30.193  1.00  0.89           C  
ATOM   6649  OE1 GLU A 824       9.176  21.341  28.995  1.00  0.89           O  
ATOM   6650  OE2 GLU A 824       9.872  21.553  31.092  1.00  0.89           O  
ATOM   6651  N   ILE A 825      10.208  15.333  29.004  1.00  0.93           N  
ATOM   6652  CA  ILE A 825      10.466  14.349  27.954  1.00  0.93           C  
ATOM   6653  C   ILE A 825      10.679  12.974  28.543  1.00  0.93           C  
ATOM   6654  O   ILE A 825      10.061  11.999  28.111  1.00  0.93           O  
ATOM   6655  CB  ILE A 825      11.685  14.707  27.090  1.00  0.93           C  
ATOM   6656  CG1 ILE A 825      11.431  16.027  26.327  1.00  0.93           C  
ATOM   6657  CG2 ILE A 825      12.005  13.571  26.087  1.00  0.93           C  
ATOM   6658  CD1 ILE A 825      12.639  16.545  25.538  1.00  0.93           C  
ATOM   6659  N   TRP A 826      11.581  12.831  29.534  1.00  0.90           N  
ATOM   6660  CA  TRP A 826      11.976  11.514  30.002  1.00  0.90           C  
ATOM   6661  C   TRP A 826      11.010  10.898  31.003  1.00  0.90           C  
ATOM   6662  O   TRP A 826      10.917   9.674  31.103  1.00  0.90           O  
ATOM   6663  CB  TRP A 826      13.430  11.546  30.554  1.00  0.90           C  
ATOM   6664  CG  TRP A 826      14.473  11.983  29.522  1.00  0.90           C  
ATOM   6665  CD1 TRP A 826      14.440  11.782  28.167  1.00  0.90           C  
ATOM   6666  CD2 TRP A 826      15.685  12.726  29.784  1.00  0.90           C  
ATOM   6667  NE1 TRP A 826      15.527  12.371  27.568  1.00  0.90           N  
ATOM   6668  CE2 TRP A 826      16.311  12.941  28.534  1.00  0.90           C  
ATOM   6669  CE3 TRP A 826      16.262  13.209  30.956  1.00  0.90           C  
ATOM   6670  CZ2 TRP A 826      17.508  13.633  28.442  1.00  0.90           C  
ATOM   6671  CZ3 TRP A 826      17.475  13.910  30.863  1.00  0.90           C  
ATOM   6672  CH2 TRP A 826      18.091  14.119  29.620  1.00  0.90           C  
ATOM   6673  N   GLY A 827      10.223  11.711  31.732  1.00  0.92           N  
ATOM   6674  CA  GLY A 827       9.266  11.212  32.716  1.00  0.92           C  
ATOM   6675  C   GLY A 827       9.907  10.794  34.010  1.00  0.92           C  
ATOM   6676  O   GLY A 827       9.421   9.900  34.696  1.00  0.92           O  
ATOM   6677  N   VAL A 828      11.036  11.424  34.366  1.00  0.92           N  
ATOM   6678  CA  VAL A 828      11.752  11.151  35.598  1.00  0.92           C  
ATOM   6679  C   VAL A 828      11.856  12.437  36.388  1.00  0.92           C  
ATOM   6680  O   VAL A 828      11.877  13.534  35.831  1.00  0.92           O  
ATOM   6681  CB  VAL A 828      13.146  10.561  35.407  1.00  0.92           C  
ATOM   6682  CG1 VAL A 828      13.053   9.261  34.591  1.00  0.92           C  
ATOM   6683  CG2 VAL A 828      14.093  11.545  34.709  1.00  0.92           C  
ATOM   6684  N   GLU A 829      11.928  12.337  37.724  1.00  0.85           N  
ATOM   6685  CA  GLU A 829      12.040  13.497  38.582  1.00  0.85           C  
ATOM   6686  C   GLU A 829      13.489  13.687  39.031  1.00  0.85           C  
ATOM   6687  O   GLU A 829      14.098  12.713  39.485  1.00  0.85           O  
ATOM   6688  CB  GLU A 829      11.091  13.338  39.792  1.00  0.85           C  
ATOM   6689  CG  GLU A 829      11.065  14.502  40.816  1.00  0.85           C  
ATOM   6690  CD  GLU A 829      10.642  15.856  40.263  1.00  0.85           C  
ATOM   6691  OE1 GLU A 829      10.356  16.014  39.049  1.00  0.85           O  
ATOM   6692  OE2 GLU A 829      10.661  16.830  41.058  1.00  0.85           O  
ATOM   6693  N   PRO A 830      14.116  14.863  38.889  1.00  0.92           N  
ATOM   6694  CA  PRO A 830      15.398  15.190  39.510  1.00  0.92           C  
ATOM   6695  C   PRO A 830      15.469  14.962  41.010  1.00  0.92           C  
ATOM   6696  O   PRO A 830      14.459  15.062  41.701  1.00  0.92           O  
ATOM   6697  CB  PRO A 830      15.611  16.674  39.156  1.00  0.92           C  
ATOM   6698  CG  PRO A 830      14.782  16.879  37.892  1.00  0.92           C  
ATOM   6699  CD  PRO A 830      13.565  16.020  38.185  1.00  0.92           C  
ATOM   6700  N   SER A 831      16.662  14.679  41.546  1.00  0.85           N  
ATOM   6701  CA  SER A 831      16.845  14.458  42.969  1.00  0.85           C  
ATOM   6702  C   SER A 831      18.157  15.061  43.403  1.00  0.85           C  
ATOM   6703  O   SER A 831      19.168  14.927  42.722  1.00  0.85           O  
ATOM   6704  CB  SER A 831      16.908  12.945  43.297  1.00  0.85           C  
ATOM   6705  OG  SER A 831      17.032  12.696  44.702  1.00  0.85           O  
ATOM   6706  N   ASP A 832      18.186  15.739  44.556  1.00  0.82           N  
ATOM   6707  CA  ASP A 832      19.384  16.325  45.113  1.00  0.82           C  
ATOM   6708  C   ASP A 832      19.918  15.516  46.296  1.00  0.82           C  
ATOM   6709  O   ASP A 832      21.001  15.773  46.827  1.00  0.82           O  
ATOM   6710  CB  ASP A 832      19.066  17.785  45.536  1.00  0.82           C  
ATOM   6711  CG  ASP A 832      17.884  17.916  46.497  1.00  0.82           C  
ATOM   6712  OD1 ASP A 832      17.674  19.056  46.975  1.00  0.82           O  
ATOM   6713  OD2 ASP A 832      17.175  16.906  46.755  1.00  0.82           O  
ATOM   6714  N   LEU A 833      19.167  14.485  46.728  1.00  0.77           N  
ATOM   6715  CA  LEU A 833      19.545  13.607  47.813  1.00  0.77           C  
ATOM   6716  C   LEU A 833      20.779  12.757  47.534  1.00  0.77           C  
ATOM   6717  O   LEU A 833      20.948  12.167  46.469  1.00  0.77           O  
ATOM   6718  CB  LEU A 833      18.388  12.671  48.238  1.00  0.77           C  
ATOM   6719  CG  LEU A 833      17.121  13.384  48.755  1.00  0.77           C  
ATOM   6720  CD1 LEU A 833      16.006  12.359  49.012  1.00  0.77           C  
ATOM   6721  CD2 LEU A 833      17.383  14.190  50.035  1.00  0.77           C  
ATOM   6722  N   GLN A 834      21.678  12.662  48.531  1.00  0.78           N  
ATOM   6723  CA  GLN A 834      22.951  11.993  48.386  1.00  0.78           C  
ATOM   6724  C   GLN A 834      22.968  10.522  48.788  1.00  0.78           C  
ATOM   6725  O   GLN A 834      22.290  10.076  49.712  1.00  0.78           O  
ATOM   6726  CB  GLN A 834      24.062  12.763  49.148  1.00  0.78           C  
ATOM   6727  CG  GLN A 834      23.930  12.783  50.689  1.00  0.78           C  
ATOM   6728  CD  GLN A 834      25.105  13.528  51.329  1.00  0.78           C  
ATOM   6729  OE1 GLN A 834      26.275  13.220  51.099  1.00  0.78           O  
ATOM   6730  NE2 GLN A 834      24.798  14.534  52.180  1.00  0.78           N  
ATOM   6731  N   ILE A 835      23.794   9.724  48.087  1.00  0.77           N  
ATOM   6732  CA  ILE A 835      24.114   8.346  48.434  1.00  0.77           C  
ATOM   6733  C   ILE A 835      25.106   8.357  49.618  1.00  0.77           C  
ATOM   6734  O   ILE A 835      25.884   9.311  49.691  1.00  0.77           O  
ATOM   6735  CB  ILE A 835      24.690   7.655  47.182  1.00  0.77           C  
ATOM   6736  CG1 ILE A 835      23.650   7.647  46.027  1.00  0.77           C  
ATOM   6737  CG2 ILE A 835      25.227   6.235  47.464  1.00  0.77           C  
ATOM   6738  CD1 ILE A 835      24.186   7.093  44.700  1.00  0.77           C  
ATOM   6739  N   PRO A 836      25.166   7.419  50.575  1.00  0.75           N  
ATOM   6740  CA  PRO A 836      26.162   7.430  51.654  1.00  0.75           C  
ATOM   6741  C   PRO A 836      27.584   7.109  51.153  1.00  0.75           C  
ATOM   6742  O   PRO A 836      27.693   6.273  50.250  1.00  0.75           O  
ATOM   6743  CB  PRO A 836      25.690   6.293  52.586  1.00  0.75           C  
ATOM   6744  CG  PRO A 836      24.957   5.337  51.647  1.00  0.75           C  
ATOM   6745  CD  PRO A 836      24.228   6.307  50.724  1.00  0.75           C  
ATOM   6746  N   PRO A 837      28.657   7.710  51.638  1.00  0.64           N  
ATOM   6747  CA  PRO A 837      30.013   7.216  51.439  1.00  0.64           C  
ATOM   6748  C   PRO A 837      30.513   6.427  52.649  1.00  0.64           C  
ATOM   6749  O   PRO A 837      29.873   6.498  53.733  1.00  0.64           O  
ATOM   6750  CB  PRO A 837      30.762   8.529  51.162  1.00  0.64           C  
ATOM   6751  CG  PRO A 837      30.026   9.618  51.964  1.00  0.64           C  
ATOM   6752  CD  PRO A 837      28.638   9.036  52.248  1.00  0.64           C  
ATOM   6753  OXT PRO A 837      31.546   5.697  52.519  1.00  0.64           O  
TER    6754      PRO A 837                                                      
ATOM   6755  N   LYS B   3      61.397  23.516  61.156  1.00  0.68           N  
ATOM   6756  CA  LYS B   3      61.910  24.410  60.063  1.00  0.68           C  
ATOM   6757  C   LYS B   3      61.130  24.127  58.806  1.00  0.68           C  
ATOM   6758  O   LYS B   3      60.785  22.958  58.637  1.00  0.68           O  
ATOM   6759  CB  LYS B   3      63.423  24.094  59.852  1.00  0.68           C  
ATOM   6760  CG  LYS B   3      64.138  24.898  58.743  1.00  0.68           C  
ATOM   6761  CD  LYS B   3      65.662  24.652  58.702  1.00  0.68           C  
ATOM   6762  CE  LYS B   3      66.363  25.435  57.579  1.00  0.68           C  
ATOM   6763  NZ  LYS B   3      67.826  25.191  57.594  1.00  0.68           N  
ATOM   6764  N   PRO B   4      60.767  25.059  57.938  1.00  0.72           N  
ATOM   6765  CA  PRO B   4      60.191  24.724  56.647  1.00  0.72           C  
ATOM   6766  C   PRO B   4      61.087  23.846  55.799  1.00  0.72           C  
ATOM   6767  O   PRO B   4      62.223  24.225  55.514  1.00  0.72           O  
ATOM   6768  CB  PRO B   4      59.911  26.079  55.996  1.00  0.72           C  
ATOM   6769  CG  PRO B   4      59.685  27.006  57.190  1.00  0.72           C  
ATOM   6770  CD  PRO B   4      60.719  26.503  58.192  1.00  0.72           C  
ATOM   6771  N   LEU B   5      60.594  22.670  55.402  1.00  0.60           N  
ATOM   6772  CA  LEU B   5      61.273  21.785  54.484  1.00  0.60           C  
ATOM   6773  C   LEU B   5      61.107  22.292  53.061  1.00  0.60           C  
ATOM   6774  O   LEU B   5      60.054  22.797  52.673  1.00  0.60           O  
ATOM   6775  CB  LEU B   5      60.710  20.340  54.593  1.00  0.60           C  
ATOM   6776  CG  LEU B   5      61.295  19.452  55.719  1.00  0.60           C  
ATOM   6777  CD1 LEU B   5      61.308  20.114  57.101  1.00  0.60           C  
ATOM   6778  CD2 LEU B   5      60.530  18.124  55.818  1.00  0.60           C  
ATOM   6779  N   THR B   6      62.155  22.148  52.232  1.00  0.66           N  
ATOM   6780  CA  THR B   6      62.082  22.449  50.811  1.00  0.66           C  
ATOM   6781  C   THR B   6      61.373  21.312  50.104  1.00  0.66           C  
ATOM   6782  O   THR B   6      61.170  20.235  50.669  1.00  0.66           O  
ATOM   6783  CB  THR B   6      63.443  22.670  50.139  1.00  0.66           C  
ATOM   6784  OG1 THR B   6      64.264  21.507  50.195  1.00  0.66           O  
ATOM   6785  CG2 THR B   6      64.221  23.797  50.838  1.00  0.66           C  
ATOM   6786  N   ASP B   7      60.990  21.490  48.830  1.00  0.69           N  
ATOM   6787  CA  ASP B   7      60.356  20.444  48.055  1.00  0.69           C  
ATOM   6788  C   ASP B   7      61.210  19.191  47.909  1.00  0.69           C  
ATOM   6789  O   ASP B   7      60.718  18.070  47.988  1.00  0.69           O  
ATOM   6790  CB  ASP B   7      59.984  20.987  46.669  1.00  0.69           C  
ATOM   6791  CG  ASP B   7      59.019  22.139  46.863  1.00  0.69           C  
ATOM   6792  OD1 ASP B   7      58.026  21.965  47.619  1.00  0.69           O  
ATOM   6793  OD2 ASP B   7      59.318  23.221  46.308  1.00  0.69           O  
ATOM   6794  N   SER B   8      62.540  19.347  47.777  1.00  0.72           N  
ATOM   6795  CA  SER B   8      63.496  18.248  47.784  1.00  0.72           C  
ATOM   6796  C   SER B   8      63.434  17.396  49.034  1.00  0.72           C  
ATOM   6797  O   SER B   8      63.493  16.171  48.955  1.00  0.72           O  
ATOM   6798  CB  SER B   8      64.959  18.755  47.701  1.00  0.72           C  
ATOM   6799  OG  SER B   8      65.151  19.544  46.530  1.00  0.72           O  
ATOM   6800  N   GLU B   9      63.312  18.019  50.223  1.00  0.70           N  
ATOM   6801  CA  GLU B   9      63.194  17.279  51.465  1.00  0.70           C  
ATOM   6802  C   GLU B   9      61.830  16.658  51.692  1.00  0.70           C  
ATOM   6803  O   GLU B   9      61.690  15.529  52.155  1.00  0.70           O  
ATOM   6804  CB  GLU B   9      63.661  18.127  52.665  1.00  0.70           C  
ATOM   6805  CG  GLU B   9      64.071  17.305  53.921  1.00  0.70           C  
ATOM   6806  CD  GLU B   9      65.249  16.356  53.749  1.00  0.70           C  
ATOM   6807  OE1 GLU B   9      65.736  15.787  54.754  1.00  0.70           O  
ATOM   6808  OE2 GLU B   9      65.704  16.182  52.593  1.00  0.70           O  
ATOM   6809  N   LYS B  10      60.755  17.351  51.294  1.00  0.75           N  
ATOM   6810  CA  LYS B  10      59.420  16.790  51.323  1.00  0.75           C  
ATOM   6811  C   LYS B  10      59.242  15.564  50.434  1.00  0.75           C  
ATOM   6812  O   LYS B  10      58.644  14.568  50.845  1.00  0.75           O  
ATOM   6813  CB  LYS B  10      58.414  17.856  50.889  1.00  0.75           C  
ATOM   6814  CG  LYS B  10      58.283  19.034  51.860  1.00  0.75           C  
ATOM   6815  CD  LYS B  10      57.322  20.059  51.256  1.00  0.75           C  
ATOM   6816  CE  LYS B  10      57.017  21.263  52.133  1.00  0.75           C  
ATOM   6817  NZ  LYS B  10      56.113  22.142  51.371  1.00  0.75           N  
ATOM   6818  N   ARG B  11      59.820  15.574  49.213  1.00  0.63           N  
ATOM   6819  CA  ARG B  11      59.744  14.459  48.285  1.00  0.63           C  
ATOM   6820  C   ARG B  11      60.472  13.212  48.768  1.00  0.63           C  
ATOM   6821  O   ARG B  11      60.302  12.133  48.209  1.00  0.63           O  
ATOM   6822  CB  ARG B  11      60.268  14.827  46.871  1.00  0.63           C  
ATOM   6823  CG  ARG B  11      59.381  15.846  46.125  1.00  0.63           C  
ATOM   6824  CD  ARG B  11      59.856  16.138  44.700  1.00  0.63           C  
ATOM   6825  NE  ARG B  11      59.211  17.409  44.250  1.00  0.63           N  
ATOM   6826  CZ  ARG B  11      59.249  17.909  43.010  1.00  0.63           C  
ATOM   6827  NH1 ARG B  11      59.793  17.243  41.998  1.00  0.63           N  
ATOM   6828  NH2 ARG B  11      58.686  19.094  42.792  1.00  0.63           N  
ATOM   6829  N   LYS B  12      61.266  13.273  49.857  1.00  0.73           N  
ATOM   6830  CA  LYS B  12      61.878  12.104  50.470  1.00  0.73           C  
ATOM   6831  C   LYS B  12      60.846  11.120  51.008  1.00  0.73           C  
ATOM   6832  O   LYS B  12      61.078   9.912  51.047  1.00  0.73           O  
ATOM   6833  CB  LYS B  12      62.832  12.501  51.615  1.00  0.73           C  
ATOM   6834  CG  LYS B  12      63.940  13.483  51.206  1.00  0.73           C  
ATOM   6835  CD  LYS B  12      64.984  12.931  50.230  1.00  0.73           C  
ATOM   6836  CE  LYS B  12      66.022  13.987  49.821  1.00  0.73           C  
ATOM   6837  NZ  LYS B  12      66.723  14.552  50.982  1.00  0.73           N  
ATOM   6838  N   GLN B  13      59.640  11.633  51.343  1.00  0.62           N  
ATOM   6839  CA  GLN B  13      58.481  10.846  51.716  1.00  0.62           C  
ATOM   6840  C   GLN B  13      57.909  10.043  50.565  1.00  0.62           C  
ATOM   6841  O   GLN B  13      57.122   9.119  50.777  1.00  0.62           O  
ATOM   6842  CB  GLN B  13      57.334  11.751  52.211  1.00  0.62           C  
ATOM   6843  CG  GLN B  13      57.655  12.572  53.474  1.00  0.62           C  
ATOM   6844  CD  GLN B  13      56.461  13.476  53.766  1.00  0.62           C  
ATOM   6845  OE1 GLN B  13      55.412  13.020  54.228  1.00  0.62           O  
ATOM   6846  NE2 GLN B  13      56.605  14.774  53.429  1.00  0.62           N  
ATOM   6847  N   ILE B  14      58.303  10.338  49.306  1.00  0.61           N  
ATOM   6848  CA  ILE B  14      58.022   9.506  48.158  1.00  0.61           C  
ATOM   6849  C   ILE B  14      58.946   8.287  48.240  1.00  0.61           C  
ATOM   6850  O   ILE B  14      60.003   8.222  47.600  1.00  0.61           O  
ATOM   6851  CB  ILE B  14      58.100  10.273  46.845  1.00  0.61           C  
ATOM   6852  CG1 ILE B  14      57.183  11.523  46.922  1.00  0.61           C  
ATOM   6853  CG2 ILE B  14      57.683   9.357  45.672  1.00  0.61           C  
ATOM   6854  CD1 ILE B  14      57.319  12.469  45.729  1.00  0.61           C  
ATOM   6855  N   SER B  15      58.550   7.340  49.131  1.00  0.69           N  
ATOM   6856  CA  SER B  15      59.240   6.151  49.626  1.00  0.69           C  
ATOM   6857  C   SER B  15      58.652   4.892  49.021  1.00  0.69           C  
ATOM   6858  O   SER B  15      57.458   4.830  48.771  1.00  0.69           O  
ATOM   6859  CB  SER B  15      60.787   6.234  49.578  1.00  0.69           C  
ATOM   6860  OG  SER B  15      61.483   5.197  50.281  1.00  0.69           O  
ATOM   6861  N   VAL B  16      59.443   3.825  48.807  1.00  0.73           N  
ATOM   6862  CA  VAL B  16      58.913   2.530  48.390  1.00  0.73           C  
ATOM   6863  C   VAL B  16      58.465   1.777  49.634  1.00  0.73           C  
ATOM   6864  O   VAL B  16      59.283   1.165  50.335  1.00  0.73           O  
ATOM   6865  CB  VAL B  16      59.963   1.684  47.666  1.00  0.73           C  
ATOM   6866  CG1 VAL B  16      59.466   0.259  47.335  1.00  0.73           C  
ATOM   6867  CG2 VAL B  16      60.383   2.381  46.367  1.00  0.73           C  
ATOM   6868  N   ARG B  17      57.155   1.805  49.958  1.00  0.56           N  
ATOM   6869  CA  ARG B  17      56.617   1.169  51.148  1.00  0.56           C  
ATOM   6870  C   ARG B  17      55.176   0.723  51.004  1.00  0.56           C  
ATOM   6871  O   ARG B  17      54.465   1.080  50.072  1.00  0.56           O  
ATOM   6872  CB  ARG B  17      56.724   2.088  52.398  1.00  0.56           C  
ATOM   6873  CG  ARG B  17      58.085   2.071  53.136  1.00  0.56           C  
ATOM   6874  CD  ARG B  17      58.504   0.741  53.803  1.00  0.56           C  
ATOM   6875  NE  ARG B  17      59.043  -0.181  52.752  1.00  0.56           N  
ATOM   6876  CZ  ARG B  17      59.273  -1.497  52.908  1.00  0.56           C  
ATOM   6877  NH1 ARG B  17      59.191  -2.105  54.084  1.00  0.56           N  
ATOM   6878  NH2 ARG B  17      59.588  -2.226  51.840  1.00  0.56           N  
ATOM   6879  N   GLY B  18      54.723  -0.148  51.935  1.00  0.58           N  
ATOM   6880  CA  GLY B  18      53.380  -0.726  51.940  1.00  0.58           C  
ATOM   6881  C   GLY B  18      53.278  -2.029  51.193  1.00  0.58           C  
ATOM   6882  O   GLY B  18      52.655  -2.982  51.643  1.00  0.58           O  
ATOM   6883  N   LEU B  19      53.904  -2.121  50.019  1.00  0.47           N  
ATOM   6884  CA  LEU B  19      53.985  -3.332  49.234  1.00  0.47           C  
ATOM   6885  C   LEU B  19      54.830  -4.449  49.804  1.00  0.47           C  
ATOM   6886  O   LEU B  19      55.991  -4.266  50.163  1.00  0.47           O  
ATOM   6887  CB  LEU B  19      54.493  -2.889  47.872  1.00  0.47           C  
ATOM   6888  CG  LEU B  19      54.650  -3.915  46.746  1.00  0.47           C  
ATOM   6889  CD1 LEU B  19      54.613  -3.134  45.446  1.00  0.47           C  
ATOM   6890  CD2 LEU B  19      55.931  -4.730  46.848  1.00  0.47           C  
ATOM   6891  N   ALA B  20      54.241  -5.658  49.885  1.00  0.55           N  
ATOM   6892  CA  ALA B  20      54.901  -6.871  50.329  1.00  0.55           C  
ATOM   6893  C   ALA B  20      55.520  -6.874  51.706  1.00  0.55           C  
ATOM   6894  O   ALA B  20      56.140  -7.859  52.092  1.00  0.55           O  
ATOM   6895  CB  ALA B  20      55.956  -7.381  49.325  1.00  0.55           C  
ATOM   6896  N   GLY B  21      55.278  -5.824  52.525  1.00  0.54           N  
ATOM   6897  CA  GLY B  21      55.775  -5.754  53.896  1.00  0.54           C  
ATOM   6898  C   GLY B  21      55.127  -6.801  54.731  1.00  0.54           C  
ATOM   6899  O   GLY B  21      55.662  -7.266  55.733  1.00  0.54           O  
ATOM   6900  N   LEU B  22      53.941  -7.214  54.285  1.00  0.56           N  
ATOM   6901  CA  LEU B  22      53.228  -8.310  54.858  1.00  0.56           C  
ATOM   6902  C   LEU B  22      52.715  -9.179  53.731  1.00  0.56           C  
ATOM   6903  O   LEU B  22      51.603  -8.971  53.226  1.00  0.56           O  
ATOM   6904  CB  LEU B  22      52.032  -7.776  55.675  1.00  0.56           C  
ATOM   6905  CG  LEU B  22      52.447  -6.826  56.815  1.00  0.56           C  
ATOM   6906  CD1 LEU B  22      51.255  -6.057  57.387  1.00  0.56           C  
ATOM   6907  CD2 LEU B  22      53.209  -7.533  57.942  1.00  0.56           C  
ATOM   6908  N   GLY B  23      53.453 -10.230  53.310  1.00  0.70           N  
ATOM   6909  CA  GLY B  23      52.950 -11.300  52.441  1.00  0.70           C  
ATOM   6910  C   GLY B  23      52.054 -12.230  53.228  1.00  0.70           C  
ATOM   6911  O   GLY B  23      52.268 -13.413  53.343  1.00  0.70           O  
ATOM   6912  N   ASP B  24      51.028 -11.601  53.833  1.00  0.78           N  
ATOM   6913  CA  ASP B  24      50.097 -12.198  54.747  1.00  0.78           C  
ATOM   6914  C   ASP B  24      48.845 -12.623  53.991  1.00  0.78           C  
ATOM   6915  O   ASP B  24      48.427 -11.996  53.030  1.00  0.78           O  
ATOM   6916  CB  ASP B  24      49.771 -11.134  55.833  1.00  0.78           C  
ATOM   6917  CG  ASP B  24      49.045 -11.685  57.048  1.00  0.78           C  
ATOM   6918  OD1 ASP B  24      47.925 -12.227  56.873  1.00  0.78           O  
ATOM   6919  OD2 ASP B  24      49.596 -11.554  58.163  1.00  0.78           O  
ATOM   6920  N   VAL B  25      48.168 -13.698  54.445  1.00  0.79           N  
ATOM   6921  CA  VAL B  25      46.878 -14.108  53.900  1.00  0.79           C  
ATOM   6922  C   VAL B  25      45.818 -13.016  54.062  1.00  0.79           C  
ATOM   6923  O   VAL B  25      45.037 -12.721  53.152  1.00  0.79           O  
ATOM   6924  CB  VAL B  25      46.403 -15.402  54.557  1.00  0.79           C  
ATOM   6925  CG1 VAL B  25      44.996 -15.794  54.070  1.00  0.79           C  
ATOM   6926  CG2 VAL B  25      47.391 -16.529  54.200  1.00  0.79           C  
ATOM   6927  N   ALA B  26      45.800 -12.337  55.224  1.00  0.79           N  
ATOM   6928  CA  ALA B  26      44.908 -11.246  55.532  1.00  0.79           C  
ATOM   6929  C   ALA B  26      45.152  -9.999  54.700  1.00  0.79           C  
ATOM   6930  O   ALA B  26      44.204  -9.310  54.319  1.00  0.79           O  
ATOM   6931  CB  ALA B  26      44.990 -10.900  57.031  1.00  0.79           C  
ATOM   6932  N   GLU B  27      46.423  -9.655  54.427  1.00  0.75           N  
ATOM   6933  CA  GLU B  27      46.781  -8.555  53.546  1.00  0.75           C  
ATOM   6934  C   GLU B  27      46.568  -8.862  52.076  1.00  0.75           C  
ATOM   6935  O   GLU B  27      46.021  -8.037  51.347  1.00  0.75           O  
ATOM   6936  CB  GLU B  27      48.208  -8.037  53.818  1.00  0.75           C  
ATOM   6937  CG  GLU B  27      48.351  -7.361  55.207  1.00  0.75           C  
ATOM   6938  CD  GLU B  27      47.329  -6.261  55.451  1.00  0.75           C  
ATOM   6939  OE1 GLU B  27      46.661  -6.316  56.519  1.00  0.75           O  
ATOM   6940  OE2 GLU B  27      47.117  -5.405  54.560  1.00  0.75           O  
ATOM   6941  N   VAL B  28      46.905 -10.088  51.610  1.00  0.81           N  
ATOM   6942  CA  VAL B  28      46.623 -10.551  50.250  1.00  0.81           C  
ATOM   6943  C   VAL B  28      45.130 -10.498  49.958  1.00  0.81           C  
ATOM   6944  O   VAL B  28      44.696 -10.075  48.889  1.00  0.81           O  
ATOM   6945  CB  VAL B  28      47.160 -11.965  50.008  1.00  0.81           C  
ATOM   6946  CG1 VAL B  28      46.641 -12.602  48.701  1.00  0.81           C  
ATOM   6947  CG2 VAL B  28      48.699 -11.926  49.939  1.00  0.81           C  
ATOM   6948  N   ARG B  29      44.287 -10.870  50.943  1.00  0.79           N  
ATOM   6949  CA  ARG B  29      42.849 -10.718  50.844  1.00  0.79           C  
ATOM   6950  C   ARG B  29      42.393  -9.273  50.640  1.00  0.79           C  
ATOM   6951  O   ARG B  29      41.580  -8.995  49.761  1.00  0.79           O  
ATOM   6952  CB  ARG B  29      42.191 -11.280  52.129  1.00  0.79           C  
ATOM   6953  CG  ARG B  29      40.648 -11.307  52.101  1.00  0.79           C  
ATOM   6954  CD  ARG B  29      39.970 -11.677  53.429  1.00  0.79           C  
ATOM   6955  NE  ARG B  29      40.330 -10.624  54.439  1.00  0.79           N  
ATOM   6956  CZ  ARG B  29      39.731  -9.430  54.541  1.00  0.79           C  
ATOM   6957  NH1 ARG B  29      40.143  -8.585  55.486  1.00  0.79           N  
ATOM   6958  NH2 ARG B  29      38.750  -9.054  53.728  1.00  0.79           N  
ATOM   6959  N   LYS B  30      42.927  -8.301  51.415  1.00  0.79           N  
ATOM   6960  CA  LYS B  30      42.579  -6.895  51.258  1.00  0.79           C  
ATOM   6961  C   LYS B  30      43.003  -6.317  49.919  1.00  0.79           C  
ATOM   6962  O   LYS B  30      42.245  -5.610  49.262  1.00  0.79           O  
ATOM   6963  CB  LYS B  30      43.243  -6.000  52.329  1.00  0.79           C  
ATOM   6964  CG  LYS B  30      42.809  -6.261  53.774  1.00  0.79           C  
ATOM   6965  CD  LYS B  30      43.609  -5.344  54.708  1.00  0.79           C  
ATOM   6966  CE  LYS B  30      43.516  -5.698  56.188  1.00  0.79           C  
ATOM   6967  NZ  LYS B  30      44.194  -6.983  56.433  1.00  0.79           N  
ATOM   6968  N   SER B  31      44.234  -6.607  49.468  1.00  0.82           N  
ATOM   6969  CA  SER B  31      44.742  -6.156  48.183  1.00  0.82           C  
ATOM   6970  C   SER B  31      44.023  -6.759  47.000  1.00  0.82           C  
ATOM   6971  O   SER B  31      43.707  -6.045  46.051  1.00  0.82           O  
ATOM   6972  CB  SER B  31      46.266  -6.343  48.052  1.00  0.82           C  
ATOM   6973  OG  SER B  31      46.645  -7.693  48.274  1.00  0.82           O  
ATOM   6974  N   PHE B  32      43.669  -8.061  47.057  1.00  0.87           N  
ATOM   6975  CA  PHE B  32      42.832  -8.712  46.057  1.00  0.87           C  
ATOM   6976  C   PHE B  32      41.489  -8.022  45.941  1.00  0.87           C  
ATOM   6977  O   PHE B  32      41.010  -7.712  44.852  1.00  0.87           O  
ATOM   6978  CB  PHE B  32      42.633 -10.205  46.459  1.00  0.87           C  
ATOM   6979  CG  PHE B  32      41.793 -10.985  45.479  1.00  0.87           C  
ATOM   6980  CD1 PHE B  32      40.387 -10.901  45.510  1.00  0.87           C  
ATOM   6981  CD2 PHE B  32      42.400 -11.819  44.531  1.00  0.87           C  
ATOM   6982  CE1 PHE B  32      39.605 -11.609  44.592  1.00  0.87           C  
ATOM   6983  CE2 PHE B  32      41.619 -12.535  43.616  1.00  0.87           C  
ATOM   6984  CZ  PHE B  32      40.227 -12.423  43.641  1.00  0.87           C  
ATOM   6985  N   ASN B  33      40.878  -7.731  47.100  1.00  0.85           N  
ATOM   6986  CA  ASN B  33      39.621  -7.032  47.192  1.00  0.85           C  
ATOM   6987  C   ASN B  33      39.714  -5.618  46.620  1.00  0.85           C  
ATOM   6988  O   ASN B  33      38.938  -5.217  45.759  1.00  0.85           O  
ATOM   6989  CB  ASN B  33      39.257  -7.025  48.700  1.00  0.85           C  
ATOM   6990  CG  ASN B  33      37.811  -6.699  49.001  1.00  0.85           C  
ATOM   6991  OD1 ASN B  33      37.506  -5.999  49.967  1.00  0.85           O  
ATOM   6992  ND2 ASN B  33      36.885  -7.263  48.207  1.00  0.85           N  
ATOM   6993  N   ARG B  34      40.761  -4.869  47.008  1.00  0.78           N  
ATOM   6994  CA  ARG B  34      41.045  -3.540  46.508  1.00  0.78           C  
ATOM   6995  C   ARG B  34      41.278  -3.487  45.003  1.00  0.78           C  
ATOM   6996  O   ARG B  34      40.767  -2.617  44.302  1.00  0.78           O  
ATOM   6997  CB  ARG B  34      42.303  -2.985  47.232  1.00  0.78           C  
ATOM   6998  CG  ARG B  34      42.621  -1.517  46.906  1.00  0.78           C  
ATOM   6999  CD  ARG B  34      43.845  -0.907  47.597  1.00  0.78           C  
ATOM   7000  NE  ARG B  34      45.055  -1.791  47.454  1.00  0.78           N  
ATOM   7001  CZ  ARG B  34      45.741  -2.028  46.320  1.00  0.78           C  
ATOM   7002  NH1 ARG B  34      45.366  -1.542  45.144  1.00  0.78           N  
ATOM   7003  NH2 ARG B  34      46.866  -2.744  46.395  1.00  0.78           N  
ATOM   7004  N   HIS B  35      42.056  -4.432  44.448  1.00  0.84           N  
ATOM   7005  CA  HIS B  35      42.241  -4.537  43.014  1.00  0.84           C  
ATOM   7006  C   HIS B  35      40.976  -4.931  42.249  1.00  0.84           C  
ATOM   7007  O   HIS B  35      40.692  -4.369  41.193  1.00  0.84           O  
ATOM   7008  CB  HIS B  35      43.408  -5.485  42.660  1.00  0.84           C  
ATOM   7009  CG  HIS B  35      44.767  -4.904  42.962  1.00  0.84           C  
ATOM   7010  ND1 HIS B  35      45.188  -3.777  42.271  1.00  0.84           N  
ATOM   7011  CD2 HIS B  35      45.776  -5.375  43.740  1.00  0.84           C  
ATOM   7012  CE1 HIS B  35      46.448  -3.602  42.631  1.00  0.84           C  
ATOM   7013  NE2 HIS B  35      46.848  -4.534  43.524  1.00  0.84           N  
ATOM   7014  N   LEU B  36      40.154  -5.876  42.758  1.00  0.87           N  
ATOM   7015  CA  LEU B  36      38.916  -6.291  42.106  1.00  0.87           C  
ATOM   7016  C   LEU B  36      37.941  -5.144  41.943  1.00  0.87           C  
ATOM   7017  O   LEU B  36      37.393  -4.894  40.869  1.00  0.87           O  
ATOM   7018  CB  LEU B  36      38.255  -7.441  42.926  1.00  0.87           C  
ATOM   7019  CG  LEU B  36      37.025  -8.162  42.312  1.00  0.87           C  
ATOM   7020  CD1 LEU B  36      35.712  -7.383  42.484  1.00  0.87           C  
ATOM   7021  CD2 LEU B  36      37.226  -8.539  40.839  1.00  0.87           C  
ATOM   7022  N   HIS B  37      37.724  -4.364  43.006  1.00  0.82           N  
ATOM   7023  CA  HIS B  37      36.845  -3.233  42.894  1.00  0.82           C  
ATOM   7024  C   HIS B  37      37.455  -2.036  42.202  1.00  0.82           C  
ATOM   7025  O   HIS B  37      36.837  -1.448  41.320  1.00  0.82           O  
ATOM   7026  CB  HIS B  37      36.280  -2.846  44.266  1.00  0.82           C  
ATOM   7027  CG  HIS B  37      35.447  -3.941  44.855  1.00  0.82           C  
ATOM   7028  ND1 HIS B  37      36.020  -4.865  45.698  1.00  0.82           N  
ATOM   7029  CD2 HIS B  37      34.133  -4.229  44.680  1.00  0.82           C  
ATOM   7030  CE1 HIS B  37      35.056  -5.688  46.026  1.00  0.82           C  
ATOM   7031  NE2 HIS B  37      33.886  -5.352  45.439  1.00  0.82           N  
ATOM   7032  N   PHE B  38      38.683  -1.619  42.548  1.00  0.83           N  
ATOM   7033  CA  PHE B  38      39.101  -0.272  42.180  1.00  0.83           C  
ATOM   7034  C   PHE B  38      39.949  -0.244  40.937  1.00  0.83           C  
ATOM   7035  O   PHE B  38      39.768   0.613  40.072  1.00  0.83           O  
ATOM   7036  CB  PHE B  38      39.807   0.437  43.366  1.00  0.83           C  
ATOM   7037  CG  PHE B  38      38.973   0.285  44.629  1.00  0.83           C  
ATOM   7038  CD1 PHE B  38      37.568   0.313  44.611  1.00  0.83           C  
ATOM   7039  CD2 PHE B  38      39.605   0.024  45.853  1.00  0.83           C  
ATOM   7040  CE1 PHE B  38      36.820   0.029  45.764  1.00  0.83           C  
ATOM   7041  CE2 PHE B  38      38.870  -0.287  47.010  1.00  0.83           C  
ATOM   7042  CZ  PHE B  38      37.471  -0.306  46.952  1.00  0.83           C  
ATOM   7043  N   THR B  39      40.856  -1.220  40.777  1.00  0.83           N  
ATOM   7044  CA  THR B  39      41.651  -1.406  39.569  1.00  0.83           C  
ATOM   7045  C   THR B  39      40.817  -1.929  38.416  1.00  0.83           C  
ATOM   7046  O   THR B  39      40.888  -1.431  37.288  1.00  0.83           O  
ATOM   7047  CB  THR B  39      42.817  -2.352  39.817  1.00  0.83           C  
ATOM   7048  OG1 THR B  39      43.621  -1.831  40.864  1.00  0.83           O  
ATOM   7049  CG2 THR B  39      43.708  -2.502  38.582  1.00  0.83           C  
ATOM   7050  N   LEU B  40      39.970  -2.943  38.673  1.00  0.83           N  
ATOM   7051  CA  LEU B  40      39.172  -3.578  37.638  1.00  0.83           C  
ATOM   7052  C   LEU B  40      37.828  -2.910  37.399  1.00  0.83           C  
ATOM   7053  O   LEU B  40      37.237  -3.092  36.332  1.00  0.83           O  
ATOM   7054  CB  LEU B  40      38.918  -5.062  37.977  1.00  0.83           C  
ATOM   7055  CG  LEU B  40      40.010  -6.053  37.543  1.00  0.83           C  
ATOM   7056  CD1 LEU B  40      41.426  -5.674  37.984  1.00  0.83           C  
ATOM   7057  CD2 LEU B  40      39.655  -7.424  38.112  1.00  0.83           C  
ATOM   7058  N   VAL B  41      37.328  -2.094  38.351  1.00  0.81           N  
ATOM   7059  CA  VAL B  41      36.035  -1.414  38.258  1.00  0.81           C  
ATOM   7060  C   VAL B  41      34.898  -2.432  38.184  1.00  0.81           C  
ATOM   7061  O   VAL B  41      34.095  -2.452  37.245  1.00  0.81           O  
ATOM   7062  CB  VAL B  41      35.971  -0.342  37.168  1.00  0.81           C  
ATOM   7063  CG1 VAL B  41      34.760   0.584  37.373  1.00  0.81           C  
ATOM   7064  CG2 VAL B  41      37.246   0.518  37.203  1.00  0.81           C  
ATOM   7065  N   LYS B  42      34.884  -3.356  39.161  1.00  0.80           N  
ATOM   7066  CA  LYS B  42      34.023  -4.522  39.242  1.00  0.80           C  
ATOM   7067  C   LYS B  42      33.555  -4.720  40.674  1.00  0.80           C  
ATOM   7068  O   LYS B  42      33.930  -3.991  41.586  1.00  0.80           O  
ATOM   7069  CB  LYS B  42      34.764  -5.831  38.851  1.00  0.80           C  
ATOM   7070  CG  LYS B  42      35.215  -5.921  37.392  1.00  0.80           C  
ATOM   7071  CD  LYS B  42      34.050  -6.028  36.405  1.00  0.80           C  
ATOM   7072  CE  LYS B  42      34.558  -6.333  34.998  1.00  0.80           C  
ATOM   7073  NZ  LYS B  42      33.436  -6.572  34.088  1.00  0.80           N  
ATOM   7074  N   ASP B  43      32.707  -5.733  40.901  1.00  0.81           N  
ATOM   7075  CA  ASP B  43      32.246  -6.152  42.198  1.00  0.81           C  
ATOM   7076  C   ASP B  43      31.887  -7.625  42.083  1.00  0.81           C  
ATOM   7077  O   ASP B  43      31.968  -8.215  41.007  1.00  0.81           O  
ATOM   7078  CB  ASP B  43      31.067  -5.281  42.697  1.00  0.81           C  
ATOM   7079  CG  ASP B  43      29.856  -5.306  41.775  1.00  0.81           C  
ATOM   7080  OD1 ASP B  43      29.671  -6.301  41.028  1.00  0.81           O  
ATOM   7081  OD2 ASP B  43      29.067  -4.338  41.869  1.00  0.81           O  
ATOM   7082  N   ARG B  44      31.455  -8.281  43.177  1.00  0.75           N  
ATOM   7083  CA  ARG B  44      31.099  -9.685  43.095  1.00  0.75           C  
ATOM   7084  C   ARG B  44      29.802  -9.966  42.359  1.00  0.75           C  
ATOM   7085  O   ARG B  44      29.489 -11.114  42.053  1.00  0.75           O  
ATOM   7086  CB  ARG B  44      31.018 -10.329  44.495  1.00  0.75           C  
ATOM   7087  CG  ARG B  44      29.810  -9.903  45.353  1.00  0.75           C  
ATOM   7088  CD  ARG B  44      29.763 -10.674  46.672  1.00  0.75           C  
ATOM   7089  NE  ARG B  44      28.531 -10.254  47.415  1.00  0.75           N  
ATOM   7090  CZ  ARG B  44      28.491  -9.180  48.211  1.00  0.75           C  
ATOM   7091  NH1 ARG B  44      29.535  -8.372  48.340  1.00  0.75           N  
ATOM   7092  NH2 ARG B  44      27.380  -8.906  48.892  1.00  0.75           N  
ATOM   7093  N   ASN B  45      28.996  -8.929  42.068  1.00  0.78           N  
ATOM   7094  CA  ASN B  45      27.761  -9.087  41.339  1.00  0.78           C  
ATOM   7095  C   ASN B  45      27.998  -9.393  39.864  1.00  0.78           C  
ATOM   7096  O   ASN B  45      27.230 -10.123  39.238  1.00  0.78           O  
ATOM   7097  CB  ASN B  45      26.877  -7.825  41.499  1.00  0.78           C  
ATOM   7098  CG  ASN B  45      26.536  -7.586  42.966  1.00  0.78           C  
ATOM   7099  OD1 ASN B  45      26.780  -6.544  43.569  1.00  0.78           O  
ATOM   7100  ND2 ASN B  45      25.921  -8.605  43.611  1.00  0.78           N  
ATOM   7101  N   VAL B  46      29.076  -8.838  39.272  1.00  0.81           N  
ATOM   7102  CA  VAL B  46      29.397  -9.063  37.868  1.00  0.81           C  
ATOM   7103  C   VAL B  46      30.730  -9.771  37.608  1.00  0.81           C  
ATOM   7104  O   VAL B  46      30.981 -10.232  36.491  1.00  0.81           O  
ATOM   7105  CB  VAL B  46      29.305  -7.725  37.131  1.00  0.81           C  
ATOM   7106  CG1 VAL B  46      30.421  -6.769  37.583  1.00  0.81           C  
ATOM   7107  CG2 VAL B  46      29.321  -7.906  35.604  1.00  0.81           C  
ATOM   7108  N   ALA B  47      31.608  -9.920  38.621  1.00  0.87           N  
ATOM   7109  CA  ALA B  47      32.927 -10.516  38.461  1.00  0.87           C  
ATOM   7110  C   ALA B  47      32.984 -11.948  37.928  1.00  0.87           C  
ATOM   7111  O   ALA B  47      32.402 -12.892  38.467  1.00  0.87           O  
ATOM   7112  CB  ALA B  47      33.705 -10.475  39.784  1.00  0.87           C  
ATOM   7113  N   THR B  48      33.738 -12.138  36.834  1.00  0.84           N  
ATOM   7114  CA  THR B  48      33.931 -13.428  36.194  1.00  0.84           C  
ATOM   7115  C   THR B  48      35.163 -14.131  36.751  1.00  0.84           C  
ATOM   7116  O   THR B  48      35.954 -13.501  37.456  1.00  0.84           O  
ATOM   7117  CB  THR B  48      34.026 -13.323  34.667  1.00  0.84           C  
ATOM   7118  OG1 THR B  48      35.220 -12.715  34.200  1.00  0.84           O  
ATOM   7119  CG2 THR B  48      32.846 -12.511  34.117  1.00  0.84           C  
ATOM   7120  N   PRO B  49      35.432 -15.415  36.468  1.00  0.87           N  
ATOM   7121  CA  PRO B  49      36.710 -16.050  36.806  1.00  0.87           C  
ATOM   7122  C   PRO B  49      37.900 -15.304  36.235  1.00  0.87           C  
ATOM   7123  O   PRO B  49      38.963 -15.258  36.848  1.00  0.87           O  
ATOM   7124  CB  PRO B  49      36.574 -17.474  36.251  1.00  0.87           C  
ATOM   7125  CG  PRO B  49      35.068 -17.745  36.321  1.00  0.87           C  
ATOM   7126  CD  PRO B  49      34.461 -16.392  35.962  1.00  0.87           C  
ATOM   7127  N   ARG B  50      37.729 -14.668  35.063  1.00  0.81           N  
ATOM   7128  CA  ARG B  50      38.735 -13.812  34.483  1.00  0.81           C  
ATOM   7129  C   ARG B  50      39.023 -12.561  35.296  1.00  0.81           C  
ATOM   7130  O   ARG B  50      40.183 -12.210  35.510  1.00  0.81           O  
ATOM   7131  CB  ARG B  50      38.354 -13.454  33.032  1.00  0.81           C  
ATOM   7132  CG  ARG B  50      39.445 -12.670  32.285  1.00  0.81           C  
ATOM   7133  CD  ARG B  50      39.044 -12.214  30.877  1.00  0.81           C  
ATOM   7134  NE  ARG B  50      38.688 -13.410  30.042  1.00  0.81           N  
ATOM   7135  CZ  ARG B  50      39.566 -14.281  29.523  1.00  0.81           C  
ATOM   7136  NH1 ARG B  50      40.877 -14.174  29.710  1.00  0.81           N  
ATOM   7137  NH2 ARG B  50      39.107 -15.288  28.783  1.00  0.81           N  
ATOM   7138  N   ASP B  51      37.982 -11.887  35.820  1.00  0.88           N  
ATOM   7139  CA  ASP B  51      38.144 -10.756  36.715  1.00  0.88           C  
ATOM   7140  C   ASP B  51      38.883 -11.129  37.998  1.00  0.88           C  
ATOM   7141  O   ASP B  51      39.798 -10.445  38.452  1.00  0.88           O  
ATOM   7142  CB  ASP B  51      36.764 -10.167  37.094  1.00  0.88           C  
ATOM   7143  CG  ASP B  51      36.080  -9.616  35.863  1.00  0.88           C  
ATOM   7144  OD1 ASP B  51      36.751  -8.883  35.099  1.00  0.88           O  
ATOM   7145  OD2 ASP B  51      34.866  -9.899  35.666  1.00  0.88           O  
ATOM   7146  N   TYR B  52      38.547 -12.278  38.601  1.00  0.87           N  
ATOM   7147  CA  TYR B  52      39.261 -12.797  39.751  1.00  0.87           C  
ATOM   7148  C   TYR B  52      40.716 -13.163  39.475  1.00  0.87           C  
ATOM   7149  O   TYR B  52      41.593 -12.894  40.297  1.00  0.87           O  
ATOM   7150  CB  TYR B  52      38.486 -13.984  40.362  1.00  0.87           C  
ATOM   7151  CG  TYR B  52      37.149 -13.544  40.912  1.00  0.87           C  
ATOM   7152  CD1 TYR B  52      37.023 -12.406  41.733  1.00  0.87           C  
ATOM   7153  CD2 TYR B  52      35.998 -14.302  40.639  1.00  0.87           C  
ATOM   7154  CE1 TYR B  52      35.785 -12.054  42.280  1.00  0.87           C  
ATOM   7155  CE2 TYR B  52      34.757 -13.954  41.194  1.00  0.87           C  
ATOM   7156  CZ  TYR B  52      34.656 -12.837  42.029  1.00  0.87           C  
ATOM   7157  OH  TYR B  52      33.413 -12.479  42.591  1.00  0.87           O  
ATOM   7158  N   PHE B  53      41.038 -13.728  38.290  1.00  0.90           N  
ATOM   7159  CA  PHE B  53      42.415 -13.917  37.856  1.00  0.90           C  
ATOM   7160  C   PHE B  53      43.173 -12.591  37.795  1.00  0.90           C  
ATOM   7161  O   PHE B  53      44.277 -12.471  38.318  1.00  0.90           O  
ATOM   7162  CB  PHE B  53      42.450 -14.636  36.471  1.00  0.90           C  
ATOM   7163  CG  PHE B  53      43.824 -14.600  35.840  1.00  0.90           C  
ATOM   7164  CD1 PHE B  53      44.136 -13.591  34.909  1.00  0.90           C  
ATOM   7165  CD2 PHE B  53      44.849 -15.443  36.291  1.00  0.90           C  
ATOM   7166  CE1 PHE B  53      45.445 -13.431  34.440  1.00  0.90           C  
ATOM   7167  CE2 PHE B  53      46.151 -15.301  35.803  1.00  0.90           C  
ATOM   7168  CZ  PHE B  53      46.452 -14.286  34.893  1.00  0.90           C  
ATOM   7169  N   PHE B  54      42.578 -11.548  37.189  1.00  0.89           N  
ATOM   7170  CA  PHE B  54      43.185 -10.234  37.115  1.00  0.89           C  
ATOM   7171  C   PHE B  54      43.383  -9.579  38.469  1.00  0.89           C  
ATOM   7172  O   PHE B  54      44.426  -8.981  38.725  1.00  0.89           O  
ATOM   7173  CB  PHE B  54      42.351  -9.291  36.220  1.00  0.89           C  
ATOM   7174  CG  PHE B  54      42.602  -9.539  34.765  1.00  0.89           C  
ATOM   7175  CD1 PHE B  54      43.904  -9.469  34.240  1.00  0.89           C  
ATOM   7176  CD2 PHE B  54      41.528  -9.781  33.893  1.00  0.89           C  
ATOM   7177  CE1 PHE B  54      44.126  -9.668  32.874  1.00  0.89           C  
ATOM   7178  CE2 PHE B  54      41.752  -9.959  32.522  1.00  0.89           C  
ATOM   7179  CZ  PHE B  54      43.053  -9.911  32.015  1.00  0.89           C  
ATOM   7180  N   ALA B  55      42.414  -9.711  39.393  1.00  0.92           N  
ATOM   7181  CA  ALA B  55      42.558  -9.251  40.758  1.00  0.92           C  
ATOM   7182  C   ALA B  55      43.739  -9.901  41.472  1.00  0.92           C  
ATOM   7183  O   ALA B  55      44.554  -9.222  42.091  1.00  0.92           O  
ATOM   7184  CB  ALA B  55      41.255  -9.547  41.516  1.00  0.92           C  
ATOM   7185  N   LEU B  56      43.909 -11.232  41.329  1.00  0.90           N  
ATOM   7186  CA  LEU B  56      45.080 -11.939  41.816  1.00  0.90           C  
ATOM   7187  C   LEU B  56      46.371 -11.541  41.129  1.00  0.90           C  
ATOM   7188  O   LEU B  56      47.395 -11.338  41.782  1.00  0.90           O  
ATOM   7189  CB  LEU B  56      44.890 -13.463  41.664  1.00  0.90           C  
ATOM   7190  CG  LEU B  56      46.015 -14.341  42.251  1.00  0.90           C  
ATOM   7191  CD1 LEU B  56      46.303 -14.046  43.730  1.00  0.90           C  
ATOM   7192  CD2 LEU B  56      45.649 -15.818  42.072  1.00  0.90           C  
ATOM   7193  N   ALA B  57      46.352 -11.385  39.790  1.00  0.94           N  
ATOM   7194  CA  ALA B  57      47.504 -10.974  39.021  1.00  0.94           C  
ATOM   7195  C   ALA B  57      48.026  -9.622  39.452  1.00  0.94           C  
ATOM   7196  O   ALA B  57      49.206  -9.495  39.746  1.00  0.94           O  
ATOM   7197  CB  ALA B  57      47.168 -10.919  37.520  1.00  0.94           C  
ATOM   7198  N   HIS B  58      47.143  -8.612  39.598  1.00  0.86           N  
ATOM   7199  CA  HIS B  58      47.490  -7.308  40.142  1.00  0.86           C  
ATOM   7200  C   HIS B  58      47.984  -7.353  41.580  1.00  0.86           C  
ATOM   7201  O   HIS B  58      48.962  -6.693  41.920  1.00  0.86           O  
ATOM   7202  CB  HIS B  58      46.306  -6.328  40.060  1.00  0.86           C  
ATOM   7203  CG  HIS B  58      46.063  -5.815  38.672  1.00  0.86           C  
ATOM   7204  ND1 HIS B  58      46.932  -4.888  38.127  1.00  0.86           N  
ATOM   7205  CD2 HIS B  58      45.074  -6.100  37.787  1.00  0.86           C  
ATOM   7206  CE1 HIS B  58      46.454  -4.627  36.930  1.00  0.86           C  
ATOM   7207  NE2 HIS B  58      45.329  -5.336  36.670  1.00  0.86           N  
ATOM   7208  N   THR B  59      47.364  -8.169  42.459  1.00  0.86           N  
ATOM   7209  CA  THR B  59      47.854  -8.375  43.824  1.00  0.86           C  
ATOM   7210  C   THR B  59      49.267  -8.905  43.883  1.00  0.86           C  
ATOM   7211  O   THR B  59      50.131  -8.326  44.535  1.00  0.86           O  
ATOM   7212  CB  THR B  59      46.992  -9.372  44.585  1.00  0.86           C  
ATOM   7213  OG1 THR B  59      45.710  -8.811  44.764  1.00  0.86           O  
ATOM   7214  CG2 THR B  59      47.537  -9.672  45.986  1.00  0.86           C  
ATOM   7215  N   VAL B  60      49.571  -9.995  43.152  1.00  0.88           N  
ATOM   7216  CA  VAL B  60      50.918 -10.542  43.032  1.00  0.88           C  
ATOM   7217  C   VAL B  60      51.861  -9.567  42.350  1.00  0.88           C  
ATOM   7218  O   VAL B  60      53.036  -9.456  42.705  1.00  0.88           O  
ATOM   7219  CB  VAL B  60      50.936 -11.876  42.293  1.00  0.88           C  
ATOM   7220  CG1 VAL B  60      52.371 -12.420  42.174  1.00  0.88           C  
ATOM   7221  CG2 VAL B  60      50.086 -12.914  43.047  1.00  0.88           C  
ATOM   7222  N   ARG B  61      51.360  -8.807  41.358  1.00  0.83           N  
ATOM   7223  CA  ARG B  61      52.114  -7.801  40.653  1.00  0.83           C  
ATOM   7224  C   ARG B  61      52.659  -6.728  41.558  1.00  0.83           C  
ATOM   7225  O   ARG B  61      53.822  -6.365  41.404  1.00  0.83           O  
ATOM   7226  CB  ARG B  61      51.309  -7.117  39.540  1.00  0.83           C  
ATOM   7227  CG  ARG B  61      52.220  -6.612  38.418  1.00  0.83           C  
ATOM   7228  CD  ARG B  61      51.557  -5.573  37.533  1.00  0.83           C  
ATOM   7229  NE  ARG B  61      51.749  -4.218  38.121  1.00  0.83           N  
ATOM   7230  CZ  ARG B  61      51.277  -3.134  37.497  1.00  0.83           C  
ATOM   7231  NH1 ARG B  61      50.542  -3.249  36.391  1.00  0.83           N  
ATOM   7232  NH2 ARG B  61      51.562  -1.917  37.947  1.00  0.83           N  
ATOM   7233  N   ASP B  62      51.887  -6.248  42.567  1.00  0.82           N  
ATOM   7234  CA  ASP B  62      52.421  -5.418  43.630  1.00  0.82           C  
ATOM   7235  C   ASP B  62      53.667  -6.111  44.234  1.00  0.82           C  
ATOM   7236  O   ASP B  62      54.777  -5.672  44.065  1.00  0.82           O  
ATOM   7237  CB  ASP B  62      51.358  -5.095  44.735  1.00  0.82           C  
ATOM   7238  CG  ASP B  62      50.217  -4.176  44.296  1.00  0.82           C  
ATOM   7239  OD1 ASP B  62      50.399  -3.402  43.329  1.00  0.82           O  
ATOM   7240  OD2 ASP B  62      49.147  -4.176  44.979  1.00  0.82           O  
ATOM   7241  N   HIS B  63      53.555  -7.331  44.801  1.00  0.80           N  
ATOM   7242  CA  HIS B  63      54.727  -7.984  45.393  1.00  0.80           C  
ATOM   7243  C   HIS B  63      55.937  -8.139  44.465  1.00  0.80           C  
ATOM   7244  O   HIS B  63      57.073  -8.068  44.912  1.00  0.80           O  
ATOM   7245  CB  HIS B  63      54.373  -9.374  45.943  1.00  0.80           C  
ATOM   7246  CG  HIS B  63      53.339  -9.362  47.033  1.00  0.80           C  
ATOM   7247  ND1 HIS B  63      53.684  -9.303  48.368  1.00  0.80           N  
ATOM   7248  CD2 HIS B  63      51.997  -9.293  46.905  1.00  0.80           C  
ATOM   7249  CE1 HIS B  63      52.541  -9.187  49.019  1.00  0.80           C  
ATOM   7250  NE2 HIS B  63      51.486  -9.168  48.177  1.00  0.80           N  
ATOM   7251  N   LEU B  64      55.708  -8.312  43.148  1.00  0.83           N  
ATOM   7252  CA  LEU B  64      56.725  -8.194  42.115  1.00  0.83           C  
ATOM   7253  C   LEU B  64      57.340  -6.795  41.922  1.00  0.83           C  
ATOM   7254  O   LEU B  64      58.562  -6.630  41.925  1.00  0.83           O  
ATOM   7255  CB  LEU B  64      56.052  -8.612  40.778  1.00  0.83           C  
ATOM   7256  CG  LEU B  64      56.768  -9.668  39.925  1.00  0.83           C  
ATOM   7257  CD1 LEU B  64      56.089  -9.735  38.549  1.00  0.83           C  
ATOM   7258  CD2 LEU B  64      58.270  -9.451  39.780  1.00  0.83           C  
ATOM   7259  N   VAL B  65      56.520  -5.732  41.768  1.00  0.80           N  
ATOM   7260  CA  VAL B  65      56.964  -4.383  41.422  1.00  0.80           C  
ATOM   7261  C   VAL B  65      57.870  -3.756  42.463  1.00  0.80           C  
ATOM   7262  O   VAL B  65      58.871  -3.121  42.143  1.00  0.80           O  
ATOM   7263  CB  VAL B  65      55.794  -3.433  41.139  1.00  0.80           C  
ATOM   7264  CG1 VAL B  65      56.248  -1.967  40.983  1.00  0.80           C  
ATOM   7265  CG2 VAL B  65      55.084  -3.837  39.835  1.00  0.80           C  
ATOM   7266  N   GLY B  66      57.576  -3.924  43.763  1.00  0.82           N  
ATOM   7267  CA  GLY B  66      58.422  -3.323  44.795  1.00  0.82           C  
ATOM   7268  C   GLY B  66      59.795  -3.940  44.919  1.00  0.82           C  
ATOM   7269  O   GLY B  66      60.768  -3.256  45.234  1.00  0.82           O  
ATOM   7270  N   ARG B  67      59.918  -5.252  44.625  1.00  0.78           N  
ATOM   7271  CA  ARG B  67      61.196  -5.925  44.455  1.00  0.78           C  
ATOM   7272  C   ARG B  67      61.938  -5.423  43.222  1.00  0.78           C  
ATOM   7273  O   ARG B  67      63.155  -5.243  43.245  1.00  0.78           O  
ATOM   7274  CB  ARG B  67      61.025  -7.447  44.248  1.00  0.78           C  
ATOM   7275  CG  ARG B  67      60.189  -8.231  45.271  1.00  0.78           C  
ATOM   7276  CD  ARG B  67      60.870  -8.507  46.611  1.00  0.78           C  
ATOM   7277  NE  ARG B  67      60.336  -9.799  47.178  1.00  0.78           N  
ATOM   7278  CZ  ARG B  67      59.098 -10.010  47.647  1.00  0.78           C  
ATOM   7279  NH1 ARG B  67      58.134  -9.107  47.533  1.00  0.78           N  
ATOM   7280  NH2 ARG B  67      58.801 -11.182  48.208  1.00  0.78           N  
ATOM   7281  N   TRP B  68      61.206  -5.172  42.111  1.00  0.85           N  
ATOM   7282  CA  TRP B  68      61.746  -4.604  40.886  1.00  0.85           C  
ATOM   7283  C   TRP B  68      62.352  -3.232  41.095  1.00  0.85           C  
ATOM   7284  O   TRP B  68      63.496  -2.993  40.716  1.00  0.85           O  
ATOM   7285  CB  TRP B  68      60.651  -4.525  39.786  1.00  0.85           C  
ATOM   7286  CG  TRP B  68      61.156  -4.118  38.412  1.00  0.85           C  
ATOM   7287  CD1 TRP B  68      61.727  -4.904  37.455  1.00  0.85           C  
ATOM   7288  CD2 TRP B  68      61.201  -2.770  37.907  1.00  0.85           C  
ATOM   7289  NE1 TRP B  68      62.088  -4.146  36.371  1.00  0.85           N  
ATOM   7290  CE2 TRP B  68      61.776  -2.837  36.620  1.00  0.85           C  
ATOM   7291  CE3 TRP B  68      60.819  -1.550  38.457  1.00  0.85           C  
ATOM   7292  CZ2 TRP B  68      61.967  -1.691  35.862  1.00  0.85           C  
ATOM   7293  CZ3 TRP B  68      61.082  -0.384  37.721  1.00  0.85           C  
ATOM   7294  CH2 TRP B  68      61.637  -0.454  36.434  1.00  0.85           C  
ATOM   7295  N   ILE B  69      61.634  -2.319  41.780  1.00  0.85           N  
ATOM   7296  CA  ILE B  69      62.127  -0.980  42.071  1.00  0.85           C  
ATOM   7297  C   ILE B  69      63.394  -1.029  42.910  1.00  0.85           C  
ATOM   7298  O   ILE B  69      64.403  -0.424  42.565  1.00  0.85           O  
ATOM   7299  CB  ILE B  69      61.062  -0.119  42.754  1.00  0.85           C  
ATOM   7300  CG1 ILE B  69      59.848   0.092  41.820  1.00  0.85           C  
ATOM   7301  CG2 ILE B  69      61.661   1.250  43.142  1.00  0.85           C  
ATOM   7302  CD1 ILE B  69      58.643   0.726  42.518  1.00  0.85           C  
ATOM   7303  N   ARG B  70      63.426  -1.830  43.993  1.00  0.79           N  
ATOM   7304  CA  ARG B  70      64.633  -2.003  44.786  1.00  0.79           C  
ATOM   7305  C   ARG B  70      65.794  -2.652  44.040  1.00  0.79           C  
ATOM   7306  O   ARG B  70      66.931  -2.202  44.155  1.00  0.79           O  
ATOM   7307  CB  ARG B  70      64.333  -2.785  46.088  1.00  0.79           C  
ATOM   7308  CG  ARG B  70      63.465  -2.013  47.109  1.00  0.79           C  
ATOM   7309  CD  ARG B  70      64.022  -0.622  47.442  1.00  0.79           C  
ATOM   7310  NE  ARG B  70      63.323  -0.107  48.662  1.00  0.79           N  
ATOM   7311  CZ  ARG B  70      63.349   1.181  49.025  1.00  0.79           C  
ATOM   7312  NH1 ARG B  70      63.886   2.127  48.260  1.00  0.79           N  
ATOM   7313  NH2 ARG B  70      62.782   1.545  50.177  1.00  0.79           N  
ATOM   7314  N   THR B  71      65.532  -3.687  43.215  1.00  0.87           N  
ATOM   7315  CA  THR B  71      66.533  -4.307  42.342  1.00  0.87           C  
ATOM   7316  C   THR B  71      67.133  -3.310  41.366  1.00  0.87           C  
ATOM   7317  O   THR B  71      68.350  -3.189  41.231  1.00  0.87           O  
ATOM   7318  CB  THR B  71      65.967  -5.451  41.507  1.00  0.87           C  
ATOM   7319  OG1 THR B  71      65.431  -6.464  42.353  1.00  0.87           O  
ATOM   7320  CG2 THR B  71      67.068  -6.083  40.638  1.00  0.87           C  
ATOM   7321  N   GLN B  72      66.292  -2.511  40.681  1.00  0.84           N  
ATOM   7322  CA  GLN B  72      66.773  -1.502  39.759  1.00  0.84           C  
ATOM   7323  C   GLN B  72      67.525  -0.363  40.437  1.00  0.84           C  
ATOM   7324  O   GLN B  72      68.585   0.038  39.958  1.00  0.84           O  
ATOM   7325  CB  GLN B  72      65.651  -0.958  38.846  1.00  0.84           C  
ATOM   7326  CG  GLN B  72      64.976  -2.022  37.941  1.00  0.84           C  
ATOM   7327  CD  GLN B  72      65.956  -2.845  37.099  1.00  0.84           C  
ATOM   7328  OE1 GLN B  72      66.751  -2.336  36.299  1.00  0.84           O  
ATOM   7329  NE2 GLN B  72      65.899  -4.188  37.278  1.00  0.84           N  
ATOM   7330  N   GLN B  73      67.049   0.136  41.601  1.00  0.79           N  
ATOM   7331  CA  GLN B  73      67.748   1.119  42.423  1.00  0.79           C  
ATOM   7332  C   GLN B  73      69.120   0.630  42.880  1.00  0.79           C  
ATOM   7333  O   GLN B  73      70.113   1.350  42.789  1.00  0.79           O  
ATOM   7334  CB  GLN B  73      66.912   1.480  43.681  1.00  0.79           C  
ATOM   7335  CG  GLN B  73      65.658   2.333  43.377  1.00  0.79           C  
ATOM   7336  CD  GLN B  73      64.822   2.623  44.626  1.00  0.79           C  
ATOM   7337  OE1 GLN B  73      64.962   2.052  45.716  1.00  0.79           O  
ATOM   7338  NE2 GLN B  73      63.861   3.557  44.466  1.00  0.79           N  
ATOM   7339  N   HIS B  74      69.220  -0.646  43.305  1.00  0.80           N  
ATOM   7340  CA  HIS B  74      70.470  -1.307  43.663  1.00  0.80           C  
ATOM   7341  C   HIS B  74      71.505  -1.328  42.536  1.00  0.80           C  
ATOM   7342  O   HIS B  74      72.699  -1.116  42.732  1.00  0.80           O  
ATOM   7343  CB  HIS B  74      70.166  -2.760  44.097  1.00  0.80           C  
ATOM   7344  CG  HIS B  74      71.361  -3.571  44.497  1.00  0.80           C  
ATOM   7345  ND1 HIS B  74      72.019  -3.280  45.672  1.00  0.80           N  
ATOM   7346  CD2 HIS B  74      71.971  -4.604  43.862  1.00  0.80           C  
ATOM   7347  CE1 HIS B  74      73.012  -4.137  45.736  1.00  0.80           C  
ATOM   7348  NE2 HIS B  74      73.034  -4.964  44.664  1.00  0.80           N  
ATOM   7349  N   TYR B  75      71.080  -1.554  41.278  1.00  0.83           N  
ATOM   7350  CA  TYR B  75      71.973  -1.474  40.132  1.00  0.83           C  
ATOM   7351  C   TYR B  75      72.503  -0.081  39.831  1.00  0.83           C  
ATOM   7352  O   TYR B  75      73.622   0.080  39.355  1.00  0.83           O  
ATOM   7353  CB  TYR B  75      71.311  -2.037  38.851  1.00  0.83           C  
ATOM   7354  CG  TYR B  75      70.954  -3.498  38.962  1.00  0.83           C  
ATOM   7355  CD1 TYR B  75      71.650  -4.391  39.806  1.00  0.83           C  
ATOM   7356  CD2 TYR B  75      69.887  -3.996  38.189  1.00  0.83           C  
ATOM   7357  CE1 TYR B  75      71.259  -5.728  39.910  1.00  0.83           C  
ATOM   7358  CE2 TYR B  75      69.509  -5.341  38.280  1.00  0.83           C  
ATOM   7359  CZ  TYR B  75      70.192  -6.192  39.154  1.00  0.83           C  
ATOM   7360  OH  TYR B  75      69.815  -7.530  39.281  1.00  0.83           O  
ATOM   7361  N   TYR B  76      71.727   0.985  40.071  1.00  0.80           N  
ATOM   7362  CA  TYR B  76      72.268   2.338  40.027  1.00  0.80           C  
ATOM   7363  C   TYR B  76      73.204   2.639  41.194  1.00  0.80           C  
ATOM   7364  O   TYR B  76      74.208   3.322  41.026  1.00  0.80           O  
ATOM   7365  CB  TYR B  76      71.146   3.396  39.913  1.00  0.80           C  
ATOM   7366  CG  TYR B  76      70.627   3.418  38.494  1.00  0.80           C  
ATOM   7367  CD1 TYR B  76      69.555   2.604  38.090  1.00  0.80           C  
ATOM   7368  CD2 TYR B  76      71.224   4.260  37.541  1.00  0.80           C  
ATOM   7369  CE1 TYR B  76      69.073   2.638  36.773  1.00  0.80           C  
ATOM   7370  CE2 TYR B  76      70.738   4.305  36.226  1.00  0.80           C  
ATOM   7371  CZ  TYR B  76      69.650   3.512  35.850  1.00  0.80           C  
ATOM   7372  OH  TYR B  76      69.112   3.644  34.555  1.00  0.80           O  
ATOM   7373  N   GLU B  77      72.924   2.107  42.401  1.00  0.76           N  
ATOM   7374  CA  GLU B  77      73.793   2.238  43.564  1.00  0.76           C  
ATOM   7375  C   GLU B  77      75.164   1.605  43.361  1.00  0.76           C  
ATOM   7376  O   GLU B  77      76.200   2.173  43.702  1.00  0.76           O  
ATOM   7377  CB  GLU B  77      73.121   1.584  44.800  1.00  0.76           C  
ATOM   7378  CG  GLU B  77      73.902   1.743  46.132  1.00  0.76           C  
ATOM   7379  CD  GLU B  77      73.409   0.781  47.212  1.00  0.76           C  
ATOM   7380  OE1 GLU B  77      72.262   0.967  47.683  1.00  0.76           O  
ATOM   7381  OE2 GLU B  77      74.182  -0.155  47.576  1.00  0.76           O  
ATOM   7382  N   ARG B  78      75.211   0.395  42.775  1.00  0.77           N  
ATOM   7383  CA  ARG B  78      76.460  -0.332  42.664  1.00  0.77           C  
ATOM   7384  C   ARG B  78      77.139  -0.242  41.316  1.00  0.77           C  
ATOM   7385  O   ARG B  78      78.298  -0.636  41.200  1.00  0.77           O  
ATOM   7386  CB  ARG B  78      76.186  -1.833  42.936  1.00  0.77           C  
ATOM   7387  CG  ARG B  78      75.703  -2.130  44.370  1.00  0.77           C  
ATOM   7388  CD  ARG B  78      76.722  -1.749  45.444  1.00  0.77           C  
ATOM   7389  NE  ARG B  78      76.119  -2.096  46.762  1.00  0.77           N  
ATOM   7390  CZ  ARG B  78      76.799  -2.016  47.911  1.00  0.77           C  
ATOM   7391  NH1 ARG B  78      76.189  -2.351  49.043  1.00  0.77           N  
ATOM   7392  NH2 ARG B  78      78.067  -1.615  47.944  1.00  0.77           N  
ATOM   7393  N   ASP B  79      76.444   0.255  40.271  1.00  0.85           N  
ATOM   7394  CA  ASP B  79      76.918   0.289  38.891  1.00  0.85           C  
ATOM   7395  C   ASP B  79      77.573  -1.033  38.399  1.00  0.85           C  
ATOM   7396  O   ASP B  79      78.714  -1.040  37.923  1.00  0.85           O  
ATOM   7397  CB  ASP B  79      77.775   1.574  38.715  1.00  0.85           C  
ATOM   7398  CG  ASP B  79      78.321   1.794  37.321  1.00  0.85           C  
ATOM   7399  OD1 ASP B  79      77.582   2.062  36.336  1.00  0.85           O  
ATOM   7400  OD2 ASP B  79      79.571   1.712  37.188  1.00  0.85           O  
ATOM   7401  N   PRO B  80      76.944  -2.201  38.498  1.00  0.92           N  
ATOM   7402  CA  PRO B  80      77.522  -3.429  37.979  1.00  0.92           C  
ATOM   7403  C   PRO B  80      77.526  -3.447  36.466  1.00  0.92           C  
ATOM   7404  O   PRO B  80      76.831  -2.660  35.820  1.00  0.92           O  
ATOM   7405  CB  PRO B  80      76.578  -4.500  38.532  1.00  0.92           C  
ATOM   7406  CG  PRO B  80      75.210  -3.820  38.472  1.00  0.92           C  
ATOM   7407  CD  PRO B  80      75.526  -2.367  38.821  1.00  0.92           C  
ATOM   7408  N   LYS B  81      78.310  -4.358  35.866  1.00  0.90           N  
ATOM   7409  CA  LYS B  81      78.248  -4.588  34.443  1.00  0.90           C  
ATOM   7410  C   LYS B  81      76.885  -5.107  34.005  1.00  0.90           C  
ATOM   7411  O   LYS B  81      76.393  -6.123  34.493  1.00  0.90           O  
ATOM   7412  CB  LYS B  81      79.374  -5.542  33.993  1.00  0.90           C  
ATOM   7413  CG  LYS B  81      79.407  -5.790  32.479  1.00  0.90           C  
ATOM   7414  CD  LYS B  81      80.696  -6.478  32.010  1.00  0.90           C  
ATOM   7415  CE  LYS B  81      80.705  -6.628  30.488  1.00  0.90           C  
ATOM   7416  NZ  LYS B  81      81.983  -7.182  30.000  1.00  0.90           N  
ATOM   7417  N   ARG B  82      76.228  -4.380  33.085  1.00  0.89           N  
ATOM   7418  CA  ARG B  82      74.882  -4.680  32.665  1.00  0.89           C  
ATOM   7419  C   ARG B  82      74.858  -5.548  31.433  1.00  0.89           C  
ATOM   7420  O   ARG B  82      75.581  -5.332  30.461  1.00  0.89           O  
ATOM   7421  CB  ARG B  82      74.087  -3.390  32.389  1.00  0.89           C  
ATOM   7422  CG  ARG B  82      73.782  -2.606  33.678  1.00  0.89           C  
ATOM   7423  CD  ARG B  82      72.941  -1.363  33.400  1.00  0.89           C  
ATOM   7424  NE  ARG B  82      72.229  -0.952  34.651  1.00  0.89           N  
ATOM   7425  CZ  ARG B  82      72.714  -0.076  35.544  1.00  0.89           C  
ATOM   7426  NH1 ARG B  82      73.982   0.324  35.527  1.00  0.89           N  
ATOM   7427  NH2 ARG B  82      71.893   0.427  36.461  1.00  0.89           N  
ATOM   7428  N   ILE B  83      74.002  -6.576  31.454  1.00  0.96           N  
ATOM   7429  CA  ILE B  83      73.987  -7.593  30.426  1.00  0.96           C  
ATOM   7430  C   ILE B  83      72.713  -7.480  29.646  1.00  0.96           C  
ATOM   7431  O   ILE B  83      71.607  -7.564  30.174  1.00  0.96           O  
ATOM   7432  CB  ILE B  83      74.117  -8.988  31.010  1.00  0.96           C  
ATOM   7433  CG1 ILE B  83      75.453  -9.102  31.771  1.00  0.96           C  
ATOM   7434  CG2 ILE B  83      74.030 -10.052  29.889  1.00  0.96           C  
ATOM   7435  CD1 ILE B  83      75.497 -10.314  32.691  1.00  0.96           C  
ATOM   7436  N   TYR B  84      72.843  -7.283  28.333  1.00  0.97           N  
ATOM   7437  CA  TYR B  84      71.721  -7.055  27.470  1.00  0.97           C  
ATOM   7438  C   TYR B  84      71.590  -8.214  26.518  1.00  0.97           C  
ATOM   7439  O   TYR B  84      72.403  -8.434  25.620  1.00  0.97           O  
ATOM   7440  CB  TYR B  84      71.921  -5.743  26.688  1.00  0.97           C  
ATOM   7441  CG  TYR B  84      71.918  -4.580  27.647  1.00  0.97           C  
ATOM   7442  CD1 TYR B  84      70.700  -4.063  28.100  1.00  0.97           C  
ATOM   7443  CD2 TYR B  84      73.108  -3.993  28.105  1.00  0.97           C  
ATOM   7444  CE1 TYR B  84      70.657  -2.955  28.958  1.00  0.97           C  
ATOM   7445  CE2 TYR B  84      73.075  -2.877  28.959  1.00  0.97           C  
ATOM   7446  CZ  TYR B  84      71.844  -2.342  29.362  1.00  0.97           C  
ATOM   7447  OH  TYR B  84      71.790  -1.141  30.101  1.00  0.97           O  
ATOM   7448  N   TYR B  85      70.522  -9.003  26.700  1.00  0.97           N  
ATOM   7449  CA  TYR B  85      70.232 -10.129  25.850  1.00  0.97           C  
ATOM   7450  C   TYR B  85      69.280  -9.662  24.770  1.00  0.97           C  
ATOM   7451  O   TYR B  85      68.101  -9.399  25.014  1.00  0.97           O  
ATOM   7452  CB  TYR B  85      69.619 -11.279  26.687  1.00  0.97           C  
ATOM   7453  CG  TYR B  85      69.724 -12.594  25.964  1.00  0.97           C  
ATOM   7454  CD1 TYR B  85      70.918 -13.327  26.040  1.00  0.97           C  
ATOM   7455  CD2 TYR B  85      68.653 -13.108  25.212  1.00  0.97           C  
ATOM   7456  CE1 TYR B  85      71.041 -14.554  25.376  1.00  0.97           C  
ATOM   7457  CE2 TYR B  85      68.777 -14.339  24.547  1.00  0.97           C  
ATOM   7458  CZ  TYR B  85      69.972 -15.064  24.636  1.00  0.97           C  
ATOM   7459  OH  TYR B  85      70.127 -16.325  24.025  1.00  0.97           O  
ATOM   7460  N   LEU B  86      69.789  -9.518  23.536  1.00  0.97           N  
ATOM   7461  CA  LEU B  86      68.997  -9.019  22.433  1.00  0.97           C  
ATOM   7462  C   LEU B  86      68.435 -10.193  21.674  1.00  0.97           C  
ATOM   7463  O   LEU B  86      69.155 -11.084  21.218  1.00  0.97           O  
ATOM   7464  CB  LEU B  86      69.799  -8.131  21.447  1.00  0.97           C  
ATOM   7465  CG  LEU B  86      69.870  -6.636  21.817  1.00  0.97           C  
ATOM   7466  CD1 LEU B  86      70.484  -6.416  23.204  1.00  0.97           C  
ATOM   7467  CD2 LEU B  86      70.640  -5.857  20.738  1.00  0.97           C  
ATOM   7468  N   SER B  87      67.107 -10.220  21.519  1.00  0.98           N  
ATOM   7469  CA  SER B  87      66.443 -11.328  20.870  1.00  0.98           C  
ATOM   7470  C   SER B  87      65.217 -10.821  20.167  1.00  0.98           C  
ATOM   7471  O   SER B  87      64.545  -9.896  20.612  1.00  0.98           O  
ATOM   7472  CB  SER B  87      66.017 -12.426  21.880  1.00  0.98           C  
ATOM   7473  OG  SER B  87      65.431 -13.560  21.234  1.00  0.98           O  
ATOM   7474  N   LEU B  88      64.853 -11.450  19.040  1.00  0.96           N  
ATOM   7475  CA  LEU B  88      63.641 -11.096  18.333  1.00  0.96           C  
ATOM   7476  C   LEU B  88      62.500 -11.950  18.853  1.00  0.96           C  
ATOM   7477  O   LEU B  88      61.363 -11.809  18.409  1.00  0.96           O  
ATOM   7478  CB  LEU B  88      63.812 -11.358  16.812  1.00  0.96           C  
ATOM   7479  CG  LEU B  88      64.386 -10.184  15.988  1.00  0.96           C  
ATOM   7480  CD1 LEU B  88      63.373  -9.041  15.863  1.00  0.96           C  
ATOM   7481  CD2 LEU B  88      65.723  -9.658  16.524  1.00  0.96           C  
ATOM   7482  N   GLU B  89      62.776 -12.834  19.829  1.00  0.94           N  
ATOM   7483  CA  GLU B  89      61.795 -13.727  20.401  1.00  0.94           C  
ATOM   7484  C   GLU B  89      61.988 -13.912  21.898  1.00  0.94           C  
ATOM   7485  O   GLU B  89      63.100 -14.079  22.399  1.00  0.94           O  
ATOM   7486  CB  GLU B  89      61.875 -15.129  19.766  1.00  0.94           C  
ATOM   7487  CG  GLU B  89      61.459 -15.176  18.283  1.00  0.94           C  
ATOM   7488  CD  GLU B  89      61.519 -16.592  17.741  1.00  0.94           C  
ATOM   7489  OE1 GLU B  89      61.437 -17.564  18.542  1.00  0.94           O  
ATOM   7490  OE2 GLU B  89      61.585 -16.723  16.495  1.00  0.94           O  
ATOM   7491  N   PHE B  90      60.873 -13.914  22.645  1.00  0.94           N  
ATOM   7492  CA  PHE B  90      60.838 -14.168  24.069  1.00  0.94           C  
ATOM   7493  C   PHE B  90      59.607 -15.007  24.365  1.00  0.94           C  
ATOM   7494  O   PHE B  90      58.503 -14.501  24.557  1.00  0.94           O  
ATOM   7495  CB  PHE B  90      60.757 -12.845  24.872  1.00  0.94           C  
ATOM   7496  CG  PHE B  90      62.129 -12.265  25.044  1.00  0.94           C  
ATOM   7497  CD1 PHE B  90      62.985 -12.802  26.018  1.00  0.94           C  
ATOM   7498  CD2 PHE B  90      62.589 -11.212  24.237  1.00  0.94           C  
ATOM   7499  CE1 PHE B  90      64.290 -12.317  26.165  1.00  0.94           C  
ATOM   7500  CE2 PHE B  90      63.890 -10.718  24.391  1.00  0.94           C  
ATOM   7501  CZ  PHE B  90      64.747 -11.278  25.348  1.00  0.94           C  
ATOM   7502  N   TYR B  91      59.762 -16.343  24.412  1.00  0.92           N  
ATOM   7503  CA  TYR B  91      58.661 -17.285  24.540  1.00  0.92           C  
ATOM   7504  C   TYR B  91      58.350 -17.549  26.008  1.00  0.92           C  
ATOM   7505  O   TYR B  91      58.594 -18.624  26.566  1.00  0.92           O  
ATOM   7506  CB  TYR B  91      59.037 -18.596  23.797  1.00  0.92           C  
ATOM   7507  CG  TYR B  91      57.920 -19.410  23.198  1.00  0.92           C  
ATOM   7508  CD1 TYR B  91      56.552 -19.124  23.354  1.00  0.92           C  
ATOM   7509  CD2 TYR B  91      58.291 -20.506  22.399  1.00  0.92           C  
ATOM   7510  CE1 TYR B  91      55.582 -19.906  22.706  1.00  0.92           C  
ATOM   7511  CE2 TYR B  91      57.326 -21.289  21.755  1.00  0.92           C  
ATOM   7512  CZ  TYR B  91      55.972 -20.981  21.902  1.00  0.92           C  
ATOM   7513  OH  TYR B  91      55.013 -21.755  21.224  1.00  0.92           O  
ATOM   7514  N   MET B  92      57.852 -16.513  26.694  1.00  0.92           N  
ATOM   7515  CA  MET B  92      57.700 -16.483  28.133  1.00  0.92           C  
ATOM   7516  C   MET B  92      56.686 -17.456  28.710  1.00  0.92           C  
ATOM   7517  O   MET B  92      56.961 -18.103  29.723  1.00  0.92           O  
ATOM   7518  CB  MET B  92      57.377 -15.051  28.604  1.00  0.92           C  
ATOM   7519  CG  MET B  92      58.436 -14.004  28.208  1.00  0.92           C  
ATOM   7520  SD  MET B  92      60.105 -14.342  28.842  1.00  0.92           S  
ATOM   7521  CE  MET B  92      59.820 -13.753  30.536  1.00  0.92           C  
ATOM   7522  N   GLY B  93      55.514 -17.609  28.058  1.00  0.96           N  
ATOM   7523  CA  GLY B  93      54.418 -18.422  28.582  1.00  0.96           C  
ATOM   7524  C   GLY B  93      53.576 -17.658  29.569  1.00  0.96           C  
ATOM   7525  O   GLY B  93      53.412 -16.450  29.442  1.00  0.96           O  
ATOM   7526  N   ARG B  94      52.992 -18.357  30.559  1.00  0.89           N  
ATOM   7527  CA  ARG B  94      52.236 -17.746  31.644  1.00  0.89           C  
ATOM   7528  C   ARG B  94      53.130 -17.182  32.747  1.00  0.89           C  
ATOM   7529  O   ARG B  94      54.223 -17.693  33.008  1.00  0.89           O  
ATOM   7530  CB  ARG B  94      51.305 -18.791  32.301  1.00  0.89           C  
ATOM   7531  CG  ARG B  94      50.161 -19.279  31.393  1.00  0.89           C  
ATOM   7532  CD  ARG B  94      49.343 -20.376  32.076  1.00  0.89           C  
ATOM   7533  NE  ARG B  94      48.161 -20.696  31.220  1.00  0.89           N  
ATOM   7534  CZ  ARG B  94      47.426 -21.796  31.416  1.00  0.89           C  
ATOM   7535  NH1 ARG B  94      47.791 -22.710  32.316  1.00  0.89           N  
ATOM   7536  NH2 ARG B  94      46.321 -22.016  30.713  1.00  0.89           N  
ATOM   7537  N   THR B  95      52.680 -16.133  33.457  1.00  0.95           N  
ATOM   7538  CA  THR B  95      53.495 -15.461  34.466  1.00  0.95           C  
ATOM   7539  C   THR B  95      52.984 -15.663  35.882  1.00  0.95           C  
ATOM   7540  O   THR B  95      53.791 -15.667  36.814  1.00  0.95           O  
ATOM   7541  CB  THR B  95      53.565 -13.957  34.204  1.00  0.95           C  
ATOM   7542  OG1 THR B  95      54.183 -13.697  32.952  1.00  0.95           O  
ATOM   7543  CG2 THR B  95      54.378 -13.185  35.254  1.00  0.95           C  
ATOM   7544  N   LEU B  96      51.667 -15.880  36.134  1.00  0.93           N  
ATOM   7545  CA  LEU B  96      51.120 -15.829  37.498  1.00  0.93           C  
ATOM   7546  C   LEU B  96      51.750 -16.819  38.475  1.00  0.93           C  
ATOM   7547  O   LEU B  96      52.310 -16.441  39.507  1.00  0.93           O  
ATOM   7548  CB  LEU B  96      49.576 -16.062  37.516  1.00  0.93           C  
ATOM   7549  CG  LEU B  96      48.735 -15.277  38.565  1.00  0.93           C  
ATOM   7550  CD1 LEU B  96      47.472 -16.060  38.964  1.00  0.93           C  
ATOM   7551  CD2 LEU B  96      49.468 -14.888  39.855  1.00  0.93           C  
ATOM   7552  N   GLN B  97      51.753 -18.123  38.126  1.00  0.91           N  
ATOM   7553  CA  GLN B  97      52.350 -19.152  38.955  1.00  0.91           C  
ATOM   7554  C   GLN B  97      53.850 -18.991  39.111  1.00  0.91           C  
ATOM   7555  O   GLN B  97      54.399 -19.109  40.204  1.00  0.91           O  
ATOM   7556  CB  GLN B  97      52.035 -20.572  38.432  1.00  0.91           C  
ATOM   7557  CG  GLN B  97      52.631 -21.665  39.345  1.00  0.91           C  
ATOM   7558  CD  GLN B  97      52.233 -23.086  38.945  1.00  0.91           C  
ATOM   7559  OE1 GLN B  97      52.180 -23.454  37.775  1.00  0.91           O  
ATOM   7560  NE2 GLN B  97      52.028 -23.937  39.978  1.00  0.91           N  
ATOM   7561  N   ASN B  98      54.563 -18.661  38.015  1.00  0.93           N  
ATOM   7562  CA  ASN B  98      56.004 -18.478  38.037  1.00  0.93           C  
ATOM   7563  C   ASN B  98      56.426 -17.357  38.977  1.00  0.93           C  
ATOM   7564  O   ASN B  98      57.359 -17.510  39.763  1.00  0.93           O  
ATOM   7565  CB  ASN B  98      56.524 -18.234  36.595  1.00  0.93           C  
ATOM   7566  CG  ASN B  98      58.049 -18.170  36.488  1.00  0.93           C  
ATOM   7567  OD1 ASN B  98      58.597 -17.134  36.126  1.00  0.93           O  
ATOM   7568  ND2 ASN B  98      58.750 -19.293  36.765  1.00  0.93           N  
ATOM   7569  N   THR B  99      55.699 -16.227  38.964  1.00  0.94           N  
ATOM   7570  CA  THR B  99      55.905 -15.146  39.915  1.00  0.94           C  
ATOM   7571  C   THR B  99      55.644 -15.566  41.347  1.00  0.94           C  
ATOM   7572  O   THR B  99      56.450 -15.312  42.240  1.00  0.94           O  
ATOM   7573  CB  THR B  99      55.027 -13.939  39.626  1.00  0.94           C  
ATOM   7574  OG1 THR B  99      55.340 -13.421  38.345  1.00  0.94           O  
ATOM   7575  CG2 THR B  99      55.340 -12.819  40.615  1.00  0.94           C  
ATOM   7576  N   MET B 100      54.526 -16.269  41.619  1.00  0.89           N  
ATOM   7577  CA  MET B 100      54.219 -16.736  42.960  1.00  0.89           C  
ATOM   7578  C   MET B 100      55.228 -17.719  43.533  1.00  0.89           C  
ATOM   7579  O   MET B 100      55.592 -17.602  44.700  1.00  0.89           O  
ATOM   7580  CB  MET B 100      52.802 -17.346  43.060  1.00  0.89           C  
ATOM   7581  CG  MET B 100      51.680 -16.303  42.909  1.00  0.89           C  
ATOM   7582  SD  MET B 100      50.007 -16.940  43.214  1.00  0.89           S  
ATOM   7583  CE  MET B 100      50.029 -18.172  41.888  1.00  0.89           C  
ATOM   7584  N   VAL B 101      55.736 -18.702  42.763  1.00  0.92           N  
ATOM   7585  CA  VAL B 101      56.778 -19.594  43.272  1.00  0.92           C  
ATOM   7586  C   VAL B 101      58.104 -18.894  43.506  1.00  0.92           C  
ATOM   7587  O   VAL B 101      58.749 -19.095  44.535  1.00  0.92           O  
ATOM   7588  CB  VAL B 101      56.994 -20.865  42.462  1.00  0.92           C  
ATOM   7589  CG1 VAL B 101      55.629 -21.536  42.246  1.00  0.92           C  
ATOM   7590  CG2 VAL B 101      57.712 -20.613  41.125  1.00  0.92           C  
ATOM   7591  N   ASN B 102      58.525 -18.008  42.576  1.00  0.92           N  
ATOM   7592  CA  ASN B 102      59.778 -17.284  42.671  1.00  0.92           C  
ATOM   7593  C   ASN B 102      59.812 -16.339  43.863  1.00  0.92           C  
ATOM   7594  O   ASN B 102      60.850 -16.163  44.496  1.00  0.92           O  
ATOM   7595  CB  ASN B 102      60.101 -16.527  41.355  1.00  0.92           C  
ATOM   7596  CG  ASN B 102      60.735 -17.472  40.333  1.00  0.92           C  
ATOM   7597  OD1 ASN B 102      61.612 -18.270  40.658  1.00  0.92           O  
ATOM   7598  ND2 ASN B 102      60.309 -17.385  39.058  1.00  0.92           N  
ATOM   7599  N   LEU B 103      58.667 -15.732  44.229  1.00  0.87           N  
ATOM   7600  CA  LEU B 103      58.596 -14.840  45.369  1.00  0.87           C  
ATOM   7601  C   LEU B 103      58.085 -15.513  46.638  1.00  0.87           C  
ATOM   7602  O   LEU B 103      57.939 -14.856  47.668  1.00  0.87           O  
ATOM   7603  CB  LEU B 103      57.666 -13.647  45.046  1.00  0.87           C  
ATOM   7604  CG  LEU B 103      58.049 -12.818  43.801  1.00  0.87           C  
ATOM   7605  CD1 LEU B 103      57.237 -11.519  43.781  1.00  0.87           C  
ATOM   7606  CD2 LEU B 103      59.546 -12.491  43.705  1.00  0.87           C  
ATOM   7607  N   GLY B 104      57.821 -16.840  46.606  1.00  0.87           N  
ATOM   7608  CA  GLY B 104      57.356 -17.618  47.758  1.00  0.87           C  
ATOM   7609  C   GLY B 104      55.946 -17.343  48.215  1.00  0.87           C  
ATOM   7610  O   GLY B 104      55.597 -17.565  49.371  1.00  0.87           O  
ATOM   7611  N   LEU B 105      55.079 -16.868  47.314  1.00  0.85           N  
ATOM   7612  CA  LEU B 105      53.746 -16.416  47.659  1.00  0.85           C  
ATOM   7613  C   LEU B 105      52.671 -17.439  47.383  1.00  0.85           C  
ATOM   7614  O   LEU B 105      51.519 -17.237  47.755  1.00  0.85           O  
ATOM   7615  CB  LEU B 105      53.387 -15.190  46.793  1.00  0.85           C  
ATOM   7616  CG  LEU B 105      54.206 -13.933  47.112  1.00  0.85           C  
ATOM   7617  CD1 LEU B 105      53.959 -12.871  46.039  1.00  0.85           C  
ATOM   7618  CD2 LEU B 105      53.863 -13.366  48.496  1.00  0.85           C  
ATOM   7619  N   GLN B 106      53.002 -18.580  46.745  1.00  0.83           N  
ATOM   7620  CA  GLN B 106      52.007 -19.536  46.273  1.00  0.83           C  
ATOM   7621  C   GLN B 106      51.080 -20.077  47.351  1.00  0.83           C  
ATOM   7622  O   GLN B 106      49.865 -20.035  47.202  1.00  0.83           O  
ATOM   7623  CB  GLN B 106      52.718 -20.717  45.560  1.00  0.83           C  
ATOM   7624  CG  GLN B 106      51.772 -21.814  44.998  1.00  0.83           C  
ATOM   7625  CD  GLN B 106      52.554 -22.966  44.362  1.00  0.83           C  
ATOM   7626  OE1 GLN B 106      53.757 -23.119  44.568  1.00  0.83           O  
ATOM   7627  NE2 GLN B 106      51.858 -23.811  43.566  1.00  0.83           N  
ATOM   7628  N   ASN B 107      51.627 -20.523  48.498  1.00  0.81           N  
ATOM   7629  CA  ASN B 107      50.827 -21.022  49.608  1.00  0.81           C  
ATOM   7630  C   ASN B 107      49.935 -19.955  50.244  1.00  0.81           C  
ATOM   7631  O   ASN B 107      48.763 -20.176  50.530  1.00  0.81           O  
ATOM   7632  CB  ASN B 107      51.743 -21.621  50.704  1.00  0.81           C  
ATOM   7633  CG  ASN B 107      52.574 -22.756  50.115  1.00  0.81           C  
ATOM   7634  OD1 ASN B 107      52.065 -23.676  49.485  1.00  0.81           O  
ATOM   7635  ND2 ASN B 107      53.913 -22.691  50.305  1.00  0.81           N  
ATOM   7636  N   ALA B 108      50.473 -18.737  50.459  1.00  0.87           N  
ATOM   7637  CA  ALA B 108      49.722 -17.628  51.015  1.00  0.87           C  
ATOM   7638  C   ALA B 108      48.600 -17.147  50.104  1.00  0.87           C  
ATOM   7639  O   ALA B 108      47.477 -16.888  50.535  1.00  0.87           O  
ATOM   7640  CB  ALA B 108      50.689 -16.470  51.317  1.00  0.87           C  
ATOM   7641  N   CYS B 109      48.880 -17.049  48.792  1.00  0.86           N  
ATOM   7642  CA  CYS B 109      47.880 -16.735  47.794  1.00  0.86           C  
ATOM   7643  C   CYS B 109      46.812 -17.798  47.651  1.00  0.86           C  
ATOM   7644  O   CYS B 109      45.637 -17.461  47.573  1.00  0.86           O  
ATOM   7645  CB  CYS B 109      48.519 -16.470  46.416  1.00  0.86           C  
ATOM   7646  SG  CYS B 109      49.385 -14.863  46.395  1.00  0.86           S  
ATOM   7647  N   ASP B 110      47.165 -19.099  47.652  1.00  0.86           N  
ATOM   7648  CA  ASP B 110      46.199 -20.190  47.587  1.00  0.86           C  
ATOM   7649  C   ASP B 110      45.189 -20.154  48.740  1.00  0.86           C  
ATOM   7650  O   ASP B 110      43.974 -20.148  48.537  1.00  0.86           O  
ATOM   7651  CB  ASP B 110      46.996 -21.519  47.576  1.00  0.86           C  
ATOM   7652  CG  ASP B 110      46.099 -22.730  47.396  1.00  0.86           C  
ATOM   7653  OD1 ASP B 110      45.238 -22.679  46.486  1.00  0.86           O  
ATOM   7654  OD2 ASP B 110      46.280 -23.703  48.170  1.00  0.86           O  
ATOM   7655  N   GLU B 111      45.684 -19.993  49.979  1.00  0.82           N  
ATOM   7656  CA  GLU B 111      44.864 -19.826  51.164  1.00  0.82           C  
ATOM   7657  C   GLU B 111      43.973 -18.585  51.134  1.00  0.82           C  
ATOM   7658  O   GLU B 111      42.781 -18.626  51.434  1.00  0.82           O  
ATOM   7659  CB  GLU B 111      45.808 -19.784  52.384  1.00  0.82           C  
ATOM   7660  CG  GLU B 111      45.113 -19.760  53.763  1.00  0.82           C  
ATOM   7661  CD  GLU B 111      44.147 -20.924  53.966  1.00  0.82           C  
ATOM   7662  OE1 GLU B 111      44.584 -22.089  53.815  1.00  0.82           O  
ATOM   7663  OE2 GLU B 111      42.967 -20.649  54.314  1.00  0.82           O  
ATOM   7664  N   ALA B 112      44.511 -17.428  50.693  1.00  0.87           N  
ATOM   7665  CA  ALA B 112      43.732 -16.213  50.538  1.00  0.87           C  
ATOM   7666  C   ALA B 112      42.588 -16.334  49.535  1.00  0.87           C  
ATOM   7667  O   ALA B 112      41.460 -15.916  49.793  1.00  0.87           O  
ATOM   7668  CB  ALA B 112      44.669 -15.066  50.121  1.00  0.87           C  
ATOM   7669  N   ILE B 113      42.846 -16.959  48.371  1.00  0.85           N  
ATOM   7670  CA  ILE B 113      41.843 -17.256  47.360  1.00  0.85           C  
ATOM   7671  C   ILE B 113      40.819 -18.278  47.861  1.00  0.85           C  
ATOM   7672  O   ILE B 113      39.612 -18.102  47.689  1.00  0.85           O  
ATOM   7673  CB  ILE B 113      42.546 -17.680  46.063  1.00  0.85           C  
ATOM   7674  CG1 ILE B 113      43.422 -16.545  45.481  1.00  0.85           C  
ATOM   7675  CG2 ILE B 113      41.590 -18.185  44.977  1.00  0.85           C  
ATOM   7676  CD1 ILE B 113      42.718 -15.214  45.214  1.00  0.85           C  
ATOM   7677  N   TYR B 114      41.260 -19.339  48.573  1.00  0.85           N  
ATOM   7678  CA  TYR B 114      40.398 -20.342  49.188  1.00  0.85           C  
ATOM   7679  C   TYR B 114      39.428 -19.758  50.220  1.00  0.85           C  
ATOM   7680  O   TYR B 114      38.251 -20.136  50.296  1.00  0.85           O  
ATOM   7681  CB  TYR B 114      41.269 -21.459  49.839  1.00  0.85           C  
ATOM   7682  CG  TYR B 114      40.421 -22.516  50.500  1.00  0.85           C  
ATOM   7683  CD1 TYR B 114      39.592 -23.348  49.731  1.00  0.85           C  
ATOM   7684  CD2 TYR B 114      40.344 -22.576  51.903  1.00  0.85           C  
ATOM   7685  CE1 TYR B 114      38.658 -24.186  50.354  1.00  0.85           C  
ATOM   7686  CE2 TYR B 114      39.413 -23.417  52.528  1.00  0.85           C  
ATOM   7687  CZ  TYR B 114      38.563 -24.210  51.748  1.00  0.85           C  
ATOM   7688  OH  TYR B 114      37.532 -24.958  52.345  1.00  0.85           O  
ATOM   7689  N   GLN B 115      39.893 -18.799  51.040  1.00  0.81           N  
ATOM   7690  CA  GLN B 115      39.071 -18.100  52.007  1.00  0.81           C  
ATOM   7691  C   GLN B 115      38.049 -17.175  51.371  1.00  0.81           C  
ATOM   7692  O   GLN B 115      37.026 -16.880  51.981  1.00  0.81           O  
ATOM   7693  CB  GLN B 115      39.959 -17.303  52.985  1.00  0.81           C  
ATOM   7694  CG  GLN B 115      40.624 -18.223  54.030  1.00  0.81           C  
ATOM   7695  CD  GLN B 115      41.571 -17.457  54.955  1.00  0.81           C  
ATOM   7696  OE1 GLN B 115      41.440 -16.258  55.206  1.00  0.81           O  
ATOM   7697  NE2 GLN B 115      42.562 -18.197  55.498  1.00  0.81           N  
ATOM   7698  N   LEU B 116      38.260 -16.754  50.111  1.00  0.83           N  
ATOM   7699  CA  LEU B 116      37.308 -15.955  49.362  1.00  0.83           C  
ATOM   7700  C   LEU B 116      36.408 -16.787  48.465  1.00  0.83           C  
ATOM   7701  O   LEU B 116      35.581 -16.241  47.746  1.00  0.83           O  
ATOM   7702  CB  LEU B 116      38.041 -14.926  48.470  1.00  0.83           C  
ATOM   7703  CG  LEU B 116      38.783 -13.830  49.256  1.00  0.83           C  
ATOM   7704  CD1 LEU B 116      39.617 -12.969  48.301  1.00  0.83           C  
ATOM   7705  CD2 LEU B 116      37.809 -12.953  50.054  1.00  0.83           C  
ATOM   7706  N   GLY B 117      36.497 -18.134  48.502  1.00  0.82           N  
ATOM   7707  CA  GLY B 117      35.574 -19.003  47.766  1.00  0.82           C  
ATOM   7708  C   GLY B 117      35.855 -19.067  46.300  1.00  0.82           C  
ATOM   7709  O   GLY B 117      34.963 -19.069  45.449  1.00  0.82           O  
ATOM   7710  N   LEU B 118      37.143 -19.089  45.974  1.00  0.84           N  
ATOM   7711  CA  LEU B 118      37.655 -19.106  44.634  1.00  0.84           C  
ATOM   7712  C   LEU B 118      38.682 -20.220  44.596  1.00  0.84           C  
ATOM   7713  O   LEU B 118      39.233 -20.590  45.632  1.00  0.84           O  
ATOM   7714  CB  LEU B 118      38.342 -17.754  44.335  1.00  0.84           C  
ATOM   7715  CG  LEU B 118      37.421 -16.528  44.306  1.00  0.84           C  
ATOM   7716  CD1 LEU B 118      38.239 -15.231  44.276  1.00  0.84           C  
ATOM   7717  CD2 LEU B 118      36.484 -16.574  43.103  1.00  0.84           C  
ATOM   7718  N   ASP B 119      38.979 -20.778  43.410  1.00  0.84           N  
ATOM   7719  CA  ASP B 119      40.035 -21.764  43.256  1.00  0.84           C  
ATOM   7720  C   ASP B 119      41.187 -21.087  42.535  1.00  0.84           C  
ATOM   7721  O   ASP B 119      41.016 -20.502  41.469  1.00  0.84           O  
ATOM   7722  CB  ASP B 119      39.533 -22.991  42.446  1.00  0.84           C  
ATOM   7723  CG  ASP B 119      40.658 -23.924  42.008  1.00  0.84           C  
ATOM   7724  OD1 ASP B 119      41.697 -23.970  42.712  1.00  0.84           O  
ATOM   7725  OD2 ASP B 119      40.534 -24.511  40.908  1.00  0.84           O  
ATOM   7726  N   LEU B 120      42.406 -21.149  43.094  1.00  0.87           N  
ATOM   7727  CA  LEU B 120      43.575 -20.563  42.474  1.00  0.87           C  
ATOM   7728  C   LEU B 120      44.004 -21.253  41.188  1.00  0.87           C  
ATOM   7729  O   LEU B 120      44.355 -20.570  40.226  1.00  0.87           O  
ATOM   7730  CB  LEU B 120      44.725 -20.473  43.499  1.00  0.87           C  
ATOM   7731  CG  LEU B 120      45.998 -19.745  43.011  1.00  0.87           C  
ATOM   7732  CD1 LEU B 120      46.443 -18.656  43.993  1.00  0.87           C  
ATOM   7733  CD2 LEU B 120      47.147 -20.738  42.812  1.00  0.87           C  
ATOM   7734  N   GLU B 121      43.919 -22.600  41.112  1.00  0.81           N  
ATOM   7735  CA  GLU B 121      44.247 -23.372  39.917  1.00  0.81           C  
ATOM   7736  C   GLU B 121      43.343 -23.014  38.732  1.00  0.81           C  
ATOM   7737  O   GLU B 121      43.803 -22.807  37.608  1.00  0.81           O  
ATOM   7738  CB  GLU B 121      44.133 -24.904  40.169  1.00  0.81           C  
ATOM   7739  CG  GLU B 121      45.220 -25.512  41.095  1.00  0.81           C  
ATOM   7740  CD  GLU B 121      45.164 -27.046  41.172  1.00  0.81           C  
ATOM   7741  OE1 GLU B 121      45.268 -27.724  40.105  1.00  0.81           O  
ATOM   7742  OE2 GLU B 121      45.075 -27.579  42.308  1.00  0.81           O  
ATOM   7743  N   GLU B 122      42.018 -22.863  38.973  1.00  0.83           N  
ATOM   7744  CA  GLU B 122      41.060 -22.358  37.997  1.00  0.83           C  
ATOM   7745  C   GLU B 122      41.415 -20.972  37.474  1.00  0.83           C  
ATOM   7746  O   GLU B 122      41.396 -20.716  36.269  1.00  0.83           O  
ATOM   7747  CB  GLU B 122      39.642 -22.281  38.626  1.00  0.83           C  
ATOM   7748  CG  GLU B 122      38.500 -21.889  37.648  1.00  0.83           C  
ATOM   7749  CD  GLU B 122      37.203 -21.500  38.364  1.00  0.83           C  
ATOM   7750  OE1 GLU B 122      36.691 -22.303  39.181  1.00  0.83           O  
ATOM   7751  OE2 GLU B 122      36.698 -20.376  38.090  1.00  0.83           O  
ATOM   7752  N   LEU B 123      41.812 -20.038  38.368  1.00  0.89           N  
ATOM   7753  CA  LEU B 123      42.248 -18.715  37.959  1.00  0.89           C  
ATOM   7754  C   LEU B 123      43.501 -18.744  37.089  1.00  0.89           C  
ATOM   7755  O   LEU B 123      43.547 -18.088  36.055  1.00  0.89           O  
ATOM   7756  CB  LEU B 123      42.497 -17.764  39.163  1.00  0.89           C  
ATOM   7757  CG  LEU B 123      41.290 -17.520  40.095  1.00  0.89           C  
ATOM   7758  CD1 LEU B 123      41.638 -16.505  41.196  1.00  0.89           C  
ATOM   7759  CD2 LEU B 123      40.016 -17.100  39.355  1.00  0.89           C  
ATOM   7760  N   GLU B 124      44.531 -19.543  37.437  1.00  0.88           N  
ATOM   7761  CA  GLU B 124      45.774 -19.668  36.678  1.00  0.88           C  
ATOM   7762  C   GLU B 124      45.571 -20.144  35.243  1.00  0.88           C  
ATOM   7763  O   GLU B 124      46.250 -19.692  34.322  1.00  0.88           O  
ATOM   7764  CB  GLU B 124      46.789 -20.594  37.396  1.00  0.88           C  
ATOM   7765  CG  GLU B 124      47.288 -20.030  38.752  1.00  0.88           C  
ATOM   7766  CD  GLU B 124      48.220 -20.985  39.497  1.00  0.88           C  
ATOM   7767  OE1 GLU B 124      47.970 -22.214  39.484  1.00  0.88           O  
ATOM   7768  OE2 GLU B 124      49.202 -20.477  40.101  1.00  0.88           O  
ATOM   7769  N   GLU B 125      44.591 -21.037  34.992  1.00  0.86           N  
ATOM   7770  CA  GLU B 125      44.270 -21.474  33.644  1.00  0.86           C  
ATOM   7771  C   GLU B 125      43.663 -20.414  32.733  1.00  0.86           C  
ATOM   7772  O   GLU B 125      43.744 -20.524  31.511  1.00  0.86           O  
ATOM   7773  CB  GLU B 125      43.349 -22.716  33.655  1.00  0.86           C  
ATOM   7774  CG  GLU B 125      44.080 -24.024  34.048  1.00  0.86           C  
ATOM   7775  CD  GLU B 125      45.313 -24.284  33.205  1.00  0.86           C  
ATOM   7776  OE1 GLU B 125      45.281 -24.204  31.950  1.00  0.86           O  
ATOM   7777  OE2 GLU B 125      46.409 -24.568  33.753  1.00  0.86           O  
ATOM   7778  N   ILE B 126      43.094 -19.329  33.292  1.00  0.89           N  
ATOM   7779  CA  ILE B 126      42.615 -18.179  32.535  1.00  0.89           C  
ATOM   7780  C   ILE B 126      43.727 -17.480  31.754  1.00  0.89           C  
ATOM   7781  O   ILE B 126      43.496 -16.947  30.665  1.00  0.89           O  
ATOM   7782  CB  ILE B 126      41.919 -17.175  33.458  1.00  0.89           C  
ATOM   7783  CG1 ILE B 126      40.680 -17.780  34.169  1.00  0.89           C  
ATOM   7784  CG2 ILE B 126      41.549 -15.866  32.732  1.00  0.89           C  
ATOM   7785  CD1 ILE B 126      39.546 -18.248  33.246  1.00  0.89           C  
ATOM   7786  N   GLU B 127      44.957 -17.439  32.308  1.00  0.89           N  
ATOM   7787  CA  GLU B 127      46.094 -16.772  31.697  1.00  0.89           C  
ATOM   7788  C   GLU B 127      46.514 -17.300  30.325  1.00  0.89           C  
ATOM   7789  O   GLU B 127      46.739 -18.498  30.118  1.00  0.89           O  
ATOM   7790  CB  GLU B 127      47.316 -16.779  32.649  1.00  0.89           C  
ATOM   7791  CG  GLU B 127      48.461 -15.821  32.222  1.00  0.89           C  
ATOM   7792  CD  GLU B 127      49.525 -15.613  33.292  1.00  0.89           C  
ATOM   7793  OE1 GLU B 127      49.696 -16.472  34.193  1.00  0.89           O  
ATOM   7794  OE2 GLU B 127      50.241 -14.584  33.221  1.00  0.89           O  
ATOM   7795  N   GLU B 128      46.659 -16.383  29.347  1.00  0.88           N  
ATOM   7796  CA  GLU B 128      47.154 -16.693  28.020  1.00  0.88           C  
ATOM   7797  C   GLU B 128      48.674 -16.703  27.987  1.00  0.88           C  
ATOM   7798  O   GLU B 128      49.349 -16.000  28.739  1.00  0.88           O  
ATOM   7799  CB  GLU B 128      46.575 -15.721  26.948  1.00  0.88           C  
ATOM   7800  CG  GLU B 128      45.086 -16.051  26.640  1.00  0.88           C  
ATOM   7801  CD  GLU B 128      44.381 -15.231  25.551  1.00  0.88           C  
ATOM   7802  OE1 GLU B 128      44.808 -15.279  24.373  1.00  0.88           O  
ATOM   7803  OE2 GLU B 128      43.324 -14.622  25.890  1.00  0.88           O  
ATOM   7804  N   ASP B 129      49.273 -17.542  27.123  1.00  0.91           N  
ATOM   7805  CA  ASP B 129      50.699 -17.550  26.895  1.00  0.91           C  
ATOM   7806  C   ASP B 129      51.208 -16.237  26.306  1.00  0.91           C  
ATOM   7807  O   ASP B 129      50.685 -15.728  25.317  1.00  0.91           O  
ATOM   7808  CB  ASP B 129      51.094 -18.665  25.889  1.00  0.91           C  
ATOM   7809  CG  ASP B 129      50.895 -20.048  26.456  1.00  0.91           C  
ATOM   7810  OD1 ASP B 129      49.724 -20.428  26.708  1.00  0.91           O  
ATOM   7811  OD2 ASP B 129      51.902 -20.790  26.605  1.00  0.91           O  
ATOM   7812  N   ALA B 130      52.314 -15.685  26.832  1.00  0.95           N  
ATOM   7813  CA  ALA B 130      53.049 -14.654  26.133  1.00  0.95           C  
ATOM   7814  C   ALA B 130      53.901 -15.301  25.035  1.00  0.95           C  
ATOM   7815  O   ALA B 130      55.100 -15.552  25.191  1.00  0.95           O  
ATOM   7816  CB  ALA B 130      53.879 -13.843  27.140  1.00  0.95           C  
ATOM   7817  N   GLY B 131      53.263 -15.649  23.896  1.00  0.84           N  
ATOM   7818  CA  GLY B 131      53.830 -16.476  22.835  1.00  0.84           C  
ATOM   7819  C   GLY B 131      54.619 -15.730  21.809  1.00  0.84           C  
ATOM   7820  O   GLY B 131      54.471 -15.931  20.607  1.00  0.84           O  
ATOM   7821  N   LEU B 132      55.536 -14.861  22.252  1.00  0.89           N  
ATOM   7822  CA  LEU B 132      56.331 -14.029  21.377  1.00  0.89           C  
ATOM   7823  C   LEU B 132      57.574 -14.767  20.913  1.00  0.89           C  
ATOM   7824  O   LEU B 132      58.678 -14.230  20.931  1.00  0.89           O  
ATOM   7825  CB  LEU B 132      56.731 -12.714  22.089  1.00  0.89           C  
ATOM   7826  CG  LEU B 132      55.565 -11.957  22.758  1.00  0.89           C  
ATOM   7827  CD1 LEU B 132      56.037 -10.580  23.237  1.00  0.89           C  
ATOM   7828  CD2 LEU B 132      54.346 -11.785  21.845  1.00  0.89           C  
ATOM   7829  N   GLY B 133      57.420 -16.038  20.500  1.00  0.93           N  
ATOM   7830  CA  GLY B 133      58.515 -16.865  20.034  1.00  0.93           C  
ATOM   7831  C   GLY B 133      58.055 -18.032  19.215  1.00  0.93           C  
ATOM   7832  O   GLY B 133      56.944 -18.535  19.365  1.00  0.93           O  
ATOM   7833  N   ASN B 134      58.917 -18.499  18.306  1.00  0.85           N  
ATOM   7834  CA  ASN B 134      58.651 -19.605  17.420  1.00  0.85           C  
ATOM   7835  C   ASN B 134      58.863 -20.955  18.072  1.00  0.85           C  
ATOM   7836  O   ASN B 134      58.084 -21.889  17.857  1.00  0.85           O  
ATOM   7837  CB  ASN B 134      59.582 -19.500  16.191  1.00  0.85           C  
ATOM   7838  CG  ASN B 134      58.904 -18.605  15.169  1.00  0.85           C  
ATOM   7839  OD1 ASN B 134      57.928 -19.045  14.551  1.00  0.85           O  
ATOM   7840  ND2 ASN B 134      59.394 -17.365  15.005  1.00  0.85           N  
ATOM   7841  N   GLY B 135      59.942 -21.099  18.859  1.00  0.93           N  
ATOM   7842  CA  GLY B 135      60.302 -22.396  19.398  1.00  0.93           C  
ATOM   7843  C   GLY B 135      61.455 -22.344  20.352  1.00  0.93           C  
ATOM   7844  O   GLY B 135      61.463 -21.599  21.330  1.00  0.93           O  
ATOM   7845  N   GLY B 136      62.470 -23.198  20.105  1.00  0.94           N  
ATOM   7846  CA  GLY B 136      63.659 -23.357  20.943  1.00  0.94           C  
ATOM   7847  C   GLY B 136      64.398 -22.095  21.284  1.00  0.94           C  
ATOM   7848  O   GLY B 136      64.685 -21.840  22.449  1.00  0.94           O  
ATOM   7849  N   LEU B 137      64.695 -21.275  20.262  1.00  0.91           N  
ATOM   7850  CA  LEU B 137      65.424 -20.019  20.356  1.00  0.91           C  
ATOM   7851  C   LEU B 137      64.750 -19.000  21.263  1.00  0.91           C  
ATOM   7852  O   LEU B 137      65.369 -18.409  22.151  1.00  0.91           O  
ATOM   7853  CB  LEU B 137      65.554 -19.490  18.903  1.00  0.91           C  
ATOM   7854  CG  LEU B 137      66.227 -18.121  18.665  1.00  0.91           C  
ATOM   7855  CD1 LEU B 137      66.827 -18.087  17.255  1.00  0.91           C  
ATOM   7856  CD2 LEU B 137      65.247 -16.944  18.780  1.00  0.91           C  
ATOM   7857  N   GLY B 138      63.425 -18.804  21.104  1.00  0.95           N  
ATOM   7858  CA  GLY B 138      62.666 -17.897  21.951  1.00  0.95           C  
ATOM   7859  C   GLY B 138      62.450 -18.404  23.346  1.00  0.95           C  
ATOM   7860  O   GLY B 138      62.391 -17.636  24.306  1.00  0.95           O  
ATOM   7861  N   ARG B 139      62.302 -19.730  23.516  1.00  0.90           N  
ATOM   7862  CA  ARG B 139      62.148 -20.323  24.828  1.00  0.90           C  
ATOM   7863  C   ARG B 139      63.430 -20.330  25.625  1.00  0.90           C  
ATOM   7864  O   ARG B 139      63.422 -20.189  26.849  1.00  0.90           O  
ATOM   7865  CB  ARG B 139      61.551 -21.751  24.742  1.00  0.90           C  
ATOM   7866  CG  ARG B 139      61.226 -22.376  26.115  1.00  0.90           C  
ATOM   7867  CD  ARG B 139      60.250 -21.526  26.945  1.00  0.90           C  
ATOM   7868  NE  ARG B 139      60.907 -21.234  28.255  1.00  0.90           N  
ATOM   7869  CZ  ARG B 139      60.332 -20.489  29.209  1.00  0.90           C  
ATOM   7870  NH1 ARG B 139      59.121 -19.962  29.040  1.00  0.90           N  
ATOM   7871  NH2 ARG B 139      60.996 -20.272  30.342  1.00  0.90           N  
ATOM   7872  N   LEU B 140      64.573 -20.462  24.935  1.00  0.95           N  
ATOM   7873  CA  LEU B 140      65.884 -20.338  25.530  1.00  0.95           C  
ATOM   7874  C   LEU B 140      66.095 -18.973  26.149  1.00  0.95           C  
ATOM   7875  O   LEU B 140      66.500 -18.865  27.303  1.00  0.95           O  
ATOM   7876  CB  LEU B 140      66.966 -20.578  24.457  1.00  0.95           C  
ATOM   7877  CG  LEU B 140      68.396 -20.708  25.004  1.00  0.95           C  
ATOM   7878  CD1 LEU B 140      68.539 -21.997  25.824  1.00  0.95           C  
ATOM   7879  CD2 LEU B 140      69.398 -20.669  23.842  1.00  0.95           C  
ATOM   7880  N   ALA B 141      65.702 -17.902  25.432  1.00  0.98           N  
ATOM   7881  CA  ALA B 141      65.739 -16.547  25.934  1.00  0.98           C  
ATOM   7882  C   ALA B 141      64.912 -16.349  27.201  1.00  0.98           C  
ATOM   7883  O   ALA B 141      65.367 -15.763  28.178  1.00  0.98           O  
ATOM   7884  CB  ALA B 141      65.235 -15.616  24.819  1.00  0.98           C  
ATOM   7885  N   ALA B 142      63.692 -16.914  27.242  1.00  0.98           N  
ATOM   7886  CA  ALA B 142      62.852 -16.942  28.421  1.00  0.98           C  
ATOM   7887  C   ALA B 142      63.416 -17.719  29.612  1.00  0.98           C  
ATOM   7888  O   ALA B 142      63.312 -17.292  30.760  1.00  0.98           O  
ATOM   7889  CB  ALA B 142      61.494 -17.532  28.022  1.00  0.98           C  
ATOM   7890  N   CYS B 143      64.038 -18.896  29.383  1.00  0.97           N  
ATOM   7891  CA  CYS B 143      64.757 -19.622  30.427  1.00  0.97           C  
ATOM   7892  C   CYS B 143      65.951 -18.846  30.945  1.00  0.97           C  
ATOM   7893  O   CYS B 143      66.212 -18.793  32.144  1.00  0.97           O  
ATOM   7894  CB  CYS B 143      65.252 -21.007  29.941  1.00  0.97           C  
ATOM   7895  SG  CYS B 143      63.872 -22.147  29.588  1.00  0.97           S  
ATOM   7896  N   PHE B 144      66.686 -18.191  30.036  1.00  0.97           N  
ATOM   7897  CA  PHE B 144      67.832 -17.369  30.350  1.00  0.97           C  
ATOM   7898  C   PHE B 144      67.490 -16.174  31.224  1.00  0.97           C  
ATOM   7899  O   PHE B 144      68.222 -15.887  32.165  1.00  0.97           O  
ATOM   7900  CB  PHE B 144      68.541 -16.901  29.049  1.00  0.97           C  
ATOM   7901  CG  PHE B 144      69.433 -17.943  28.400  1.00  0.97           C  
ATOM   7902  CD1 PHE B 144      69.496 -19.297  28.791  1.00  0.97           C  
ATOM   7903  CD2 PHE B 144      70.288 -17.515  27.369  1.00  0.97           C  
ATOM   7904  CE1 PHE B 144      70.394 -20.181  28.182  1.00  0.97           C  
ATOM   7905  CE2 PHE B 144      71.189 -18.394  26.755  1.00  0.97           C  
ATOM   7906  CZ  PHE B 144      71.241 -19.730  27.165  1.00  0.97           C  
ATOM   7907  N   LEU B 145      66.363 -15.467  30.990  1.00  0.96           N  
ATOM   7908  CA  LEU B 145      65.944 -14.374  31.864  1.00  0.96           C  
ATOM   7909  C   LEU B 145      65.687 -14.805  33.317  1.00  0.96           C  
ATOM   7910  O   LEU B 145      66.144 -14.142  34.248  1.00  0.96           O  
ATOM   7911  CB  LEU B 145      64.685 -13.626  31.345  1.00  0.96           C  
ATOM   7912  CG  LEU B 145      64.731 -13.009  29.931  1.00  0.96           C  
ATOM   7913  CD1 LEU B 145      63.505 -12.107  29.731  1.00  0.96           C  
ATOM   7914  CD2 LEU B 145      66.009 -12.209  29.656  1.00  0.96           C  
ATOM   7915  N   ASP B 146      65.001 -15.954  33.540  1.00  0.96           N  
ATOM   7916  CA  ASP B 146      64.778 -16.559  34.855  1.00  0.96           C  
ATOM   7917  C   ASP B 146      66.097 -16.889  35.556  1.00  0.96           C  
ATOM   7918  O   ASP B 146      66.351 -16.502  36.697  1.00  0.96           O  
ATOM   7919  CB  ASP B 146      63.928 -17.849  34.601  1.00  0.96           C  
ATOM   7920  CG  ASP B 146      63.573 -18.730  35.796  1.00  0.96           C  
ATOM   7921  OD1 ASP B 146      64.486 -19.377  36.374  1.00  0.96           O  
ATOM   7922  OD2 ASP B 146      62.359 -18.914  36.065  1.00  0.96           O  
ATOM   7923  N   SER B 147      67.014 -17.562  34.837  1.00  0.97           N  
ATOM   7924  CA  SER B 147      68.335 -17.906  35.335  1.00  0.97           C  
ATOM   7925  C   SER B 147      69.235 -16.725  35.636  1.00  0.97           C  
ATOM   7926  O   SER B 147      69.909 -16.704  36.658  1.00  0.97           O  
ATOM   7927  CB  SER B 147      69.109 -18.779  34.336  1.00  0.97           C  
ATOM   7928  OG  SER B 147      68.465 -20.033  34.154  1.00  0.97           O  
ATOM   7929  N   MET B 148      69.287 -15.684  34.778  1.00  0.95           N  
ATOM   7930  CA  MET B 148      70.073 -14.487  35.049  1.00  0.95           C  
ATOM   7931  C   MET B 148      69.597 -13.728  36.280  1.00  0.95           C  
ATOM   7932  O   MET B 148      70.408 -13.300  37.099  1.00  0.95           O  
ATOM   7933  CB  MET B 148      70.133 -13.539  33.826  1.00  0.95           C  
ATOM   7934  CG  MET B 148      70.904 -14.131  32.625  1.00  0.95           C  
ATOM   7935  SD  MET B 148      71.150 -13.016  31.210  1.00  0.95           S  
ATOM   7936  CE  MET B 148      69.410 -12.857  30.722  1.00  0.95           C  
ATOM   7937  N   ALA B 149      68.270 -13.597  36.473  1.00  0.97           N  
ATOM   7938  CA  ALA B 149      67.714 -13.038  37.686  1.00  0.97           C  
ATOM   7939  C   ALA B 149      67.984 -13.874  38.936  1.00  0.97           C  
ATOM   7940  O   ALA B 149      68.363 -13.336  39.972  1.00  0.97           O  
ATOM   7941  CB  ALA B 149      66.210 -12.801  37.483  1.00  0.97           C  
ATOM   7942  N   THR B 150      67.845 -15.216  38.851  1.00  0.94           N  
ATOM   7943  CA  THR B 150      68.168 -16.186  39.908  1.00  0.94           C  
ATOM   7944  C   THR B 150      69.625 -16.169  40.313  1.00  0.94           C  
ATOM   7945  O   THR B 150      69.973 -16.387  41.469  1.00  0.94           O  
ATOM   7946  CB  THR B 150      67.780 -17.603  39.493  1.00  0.94           C  
ATOM   7947  OG1 THR B 150      66.365 -17.728  39.523  1.00  0.94           O  
ATOM   7948  CG2 THR B 150      68.329 -18.698  40.419  1.00  0.94           C  
ATOM   7949  N   LEU B 151      70.530 -15.899  39.362  1.00  0.93           N  
ATOM   7950  CA  LEU B 151      71.946 -15.788  39.631  1.00  0.93           C  
ATOM   7951  C   LEU B 151      72.388 -14.357  39.868  1.00  0.93           C  
ATOM   7952  O   LEU B 151      73.578 -14.050  39.796  1.00  0.93           O  
ATOM   7953  CB  LEU B 151      72.753 -16.374  38.454  1.00  0.93           C  
ATOM   7954  CG  LEU B 151      72.556 -17.887  38.236  1.00  0.93           C  
ATOM   7955  CD1 LEU B 151      73.525 -18.375  37.160  1.00  0.93           C  
ATOM   7956  CD2 LEU B 151      72.749 -18.710  39.517  1.00  0.93           C  
ATOM   7957  N   GLY B 152      71.441 -13.440  40.167  1.00  0.94           N  
ATOM   7958  CA  GLY B 152      71.733 -12.088  40.634  1.00  0.94           C  
ATOM   7959  C   GLY B 152      72.467 -11.204  39.668  1.00  0.94           C  
ATOM   7960  O   GLY B 152      73.149 -10.260  40.064  1.00  0.94           O  
ATOM   7961  N   LEU B 153      72.357 -11.481  38.361  1.00  0.94           N  
ATOM   7962  CA  LEU B 153      73.010 -10.685  37.353  1.00  0.94           C  
ATOM   7963  C   LEU B 153      72.186  -9.445  37.045  1.00  0.94           C  
ATOM   7964  O   LEU B 153      70.954  -9.458  37.047  1.00  0.94           O  
ATOM   7965  CB  LEU B 153      73.234 -11.485  36.042  1.00  0.94           C  
ATOM   7966  CG  LEU B 153      74.054 -12.791  36.168  1.00  0.94           C  
ATOM   7967  CD1 LEU B 153      74.268 -13.410  34.779  1.00  0.94           C  
ATOM   7968  CD2 LEU B 153      75.413 -12.584  36.845  1.00  0.94           C  
ATOM   7969  N   ALA B 154      72.850  -8.314  36.729  1.00  0.96           N  
ATOM   7970  CA  ALA B 154      72.181  -7.119  36.259  1.00  0.96           C  
ATOM   7971  C   ALA B 154      71.809  -7.243  34.792  1.00  0.96           C  
ATOM   7972  O   ALA B 154      72.343  -6.567  33.910  1.00  0.96           O  
ATOM   7973  CB  ALA B 154      73.051  -5.881  36.512  1.00  0.96           C  
ATOM   7974  N   ALA B 155      70.889  -8.172  34.508  1.00  0.97           N  
ATOM   7975  CA  ALA B 155      70.549  -8.563  33.174  1.00  0.97           C  
ATOM   7976  C   ALA B 155      69.230  -7.997  32.704  1.00  0.97           C  
ATOM   7977  O   ALA B 155      68.341  -7.618  33.467  1.00  0.97           O  
ATOM   7978  CB  ALA B 155      70.519 -10.090  33.069  1.00  0.97           C  
ATOM   7979  N   TYR B 156      69.107  -7.909  31.377  1.00  0.95           N  
ATOM   7980  CA  TYR B 156      67.985  -7.302  30.723  1.00  0.95           C  
ATOM   7981  C   TYR B 156      67.691  -8.100  29.466  1.00  0.95           C  
ATOM   7982  O   TYR B 156      68.602  -8.536  28.760  1.00  0.95           O  
ATOM   7983  CB  TYR B 156      68.303  -5.856  30.245  1.00  0.95           C  
ATOM   7984  CG  TYR B 156      68.594  -4.846  31.336  1.00  0.95           C  
ATOM   7985  CD1 TYR B 156      69.834  -4.825  32.000  1.00  0.95           C  
ATOM   7986  CD2 TYR B 156      67.658  -3.841  31.641  1.00  0.95           C  
ATOM   7987  CE1 TYR B 156      70.104  -3.873  32.994  1.00  0.95           C  
ATOM   7988  CE2 TYR B 156      67.926  -2.884  32.634  1.00  0.95           C  
ATOM   7989  CZ  TYR B 156      69.142  -2.916  33.334  1.00  0.95           C  
ATOM   7990  OH  TYR B 156      69.376  -2.015  34.403  1.00  0.95           O  
ATOM   7991  N   GLY B 157      66.404  -8.292  29.128  1.00  0.98           N  
ATOM   7992  CA  GLY B 157      66.020  -8.860  27.838  1.00  0.98           C  
ATOM   7993  C   GLY B 157      65.434  -7.788  26.980  1.00  0.98           C  
ATOM   7994  O   GLY B 157      64.527  -7.093  27.420  1.00  0.98           O  
ATOM   7995  N   TYR B 158      65.922  -7.618  25.740  1.00  0.96           N  
ATOM   7996  CA  TYR B 158      65.417  -6.595  24.840  1.00  0.96           C  
ATOM   7997  C   TYR B 158      64.923  -7.216  23.547  1.00  0.96           C  
ATOM   7998  O   TYR B 158      65.637  -7.958  22.869  1.00  0.96           O  
ATOM   7999  CB  TYR B 158      66.486  -5.532  24.498  1.00  0.96           C  
ATOM   8000  CG  TYR B 158      66.584  -4.449  25.538  1.00  0.96           C  
ATOM   8001  CD1 TYR B 158      67.227  -4.653  26.769  1.00  0.96           C  
ATOM   8002  CD2 TYR B 158      66.096  -3.165  25.242  1.00  0.96           C  
ATOM   8003  CE1 TYR B 158      67.378  -3.586  27.667  1.00  0.96           C  
ATOM   8004  CE2 TYR B 158      66.295  -2.093  26.117  1.00  0.96           C  
ATOM   8005  CZ  TYR B 158      66.919  -2.318  27.339  1.00  0.96           C  
ATOM   8006  OH  TYR B 158      67.069  -1.275  28.258  1.00  0.96           O  
ATOM   8007  N   GLY B 159      63.657  -6.923  23.184  1.00  0.99           N  
ATOM   8008  CA  GLY B 159      63.018  -7.498  22.009  1.00  0.99           C  
ATOM   8009  C   GLY B 159      61.891  -6.655  21.495  1.00  0.99           C  
ATOM   8010  O   GLY B 159      61.778  -5.467  21.789  1.00  0.99           O  
ATOM   8011  N   ILE B 160      60.989  -7.262  20.708  1.00  0.96           N  
ATOM   8012  CA  ILE B 160      59.833  -6.578  20.150  1.00  0.96           C  
ATOM   8013  C   ILE B 160      58.592  -7.042  20.863  1.00  0.96           C  
ATOM   8014  O   ILE B 160      58.373  -8.229  21.104  1.00  0.96           O  
ATOM   8015  CB  ILE B 160      59.661  -6.805  18.649  1.00  0.96           C  
ATOM   8016  CG1 ILE B 160      60.893  -6.244  17.919  1.00  0.96           C  
ATOM   8017  CG2 ILE B 160      58.372  -6.134  18.114  1.00  0.96           C  
ATOM   8018  CD1 ILE B 160      60.845  -6.456  16.411  1.00  0.96           C  
ATOM   8019  N   ARG B 161      57.716  -6.085  21.216  1.00  0.90           N  
ATOM   8020  CA  ARG B 161      56.401  -6.388  21.722  1.00  0.90           C  
ATOM   8021  C   ARG B 161      55.474  -6.590  20.555  1.00  0.90           C  
ATOM   8022  O   ARG B 161      54.792  -5.669  20.103  1.00  0.90           O  
ATOM   8023  CB  ARG B 161      55.872  -5.236  22.595  1.00  0.90           C  
ATOM   8024  CG  ARG B 161      54.485  -5.495  23.216  1.00  0.90           C  
ATOM   8025  CD  ARG B 161      54.088  -4.349  24.139  1.00  0.90           C  
ATOM   8026  NE  ARG B 161      52.718  -4.583  24.682  1.00  0.90           N  
ATOM   8027  CZ  ARG B 161      51.596  -4.126  24.118  1.00  0.90           C  
ATOM   8028  NH1 ARG B 161      51.556  -3.740  22.843  1.00  0.90           N  
ATOM   8029  NH2 ARG B 161      50.489  -4.056  24.846  1.00  0.90           N  
ATOM   8030  N   TYR B 162      55.442  -7.822  20.018  1.00  0.90           N  
ATOM   8031  CA  TYR B 162      54.510  -8.159  18.971  1.00  0.90           C  
ATOM   8032  C   TYR B 162      53.085  -8.083  19.479  1.00  0.90           C  
ATOM   8033  O   TYR B 162      52.757  -8.608  20.540  1.00  0.90           O  
ATOM   8034  CB  TYR B 162      54.744  -9.555  18.355  1.00  0.90           C  
ATOM   8035  CG  TYR B 162      56.160  -9.733  17.893  1.00  0.90           C  
ATOM   8036  CD1 TYR B 162      56.621  -9.115  16.718  1.00  0.90           C  
ATOM   8037  CD2 TYR B 162      57.031 -10.569  18.608  1.00  0.90           C  
ATOM   8038  CE1 TYR B 162      57.922  -9.358  16.252  1.00  0.90           C  
ATOM   8039  CE2 TYR B 162      58.331 -10.803  18.150  1.00  0.90           C  
ATOM   8040  CZ  TYR B 162      58.774 -10.206  16.965  1.00  0.90           C  
ATOM   8041  OH  TYR B 162      60.073 -10.468  16.491  1.00  0.90           O  
ATOM   8042  N   GLU B 163      52.195  -7.417  18.732  1.00  0.86           N  
ATOM   8043  CA  GLU B 163      50.780  -7.387  19.041  1.00  0.86           C  
ATOM   8044  C   GLU B 163      50.156  -8.757  18.855  1.00  0.86           C  
ATOM   8045  O   GLU B 163      49.304  -9.199  19.621  1.00  0.86           O  
ATOM   8046  CB  GLU B 163      50.094  -6.309  18.188  1.00  0.86           C  
ATOM   8047  CG  GLU B 163      48.607  -6.082  18.530  1.00  0.86           C  
ATOM   8048  CD  GLU B 163      48.078  -4.779  17.941  1.00  0.86           C  
ATOM   8049  OE1 GLU B 163      46.850  -4.565  18.034  1.00  0.86           O  
ATOM   8050  OE2 GLU B 163      48.876  -3.974  17.381  1.00  0.86           O  
ATOM   8051  N   PHE B 164      50.649  -9.483  17.840  1.00  0.86           N  
ATOM   8052  CA  PHE B 164      50.280 -10.848  17.561  1.00  0.86           C  
ATOM   8053  C   PHE B 164      51.515 -11.738  17.623  1.00  0.86           C  
ATOM   8054  O   PHE B 164      52.481 -11.551  16.880  1.00  0.86           O  
ATOM   8055  CB  PHE B 164      49.606 -10.954  16.169  1.00  0.86           C  
ATOM   8056  CG  PHE B 164      48.400 -10.050  16.132  1.00  0.86           C  
ATOM   8057  CD1 PHE B 164      47.186 -10.455  16.706  1.00  0.86           C  
ATOM   8058  CD2 PHE B 164      48.486  -8.756  15.590  1.00  0.86           C  
ATOM   8059  CE1 PHE B 164      46.104  -9.568  16.788  1.00  0.86           C  
ATOM   8060  CE2 PHE B 164      47.395  -7.884  15.617  1.00  0.86           C  
ATOM   8061  CZ  PHE B 164      46.211  -8.280  16.245  1.00  0.86           C  
ATOM   8062  N   GLY B 165      51.531 -12.735  18.534  1.00  0.90           N  
ATOM   8063  CA  GLY B 165      52.654 -13.659  18.678  1.00  0.90           C  
ATOM   8064  C   GLY B 165      52.663 -14.756  17.641  1.00  0.90           C  
ATOM   8065  O   GLY B 165      52.254 -14.579  16.493  1.00  0.90           O  
ATOM   8066  N   ILE B 166      53.159 -15.957  18.001  1.00  0.85           N  
ATOM   8067  CA  ILE B 166      52.989 -17.134  17.160  1.00  0.85           C  
ATOM   8068  C   ILE B 166      51.513 -17.489  17.023  1.00  0.85           C  
ATOM   8069  O   ILE B 166      50.774 -17.520  18.001  1.00  0.85           O  
ATOM   8070  CB  ILE B 166      53.797 -18.346  17.642  1.00  0.85           C  
ATOM   8071  CG1 ILE B 166      53.798 -19.511  16.622  1.00  0.85           C  
ATOM   8072  CG2 ILE B 166      53.281 -18.837  19.012  1.00  0.85           C  
ATOM   8073  CD1 ILE B 166      54.513 -19.167  15.314  1.00  0.85           C  
ATOM   8074  N   PHE B 167      51.015 -17.781  15.807  1.00  0.87           N  
ATOM   8075  CA  PHE B 167      49.605 -18.051  15.587  1.00  0.87           C  
ATOM   8076  C   PHE B 167      49.021 -19.160  16.458  1.00  0.87           C  
ATOM   8077  O   PHE B 167      49.671 -20.160  16.775  1.00  0.87           O  
ATOM   8078  CB  PHE B 167      49.305 -18.326  14.085  1.00  0.87           C  
ATOM   8079  CG  PHE B 167      49.977 -19.577  13.579  1.00  0.87           C  
ATOM   8080  CD1 PHE B 167      49.340 -20.821  13.729  1.00  0.87           C  
ATOM   8081  CD2 PHE B 167      51.241 -19.531  12.968  1.00  0.87           C  
ATOM   8082  CE1 PHE B 167      49.969 -22.000  13.327  1.00  0.87           C  
ATOM   8083  CE2 PHE B 167      51.877 -20.712  12.566  1.00  0.87           C  
ATOM   8084  CZ  PHE B 167      51.245 -21.945  12.763  1.00  0.87           C  
ATOM   8085  N   ASN B 168      47.747 -19.027  16.857  1.00  0.87           N  
ATOM   8086  CA  ASN B 168      47.045 -20.115  17.486  1.00  0.87           C  
ATOM   8087  C   ASN B 168      46.659 -21.097  16.401  1.00  0.87           C  
ATOM   8088  O   ASN B 168      45.950 -20.777  15.450  1.00  0.87           O  
ATOM   8089  CB  ASN B 168      45.811 -19.636  18.286  1.00  0.87           C  
ATOM   8090  CG  ASN B 168      46.295 -19.126  19.641  1.00  0.87           C  
ATOM   8091  OD1 ASN B 168      46.812 -19.924  20.424  1.00  0.87           O  
ATOM   8092  ND2 ASN B 168      46.113 -17.818  19.917  1.00  0.87           N  
ATOM   8093  N   GLN B 169      47.183 -22.323  16.493  1.00  0.87           N  
ATOM   8094  CA  GLN B 169      46.920 -23.348  15.515  1.00  0.87           C  
ATOM   8095  C   GLN B 169      45.595 -23.991  15.798  1.00  0.87           C  
ATOM   8096  O   GLN B 169      45.328 -24.412  16.916  1.00  0.87           O  
ATOM   8097  CB  GLN B 169      48.031 -24.418  15.562  1.00  0.87           C  
ATOM   8098  CG  GLN B 169      47.840 -25.642  14.637  1.00  0.87           C  
ATOM   8099  CD  GLN B 169      48.914 -26.681  14.947  1.00  0.87           C  
ATOM   8100  OE1 GLN B 169      48.987 -27.181  16.072  1.00  0.87           O  
ATOM   8101  NE2 GLN B 169      49.783 -26.993  13.963  1.00  0.87           N  
ATOM   8102  N   LYS B 170      44.743 -24.066  14.778  1.00  0.85           N  
ATOM   8103  CA  LYS B 170      43.518 -24.814  14.843  1.00  0.85           C  
ATOM   8104  C   LYS B 170      43.664 -25.986  13.906  1.00  0.85           C  
ATOM   8105  O   LYS B 170      44.418 -25.919  12.933  1.00  0.85           O  
ATOM   8106  CB  LYS B 170      42.335 -23.936  14.386  1.00  0.85           C  
ATOM   8107  CG  LYS B 170      42.044 -22.755  15.324  1.00  0.85           C  
ATOM   8108  CD  LYS B 170      41.647 -23.225  16.737  1.00  0.85           C  
ATOM   8109  CE  LYS B 170      40.905 -22.187  17.576  1.00  0.85           C  
ATOM   8110  NZ  LYS B 170      41.721 -20.978  17.690  1.00  0.85           N  
ATOM   8111  N   ILE B 171      42.963 -27.102  14.170  1.00  0.88           N  
ATOM   8112  CA  ILE B 171      42.967 -28.233  13.257  1.00  0.88           C  
ATOM   8113  C   ILE B 171      41.572 -28.437  12.710  1.00  0.88           C  
ATOM   8114  O   ILE B 171      40.619 -28.735  13.426  1.00  0.88           O  
ATOM   8115  CB  ILE B 171      43.500 -29.515  13.890  1.00  0.88           C  
ATOM   8116  CG1 ILE B 171      44.989 -29.365  14.291  1.00  0.88           C  
ATOM   8117  CG2 ILE B 171      43.321 -30.720  12.937  1.00  0.88           C  
ATOM   8118  CD1 ILE B 171      45.970 -29.266  13.115  1.00  0.88           C  
ATOM   8119  N   VAL B 172      41.404 -28.284  11.383  1.00  0.89           N  
ATOM   8120  CA  VAL B 172      40.113 -28.482  10.738  1.00  0.89           C  
ATOM   8121  C   VAL B 172      40.344 -29.362   9.534  1.00  0.89           C  
ATOM   8122  O   VAL B 172      41.256 -29.123   8.744  1.00  0.89           O  
ATOM   8123  CB  VAL B 172      39.430 -27.184  10.313  1.00  0.89           C  
ATOM   8124  CG1 VAL B 172      38.041 -27.467   9.706  1.00  0.89           C  
ATOM   8125  CG2 VAL B 172      39.267 -26.253  11.530  1.00  0.89           C  
ATOM   8126  N   ASN B 173      39.568 -30.467   9.396  1.00  0.87           N  
ATOM   8127  CA  ASN B 173      39.724 -31.472   8.343  1.00  0.87           C  
ATOM   8128  C   ASN B 173      41.077 -32.179   8.392  1.00  0.87           C  
ATOM   8129  O   ASN B 173      41.551 -32.749   7.413  1.00  0.87           O  
ATOM   8130  CB  ASN B 173      39.502 -30.871   6.930  1.00  0.87           C  
ATOM   8131  CG  ASN B 173      38.115 -30.265   6.817  1.00  0.87           C  
ATOM   8132  OD1 ASN B 173      37.113 -30.897   7.146  1.00  0.87           O  
ATOM   8133  ND2 ASN B 173      38.039 -29.004   6.330  1.00  0.87           N  
ATOM   8134  N   GLY B 174      41.741 -32.141   9.562  1.00  0.92           N  
ATOM   8135  CA  GLY B 174      43.088 -32.649   9.757  1.00  0.92           C  
ATOM   8136  C   GLY B 174      44.202 -31.729   9.324  1.00  0.92           C  
ATOM   8137  O   GLY B 174      45.369 -32.074   9.477  1.00  0.92           O  
ATOM   8138  N   TRP B 175      43.892 -30.535   8.793  1.00  0.88           N  
ATOM   8139  CA  TRP B 175      44.890 -29.581   8.337  1.00  0.88           C  
ATOM   8140  C   TRP B 175      45.157 -28.507   9.377  1.00  0.88           C  
ATOM   8141  O   TRP B 175      44.256 -28.093  10.103  1.00  0.88           O  
ATOM   8142  CB  TRP B 175      44.429 -28.843   7.051  1.00  0.88           C  
ATOM   8143  CG  TRP B 175      44.193 -29.722   5.839  1.00  0.88           C  
ATOM   8144  CD1 TRP B 175      43.019 -30.285   5.426  1.00  0.88           C  
ATOM   8145  CD2 TRP B 175      45.183 -30.095   4.861  1.00  0.88           C  
ATOM   8146  NE1 TRP B 175      43.204 -30.993   4.260  1.00  0.88           N  
ATOM   8147  CE2 TRP B 175      44.526 -30.895   3.901  1.00  0.88           C  
ATOM   8148  CE3 TRP B 175      46.545 -29.811   4.752  1.00  0.88           C  
ATOM   8149  CZ2 TRP B 175      45.215 -31.440   2.830  1.00  0.88           C  
ATOM   8150  CZ3 TRP B 175      47.244 -30.372   3.670  1.00  0.88           C  
ATOM   8151  CH2 TRP B 175      46.590 -31.180   2.727  1.00  0.88           C  
ATOM   8152  N   GLN B 176      46.409 -27.991   9.449  1.00  0.88           N  
ATOM   8153  CA  GLN B 176      46.690 -26.763  10.181  1.00  0.88           C  
ATOM   8154  C   GLN B 176      45.956 -25.565   9.604  1.00  0.88           C  
ATOM   8155  O   GLN B 176      46.076 -25.251   8.419  1.00  0.88           O  
ATOM   8156  CB  GLN B 176      48.208 -26.420  10.233  1.00  0.88           C  
ATOM   8157  CG  GLN B 176      48.529 -24.957  10.660  1.00  0.88           C  
ATOM   8158  CD  GLN B 176      50.025 -24.724  10.845  1.00  0.88           C  
ATOM   8159  OE1 GLN B 176      50.684 -25.409  11.636  1.00  0.88           O  
ATOM   8160  NE2 GLN B 176      50.584 -23.723  10.129  1.00  0.88           N  
ATOM   8161  N   VAL B 177      45.224 -24.851  10.470  1.00  0.85           N  
ATOM   8162  CA  VAL B 177      44.562 -23.611  10.144  1.00  0.85           C  
ATOM   8163  C   VAL B 177      45.140 -22.587  11.092  1.00  0.85           C  
ATOM   8164  O   VAL B 177      45.043 -22.717  12.314  1.00  0.85           O  
ATOM   8165  CB  VAL B 177      43.055 -23.714  10.352  1.00  0.85           C  
ATOM   8166  CG1 VAL B 177      42.336 -22.398   9.993  1.00  0.85           C  
ATOM   8167  CG2 VAL B 177      42.501 -24.875   9.507  1.00  0.85           C  
ATOM   8168  N   GLU B 178      45.814 -21.553  10.573  1.00  0.82           N  
ATOM   8169  CA  GLU B 178      46.436 -20.550  11.410  1.00  0.82           C  
ATOM   8170  C   GLU B 178      45.470 -19.433  11.799  1.00  0.82           C  
ATOM   8171  O   GLU B 178      44.749 -18.868  10.979  1.00  0.82           O  
ATOM   8172  CB  GLU B 178      47.756 -20.003  10.800  1.00  0.82           C  
ATOM   8173  CG  GLU B 178      47.802 -19.852   9.262  1.00  0.82           C  
ATOM   8174  CD  GLU B 178      48.084 -21.175   8.562  1.00  0.82           C  
ATOM   8175  OE1 GLU B 178      49.223 -21.709   8.657  1.00  0.82           O  
ATOM   8176  OE2 GLU B 178      47.182 -21.717   7.880  1.00  0.82           O  
ATOM   8177  N   GLU B 179      45.420 -19.090  13.105  1.00  0.82           N  
ATOM   8178  CA  GLU B 179      44.513 -18.091  13.642  1.00  0.82           C  
ATOM   8179  C   GLU B 179      45.277 -17.085  14.492  1.00  0.82           C  
ATOM   8180  O   GLU B 179      46.137 -17.453  15.287  1.00  0.82           O  
ATOM   8181  CB  GLU B 179      43.447 -18.779  14.504  1.00  0.82           C  
ATOM   8182  CG  GLU B 179      42.251 -17.878  14.840  1.00  0.82           C  
ATOM   8183  CD  GLU B 179      41.463 -18.497  15.958  1.00  0.82           C  
ATOM   8184  OE1 GLU B 179      41.463 -17.971  17.107  1.00  0.82           O  
ATOM   8185  OE2 GLU B 179      40.935 -19.604  15.707  1.00  0.82           O  
ATOM   8186  N   ALA B 180      45.038 -15.761  14.349  1.00  0.85           N  
ATOM   8187  CA  ALA B 180      45.858 -14.774  15.039  1.00  0.85           C  
ATOM   8188  C   ALA B 180      45.857 -14.866  16.563  1.00  0.85           C  
ATOM   8189  O   ALA B 180      44.837 -15.050  17.241  1.00  0.85           O  
ATOM   8190  CB  ALA B 180      45.552 -13.314  14.653  1.00  0.85           C  
ATOM   8191  N   ASP B 181      47.057 -14.724  17.128  1.00  0.86           N  
ATOM   8192  CA  ASP B 181      47.294 -14.757  18.546  1.00  0.86           C  
ATOM   8193  C   ASP B 181      47.120 -13.378  19.153  1.00  0.86           C  
ATOM   8194  O   ASP B 181      48.057 -12.621  19.383  1.00  0.86           O  
ATOM   8195  CB  ASP B 181      48.688 -15.360  18.766  1.00  0.86           C  
ATOM   8196  CG  ASP B 181      49.045 -15.452  20.235  1.00  0.86           C  
ATOM   8197  OD1 ASP B 181      48.224 -16.058  20.969  1.00  0.86           O  
ATOM   8198  OD2 ASP B 181      50.107 -14.899  20.616  1.00  0.86           O  
ATOM   8199  N   ASP B 182      45.857 -13.018  19.403  1.00  0.85           N  
ATOM   8200  CA  ASP B 182      45.440 -11.789  20.034  1.00  0.85           C  
ATOM   8201  C   ASP B 182      45.586 -11.911  21.546  1.00  0.85           C  
ATOM   8202  O   ASP B 182      44.620 -11.874  22.308  1.00  0.85           O  
ATOM   8203  CB  ASP B 182      43.993 -11.526  19.555  1.00  0.85           C  
ATOM   8204  CG  ASP B 182      43.435 -10.174  19.947  1.00  0.85           C  
ATOM   8205  OD1 ASP B 182      44.218  -9.220  20.139  1.00  0.85           O  
ATOM   8206  OD2 ASP B 182      42.178 -10.106  19.998  1.00  0.85           O  
ATOM   8207  N   TRP B 183      46.843 -12.072  21.998  1.00  0.84           N  
ATOM   8208  CA  TRP B 183      47.207 -12.361  23.373  1.00  0.84           C  
ATOM   8209  C   TRP B 183      47.004 -11.158  24.284  1.00  0.84           C  
ATOM   8210  O   TRP B 183      46.953 -11.247  25.509  1.00  0.84           O  
ATOM   8211  CB  TRP B 183      48.689 -12.837  23.442  1.00  0.84           C  
ATOM   8212  CG  TRP B 183      49.752 -11.800  23.101  1.00  0.84           C  
ATOM   8213  CD1 TRP B 183      50.081 -11.279  21.882  1.00  0.84           C  
ATOM   8214  CD2 TRP B 183      50.603 -11.144  24.062  1.00  0.84           C  
ATOM   8215  NE1 TRP B 183      51.058 -10.319  22.022  1.00  0.84           N  
ATOM   8216  CE2 TRP B 183      51.389 -10.221  23.347  1.00  0.84           C  
ATOM   8217  CE3 TRP B 183      50.735 -11.284  25.443  1.00  0.84           C  
ATOM   8218  CZ2 TRP B 183      52.313  -9.413  23.991  1.00  0.84           C  
ATOM   8219  CZ3 TRP B 183      51.676 -10.471  26.096  1.00  0.84           C  
ATOM   8220  CH2 TRP B 183      52.453  -9.545  25.381  1.00  0.84           C  
ATOM   8221  N   LEU B 184      46.856  -9.970  23.674  1.00  0.86           N  
ATOM   8222  CA  LEU B 184      46.655  -8.729  24.376  1.00  0.86           C  
ATOM   8223  C   LEU B 184      45.194  -8.349  24.475  1.00  0.86           C  
ATOM   8224  O   LEU B 184      44.874  -7.275  24.986  1.00  0.86           O  
ATOM   8225  CB  LEU B 184      47.390  -7.593  23.631  1.00  0.86           C  
ATOM   8226  CG  LEU B 184      48.923  -7.700  23.677  1.00  0.86           C  
ATOM   8227  CD1 LEU B 184      49.548  -6.708  22.691  1.00  0.86           C  
ATOM   8228  CD2 LEU B 184      49.459  -7.471  25.095  1.00  0.86           C  
ATOM   8229  N   ARG B 185      44.258  -9.222  24.044  1.00  0.79           N  
ATOM   8230  CA  ARG B 185      42.839  -8.909  23.963  1.00  0.79           C  
ATOM   8231  C   ARG B 185      42.222  -8.444  25.268  1.00  0.79           C  
ATOM   8232  O   ARG B 185      41.477  -7.470  25.319  1.00  0.79           O  
ATOM   8233  CB  ARG B 185      42.052 -10.158  23.515  1.00  0.79           C  
ATOM   8234  CG  ARG B 185      40.587  -9.868  23.132  1.00  0.79           C  
ATOM   8235  CD  ARG B 185      39.713 -11.116  23.061  1.00  0.79           C  
ATOM   8236  NE  ARG B 185      40.393 -12.085  22.157  1.00  0.79           N  
ATOM   8237  CZ  ARG B 185      40.038 -13.369  22.055  1.00  0.79           C  
ATOM   8238  NH1 ARG B 185      38.881 -13.804  22.550  1.00  0.79           N  
ATOM   8239  NH2 ARG B 185      40.873 -14.238  21.489  1.00  0.79           N  
ATOM   8240  N   TYR B 186      42.561  -9.115  26.381  1.00  0.83           N  
ATOM   8241  CA  TYR B 186      42.032  -8.769  27.684  1.00  0.83           C  
ATOM   8242  C   TYR B 186      43.006  -7.903  28.464  1.00  0.83           C  
ATOM   8243  O   TYR B 186      42.845  -7.670  29.660  1.00  0.83           O  
ATOM   8244  CB  TYR B 186      41.682 -10.039  28.491  1.00  0.83           C  
ATOM   8245  CG  TYR B 186      40.648 -10.859  27.764  1.00  0.83           C  
ATOM   8246  CD1 TYR B 186      39.304 -10.444  27.717  1.00  0.83           C  
ATOM   8247  CD2 TYR B 186      41.009 -12.053  27.118  1.00  0.83           C  
ATOM   8248  CE1 TYR B 186      38.344 -11.202  27.031  1.00  0.83           C  
ATOM   8249  CE2 TYR B 186      40.049 -12.821  26.447  1.00  0.83           C  
ATOM   8250  CZ  TYR B 186      38.717 -12.396  26.407  1.00  0.83           C  
ATOM   8251  OH  TYR B 186      37.759 -13.177  25.731  1.00  0.83           O  
ATOM   8252  N   GLY B 187      44.034  -7.375  27.774  1.00  0.86           N  
ATOM   8253  CA  GLY B 187      45.149  -6.661  28.366  1.00  0.86           C  
ATOM   8254  C   GLY B 187      46.176  -7.566  28.995  1.00  0.86           C  
ATOM   8255  O   GLY B 187      45.953  -8.743  29.264  1.00  0.86           O  
ATOM   8256  N   ASN B 188      47.362  -7.004  29.266  1.00  0.88           N  
ATOM   8257  CA  ASN B 188      48.467  -7.705  29.879  1.00  0.88           C  
ATOM   8258  C   ASN B 188      48.751  -6.971  31.190  1.00  0.88           C  
ATOM   8259  O   ASN B 188      49.096  -5.791  31.148  1.00  0.88           O  
ATOM   8260  CB  ASN B 188      49.681  -7.684  28.911  1.00  0.88           C  
ATOM   8261  CG  ASN B 188      50.944  -8.334  29.473  1.00  0.88           C  
ATOM   8262  OD1 ASN B 188      50.963  -8.926  30.553  1.00  0.88           O  
ATOM   8263  ND2 ASN B 188      52.058  -8.209  28.717  1.00  0.88           N  
ATOM   8264  N   PRO B 189      48.617  -7.569  32.370  1.00  0.90           N  
ATOM   8265  CA  PRO B 189      48.730  -6.826  33.617  1.00  0.90           C  
ATOM   8266  C   PRO B 189      50.170  -6.704  34.015  1.00  0.90           C  
ATOM   8267  O   PRO B 189      50.479  -5.837  34.830  1.00  0.90           O  
ATOM   8268  CB  PRO B 189      47.966  -7.699  34.631  1.00  0.90           C  
ATOM   8269  CG  PRO B 189      48.048  -9.120  34.064  1.00  0.90           C  
ATOM   8270  CD  PRO B 189      47.996  -8.880  32.559  1.00  0.90           C  
ATOM   8271  N   TRP B 190      51.036  -7.593  33.501  1.00  0.87           N  
ATOM   8272  CA  TRP B 190      52.420  -7.714  33.898  1.00  0.87           C  
ATOM   8273  C   TRP B 190      53.332  -6.713  33.228  1.00  0.87           C  
ATOM   8274  O   TRP B 190      54.401  -6.403  33.747  1.00  0.87           O  
ATOM   8275  CB  TRP B 190      52.948  -9.123  33.533  1.00  0.87           C  
ATOM   8276  CG  TRP B 190      52.057 -10.263  33.984  1.00  0.87           C  
ATOM   8277  CD1 TRP B 190      51.261 -11.073  33.220  1.00  0.87           C  
ATOM   8278  CD2 TRP B 190      51.882 -10.673  35.347  1.00  0.87           C  
ATOM   8279  NE1 TRP B 190      50.582 -11.957  34.026  1.00  0.87           N  
ATOM   8280  CE2 TRP B 190      50.931 -11.726  35.332  1.00  0.87           C  
ATOM   8281  CE3 TRP B 190      52.451 -10.236  36.541  1.00  0.87           C  
ATOM   8282  CZ2 TRP B 190      50.533 -12.331  36.508  1.00  0.87           C  
ATOM   8283  CZ3 TRP B 190      52.044 -10.855  37.732  1.00  0.87           C  
ATOM   8284  CH2 TRP B 190      51.083 -11.880  37.716  1.00  0.87           C  
ATOM   8285  N   GLU B 191      52.926  -6.173  32.069  1.00  0.89           N  
ATOM   8286  CA  GLU B 191      53.697  -5.163  31.385  1.00  0.89           C  
ATOM   8287  C   GLU B 191      53.367  -3.774  31.892  1.00  0.89           C  
ATOM   8288  O   GLU B 191      52.262  -3.472  32.349  1.00  0.89           O  
ATOM   8289  CB  GLU B 191      53.476  -5.188  29.854  1.00  0.89           C  
ATOM   8290  CG  GLU B 191      52.028  -4.843  29.428  1.00  0.89           C  
ATOM   8291  CD  GLU B 191      51.792  -4.948  27.929  1.00  0.89           C  
ATOM   8292  OE1 GLU B 191      52.600  -5.591  27.208  1.00  0.89           O  
ATOM   8293  OE2 GLU B 191      50.778  -4.392  27.434  1.00  0.89           O  
ATOM   8294  N   LYS B 192      54.337  -2.857  31.800  1.00  0.84           N  
ATOM   8295  CA  LYS B 192      54.096  -1.460  32.014  1.00  0.84           C  
ATOM   8296  C   LYS B 192      54.600  -0.658  30.837  1.00  0.84           C  
ATOM   8297  O   LYS B 192      55.798  -0.529  30.593  1.00  0.84           O  
ATOM   8298  CB  LYS B 192      54.755  -0.958  33.321  1.00  0.84           C  
ATOM   8299  CG  LYS B 192      54.432   0.507  33.658  1.00  0.84           C  
ATOM   8300  CD  LYS B 192      52.933   0.737  33.914  1.00  0.84           C  
ATOM   8301  CE  LYS B 192      52.558   2.208  34.088  1.00  0.84           C  
ATOM   8302  NZ  LYS B 192      52.767   2.975  32.839  1.00  0.84           N  
ATOM   8303  N   ALA B 193      53.665  -0.047  30.087  1.00  0.89           N  
ATOM   8304  CA  ALA B 193      53.959   0.911  29.047  1.00  0.89           C  
ATOM   8305  C   ALA B 193      54.718   2.137  29.531  1.00  0.89           C  
ATOM   8306  O   ALA B 193      54.372   2.725  30.565  1.00  0.89           O  
ATOM   8307  CB  ALA B 193      52.628   1.386  28.442  1.00  0.89           C  
ATOM   8308  N   ARG B 194      55.754   2.554  28.781  1.00  0.83           N  
ATOM   8309  CA  ARG B 194      56.505   3.767  29.053  1.00  0.83           C  
ATOM   8310  C   ARG B 194      56.390   4.755  27.897  1.00  0.83           C  
ATOM   8311  O   ARG B 194      57.357   4.942  27.151  1.00  0.83           O  
ATOM   8312  CB  ARG B 194      58.000   3.463  29.283  1.00  0.83           C  
ATOM   8313  CG  ARG B 194      58.295   2.355  30.308  1.00  0.83           C  
ATOM   8314  CD  ARG B 194      57.689   2.649  31.674  1.00  0.83           C  
ATOM   8315  NE  ARG B 194      58.345   1.736  32.644  1.00  0.83           N  
ATOM   8316  CZ  ARG B 194      58.228   1.840  33.966  1.00  0.83           C  
ATOM   8317  NH1 ARG B 194      57.436   2.735  34.541  1.00  0.83           N  
ATOM   8318  NH2 ARG B 194      58.961   1.027  34.712  1.00  0.83           N  
ATOM   8319  N   PRO B 195      55.257   5.417  27.683  1.00  0.83           N  
ATOM   8320  CA  PRO B 195      55.084   6.364  26.581  1.00  0.83           C  
ATOM   8321  C   PRO B 195      55.952   7.600  26.709  1.00  0.83           C  
ATOM   8322  O   PRO B 195      56.080   8.354  25.747  1.00  0.83           O  
ATOM   8323  CB  PRO B 195      53.596   6.718  26.671  1.00  0.83           C  
ATOM   8324  CG  PRO B 195      53.247   6.550  28.152  1.00  0.83           C  
ATOM   8325  CD  PRO B 195      54.077   5.346  28.552  1.00  0.83           C  
ATOM   8326  N   GLU B 196      56.569   7.844  27.870  1.00  0.81           N  
ATOM   8327  CA  GLU B 196      57.474   8.940  28.089  1.00  0.81           C  
ATOM   8328  C   GLU B 196      58.888   8.665  27.598  1.00  0.81           C  
ATOM   8329  O   GLU B 196      59.681   9.588  27.433  1.00  0.81           O  
ATOM   8330  CB  GLU B 196      57.484   9.318  29.594  1.00  0.81           C  
ATOM   8331  CG  GLU B 196      58.204   8.337  30.565  1.00  0.81           C  
ATOM   8332  CD  GLU B 196      57.482   7.020  30.850  1.00  0.81           C  
ATOM   8333  OE1 GLU B 196      58.049   6.226  31.655  1.00  0.81           O  
ATOM   8334  OE2 GLU B 196      56.380   6.766  30.314  1.00  0.81           O  
ATOM   8335  N   TYR B 197      59.241   7.391  27.320  1.00  0.84           N  
ATOM   8336  CA  TYR B 197      60.586   7.008  26.903  1.00  0.84           C  
ATOM   8337  C   TYR B 197      60.654   6.530  25.461  1.00  0.84           C  
ATOM   8338  O   TYR B 197      61.487   5.698  25.103  1.00  0.84           O  
ATOM   8339  CB  TYR B 197      61.194   5.922  27.838  1.00  0.84           C  
ATOM   8340  CG  TYR B 197      61.763   6.538  29.089  1.00  0.84           C  
ATOM   8341  CD1 TYR B 197      62.938   7.311  29.028  1.00  0.84           C  
ATOM   8342  CD2 TYR B 197      61.147   6.345  30.334  1.00  0.84           C  
ATOM   8343  CE1 TYR B 197      63.456   7.919  30.182  1.00  0.84           C  
ATOM   8344  CE2 TYR B 197      61.659   6.958  31.487  1.00  0.84           C  
ATOM   8345  CZ  TYR B 197      62.808   7.754  31.409  1.00  0.84           C  
ATOM   8346  OH  TYR B 197      63.309   8.389  32.564  1.00  0.84           O  
ATOM   8347  N   MET B 198      59.779   7.035  24.574  1.00  0.83           N  
ATOM   8348  CA  MET B 198      59.880   6.757  23.154  1.00  0.83           C  
ATOM   8349  C   MET B 198      61.161   7.257  22.486  1.00  0.83           C  
ATOM   8350  O   MET B 198      61.637   8.361  22.742  1.00  0.83           O  
ATOM   8351  CB  MET B 198      58.677   7.323  22.372  1.00  0.83           C  
ATOM   8352  CG  MET B 198      57.324   6.737  22.806  1.00  0.83           C  
ATOM   8353  SD  MET B 198      55.947   7.210  21.719  1.00  0.83           S  
ATOM   8354  CE  MET B 198      55.841   8.934  22.280  1.00  0.83           C  
ATOM   8355  N   LEU B 199      61.737   6.439  21.585  1.00  0.89           N  
ATOM   8356  CA  LEU B 199      62.982   6.757  20.910  1.00  0.89           C  
ATOM   8357  C   LEU B 199      62.812   6.747  19.397  1.00  0.89           C  
ATOM   8358  O   LEU B 199      62.057   5.921  18.883  1.00  0.89           O  
ATOM   8359  CB  LEU B 199      64.083   5.740  21.291  1.00  0.89           C  
ATOM   8360  CG  LEU B 199      64.485   5.781  22.779  1.00  0.89           C  
ATOM   8361  CD1 LEU B 199      65.413   4.609  23.101  1.00  0.89           C  
ATOM   8362  CD2 LEU B 199      65.164   7.107  23.149  1.00  0.89           C  
ATOM   8363  N   PRO B 200      63.447   7.625  18.623  1.00  0.90           N  
ATOM   8364  CA  PRO B 200      63.335   7.615  17.171  1.00  0.90           C  
ATOM   8365  C   PRO B 200      64.164   6.527  16.511  1.00  0.90           C  
ATOM   8366  O   PRO B 200      65.312   6.287  16.881  1.00  0.90           O  
ATOM   8367  CB  PRO B 200      63.843   9.011  16.778  1.00  0.90           C  
ATOM   8368  CG  PRO B 200      64.897   9.334  17.840  1.00  0.90           C  
ATOM   8369  CD  PRO B 200      64.306   8.712  19.106  1.00  0.90           C  
ATOM   8370  N   VAL B 201      63.593   5.869  15.492  1.00  0.93           N  
ATOM   8371  CA  VAL B 201      64.275   4.897  14.663  1.00  0.93           C  
ATOM   8372  C   VAL B 201      64.194   5.381  13.230  1.00  0.93           C  
ATOM   8373  O   VAL B 201      63.121   5.706  12.726  1.00  0.93           O  
ATOM   8374  CB  VAL B 201      63.667   3.503  14.766  1.00  0.93           C  
ATOM   8375  CG1 VAL B 201      64.460   2.504  13.901  1.00  0.93           C  
ATOM   8376  CG2 VAL B 201      63.670   3.061  16.243  1.00  0.93           C  
ATOM   8377  N   HIS B 202      65.349   5.464  12.546  1.00  0.89           N  
ATOM   8378  CA  HIS B 202      65.451   5.994  11.197  1.00  0.89           C  
ATOM   8379  C   HIS B 202      65.484   4.918  10.131  1.00  0.89           C  
ATOM   8380  O   HIS B 202      66.075   3.859  10.304  1.00  0.89           O  
ATOM   8381  CB  HIS B 202      66.741   6.819  11.036  1.00  0.89           C  
ATOM   8382  CG  HIS B 202      66.783   7.983  11.967  1.00  0.89           C  
ATOM   8383  ND1 HIS B 202      65.999   9.081  11.692  1.00  0.89           N  
ATOM   8384  CD2 HIS B 202      67.422   8.144  13.154  1.00  0.89           C  
ATOM   8385  CE1 HIS B 202      66.167   9.892  12.719  1.00  0.89           C  
ATOM   8386  NE2 HIS B 202      67.021   9.372  13.635  1.00  0.89           N  
ATOM   8387  N   PHE B 203      64.865   5.187   8.978  1.00  0.90           N  
ATOM   8388  CA  PHE B 203      64.840   4.274   7.854  1.00  0.90           C  
ATOM   8389  C   PHE B 203      64.996   5.057   6.563  1.00  0.90           C  
ATOM   8390  O   PHE B 203      64.668   6.240   6.501  1.00  0.90           O  
ATOM   8391  CB  PHE B 203      63.481   3.523   7.781  1.00  0.90           C  
ATOM   8392  CG  PHE B 203      63.319   2.522   8.891  1.00  0.90           C  
ATOM   8393  CD1 PHE B 203      64.031   1.314   8.854  1.00  0.90           C  
ATOM   8394  CD2 PHE B 203      62.415   2.746   9.944  1.00  0.90           C  
ATOM   8395  CE1 PHE B 203      63.823   0.332   9.829  1.00  0.90           C  
ATOM   8396  CE2 PHE B 203      62.208   1.768  10.926  1.00  0.90           C  
ATOM   8397  CZ  PHE B 203      62.912   0.558  10.868  1.00  0.90           C  
ATOM   8398  N   TYR B 204      65.470   4.406   5.483  1.00  0.88           N  
ATOM   8399  CA  TYR B 204      65.665   5.001   4.164  1.00  0.88           C  
ATOM   8400  C   TYR B 204      66.601   6.200   4.140  1.00  0.88           C  
ATOM   8401  O   TYR B 204      67.685   6.166   4.712  1.00  0.88           O  
ATOM   8402  CB  TYR B 204      64.326   5.355   3.465  1.00  0.88           C  
ATOM   8403  CG  TYR B 204      63.385   4.186   3.484  1.00  0.88           C  
ATOM   8404  CD1 TYR B 204      63.564   3.069   2.648  1.00  0.88           C  
ATOM   8405  CD2 TYR B 204      62.290   4.209   4.357  1.00  0.88           C  
ATOM   8406  CE1 TYR B 204      62.642   2.008   2.672  1.00  0.88           C  
ATOM   8407  CE2 TYR B 204      61.370   3.159   4.379  1.00  0.88           C  
ATOM   8408  CZ  TYR B 204      61.524   2.084   3.510  1.00  0.88           C  
ATOM   8409  OH  TYR B 204      60.475   1.158   3.418  1.00  0.88           O  
ATOM   8410  N   GLY B 205      66.222   7.291   3.439  1.00  0.89           N  
ATOM   8411  CA  GLY B 205      67.080   8.445   3.225  1.00  0.89           C  
ATOM   8412  C   GLY B 205      68.364   8.147   2.510  1.00  0.89           C  
ATOM   8413  O   GLY B 205      68.466   7.224   1.705  1.00  0.89           O  
ATOM   8414  N   ARG B 206      69.393   8.953   2.777  1.00  0.81           N  
ATOM   8415  CA  ARG B 206      70.683   8.733   2.177  1.00  0.81           C  
ATOM   8416  C   ARG B 206      71.765   9.354   3.014  1.00  0.81           C  
ATOM   8417  O   ARG B 206      71.519  10.031   4.009  1.00  0.81           O  
ATOM   8418  CB  ARG B 206      70.792   9.254   0.723  1.00  0.81           C  
ATOM   8419  CG  ARG B 206      70.660  10.778   0.561  1.00  0.81           C  
ATOM   8420  CD  ARG B 206      71.196  11.261  -0.790  1.00  0.81           C  
ATOM   8421  NE  ARG B 206      71.037  12.739  -0.822  1.00  0.81           N  
ATOM   8422  CZ  ARG B 206      69.884  13.401  -0.976  1.00  0.81           C  
ATOM   8423  NH1 ARG B 206      69.894  14.715  -0.794  1.00  0.81           N  
ATOM   8424  NH2 ARG B 206      68.747  12.789  -1.284  1.00  0.81           N  
ATOM   8425  N   VAL B 207      73.019   9.103   2.632  1.00  0.89           N  
ATOM   8426  CA  VAL B 207      74.167   9.571   3.365  1.00  0.89           C  
ATOM   8427  C   VAL B 207      74.856  10.698   2.632  1.00  0.89           C  
ATOM   8428  O   VAL B 207      75.158  10.604   1.444  1.00  0.89           O  
ATOM   8429  CB  VAL B 207      75.139   8.436   3.600  1.00  0.89           C  
ATOM   8430  CG1 VAL B 207      76.354   8.937   4.371  1.00  0.89           C  
ATOM   8431  CG2 VAL B 207      74.428   7.329   4.399  1.00  0.89           C  
ATOM   8432  N   GLU B 208      75.128  11.792   3.363  1.00  0.84           N  
ATOM   8433  CA  GLU B 208      75.917  12.906   2.899  1.00  0.84           C  
ATOM   8434  C   GLU B 208      77.213  12.905   3.705  1.00  0.84           C  
ATOM   8435  O   GLU B 208      77.211  13.013   4.934  1.00  0.84           O  
ATOM   8436  CB  GLU B 208      75.175  14.249   3.118  1.00  0.84           C  
ATOM   8437  CG  GLU B 208      73.814  14.386   2.377  1.00  0.84           C  
ATOM   8438  CD  GLU B 208      73.903  14.525   0.859  1.00  0.84           C  
ATOM   8439  OE1 GLU B 208      75.004  14.822   0.339  1.00  0.84           O  
ATOM   8440  OE2 GLU B 208      72.830  14.370   0.204  1.00  0.84           O  
ATOM   8441  N   HIS B 209      78.375  12.756   3.041  1.00  0.83           N  
ATOM   8442  CA  HIS B 209      79.672  12.742   3.706  1.00  0.83           C  
ATOM   8443  C   HIS B 209      80.194  14.163   3.850  1.00  0.83           C  
ATOM   8444  O   HIS B 209      80.455  14.833   2.852  1.00  0.83           O  
ATOM   8445  CB  HIS B 209      80.698  11.900   2.904  1.00  0.83           C  
ATOM   8446  CG  HIS B 209      80.338  10.440   2.873  1.00  0.83           C  
ATOM   8447  ND1 HIS B 209      80.430   9.717   4.046  1.00  0.83           N  
ATOM   8448  CD2 HIS B 209      79.795   9.673   1.889  1.00  0.83           C  
ATOM   8449  CE1 HIS B 209      79.934   8.528   3.755  1.00  0.83           C  
ATOM   8450  NE2 HIS B 209      79.534   8.448   2.466  1.00  0.83           N  
ATOM   8451  N   THR B 210      80.352  14.686   5.089  1.00  0.85           N  
ATOM   8452  CA  THR B 210      80.659  16.105   5.296  1.00  0.85           C  
ATOM   8453  C   THR B 210      81.906  16.290   6.148  1.00  0.85           C  
ATOM   8454  O   THR B 210      82.368  15.333   6.774  1.00  0.85           O  
ATOM   8455  CB  THR B 210      79.504  16.931   5.905  1.00  0.85           C  
ATOM   8456  OG1 THR B 210      79.343  16.755   7.309  1.00  0.85           O  
ATOM   8457  CG2 THR B 210      78.170  16.562   5.242  1.00  0.85           C  
ATOM   8458  N   PRO B 211      82.497  17.496   6.230  1.00  0.83           N  
ATOM   8459  CA  PRO B 211      83.664  17.736   7.078  1.00  0.83           C  
ATOM   8460  C   PRO B 211      83.396  17.559   8.562  1.00  0.83           C  
ATOM   8461  O   PRO B 211      84.352  17.435   9.323  1.00  0.83           O  
ATOM   8462  CB  PRO B 211      84.097  19.175   6.744  1.00  0.83           C  
ATOM   8463  CG  PRO B 211      83.606  19.403   5.313  1.00  0.83           C  
ATOM   8464  CD  PRO B 211      82.325  18.573   5.246  1.00  0.83           C  
ATOM   8465  N   ASP B 212      82.120  17.525   8.985  1.00  0.76           N  
ATOM   8466  CA  ASP B 212      81.723  17.388  10.372  1.00  0.76           C  
ATOM   8467  C   ASP B 212      81.074  16.037  10.630  1.00  0.76           C  
ATOM   8468  O   ASP B 212      80.252  15.857  11.543  1.00  0.76           O  
ATOM   8469  CB  ASP B 212      80.736  18.497  10.771  1.00  0.76           C  
ATOM   8470  CG  ASP B 212      81.471  19.817  10.820  1.00  0.76           C  
ATOM   8471  OD1 ASP B 212      82.267  19.989  11.778  1.00  0.76           O  
ATOM   8472  OD2 ASP B 212      81.201  20.663   9.933  1.00  0.76           O  
ATOM   8473  N   GLY B 213      81.421  15.036   9.805  1.00  0.84           N  
ATOM   8474  CA  GLY B 213      81.012  13.657   9.993  1.00  0.84           C  
ATOM   8475  C   GLY B 213      80.092  13.174   8.918  1.00  0.84           C  
ATOM   8476  O   GLY B 213      79.670  13.893   8.019  1.00  0.84           O  
ATOM   8477  N   VAL B 214      79.720  11.895   8.994  1.00  0.88           N  
ATOM   8478  CA  VAL B 214      78.793  11.312   8.051  1.00  0.88           C  
ATOM   8479  C   VAL B 214      77.372  11.620   8.494  1.00  0.88           C  
ATOM   8480  O   VAL B 214      77.005  11.439   9.656  1.00  0.88           O  
ATOM   8481  CB  VAL B 214      79.022   9.816   7.929  1.00  0.88           C  
ATOM   8482  CG1 VAL B 214      78.096   9.231   6.871  1.00  0.88           C  
ATOM   8483  CG2 VAL B 214      80.489   9.552   7.544  1.00  0.88           C  
ATOM   8484  N   LYS B 215      76.530  12.159   7.591  1.00  0.85           N  
ATOM   8485  CA  LYS B 215      75.182  12.561   7.940  1.00  0.85           C  
ATOM   8486  C   LYS B 215      74.168  11.725   7.200  1.00  0.85           C  
ATOM   8487  O   LYS B 215      74.073  11.747   5.977  1.00  0.85           O  
ATOM   8488  CB  LYS B 215      74.914  14.061   7.652  1.00  0.85           C  
ATOM   8489  CG  LYS B 215      75.920  15.026   8.302  1.00  0.85           C  
ATOM   8490  CD  LYS B 215      76.003  14.911   9.835  1.00  0.85           C  
ATOM   8491  CE  LYS B 215      77.196  15.695  10.384  1.00  0.85           C  
ATOM   8492  NZ  LYS B 215      77.392  15.439  11.827  1.00  0.85           N  
ATOM   8493  N   TRP B 216      73.354  10.966   7.953  1.00  0.82           N  
ATOM   8494  CA  TRP B 216      72.247  10.213   7.412  1.00  0.82           C  
ATOM   8495  C   TRP B 216      71.024  11.113   7.415  1.00  0.82           C  
ATOM   8496  O   TRP B 216      70.495  11.456   8.472  1.00  0.82           O  
ATOM   8497  CB  TRP B 216      72.029   8.933   8.265  1.00  0.82           C  
ATOM   8498  CG  TRP B 216      71.065   7.894   7.720  1.00  0.82           C  
ATOM   8499  CD1 TRP B 216      70.563   7.764   6.456  1.00  0.82           C  
ATOM   8500  CD2 TRP B 216      70.516   6.809   8.490  1.00  0.82           C  
ATOM   8501  NE1 TRP B 216      69.735   6.677   6.392  1.00  0.82           N  
ATOM   8502  CE2 TRP B 216      69.674   6.077   7.616  1.00  0.82           C  
ATOM   8503  CE3 TRP B 216      70.674   6.423   9.818  1.00  0.82           C  
ATOM   8504  CZ2 TRP B 216      68.971   4.972   8.063  1.00  0.82           C  
ATOM   8505  CZ3 TRP B 216      69.970   5.295  10.265  1.00  0.82           C  
ATOM   8506  CH2 TRP B 216      69.126   4.580   9.398  1.00  0.82           C  
ATOM   8507  N   LEU B 217      70.592  11.551   6.222  1.00  0.86           N  
ATOM   8508  CA  LEU B 217      69.565  12.561   6.058  1.00  0.86           C  
ATOM   8509  C   LEU B 217      68.412  12.048   5.221  1.00  0.86           C  
ATOM   8510  O   LEU B 217      68.482  10.980   4.613  1.00  0.86           O  
ATOM   8511  CB  LEU B 217      70.100  13.839   5.355  1.00  0.86           C  
ATOM   8512  CG  LEU B 217      71.208  14.620   6.092  1.00  0.86           C  
ATOM   8513  CD1 LEU B 217      71.628  15.834   5.251  1.00  0.86           C  
ATOM   8514  CD2 LEU B 217      70.774  15.093   7.486  1.00  0.86           C  
ATOM   8515  N   ASP B 218      67.297  12.813   5.221  1.00  0.82           N  
ATOM   8516  CA  ASP B 218      66.065  12.552   4.495  1.00  0.82           C  
ATOM   8517  C   ASP B 218      65.438  11.210   4.872  1.00  0.82           C  
ATOM   8518  O   ASP B 218      64.872  10.486   4.053  1.00  0.82           O  
ATOM   8519  CB  ASP B 218      66.251  12.701   2.957  1.00  0.82           C  
ATOM   8520  CG  ASP B 218      66.843  14.044   2.551  1.00  0.82           C  
ATOM   8521  OD1 ASP B 218      66.769  15.004   3.360  1.00  0.82           O  
ATOM   8522  OD2 ASP B 218      67.368  14.120   1.402  1.00  0.82           O  
ATOM   8523  N   THR B 219      65.539  10.846   6.162  1.00  0.85           N  
ATOM   8524  CA  THR B 219      65.075   9.577   6.691  1.00  0.85           C  
ATOM   8525  C   THR B 219      63.592   9.560   7.012  1.00  0.85           C  
ATOM   8526  O   THR B 219      62.950  10.563   7.321  1.00  0.85           O  
ATOM   8527  CB  THR B 219      65.837   9.114   7.933  1.00  0.85           C  
ATOM   8528  OG1 THR B 219      65.764  10.079   8.978  1.00  0.85           O  
ATOM   8529  CG2 THR B 219      67.318   8.944   7.573  1.00  0.85           C  
ATOM   8530  N   GLN B 220      62.998   8.358   6.975  1.00  0.79           N  
ATOM   8531  CA  GLN B 220      61.683   8.100   7.514  1.00  0.79           C  
ATOM   8532  C   GLN B 220      61.861   7.741   8.972  1.00  0.79           C  
ATOM   8533  O   GLN B 220      62.709   6.918   9.309  1.00  0.79           O  
ATOM   8534  CB  GLN B 220      61.017   6.901   6.797  1.00  0.79           C  
ATOM   8535  CG  GLN B 220      59.678   6.420   7.410  1.00  0.79           C  
ATOM   8536  CD  GLN B 220      59.276   5.063   6.838  1.00  0.79           C  
ATOM   8537  OE1 GLN B 220      58.894   4.911   5.681  1.00  0.79           O  
ATOM   8538  NE2 GLN B 220      59.382   4.005   7.679  1.00  0.79           N  
ATOM   8539  N   VAL B 221      61.064   8.328   9.877  1.00  0.85           N  
ATOM   8540  CA  VAL B 221      61.164   8.024  11.292  1.00  0.85           C  
ATOM   8541  C   VAL B 221      59.986   7.179  11.725  1.00  0.85           C  
ATOM   8542  O   VAL B 221      58.844   7.399  11.330  1.00  0.85           O  
ATOM   8543  CB  VAL B 221      61.278   9.288  12.139  1.00  0.85           C  
ATOM   8544  CG1 VAL B 221      61.256   8.981  13.651  1.00  0.85           C  
ATOM   8545  CG2 VAL B 221      62.605   9.984  11.790  1.00  0.85           C  
ATOM   8546  N   VAL B 222      60.247   6.159  12.554  1.00  0.88           N  
ATOM   8547  CA  VAL B 222      59.237   5.409  13.271  1.00  0.88           C  
ATOM   8548  C   VAL B 222      59.669   5.507  14.716  1.00  0.88           C  
ATOM   8549  O   VAL B 222      60.864   5.489  15.004  1.00  0.88           O  
ATOM   8550  CB  VAL B 222      59.140   3.958  12.817  1.00  0.88           C  
ATOM   8551  CG1 VAL B 222      58.127   3.181  13.679  1.00  0.88           C  
ATOM   8552  CG2 VAL B 222      58.697   3.929  11.341  1.00  0.88           C  
ATOM   8553  N   LEU B 223      58.746   5.676  15.679  1.00  0.87           N  
ATOM   8554  CA  LEU B 223      59.135   5.760  17.074  1.00  0.87           C  
ATOM   8555  C   LEU B 223      59.035   4.417  17.764  1.00  0.87           C  
ATOM   8556  O   LEU B 223      58.174   3.597  17.457  1.00  0.87           O  
ATOM   8557  CB  LEU B 223      58.279   6.774  17.863  1.00  0.87           C  
ATOM   8558  CG  LEU B 223      58.368   8.228  17.364  1.00  0.87           C  
ATOM   8559  CD1 LEU B 223      57.484   9.129  18.237  1.00  0.87           C  
ATOM   8560  CD2 LEU B 223      59.807   8.756  17.357  1.00  0.87           C  
ATOM   8561  N   ALA B 224      59.926   4.162  18.732  1.00  0.93           N  
ATOM   8562  CA  ALA B 224      59.941   2.941  19.495  1.00  0.93           C  
ATOM   8563  C   ALA B 224      59.574   3.207  20.936  1.00  0.93           C  
ATOM   8564  O   ALA B 224      60.287   3.889  21.667  1.00  0.93           O  
ATOM   8565  CB  ALA B 224      61.336   2.303  19.425  1.00  0.93           C  
ATOM   8566  N   MET B 225      58.433   2.659  21.381  1.00  0.90           N  
ATOM   8567  CA  MET B 225      57.914   2.832  22.718  1.00  0.90           C  
ATOM   8568  C   MET B 225      58.190   1.598  23.566  1.00  0.90           C  
ATOM   8569  O   MET B 225      57.736   0.516  23.186  1.00  0.90           O  
ATOM   8570  CB  MET B 225      56.391   3.067  22.635  1.00  0.90           C  
ATOM   8571  CG  MET B 225      55.707   3.256  23.997  1.00  0.90           C  
ATOM   8572  SD  MET B 225      54.025   3.915  23.838  1.00  0.90           S  
ATOM   8573  CE  MET B 225      53.465   3.196  25.398  1.00  0.90           C  
ATOM   8574  N   PRO B 226      58.918   1.652  24.676  1.00  0.95           N  
ATOM   8575  CA  PRO B 226      59.206   0.470  25.461  1.00  0.95           C  
ATOM   8576  C   PRO B 226      58.104   0.100  26.427  1.00  0.95           C  
ATOM   8577  O   PRO B 226      57.406   0.950  26.985  1.00  0.95           O  
ATOM   8578  CB  PRO B 226      60.487   0.844  26.207  1.00  0.95           C  
ATOM   8579  CG  PRO B 226      60.435   2.360  26.385  1.00  0.95           C  
ATOM   8580  CD  PRO B 226      59.592   2.845  25.204  1.00  0.95           C  
ATOM   8581  N   TYR B 227      57.946  -1.210  26.628  1.00  0.93           N  
ATOM   8582  CA  TYR B 227      57.074  -1.778  27.623  1.00  0.93           C  
ATOM   8583  C   TYR B 227      57.950  -2.615  28.543  1.00  0.93           C  
ATOM   8584  O   TYR B 227      58.692  -3.484  28.080  1.00  0.93           O  
ATOM   8585  CB  TYR B 227      55.994  -2.682  26.973  1.00  0.93           C  
ATOM   8586  CG  TYR B 227      54.863  -1.897  26.340  1.00  0.93           C  
ATOM   8587  CD1 TYR B 227      55.055  -1.129  25.176  1.00  0.93           C  
ATOM   8588  CD2 TYR B 227      53.559  -2.010  26.856  1.00  0.93           C  
ATOM   8589  CE1 TYR B 227      53.971  -0.496  24.549  1.00  0.93           C  
ATOM   8590  CE2 TYR B 227      52.472  -1.393  26.218  1.00  0.93           C  
ATOM   8591  CZ  TYR B 227      52.681  -0.637  25.061  1.00  0.93           C  
ATOM   8592  OH  TYR B 227      51.597  -0.019  24.403  1.00  0.93           O  
ATOM   8593  N   ASP B 228      57.898  -2.352  29.863  1.00  0.93           N  
ATOM   8594  CA  ASP B 228      58.707  -3.044  30.852  1.00  0.93           C  
ATOM   8595  C   ASP B 228      57.910  -4.165  31.506  1.00  0.93           C  
ATOM   8596  O   ASP B 228      56.830  -3.936  32.043  1.00  0.93           O  
ATOM   8597  CB  ASP B 228      59.131  -2.094  32.012  1.00  0.93           C  
ATOM   8598  CG  ASP B 228      60.142  -1.037  31.641  1.00  0.93           C  
ATOM   8599  OD1 ASP B 228      60.746  -1.080  30.547  1.00  0.93           O  
ATOM   8600  OD2 ASP B 228      60.319  -0.098  32.470  1.00  0.93           O  
ATOM   8601  N   THR B 229      58.445  -5.396  31.521  1.00  0.93           N  
ATOM   8602  CA  THR B 229      57.841  -6.529  32.222  1.00  0.93           C  
ATOM   8603  C   THR B 229      58.822  -7.007  33.284  1.00  0.93           C  
ATOM   8604  O   THR B 229      59.978  -7.267  32.937  1.00  0.93           O  
ATOM   8605  CB  THR B 229      57.522  -7.703  31.304  1.00  0.93           C  
ATOM   8606  OG1 THR B 229      56.504  -7.345  30.381  1.00  0.93           O  
ATOM   8607  CG2 THR B 229      57.004  -8.929  32.076  1.00  0.93           C  
ATOM   8608  N   PRO B 230      58.477  -7.151  34.568  1.00  0.96           N  
ATOM   8609  CA  PRO B 230      59.408  -7.628  35.585  1.00  0.96           C  
ATOM   8610  C   PRO B 230      59.712  -9.115  35.473  1.00  0.96           C  
ATOM   8611  O   PRO B 230      58.817  -9.910  35.197  1.00  0.96           O  
ATOM   8612  CB  PRO B 230      58.692  -7.327  36.915  1.00  0.96           C  
ATOM   8613  CG  PRO B 230      57.642  -6.269  36.585  1.00  0.96           C  
ATOM   8614  CD  PRO B 230      57.239  -6.650  35.168  1.00  0.96           C  
ATOM   8615  N   VAL B 231      60.976  -9.508  35.703  1.00  0.97           N  
ATOM   8616  CA  VAL B 231      61.414 -10.895  35.656  1.00  0.97           C  
ATOM   8617  C   VAL B 231      61.963 -11.304  37.018  1.00  0.97           C  
ATOM   8618  O   VAL B 231      63.052 -10.848  37.373  1.00  0.97           O  
ATOM   8619  CB  VAL B 231      62.523 -11.074  34.628  1.00  0.97           C  
ATOM   8620  CG1 VAL B 231      63.063 -12.519  34.644  1.00  0.97           C  
ATOM   8621  CG2 VAL B 231      61.979 -10.709  33.234  1.00  0.97           C  
ATOM   8622  N   PRO B 232      61.313 -12.129  37.829  1.00  0.97           N  
ATOM   8623  CA  PRO B 232      61.817 -12.477  39.150  1.00  0.97           C  
ATOM   8624  C   PRO B 232      62.790 -13.639  39.156  1.00  0.97           C  
ATOM   8625  O   PRO B 232      62.563 -14.659  38.512  1.00  0.97           O  
ATOM   8626  CB  PRO B 232      60.530 -12.855  39.896  1.00  0.97           C  
ATOM   8627  CG  PRO B 232      59.661 -13.517  38.821  1.00  0.97           C  
ATOM   8628  CD  PRO B 232      59.997 -12.719  37.559  1.00  0.97           C  
ATOM   8629  N   GLY B 233      63.881 -13.522  39.933  1.00  0.96           N  
ATOM   8630  CA  GLY B 233      64.714 -14.674  40.241  1.00  0.96           C  
ATOM   8631  C   GLY B 233      64.163 -15.443  41.414  1.00  0.96           C  
ATOM   8632  O   GLY B 233      63.328 -14.946  42.171  1.00  0.96           O  
ATOM   8633  N   TYR B 234      64.653 -16.668  41.647  1.00  0.92           N  
ATOM   8634  CA  TYR B 234      64.103 -17.535  42.675  1.00  0.92           C  
ATOM   8635  C   TYR B 234      64.537 -17.184  44.094  1.00  0.92           C  
ATOM   8636  O   TYR B 234      65.685 -17.374  44.485  1.00  0.92           O  
ATOM   8637  CB  TYR B 234      64.468 -19.006  42.351  1.00  0.92           C  
ATOM   8638  CG  TYR B 234      63.795 -20.000  43.269  1.00  0.92           C  
ATOM   8639  CD1 TYR B 234      62.459 -20.377  43.083  1.00  0.92           C  
ATOM   8640  CD2 TYR B 234      64.498 -20.548  44.350  1.00  0.92           C  
ATOM   8641  CE1 TYR B 234      61.848 -21.305  43.937  1.00  0.92           C  
ATOM   8642  CE2 TYR B 234      63.906 -21.491  45.199  1.00  0.92           C  
ATOM   8643  CZ  TYR B 234      62.579 -21.870  44.986  1.00  0.92           C  
ATOM   8644  OH  TYR B 234      61.966 -22.795  45.850  1.00  0.92           O  
ATOM   8645  N   LYS B 235      63.586 -16.674  44.908  1.00  0.87           N  
ATOM   8646  CA  LYS B 235      63.688 -16.443  46.343  1.00  0.87           C  
ATOM   8647  C   LYS B 235      64.819 -15.513  46.781  1.00  0.87           C  
ATOM   8648  O   LYS B 235      65.186 -15.447  47.949  1.00  0.87           O  
ATOM   8649  CB  LYS B 235      63.674 -17.770  47.162  1.00  0.87           C  
ATOM   8650  CG  LYS B 235      62.377 -18.605  47.035  1.00  0.87           C  
ATOM   8651  CD  LYS B 235      62.355 -19.820  47.997  1.00  0.87           C  
ATOM   8652  CE  LYS B 235      61.057 -20.654  47.970  1.00  0.87           C  
ATOM   8653  NZ  LYS B 235      61.215 -21.930  48.730  1.00  0.87           N  
ATOM   8654  N   ASN B 236      65.368 -14.721  45.846  1.00  0.87           N  
ATOM   8655  CA  ASN B 236      66.500 -13.848  46.113  1.00  0.87           C  
ATOM   8656  C   ASN B 236      66.140 -12.373  46.108  1.00  0.87           C  
ATOM   8657  O   ASN B 236      66.985 -11.504  46.296  1.00  0.87           O  
ATOM   8658  CB  ASN B 236      67.654 -14.131  45.111  1.00  0.87           C  
ATOM   8659  CG  ASN B 236      67.368 -13.902  43.624  1.00  0.87           C  
ATOM   8660  OD1 ASN B 236      68.274 -13.990  42.803  1.00  0.87           O  
ATOM   8661  ND2 ASN B 236      66.115 -13.585  43.222  1.00  0.87           N  
ATOM   8662  N   ASN B 237      64.856 -12.062  45.841  1.00  0.83           N  
ATOM   8663  CA  ASN B 237      64.320 -10.712  45.752  1.00  0.83           C  
ATOM   8664  C   ASN B 237      64.873  -9.883  44.593  1.00  0.83           C  
ATOM   8665  O   ASN B 237      64.536  -8.712  44.447  1.00  0.83           O  
ATOM   8666  CB  ASN B 237      64.422  -9.961  47.106  1.00  0.83           C  
ATOM   8667  CG  ASN B 237      63.693 -10.779  48.168  1.00  0.83           C  
ATOM   8668  OD1 ASN B 237      62.542 -11.187  47.965  1.00  0.83           O  
ATOM   8669  ND2 ASN B 237      64.372 -11.055  49.299  1.00  0.83           N  
ATOM   8670  N   THR B 238      65.665 -10.507  43.699  1.00  0.91           N  
ATOM   8671  CA  THR B 238      66.187  -9.921  42.476  1.00  0.91           C  
ATOM   8672  C   THR B 238      65.131  -9.976  41.409  1.00  0.91           C  
ATOM   8673  O   THR B 238      64.666 -11.055  41.042  1.00  0.91           O  
ATOM   8674  CB  THR B 238      67.396 -10.670  41.914  1.00  0.91           C  
ATOM   8675  OG1 THR B 238      68.434 -10.714  42.877  1.00  0.91           O  
ATOM   8676  CG2 THR B 238      67.963 -10.010  40.648  1.00  0.91           C  
ATOM   8677  N   VAL B 239      64.708  -8.819  40.878  1.00  0.94           N  
ATOM   8678  CA  VAL B 239      63.749  -8.763  39.793  1.00  0.94           C  
ATOM   8679  C   VAL B 239      64.296  -7.896  38.668  1.00  0.94           C  
ATOM   8680  O   VAL B 239      64.522  -6.692  38.790  1.00  0.94           O  
ATOM   8681  CB  VAL B 239      62.388  -8.286  40.264  1.00  0.94           C  
ATOM   8682  CG1 VAL B 239      61.366  -8.322  39.121  1.00  0.94           C  
ATOM   8683  CG2 VAL B 239      61.887  -9.182  41.412  1.00  0.94           C  
ATOM   8684  N   ASN B 240      64.552  -8.519  37.508  1.00  0.95           N  
ATOM   8685  CA  ASN B 240      65.139  -7.880  36.348  1.00  0.95           C  
ATOM   8686  C   ASN B 240      64.069  -7.352  35.408  1.00  0.95           C  
ATOM   8687  O   ASN B 240      62.876  -7.415  35.693  1.00  0.95           O  
ATOM   8688  CB  ASN B 240      66.061  -8.854  35.574  1.00  0.95           C  
ATOM   8689  CG  ASN B 240      67.318  -9.282  36.322  1.00  0.95           C  
ATOM   8690  OD1 ASN B 240      67.952 -10.262  35.939  1.00  0.95           O  
ATOM   8691  ND2 ASN B 240      67.735  -8.555  37.377  1.00  0.95           N  
ATOM   8692  N   THR B 241      64.483  -6.788  34.259  1.00  0.95           N  
ATOM   8693  CA  THR B 241      63.570  -6.137  33.329  1.00  0.95           C  
ATOM   8694  C   THR B 241      63.590  -6.812  31.982  1.00  0.95           C  
ATOM   8695  O   THR B 241      64.637  -6.954  31.348  1.00  0.95           O  
ATOM   8696  CB  THR B 241      63.947  -4.680  33.072  1.00  0.95           C  
ATOM   8697  OG1 THR B 241      64.074  -3.986  34.300  1.00  0.95           O  
ATOM   8698  CG2 THR B 241      62.874  -3.947  32.255  1.00  0.95           C  
ATOM   8699  N   MET B 242      62.414  -7.200  31.465  1.00  0.94           N  
ATOM   8700  CA  MET B 242      62.266  -7.505  30.060  1.00  0.94           C  
ATOM   8701  C   MET B 242      61.701  -6.259  29.405  1.00  0.94           C  
ATOM   8702  O   MET B 242      60.680  -5.729  29.836  1.00  0.94           O  
ATOM   8703  CB  MET B 242      61.356  -8.730  29.830  1.00  0.94           C  
ATOM   8704  CG  MET B 242      61.165  -9.083  28.342  1.00  0.94           C  
ATOM   8705  SD  MET B 242      60.271 -10.634  28.038  1.00  0.94           S  
ATOM   8706  CE  MET B 242      58.621 -10.027  28.487  1.00  0.94           C  
ATOM   8707  N   ARG B 243      62.385  -5.731  28.381  1.00  0.91           N  
ATOM   8708  CA  ARG B 243      62.041  -4.492  27.726  1.00  0.91           C  
ATOM   8709  C   ARG B 243      61.651  -4.791  26.299  1.00  0.91           C  
ATOM   8710  O   ARG B 243      62.471  -5.208  25.482  1.00  0.91           O  
ATOM   8711  CB  ARG B 243      63.277  -3.566  27.686  1.00  0.91           C  
ATOM   8712  CG  ARG B 243      63.008  -2.130  27.192  1.00  0.91           C  
ATOM   8713  CD  ARG B 243      62.626  -1.203  28.342  1.00  0.91           C  
ATOM   8714  NE  ARG B 243      63.345   0.112  28.221  1.00  0.91           N  
ATOM   8715  CZ  ARG B 243      63.056   1.144  29.019  1.00  0.91           C  
ATOM   8716  NH1 ARG B 243      62.071   1.098  29.910  1.00  0.91           N  
ATOM   8717  NH2 ARG B 243      63.769   2.264  28.937  1.00  0.91           N  
ATOM   8718  N   LEU B 244      60.379  -4.591  25.938  1.00  0.96           N  
ATOM   8719  CA  LEU B 244      59.937  -4.925  24.601  1.00  0.96           C  
ATOM   8720  C   LEU B 244      59.416  -3.696  23.888  1.00  0.96           C  
ATOM   8721  O   LEU B 244      58.592  -2.949  24.416  1.00  0.96           O  
ATOM   8722  CB  LEU B 244      58.851  -6.015  24.620  1.00  0.96           C  
ATOM   8723  CG  LEU B 244      59.214  -7.334  25.324  1.00  0.96           C  
ATOM   8724  CD1 LEU B 244      58.035  -8.300  25.173  1.00  0.96           C  
ATOM   8725  CD2 LEU B 244      60.482  -8.002  24.772  1.00  0.96           C  
ATOM   8726  N   TRP B 245      59.899  -3.434  22.660  1.00  0.93           N  
ATOM   8727  CA  TRP B 245      59.578  -2.217  21.938  1.00  0.93           C  
ATOM   8728  C   TRP B 245      58.332  -2.331  21.071  1.00  0.93           C  
ATOM   8729  O   TRP B 245      58.062  -3.354  20.440  1.00  0.93           O  
ATOM   8730  CB  TRP B 245      60.752  -1.762  21.037  1.00  0.93           C  
ATOM   8731  CG  TRP B 245      62.071  -1.570  21.759  1.00  0.93           C  
ATOM   8732  CD1 TRP B 245      63.124  -2.437  21.838  1.00  0.93           C  
ATOM   8733  CD2 TRP B 245      62.463  -0.390  22.481  1.00  0.93           C  
ATOM   8734  NE1 TRP B 245      64.143  -1.880  22.570  1.00  0.93           N  
ATOM   8735  CE2 TRP B 245      63.754  -0.639  22.999  1.00  0.93           C  
ATOM   8736  CE3 TRP B 245      61.829   0.828  22.698  1.00  0.93           C  
ATOM   8737  CZ2 TRP B 245      64.407   0.309  23.769  1.00  0.93           C  
ATOM   8738  CZ3 TRP B 245      62.522   1.810  23.423  1.00  0.93           C  
ATOM   8739  CH2 TRP B 245      63.782   1.544  23.973  1.00  0.93           C  
ATOM   8740  N   SER B 246      57.541  -1.248  21.023  1.00  0.93           N  
ATOM   8741  CA  SER B 246      56.304  -1.146  20.269  1.00  0.93           C  
ATOM   8742  C   SER B 246      56.397   0.048  19.346  1.00  0.93           C  
ATOM   8743  O   SER B 246      56.705   1.158  19.779  1.00  0.93           O  
ATOM   8744  CB  SER B 246      55.119  -0.973  21.251  1.00  0.93           C  
ATOM   8745  OG  SER B 246      53.832  -1.074  20.637  1.00  0.93           O  
ATOM   8746  N   ALA B 247      56.204  -0.162  18.034  1.00  0.92           N  
ATOM   8747  CA  ALA B 247      56.264   0.870  17.020  1.00  0.92           C  
ATOM   8748  C   ALA B 247      55.117   1.863  17.106  1.00  0.92           C  
ATOM   8749  O   ALA B 247      53.968   1.473  17.296  1.00  0.92           O  
ATOM   8750  CB  ALA B 247      56.366   0.238  15.618  1.00  0.92           C  
ATOM   8751  N   LYS B 248      55.418   3.173  16.989  1.00  0.82           N  
ATOM   8752  CA  LYS B 248      54.425   4.230  17.029  1.00  0.82           C  
ATOM   8753  C   LYS B 248      54.684   5.231  15.924  1.00  0.82           C  
ATOM   8754  O   LYS B 248      55.826   5.517  15.553  1.00  0.82           O  
ATOM   8755  CB  LYS B 248      54.407   4.999  18.381  1.00  0.82           C  
ATOM   8756  CG  LYS B 248      54.233   4.102  19.618  1.00  0.82           C  
ATOM   8757  CD  LYS B 248      52.880   3.373  19.626  1.00  0.82           C  
ATOM   8758  CE  LYS B 248      52.824   2.232  20.632  1.00  0.82           C  
ATOM   8759  NZ  LYS B 248      51.583   1.463  20.419  1.00  0.82           N  
ATOM   8760  N   ALA B 249      53.613   5.806  15.348  1.00  0.82           N  
ATOM   8761  CA  ALA B 249      53.745   6.891  14.400  1.00  0.82           C  
ATOM   8762  C   ALA B 249      54.343   8.173  15.002  1.00  0.82           C  
ATOM   8763  O   ALA B 249      53.865   8.607  16.054  1.00  0.82           O  
ATOM   8764  CB  ALA B 249      52.372   7.237  13.826  1.00  0.82           C  
ATOM   8765  N   PRO B 250      55.338   8.841  14.414  1.00  0.76           N  
ATOM   8766  CA  PRO B 250      55.914  10.054  14.983  1.00  0.76           C  
ATOM   8767  C   PRO B 250      54.941  11.205  15.141  1.00  0.76           C  
ATOM   8768  O   PRO B 250      53.888  11.228  14.500  1.00  0.76           O  
ATOM   8769  CB  PRO B 250      57.081  10.421  14.055  1.00  0.76           C  
ATOM   8770  CG  PRO B 250      57.375   9.147  13.266  1.00  0.76           C  
ATOM   8771  CD  PRO B 250      56.040   8.413  13.207  1.00  0.76           C  
ATOM   8772  N   ASN B 251      55.284  12.192  15.991  1.00  0.68           N  
ATOM   8773  CA  ASN B 251      54.479  13.384  16.183  1.00  0.68           C  
ATOM   8774  C   ASN B 251      54.349  14.216  14.912  1.00  0.68           C  
ATOM   8775  O   ASN B 251      53.271  14.687  14.565  1.00  0.68           O  
ATOM   8776  CB  ASN B 251      55.026  14.264  17.343  1.00  0.68           C  
ATOM   8777  CG  ASN B 251      54.758  13.591  18.683  1.00  0.68           C  
ATOM   8778  OD1 ASN B 251      53.761  12.890  18.864  1.00  0.68           O  
ATOM   8779  ND2 ASN B 251      55.624  13.839  19.691  1.00  0.68           N  
ATOM   8780  N   ASP B 252      55.423  14.387  14.142  1.00  0.70           N  
ATOM   8781  CA  ASP B 252      55.370  15.258  12.983  1.00  0.70           C  
ATOM   8782  C   ASP B 252      54.663  14.609  11.784  1.00  0.70           C  
ATOM   8783  O   ASP B 252      54.076  15.260  10.923  1.00  0.70           O  
ATOM   8784  CB  ASP B 252      56.816  15.664  12.647  1.00  0.70           C  
ATOM   8785  CG  ASP B 252      57.462  16.348  13.847  1.00  0.70           C  
ATOM   8786  OD1 ASP B 252      56.731  16.933  14.686  1.00  0.70           O  
ATOM   8787  OD2 ASP B 252      58.703  16.206  13.970  1.00  0.70           O  
ATOM   8788  N   PHE B 253      54.601  13.264  11.771  1.00  0.62           N  
ATOM   8789  CA  PHE B 253      53.901  12.469  10.771  1.00  0.62           C  
ATOM   8790  C   PHE B 253      52.501  12.119  11.244  1.00  0.62           C  
ATOM   8791  O   PHE B 253      51.929  11.074  10.950  1.00  0.62           O  
ATOM   8792  CB  PHE B 253      54.634  11.140  10.478  1.00  0.62           C  
ATOM   8793  CG  PHE B 253      55.886  11.354   9.680  1.00  0.62           C  
ATOM   8794  CD1 PHE B 253      55.814  11.434   8.280  1.00  0.62           C  
ATOM   8795  CD2 PHE B 253      57.145  11.405  10.294  1.00  0.62           C  
ATOM   8796  CE1 PHE B 253      56.981  11.549   7.512  1.00  0.62           C  
ATOM   8797  CE2 PHE B 253      58.315  11.528   9.537  1.00  0.62           C  
ATOM   8798  CZ  PHE B 253      58.232  11.596   8.142  1.00  0.62           C  
ATOM   8799  N   LYS B 254      51.892  12.993  12.050  1.00  0.62           N  
ATOM   8800  CA  LYS B 254      50.503  12.868  12.401  1.00  0.62           C  
ATOM   8801  C   LYS B 254      49.548  13.045  11.247  1.00  0.62           C  
ATOM   8802  O   LYS B 254      48.555  12.324  11.168  1.00  0.62           O  
ATOM   8803  CB  LYS B 254      50.170  13.880  13.500  1.00  0.62           C  
ATOM   8804  CG  LYS B 254      50.577  13.409  14.904  1.00  0.62           C  
ATOM   8805  CD  LYS B 254      50.451  14.578  15.863  1.00  0.62           C  
ATOM   8806  CE  LYS B 254      50.883  14.324  17.289  1.00  0.62           C  
ATOM   8807  NZ  LYS B 254      50.553  15.530  18.062  1.00  0.62           N  
ATOM   8808  N   LEU B 255      49.810  14.031  10.387  1.00  0.64           N  
ATOM   8809  CA  LEU B 255      48.842  14.493   9.424  1.00  0.64           C  
ATOM   8810  C   LEU B 255      49.512  15.245   8.274  1.00  0.64           C  
ATOM   8811  O   LEU B 255      48.937  15.542   7.241  1.00  0.64           O  
ATOM   8812  CB  LEU B 255      47.884  15.504  10.110  1.00  0.64           C  
ATOM   8813  CG  LEU B 255      46.737  14.917  10.952  1.00  0.64           C  
ATOM   8814  CD1 LEU B 255      45.832  16.036  11.460  1.00  0.64           C  
ATOM   8815  CD2 LEU B 255      45.873  13.887  10.236  1.00  0.64           C  
ATOM   8816  N   GLN B 256      50.807  15.572   8.347  1.00  0.63           N  
ATOM   8817  CA  GLN B 256      51.410  16.400   7.307  1.00  0.63           C  
ATOM   8818  C   GLN B 256      51.802  15.601   6.073  1.00  0.63           C  
ATOM   8819  O   GLN B 256      52.371  16.117   5.116  1.00  0.63           O  
ATOM   8820  CB  GLN B 256      52.689  17.064   7.859  1.00  0.63           C  
ATOM   8821  CG  GLN B 256      52.428  18.119   8.959  1.00  0.63           C  
ATOM   8822  CD  GLN B 256      53.750  18.681   9.484  1.00  0.63           C  
ATOM   8823  OE1 GLN B 256      54.832  18.149   9.243  1.00  0.63           O  
ATOM   8824  NE2 GLN B 256      53.688  19.820  10.211  1.00  0.63           N  
ATOM   8825  N   ASP B 257      51.446  14.318   6.051  1.00  0.55           N  
ATOM   8826  CA  ASP B 257      51.613  13.428   4.944  1.00  0.55           C  
ATOM   8827  C   ASP B 257      50.414  13.458   3.978  1.00  0.55           C  
ATOM   8828  O   ASP B 257      50.482  12.926   2.870  1.00  0.55           O  
ATOM   8829  CB  ASP B 257      51.894  12.019   5.536  1.00  0.55           C  
ATOM   8830  CG  ASP B 257      50.882  11.537   6.579  1.00  0.55           C  
ATOM   8831  OD1 ASP B 257      49.980  12.315   6.990  1.00  0.55           O  
ATOM   8832  OD2 ASP B 257      51.067  10.382   7.026  1.00  0.55           O  
ATOM   8833  N   PHE B 258      49.302  14.132   4.346  1.00  0.60           N  
ATOM   8834  CA  PHE B 258      48.071  14.156   3.565  1.00  0.60           C  
ATOM   8835  C   PHE B 258      47.830  15.435   2.737  1.00  0.60           C  
ATOM   8836  O   PHE B 258      48.335  16.518   3.037  1.00  0.60           O  
ATOM   8837  CB  PHE B 258      46.896  13.786   4.510  1.00  0.60           C  
ATOM   8838  CG  PHE B 258      46.266  14.900   5.343  1.00  0.60           C  
ATOM   8839  CD1 PHE B 258      45.472  15.795   4.660  1.00  0.60           C  
ATOM   8840  CD2 PHE B 258      46.325  15.067   6.733  1.00  0.60           C  
ATOM   8841  CE1 PHE B 258      44.884  16.907   5.260  1.00  0.60           C  
ATOM   8842  CE2 PHE B 258      45.736  16.172   7.366  1.00  0.60           C  
ATOM   8843  CZ  PHE B 258      45.046  17.123   6.623  1.00  0.60           C  
ATOM   8844  N   ASN B 259      46.977  15.366   1.683  1.00  0.44           N  
ATOM   8845  CA  ASN B 259      46.465  16.533   0.956  1.00  0.44           C  
ATOM   8846  C   ASN B 259      45.299  17.207   1.670  1.00  0.44           C  
ATOM   8847  O   ASN B 259      44.350  16.479   1.960  1.00  0.44           O  
ATOM   8848  CB  ASN B 259      45.771  16.104  -0.372  1.00  0.44           C  
ATOM   8849  CG  ASN B 259      46.655  15.399  -1.393  1.00  0.44           C  
ATOM   8850  OD1 ASN B 259      47.680  15.919  -1.838  1.00  0.44           O  
ATOM   8851  ND2 ASN B 259      46.195  14.209  -1.841  1.00  0.44           N  
ATOM   8852  N   VAL B 260      45.199  18.517   1.925  1.00  0.42           N  
ATOM   8853  CA  VAL B 260      44.116  19.208   2.675  1.00  0.42           C  
ATOM   8854  C   VAL B 260      42.699  18.546   2.788  1.00  0.42           C  
ATOM   8855  O   VAL B 260      42.141  18.435   3.876  1.00  0.42           O  
ATOM   8856  CB  VAL B 260      43.998  20.673   2.266  1.00  0.42           C  
ATOM   8857  CG1 VAL B 260      42.934  21.399   3.110  1.00  0.42           C  
ATOM   8858  CG2 VAL B 260      45.349  21.390   2.480  1.00  0.42           C  
ATOM   8859  N   GLY B 261      42.091  18.040   1.683  1.00  0.40           N  
ATOM   8860  CA  GLY B 261      40.849  17.254   1.749  1.00  0.40           C  
ATOM   8861  C   GLY B 261      40.924  15.873   2.370  1.00  0.40           C  
ATOM   8862  O   GLY B 261      39.946  15.360   2.895  1.00  0.40           O  
ATOM   8863  N   ASP B 262      42.105  15.247   2.368  1.00  0.54           N  
ATOM   8864  CA  ASP B 262      42.315  13.863   2.728  1.00  0.54           C  
ATOM   8865  C   ASP B 262      42.736  13.728   4.195  1.00  0.54           C  
ATOM   8866  O   ASP B 262      43.449  12.806   4.592  1.00  0.54           O  
ATOM   8867  CB  ASP B 262      43.390  13.240   1.804  1.00  0.54           C  
ATOM   8868  CG  ASP B 262      42.980  13.293   0.339  1.00  0.54           C  
ATOM   8869  OD1 ASP B 262      41.760  13.252   0.043  1.00  0.54           O  
ATOM   8870  OD2 ASP B 262      43.902  13.448  -0.506  1.00  0.54           O  
ATOM   8871  N   TYR B 263      42.255  14.652   5.063  1.00  0.45           N  
ATOM   8872  CA  TYR B 263      42.557  14.751   6.495  1.00  0.45           C  
ATOM   8873  C   TYR B 263      42.320  13.448   7.235  1.00  0.45           C  
ATOM   8874  O   TYR B 263      43.118  13.015   8.061  1.00  0.45           O  
ATOM   8875  CB  TYR B 263      41.742  15.932   7.133  1.00  0.45           C  
ATOM   8876  CG  TYR B 263      41.651  15.876   8.648  1.00  0.45           C  
ATOM   8877  CD1 TYR B 263      42.662  16.376   9.484  1.00  0.45           C  
ATOM   8878  CD2 TYR B 263      40.547  15.236   9.237  1.00  0.45           C  
ATOM   8879  CE1 TYR B 263      42.546  16.260  10.879  1.00  0.45           C  
ATOM   8880  CE2 TYR B 263      40.462  15.073  10.626  1.00  0.45           C  
ATOM   8881  CZ  TYR B 263      41.459  15.593  11.443  1.00  0.45           C  
ATOM   8882  OH  TYR B 263      41.343  15.445  12.835  1.00  0.45           O  
ATOM   8883  N   ILE B 264      41.190  12.796   6.939  1.00  0.57           N  
ATOM   8884  CA  ILE B 264      40.822  11.532   7.536  1.00  0.57           C  
ATOM   8885  C   ILE B 264      41.764  10.408   7.158  1.00  0.57           C  
ATOM   8886  O   ILE B 264      42.219   9.686   8.040  1.00  0.57           O  
ATOM   8887  CB  ILE B 264      39.376  11.184   7.201  1.00  0.57           C  
ATOM   8888  CG1 ILE B 264      38.410  12.294   7.690  1.00  0.57           C  
ATOM   8889  CG2 ILE B 264      38.986   9.818   7.805  1.00  0.57           C  
ATOM   8890  CD1 ILE B 264      38.358  12.470   9.214  1.00  0.57           C  
ATOM   8891  N   GLU B 265      42.141  10.275   5.865  1.00  0.56           N  
ATOM   8892  CA  GLU B 265      42.971   9.191   5.356  1.00  0.56           C  
ATOM   8893  C   GLU B 265      44.332   9.150   6.028  1.00  0.56           C  
ATOM   8894  O   GLU B 265      44.789   8.107   6.476  1.00  0.56           O  
ATOM   8895  CB  GLU B 265      43.096   9.278   3.813  1.00  0.56           C  
ATOM   8896  CG  GLU B 265      41.765   8.921   3.095  1.00  0.56           C  
ATOM   8897  CD  GLU B 265      41.843   8.772   1.572  1.00  0.56           C  
ATOM   8898  OE1 GLU B 265      42.931   8.963   0.983  1.00  0.56           O  
ATOM   8899  OE2 GLU B 265      40.767   8.433   1.007  1.00  0.56           O  
ATOM   8900  N   ALA B 266      44.943  10.317   6.254  1.00  0.62           N  
ATOM   8901  CA  ALA B 266      46.159  10.455   7.039  1.00  0.62           C  
ATOM   8902  C   ALA B 266      46.120   9.933   8.468  1.00  0.62           C  
ATOM   8903  O   ALA B 266      47.037   9.284   8.967  1.00  0.62           O  
ATOM   8904  CB  ALA B 266      46.376  11.936   7.179  1.00  0.62           C  
ATOM   8905  N   VAL B 267      45.020  10.192   9.204  1.00  0.57           N  
ATOM   8906  CA  VAL B 267      44.860   9.684  10.553  1.00  0.57           C  
ATOM   8907  C   VAL B 267      44.778   8.161  10.584  1.00  0.57           C  
ATOM   8908  O   VAL B 267      45.314   7.492  11.468  1.00  0.57           O  
ATOM   8909  CB  VAL B 267      43.617  10.242  11.228  1.00  0.57           C  
ATOM   8910  CG1 VAL B 267      43.600   9.754  12.672  1.00  0.57           C  
ATOM   8911  CG2 VAL B 267      43.597  11.767  11.225  1.00  0.57           C  
ATOM   8912  N   LEU B 268      44.094   7.577   9.584  1.00  0.56           N  
ATOM   8913  CA  LEU B 268      44.054   6.148   9.344  1.00  0.56           C  
ATOM   8914  C   LEU B 268      45.439   5.590   8.969  1.00  0.56           C  
ATOM   8915  O   LEU B 268      45.875   4.564   9.501  1.00  0.56           O  
ATOM   8916  CB  LEU B 268      42.989   5.836   8.253  1.00  0.56           C  
ATOM   8917  CG  LEU B 268      41.580   6.458   8.453  1.00  0.56           C  
ATOM   8918  CD1 LEU B 268      40.594   5.894   7.421  1.00  0.56           C  
ATOM   8919  CD2 LEU B 268      41.019   6.308   9.871  1.00  0.56           C  
ATOM   8920  N   ASP B 269      46.188   6.299   8.100  1.00  0.59           N  
ATOM   8921  CA  ASP B 269      47.528   5.953   7.659  1.00  0.59           C  
ATOM   8922  C   ASP B 269      48.619   6.069   8.719  1.00  0.59           C  
ATOM   8923  O   ASP B 269      49.610   5.344   8.647  1.00  0.59           O  
ATOM   8924  CB  ASP B 269      47.944   6.789   6.425  1.00  0.59           C  
ATOM   8925  CG  ASP B 269      47.235   6.323   5.163  1.00  0.59           C  
ATOM   8926  OD1 ASP B 269      46.530   5.281   5.209  1.00  0.59           O  
ATOM   8927  OD2 ASP B 269      47.451   6.985   4.116  1.00  0.59           O  
ATOM   8928  N   ARG B 270      48.458   6.893   9.789  1.00  0.58           N  
ATOM   8929  CA  ARG B 270      49.386   6.940  10.928  1.00  0.58           C  
ATOM   8930  C   ARG B 270      49.682   5.556  11.474  1.00  0.58           C  
ATOM   8931  O   ARG B 270      50.827   5.167  11.693  1.00  0.58           O  
ATOM   8932  CB  ARG B 270      48.789   7.692  12.149  1.00  0.58           C  
ATOM   8933  CG  ARG B 270      48.898   9.221  12.107  1.00  0.58           C  
ATOM   8934  CD  ARG B 270      48.245   9.901  13.323  1.00  0.58           C  
ATOM   8935  NE  ARG B 270      48.770   9.341  14.620  1.00  0.58           N  
ATOM   8936  CZ  ARG B 270      49.969   9.561  15.178  1.00  0.58           C  
ATOM   8937  NH1 ARG B 270      50.953  10.174  14.526  1.00  0.58           N  
ATOM   8938  NH2 ARG B 270      50.188   9.119  16.414  1.00  0.58           N  
ATOM   8939  N   ASN B 271      48.623   4.745  11.635  1.00  0.70           N  
ATOM   8940  CA  ASN B 271      48.720   3.390  12.123  1.00  0.70           C  
ATOM   8941  C   ASN B 271      49.648   2.508  11.271  1.00  0.70           C  
ATOM   8942  O   ASN B 271      50.237   1.548  11.762  1.00  0.70           O  
ATOM   8943  CB  ASN B 271      47.285   2.795  12.224  1.00  0.70           C  
ATOM   8944  CG  ASN B 271      47.341   1.286  12.410  1.00  0.70           C  
ATOM   8945  OD1 ASN B 271      47.428   0.717  13.492  1.00  0.70           O  
ATOM   8946  ND2 ASN B 271      47.440   0.590  11.249  1.00  0.70           N  
ATOM   8947  N   LEU B 272      49.761   2.754   9.956  1.00  0.69           N  
ATOM   8948  CA  LEU B 272      50.547   1.915   9.069  1.00  0.69           C  
ATOM   8949  C   LEU B 272      52.023   1.861   9.447  1.00  0.69           C  
ATOM   8950  O   LEU B 272      52.694   0.848   9.251  1.00  0.69           O  
ATOM   8951  CB  LEU B 272      50.421   2.375   7.601  1.00  0.69           C  
ATOM   8952  CG  LEU B 272      49.037   2.162   6.956  1.00  0.69           C  
ATOM   8953  CD1 LEU B 272      48.985   2.880   5.602  1.00  0.69           C  
ATOM   8954  CD2 LEU B 272      48.716   0.674   6.767  1.00  0.69           C  
ATOM   8955  N   ALA B 273      52.543   2.934  10.075  1.00  0.74           N  
ATOM   8956  CA  ALA B 273      53.879   2.991  10.632  1.00  0.74           C  
ATOM   8957  C   ALA B 273      54.106   2.025  11.797  1.00  0.74           C  
ATOM   8958  O   ALA B 273      55.228   1.610  12.082  1.00  0.74           O  
ATOM   8959  CB  ALA B 273      54.133   4.438  11.087  1.00  0.74           C  
ATOM   8960  N   GLU B 274      53.019   1.587  12.458  1.00  0.82           N  
ATOM   8961  CA  GLU B 274      53.070   0.702  13.602  1.00  0.82           C  
ATOM   8962  C   GLU B 274      53.031  -0.765  13.209  1.00  0.82           C  
ATOM   8963  O   GLU B 274      53.144  -1.665  14.040  1.00  0.82           O  
ATOM   8964  CB  GLU B 274      51.879   0.975  14.546  1.00  0.82           C  
ATOM   8965  CG  GLU B 274      51.645   2.479  14.814  1.00  0.82           C  
ATOM   8966  CD  GLU B 274      50.731   2.714  16.009  1.00  0.82           C  
ATOM   8967  OE1 GLU B 274      49.802   1.899  16.229  1.00  0.82           O  
ATOM   8968  OE2 GLU B 274      50.988   3.720  16.725  1.00  0.82           O  
ATOM   8969  N   ASN B 275      52.962  -1.066  11.892  1.00  0.83           N  
ATOM   8970  CA  ASN B 275      52.929  -2.428  11.387  1.00  0.83           C  
ATOM   8971  C   ASN B 275      54.236  -3.183  11.581  1.00  0.83           C  
ATOM   8972  O   ASN B 275      54.284  -4.406  11.477  1.00  0.83           O  
ATOM   8973  CB  ASN B 275      52.506  -2.483   9.900  1.00  0.83           C  
ATOM   8974  CG  ASN B 275      51.004  -2.253   9.750  1.00  0.83           C  
ATOM   8975  OD1 ASN B 275      50.198  -2.473  10.657  1.00  0.83           O  
ATOM   8976  ND2 ASN B 275      50.589  -1.842   8.531  1.00  0.83           N  
ATOM   8977  N   ILE B 276      55.322  -2.471  11.929  1.00  0.88           N  
ATOM   8978  CA  ILE B 276      56.607  -3.053  12.280  1.00  0.88           C  
ATOM   8979  C   ILE B 276      56.530  -3.981  13.489  1.00  0.88           C  
ATOM   8980  O   ILE B 276      57.072  -5.082  13.478  1.00  0.88           O  
ATOM   8981  CB  ILE B 276      57.639  -1.945  12.478  1.00  0.88           C  
ATOM   8982  CG1 ILE B 276      57.873  -1.235  11.122  1.00  0.88           C  
ATOM   8983  CG2 ILE B 276      58.961  -2.504  13.051  1.00  0.88           C  
ATOM   8984  CD1 ILE B 276      58.746   0.018  11.213  1.00  0.88           C  
ATOM   8985  N   SER B 277      55.803  -3.608  14.556  1.00  0.90           N  
ATOM   8986  CA  SER B 277      55.674  -4.462  15.735  1.00  0.90           C  
ATOM   8987  C   SER B 277      54.345  -5.188  15.802  1.00  0.90           C  
ATOM   8988  O   SER B 277      53.936  -5.668  16.854  1.00  0.90           O  
ATOM   8989  CB  SER B 277      55.882  -3.697  17.065  1.00  0.90           C  
ATOM   8990  OG  SER B 277      55.004  -2.580  17.194  1.00  0.90           O  
ATOM   8991  N   ARG B 278      53.608  -5.307  14.684  1.00  0.82           N  
ATOM   8992  CA  ARG B 278      52.346  -6.030  14.674  1.00  0.82           C  
ATOM   8993  C   ARG B 278      52.453  -7.528  14.875  1.00  0.82           C  
ATOM   8994  O   ARG B 278      51.705  -8.093  15.662  1.00  0.82           O  
ATOM   8995  CB  ARG B 278      51.598  -5.809  13.339  1.00  0.82           C  
ATOM   8996  CG  ARG B 278      50.754  -4.528  13.323  1.00  0.82           C  
ATOM   8997  CD  ARG B 278      49.366  -4.691  13.945  1.00  0.82           C  
ATOM   8998  NE  ARG B 278      49.032  -3.496  14.771  1.00  0.82           N  
ATOM   8999  CZ  ARG B 278      48.903  -2.216  14.398  1.00  0.82           C  
ATOM   9000  NH1 ARG B 278      49.082  -1.762  13.162  1.00  0.82           N  
ATOM   9001  NH2 ARG B 278      48.578  -1.344  15.349  1.00  0.82           N  
ATOM   9002  N   VAL B 279      53.363  -8.229  14.182  1.00  0.87           N  
ATOM   9003  CA  VAL B 279      53.316  -9.682  14.191  1.00  0.87           C  
ATOM   9004  C   VAL B 279      54.679 -10.320  14.119  1.00  0.87           C  
ATOM   9005  O   VAL B 279      55.567  -9.909  13.370  1.00  0.87           O  
ATOM   9006  CB  VAL B 279      52.396 -10.236  13.105  1.00  0.87           C  
ATOM   9007  CG1 VAL B 279      52.818  -9.786  11.696  1.00  0.87           C  
ATOM   9008  CG2 VAL B 279      52.290 -11.771  13.197  1.00  0.87           C  
ATOM   9009  N   LEU B 280      54.881 -11.372  14.932  1.00  0.89           N  
ATOM   9010  CA  LEU B 280      56.028 -12.241  14.848  1.00  0.89           C  
ATOM   9011  C   LEU B 280      56.071 -13.015  13.540  1.00  0.89           C  
ATOM   9012  O   LEU B 280      55.108 -13.669  13.139  1.00  0.89           O  
ATOM   9013  CB  LEU B 280      55.979 -13.226  16.035  1.00  0.89           C  
ATOM   9014  CG  LEU B 280      57.012 -14.367  16.028  1.00  0.89           C  
ATOM   9015  CD1 LEU B 280      58.459 -13.865  16.105  1.00  0.89           C  
ATOM   9016  CD2 LEU B 280      56.722 -15.310  17.195  1.00  0.89           C  
ATOM   9017  N   TYR B 281      57.217 -12.997  12.833  1.00  0.86           N  
ATOM   9018  CA  TYR B 281      57.403 -13.860  11.686  1.00  0.86           C  
ATOM   9019  C   TYR B 281      57.435 -15.338  12.103  1.00  0.86           C  
ATOM   9020  O   TYR B 281      58.290 -15.709  12.908  1.00  0.86           O  
ATOM   9021  CB  TYR B 281      58.704 -13.515  10.920  1.00  0.86           C  
ATOM   9022  CG  TYR B 281      58.406 -12.508   9.844  1.00  0.86           C  
ATOM   9023  CD1 TYR B 281      58.258 -11.140  10.126  1.00  0.86           C  
ATOM   9024  CD2 TYR B 281      58.219 -12.952   8.527  1.00  0.86           C  
ATOM   9025  CE1 TYR B 281      57.935 -10.232   9.105  1.00  0.86           C  
ATOM   9026  CE2 TYR B 281      57.896 -12.052   7.505  1.00  0.86           C  
ATOM   9027  CZ  TYR B 281      57.751 -10.693   7.796  1.00  0.86           C  
ATOM   9028  OH  TYR B 281      57.401  -9.804   6.765  1.00  0.86           O  
ATOM   9029  N   PRO B 282      56.567 -16.217  11.610  1.00  0.89           N  
ATOM   9030  CA  PRO B 282      56.354 -17.551  12.180  1.00  0.89           C  
ATOM   9031  C   PRO B 282      57.343 -18.570  11.650  1.00  0.89           C  
ATOM   9032  O   PRO B 282      57.019 -19.759  11.554  1.00  0.89           O  
ATOM   9033  CB  PRO B 282      54.935 -17.877  11.694  1.00  0.89           C  
ATOM   9034  CG  PRO B 282      54.859 -17.191  10.332  1.00  0.89           C  
ATOM   9035  CD  PRO B 282      55.562 -15.879  10.603  1.00  0.89           C  
ATOM   9036  N   ASN B 283      58.573 -18.149  11.346  1.00  0.85           N  
ATOM   9037  CA  ASN B 283      59.590 -19.003  10.789  1.00  0.85           C  
ATOM   9038  C   ASN B 283      60.508 -19.550  11.870  1.00  0.85           C  
ATOM   9039  O   ASN B 283      61.106 -18.815  12.648  1.00  0.85           O  
ATOM   9040  CB  ASN B 283      60.426 -18.234   9.745  1.00  0.85           C  
ATOM   9041  CG  ASN B 283      59.524 -17.813   8.589  1.00  0.85           C  
ATOM   9042  OD1 ASN B 283      58.755 -18.616   8.062  1.00  0.85           O  
ATOM   9043  ND2 ASN B 283      59.630 -16.524   8.195  1.00  0.85           N  
ATOM   9044  N   ASP B 284      60.664 -20.882  11.917  1.00  0.84           N  
ATOM   9045  CA  ASP B 284      61.542 -21.552  12.852  1.00  0.84           C  
ATOM   9046  C   ASP B 284      62.609 -22.190  12.000  1.00  0.84           C  
ATOM   9047  O   ASP B 284      62.284 -22.918  11.065  1.00  0.84           O  
ATOM   9048  CB  ASP B 284      60.749 -22.630  13.633  1.00  0.84           C  
ATOM   9049  CG  ASP B 284      61.589 -23.342  14.676  1.00  0.84           C  
ATOM   9050  OD1 ASP B 284      61.664 -22.864  15.834  1.00  0.84           O  
ATOM   9051  OD2 ASP B 284      62.157 -24.407  14.319  1.00  0.84           O  
ATOM   9052  N   ASN B 285      63.901 -21.891  12.263  1.00  0.79           N  
ATOM   9053  CA  ASN B 285      65.024 -22.419  11.495  1.00  0.79           C  
ATOM   9054  C   ASN B 285      64.905 -22.177   9.990  1.00  0.79           C  
ATOM   9055  O   ASN B 285      65.242 -23.029   9.172  1.00  0.79           O  
ATOM   9056  CB  ASN B 285      65.228 -23.931  11.767  1.00  0.79           C  
ATOM   9057  CG  ASN B 285      65.772 -24.144  13.165  1.00  0.79           C  
ATOM   9058  OD1 ASN B 285      66.984 -24.080  13.369  1.00  0.79           O  
ATOM   9059  ND2 ASN B 285      64.897 -24.437  14.153  1.00  0.79           N  
ATOM   9060  N   PHE B 286      64.414 -20.993   9.595  1.00  0.81           N  
ATOM   9061  CA  PHE B 286      64.235 -20.674   8.198  1.00  0.81           C  
ATOM   9062  C   PHE B 286      64.394 -19.180   8.001  1.00  0.81           C  
ATOM   9063  O   PHE B 286      63.799 -18.374   8.717  1.00  0.81           O  
ATOM   9064  CB  PHE B 286      62.840 -21.154   7.709  1.00  0.81           C  
ATOM   9065  CG  PHE B 286      62.668 -20.963   6.230  1.00  0.81           C  
ATOM   9066  CD1 PHE B 286      63.363 -21.786   5.332  1.00  0.81           C  
ATOM   9067  CD2 PHE B 286      61.845 -19.941   5.729  1.00  0.81           C  
ATOM   9068  CE1 PHE B 286      63.258 -21.579   3.951  1.00  0.81           C  
ATOM   9069  CE2 PHE B 286      61.740 -19.727   4.349  1.00  0.81           C  
ATOM   9070  CZ  PHE B 286      62.452 -20.542   3.460  1.00  0.81           C  
ATOM   9071  N   PHE B 287      65.195 -18.777   7.002  1.00  0.83           N  
ATOM   9072  CA  PHE B 287      65.404 -17.394   6.650  1.00  0.83           C  
ATOM   9073  C   PHE B 287      64.433 -16.987   5.552  1.00  0.83           C  
ATOM   9074  O   PHE B 287      64.490 -17.456   4.416  1.00  0.83           O  
ATOM   9075  CB  PHE B 287      66.878 -17.164   6.199  1.00  0.83           C  
ATOM   9076  CG  PHE B 287      67.150 -15.771   5.686  1.00  0.83           C  
ATOM   9077  CD1 PHE B 287      66.898 -14.651   6.489  1.00  0.83           C  
ATOM   9078  CD2 PHE B 287      67.645 -15.576   4.385  1.00  0.83           C  
ATOM   9079  CE1 PHE B 287      67.146 -13.361   6.011  1.00  0.83           C  
ATOM   9080  CE2 PHE B 287      67.886 -14.285   3.897  1.00  0.83           C  
ATOM   9081  CZ  PHE B 287      67.639 -13.174   4.714  1.00  0.83           C  
ATOM   9082  N   GLU B 288      63.537 -16.039   5.869  1.00  0.78           N  
ATOM   9083  CA  GLU B 288      62.645 -15.459   4.894  1.00  0.78           C  
ATOM   9084  C   GLU B 288      63.036 -14.009   4.732  1.00  0.78           C  
ATOM   9085  O   GLU B 288      62.934 -13.192   5.648  1.00  0.78           O  
ATOM   9086  CB  GLU B 288      61.173 -15.553   5.334  1.00  0.78           C  
ATOM   9087  CG  GLU B 288      60.143 -15.059   4.290  1.00  0.78           C  
ATOM   9088  CD  GLU B 288      58.771 -14.831   4.919  1.00  0.78           C  
ATOM   9089  OE1 GLU B 288      58.580 -15.178   6.105  1.00  0.78           O  
ATOM   9090  OE2 GLU B 288      57.892 -14.256   4.213  1.00  0.78           O  
ATOM   9091  N   GLY B 289      63.522 -13.640   3.534  1.00  0.87           N  
ATOM   9092  CA  GLY B 289      64.159 -12.346   3.321  1.00  0.87           C  
ATOM   9093  C   GLY B 289      63.222 -11.213   3.029  1.00  0.87           C  
ATOM   9094  O   GLY B 289      63.337 -10.546   2.005  1.00  0.87           O  
ATOM   9095  N   LYS B 290      62.267 -10.939   3.928  1.00  0.84           N  
ATOM   9096  CA  LYS B 290      61.340  -9.842   3.750  1.00  0.84           C  
ATOM   9097  C   LYS B 290      61.821  -8.549   4.387  1.00  0.84           C  
ATOM   9098  O   LYS B 290      62.362  -8.529   5.489  1.00  0.84           O  
ATOM   9099  CB  LYS B 290      59.937 -10.180   4.314  1.00  0.84           C  
ATOM   9100  CG  LYS B 290      59.256 -11.414   3.700  1.00  0.84           C  
ATOM   9101  CD  LYS B 290      59.164 -11.391   2.166  1.00  0.84           C  
ATOM   9102  CE  LYS B 290      58.609 -12.677   1.528  1.00  0.84           C  
ATOM   9103  NZ  LYS B 290      57.245 -12.999   2.001  1.00  0.84           N  
ATOM   9104  N   GLU B 291      61.576  -7.401   3.716  1.00  0.86           N  
ATOM   9105  CA  GLU B 291      61.920  -6.079   4.222  1.00  0.86           C  
ATOM   9106  C   GLU B 291      61.280  -5.765   5.566  1.00  0.86           C  
ATOM   9107  O   GLU B 291      61.902  -5.183   6.448  1.00  0.86           O  
ATOM   9108  CB  GLU B 291      61.506  -4.969   3.226  1.00  0.86           C  
ATOM   9109  CG  GLU B 291      62.023  -3.559   3.621  1.00  0.86           C  
ATOM   9110  CD  GLU B 291      61.307  -2.424   2.889  1.00  0.86           C  
ATOM   9111  OE1 GLU B 291      60.100  -2.196   3.196  1.00  0.86           O  
ATOM   9112  OE2 GLU B 291      61.966  -1.723   2.084  1.00  0.86           O  
ATOM   9113  N   LEU B 292      60.016  -6.184   5.791  1.00  0.89           N  
ATOM   9114  CA  LEU B 292      59.344  -5.972   7.061  1.00  0.89           C  
ATOM   9115  C   LEU B 292      60.069  -6.634   8.227  1.00  0.89           C  
ATOM   9116  O   LEU B 292      60.321  -5.996   9.242  1.00  0.89           O  
ATOM   9117  CB  LEU B 292      57.887  -6.494   7.021  1.00  0.89           C  
ATOM   9118  CG  LEU B 292      56.828  -5.672   7.791  1.00  0.89           C  
ATOM   9119  CD1 LEU B 292      55.680  -6.598   8.217  1.00  0.89           C  
ATOM   9120  CD2 LEU B 292      57.339  -4.923   9.028  1.00  0.89           C  
ATOM   9121  N   ARG B 293      60.514  -7.900   8.064  1.00  0.86           N  
ATOM   9122  CA  ARG B 293      61.343  -8.597   9.034  1.00  0.86           C  
ATOM   9123  C   ARG B 293      62.650  -7.870   9.299  1.00  0.86           C  
ATOM   9124  O   ARG B 293      63.044  -7.676  10.444  1.00  0.86           O  
ATOM   9125  CB  ARG B 293      61.665 -10.028   8.537  1.00  0.86           C  
ATOM   9126  CG  ARG B 293      62.677 -10.806   9.406  1.00  0.86           C  
ATOM   9127  CD  ARG B 293      62.237 -10.974  10.863  1.00  0.86           C  
ATOM   9128  NE  ARG B 293      63.325 -11.738  11.516  1.00  0.86           N  
ATOM   9129  CZ  ARG B 293      63.229 -12.454  12.639  1.00  0.86           C  
ATOM   9130  NH1 ARG B 293      62.105 -12.517  13.341  1.00  0.86           N  
ATOM   9131  NH2 ARG B 293      64.326 -13.084  13.039  1.00  0.86           N  
ATOM   9132  N   LEU B 294      63.312  -7.374   8.244  1.00  0.93           N  
ATOM   9133  CA  LEU B 294      64.504  -6.559   8.380  1.00  0.93           C  
ATOM   9134  C   LEU B 294      64.275  -5.250   9.136  1.00  0.93           C  
ATOM   9135  O   LEU B 294      65.068  -4.832   9.981  1.00  0.93           O  
ATOM   9136  CB  LEU B 294      65.069  -6.250   6.981  1.00  0.93           C  
ATOM   9137  CG  LEU B 294      66.398  -5.488   6.991  1.00  0.93           C  
ATOM   9138  CD1 LEU B 294      67.498  -6.255   7.723  1.00  0.93           C  
ATOM   9139  CD2 LEU B 294      66.836  -5.189   5.555  1.00  0.93           C  
ATOM   9140  N   LYS B 295      63.138  -4.566   8.890  1.00  0.92           N  
ATOM   9141  CA  LYS B 295      62.740  -3.409   9.667  1.00  0.92           C  
ATOM   9142  C   LYS B 295      62.540  -3.720  11.127  1.00  0.92           C  
ATOM   9143  O   LYS B 295      62.932  -2.925  11.973  1.00  0.92           O  
ATOM   9144  CB  LYS B 295      61.431  -2.765   9.173  1.00  0.92           C  
ATOM   9145  CG  LYS B 295      61.570  -2.101   7.811  1.00  0.92           C  
ATOM   9146  CD  LYS B 295      60.260  -1.435   7.374  1.00  0.92           C  
ATOM   9147  CE  LYS B 295      60.421  -0.919   5.954  1.00  0.92           C  
ATOM   9148  NZ  LYS B 295      59.151  -0.523   5.323  1.00  0.92           N  
ATOM   9149  N   GLN B 296      61.958  -4.890  11.465  1.00  0.93           N  
ATOM   9150  CA  GLN B 296      61.823  -5.340  12.838  1.00  0.93           C  
ATOM   9151  C   GLN B 296      63.164  -5.470  13.534  1.00  0.93           C  
ATOM   9152  O   GLN B 296      63.354  -4.972  14.642  1.00  0.93           O  
ATOM   9153  CB  GLN B 296      61.124  -6.724  12.912  1.00  0.93           C  
ATOM   9154  CG  GLN B 296      59.683  -6.715  12.375  1.00  0.93           C  
ATOM   9155  CD  GLN B 296      58.946  -8.031  12.627  1.00  0.93           C  
ATOM   9156  OE1 GLN B 296      59.501  -9.128  12.533  1.00  0.93           O  
ATOM   9157  NE2 GLN B 296      57.633  -7.907  12.928  1.00  0.93           N  
ATOM   9158  N   GLU B 297      64.145  -6.090  12.863  1.00  0.95           N  
ATOM   9159  CA  GLU B 297      65.491  -6.273  13.356  1.00  0.95           C  
ATOM   9160  C   GLU B 297      66.240  -4.975  13.564  1.00  0.95           C  
ATOM   9161  O   GLU B 297      66.837  -4.748  14.614  1.00  0.95           O  
ATOM   9162  CB  GLU B 297      66.224  -7.230  12.409  1.00  0.95           C  
ATOM   9163  CG  GLU B 297      65.532  -8.609  12.439  1.00  0.95           C  
ATOM   9164  CD  GLU B 297      66.112  -9.589  11.441  1.00  0.95           C  
ATOM   9165  OE1 GLU B 297      66.809  -9.163  10.490  1.00  0.95           O  
ATOM   9166  OE2 GLU B 297      65.755 -10.786  11.617  1.00  0.95           O  
ATOM   9167  N   TYR B 298      66.168  -4.024  12.617  1.00  0.96           N  
ATOM   9168  CA  TYR B 298      66.719  -2.704  12.857  1.00  0.96           C  
ATOM   9169  C   TYR B 298      65.992  -1.929  13.960  1.00  0.96           C  
ATOM   9170  O   TYR B 298      66.619  -1.274  14.790  1.00  0.96           O  
ATOM   9171  CB  TYR B 298      66.789  -1.887  11.547  1.00  0.96           C  
ATOM   9172  CG  TYR B 298      67.551  -0.615  11.788  1.00  0.96           C  
ATOM   9173  CD1 TYR B 298      68.899  -0.662  12.177  1.00  0.96           C  
ATOM   9174  CD2 TYR B 298      66.888   0.621  11.769  1.00  0.96           C  
ATOM   9175  CE1 TYR B 298      69.566   0.511  12.551  1.00  0.96           C  
ATOM   9176  CE2 TYR B 298      67.560   1.791  12.137  1.00  0.96           C  
ATOM   9177  CZ  TYR B 298      68.901   1.738  12.514  1.00  0.96           C  
ATOM   9178  OH  TYR B 298      69.561   2.922  12.883  1.00  0.96           O  
ATOM   9179  N   PHE B 299      64.650  -2.016  14.013  1.00  0.95           N  
ATOM   9180  CA  PHE B 299      63.821  -1.350  14.999  1.00  0.95           C  
ATOM   9181  C   PHE B 299      64.176  -1.725  16.431  1.00  0.95           C  
ATOM   9182  O   PHE B 299      64.402  -0.856  17.274  1.00  0.95           O  
ATOM   9183  CB  PHE B 299      62.342  -1.695  14.671  1.00  0.95           C  
ATOM   9184  CG  PHE B 299      61.351  -1.131  15.637  1.00  0.95           C  
ATOM   9185  CD1 PHE B 299      60.983   0.220  15.575  1.00  0.95           C  
ATOM   9186  CD2 PHE B 299      60.796  -1.959  16.625  1.00  0.95           C  
ATOM   9187  CE1 PHE B 299      60.092   0.747  16.515  1.00  0.95           C  
ATOM   9188  CE2 PHE B 299      59.908  -1.435  17.568  1.00  0.95           C  
ATOM   9189  CZ  PHE B 299      59.573  -0.079  17.520  1.00  0.95           C  
ATOM   9190  N   VAL B 300      64.303  -3.034  16.727  1.00  0.97           N  
ATOM   9191  CA  VAL B 300      64.749  -3.481  18.036  1.00  0.97           C  
ATOM   9192  C   VAL B 300      66.178  -3.067  18.333  1.00  0.97           C  
ATOM   9193  O   VAL B 300      66.493  -2.617  19.430  1.00  0.97           O  
ATOM   9194  CB  VAL B 300      64.553  -4.981  18.237  1.00  0.97           C  
ATOM   9195  CG1 VAL B 300      65.306  -5.816  17.192  1.00  0.97           C  
ATOM   9196  CG2 VAL B 300      64.989  -5.420  19.645  1.00  0.97           C  
ATOM   9197  N   VAL B 301      67.095  -3.177  17.358  1.00  0.98           N  
ATOM   9198  CA  VAL B 301      68.484  -2.804  17.539  1.00  0.98           C  
ATOM   9199  C   VAL B 301      68.706  -1.324  17.829  1.00  0.98           C  
ATOM   9200  O   VAL B 301      69.373  -0.969  18.800  1.00  0.98           O  
ATOM   9201  CB  VAL B 301      69.267  -3.238  16.307  1.00  0.98           C  
ATOM   9202  CG1 VAL B 301      70.622  -2.526  16.208  1.00  0.98           C  
ATOM   9203  CG2 VAL B 301      69.472  -4.764  16.370  1.00  0.98           C  
ATOM   9204  N   ALA B 302      68.125  -0.415  17.026  1.00  0.98           N  
ATOM   9205  CA  ALA B 302      68.324   1.011  17.182  1.00  0.98           C  
ATOM   9206  C   ALA B 302      67.762   1.568  18.476  1.00  0.98           C  
ATOM   9207  O   ALA B 302      68.400   2.347  19.180  1.00  0.98           O  
ATOM   9208  CB  ALA B 302      67.673   1.730  15.994  1.00  0.98           C  
ATOM   9209  N   ALA B 303      66.540   1.156  18.851  1.00  0.97           N  
ATOM   9210  CA  ALA B 303      65.937   1.548  20.105  1.00  0.97           C  
ATOM   9211  C   ALA B 303      66.683   1.024  21.330  1.00  0.97           C  
ATOM   9212  O   ALA B 303      66.974   1.756  22.277  1.00  0.97           O  
ATOM   9213  CB  ALA B 303      64.486   1.058  20.092  1.00  0.97           C  
ATOM   9214  N   THR B 304      67.071  -0.266  21.305  1.00  0.97           N  
ATOM   9215  CA  THR B 304      67.830  -0.906  22.370  1.00  0.97           C  
ATOM   9216  C   THR B 304      69.179  -0.281  22.605  1.00  0.97           C  
ATOM   9217  O   THR B 304      69.523   0.048  23.734  1.00  0.97           O  
ATOM   9218  CB  THR B 304      68.048  -2.375  22.063  1.00  0.97           C  
ATOM   9219  OG1 THR B 304      66.806  -3.057  22.128  1.00  0.97           O  
ATOM   9220  CG2 THR B 304      68.961  -3.063  23.077  1.00  0.97           C  
ATOM   9221  N   LEU B 305      69.980  -0.046  21.550  1.00  0.96           N  
ATOM   9222  CA  LEU B 305      71.306   0.533  21.693  1.00  0.96           C  
ATOM   9223  C   LEU B 305      71.280   1.969  22.206  1.00  0.96           C  
ATOM   9224  O   LEU B 305      72.090   2.338  23.056  1.00  0.96           O  
ATOM   9225  CB  LEU B 305      72.126   0.389  20.391  1.00  0.96           C  
ATOM   9226  CG  LEU B 305      72.906  -0.944  20.266  1.00  0.96           C  
ATOM   9227  CD1 LEU B 305      72.049  -2.212  20.398  1.00  0.96           C  
ATOM   9228  CD2 LEU B 305      73.650  -0.975  18.930  1.00  0.96           C  
ATOM   9229  N   GLN B 306      70.305   2.799  21.769  1.00  0.92           N  
ATOM   9230  CA  GLN B 306      70.079   4.115  22.353  1.00  0.92           C  
ATOM   9231  C   GLN B 306      69.753   4.061  23.858  1.00  0.92           C  
ATOM   9232  O   GLN B 306      70.338   4.795  24.654  1.00  0.92           O  
ATOM   9233  CB  GLN B 306      68.920   4.843  21.623  1.00  0.92           C  
ATOM   9234  CG  GLN B 306      69.213   5.279  20.167  1.00  0.92           C  
ATOM   9235  CD  GLN B 306      67.979   5.946  19.544  1.00  0.92           C  
ATOM   9236  OE1 GLN B 306      67.746   7.145  19.691  1.00  0.92           O  
ATOM   9237  NE2 GLN B 306      67.158   5.146  18.827  1.00  0.92           N  
ATOM   9238  N   ASP B 307      68.853   3.149  24.303  1.00  0.94           N  
ATOM   9239  CA  ASP B 307      68.511   2.948  25.711  1.00  0.94           C  
ATOM   9240  C   ASP B 307      69.701   2.437  26.541  1.00  0.94           C  
ATOM   9241  O   ASP B 307      69.926   2.886  27.667  1.00  0.94           O  
ATOM   9242  CB  ASP B 307      67.259   2.017  25.801  1.00  0.94           C  
ATOM   9243  CG  ASP B 307      66.452   2.063  27.092  1.00  0.94           C  
ATOM   9244  OD1 ASP B 307      65.987   3.142  27.537  1.00  0.94           O  
ATOM   9245  OD2 ASP B 307      66.164   0.981  27.667  1.00  0.94           O  
ATOM   9246  N   ILE B 308      70.526   1.512  25.984  1.00  0.95           N  
ATOM   9247  CA  ILE B 308      71.763   1.032  26.602  1.00  0.95           C  
ATOM   9248  C   ILE B 308      72.768   2.148  26.841  1.00  0.95           C  
ATOM   9249  O   ILE B 308      73.277   2.310  27.951  1.00  0.95           O  
ATOM   9250  CB  ILE B 308      72.454  -0.055  25.760  1.00  0.95           C  
ATOM   9251  CG1 ILE B 308      71.602  -1.343  25.714  1.00  0.95           C  
ATOM   9252  CG2 ILE B 308      73.864  -0.386  26.309  1.00  0.95           C  
ATOM   9253  CD1 ILE B 308      72.174  -2.443  24.810  1.00  0.95           C  
ATOM   9254  N   ILE B 309      73.057   2.977  25.815  1.00  0.91           N  
ATOM   9255  CA  ILE B 309      73.982   4.098  25.919  1.00  0.91           C  
ATOM   9256  C   ILE B 309      73.474   5.176  26.856  1.00  0.91           C  
ATOM   9257  O   ILE B 309      74.216   5.696  27.686  1.00  0.91           O  
ATOM   9258  CB  ILE B 309      74.323   4.672  24.547  1.00  0.91           C  
ATOM   9259  CG1 ILE B 309      75.136   3.624  23.749  1.00  0.91           C  
ATOM   9260  CG2 ILE B 309      75.109   5.998  24.672  1.00  0.91           C  
ATOM   9261  CD1 ILE B 309      75.340   3.995  22.280  1.00  0.91           C  
ATOM   9262  N   ARG B 310      72.171   5.507  26.797  1.00  0.81           N  
ATOM   9263  CA  ARG B 310      71.554   6.448  27.714  1.00  0.81           C  
ATOM   9264  C   ARG B 310      71.668   6.008  29.169  1.00  0.81           C  
ATOM   9265  O   ARG B 310      72.043   6.787  30.039  1.00  0.81           O  
ATOM   9266  CB  ARG B 310      70.057   6.582  27.360  1.00  0.81           C  
ATOM   9267  CG  ARG B 310      69.276   7.606  28.209  1.00  0.81           C  
ATOM   9268  CD  ARG B 310      67.858   7.139  28.538  1.00  0.81           C  
ATOM   9269  NE  ARG B 310      67.998   5.992  29.483  1.00  0.81           N  
ATOM   9270  CZ  ARG B 310      67.030   5.096  29.696  1.00  0.81           C  
ATOM   9271  NH1 ARG B 310      65.800   5.259  29.229  1.00  0.81           N  
ATOM   9272  NH2 ARG B 310      67.302   3.988  30.378  1.00  0.81           N  
ATOM   9273  N   ARG B 311      71.382   4.719  29.454  1.00  0.81           N  
ATOM   9274  CA  ARG B 311      71.559   4.120  30.765  1.00  0.81           C  
ATOM   9275  C   ARG B 311      72.999   4.069  31.232  1.00  0.81           C  
ATOM   9276  O   ARG B 311      73.287   4.259  32.410  1.00  0.81           O  
ATOM   9277  CB  ARG B 311      70.956   2.694  30.801  1.00  0.81           C  
ATOM   9278  CG  ARG B 311      70.997   2.069  32.212  1.00  0.81           C  
ATOM   9279  CD  ARG B 311      70.188   0.790  32.453  1.00  0.81           C  
ATOM   9280  NE  ARG B 311      68.753   1.024  32.095  1.00  0.81           N  
ATOM   9281  CZ  ARG B 311      68.200   0.575  30.958  1.00  0.81           C  
ATOM   9282  NH1 ARG B 311      68.923  -0.009  30.010  1.00  0.81           N  
ATOM   9283  NH2 ARG B 311      66.895   0.738  30.756  1.00  0.81           N  
ATOM   9284  N   PHE B 312      73.952   3.806  30.317  1.00  0.84           N  
ATOM   9285  CA  PHE B 312      75.364   3.875  30.625  1.00  0.84           C  
ATOM   9286  C   PHE B 312      75.760   5.267  31.086  1.00  0.84           C  
ATOM   9287  O   PHE B 312      76.370   5.389  32.143  1.00  0.84           O  
ATOM   9288  CB  PHE B 312      76.176   3.450  29.370  1.00  0.84           C  
ATOM   9289  CG  PHE B 312      77.668   3.606  29.500  1.00  0.84           C  
ATOM   9290  CD1 PHE B 312      78.433   2.689  30.237  1.00  0.84           C  
ATOM   9291  CD2 PHE B 312      78.316   4.662  28.834  1.00  0.84           C  
ATOM   9292  CE1 PHE B 312      79.828   2.815  30.287  1.00  0.84           C  
ATOM   9293  CE2 PHE B 312      79.711   4.780  28.870  1.00  0.84           C  
ATOM   9294  CZ  PHE B 312      80.469   3.850  29.592  1.00  0.84           C  
ATOM   9295  N   LYS B 313      75.369   6.324  30.340  1.00  0.75           N  
ATOM   9296  CA  LYS B 313      75.713   7.704  30.640  1.00  0.75           C  
ATOM   9297  C   LYS B 313      75.163   8.243  31.961  1.00  0.75           C  
ATOM   9298  O   LYS B 313      75.881   8.906  32.712  1.00  0.75           O  
ATOM   9299  CB  LYS B 313      75.279   8.668  29.498  1.00  0.75           C  
ATOM   9300  CG  LYS B 313      76.041   8.485  28.172  1.00  0.75           C  
ATOM   9301  CD  LYS B 313      75.811   9.633  27.165  1.00  0.75           C  
ATOM   9302  CE  LYS B 313      76.639   9.439  25.883  1.00  0.75           C  
ATOM   9303  NZ  LYS B 313      76.534  10.586  24.959  1.00  0.75           N  
ATOM   9304  N   SER B 314      73.884   7.976  32.295  1.00  0.75           N  
ATOM   9305  CA  SER B 314      73.268   8.421  33.546  1.00  0.75           C  
ATOM   9306  C   SER B 314      73.507   7.472  34.706  1.00  0.75           C  
ATOM   9307  O   SER B 314      72.594   6.914  35.309  1.00  0.75           O  
ATOM   9308  CB  SER B 314      71.751   8.709  33.413  1.00  0.75           C  
ATOM   9309  OG  SER B 314      71.024   7.605  32.860  1.00  0.75           O  
ATOM   9310  N   SER B 315      74.780   7.259  35.062  1.00  0.73           N  
ATOM   9311  CA  SER B 315      75.174   6.256  36.042  1.00  0.73           C  
ATOM   9312  C   SER B 315      75.013   6.612  37.503  1.00  0.73           C  
ATOM   9313  O   SER B 315      74.933   5.726  38.350  1.00  0.73           O  
ATOM   9314  CB  SER B 315      76.656   5.853  35.851  1.00  0.73           C  
ATOM   9315  OG  SER B 315      77.545   6.976  35.904  1.00  0.73           O  
ATOM   9316  N   LYS B 316      74.977   7.905  37.862  1.00  0.57           N  
ATOM   9317  CA  LYS B 316      74.911   8.315  39.252  1.00  0.57           C  
ATOM   9318  C   LYS B 316      73.558   8.067  39.912  1.00  0.57           C  
ATOM   9319  O   LYS B 316      72.516   8.509  39.439  1.00  0.57           O  
ATOM   9320  CB  LYS B 316      75.293   9.811  39.402  1.00  0.57           C  
ATOM   9321  CG  LYS B 316      75.322  10.311  40.859  1.00  0.57           C  
ATOM   9322  CD  LYS B 316      75.861  11.743  41.015  1.00  0.57           C  
ATOM   9323  CE  LYS B 316      75.880  12.179  42.485  1.00  0.57           C  
ATOM   9324  NZ  LYS B 316      76.445  13.541  42.630  1.00  0.57           N  
ATOM   9325  N   PHE B 317      73.536   7.386  41.078  1.00  0.53           N  
ATOM   9326  CA  PHE B 317      72.320   7.202  41.856  1.00  0.53           C  
ATOM   9327  C   PHE B 317      71.629   8.518  42.228  1.00  0.53           C  
ATOM   9328  O   PHE B 317      72.233   9.457  42.750  1.00  0.53           O  
ATOM   9329  CB  PHE B 317      72.610   6.357  43.132  1.00  0.53           C  
ATOM   9330  CG  PHE B 317      71.361   5.991  43.903  1.00  0.53           C  
ATOM   9331  CD1 PHE B 317      70.755   6.917  44.773  1.00  0.53           C  
ATOM   9332  CD2 PHE B 317      70.789   4.719  43.775  1.00  0.53           C  
ATOM   9333  CE1 PHE B 317      69.580   6.594  45.461  1.00  0.53           C  
ATOM   9334  CE2 PHE B 317      69.629   4.381  44.479  1.00  0.53           C  
ATOM   9335  CZ  PHE B 317      69.014   5.322  45.313  1.00  0.53           C  
ATOM   9336  N   GLY B 318      70.310   8.596  41.954  1.00  0.66           N  
ATOM   9337  CA  GLY B 318      69.480   9.745  42.292  1.00  0.66           C  
ATOM   9338  C   GLY B 318      69.616  10.910  41.364  1.00  0.66           C  
ATOM   9339  O   GLY B 318      68.991  11.945  41.569  1.00  0.66           O  
ATOM   9340  N   CYS B 319      70.431  10.768  40.317  1.00  0.67           N  
ATOM   9341  CA  CYS B 319      70.717  11.828  39.388  1.00  0.67           C  
ATOM   9342  C   CYS B 319      70.527  11.294  37.989  1.00  0.67           C  
ATOM   9343  O   CYS B 319      70.946  10.191  37.664  1.00  0.67           O  
ATOM   9344  CB  CYS B 319      72.169  12.307  39.601  1.00  0.67           C  
ATOM   9345  SG  CYS B 319      72.708  13.571  38.415  1.00  0.67           S  
ATOM   9346  N   ARG B 320      69.874  12.063  37.103  1.00  0.55           N  
ATOM   9347  CA  ARG B 320      69.646  11.587  35.752  1.00  0.55           C  
ATOM   9348  C   ARG B 320      70.495  12.295  34.727  1.00  0.55           C  
ATOM   9349  O   ARG B 320      70.350  12.053  33.528  1.00  0.55           O  
ATOM   9350  CB  ARG B 320      68.161  11.717  35.368  1.00  0.55           C  
ATOM   9351  CG  ARG B 320      67.270  10.733  36.145  1.00  0.55           C  
ATOM   9352  CD  ARG B 320      65.861  10.605  35.572  1.00  0.55           C  
ATOM   9353  NE  ARG B 320      65.205  11.939  35.697  1.00  0.55           N  
ATOM   9354  CZ  ARG B 320      64.019  12.253  35.163  1.00  0.55           C  
ATOM   9355  NH1 ARG B 320      63.342  11.405  34.398  1.00  0.55           N  
ATOM   9356  NH2 ARG B 320      63.514  13.462  35.393  1.00  0.55           N  
ATOM   9357  N   ASP B 321      71.422  13.161  35.170  1.00  0.58           N  
ATOM   9358  CA  ASP B 321      72.344  13.841  34.295  1.00  0.58           C  
ATOM   9359  C   ASP B 321      73.281  12.873  33.560  1.00  0.58           C  
ATOM   9360  O   ASP B 321      73.703  11.868  34.146  1.00  0.58           O  
ATOM   9361  CB  ASP B 321      73.196  14.893  35.038  1.00  0.58           C  
ATOM   9362  CG  ASP B 321      72.327  15.934  35.722  1.00  0.58           C  
ATOM   9363  OD1 ASP B 321      71.271  16.300  35.150  1.00  0.58           O  
ATOM   9364  OD2 ASP B 321      72.728  16.367  36.832  1.00  0.58           O  
ATOM   9365  N   PRO B 322      73.663  13.107  32.303  1.00  0.62           N  
ATOM   9366  CA  PRO B 322      74.595  12.223  31.609  1.00  0.62           C  
ATOM   9367  C   PRO B 322      76.028  12.474  32.060  1.00  0.62           C  
ATOM   9368  O   PRO B 322      76.838  13.018  31.311  1.00  0.62           O  
ATOM   9369  CB  PRO B 322      74.371  12.560  30.119  1.00  0.62           C  
ATOM   9370  CG  PRO B 322      72.959  13.143  30.070  1.00  0.62           C  
ATOM   9371  CD  PRO B 322      72.896  13.932  31.367  1.00  0.62           C  
ATOM   9372  N   VAL B 323      76.351  12.092  33.304  1.00  0.64           N  
ATOM   9373  CA  VAL B 323      77.621  12.346  33.962  1.00  0.64           C  
ATOM   9374  C   VAL B 323      78.793  11.617  33.338  1.00  0.64           C  
ATOM   9375  O   VAL B 323      79.921  12.104  33.305  1.00  0.64           O  
ATOM   9376  CB  VAL B 323      77.576  12.063  35.464  1.00  0.64           C  
ATOM   9377  CG1 VAL B 323      76.535  13.000  36.100  1.00  0.64           C  
ATOM   9378  CG2 VAL B 323      77.233  10.592  35.775  1.00  0.64           C  
ATOM   9379  N   ARG B 324      78.553  10.397  32.837  1.00  0.54           N  
ATOM   9380  CA  ARG B 324      79.567   9.550  32.265  1.00  0.54           C  
ATOM   9381  C   ARG B 324      79.565   9.664  30.752  1.00  0.54           C  
ATOM   9382  O   ARG B 324      78.851   8.970  30.033  1.00  0.54           O  
ATOM   9383  CB  ARG B 324      79.268   8.117  32.727  1.00  0.54           C  
ATOM   9384  CG  ARG B 324      80.150   6.989  32.168  1.00  0.54           C  
ATOM   9385  CD  ARG B 324      79.427   5.665  32.394  1.00  0.54           C  
ATOM   9386  NE  ARG B 324      80.017   4.944  33.546  1.00  0.54           N  
ATOM   9387  CZ  ARG B 324      79.401   3.929  34.166  1.00  0.54           C  
ATOM   9388  NH1 ARG B 324      78.170   3.526  33.876  1.00  0.54           N  
ATOM   9389  NH2 ARG B 324      80.041   3.327  35.159  1.00  0.54           N  
ATOM   9390  N   THR B 325      80.406  10.561  30.223  1.00  0.66           N  
ATOM   9391  CA  THR B 325      80.491  10.834  28.793  1.00  0.66           C  
ATOM   9392  C   THR B 325      81.648  10.111  28.143  1.00  0.66           C  
ATOM   9393  O   THR B 325      81.745  10.022  26.922  1.00  0.66           O  
ATOM   9394  CB  THR B 325      80.673  12.326  28.543  1.00  0.66           C  
ATOM   9395  OG1 THR B 325      81.702  12.852  29.375  1.00  0.66           O  
ATOM   9396  CG2 THR B 325      79.372  13.050  28.918  1.00  0.66           C  
ATOM   9397  N   CYS B 326      82.544   9.517  28.949  1.00  0.70           N  
ATOM   9398  CA  CYS B 326      83.669   8.763  28.446  1.00  0.70           C  
ATOM   9399  C   CYS B 326      83.324   7.293  28.255  1.00  0.70           C  
ATOM   9400  O   CYS B 326      82.823   6.614  29.149  1.00  0.70           O  
ATOM   9401  CB  CYS B 326      84.896   8.895  29.380  1.00  0.70           C  
ATOM   9402  SG  CYS B 326      86.413   8.161  28.648  1.00  0.70           S  
ATOM   9403  N   PHE B 327      83.635   6.752  27.064  1.00  0.80           N  
ATOM   9404  CA  PHE B 327      83.297   5.391  26.692  1.00  0.80           C  
ATOM   9405  C   PHE B 327      84.400   4.385  26.964  1.00  0.80           C  
ATOM   9406  O   PHE B 327      84.312   3.242  26.523  1.00  0.80           O  
ATOM   9407  CB  PHE B 327      82.985   5.313  25.176  1.00  0.80           C  
ATOM   9408  CG  PHE B 327      81.589   5.774  24.892  1.00  0.80           C  
ATOM   9409  CD1 PHE B 327      80.528   4.855  24.940  1.00  0.80           C  
ATOM   9410  CD2 PHE B 327      81.322   7.104  24.539  1.00  0.80           C  
ATOM   9411  CE1 PHE B 327      79.218   5.255  24.649  1.00  0.80           C  
ATOM   9412  CE2 PHE B 327      80.015   7.510  24.251  1.00  0.80           C  
ATOM   9413  CZ  PHE B 327      78.962   6.587  24.302  1.00  0.80           C  
ATOM   9414  N   GLU B 328      85.459   4.743  27.715  1.00  0.75           N  
ATOM   9415  CA  GLU B 328      86.544   3.821  28.037  1.00  0.75           C  
ATOM   9416  C   GLU B 328      86.068   2.591  28.789  1.00  0.75           C  
ATOM   9417  O   GLU B 328      86.421   1.459  28.478  1.00  0.75           O  
ATOM   9418  CB  GLU B 328      87.610   4.554  28.877  1.00  0.75           C  
ATOM   9419  CG  GLU B 328      88.856   3.708  29.247  1.00  0.75           C  
ATOM   9420  CD  GLU B 328      89.899   4.523  30.010  1.00  0.75           C  
ATOM   9421  OE1 GLU B 328      90.949   3.928  30.355  1.00  0.75           O  
ATOM   9422  OE2 GLU B 328      89.658   5.740  30.228  1.00  0.75           O  
ATOM   9423  N   THR B 329      85.150   2.799  29.745  1.00  0.80           N  
ATOM   9424  CA  THR B 329      84.612   1.736  30.572  1.00  0.80           C  
ATOM   9425  C   THR B 329      83.347   1.124  30.006  1.00  0.80           C  
ATOM   9426  O   THR B 329      82.685   0.334  30.673  1.00  0.80           O  
ATOM   9427  CB  THR B 329      84.297   2.228  31.980  1.00  0.80           C  
ATOM   9428  OG1 THR B 329      83.414   3.347  31.973  1.00  0.80           O  
ATOM   9429  CG2 THR B 329      85.587   2.696  32.670  1.00  0.80           C  
ATOM   9430  N   PHE B 330      82.970   1.429  28.746  1.00  0.89           N  
ATOM   9431  CA  PHE B 330      81.786   0.846  28.120  1.00  0.89           C  
ATOM   9432  C   PHE B 330      81.824  -0.681  28.009  1.00  0.89           C  
ATOM   9433  O   PHE B 330      80.826  -1.298  28.388  1.00  0.89           O  
ATOM   9434  CB  PHE B 330      81.478   1.531  26.755  1.00  0.89           C  
ATOM   9435  CG  PHE B 330      80.116   1.195  26.189  1.00  0.89           C  
ATOM   9436  CD1 PHE B 330      79.002   1.970  26.536  1.00  0.89           C  
ATOM   9437  CD2 PHE B 330      79.942   0.147  25.270  1.00  0.89           C  
ATOM   9438  CE1 PHE B 330      77.739   1.715  25.990  1.00  0.89           C  
ATOM   9439  CE2 PHE B 330      78.681  -0.116  24.714  1.00  0.89           C  
ATOM   9440  CZ  PHE B 330      77.578   0.668  25.075  1.00  0.89           C  
ATOM   9441  N   PRO B 331      82.895  -1.375  27.607  1.00  0.95           N  
ATOM   9442  CA  PRO B 331      82.862  -2.834  27.523  1.00  0.95           C  
ATOM   9443  C   PRO B 331      82.895  -3.496  28.881  1.00  0.95           C  
ATOM   9444  O   PRO B 331      82.615  -4.689  28.985  1.00  0.95           O  
ATOM   9445  CB  PRO B 331      84.112  -3.177  26.700  1.00  0.95           C  
ATOM   9446  CG  PRO B 331      84.380  -1.913  25.886  1.00  0.95           C  
ATOM   9447  CD  PRO B 331      84.061  -0.827  26.901  1.00  0.95           C  
ATOM   9448  N   ASP B 332      83.220  -2.753  29.947  1.00  0.90           N  
ATOM   9449  CA  ASP B 332      83.249  -3.291  31.287  1.00  0.90           C  
ATOM   9450  C   ASP B 332      81.976  -2.955  32.043  1.00  0.90           C  
ATOM   9451  O   ASP B 332      81.777  -3.377  33.180  1.00  0.90           O  
ATOM   9452  CB  ASP B 332      84.456  -2.722  32.049  1.00  0.90           C  
ATOM   9453  CG  ASP B 332      85.721  -3.162  31.341  1.00  0.90           C  
ATOM   9454  OD1 ASP B 332      85.864  -4.389  31.106  1.00  0.90           O  
ATOM   9455  OD2 ASP B 332      86.535  -2.266  31.009  1.00  0.90           O  
ATOM   9456  N   LYS B 333      81.049  -2.208  31.415  1.00  0.88           N  
ATOM   9457  CA  LYS B 333      79.771  -1.887  32.018  1.00  0.88           C  
ATOM   9458  C   LYS B 333      78.604  -2.338  31.172  1.00  0.88           C  
ATOM   9459  O   LYS B 333      77.456  -2.268  31.611  1.00  0.88           O  
ATOM   9460  CB  LYS B 333      79.657  -0.370  32.264  1.00  0.88           C  
ATOM   9461  CG  LYS B 333      80.684   0.163  33.276  1.00  0.88           C  
ATOM   9462  CD  LYS B 333      80.501  -0.433  34.680  1.00  0.88           C  
ATOM   9463  CE  LYS B 333      81.571   0.030  35.667  1.00  0.88           C  
ATOM   9464  NZ  LYS B 333      81.198  -0.390  37.027  1.00  0.88           N  
ATOM   9465  N   VAL B 334      78.872  -2.858  29.963  1.00  0.95           N  
ATOM   9466  CA  VAL B 334      77.849  -3.277  29.025  1.00  0.95           C  
ATOM   9467  C   VAL B 334      78.289  -4.562  28.345  1.00  0.95           C  
ATOM   9468  O   VAL B 334      79.426  -4.704  27.901  1.00  0.95           O  
ATOM   9469  CB  VAL B 334      77.588  -2.220  27.948  1.00  0.95           C  
ATOM   9470  CG1 VAL B 334      76.473  -2.659  26.980  1.00  0.95           C  
ATOM   9471  CG2 VAL B 334      77.206  -0.877  28.603  1.00  0.95           C  
ATOM   9472  N   ALA B 335      77.387  -5.552  28.247  1.00  0.97           N  
ATOM   9473  CA  ALA B 335      77.560  -6.711  27.398  1.00  0.97           C  
ATOM   9474  C   ALA B 335      76.338  -6.826  26.516  1.00  0.97           C  
ATOM   9475  O   ALA B 335      75.215  -6.699  27.000  1.00  0.97           O  
ATOM   9476  CB  ALA B 335      77.699  -8.014  28.209  1.00  0.97           C  
ATOM   9477  N   ILE B 336      76.511  -7.064  25.204  1.00  0.97           N  
ATOM   9478  CA  ILE B 336      75.395  -7.274  24.294  1.00  0.97           C  
ATOM   9479  C   ILE B 336      75.503  -8.681  23.736  1.00  0.97           C  
ATOM   9480  O   ILE B 336      76.414  -9.015  22.982  1.00  0.97           O  
ATOM   9481  CB  ILE B 336      75.333  -6.236  23.167  1.00  0.97           C  
ATOM   9482  CG1 ILE B 336      75.111  -4.819  23.749  1.00  0.97           C  
ATOM   9483  CG2 ILE B 336      74.193  -6.569  22.184  1.00  0.97           C  
ATOM   9484  CD1 ILE B 336      75.118  -3.701  22.696  1.00  0.97           C  
ATOM   9485  N   GLN B 337      74.549  -9.560  24.088  1.00  0.96           N  
ATOM   9486  CA  GLN B 337      74.532 -10.919  23.593  1.00  0.96           C  
ATOM   9487  C   GLN B 337      73.532 -11.030  22.468  1.00  0.96           C  
ATOM   9488  O   GLN B 337      72.349 -10.719  22.620  1.00  0.96           O  
ATOM   9489  CB  GLN B 337      74.162 -11.927  24.705  1.00  0.96           C  
ATOM   9490  CG  GLN B 337      74.363 -13.416  24.324  1.00  0.96           C  
ATOM   9491  CD  GLN B 337      75.843 -13.751  24.140  1.00  0.96           C  
ATOM   9492  OE1 GLN B 337      76.681 -13.357  24.952  1.00  0.96           O  
ATOM   9493  NE2 GLN B 337      76.175 -14.504  23.070  1.00  0.96           N  
ATOM   9494  N   LEU B 338      73.999 -11.470  21.290  1.00  0.97           N  
ATOM   9495  CA  LEU B 338      73.167 -11.605  20.116  1.00  0.97           C  
ATOM   9496  C   LEU B 338      72.600 -13.001  20.073  1.00  0.97           C  
ATOM   9497  O   LEU B 338      73.310 -13.990  19.872  1.00  0.97           O  
ATOM   9498  CB  LEU B 338      73.939 -11.333  18.792  1.00  0.97           C  
ATOM   9499  CG  LEU B 338      74.212  -9.854  18.423  1.00  0.97           C  
ATOM   9500  CD1 LEU B 338      73.790  -8.860  19.506  1.00  0.97           C  
ATOM   9501  CD2 LEU B 338      75.689  -9.643  18.064  1.00  0.97           C  
ATOM   9502  N   ASN B 339      71.270 -13.103  20.253  1.00  0.96           N  
ATOM   9503  CA  ASN B 339      70.555 -14.344  20.077  1.00  0.96           C  
ATOM   9504  C   ASN B 339      70.323 -14.560  18.590  1.00  0.96           C  
ATOM   9505  O   ASN B 339      69.455 -13.922  17.995  1.00  0.96           O  
ATOM   9506  CB  ASN B 339      69.212 -14.292  20.853  1.00  0.96           C  
ATOM   9507  CG  ASN B 339      68.638 -15.678  21.101  1.00  0.96           C  
ATOM   9508  OD1 ASN B 339      69.378 -16.635  21.335  1.00  0.96           O  
ATOM   9509  ND2 ASN B 339      67.297 -15.797  21.147  1.00  0.96           N  
ATOM   9510  N   ASP B 340      71.132 -15.454  17.982  1.00  0.94           N  
ATOM   9511  CA  ASP B 340      71.212 -15.665  16.549  1.00  0.94           C  
ATOM   9512  C   ASP B 340      71.695 -14.428  15.774  1.00  0.94           C  
ATOM   9513  O   ASP B 340      72.241 -13.482  16.346  1.00  0.94           O  
ATOM   9514  CB  ASP B 340      69.869 -16.236  16.023  1.00  0.94           C  
ATOM   9515  CG  ASP B 340      70.109 -17.272  14.944  1.00  0.94           C  
ATOM   9516  OD1 ASP B 340      70.688 -16.889  13.899  1.00  0.94           O  
ATOM   9517  OD2 ASP B 340      69.771 -18.460  15.167  1.00  0.94           O  
ATOM   9518  N   THR B 341      71.539 -14.400  14.433  1.00  0.95           N  
ATOM   9519  CA  THR B 341      71.968 -13.271  13.610  1.00  0.95           C  
ATOM   9520  C   THR B 341      70.910 -12.223  13.453  1.00  0.95           C  
ATOM   9521  O   THR B 341      71.182 -11.135  12.961  1.00  0.95           O  
ATOM   9522  CB  THR B 341      72.533 -13.593  12.235  1.00  0.95           C  
ATOM   9523  OG1 THR B 341      71.623 -14.298  11.368  1.00  0.95           O  
ATOM   9524  CG2 THR B 341      73.828 -14.381  12.454  1.00  0.95           C  
ATOM   9525  N   HIS B 342      69.703 -12.469  13.982  1.00  0.94           N  
ATOM   9526  CA  HIS B 342      68.584 -11.541  13.922  1.00  0.94           C  
ATOM   9527  C   HIS B 342      68.857 -10.163  14.554  1.00  0.94           C  
ATOM   9528  O   HIS B 342      68.361  -9.165  14.042  1.00  0.94           O  
ATOM   9529  CB  HIS B 342      67.313 -12.152  14.558  1.00  0.94           C  
ATOM   9530  CG  HIS B 342      67.051 -13.597  14.245  1.00  0.94           C  
ATOM   9531  ND1 HIS B 342      66.204 -14.303  15.089  1.00  0.94           N  
ATOM   9532  CD2 HIS B 342      67.543 -14.418  13.282  1.00  0.94           C  
ATOM   9533  CE1 HIS B 342      66.219 -15.542  14.626  1.00  0.94           C  
ATOM   9534  NE2 HIS B 342      67.012 -15.663  13.535  1.00  0.94           N  
ATOM   9535  N   PRO B 343      69.636  -9.966  15.627  1.00  0.99           N  
ATOM   9536  CA  PRO B 343      69.941  -8.606  16.067  1.00  0.99           C  
ATOM   9537  C   PRO B 343      71.362  -8.247  15.675  1.00  0.99           C  
ATOM   9538  O   PRO B 343      71.947  -7.363  16.300  1.00  0.99           O  
ATOM   9539  CB  PRO B 343      69.796  -8.718  17.591  1.00  0.99           C  
ATOM   9540  CG  PRO B 343      70.306 -10.123  17.902  1.00  0.99           C  
ATOM   9541  CD  PRO B 343      69.773 -10.936  16.727  1.00  0.99           C  
ATOM   9542  N   ALA B 344      71.924  -8.847  14.602  1.00  0.98           N  
ATOM   9543  CA  ALA B 344      73.287  -8.617  14.137  1.00  0.98           C  
ATOM   9544  C   ALA B 344      73.591  -7.195  13.723  1.00  0.98           C  
ATOM   9545  O   ALA B 344      74.733  -6.740  13.770  1.00  0.98           O  
ATOM   9546  CB  ALA B 344      73.610  -9.496  12.920  1.00  0.98           C  
ATOM   9547  N   LEU B 345      72.554  -6.427  13.342  1.00  0.97           N  
ATOM   9548  CA  LEU B 345      72.679  -5.025  13.010  1.00  0.97           C  
ATOM   9549  C   LEU B 345      73.134  -4.159  14.172  1.00  0.97           C  
ATOM   9550  O   LEU B 345      73.510  -3.006  13.979  1.00  0.97           O  
ATOM   9551  CB  LEU B 345      71.352  -4.478  12.447  1.00  0.97           C  
ATOM   9552  CG  LEU B 345      71.026  -4.986  11.031  1.00  0.97           C  
ATOM   9553  CD1 LEU B 345      69.640  -4.484  10.618  1.00  0.97           C  
ATOM   9554  CD2 LEU B 345      72.076  -4.533  10.004  1.00  0.97           C  
ATOM   9555  N   SER B 346      73.189  -4.708  15.402  1.00  0.98           N  
ATOM   9556  CA  SER B 346      73.778  -4.053  16.561  1.00  0.98           C  
ATOM   9557  C   SER B 346      75.228  -3.665  16.361  1.00  0.98           C  
ATOM   9558  O   SER B 346      75.649  -2.587  16.760  1.00  0.98           O  
ATOM   9559  CB  SER B 346      73.667  -4.928  17.831  1.00  0.98           C  
ATOM   9560  OG  SER B 346      74.459  -6.106  17.717  1.00  0.98           O  
ATOM   9561  N   ILE B 347      76.020  -4.523  15.700  1.00  0.96           N  
ATOM   9562  CA  ILE B 347      77.412  -4.270  15.381  1.00  0.96           C  
ATOM   9563  C   ILE B 347      77.635  -3.058  14.470  1.00  0.96           C  
ATOM   9564  O   ILE B 347      78.432  -2.194  14.850  1.00  0.96           O  
ATOM   9565  CB  ILE B 347      78.034  -5.540  14.805  1.00  0.96           C  
ATOM   9566  CG1 ILE B 347      77.998  -6.670  15.859  1.00  0.96           C  
ATOM   9567  CG2 ILE B 347      79.474  -5.279  14.315  1.00  0.96           C  
ATOM   9568  CD1 ILE B 347      78.381  -8.035  15.292  1.00  0.96           C  
ATOM   9569  N   PRO B 348      76.976  -2.845  13.325  1.00  0.98           N  
ATOM   9570  CA  PRO B 348      77.166  -1.614  12.573  1.00  0.98           C  
ATOM   9571  C   PRO B 348      76.393  -0.460  13.181  1.00  0.98           C  
ATOM   9572  O   PRO B 348      76.825   0.674  13.001  1.00  0.98           O  
ATOM   9573  CB  PRO B 348      76.698  -1.972  11.152  1.00  0.98           C  
ATOM   9574  CG  PRO B 348      75.693  -3.102  11.361  1.00  0.98           C  
ATOM   9575  CD  PRO B 348      76.328  -3.878  12.511  1.00  0.98           C  
ATOM   9576  N   GLU B 349      75.268  -0.681  13.891  1.00  0.95           N  
ATOM   9577  CA  GLU B 349      74.567   0.391  14.585  1.00  0.95           C  
ATOM   9578  C   GLU B 349      75.352   0.991  15.735  1.00  0.95           C  
ATOM   9579  O   GLU B 349      75.441   2.207  15.887  1.00  0.95           O  
ATOM   9580  CB  GLU B 349      73.176  -0.074  15.080  1.00  0.95           C  
ATOM   9581  CG  GLU B 349      72.357   0.956  15.916  1.00  0.95           C  
ATOM   9582  CD  GLU B 349      72.039   2.259  15.196  1.00  0.95           C  
ATOM   9583  OE1 GLU B 349      72.400   2.407  14.003  1.00  0.95           O  
ATOM   9584  OE2 GLU B 349      71.438   3.177  15.812  1.00  0.95           O  
ATOM   9585  N   LEU B 350      76.016   0.157  16.558  1.00  0.95           N  
ATOM   9586  CA  LEU B 350      76.884   0.624  17.622  1.00  0.95           C  
ATOM   9587  C   LEU B 350      78.055   1.417  17.076  1.00  0.95           C  
ATOM   9588  O   LEU B 350      78.370   2.504  17.552  1.00  0.95           O  
ATOM   9589  CB  LEU B 350      77.383  -0.561  18.480  1.00  0.95           C  
ATOM   9590  CG  LEU B 350      78.251  -0.188  19.700  1.00  0.95           C  
ATOM   9591  CD1 LEU B 350      77.600   0.878  20.594  1.00  0.95           C  
ATOM   9592  CD2 LEU B 350      78.555  -1.445  20.526  1.00  0.95           C  
ATOM   9593  N   MET B 351      78.666   0.935  15.975  1.00  0.92           N  
ATOM   9594  CA  MET B 351      79.658   1.697  15.245  1.00  0.92           C  
ATOM   9595  C   MET B 351      79.146   3.014  14.694  1.00  0.92           C  
ATOM   9596  O   MET B 351      79.812   4.037  14.823  1.00  0.92           O  
ATOM   9597  CB  MET B 351      80.239   0.860  14.083  1.00  0.92           C  
ATOM   9598  CG  MET B 351      81.232  -0.200  14.572  1.00  0.92           C  
ATOM   9599  SD  MET B 351      82.620   0.525  15.486  1.00  0.92           S  
ATOM   9600  CE  MET B 351      83.514   1.220  14.072  1.00  0.92           C  
ATOM   9601  N   ARG B 352      77.930   3.040  14.118  1.00  0.90           N  
ATOM   9602  CA  ARG B 352      77.300   4.259  13.650  1.00  0.90           C  
ATOM   9603  C   ARG B 352      77.080   5.283  14.754  1.00  0.90           C  
ATOM   9604  O   ARG B 352      77.406   6.458  14.612  1.00  0.90           O  
ATOM   9605  CB  ARG B 352      75.925   3.931  13.025  1.00  0.90           C  
ATOM   9606  CG  ARG B 352      75.294   5.120  12.279  1.00  0.90           C  
ATOM   9607  CD  ARG B 352      73.892   4.818  11.751  1.00  0.90           C  
ATOM   9608  NE  ARG B 352      72.969   4.721  12.918  1.00  0.90           N  
ATOM   9609  CZ  ARG B 352      72.307   5.731  13.483  1.00  0.90           C  
ATOM   9610  NH1 ARG B 352      72.476   6.993  13.095  1.00  0.90           N  
ATOM   9611  NH2 ARG B 352      71.454   5.470  14.467  1.00  0.90           N  
ATOM   9612  N   ILE B 353      76.557   4.854  15.920  1.00  0.92           N  
ATOM   9613  CA  ILE B 353      76.371   5.735  17.065  1.00  0.92           C  
ATOM   9614  C   ILE B 353      77.695   6.271  17.596  1.00  0.92           C  
ATOM   9615  O   ILE B 353      77.866   7.473  17.791  1.00  0.92           O  
ATOM   9616  CB  ILE B 353      75.587   5.056  18.191  1.00  0.92           C  
ATOM   9617  CG1 ILE B 353      74.159   4.685  17.720  1.00  0.92           C  
ATOM   9618  CG2 ILE B 353      75.523   6.003  19.412  1.00  0.92           C  
ATOM   9619  CD1 ILE B 353      73.383   3.818  18.722  1.00  0.92           C  
ATOM   9620  N   LEU B 354      78.702   5.405  17.802  1.00  0.89           N  
ATOM   9621  CA  LEU B 354      79.986   5.849  18.314  1.00  0.89           C  
ATOM   9622  C   LEU B 354      80.748   6.763  17.356  1.00  0.89           C  
ATOM   9623  O   LEU B 354      81.254   7.809  17.755  1.00  0.89           O  
ATOM   9624  CB  LEU B 354      80.880   4.644  18.706  1.00  0.89           C  
ATOM   9625  CG  LEU B 354      80.324   3.754  19.839  1.00  0.89           C  
ATOM   9626  CD1 LEU B 354      81.247   2.545  20.057  1.00  0.89           C  
ATOM   9627  CD2 LEU B 354      80.125   4.522  21.152  1.00  0.89           C  
ATOM   9628  N   VAL B 355      80.828   6.412  16.059  1.00  0.89           N  
ATOM   9629  CA  VAL B 355      81.592   7.188  15.091  1.00  0.89           C  
ATOM   9630  C   VAL B 355      80.879   8.451  14.632  1.00  0.89           C  
ATOM   9631  O   VAL B 355      81.424   9.553  14.703  1.00  0.89           O  
ATOM   9632  CB  VAL B 355      81.968   6.314  13.889  1.00  0.89           C  
ATOM   9633  CG1 VAL B 355      82.653   7.124  12.770  1.00  0.89           C  
ATOM   9634  CG2 VAL B 355      82.917   5.198  14.371  1.00  0.89           C  
ATOM   9635  N   ASP B 356      79.619   8.348  14.175  1.00  0.89           N  
ATOM   9636  CA  ASP B 356      78.931   9.479  13.583  1.00  0.89           C  
ATOM   9637  C   ASP B 356      78.325  10.426  14.612  1.00  0.89           C  
ATOM   9638  O   ASP B 356      78.309  11.645  14.425  1.00  0.89           O  
ATOM   9639  CB  ASP B 356      77.823   8.992  12.621  1.00  0.89           C  
ATOM   9640  CG  ASP B 356      78.394   8.163  11.489  1.00  0.89           C  
ATOM   9641  OD1 ASP B 356      79.551   8.372  11.048  1.00  0.89           O  
ATOM   9642  OD2 ASP B 356      77.645   7.279  10.997  1.00  0.89           O  
ATOM   9643  N   VAL B 357      77.770   9.887  15.717  1.00  0.87           N  
ATOM   9644  CA  VAL B 357      77.109  10.701  16.730  1.00  0.87           C  
ATOM   9645  C   VAL B 357      78.044  11.132  17.850  1.00  0.87           C  
ATOM   9646  O   VAL B 357      78.111  12.316  18.184  1.00  0.87           O  
ATOM   9647  CB  VAL B 357      75.865  10.000  17.271  1.00  0.87           C  
ATOM   9648  CG1 VAL B 357      75.173  10.825  18.371  1.00  0.87           C  
ATOM   9649  CG2 VAL B 357      74.884   9.754  16.107  1.00  0.87           C  
ATOM   9650  N   GLU B 358      78.832  10.210  18.439  1.00  0.79           N  
ATOM   9651  CA  GLU B 358      79.683  10.549  19.577  1.00  0.79           C  
ATOM   9652  C   GLU B 358      81.081  10.988  19.156  1.00  0.79           C  
ATOM   9653  O   GLU B 358      81.888  11.390  19.993  1.00  0.79           O  
ATOM   9654  CB  GLU B 358      79.835   9.341  20.536  1.00  0.79           C  
ATOM   9655  CG  GLU B 358      78.510   8.834  21.175  1.00  0.79           C  
ATOM   9656  CD  GLU B 358      77.862   9.662  22.287  1.00  0.79           C  
ATOM   9657  OE1 GLU B 358      78.506  10.472  22.998  1.00  0.79           O  
ATOM   9658  OE2 GLU B 358      76.653   9.419  22.560  1.00  0.79           O  
ATOM   9659  N   LYS B 359      81.394  10.947  17.840  1.00  0.80           N  
ATOM   9660  CA  LYS B 359      82.632  11.440  17.244  1.00  0.80           C  
ATOM   9661  C   LYS B 359      83.877  10.663  17.653  1.00  0.80           C  
ATOM   9662  O   LYS B 359      85.000  11.165  17.608  1.00  0.80           O  
ATOM   9663  CB  LYS B 359      82.858  12.958  17.495  1.00  0.80           C  
ATOM   9664  CG  LYS B 359      81.687  13.860  17.072  1.00  0.80           C  
ATOM   9665  CD  LYS B 359      81.941  15.332  17.439  1.00  0.80           C  
ATOM   9666  CE  LYS B 359      80.783  16.257  17.064  1.00  0.80           C  
ATOM   9667  NZ  LYS B 359      81.127  17.649  17.430  1.00  0.80           N  
ATOM   9668  N   VAL B 360      83.706   9.392  18.046  1.00  0.81           N  
ATOM   9669  CA  VAL B 360      84.791   8.485  18.359  1.00  0.81           C  
ATOM   9670  C   VAL B 360      85.485   8.070  17.073  1.00  0.81           C  
ATOM   9671  O   VAL B 360      84.847   7.871  16.039  1.00  0.81           O  
ATOM   9672  CB  VAL B 360      84.259   7.275  19.126  1.00  0.81           C  
ATOM   9673  CG1 VAL B 360      85.375   6.300  19.541  1.00  0.81           C  
ATOM   9674  CG2 VAL B 360      83.509   7.754  20.386  1.00  0.81           C  
ATOM   9675  N   ASP B 361      86.824   7.923  17.072  1.00  0.82           N  
ATOM   9676  CA  ASP B 361      87.525   7.394  15.927  1.00  0.82           C  
ATOM   9677  C   ASP B 361      87.132   5.945  15.631  1.00  0.82           C  
ATOM   9678  O   ASP B 361      86.672   5.204  16.502  1.00  0.82           O  
ATOM   9679  CB  ASP B 361      89.052   7.590  16.063  1.00  0.82           C  
ATOM   9680  CG  ASP B 361      89.601   6.661  17.127  1.00  0.82           C  
ATOM   9681  OD1 ASP B 361      89.597   7.071  18.316  1.00  0.82           O  
ATOM   9682  OD2 ASP B 361      89.940   5.501  16.771  1.00  0.82           O  
ATOM   9683  N   TRP B 362      87.272   5.502  14.369  1.00  0.84           N  
ATOM   9684  CA  TRP B 362      86.813   4.182  13.989  1.00  0.84           C  
ATOM   9685  C   TRP B 362      87.473   3.053  14.760  1.00  0.84           C  
ATOM   9686  O   TRP B 362      86.800   2.120  15.192  1.00  0.84           O  
ATOM   9687  CB  TRP B 362      87.040   3.945  12.468  1.00  0.84           C  
ATOM   9688  CG  TRP B 362      86.639   2.562  11.957  1.00  0.84           C  
ATOM   9689  CD1 TRP B 362      87.316   1.381  12.118  1.00  0.84           C  
ATOM   9690  CD2 TRP B 362      85.407   2.226  11.301  1.00  0.84           C  
ATOM   9691  NE1 TRP B 362      86.619   0.342  11.557  1.00  0.84           N  
ATOM   9692  CE2 TRP B 362      85.446   0.836  11.056  1.00  0.84           C  
ATOM   9693  CE3 TRP B 362      84.302   2.994  10.939  1.00  0.84           C  
ATOM   9694  CZ2 TRP B 362      84.396   0.193  10.433  1.00  0.84           C  
ATOM   9695  CZ3 TRP B 362      83.223   2.332  10.331  1.00  0.84           C  
ATOM   9696  CH2 TRP B 362      83.275   0.952  10.077  1.00  0.84           C  
ATOM   9697  N   ASP B 363      88.799   3.102  14.927  1.00  0.86           N  
ATOM   9698  CA  ASP B 363      89.547   1.989  15.456  1.00  0.86           C  
ATOM   9699  C   ASP B 363      89.238   1.784  16.937  1.00  0.86           C  
ATOM   9700  O   ASP B 363      88.909   0.677  17.365  1.00  0.86           O  
ATOM   9701  CB  ASP B 363      91.050   2.185  15.137  1.00  0.86           C  
ATOM   9702  CG  ASP B 363      91.295   2.262  13.634  1.00  0.86           C  
ATOM   9703  OD1 ASP B 363      90.510   1.665  12.845  1.00  0.86           O  
ATOM   9704  OD2 ASP B 363      92.271   2.926  13.218  1.00  0.86           O  
ATOM   9705  N   LYS B 364      89.197   2.877  17.727  1.00  0.81           N  
ATOM   9706  CA  LYS B 364      88.737   2.845  19.107  1.00  0.81           C  
ATOM   9707  C   LYS B 364      87.280   2.426  19.271  1.00  0.81           C  
ATOM   9708  O   LYS B 364      86.923   1.650  20.159  1.00  0.81           O  
ATOM   9709  CB  LYS B 364      88.927   4.235  19.746  1.00  0.81           C  
ATOM   9710  CG  LYS B 364      88.581   4.301  21.241  1.00  0.81           C  
ATOM   9711  CD  LYS B 364      88.832   5.706  21.806  1.00  0.81           C  
ATOM   9712  CE  LYS B 364      88.383   5.852  23.258  1.00  0.81           C  
ATOM   9713  NZ  LYS B 364      88.609   7.242  23.709  1.00  0.81           N  
ATOM   9714  N   ALA B 365      86.374   2.911  18.401  1.00  0.90           N  
ATOM   9715  CA  ALA B 365      84.993   2.475  18.389  1.00  0.90           C  
ATOM   9716  C   ALA B 365      84.837   0.991  18.081  1.00  0.90           C  
ATOM   9717  O   ALA B 365      84.028   0.291  18.686  1.00  0.90           O  
ATOM   9718  CB  ALA B 365      84.200   3.299  17.364  1.00  0.90           C  
ATOM   9719  N   TRP B 366      85.632   0.467  17.134  1.00  0.85           N  
ATOM   9720  CA  TRP B 366      85.667  -0.935  16.776  1.00  0.85           C  
ATOM   9721  C   TRP B 366      86.150  -1.834  17.902  1.00  0.85           C  
ATOM   9722  O   TRP B 366      85.572  -2.893  18.155  1.00  0.85           O  
ATOM   9723  CB  TRP B 366      86.505  -1.123  15.489  1.00  0.85           C  
ATOM   9724  CG  TRP B 366      86.460  -2.507  14.873  1.00  0.85           C  
ATOM   9725  CD1 TRP B 366      87.501  -3.354  14.617  1.00  0.85           C  
ATOM   9726  CD2 TRP B 366      85.265  -3.183  14.449  1.00  0.85           C  
ATOM   9727  NE1 TRP B 366      87.032  -4.520  14.051  1.00  0.85           N  
ATOM   9728  CE2 TRP B 366      85.659  -4.449  13.977  1.00  0.85           C  
ATOM   9729  CE3 TRP B 366      83.926  -2.804  14.437  1.00  0.85           C  
ATOM   9730  CZ2 TRP B 366      84.718  -5.360  13.532  1.00  0.85           C  
ATOM   9731  CZ3 TRP B 366      82.971  -3.721  13.979  1.00  0.85           C  
ATOM   9732  CH2 TRP B 366      83.362  -4.991  13.536  1.00  0.85           C  
ATOM   9733  N   GLU B 367      87.186  -1.407  18.651  1.00  0.85           N  
ATOM   9734  CA  GLU B 367      87.622  -2.084  19.858  1.00  0.85           C  
ATOM   9735  C   GLU B 367      86.539  -2.154  20.926  1.00  0.85           C  
ATOM   9736  O   GLU B 367      86.325  -3.200  21.537  1.00  0.85           O  
ATOM   9737  CB  GLU B 367      88.826  -1.369  20.506  1.00  0.85           C  
ATOM   9738  CG  GLU B 367      90.154  -1.448  19.722  1.00  0.85           C  
ATOM   9739  CD  GLU B 367      91.303  -0.822  20.514  1.00  0.85           C  
ATOM   9740  OE1 GLU B 367      91.069  -0.391  21.677  1.00  0.85           O  
ATOM   9741  OE2 GLU B 367      92.438  -0.839  19.981  1.00  0.85           O  
ATOM   9742  N   ILE B 368      85.800  -1.047  21.157  1.00  0.89           N  
ATOM   9743  CA  ILE B 368      84.649  -1.031  22.053  1.00  0.89           C  
ATOM   9744  C   ILE B 368      83.546  -1.966  21.575  1.00  0.89           C  
ATOM   9745  O   ILE B 368      83.041  -2.784  22.336  1.00  0.89           O  
ATOM   9746  CB  ILE B 368      84.093   0.390  22.204  1.00  0.89           C  
ATOM   9747  CG1 ILE B 368      85.099   1.305  22.942  1.00  0.89           C  
ATOM   9748  CG2 ILE B 368      82.722   0.397  22.923  1.00  0.89           C  
ATOM   9749  CD1 ILE B 368      84.751   2.795  22.823  1.00  0.89           C  
ATOM   9750  N   THR B 369      83.179  -1.913  20.280  1.00  0.92           N  
ATOM   9751  CA  THR B 369      82.135  -2.748  19.689  1.00  0.92           C  
ATOM   9752  C   THR B 369      82.418  -4.230  19.798  1.00  0.92           C  
ATOM   9753  O   THR B 369      81.562  -4.997  20.238  1.00  0.92           O  
ATOM   9754  CB  THR B 369      81.924  -2.392  18.222  1.00  0.92           C  
ATOM   9755  OG1 THR B 369      81.352  -1.094  18.138  1.00  0.92           O  
ATOM   9756  CG2 THR B 369      80.957  -3.341  17.502  1.00  0.92           C  
ATOM   9757  N   LYS B 370      83.652  -4.669  19.468  1.00  0.90           N  
ATOM   9758  CA  LYS B 370      84.051  -6.060  19.596  1.00  0.90           C  
ATOM   9759  C   LYS B 370      84.043  -6.574  21.020  1.00  0.90           C  
ATOM   9760  O   LYS B 370      83.664  -7.710  21.248  1.00  0.90           O  
ATOM   9761  CB  LYS B 370      85.438  -6.351  18.955  1.00  0.90           C  
ATOM   9762  CG  LYS B 370      85.418  -6.301  17.417  1.00  0.90           C  
ATOM   9763  CD  LYS B 370      86.774  -6.606  16.744  1.00  0.90           C  
ATOM   9764  CE  LYS B 370      87.251  -8.058  16.879  1.00  0.90           C  
ATOM   9765  NZ  LYS B 370      88.501  -8.286  16.104  1.00  0.90           N  
ATOM   9766  N   LYS B 371      84.462  -5.770  22.015  1.00  0.90           N  
ATOM   9767  CA  LYS B 371      84.495  -6.222  23.398  1.00  0.90           C  
ATOM   9768  C   LYS B 371      83.129  -6.189  24.083  1.00  0.90           C  
ATOM   9769  O   LYS B 371      82.921  -6.803  25.130  1.00  0.90           O  
ATOM   9770  CB  LYS B 371      85.479  -5.334  24.197  1.00  0.90           C  
ATOM   9771  CG  LYS B 371      86.956  -5.473  23.792  1.00  0.90           C  
ATOM   9772  CD  LYS B 371      87.845  -4.488  24.575  1.00  0.90           C  
ATOM   9773  CE  LYS B 371      89.316  -4.529  24.148  1.00  0.90           C  
ATOM   9774  NZ  LYS B 371      90.108  -3.547  24.923  1.00  0.90           N  
ATOM   9775  N   THR B 372      82.162  -5.452  23.512  1.00  0.94           N  
ATOM   9776  CA  THR B 372      80.787  -5.421  23.993  1.00  0.94           C  
ATOM   9777  C   THR B 372      79.970  -6.592  23.481  1.00  0.94           C  
ATOM   9778  O   THR B 372      79.162  -7.167  24.214  1.00  0.94           O  
ATOM   9779  CB  THR B 372      80.067  -4.135  23.598  1.00  0.94           C  
ATOM   9780  OG1 THR B 372      80.754  -3.010  24.125  1.00  0.94           O  
ATOM   9781  CG2 THR B 372      78.665  -4.066  24.208  1.00  0.94           C  
ATOM   9782  N   CYS B 373      80.122  -6.953  22.192  1.00  0.96           N  
ATOM   9783  CA  CYS B 373      79.221  -7.875  21.521  1.00  0.96           C  
ATOM   9784  C   CYS B 373      79.691  -9.320  21.496  1.00  0.96           C  
ATOM   9785  O   CYS B 373      80.856  -9.643  21.277  1.00  0.96           O  
ATOM   9786  CB  CYS B 373      78.917  -7.431  20.067  1.00  0.96           C  
ATOM   9787  SG  CYS B 373      78.089  -5.799  20.014  1.00  0.96           S  
ATOM   9788  N   ALA B 374      78.742 -10.250  21.690  1.00  0.98           N  
ATOM   9789  CA  ALA B 374      78.988 -11.667  21.575  1.00  0.98           C  
ATOM   9790  C   ALA B 374      77.848 -12.323  20.811  1.00  0.98           C  
ATOM   9791  O   ALA B 374      76.702 -11.883  20.875  1.00  0.98           O  
ATOM   9792  CB  ALA B 374      79.159 -12.299  22.964  1.00  0.98           C  
ATOM   9793  N   TYR B 375      78.135 -13.387  20.035  1.00  0.96           N  
ATOM   9794  CA  TYR B 375      77.176 -13.998  19.125  1.00  0.96           C  
ATOM   9795  C   TYR B 375      76.920 -15.466  19.432  1.00  0.96           C  
ATOM   9796  O   TYR B 375      77.833 -16.282  19.547  1.00  0.96           O  
ATOM   9797  CB  TYR B 375      77.678 -13.793  17.661  1.00  0.96           C  
ATOM   9798  CG  TYR B 375      77.088 -14.695  16.590  1.00  0.96           C  
ATOM   9799  CD1 TYR B 375      75.702 -14.837  16.396  1.00  0.96           C  
ATOM   9800  CD2 TYR B 375      77.962 -15.386  15.734  1.00  0.96           C  
ATOM   9801  CE1 TYR B 375      75.211 -15.715  15.416  1.00  0.96           C  
ATOM   9802  CE2 TYR B 375      77.474 -16.235  14.733  1.00  0.96           C  
ATOM   9803  CZ  TYR B 375      76.097 -16.413  14.588  1.00  0.96           C  
ATOM   9804  OH  TYR B 375      75.619 -17.287  13.593  1.00  0.96           O  
ATOM   9805  N   THR B 376      75.628 -15.834  19.507  1.00  0.97           N  
ATOM   9806  CA  THR B 376      75.198 -17.211  19.718  1.00  0.97           C  
ATOM   9807  C   THR B 376      74.626 -17.789  18.440  1.00  0.97           C  
ATOM   9808  O   THR B 376      73.640 -17.286  17.912  1.00  0.97           O  
ATOM   9809  CB  THR B 376      74.115 -17.343  20.785  1.00  0.97           C  
ATOM   9810  OG1 THR B 376      74.564 -16.784  22.011  1.00  0.97           O  
ATOM   9811  CG2 THR B 376      73.783 -18.820  21.048  1.00  0.97           C  
ATOM   9812  N   ASN B 377      75.210 -18.884  17.908  1.00  0.93           N  
ATOM   9813  CA  ASN B 377      74.696 -19.574  16.732  1.00  0.93           C  
ATOM   9814  C   ASN B 377      73.827 -20.765  17.128  1.00  0.93           C  
ATOM   9815  O   ASN B 377      74.223 -21.611  17.931  1.00  0.93           O  
ATOM   9816  CB  ASN B 377      75.879 -20.042  15.837  1.00  0.93           C  
ATOM   9817  CG  ASN B 377      75.451 -20.927  14.666  1.00  0.93           C  
ATOM   9818  OD1 ASN B 377      75.371 -22.145  14.813  1.00  0.93           O  
ATOM   9819  ND2 ASN B 377      75.127 -20.333  13.504  1.00  0.93           N  
ATOM   9820  N   HIS B 378      72.632 -20.882  16.513  1.00  0.90           N  
ATOM   9821  CA  HIS B 378      71.684 -21.927  16.865  1.00  0.90           C  
ATOM   9822  C   HIS B 378      71.415 -22.928  15.762  1.00  0.90           C  
ATOM   9823  O   HIS B 378      70.529 -23.764  15.905  1.00  0.90           O  
ATOM   9824  CB  HIS B 378      70.321 -21.299  17.209  1.00  0.90           C  
ATOM   9825  CG  HIS B 378      70.410 -20.299  18.311  1.00  0.90           C  
ATOM   9826  ND1 HIS B 378      70.114 -20.657  19.614  1.00  0.90           N  
ATOM   9827  CD2 HIS B 378      70.724 -18.983  18.240  1.00  0.90           C  
ATOM   9828  CE1 HIS B 378      70.248 -19.543  20.305  1.00  0.90           C  
ATOM   9829  NE2 HIS B 378      70.616 -18.503  19.522  1.00  0.90           N  
ATOM   9830  N   THR B 379      72.151 -22.890  14.636  1.00  0.87           N  
ATOM   9831  CA  THR B 379      71.883 -23.805  13.527  1.00  0.87           C  
ATOM   9832  C   THR B 379      73.004 -23.790  12.505  1.00  0.87           C  
ATOM   9833  O   THR B 379      73.678 -22.784  12.288  1.00  0.87           O  
ATOM   9834  CB  THR B 379      70.539 -23.555  12.824  1.00  0.87           C  
ATOM   9835  OG1 THR B 379      70.300 -24.448  11.737  1.00  0.87           O  
ATOM   9836  CG2 THR B 379      70.450 -22.111  12.309  1.00  0.87           C  
ATOM   9837  N   VAL B 380      73.217 -24.934  11.825  1.00  0.86           N  
ATOM   9838  CA  VAL B 380      74.189 -25.055  10.748  1.00  0.86           C  
ATOM   9839  C   VAL B 380      73.498 -25.185   9.401  1.00  0.86           C  
ATOM   9840  O   VAL B 380      74.145 -25.295   8.360  1.00  0.86           O  
ATOM   9841  CB  VAL B 380      75.116 -26.255  10.936  1.00  0.86           C  
ATOM   9842  CG1 VAL B 380      75.810 -26.164  12.306  1.00  0.86           C  
ATOM   9843  CG2 VAL B 380      74.347 -27.587  10.832  1.00  0.86           C  
ATOM   9844  N   LEU B 381      72.148 -25.189   9.381  1.00  0.81           N  
ATOM   9845  CA  LEU B 381      71.377 -25.465   8.185  1.00  0.81           C  
ATOM   9846  C   LEU B 381      71.349 -24.277   7.216  1.00  0.81           C  
ATOM   9847  O   LEU B 381      70.969 -23.186   7.645  1.00  0.81           O  
ATOM   9848  CB  LEU B 381      69.920 -25.876   8.515  1.00  0.81           C  
ATOM   9849  CG  LEU B 381      69.765 -27.187   9.317  1.00  0.81           C  
ATOM   9850  CD1 LEU B 381      68.279 -27.458   9.594  1.00  0.81           C  
ATOM   9851  CD2 LEU B 381      70.374 -28.391   8.584  1.00  0.81           C  
ATOM   9852  N   PRO B 382      71.713 -24.389   5.928  1.00  0.85           N  
ATOM   9853  CA  PRO B 382      71.912 -23.240   5.041  1.00  0.85           C  
ATOM   9854  C   PRO B 382      70.710 -22.349   4.852  1.00  0.85           C  
ATOM   9855  O   PRO B 382      70.871 -21.142   4.673  1.00  0.85           O  
ATOM   9856  CB  PRO B 382      72.325 -23.879   3.706  1.00  0.85           C  
ATOM   9857  CG  PRO B 382      73.059 -25.147   4.129  1.00  0.85           C  
ATOM   9858  CD  PRO B 382      72.239 -25.618   5.326  1.00  0.85           C  
ATOM   9859  N   GLU B 383      69.495 -22.914   4.879  1.00  0.82           N  
ATOM   9860  CA  GLU B 383      68.276 -22.166   4.692  1.00  0.82           C  
ATOM   9861  C   GLU B 383      67.875 -21.335   5.895  1.00  0.82           C  
ATOM   9862  O   GLU B 383      66.999 -20.481   5.802  1.00  0.82           O  
ATOM   9863  CB  GLU B 383      67.111 -23.107   4.308  1.00  0.82           C  
ATOM   9864  CG  GLU B 383      66.699 -24.152   5.384  1.00  0.82           C  
ATOM   9865  CD  GLU B 383      67.452 -25.482   5.323  1.00  0.82           C  
ATOM   9866  OE1 GLU B 383      68.525 -25.599   4.672  1.00  0.82           O  
ATOM   9867  OE2 GLU B 383      66.932 -26.477   5.892  1.00  0.82           O  
ATOM   9868  N   ALA B 384      68.511 -21.550   7.059  1.00  0.88           N  
ATOM   9869  CA  ALA B 384      68.185 -20.840   8.274  1.00  0.88           C  
ATOM   9870  C   ALA B 384      69.083 -19.646   8.533  1.00  0.88           C  
ATOM   9871  O   ALA B 384      68.844 -18.862   9.447  1.00  0.88           O  
ATOM   9872  CB  ALA B 384      68.354 -21.824   9.439  1.00  0.88           C  
ATOM   9873  N   LEU B 385      70.133 -19.470   7.717  1.00  0.87           N  
ATOM   9874  CA  LEU B 385      71.151 -18.468   7.954  1.00  0.87           C  
ATOM   9875  C   LEU B 385      70.839 -17.204   7.192  1.00  0.87           C  
ATOM   9876  O   LEU B 385      70.557 -17.213   5.992  1.00  0.87           O  
ATOM   9877  CB  LEU B 385      72.546 -18.959   7.494  1.00  0.87           C  
ATOM   9878  CG  LEU B 385      73.335 -19.845   8.487  1.00  0.87           C  
ATOM   9879  CD1 LEU B 385      72.469 -20.677   9.439  1.00  0.87           C  
ATOM   9880  CD2 LEU B 385      74.277 -20.768   7.704  1.00  0.87           C  
ATOM   9881  N   GLU B 386      70.904 -16.057   7.883  1.00  0.88           N  
ATOM   9882  CA  GLU B 386      70.574 -14.788   7.288  1.00  0.88           C  
ATOM   9883  C   GLU B 386      71.585 -14.224   6.317  1.00  0.88           C  
ATOM   9884  O   GLU B 386      72.759 -13.979   6.614  1.00  0.88           O  
ATOM   9885  CB  GLU B 386      70.257 -13.747   8.352  1.00  0.88           C  
ATOM   9886  CG  GLU B 386      69.142 -14.262   9.275  1.00  0.88           C  
ATOM   9887  CD  GLU B 386      68.569 -13.139  10.098  1.00  0.88           C  
ATOM   9888  OE1 GLU B 386      69.396 -12.482  10.781  1.00  0.88           O  
ATOM   9889  OE2 GLU B 386      67.323 -13.005  10.103  1.00  0.88           O  
ATOM   9890  N   ARG B 387      71.103 -13.993   5.089  1.00  0.83           N  
ATOM   9891  CA  ARG B 387      71.903 -13.512   3.995  1.00  0.83           C  
ATOM   9892  C   ARG B 387      71.081 -12.497   3.226  1.00  0.83           C  
ATOM   9893  O   ARG B 387      70.433 -12.790   2.212  1.00  0.83           O  
ATOM   9894  CB  ARG B 387      72.336 -14.649   3.053  1.00  0.83           C  
ATOM   9895  CG  ARG B 387      73.030 -15.846   3.734  1.00  0.83           C  
ATOM   9896  CD  ARG B 387      73.501 -16.879   2.715  1.00  0.83           C  
ATOM   9897  NE  ARG B 387      72.279 -17.348   1.985  1.00  0.83           N  
ATOM   9898  CZ  ARG B 387      72.273 -17.647   0.680  1.00  0.83           C  
ATOM   9899  NH1 ARG B 387      73.391 -17.729  -0.025  1.00  0.83           N  
ATOM   9900  NH2 ARG B 387      71.113 -17.884   0.067  1.00  0.83           N  
ATOM   9901  N   TRP B 388      71.065 -11.256   3.729  1.00  0.88           N  
ATOM   9902  CA  TRP B 388      70.241 -10.192   3.192  1.00  0.88           C  
ATOM   9903  C   TRP B 388      70.805  -9.634   1.891  1.00  0.88           C  
ATOM   9904  O   TRP B 388      71.981  -9.268   1.870  1.00  0.88           O  
ATOM   9905  CB  TRP B 388      70.076  -9.034   4.196  1.00  0.88           C  
ATOM   9906  CG  TRP B 388      69.328  -9.393   5.467  1.00  0.88           C  
ATOM   9907  CD1 TRP B 388      69.823  -9.640   6.716  1.00  0.88           C  
ATOM   9908  CD2 TRP B 388      67.901  -9.503   5.571  1.00  0.88           C  
ATOM   9909  NE1 TRP B 388      68.802  -9.935   7.588  1.00  0.88           N  
ATOM   9910  CE2 TRP B 388      67.614  -9.844   6.913  1.00  0.88           C  
ATOM   9911  CE3 TRP B 388      66.885  -9.330   4.638  1.00  0.88           C  
ATOM   9912  CZ2 TRP B 388      66.310 -10.026   7.338  1.00  0.88           C  
ATOM   9913  CZ3 TRP B 388      65.566  -9.501   5.075  1.00  0.88           C  
ATOM   9914  CH2 TRP B 388      65.280  -9.858   6.402  1.00  0.88           C  
ATOM   9915  N   PRO B 389      70.065  -9.570   0.780  1.00  0.93           N  
ATOM   9916  CA  PRO B 389      70.524  -8.909  -0.437  1.00  0.93           C  
ATOM   9917  C   PRO B 389      70.959  -7.464  -0.233  1.00  0.93           C  
ATOM   9918  O   PRO B 389      70.297  -6.717   0.488  1.00  0.93           O  
ATOM   9919  CB  PRO B 389      69.355  -9.067  -1.416  1.00  0.93           C  
ATOM   9920  CG  PRO B 389      68.121  -9.181  -0.525  1.00  0.93           C  
ATOM   9921  CD  PRO B 389      68.650  -9.949   0.683  1.00  0.93           C  
ATOM   9922  N   VAL B 390      72.080  -7.047  -0.852  1.00  0.91           N  
ATOM   9923  CA  VAL B 390      72.650  -5.717  -0.664  1.00  0.91           C  
ATOM   9924  C   VAL B 390      71.750  -4.579  -1.095  1.00  0.91           C  
ATOM   9925  O   VAL B 390      71.709  -3.548  -0.436  1.00  0.91           O  
ATOM   9926  CB  VAL B 390      74.023  -5.519  -1.300  1.00  0.91           C  
ATOM   9927  CG1 VAL B 390      75.027  -6.488  -0.657  1.00  0.91           C  
ATOM   9928  CG2 VAL B 390      73.983  -5.708  -2.826  1.00  0.91           C  
ATOM   9929  N   SER B 391      70.971  -4.749  -2.181  1.00  0.89           N  
ATOM   9930  CA  SER B 391      70.037  -3.750  -2.685  1.00  0.89           C  
ATOM   9931  C   SER B 391      68.949  -3.378  -1.692  1.00  0.89           C  
ATOM   9932  O   SER B 391      68.533  -2.226  -1.581  1.00  0.89           O  
ATOM   9933  CB  SER B 391      69.369  -4.224  -4.000  1.00  0.89           C  
ATOM   9934  OG  SER B 391      68.669  -5.462  -3.826  1.00  0.89           O  
ATOM   9935  N   MET B 392      68.467  -4.367  -0.916  1.00  0.88           N  
ATOM   9936  CA  MET B 392      67.546  -4.138   0.178  1.00  0.88           C  
ATOM   9937  C   MET B 392      68.152  -3.318   1.308  1.00  0.88           C  
ATOM   9938  O   MET B 392      67.580  -2.329   1.765  1.00  0.88           O  
ATOM   9939  CB  MET B 392      67.088  -5.503   0.742  1.00  0.88           C  
ATOM   9940  CG  MET B 392      65.933  -5.414   1.754  1.00  0.88           C  
ATOM   9941  SD  MET B 392      64.426  -4.684   1.056  1.00  0.88           S  
ATOM   9942  CE  MET B 392      63.932  -6.121   0.063  1.00  0.88           C  
ATOM   9943  N   PHE B 393      69.379  -3.679   1.748  1.00  0.91           N  
ATOM   9944  CA  PHE B 393      70.100  -2.937   2.768  1.00  0.91           C  
ATOM   9945  C   PHE B 393      70.442  -1.530   2.333  1.00  0.91           C  
ATOM   9946  O   PHE B 393      70.301  -0.590   3.103  1.00  0.91           O  
ATOM   9947  CB  PHE B 393      71.436  -3.630   3.162  1.00  0.91           C  
ATOM   9948  CG  PHE B 393      71.299  -4.567   4.324  1.00  0.91           C  
ATOM   9949  CD1 PHE B 393      70.558  -4.209   5.462  1.00  0.91           C  
ATOM   9950  CD2 PHE B 393      72.008  -5.781   4.333  1.00  0.91           C  
ATOM   9951  CE1 PHE B 393      70.503  -5.060   6.562  1.00  0.91           C  
ATOM   9952  CE2 PHE B 393      71.977  -6.614   5.458  1.00  0.91           C  
ATOM   9953  CZ  PHE B 393      71.192  -6.271   6.561  1.00  0.91           C  
ATOM   9954  N   GLU B 394      70.874  -1.359   1.078  1.00  0.87           N  
ATOM   9955  CA  GLU B 394      71.209  -0.086   0.475  1.00  0.87           C  
ATOM   9956  C   GLU B 394      70.051   0.882   0.445  1.00  0.87           C  
ATOM   9957  O   GLU B 394      70.177   2.049   0.811  1.00  0.87           O  
ATOM   9958  CB  GLU B 394      71.677  -0.377  -0.964  1.00  0.87           C  
ATOM   9959  CG  GLU B 394      72.088   0.848  -1.810  1.00  0.87           C  
ATOM   9960  CD  GLU B 394      73.073   0.431  -2.900  1.00  0.87           C  
ATOM   9961  OE1 GLU B 394      72.892  -0.677  -3.473  1.00  0.87           O  
ATOM   9962  OE2 GLU B 394      74.034   1.204  -3.143  1.00  0.87           O  
ATOM   9963  N   LYS B 395      68.857   0.404   0.058  1.00  0.86           N  
ATOM   9964  CA  LYS B 395      67.667   1.220   0.127  1.00  0.86           C  
ATOM   9965  C   LYS B 395      67.182   1.527   1.541  1.00  0.86           C  
ATOM   9966  O   LYS B 395      66.864   2.668   1.865  1.00  0.86           O  
ATOM   9967  CB  LYS B 395      66.532   0.528  -0.662  1.00  0.86           C  
ATOM   9968  CG  LYS B 395      65.278   1.398  -0.830  1.00  0.86           C  
ATOM   9969  CD  LYS B 395      64.235   0.742  -1.744  1.00  0.86           C  
ATOM   9970  CE  LYS B 395      62.986   1.606  -1.904  1.00  0.86           C  
ATOM   9971  NZ  LYS B 395      62.019   0.911  -2.777  1.00  0.86           N  
ATOM   9972  N   LEU B 396      67.093   0.512   2.423  1.00  0.91           N  
ATOM   9973  CA  LEU B 396      66.549   0.682   3.759  1.00  0.91           C  
ATOM   9974  C   LEU B 396      67.481   1.328   4.763  1.00  0.91           C  
ATOM   9975  O   LEU B 396      67.047   2.120   5.599  1.00  0.91           O  
ATOM   9976  CB  LEU B 396      66.072  -0.683   4.308  1.00  0.91           C  
ATOM   9977  CG  LEU B 396      65.292  -0.626   5.638  1.00  0.91           C  
ATOM   9978  CD1 LEU B 396      63.989   0.169   5.501  1.00  0.91           C  
ATOM   9979  CD2 LEU B 396      65.001  -2.042   6.141  1.00  0.91           C  
ATOM   9980  N   LEU B 397      68.780   0.997   4.720  1.00  0.92           N  
ATOM   9981  CA  LEU B 397      69.750   1.402   5.715  1.00  0.92           C  
ATOM   9982  C   LEU B 397      71.091   1.740   5.055  1.00  0.92           C  
ATOM   9983  O   LEU B 397      72.085   1.048   5.309  1.00  0.92           O  
ATOM   9984  CB  LEU B 397      69.994   0.264   6.746  1.00  0.92           C  
ATOM   9985  CG  LEU B 397      68.755  -0.265   7.493  1.00  0.92           C  
ATOM   9986  CD1 LEU B 397      69.130  -1.493   8.330  1.00  0.92           C  
ATOM   9987  CD2 LEU B 397      68.118   0.794   8.402  1.00  0.92           C  
ATOM   9988  N   PRO B 398      71.202   2.771   4.204  1.00  0.92           N  
ATOM   9989  CA  PRO B 398      72.384   3.022   3.367  1.00  0.92           C  
ATOM   9990  C   PRO B 398      73.662   3.192   4.161  1.00  0.92           C  
ATOM   9991  O   PRO B 398      74.705   2.664   3.784  1.00  0.92           O  
ATOM   9992  CB  PRO B 398      72.025   4.312   2.601  1.00  0.92           C  
ATOM   9993  CG  PRO B 398      70.951   4.990   3.458  1.00  0.92           C  
ATOM   9994  CD  PRO B 398      70.173   3.800   4.011  1.00  0.92           C  
ATOM   9995  N   ARG B 399      73.585   3.909   5.291  1.00  0.87           N  
ATOM   9996  CA  ARG B 399      74.681   4.124   6.206  1.00  0.87           C  
ATOM   9997  C   ARG B 399      75.222   2.848   6.823  1.00  0.87           C  
ATOM   9998  O   ARG B 399      76.426   2.612   6.867  1.00  0.87           O  
ATOM   9999  CB  ARG B 399      74.160   5.035   7.330  1.00  0.87           C  
ATOM  10000  CG  ARG B 399      75.148   5.289   8.477  1.00  0.87           C  
ATOM  10001  CD  ARG B 399      76.281   6.296   8.239  1.00  0.87           C  
ATOM  10002  NE  ARG B 399      77.396   5.731   7.405  1.00  0.87           N  
ATOM  10003  CZ  ARG B 399      78.694   5.875   7.722  1.00  0.87           C  
ATOM  10004  NH1 ARG B 399      79.121   6.295   8.910  1.00  0.87           N  
ATOM  10005  NH2 ARG B 399      79.582   5.669   6.747  1.00  0.87           N  
ATOM  10006  N   HIS B 400      74.338   1.949   7.290  1.00  0.93           N  
ATOM  10007  CA  HIS B 400      74.738   0.664   7.819  1.00  0.93           C  
ATOM  10008  C   HIS B 400      75.427  -0.191   6.786  1.00  0.93           C  
ATOM  10009  O   HIS B 400      76.405  -0.856   7.099  1.00  0.93           O  
ATOM  10010  CB  HIS B 400      73.551  -0.112   8.416  1.00  0.93           C  
ATOM  10011  CG  HIS B 400      72.980   0.598   9.599  1.00  0.93           C  
ATOM  10012  ND1 HIS B 400      72.101   1.653   9.422  1.00  0.93           N  
ATOM  10013  CD2 HIS B 400      73.263   0.433  10.914  1.00  0.93           C  
ATOM  10014  CE1 HIS B 400      71.858   2.096  10.639  1.00  0.93           C  
ATOM  10015  NE2 HIS B 400      72.545   1.400  11.569  1.00  0.93           N  
ATOM  10016  N   LEU B 401      74.980  -0.157   5.516  1.00  0.92           N  
ATOM  10017  CA  LEU B 401      75.668  -0.833   4.431  1.00  0.92           C  
ATOM  10018  C   LEU B 401      77.088  -0.302   4.198  1.00  0.92           C  
ATOM  10019  O   LEU B 401      78.039  -1.072   4.084  1.00  0.92           O  
ATOM  10020  CB  LEU B 401      74.836  -0.718   3.131  1.00  0.92           C  
ATOM  10021  CG  LEU B 401      74.881  -1.918   2.153  1.00  0.92           C  
ATOM  10022  CD1 LEU B 401      74.847  -1.397   0.714  1.00  0.92           C  
ATOM  10023  CD2 LEU B 401      76.064  -2.878   2.330  1.00  0.92           C  
ATOM  10024  N   GLU B 402      77.288   1.039   4.213  1.00  0.89           N  
ATOM  10025  CA  GLU B 402      78.613   1.652   4.146  1.00  0.89           C  
ATOM  10026  C   GLU B 402      79.527   1.183   5.280  1.00  0.89           C  
ATOM  10027  O   GLU B 402      80.685   0.820   5.076  1.00  0.89           O  
ATOM  10028  CB  GLU B 402      78.551   3.201   4.279  1.00  0.89           C  
ATOM  10029  CG  GLU B 402      77.873   3.987   3.129  1.00  0.89           C  
ATOM  10030  CD  GLU B 402      77.839   5.480   3.430  1.00  0.89           C  
ATOM  10031  OE1 GLU B 402      77.883   5.834   4.644  1.00  0.89           O  
ATOM  10032  OE2 GLU B 402      77.810   6.289   2.471  1.00  0.89           O  
ATOM  10033  N   ILE B 403      78.997   1.140   6.519  1.00  0.93           N  
ATOM  10034  CA  ILE B 403      79.689   0.626   7.691  1.00  0.93           C  
ATOM  10035  C   ILE B 403      80.014  -0.858   7.567  1.00  0.93           C  
ATOM  10036  O   ILE B 403      81.135  -1.272   7.846  1.00  0.93           O  
ATOM  10037  CB  ILE B 403      78.892   0.929   8.959  1.00  0.93           C  
ATOM  10038  CG1 ILE B 403      78.814   2.460   9.171  1.00  0.93           C  
ATOM  10039  CG2 ILE B 403      79.508   0.248  10.202  1.00  0.93           C  
ATOM  10040  CD1 ILE B 403      77.911   2.872  10.335  1.00  0.93           C  
ATOM  10041  N   ILE B 404      79.074  -1.698   7.084  1.00  0.93           N  
ATOM  10042  CA  ILE B 404      79.293  -3.116   6.804  1.00  0.93           C  
ATOM  10043  C   ILE B 404      80.390  -3.328   5.764  1.00  0.93           C  
ATOM  10044  O   ILE B 404      81.276  -4.168   5.934  1.00  0.93           O  
ATOM  10045  CB  ILE B 404      77.994  -3.797   6.354  1.00  0.93           C  
ATOM  10046  CG1 ILE B 404      76.983  -3.901   7.521  1.00  0.93           C  
ATOM  10047  CG2 ILE B 404      78.259  -5.205   5.779  1.00  0.93           C  
ATOM  10048  CD1 ILE B 404      75.551  -4.193   7.047  1.00  0.93           C  
ATOM  10049  N   TYR B 405      80.398  -2.533   4.674  1.00  0.92           N  
ATOM  10050  CA  TYR B 405      81.458  -2.549   3.681  1.00  0.92           C  
ATOM  10051  C   TYR B 405      82.824  -2.167   4.244  1.00  0.92           C  
ATOM  10052  O   TYR B 405      83.825  -2.832   3.971  1.00  0.92           O  
ATOM  10053  CB  TYR B 405      81.120  -1.612   2.486  1.00  0.92           C  
ATOM  10054  CG  TYR B 405      80.091  -2.160   1.521  1.00  0.92           C  
ATOM  10055  CD1 TYR B 405      80.013  -3.521   1.171  1.00  0.92           C  
ATOM  10056  CD2 TYR B 405      79.247  -1.255   0.855  1.00  0.92           C  
ATOM  10057  CE1 TYR B 405      79.122  -3.962   0.178  1.00  0.92           C  
ATOM  10058  CE2 TYR B 405      78.362  -1.690  -0.142  1.00  0.92           C  
ATOM  10059  CZ  TYR B 405      78.297  -3.046  -0.478  1.00  0.92           C  
ATOM  10060  OH  TYR B 405      77.403  -3.492  -1.475  1.00  0.92           O  
ATOM  10061  N   ALA B 406      82.898  -1.120   5.090  1.00  0.93           N  
ATOM  10062  CA  ALA B 406      84.114  -0.751   5.786  1.00  0.93           C  
ATOM  10063  C   ALA B 406      84.618  -1.819   6.747  1.00  0.93           C  
ATOM  10064  O   ALA B 406      85.800  -2.152   6.735  1.00  0.93           O  
ATOM  10065  CB  ALA B 406      83.895   0.568   6.544  1.00  0.93           C  
ATOM  10066  N   ILE B 407      83.723  -2.439   7.551  1.00  0.92           N  
ATOM  10067  CA  ILE B 407      84.041  -3.556   8.443  1.00  0.92           C  
ATOM  10068  C   ILE B 407      84.611  -4.730   7.666  1.00  0.92           C  
ATOM  10069  O   ILE B 407      85.617  -5.325   8.055  1.00  0.92           O  
ATOM  10070  CB  ILE B 407      82.804  -4.027   9.224  1.00  0.92           C  
ATOM  10071  CG1 ILE B 407      82.360  -2.969  10.259  1.00  0.92           C  
ATOM  10072  CG2 ILE B 407      83.067  -5.372   9.938  1.00  0.92           C  
ATOM  10073  CD1 ILE B 407      81.008  -3.289  10.914  1.00  0.92           C  
ATOM  10074  N   ASN B 408      84.001  -5.059   6.508  1.00  0.90           N  
ATOM  10075  CA  ASN B 408      84.474  -6.107   5.630  1.00  0.90           C  
ATOM  10076  C   ASN B 408      85.873  -5.873   5.105  1.00  0.90           C  
ATOM  10077  O   ASN B 408      86.697  -6.774   5.167  1.00  0.90           O  
ATOM  10078  CB  ASN B 408      83.523  -6.244   4.422  1.00  0.90           C  
ATOM  10079  CG  ASN B 408      83.811  -7.538   3.671  1.00  0.90           C  
ATOM  10080  OD1 ASN B 408      83.921  -8.604   4.272  1.00  0.90           O  
ATOM  10081  ND2 ASN B 408      83.943  -7.455   2.332  1.00  0.90           N  
ATOM  10082  N   GLN B 409      86.189  -4.656   4.617  1.00  0.86           N  
ATOM  10083  CA  GLN B 409      87.523  -4.333   4.141  1.00  0.86           C  
ATOM  10084  C   GLN B 409      88.571  -4.469   5.236  1.00  0.86           C  
ATOM  10085  O   GLN B 409      89.561  -5.167   5.067  1.00  0.86           O  
ATOM  10086  CB  GLN B 409      87.531  -2.902   3.554  1.00  0.86           C  
ATOM  10087  CG  GLN B 409      88.900  -2.447   2.990  1.00  0.86           C  
ATOM  10088  CD  GLN B 409      88.828  -0.998   2.511  1.00  0.86           C  
ATOM  10089  OE1 GLN B 409      88.136  -0.651   1.555  1.00  0.86           O  
ATOM  10090  NE2 GLN B 409      89.547  -0.096   3.220  1.00  0.86           N  
ATOM  10091  N   ARG B 410      88.309  -3.912   6.442  1.00  0.82           N  
ATOM  10092  CA  ARG B 410      89.222  -4.035   7.572  1.00  0.82           C  
ATOM  10093  C   ARG B 410      89.465  -5.490   7.984  1.00  0.82           C  
ATOM  10094  O   ARG B 410      90.584  -5.908   8.276  1.00  0.82           O  
ATOM  10095  CB  ARG B 410      88.681  -3.289   8.825  1.00  0.82           C  
ATOM  10096  CG  ARG B 410      88.402  -1.777   8.674  1.00  0.82           C  
ATOM  10097  CD  ARG B 410      89.575  -0.920   8.197  1.00  0.82           C  
ATOM  10098  NE  ARG B 410      89.135   0.511   8.360  1.00  0.82           N  
ATOM  10099  CZ  ARG B 410      89.436   1.262   9.431  1.00  0.82           C  
ATOM  10100  NH1 ARG B 410      90.181   0.792  10.423  1.00  0.82           N  
ATOM  10101  NH2 ARG B 410      88.976   2.505   9.518  1.00  0.82           N  
ATOM  10102  N   HIS B 411      88.397  -6.308   8.007  1.00  0.87           N  
ATOM  10103  CA  HIS B 411      88.493  -7.737   8.242  1.00  0.87           C  
ATOM  10104  C   HIS B 411      89.245  -8.503   7.163  1.00  0.87           C  
ATOM  10105  O   HIS B 411      90.128  -9.304   7.455  1.00  0.87           O  
ATOM  10106  CB  HIS B 411      87.062  -8.299   8.363  1.00  0.87           C  
ATOM  10107  CG  HIS B 411      86.948  -9.789   8.331  1.00  0.87           C  
ATOM  10108  ND1 HIS B 411      87.501 -10.557   9.335  1.00  0.87           N  
ATOM  10109  CD2 HIS B 411      86.357 -10.579   7.399  1.00  0.87           C  
ATOM  10110  CE1 HIS B 411      87.229 -11.803   8.997  1.00  0.87           C  
ATOM  10111  NE2 HIS B 411      86.539 -11.872   7.831  1.00  0.87           N  
ATOM  10112  N   LEU B 412      88.949  -8.258   5.877  1.00  0.87           N  
ATOM  10113  CA  LEU B 412      89.599  -8.912   4.755  1.00  0.87           C  
ATOM  10114  C   LEU B 412      91.083  -8.611   4.654  1.00  0.87           C  
ATOM  10115  O   LEU B 412      91.873  -9.510   4.373  1.00  0.87           O  
ATOM  10116  CB  LEU B 412      88.855  -8.593   3.431  1.00  0.87           C  
ATOM  10117  CG  LEU B 412      88.086  -9.765   2.775  1.00  0.87           C  
ATOM  10118  CD1 LEU B 412      87.363 -10.699   3.758  1.00  0.87           C  
ATOM  10119  CD2 LEU B 412      87.066  -9.210   1.772  1.00  0.87           C  
ATOM  10120  N   ASP B 413      91.506  -7.367   4.958  1.00  0.87           N  
ATOM  10121  CA  ASP B 413      92.903  -6.992   5.099  1.00  0.87           C  
ATOM  10122  C   ASP B 413      93.608  -7.820   6.187  1.00  0.87           C  
ATOM  10123  O   ASP B 413      94.714  -8.324   5.999  1.00  0.87           O  
ATOM  10124  CB  ASP B 413      93.017  -5.480   5.442  1.00  0.87           C  
ATOM  10125  CG  ASP B 413      92.522  -4.576   4.319  1.00  0.87           C  
ATOM  10126  OD1 ASP B 413      92.467  -5.036   3.152  1.00  0.87           O  
ATOM  10127  OD2 ASP B 413      92.218  -3.391   4.632  1.00  0.87           O  
ATOM  10128  N   HIS B 414      92.948  -8.048   7.346  1.00  0.83           N  
ATOM  10129  CA  HIS B 414      93.430  -8.965   8.375  1.00  0.83           C  
ATOM  10130  C   HIS B 414      93.503 -10.426   7.919  1.00  0.83           C  
ATOM  10131  O   HIS B 414      94.482 -11.126   8.165  1.00  0.83           O  
ATOM  10132  CB  HIS B 414      92.569  -8.848   9.656  1.00  0.83           C  
ATOM  10133  CG  HIS B 414      93.121  -9.555  10.859  1.00  0.83           C  
ATOM  10134  ND1 HIS B 414      94.282  -9.089  11.442  1.00  0.83           N  
ATOM  10135  CD2 HIS B 414      92.664 -10.644  11.531  1.00  0.83           C  
ATOM  10136  CE1 HIS B 414      94.511  -9.902  12.453  1.00  0.83           C  
ATOM  10137  NE2 HIS B 414      93.561 -10.864  12.554  1.00  0.83           N  
ATOM  10138  N   VAL B 415      92.492 -10.931   7.177  1.00  0.86           N  
ATOM  10139  CA  VAL B 415      92.528 -12.263   6.570  1.00  0.86           C  
ATOM  10140  C   VAL B 415      93.690 -12.417   5.592  1.00  0.86           C  
ATOM  10141  O   VAL B 415      94.421 -13.405   5.623  1.00  0.86           O  
ATOM  10142  CB  VAL B 415      91.231 -12.609   5.830  1.00  0.86           C  
ATOM  10143  CG1 VAL B 415      91.317 -14.008   5.183  1.00  0.86           C  
ATOM  10144  CG2 VAL B 415      90.037 -12.603   6.798  1.00  0.86           C  
ATOM  10145  N   ALA B 416      93.916 -11.408   4.729  1.00  0.87           N  
ATOM  10146  CA  ALA B 416      95.019 -11.351   3.793  1.00  0.87           C  
ATOM  10147  C   ALA B 416      96.386 -11.329   4.462  1.00  0.87           C  
ATOM  10148  O   ALA B 416      97.325 -11.976   4.008  1.00  0.87           O  
ATOM  10149  CB  ALA B 416      94.852 -10.108   2.901  1.00  0.87           C  
ATOM  10150  N   ALA B 417      96.523 -10.586   5.574  1.00  0.87           N  
ATOM  10151  CA  ALA B 417      97.722 -10.570   6.379  1.00  0.87           C  
ATOM  10152  C   ALA B 417      98.061 -11.903   7.037  1.00  0.87           C  
ATOM  10153  O   ALA B 417      99.210 -12.336   7.042  1.00  0.87           O  
ATOM  10154  CB  ALA B 417      97.558  -9.492   7.463  1.00  0.87           C  
ATOM  10155  N   LEU B 418      97.057 -12.590   7.614  1.00  0.86           N  
ATOM  10156  CA  LEU B 418      97.250 -13.883   8.246  1.00  0.86           C  
ATOM  10157  C   LEU B 418      97.478 -15.015   7.252  1.00  0.86           C  
ATOM  10158  O   LEU B 418      98.259 -15.929   7.509  1.00  0.86           O  
ATOM  10159  CB  LEU B 418      96.063 -14.225   9.187  1.00  0.86           C  
ATOM  10160  CG  LEU B 418      96.172 -13.686  10.636  1.00  0.86           C  
ATOM  10161  CD1 LEU B 418      97.318 -14.349  11.406  1.00  0.86           C  
ATOM  10162  CD2 LEU B 418      96.289 -12.161  10.720  1.00  0.86           C  
ATOM  10163  N   PHE B 419      96.803 -14.990   6.086  1.00  0.86           N  
ATOM  10164  CA  PHE B 419      96.943 -16.026   5.074  1.00  0.86           C  
ATOM  10165  C   PHE B 419      97.390 -15.428   3.737  1.00  0.86           C  
ATOM  10166  O   PHE B 419      96.602 -15.407   2.784  1.00  0.86           O  
ATOM  10167  CB  PHE B 419      95.613 -16.805   4.878  1.00  0.86           C  
ATOM  10168  CG  PHE B 419      95.125 -17.417   6.171  1.00  0.86           C  
ATOM  10169  CD1 PHE B 419      94.325 -16.667   7.053  1.00  0.86           C  
ATOM  10170  CD2 PHE B 419      95.429 -18.748   6.506  1.00  0.86           C  
ATOM  10171  CE1 PHE B 419      93.868 -17.218   8.256  1.00  0.86           C  
ATOM  10172  CE2 PHE B 419      94.973 -19.305   7.710  1.00  0.86           C  
ATOM  10173  CZ  PHE B 419      94.199 -18.536   8.589  1.00  0.86           C  
ATOM  10174  N   PRO B 420      98.619 -14.916   3.597  1.00  0.88           N  
ATOM  10175  CA  PRO B 420      99.101 -14.288   2.370  1.00  0.88           C  
ATOM  10176  C   PRO B 420      99.014 -15.172   1.138  1.00  0.88           C  
ATOM  10177  O   PRO B 420      99.554 -16.275   1.112  1.00  0.88           O  
ATOM  10178  CB  PRO B 420     100.543 -13.869   2.703  1.00  0.88           C  
ATOM  10179  CG  PRO B 420     100.974 -14.862   3.782  1.00  0.88           C  
ATOM  10180  CD  PRO B 420      99.692 -15.030   4.592  1.00  0.88           C  
ATOM  10181  N   GLY B 421      98.342 -14.682   0.080  1.00  0.87           N  
ATOM  10182  CA  GLY B 421      98.170 -15.420  -1.166  1.00  0.87           C  
ATOM  10183  C   GLY B 421      97.011 -16.387  -1.211  1.00  0.87           C  
ATOM  10184  O   GLY B 421      96.769 -16.996  -2.251  1.00  0.87           O  
ATOM  10185  N   ASP B 422      96.224 -16.542  -0.125  1.00  0.86           N  
ATOM  10186  CA  ASP B 422      95.063 -17.423  -0.122  1.00  0.86           C  
ATOM  10187  C   ASP B 422      93.847 -16.735  -0.756  1.00  0.86           C  
ATOM  10188  O   ASP B 422      92.985 -16.158  -0.097  1.00  0.86           O  
ATOM  10189  CB  ASP B 422      94.785 -17.943   1.315  1.00  0.86           C  
ATOM  10190  CG  ASP B 422      93.884 -19.171   1.358  1.00  0.86           C  
ATOM  10191  OD1 ASP B 422      93.138 -19.422   0.373  1.00  0.86           O  
ATOM  10192  OD2 ASP B 422      93.864 -19.840   2.427  1.00  0.86           O  
ATOM  10193  N   VAL B 423      93.778 -16.776  -2.103  1.00  0.81           N  
ATOM  10194  CA  VAL B 423      92.762 -16.115  -2.916  1.00  0.81           C  
ATOM  10195  C   VAL B 423      91.334 -16.569  -2.629  1.00  0.81           C  
ATOM  10196  O   VAL B 423      90.424 -15.751  -2.485  1.00  0.81           O  
ATOM  10197  CB  VAL B 423      93.059 -16.316  -4.407  1.00  0.81           C  
ATOM  10198  CG1 VAL B 423      91.964 -15.692  -5.298  1.00  0.81           C  
ATOM  10199  CG2 VAL B 423      94.419 -15.685  -4.761  1.00  0.81           C  
ATOM  10200  N   ASP B 424      91.082 -17.891  -2.514  1.00  0.86           N  
ATOM  10201  CA  ASP B 424      89.745 -18.396  -2.243  1.00  0.86           C  
ATOM  10202  C   ASP B 424      89.271 -18.054  -0.837  1.00  0.86           C  
ATOM  10203  O   ASP B 424      88.097 -17.792  -0.597  1.00  0.86           O  
ATOM  10204  CB  ASP B 424      89.643 -19.918  -2.524  1.00  0.86           C  
ATOM  10205  CG  ASP B 424      88.191 -20.365  -2.511  1.00  0.86           C  
ATOM  10206  OD1 ASP B 424      87.433 -19.930  -3.412  1.00  0.86           O  
ATOM  10207  OD2 ASP B 424      87.767 -21.106  -1.587  1.00  0.86           O  
ATOM  10208  N   ARG B 425      90.182 -18.001   0.141  1.00  0.82           N  
ATOM  10209  CA  ARG B 425      89.848 -17.623   1.494  1.00  0.82           C  
ATOM  10210  C   ARG B 425      89.282 -16.223   1.658  1.00  0.82           C  
ATOM  10211  O   ARG B 425      88.349 -16.014   2.433  1.00  0.82           O  
ATOM  10212  CB  ARG B 425      91.099 -17.773   2.342  1.00  0.82           C  
ATOM  10213  CG  ARG B 425      90.853 -17.739   3.845  1.00  0.82           C  
ATOM  10214  CD  ARG B 425      92.140 -18.032   4.596  1.00  0.82           C  
ATOM  10215  NE  ARG B 425      91.732 -18.535   5.930  1.00  0.82           N  
ATOM  10216  CZ  ARG B 425      91.810 -19.819   6.287  1.00  0.82           C  
ATOM  10217  NH1 ARG B 425      92.382 -20.752   5.533  1.00  0.82           N  
ATOM  10218  NH2 ARG B 425      91.316 -20.173   7.463  1.00  0.82           N  
ATOM  10219  N   LEU B 426      89.782 -15.226   0.890  1.00  0.86           N  
ATOM  10220  CA  LEU B 426      89.154 -13.912   0.834  1.00  0.86           C  
ATOM  10221  C   LEU B 426      87.707 -13.984   0.343  1.00  0.86           C  
ATOM  10222  O   LEU B 426      86.829 -13.313   0.873  1.00  0.86           O  
ATOM  10223  CB  LEU B 426      89.907 -12.911  -0.095  1.00  0.86           C  
ATOM  10224  CG  LEU B 426      91.197 -12.232   0.434  1.00  0.86           C  
ATOM  10225  CD1 LEU B 426      91.275 -12.140   1.961  1.00  0.86           C  
ATOM  10226  CD2 LEU B 426      92.471 -12.880  -0.114  1.00  0.86           C  
ATOM  10227  N   ARG B 427      87.415 -14.831  -0.666  1.00  0.81           N  
ATOM  10228  CA  ARG B 427      86.058 -15.089  -1.122  1.00  0.81           C  
ATOM  10229  C   ARG B 427      85.170 -15.756  -0.071  1.00  0.81           C  
ATOM  10230  O   ARG B 427      84.021 -15.369   0.122  1.00  0.81           O  
ATOM  10231  CB  ARG B 427      86.105 -15.973  -2.393  1.00  0.81           C  
ATOM  10232  CG  ARG B 427      84.747 -16.230  -3.079  1.00  0.81           C  
ATOM  10233  CD  ARG B 427      84.828 -17.291  -4.184  1.00  0.81           C  
ATOM  10234  NE  ARG B 427      85.175 -18.602  -3.552  1.00  0.81           N  
ATOM  10235  CZ  ARG B 427      84.345 -19.443  -2.931  1.00  0.81           C  
ATOM  10236  NH1 ARG B 427      83.052 -19.184  -2.779  1.00  0.81           N  
ATOM  10237  NH2 ARG B 427      84.857 -20.573  -2.455  1.00  0.81           N  
ATOM  10238  N   ARG B 428      85.676 -16.784   0.637  1.00  0.83           N  
ATOM  10239  CA  ARG B 428      84.925 -17.495   1.662  1.00  0.83           C  
ATOM  10240  C   ARG B 428      84.609 -16.704   2.924  1.00  0.83           C  
ATOM  10241  O   ARG B 428      83.517 -16.822   3.479  1.00  0.83           O  
ATOM  10242  CB  ARG B 428      85.638 -18.801   2.079  1.00  0.83           C  
ATOM  10243  CG  ARG B 428      85.876 -19.783   0.919  1.00  0.83           C  
ATOM  10244  CD  ARG B 428      86.228 -21.207   1.372  1.00  0.83           C  
ATOM  10245  NE  ARG B 428      87.392 -21.165   2.314  1.00  0.83           N  
ATOM  10246  CZ  ARG B 428      88.675 -21.321   1.969  1.00  0.83           C  
ATOM  10247  NH1 ARG B 428      89.067 -21.476   0.708  1.00  0.83           N  
ATOM  10248  NH2 ARG B 428      89.608 -21.324   2.920  1.00  0.83           N  
ATOM  10249  N   MET B 429      85.561 -15.890   3.421  1.00  0.88           N  
ATOM  10250  CA  MET B 429      85.411 -15.200   4.693  1.00  0.88           C  
ATOM  10251  C   MET B 429      84.884 -13.787   4.559  1.00  0.88           C  
ATOM  10252  O   MET B 429      84.740 -13.074   5.555  1.00  0.88           O  
ATOM  10253  CB  MET B 429      86.776 -15.088   5.415  1.00  0.88           C  
ATOM  10254  CG  MET B 429      87.429 -16.440   5.728  1.00  0.88           C  
ATOM  10255  SD  MET B 429      88.973 -16.290   6.681  1.00  0.88           S  
ATOM  10256  CE  MET B 429      88.157 -15.897   8.245  1.00  0.88           C  
ATOM  10257  N   SER B 430      84.600 -13.341   3.327  1.00  0.91           N  
ATOM  10258  CA  SER B 430      83.990 -12.048   3.068  1.00  0.91           C  
ATOM  10259  C   SER B 430      82.594 -11.927   3.642  1.00  0.91           C  
ATOM  10260  O   SER B 430      81.766 -12.821   3.515  1.00  0.91           O  
ATOM  10261  CB  SER B 430      83.905 -11.761   1.549  1.00  0.91           C  
ATOM  10262  OG  SER B 430      83.429 -10.443   1.247  1.00  0.91           O  
ATOM  10263  N   VAL B 431      82.255 -10.761   4.223  1.00  0.93           N  
ATOM  10264  CA  VAL B 431      80.903 -10.481   4.676  1.00  0.93           C  
ATOM  10265  C   VAL B 431      79.969 -10.319   3.492  1.00  0.93           C  
ATOM  10266  O   VAL B 431      78.756 -10.469   3.596  1.00  0.93           O  
ATOM  10267  CB  VAL B 431      80.854  -9.234   5.564  1.00  0.93           C  
ATOM  10268  CG1 VAL B 431      80.476  -7.938   4.817  1.00  0.93           C  
ATOM  10269  CG2 VAL B 431      79.850  -9.462   6.696  1.00  0.93           C  
ATOM  10270  N   ILE B 432      80.547 -10.009   2.317  1.00  0.90           N  
ATOM  10271  CA  ILE B 432      79.836  -9.864   1.070  1.00  0.90           C  
ATOM  10272  C   ILE B 432      79.842 -11.196   0.338  1.00  0.90           C  
ATOM  10273  O   ILE B 432      80.894 -11.733  -0.011  1.00  0.90           O  
ATOM  10274  CB  ILE B 432      80.475  -8.810   0.167  1.00  0.90           C  
ATOM  10275  CG1 ILE B 432      80.687  -7.452   0.876  1.00  0.90           C  
ATOM  10276  CG2 ILE B 432      79.634  -8.640  -1.111  1.00  0.90           C  
ATOM  10277  CD1 ILE B 432      81.610  -6.508   0.091  1.00  0.90           C  
ATOM  10278  N   GLU B 433      78.647 -11.743   0.065  1.00  0.84           N  
ATOM  10279  CA  GLU B 433      78.478 -12.955  -0.704  1.00  0.84           C  
ATOM  10280  C   GLU B 433      78.054 -12.620  -2.124  1.00  0.84           C  
ATOM  10281  O   GLU B 433      77.036 -11.965  -2.357  1.00  0.84           O  
ATOM  10282  CB  GLU B 433      77.414 -13.877  -0.054  1.00  0.84           C  
ATOM  10283  CG  GLU B 433      77.140 -15.184  -0.842  1.00  0.84           C  
ATOM  10284  CD  GLU B 433      75.853 -15.873  -0.436  1.00  0.84           C  
ATOM  10285  OE1 GLU B 433      75.830 -16.584   0.602  1.00  0.84           O  
ATOM  10286  OE2 GLU B 433      74.834 -15.746  -1.167  1.00  0.84           O  
ATOM  10287  N   GLU B 434      78.834 -13.089  -3.114  1.00  0.78           N  
ATOM  10288  CA  GLU B 434      78.481 -13.023  -4.516  1.00  0.78           C  
ATOM  10289  C   GLU B 434      77.697 -14.265  -4.934  1.00  0.78           C  
ATOM  10290  O   GLU B 434      77.685 -15.286  -4.247  1.00  0.78           O  
ATOM  10291  CB  GLU B 434      79.738 -12.942  -5.413  1.00  0.78           C  
ATOM  10292  CG  GLU B 434      80.753 -11.831  -5.033  1.00  0.78           C  
ATOM  10293  CD  GLU B 434      80.211 -10.401  -5.095  1.00  0.78           C  
ATOM  10294  OE1 GLU B 434      79.532 -10.041  -6.091  1.00  0.78           O  
ATOM  10295  OE2 GLU B 434      80.504  -9.624  -4.148  1.00  0.78           O  
ATOM  10296  N   GLY B 435      77.040 -14.236  -6.106  1.00  0.73           N  
ATOM  10297  CA  GLY B 435      76.224 -15.347  -6.583  1.00  0.73           C  
ATOM  10298  C   GLY B 435      75.131 -14.809  -7.449  1.00  0.73           C  
ATOM  10299  O   GLY B 435      75.286 -13.748  -8.046  1.00  0.73           O  
ATOM  10300  N   ASP B 436      73.975 -15.500  -7.509  1.00  0.66           N  
ATOM  10301  CA  ASP B 436      72.784 -15.071  -8.229  1.00  0.66           C  
ATOM  10302  C   ASP B 436      72.266 -13.720  -7.741  1.00  0.66           C  
ATOM  10303  O   ASP B 436      71.788 -12.874  -8.493  1.00  0.66           O  
ATOM  10304  CB  ASP B 436      71.654 -16.105  -8.010  1.00  0.66           C  
ATOM  10305  CG  ASP B 436      72.013 -17.478  -8.551  1.00  0.66           C  
ATOM  10306  OD1 ASP B 436      73.006 -17.599  -9.307  1.00  0.66           O  
ATOM  10307  OD2 ASP B 436      71.293 -18.428  -8.156  1.00  0.66           O  
ATOM  10308  N   CYS B 437      72.367 -13.493  -6.419  1.00  0.82           N  
ATOM  10309  CA  CYS B 437      72.046 -12.226  -5.813  1.00  0.82           C  
ATOM  10310  C   CYS B 437      73.139 -11.897  -4.830  1.00  0.82           C  
ATOM  10311  O   CYS B 437      73.501 -12.738  -4.013  1.00  0.82           O  
ATOM  10312  CB  CYS B 437      70.697 -12.278  -5.060  1.00  0.82           C  
ATOM  10313  SG  CYS B 437      70.129 -10.617  -4.552  1.00  0.82           S  
ATOM  10314  N   LYS B 438      73.681 -10.669  -4.887  1.00  0.83           N  
ATOM  10315  CA  LYS B 438      74.705 -10.206  -3.976  1.00  0.83           C  
ATOM  10316  C   LYS B 438      74.145  -9.900  -2.595  1.00  0.83           C  
ATOM  10317  O   LYS B 438      73.167  -9.163  -2.451  1.00  0.83           O  
ATOM  10318  CB  LYS B 438      75.386  -8.955  -4.562  1.00  0.83           C  
ATOM  10319  CG  LYS B 438      76.658  -8.515  -3.828  1.00  0.83           C  
ATOM  10320  CD  LYS B 438      77.278  -7.278  -4.492  1.00  0.83           C  
ATOM  10321  CE  LYS B 438      78.583  -6.871  -3.819  1.00  0.83           C  
ATOM  10322  NZ  LYS B 438      79.168  -5.694  -4.483  1.00  0.83           N  
ATOM  10323  N   ARG B 439      74.737 -10.478  -1.536  1.00  0.86           N  
ATOM  10324  CA  ARG B 439      74.171 -10.444  -0.202  1.00  0.86           C  
ATOM  10325  C   ARG B 439      75.207 -10.121   0.848  1.00  0.86           C  
ATOM  10326  O   ARG B 439      76.410 -10.180   0.614  1.00  0.86           O  
ATOM  10327  CB  ARG B 439      73.557 -11.810   0.199  1.00  0.86           C  
ATOM  10328  CG  ARG B 439      72.520 -12.369  -0.788  1.00  0.86           C  
ATOM  10329  CD  ARG B 439      72.217 -13.841  -0.521  1.00  0.86           C  
ATOM  10330  NE  ARG B 439      71.283 -14.326  -1.578  1.00  0.86           N  
ATOM  10331  CZ  ARG B 439      69.953 -14.206  -1.507  1.00  0.86           C  
ATOM  10332  NH1 ARG B 439      69.352 -13.645  -0.459  1.00  0.86           N  
ATOM  10333  NH2 ARG B 439      69.207 -14.676  -2.505  1.00  0.86           N  
ATOM  10334  N   ILE B 440      74.744  -9.795   2.066  1.00  0.93           N  
ATOM  10335  CA  ILE B 440      75.594  -9.681   3.236  1.00  0.93           C  
ATOM  10336  C   ILE B 440      75.340 -10.890   4.112  1.00  0.93           C  
ATOM  10337  O   ILE B 440      74.206 -11.164   4.505  1.00  0.93           O  
ATOM  10338  CB  ILE B 440      75.336  -8.414   4.044  1.00  0.93           C  
ATOM  10339  CG1 ILE B 440      75.542  -7.145   3.182  1.00  0.93           C  
ATOM  10340  CG2 ILE B 440      76.231  -8.382   5.304  1.00  0.93           C  
ATOM  10341  CD1 ILE B 440      76.959  -6.971   2.612  1.00  0.93           C  
ATOM  10342  N   ASN B 441      76.396 -11.654   4.449  1.00  0.92           N  
ATOM  10343  CA  ASN B 441      76.317 -12.779   5.356  1.00  0.92           C  
ATOM  10344  C   ASN B 441      76.354 -12.277   6.796  1.00  0.92           C  
ATOM  10345  O   ASN B 441      77.367 -11.783   7.297  1.00  0.92           O  
ATOM  10346  CB  ASN B 441      77.487 -13.758   5.067  1.00  0.92           C  
ATOM  10347  CG  ASN B 441      77.343 -15.082   5.814  1.00  0.92           C  
ATOM  10348  OD1 ASN B 441      77.180 -15.128   7.035  1.00  0.92           O  
ATOM  10349  ND2 ASN B 441      77.388 -16.206   5.065  1.00  0.92           N  
ATOM  10350  N   MET B 442      75.227 -12.401   7.519  1.00  0.94           N  
ATOM  10351  CA  MET B 442      75.115 -11.823   8.844  1.00  0.94           C  
ATOM  10352  C   MET B 442      75.823 -12.626   9.910  1.00  0.94           C  
ATOM  10353  O   MET B 442      76.253 -12.093  10.932  1.00  0.94           O  
ATOM  10354  CB  MET B 442      73.641 -11.645   9.248  1.00  0.94           C  
ATOM  10355  CG  MET B 442      72.811 -10.867   8.216  1.00  0.94           C  
ATOM  10356  SD  MET B 442      73.544  -9.295   7.661  1.00  0.94           S  
ATOM  10357  CE  MET B 442      72.875  -8.280   9.003  1.00  0.94           C  
ATOM  10358  N   ALA B 443      76.033 -13.935   9.675  1.00  0.96           N  
ATOM  10359  CA  ALA B 443      76.846 -14.757  10.542  1.00  0.96           C  
ATOM  10360  C   ALA B 443      78.293 -14.332  10.501  1.00  0.96           C  
ATOM  10361  O   ALA B 443      78.943 -14.179  11.529  1.00  0.96           O  
ATOM  10362  CB  ALA B 443      76.708 -16.235  10.151  1.00  0.96           C  
ATOM  10363  N   HIS B 444      78.808 -14.052   9.292  1.00  0.93           N  
ATOM  10364  CA  HIS B 444      80.137 -13.507   9.113  1.00  0.93           C  
ATOM  10365  C   HIS B 444      80.296 -12.137   9.756  1.00  0.93           C  
ATOM  10366  O   HIS B 444      81.269 -11.900  10.466  1.00  0.93           O  
ATOM  10367  CB  HIS B 444      80.502 -13.440   7.619  1.00  0.93           C  
ATOM  10368  CG  HIS B 444      80.541 -14.787   6.953  1.00  0.93           C  
ATOM  10369  ND1 HIS B 444      80.930 -14.835   5.638  1.00  0.93           N  
ATOM  10370  CD2 HIS B 444      80.345 -16.048   7.424  1.00  0.93           C  
ATOM  10371  CE1 HIS B 444      80.979 -16.112   5.321  1.00  0.93           C  
ATOM  10372  NE2 HIS B 444      80.628 -16.895   6.371  1.00  0.93           N  
ATOM  10373  N   LEU B 445      79.303 -11.228   9.614  1.00  0.95           N  
ATOM  10374  CA  LEU B 445      79.288  -9.935  10.296  1.00  0.95           C  
ATOM  10375  C   LEU B 445      79.363 -10.068  11.812  1.00  0.95           C  
ATOM  10376  O   LEU B 445      80.162  -9.410  12.481  1.00  0.95           O  
ATOM  10377  CB  LEU B 445      77.998  -9.156   9.921  1.00  0.95           C  
ATOM  10378  CG  LEU B 445      77.767  -7.807  10.642  1.00  0.95           C  
ATOM  10379  CD1 LEU B 445      78.930  -6.821  10.457  1.00  0.95           C  
ATOM  10380  CD2 LEU B 445      76.453  -7.175  10.160  1.00  0.95           C  
ATOM  10381  N   CYS B 446      78.568 -10.990  12.385  1.00  0.96           N  
ATOM  10382  CA  CYS B 446      78.618 -11.306  13.795  1.00  0.96           C  
ATOM  10383  C   CYS B 446      79.936 -11.872  14.282  1.00  0.96           C  
ATOM  10384  O   CYS B 446      80.409 -11.507  15.352  1.00  0.96           O  
ATOM  10385  CB  CYS B 446      77.515 -12.299  14.190  1.00  0.96           C  
ATOM  10386  SG  CYS B 446      75.892 -11.513  14.361  1.00  0.96           S  
ATOM  10387  N   VAL B 447      80.579 -12.780  13.528  1.00  0.95           N  
ATOM  10388  CA  VAL B 447      81.894 -13.304  13.887  1.00  0.95           C  
ATOM  10389  C   VAL B 447      82.956 -12.216  13.895  1.00  0.95           C  
ATOM  10390  O   VAL B 447      83.774 -12.121  14.811  1.00  0.95           O  
ATOM  10391  CB  VAL B 447      82.337 -14.426  12.952  1.00  0.95           C  
ATOM  10392  CG1 VAL B 447      83.776 -14.887  13.255  1.00  0.95           C  
ATOM  10393  CG2 VAL B 447      81.397 -15.639  13.093  1.00  0.95           C  
ATOM  10394  N   ILE B 448      82.949 -11.333  12.882  1.00  0.93           N  
ATOM  10395  CA  ILE B 448      83.886 -10.230  12.743  1.00  0.93           C  
ATOM  10396  C   ILE B 448      83.787  -9.216  13.879  1.00  0.93           C  
ATOM  10397  O   ILE B 448      84.802  -8.775  14.431  1.00  0.93           O  
ATOM  10398  CB  ILE B 448      83.647  -9.554  11.392  1.00  0.93           C  
ATOM  10399  CG1 ILE B 448      84.035 -10.499  10.231  1.00  0.93           C  
ATOM  10400  CG2 ILE B 448      84.396  -8.211  11.280  1.00  0.93           C  
ATOM  10401  CD1 ILE B 448      83.505 -10.054   8.858  1.00  0.93           C  
ATOM  10402  N   GLY B 449      82.552  -8.847  14.277  1.00  0.96           N  
ATOM  10403  CA  GLY B 449      82.300  -7.810  15.275  1.00  0.96           C  
ATOM  10404  C   GLY B 449      82.069  -8.238  16.696  1.00  0.96           C  
ATOM  10405  O   GLY B 449      81.697  -7.406  17.514  1.00  0.96           O  
ATOM  10406  N   SER B 450      82.284  -9.517  17.034  1.00  0.96           N  
ATOM  10407  CA  SER B 450      82.074 -10.042  18.384  1.00  0.96           C  
ATOM  10408  C   SER B 450      83.354 -10.599  18.956  1.00  0.96           C  
ATOM  10409  O   SER B 450      84.168 -11.144  18.215  1.00  0.96           O  
ATOM  10410  CB  SER B 450      81.081 -11.228  18.389  1.00  0.96           C  
ATOM  10411  OG  SER B 450      79.747 -10.765  18.188  1.00  0.96           O  
ATOM  10412  N   HIS B 451      83.587 -10.517  20.287  1.00  0.92           N  
ATOM  10413  CA  HIS B 451      84.759 -11.129  20.913  1.00  0.92           C  
ATOM  10414  C   HIS B 451      84.567 -12.597  21.219  1.00  0.92           C  
ATOM  10415  O   HIS B 451      85.522 -13.312  21.511  1.00  0.92           O  
ATOM  10416  CB  HIS B 451      85.184 -10.454  22.239  1.00  0.92           C  
ATOM  10417  CG  HIS B 451      84.227 -10.620  23.386  1.00  0.92           C  
ATOM  10418  ND1 HIS B 451      83.110  -9.825  23.432  1.00  0.92           N  
ATOM  10419  CD2 HIS B 451      84.266 -11.433  24.476  1.00  0.92           C  
ATOM  10420  CE1 HIS B 451      82.488 -10.149  24.542  1.00  0.92           C  
ATOM  10421  NE2 HIS B 451      83.144 -11.123  25.219  1.00  0.92           N  
ATOM  10422  N   ALA B 452      83.321 -13.078  21.146  1.00  0.96           N  
ATOM  10423  CA  ALA B 452      83.003 -14.455  21.406  1.00  0.96           C  
ATOM  10424  C   ALA B 452      81.913 -14.919  20.469  1.00  0.96           C  
ATOM  10425  O   ALA B 452      80.934 -14.216  20.204  1.00  0.96           O  
ATOM  10426  CB  ALA B 452      82.542 -14.646  22.861  1.00  0.96           C  
ATOM  10427  N   VAL B 453      82.077 -16.136  19.936  1.00  0.96           N  
ATOM  10428  CA  VAL B 453      81.093 -16.789  19.105  1.00  0.96           C  
ATOM  10429  C   VAL B 453      80.874 -18.132  19.729  1.00  0.96           C  
ATOM  10430  O   VAL B 453      81.816 -18.903  19.909  1.00  0.96           O  
ATOM  10431  CB  VAL B 453      81.541 -16.992  17.664  1.00  0.96           C  
ATOM  10432  CG1 VAL B 453      80.463 -17.756  16.863  1.00  0.96           C  
ATOM  10433  CG2 VAL B 453      81.803 -15.614  17.037  1.00  0.96           C  
ATOM  10434  N   ASN B 454      79.634 -18.469  20.107  1.00  0.95           N  
ATOM  10435  CA  ASN B 454      79.384 -19.751  20.715  1.00  0.95           C  
ATOM  10436  C   ASN B 454      78.349 -20.570  19.995  1.00  0.95           C  
ATOM  10437  O   ASN B 454      77.316 -20.083  19.537  1.00  0.95           O  
ATOM  10438  CB  ASN B 454      79.098 -19.662  22.237  1.00  0.95           C  
ATOM  10439  CG  ASN B 454      77.764 -19.012  22.591  1.00  0.95           C  
ATOM  10440  OD1 ASN B 454      77.672 -17.804  22.794  1.00  0.95           O  
ATOM  10441  ND2 ASN B 454      76.720 -19.859  22.738  1.00  0.95           N  
ATOM  10442  N   GLY B 455      78.608 -21.886  19.921  1.00  0.96           N  
ATOM  10443  CA  GLY B 455      77.551 -22.843  19.662  1.00  0.96           C  
ATOM  10444  C   GLY B 455      76.854 -23.221  20.952  1.00  0.96           C  
ATOM  10445  O   GLY B 455      77.224 -22.804  22.052  1.00  0.96           O  
ATOM  10446  N   VAL B 456      75.808 -24.037  20.831  1.00  0.95           N  
ATOM  10447  CA  VAL B 456      74.738 -24.140  21.801  1.00  0.95           C  
ATOM  10448  C   VAL B 456      74.550 -25.579  22.326  1.00  0.95           C  
ATOM  10449  O   VAL B 456      73.662 -25.892  23.125  1.00  0.95           O  
ATOM  10450  CB  VAL B 456      73.526 -23.524  21.088  1.00  0.95           C  
ATOM  10451  CG1 VAL B 456      72.634 -24.575  20.420  1.00  0.95           C  
ATOM  10452  CG2 VAL B 456      72.755 -22.594  22.026  1.00  0.95           C  
ATOM  10453  N   ALA B 457      75.458 -26.484  21.907  1.00  0.95           N  
ATOM  10454  CA  ALA B 457      75.667 -27.822  22.436  1.00  0.95           C  
ATOM  10455  C   ALA B 457      77.036 -28.253  21.967  1.00  0.95           C  
ATOM  10456  O   ALA B 457      77.547 -27.695  20.990  1.00  0.95           O  
ATOM  10457  CB  ALA B 457      74.642 -28.860  21.961  1.00  0.95           C  
ATOM  10458  N   ARG B 458      77.684 -29.218  22.649  1.00  0.87           N  
ATOM  10459  CA  ARG B 458      79.074 -29.576  22.403  1.00  0.87           C  
ATOM  10460  C   ARG B 458      79.354 -30.061  20.991  1.00  0.87           C  
ATOM  10461  O   ARG B 458      80.285 -29.606  20.331  1.00  0.87           O  
ATOM  10462  CB  ARG B 458      79.539 -30.639  23.434  1.00  0.87           C  
ATOM  10463  CG  ARG B 458      81.023 -31.054  23.329  1.00  0.87           C  
ATOM  10464  CD  ARG B 458      81.551 -31.799  24.563  1.00  0.87           C  
ATOM  10465  NE  ARG B 458      80.827 -33.101  24.600  1.00  0.87           N  
ATOM  10466  CZ  ARG B 458      80.554 -33.814  25.698  1.00  0.87           C  
ATOM  10467  NH1 ARG B 458      80.983 -33.499  26.911  1.00  0.87           N  
ATOM  10468  NH2 ARG B 458      79.840 -34.922  25.551  1.00  0.87           N  
ATOM  10469  N   ILE B 459      78.503 -30.958  20.457  1.00  0.88           N  
ATOM  10470  CA  ILE B 459      78.635 -31.460  19.098  1.00  0.88           C  
ATOM  10471  C   ILE B 459      78.459 -30.379  18.044  1.00  0.88           C  
ATOM  10472  O   ILE B 459      79.219 -30.291  17.088  1.00  0.88           O  
ATOM  10473  CB  ILE B 459      77.704 -32.643  18.870  1.00  0.88           C  
ATOM  10474  CG1 ILE B 459      78.041 -33.370  17.554  1.00  0.88           C  
ATOM  10475  CG2 ILE B 459      76.224 -32.216  18.920  1.00  0.88           C  
ATOM  10476  CD1 ILE B 459      77.338 -34.724  17.435  1.00  0.88           C  
ATOM  10477  N   HIS B 460      77.481 -29.476  18.233  1.00  0.88           N  
ATOM  10478  CA  HIS B 460      77.227 -28.339  17.372  1.00  0.88           C  
ATOM  10479  C   HIS B 460      78.366 -27.331  17.339  1.00  0.88           C  
ATOM  10480  O   HIS B 460      78.803 -26.914  16.272  1.00  0.88           O  
ATOM  10481  CB  HIS B 460      75.902 -27.683  17.804  1.00  0.88           C  
ATOM  10482  CG  HIS B 460      75.567 -26.396  17.124  1.00  0.88           C  
ATOM  10483  ND1 HIS B 460      75.437 -26.339  15.757  1.00  0.88           N  
ATOM  10484  CD2 HIS B 460      75.415 -25.162  17.653  1.00  0.88           C  
ATOM  10485  CE1 HIS B 460      75.217 -25.067  15.484  1.00  0.88           C  
ATOM  10486  NE2 HIS B 460      75.195 -24.311  16.604  1.00  0.88           N  
ATOM  10487  N   SER B 461      78.952 -26.957  18.497  1.00  0.93           N  
ATOM  10488  CA  SER B 461      80.125 -26.082  18.516  1.00  0.93           C  
ATOM  10489  C   SER B 461      81.320 -26.661  17.788  1.00  0.93           C  
ATOM  10490  O   SER B 461      82.010 -25.963  17.045  1.00  0.93           O  
ATOM  10491  CB  SER B 461      80.611 -25.748  19.942  1.00  0.93           C  
ATOM  10492  OG  SER B 461      79.639 -24.976  20.641  1.00  0.93           O  
ATOM  10493  N   GLU B 462      81.578 -27.969  17.953  1.00  0.85           N  
ATOM  10494  CA  GLU B 462      82.602 -28.654  17.193  1.00  0.85           C  
ATOM  10495  C   GLU B 462      82.314 -28.718  15.698  1.00  0.85           C  
ATOM  10496  O   GLU B 462      83.199 -28.466  14.884  1.00  0.85           O  
ATOM  10497  CB  GLU B 462      82.885 -30.060  17.772  1.00  0.85           C  
ATOM  10498  CG  GLU B 462      83.560 -30.034  19.171  1.00  0.85           C  
ATOM  10499  CD  GLU B 462      84.720 -29.054  19.261  1.00  0.85           C  
ATOM  10500  OE1 GLU B 462      85.707 -29.157  18.488  1.00  0.85           O  
ATOM  10501  OE2 GLU B 462      84.653 -28.103  20.086  1.00  0.85           O  
ATOM  10502  N   ILE B 463      81.053 -28.976  15.281  1.00  0.82           N  
ATOM  10503  CA  ILE B 463      80.645 -28.899  13.879  1.00  0.82           C  
ATOM  10504  C   ILE B 463      80.876 -27.507  13.303  1.00  0.82           C  
ATOM  10505  O   ILE B 463      81.443 -27.371  12.223  1.00  0.82           O  
ATOM  10506  CB  ILE B 463      79.182 -29.307  13.672  1.00  0.82           C  
ATOM  10507  CG1 ILE B 463      78.980 -30.811  13.976  1.00  0.82           C  
ATOM  10508  CG2 ILE B 463      78.718 -29.004  12.226  1.00  0.82           C  
ATOM  10509  CD1 ILE B 463      77.503 -31.213  14.087  1.00  0.82           C  
ATOM  10510  N   VAL B 464      80.526 -26.432  14.037  1.00  0.88           N  
ATOM  10511  CA  VAL B 464      80.758 -25.045  13.644  1.00  0.88           C  
ATOM  10512  C   VAL B 464      82.228 -24.750  13.354  1.00  0.88           C  
ATOM  10513  O   VAL B 464      82.565 -24.150  12.333  1.00  0.88           O  
ATOM  10514  CB  VAL B 464      80.246 -24.111  14.750  1.00  0.88           C  
ATOM  10515  CG1 VAL B 464      80.826 -22.692  14.671  1.00  0.88           C  
ATOM  10516  CG2 VAL B 464      78.708 -24.037  14.694  1.00  0.88           C  
ATOM  10517  N   LYS B 465      83.146 -25.219  14.224  1.00  0.84           N  
ATOM  10518  CA  LYS B 465      84.582 -25.057  14.067  1.00  0.84           C  
ATOM  10519  C   LYS B 465      85.175 -25.892  12.936  1.00  0.84           C  
ATOM  10520  O   LYS B 465      86.259 -25.587  12.444  1.00  0.84           O  
ATOM  10521  CB  LYS B 465      85.294 -25.482  15.376  1.00  0.84           C  
ATOM  10522  CG  LYS B 465      85.150 -24.504  16.558  1.00  0.84           C  
ATOM  10523  CD  LYS B 465      85.425 -25.172  17.922  1.00  0.84           C  
ATOM  10524  CE  LYS B 465      86.725 -25.984  17.976  1.00  0.84           C  
ATOM  10525  NZ  LYS B 465      86.782 -26.766  19.218  1.00  0.84           N  
ATOM  10526  N   GLN B 466      84.497 -26.969  12.499  1.00  0.78           N  
ATOM  10527  CA  GLN B 466      85.013 -27.832  11.451  1.00  0.78           C  
ATOM  10528  C   GLN B 466      84.330 -27.639  10.106  1.00  0.78           C  
ATOM  10529  O   GLN B 466      84.866 -28.062   9.084  1.00  0.78           O  
ATOM  10530  CB  GLN B 466      84.864 -29.319  11.862  1.00  0.78           C  
ATOM  10531  CG  GLN B 466      85.684 -29.727  13.112  1.00  0.78           C  
ATOM  10532  CD  GLN B 466      87.185 -29.499  12.929  1.00  0.78           C  
ATOM  10533  OE1 GLN B 466      87.801 -29.890  11.938  1.00  0.78           O  
ATOM  10534  NE2 GLN B 466      87.817 -28.842  13.930  1.00  0.78           N  
ATOM  10535  N   SER B 467      83.159 -26.976  10.040  1.00  0.83           N  
ATOM  10536  CA  SER B 467      82.463 -26.750   8.775  1.00  0.83           C  
ATOM  10537  C   SER B 467      82.319 -25.277   8.426  1.00  0.83           C  
ATOM  10538  O   SER B 467      83.238 -24.653   7.903  1.00  0.83           O  
ATOM  10539  CB  SER B 467      81.095 -27.510   8.698  1.00  0.83           C  
ATOM  10540  OG  SER B 467      80.105 -27.036   9.621  1.00  0.83           O  
ATOM  10541  N   VAL B 468      81.152 -24.667   8.684  1.00  0.82           N  
ATOM  10542  CA  VAL B 468      80.779 -23.338   8.222  1.00  0.82           C  
ATOM  10543  C   VAL B 468      81.640 -22.198   8.734  1.00  0.82           C  
ATOM  10544  O   VAL B 468      81.910 -21.237   8.015  1.00  0.82           O  
ATOM  10545  CB  VAL B 468      79.296 -23.070   8.468  1.00  0.82           C  
ATOM  10546  CG1 VAL B 468      78.938 -23.092   9.969  1.00  0.82           C  
ATOM  10547  CG2 VAL B 468      78.847 -21.752   7.801  1.00  0.82           C  
ATOM  10548  N   PHE B 469      82.114 -22.261   9.991  1.00  0.89           N  
ATOM  10549  CA  PHE B 469      82.936 -21.206  10.556  1.00  0.89           C  
ATOM  10550  C   PHE B 469      84.375 -21.668  10.712  1.00  0.89           C  
ATOM  10551  O   PHE B 469      85.146 -21.072  11.462  1.00  0.89           O  
ATOM  10552  CB  PHE B 469      82.388 -20.693  11.917  1.00  0.89           C  
ATOM  10553  CG  PHE B 469      81.015 -20.051  11.860  1.00  0.89           C  
ATOM  10554  CD1 PHE B 469      80.385 -19.637  10.670  1.00  0.89           C  
ATOM  10555  CD2 PHE B 469      80.317 -19.863  13.066  1.00  0.89           C  
ATOM  10556  CE1 PHE B 469      79.060 -19.188  10.676  1.00  0.89           C  
ATOM  10557  CE2 PHE B 469      78.997 -19.405  13.087  1.00  0.89           C  
ATOM  10558  CZ  PHE B 469      78.359 -19.094  11.883  1.00  0.89           C  
ATOM  10559  N   LYS B 470      84.796 -22.716   9.968  1.00  0.87           N  
ATOM  10560  CA  LYS B 470      86.149 -23.254  10.019  1.00  0.87           C  
ATOM  10561  C   LYS B 470      87.222 -22.251   9.653  1.00  0.87           C  
ATOM  10562  O   LYS B 470      88.201 -22.095  10.376  1.00  0.87           O  
ATOM  10563  CB  LYS B 470      86.299 -24.472   9.075  1.00  0.87           C  
ATOM  10564  CG  LYS B 470      87.656 -25.195   9.173  1.00  0.87           C  
ATOM  10565  CD  LYS B 470      87.785 -26.314   8.130  1.00  0.87           C  
ATOM  10566  CE  LYS B 470      89.069 -27.140   8.251  1.00  0.87           C  
ATOM  10567  NZ  LYS B 470      90.259 -26.311   7.981  1.00  0.87           N  
ATOM  10568  N   ASP B 471      87.041 -21.478   8.562  1.00  0.92           N  
ATOM  10569  CA  ASP B 471      87.994 -20.458   8.169  1.00  0.92           C  
ATOM  10570  C   ASP B 471      88.197 -19.382   9.230  1.00  0.92           C  
ATOM  10571  O   ASP B 471      89.311 -18.916   9.484  1.00  0.92           O  
ATOM  10572  CB  ASP B 471      87.546 -19.752   6.875  1.00  0.92           C  
ATOM  10573  CG  ASP B 471      87.669 -20.663   5.676  1.00  0.92           C  
ATOM  10574  OD1 ASP B 471      88.767 -21.238   5.464  1.00  0.92           O  
ATOM  10575  OD2 ASP B 471      86.703 -20.749   4.882  1.00  0.92           O  
ATOM  10576  N   PHE B 472      87.090 -18.975   9.871  1.00  0.93           N  
ATOM  10577  CA  PHE B 472      87.055 -18.018  10.952  1.00  0.93           C  
ATOM  10578  C   PHE B 472      87.711 -18.525  12.221  1.00  0.93           C  
ATOM  10579  O   PHE B 472      88.449 -17.796  12.878  1.00  0.93           O  
ATOM  10580  CB  PHE B 472      85.601 -17.608  11.262  1.00  0.93           C  
ATOM  10581  CG  PHE B 472      84.961 -16.910  10.090  1.00  0.93           C  
ATOM  10582  CD1 PHE B 472      84.275 -17.648   9.110  1.00  0.93           C  
ATOM  10583  CD2 PHE B 472      85.020 -15.510   9.966  1.00  0.93           C  
ATOM  10584  CE1 PHE B 472      83.677 -17.006   8.020  1.00  0.93           C  
ATOM  10585  CE2 PHE B 472      84.412 -14.862   8.882  1.00  0.93           C  
ATOM  10586  CZ  PHE B 472      83.744 -15.613   7.908  1.00  0.93           C  
ATOM  10587  N   TYR B 473      87.491 -19.806  12.578  1.00  0.91           N  
ATOM  10588  CA  TYR B 473      88.160 -20.460  13.689  1.00  0.91           C  
ATOM  10589  C   TYR B 473      89.673 -20.488  13.516  1.00  0.91           C  
ATOM  10590  O   TYR B 473      90.422 -20.250  14.454  1.00  0.91           O  
ATOM  10591  CB  TYR B 473      87.571 -21.888  13.868  1.00  0.91           C  
ATOM  10592  CG  TYR B 473      88.308 -22.722  14.885  1.00  0.91           C  
ATOM  10593  CD1 TYR B 473      88.293 -22.380  16.246  1.00  0.91           C  
ATOM  10594  CD2 TYR B 473      89.075 -23.821  14.464  1.00  0.91           C  
ATOM  10595  CE1 TYR B 473      89.031 -23.126  17.175  1.00  0.91           C  
ATOM  10596  CE2 TYR B 473      89.823 -24.563  15.388  1.00  0.91           C  
ATOM  10597  CZ  TYR B 473      89.803 -24.210  16.742  1.00  0.91           C  
ATOM  10598  OH  TYR B 473      90.547 -24.960  17.672  1.00  0.91           O  
ATOM  10599  N   GLU B 474      90.166 -20.752  12.300  1.00  0.88           N  
ATOM  10600  CA  GLU B 474      91.584 -20.680  12.010  1.00  0.88           C  
ATOM  10601  C   GLU B 474      92.179 -19.281  12.156  1.00  0.88           C  
ATOM  10602  O   GLU B 474      93.290 -19.111  12.647  1.00  0.88           O  
ATOM  10603  CB  GLU B 474      91.854 -21.254  10.610  1.00  0.88           C  
ATOM  10604  CG  GLU B 474      91.411 -22.732  10.517  1.00  0.88           C  
ATOM  10605  CD  GLU B 474      91.660 -23.371   9.161  1.00  0.88           C  
ATOM  10606  OE1 GLU B 474      91.579 -22.675   8.117  1.00  0.88           O  
ATOM  10607  OE2 GLU B 474      91.861 -24.614   9.136  1.00  0.88           O  
ATOM  10608  N   LEU B 475      91.444 -18.230  11.736  1.00  0.88           N  
ATOM  10609  CA  LEU B 475      91.857 -16.849  11.930  1.00  0.88           C  
ATOM  10610  C   LEU B 475      91.859 -16.363  13.378  1.00  0.88           C  
ATOM  10611  O   LEU B 475      92.809 -15.729  13.834  1.00  0.88           O  
ATOM  10612  CB  LEU B 475      90.922 -15.928  11.111  1.00  0.88           C  
ATOM  10613  CG  LEU B 475      91.324 -14.438  11.062  1.00  0.88           C  
ATOM  10614  CD1 LEU B 475      92.598 -14.204  10.251  1.00  0.88           C  
ATOM  10615  CD2 LEU B 475      90.177 -13.598  10.496  1.00  0.88           C  
ATOM  10616  N   GLU B 476      90.785 -16.648  14.139  1.00  0.87           N  
ATOM  10617  CA  GLU B 476      90.615 -16.143  15.491  1.00  0.87           C  
ATOM  10618  C   GLU B 476      90.117 -17.267  16.407  1.00  0.87           C  
ATOM  10619  O   GLU B 476      88.953 -17.242  16.817  1.00  0.87           O  
ATOM  10620  CB  GLU B 476      89.621 -14.936  15.529  1.00  0.87           C  
ATOM  10621  CG  GLU B 476      90.108 -13.656  14.780  1.00  0.87           C  
ATOM  10622  CD  GLU B 476      89.055 -12.553  14.679  1.00  0.87           C  
ATOM  10623  OE1 GLU B 476      87.991 -12.801  14.049  1.00  0.87           O  
ATOM  10624  OE2 GLU B 476      89.212 -11.445  15.278  1.00  0.87           O  
ATOM  10625  N   PRO B 477      90.933 -18.272  16.773  1.00  0.92           N  
ATOM  10626  CA  PRO B 477      90.479 -19.474  17.483  1.00  0.92           C  
ATOM  10627  C   PRO B 477      89.918 -19.192  18.854  1.00  0.92           C  
ATOM  10628  O   PRO B 477      89.007 -19.892  19.290  1.00  0.92           O  
ATOM  10629  CB  PRO B 477      91.737 -20.365  17.549  1.00  0.92           C  
ATOM  10630  CG  PRO B 477      92.911 -19.395  17.392  1.00  0.92           C  
ATOM  10631  CD  PRO B 477      92.352 -18.374  16.405  1.00  0.92           C  
ATOM  10632  N   GLU B 478      90.443 -18.163  19.535  1.00  0.86           N  
ATOM  10633  CA  GLU B 478      90.066 -17.729  20.863  1.00  0.86           C  
ATOM  10634  C   GLU B 478      88.609 -17.314  21.006  1.00  0.86           C  
ATOM  10635  O   GLU B 478      88.004 -17.453  22.066  1.00  0.86           O  
ATOM  10636  CB  GLU B 478      90.965 -16.536  21.249  1.00  0.86           C  
ATOM  10637  CG  GLU B 478      92.444 -16.929  21.480  1.00  0.86           C  
ATOM  10638  CD  GLU B 478      93.329 -15.729  21.816  1.00  0.86           C  
ATOM  10639  OE1 GLU B 478      92.839 -14.575  21.738  1.00  0.86           O  
ATOM  10640  OE2 GLU B 478      94.518 -15.982  22.134  1.00  0.86           O  
ATOM  10641  N   LYS B 479      87.990 -16.797  19.927  1.00  0.90           N  
ATOM  10642  CA  LYS B 479      86.589 -16.420  19.930  1.00  0.90           C  
ATOM  10643  C   LYS B 479      85.618 -17.568  20.131  1.00  0.90           C  
ATOM  10644  O   LYS B 479      84.525 -17.387  20.668  1.00  0.90           O  
ATOM  10645  CB  LYS B 479      86.207 -15.742  18.596  1.00  0.90           C  
ATOM  10646  CG  LYS B 479      86.787 -14.335  18.445  1.00  0.90           C  
ATOM  10647  CD  LYS B 479      86.235 -13.660  17.185  1.00  0.90           C  
ATOM  10648  CE  LYS B 479      86.739 -12.232  17.011  1.00  0.90           C  
ATOM  10649  NZ  LYS B 479      86.277 -11.707  15.715  1.00  0.90           N  
ATOM  10650  N   PHE B 480      85.956 -18.771  19.645  1.00  0.92           N  
ATOM  10651  CA  PHE B 480      84.991 -19.837  19.525  1.00  0.92           C  
ATOM  10652  C   PHE B 480      84.831 -20.654  20.786  1.00  0.92           C  
ATOM  10653  O   PHE B 480      85.743 -21.316  21.278  1.00  0.92           O  
ATOM  10654  CB  PHE B 480      85.312 -20.771  18.340  1.00  0.92           C  
ATOM  10655  CG  PHE B 480      85.076 -20.023  17.061  1.00  0.92           C  
ATOM  10656  CD1 PHE B 480      86.058 -19.170  16.533  1.00  0.92           C  
ATOM  10657  CD2 PHE B 480      83.834 -20.116  16.415  1.00  0.92           C  
ATOM  10658  CE1 PHE B 480      85.792 -18.388  15.404  1.00  0.92           C  
ATOM  10659  CE2 PHE B 480      83.567 -19.340  15.281  1.00  0.92           C  
ATOM  10660  CZ  PHE B 480      84.543 -18.472  14.778  1.00  0.92           C  
ATOM  10661  N   GLN B 481      83.602 -20.642  21.318  1.00  0.91           N  
ATOM  10662  CA  GLN B 481      83.270 -21.282  22.564  1.00  0.91           C  
ATOM  10663  C   GLN B 481      82.082 -22.214  22.398  1.00  0.91           C  
ATOM  10664  O   GLN B 481      81.380 -22.269  21.388  1.00  0.91           O  
ATOM  10665  CB  GLN B 481      82.924 -20.240  23.662  1.00  0.91           C  
ATOM  10666  CG  GLN B 481      84.100 -19.319  24.069  1.00  0.91           C  
ATOM  10667  CD  GLN B 481      83.695 -18.419  25.239  1.00  0.91           C  
ATOM  10668  OE1 GLN B 481      82.808 -18.764  26.023  1.00  0.91           O  
ATOM  10669  NE2 GLN B 481      84.358 -17.249  25.364  1.00  0.91           N  
ATOM  10670  N   ASN B 482      81.814 -23.003  23.444  1.00  0.93           N  
ATOM  10671  CA  ASN B 482      80.617 -23.794  23.566  1.00  0.93           C  
ATOM  10672  C   ASN B 482      79.884 -23.302  24.790  1.00  0.93           C  
ATOM  10673  O   ASN B 482      80.497 -22.994  25.808  1.00  0.93           O  
ATOM  10674  CB  ASN B 482      80.961 -25.308  23.664  1.00  0.93           C  
ATOM  10675  CG  ASN B 482      79.759 -26.193  23.991  1.00  0.93           C  
ATOM  10676  OD1 ASN B 482      79.835 -27.047  24.868  1.00  0.93           O  
ATOM  10677  ND2 ASN B 482      78.621 -25.972  23.301  1.00  0.93           N  
ATOM  10678  N   LYS B 483      78.553 -23.192  24.687  1.00  0.93           N  
ATOM  10679  CA  LYS B 483      77.692 -23.002  25.827  1.00  0.93           C  
ATOM  10680  C   LYS B 483      76.501 -23.916  25.651  1.00  0.93           C  
ATOM  10681  O   LYS B 483      75.488 -23.522  25.078  1.00  0.93           O  
ATOM  10682  CB  LYS B 483      77.195 -21.537  25.918  1.00  0.93           C  
ATOM  10683  CG  LYS B 483      78.301 -20.511  26.214  1.00  0.93           C  
ATOM  10684  CD  LYS B 483      78.821 -20.636  27.653  1.00  0.93           C  
ATOM  10685  CE  LYS B 483      80.162 -19.947  27.904  1.00  0.93           C  
ATOM  10686  NZ  LYS B 483      81.263 -20.705  27.304  1.00  0.93           N  
ATOM  10687  N   THR B 484      76.587 -25.182  26.119  1.00  0.96           N  
ATOM  10688  CA  THR B 484      75.493 -26.149  26.018  1.00  0.96           C  
ATOM  10689  C   THR B 484      74.237 -25.649  26.682  1.00  0.96           C  
ATOM  10690  O   THR B 484      74.261 -25.250  27.841  1.00  0.96           O  
ATOM  10691  CB  THR B 484      75.856 -27.520  26.583  1.00  0.96           C  
ATOM  10692  OG1 THR B 484      76.952 -28.021  25.836  1.00  0.96           O  
ATOM  10693  CG2 THR B 484      74.711 -28.543  26.470  1.00  0.96           C  
ATOM  10694  N   ASN B 485      73.106 -25.620  25.951  1.00  0.94           N  
ATOM  10695  CA  ASN B 485      71.810 -25.203  26.457  1.00  0.94           C  
ATOM  10696  C   ASN B 485      71.355 -25.782  27.785  1.00  0.94           C  
ATOM  10697  O   ASN B 485      71.857 -26.778  28.304  1.00  0.94           O  
ATOM  10698  CB  ASN B 485      70.676 -25.411  25.419  1.00  0.94           C  
ATOM  10699  CG  ASN B 485      70.739 -24.311  24.383  1.00  0.94           C  
ATOM  10700  OD1 ASN B 485      71.214 -23.221  24.689  1.00  0.94           O  
ATOM  10701  ND2 ASN B 485      70.189 -24.570  23.176  1.00  0.94           N  
ATOM  10702  N   GLY B 486      70.362 -25.102  28.376  1.00  0.98           N  
ATOM  10703  CA  GLY B 486      69.707 -25.583  29.567  1.00  0.98           C  
ATOM  10704  C   GLY B 486      68.306 -25.073  29.605  1.00  0.98           C  
ATOM  10705  O   GLY B 486      67.904 -24.232  28.801  1.00  0.98           O  
ATOM  10706  N   ILE B 487      67.534 -25.546  30.584  1.00  0.96           N  
ATOM  10707  CA  ILE B 487      66.168 -25.133  30.819  1.00  0.96           C  
ATOM  10708  C   ILE B 487      66.055 -24.726  32.267  1.00  0.96           C  
ATOM  10709  O   ILE B 487      66.814 -25.184  33.118  1.00  0.96           O  
ATOM  10710  CB  ILE B 487      65.172 -26.244  30.527  1.00  0.96           C  
ATOM  10711  CG1 ILE B 487      65.481 -27.491  31.388  1.00  0.96           C  
ATOM  10712  CG2 ILE B 487      65.237 -26.545  29.015  1.00  0.96           C  
ATOM  10713  CD1 ILE B 487      64.521 -28.645  31.155  1.00  0.96           C  
ATOM  10714  N   THR B 488      65.116 -23.827  32.617  1.00  0.97           N  
ATOM  10715  CA  THR B 488      64.962 -23.436  34.019  1.00  0.97           C  
ATOM  10716  C   THR B 488      64.249 -24.520  34.828  1.00  0.97           C  
ATOM  10717  O   THR B 488      63.146 -24.932  34.454  1.00  0.97           O  
ATOM  10718  CB  THR B 488      64.302 -22.071  34.262  1.00  0.97           C  
ATOM  10719  OG1 THR B 488      63.914 -21.870  35.623  1.00  0.97           O  
ATOM  10720  CG2 THR B 488      63.034 -21.920  33.423  1.00  0.97           C  
ATOM  10721  N   PRO B 489      64.790 -25.001  35.948  1.00  0.98           N  
ATOM  10722  CA  PRO B 489      64.130 -26.011  36.763  1.00  0.98           C  
ATOM  10723  C   PRO B 489      62.998 -25.435  37.580  1.00  0.98           C  
ATOM  10724  O   PRO B 489      62.241 -26.198  38.178  1.00  0.98           O  
ATOM  10725  CB  PRO B 489      65.260 -26.504  37.673  1.00  0.98           C  
ATOM  10726  CG  PRO B 489      66.169 -25.289  37.847  1.00  0.98           C  
ATOM  10727  CD  PRO B 489      66.125 -24.659  36.461  1.00  0.98           C  
ATOM  10728  N   ARG B 490      62.826 -24.101  37.647  1.00  0.92           N  
ATOM  10729  CA  ARG B 490      61.651 -23.560  38.306  1.00  0.92           C  
ATOM  10730  C   ARG B 490      60.420 -23.814  37.456  1.00  0.92           C  
ATOM  10731  O   ARG B 490      59.480 -24.482  37.867  1.00  0.92           O  
ATOM  10732  CB  ARG B 490      61.768 -22.037  38.561  1.00  0.92           C  
ATOM  10733  CG  ARG B 490      62.532 -21.660  39.847  1.00  0.92           C  
ATOM  10734  CD  ARG B 490      64.019 -22.012  39.883  1.00  0.92           C  
ATOM  10735  NE  ARG B 490      64.686 -21.219  38.811  1.00  0.92           N  
ATOM  10736  CZ  ARG B 490      66.001 -21.281  38.577  1.00  0.92           C  
ATOM  10737  NH1 ARG B 490      66.800 -22.102  39.246  1.00  0.92           N  
ATOM  10738  NH2 ARG B 490      66.516 -20.493  37.644  1.00  0.92           N  
ATOM  10739  N   ARG B 491      60.419 -23.352  36.196  1.00  0.92           N  
ATOM  10740  CA  ARG B 491      59.315 -23.628  35.296  1.00  0.92           C  
ATOM  10741  C   ARG B 491      59.206 -25.072  34.847  1.00  0.92           C  
ATOM  10742  O   ARG B 491      58.121 -25.650  34.839  1.00  0.92           O  
ATOM  10743  CB  ARG B 491      59.347 -22.664  34.099  1.00  0.92           C  
ATOM  10744  CG  ARG B 491      58.449 -23.072  32.922  1.00  0.92           C  
ATOM  10745  CD  ARG B 491      58.349 -21.970  31.874  1.00  0.92           C  
ATOM  10746  NE  ARG B 491      56.980 -21.428  31.955  1.00  0.92           N  
ATOM  10747  CZ  ARG B 491      56.551 -20.259  32.431  1.00  0.92           C  
ATOM  10748  NH1 ARG B 491      57.341 -19.292  32.879  1.00  0.92           N  
ATOM  10749  NH2 ARG B 491      55.235 -20.098  32.461  1.00  0.92           N  
ATOM  10750  N   TRP B 492      60.327 -25.716  34.489  1.00  0.93           N  
ATOM  10751  CA  TRP B 492      60.276 -27.021  33.855  1.00  0.93           C  
ATOM  10752  C   TRP B 492      60.423 -28.174  34.826  1.00  0.93           C  
ATOM  10753  O   TRP B 492      60.687 -29.305  34.425  1.00  0.93           O  
ATOM  10754  CB  TRP B 492      61.291 -27.123  32.695  1.00  0.93           C  
ATOM  10755  CG  TRP B 492      61.025 -26.091  31.617  1.00  0.93           C  
ATOM  10756  CD1 TRP B 492      61.714 -24.945  31.336  1.00  0.93           C  
ATOM  10757  CD2 TRP B 492      59.878 -26.095  30.749  1.00  0.93           C  
ATOM  10758  NE1 TRP B 492      61.097 -24.247  30.317  1.00  0.93           N  
ATOM  10759  CE2 TRP B 492      59.957 -24.931  29.960  1.00  0.93           C  
ATOM  10760  CE3 TRP B 492      58.813 -26.985  30.619  1.00  0.93           C  
ATOM  10761  CZ2 TRP B 492      58.974 -24.631  29.029  1.00  0.93           C  
ATOM  10762  CZ3 TRP B 492      57.810 -26.671  29.689  1.00  0.93           C  
ATOM  10763  CH2 TRP B 492      57.887 -25.509  28.908  1.00  0.93           C  
ATOM  10764  N   LEU B 493      60.184 -27.912  36.121  1.00  0.96           N  
ATOM  10765  CA  LEU B 493      60.047 -28.949  37.119  1.00  0.96           C  
ATOM  10766  C   LEU B 493      59.061 -28.507  38.187  1.00  0.96           C  
ATOM  10767  O   LEU B 493      57.990 -29.086  38.325  1.00  0.96           O  
ATOM  10768  CB  LEU B 493      61.420 -29.257  37.753  1.00  0.96           C  
ATOM  10769  CG  LEU B 493      61.641 -30.698  38.247  1.00  0.96           C  
ATOM  10770  CD1 LEU B 493      62.920 -30.698  39.085  1.00  0.96           C  
ATOM  10771  CD2 LEU B 493      60.484 -31.289  39.059  1.00  0.96           C  
ATOM  10772  N   LEU B 494      59.379 -27.445  38.964  1.00  0.95           N  
ATOM  10773  CA  LEU B 494      58.554 -27.003  40.086  1.00  0.95           C  
ATOM  10774  C   LEU B 494      57.142 -26.591  39.692  1.00  0.95           C  
ATOM  10775  O   LEU B 494      56.172 -26.950  40.355  1.00  0.95           O  
ATOM  10776  CB  LEU B 494      59.260 -25.845  40.847  1.00  0.95           C  
ATOM  10777  CG  LEU B 494      58.551 -25.290  42.104  1.00  0.95           C  
ATOM  10778  CD1 LEU B 494      58.393 -26.348  43.203  1.00  0.95           C  
ATOM  10779  CD2 LEU B 494      59.317 -24.077  42.659  1.00  0.95           C  
ATOM  10780  N   LEU B 495      56.980 -25.844  38.583  1.00  0.92           N  
ATOM  10781  CA  LEU B 495      55.656 -25.476  38.116  1.00  0.92           C  
ATOM  10782  C   LEU B 495      54.922 -26.587  37.398  1.00  0.92           C  
ATOM  10783  O   LEU B 495      53.783 -26.916  37.718  1.00  0.92           O  
ATOM  10784  CB  LEU B 495      55.723 -24.301  37.111  1.00  0.92           C  
ATOM  10785  CG  LEU B 495      56.420 -23.028  37.605  1.00  0.92           C  
ATOM  10786  CD1 LEU B 495      56.084 -21.876  36.651  1.00  0.92           C  
ATOM  10787  CD2 LEU B 495      56.069 -22.708  39.049  1.00  0.92           C  
ATOM  10788  N   CYS B 496      55.567 -27.211  36.394  1.00  0.94           N  
ATOM  10789  CA  CYS B 496      54.876 -28.146  35.528  1.00  0.94           C  
ATOM  10790  C   CYS B 496      54.628 -29.497  36.170  1.00  0.94           C  
ATOM  10791  O   CYS B 496      53.680 -30.208  35.842  1.00  0.94           O  
ATOM  10792  CB  CYS B 496      55.645 -28.305  34.191  1.00  0.94           C  
ATOM  10793  SG  CYS B 496      57.272 -29.113  34.310  1.00  0.94           S  
ATOM  10794  N   ASN B 497      55.470 -29.872  37.143  1.00  0.93           N  
ATOM  10795  CA  ASN B 497      55.415 -31.177  37.752  1.00  0.93           C  
ATOM  10796  C   ASN B 497      55.629 -31.079  39.257  1.00  0.93           C  
ATOM  10797  O   ASN B 497      56.626 -31.596  39.773  1.00  0.93           O  
ATOM  10798  CB  ASN B 497      56.505 -32.033  37.080  1.00  0.93           C  
ATOM  10799  CG  ASN B 497      56.279 -33.527  37.236  1.00  0.93           C  
ATOM  10800  OD1 ASN B 497      55.490 -34.026  38.040  1.00  0.93           O  
ATOM  10801  ND2 ASN B 497      57.019 -34.300  36.408  1.00  0.93           N  
ATOM  10802  N   PRO B 498      54.721 -30.450  40.013  1.00  0.93           N  
ATOM  10803  CA  PRO B 498      54.842 -30.313  41.461  1.00  0.93           C  
ATOM  10804  C   PRO B 498      54.897 -31.651  42.153  1.00  0.93           C  
ATOM  10805  O   PRO B 498      55.635 -31.787  43.117  1.00  0.93           O  
ATOM  10806  CB  PRO B 498      53.600 -29.501  41.861  1.00  0.93           C  
ATOM  10807  CG  PRO B 498      52.574 -29.810  40.767  1.00  0.93           C  
ATOM  10808  CD  PRO B 498      53.453 -29.895  39.525  1.00  0.93           C  
ATOM  10809  N   GLY B 499      54.182 -32.677  41.651  1.00  0.93           N  
ATOM  10810  CA  GLY B 499      54.217 -34.003  42.256  1.00  0.93           C  
ATOM  10811  C   GLY B 499      55.566 -34.672  42.177  1.00  0.93           C  
ATOM  10812  O   GLY B 499      56.004 -35.331  43.111  1.00  0.93           O  
ATOM  10813  N   LEU B 500      56.316 -34.494  41.069  1.00  0.93           N  
ATOM  10814  CA  LEU B 500      57.689 -34.965  41.007  1.00  0.93           C  
ATOM  10815  C   LEU B 500      58.602 -34.151  41.892  1.00  0.93           C  
ATOM  10816  O   LEU B 500      59.448 -34.695  42.596  1.00  0.93           O  
ATOM  10817  CB  LEU B 500      58.241 -34.983  39.565  1.00  0.93           C  
ATOM  10818  CG  LEU B 500      59.611 -35.671  39.391  1.00  0.93           C  
ATOM  10819  CD1 LEU B 500      59.572 -37.156  39.783  1.00  0.93           C  
ATOM  10820  CD2 LEU B 500      60.100 -35.519  37.946  1.00  0.93           C  
ATOM  10821  N   ALA B 501      58.421 -32.815  41.905  1.00  0.94           N  
ATOM  10822  CA  ALA B 501      59.196 -31.924  42.739  1.00  0.94           C  
ATOM  10823  C   ALA B 501      59.060 -32.236  44.218  1.00  0.94           C  
ATOM  10824  O   ALA B 501      60.068 -32.386  44.899  1.00  0.94           O  
ATOM  10825  CB  ALA B 501      58.779 -30.467  42.474  1.00  0.94           C  
ATOM  10826  N   ASP B 502      57.832 -32.450  44.713  1.00  0.89           N  
ATOM  10827  CA  ASP B 502      57.539 -32.861  46.071  1.00  0.89           C  
ATOM  10828  C   ASP B 502      58.174 -34.206  46.438  1.00  0.89           C  
ATOM  10829  O   ASP B 502      58.889 -34.306  47.435  1.00  0.89           O  
ATOM  10830  CB  ASP B 502      56.001 -32.934  46.231  1.00  0.89           C  
ATOM  10831  CG  ASP B 502      55.361 -31.551  46.265  1.00  0.89           C  
ATOM  10832  OD1 ASP B 502      56.095 -30.544  46.427  1.00  0.89           O  
ATOM  10833  OD2 ASP B 502      54.109 -31.499  46.143  1.00  0.89           O  
ATOM  10834  N   THR B 503      58.039 -35.248  45.580  1.00  0.87           N  
ATOM  10835  CA  THR B 503      58.679 -36.557  45.774  1.00  0.87           C  
ATOM  10836  C   THR B 503      60.197 -36.455  45.843  1.00  0.87           C  
ATOM  10837  O   THR B 503      60.857 -37.122  46.639  1.00  0.87           O  
ATOM  10838  CB  THR B 503      58.309 -37.555  44.669  1.00  0.87           C  
ATOM  10839  OG1 THR B 503      56.910 -37.781  44.671  1.00  0.87           O  
ATOM  10840  CG2 THR B 503      58.949 -38.939  44.855  1.00  0.87           C  
ATOM  10841  N   ILE B 504      60.826 -35.596  45.014  1.00  0.89           N  
ATOM  10842  CA  ILE B 504      62.246 -35.282  45.129  1.00  0.89           C  
ATOM  10843  C   ILE B 504      62.601 -34.537  46.422  1.00  0.89           C  
ATOM  10844  O   ILE B 504      63.552 -34.906  47.115  1.00  0.89           O  
ATOM  10845  CB  ILE B 504      62.724 -34.499  43.903  1.00  0.89           C  
ATOM  10846  CG1 ILE B 504      62.621 -35.379  42.631  1.00  0.89           C  
ATOM  10847  CG2 ILE B 504      64.168 -33.986  44.096  1.00  0.89           C  
ATOM  10848  CD1 ILE B 504      63.022 -34.649  41.342  1.00  0.89           C  
ATOM  10849  N   VAL B 505      61.829 -33.495  46.810  1.00  0.88           N  
ATOM  10850  CA  VAL B 505      62.074 -32.660  47.989  1.00  0.88           C  
ATOM  10851  C   VAL B 505      62.072 -33.463  49.270  1.00  0.88           C  
ATOM  10852  O   VAL B 505      62.954 -33.298  50.112  1.00  0.88           O  
ATOM  10853  CB  VAL B 505      61.052 -31.525  48.125  1.00  0.88           C  
ATOM  10854  CG1 VAL B 505      61.136 -30.805  49.488  1.00  0.88           C  
ATOM  10855  CG2 VAL B 505      61.278 -30.481  47.021  1.00  0.88           C  
ATOM  10856  N   GLU B 506      61.128 -34.414  49.414  1.00  0.83           N  
ATOM  10857  CA  GLU B 506      61.033 -35.319  50.549  1.00  0.83           C  
ATOM  10858  C   GLU B 506      62.319 -36.080  50.828  1.00  0.83           C  
ATOM  10859  O   GLU B 506      62.651 -36.402  51.966  1.00  0.83           O  
ATOM  10860  CB  GLU B 506      59.942 -36.375  50.273  1.00  0.83           C  
ATOM  10861  CG  GLU B 506      58.495 -35.861  50.427  1.00  0.83           C  
ATOM  10862  CD  GLU B 506      57.494 -36.965  50.093  1.00  0.83           C  
ATOM  10863  OE1 GLU B 506      57.862 -38.162  50.250  1.00  0.83           O  
ATOM  10864  OE2 GLU B 506      56.354 -36.617  49.700  1.00  0.83           O  
ATOM  10865  N   LYS B 507      63.071 -36.406  49.767  1.00  0.84           N  
ATOM  10866  CA  LYS B 507      64.316 -37.117  49.886  1.00  0.84           C  
ATOM  10867  C   LYS B 507      65.546 -36.233  50.056  1.00  0.84           C  
ATOM  10868  O   LYS B 507      66.406 -36.532  50.880  1.00  0.84           O  
ATOM  10869  CB  LYS B 507      64.492 -38.003  48.637  1.00  0.84           C  
ATOM  10870  CG  LYS B 507      63.287 -38.913  48.317  1.00  0.84           C  
ATOM  10871  CD  LYS B 507      62.881 -39.913  49.422  1.00  0.84           C  
ATOM  10872  CE  LYS B 507      61.720 -40.813  48.971  1.00  0.84           C  
ATOM  10873  NZ  LYS B 507      61.305 -41.760  50.026  1.00  0.84           N  
ATOM  10874  N   ILE B 508      65.695 -35.144  49.265  1.00  0.88           N  
ATOM  10875  CA  ILE B 508      66.953 -34.387  49.245  1.00  0.88           C  
ATOM  10876  C   ILE B 508      66.834 -32.924  49.630  1.00  0.88           C  
ATOM  10877  O   ILE B 508      67.808 -32.175  49.548  1.00  0.88           O  
ATOM  10878  CB  ILE B 508      67.661 -34.465  47.890  1.00  0.88           C  
ATOM  10879  CG1 ILE B 508      66.839 -33.829  46.745  1.00  0.88           C  
ATOM  10880  CG2 ILE B 508      67.977 -35.946  47.599  1.00  0.88           C  
ATOM  10881  CD1 ILE B 508      67.635 -33.637  45.450  1.00  0.88           C  
ATOM  10882  N   GLY B 509      65.656 -32.461  50.088  1.00  0.89           N  
ATOM  10883  CA  GLY B 509      65.420 -31.044  50.361  1.00  0.89           C  
ATOM  10884  C   GLY B 509      65.247 -30.190  49.127  1.00  0.89           C  
ATOM  10885  O   GLY B 509      65.294 -30.667  48.001  1.00  0.89           O  
ATOM  10886  N   GLU B 510      65.021 -28.873  49.297  1.00  0.84           N  
ATOM  10887  CA  GLU B 510      64.657 -27.992  48.188  1.00  0.84           C  
ATOM  10888  C   GLU B 510      65.830 -27.290  47.509  1.00  0.84           C  
ATOM  10889  O   GLU B 510      65.634 -26.493  46.593  1.00  0.84           O  
ATOM  10890  CB  GLU B 510      63.693 -26.871  48.666  1.00  0.84           C  
ATOM  10891  CG  GLU B 510      62.219 -27.282  48.876  1.00  0.84           C  
ATOM  10892  CD  GLU B 510      61.393 -26.100  49.398  1.00  0.84           C  
ATOM  10893  OE1 GLU B 510      61.497 -24.963  48.838  1.00  0.84           O  
ATOM  10894  OE2 GLU B 510      60.668 -26.310  50.399  1.00  0.84           O  
ATOM  10895  N   GLU B 511      67.089 -27.586  47.886  1.00  0.82           N  
ATOM  10896  CA  GLU B 511      68.273 -26.948  47.317  1.00  0.82           C  
ATOM  10897  C   GLU B 511      68.423 -27.139  45.807  1.00  0.82           C  
ATOM  10898  O   GLU B 511      68.858 -26.243  45.090  1.00  0.82           O  
ATOM  10899  CB  GLU B 511      69.556 -27.435  48.035  1.00  0.82           C  
ATOM  10900  CG  GLU B 511      69.662 -26.974  49.514  1.00  0.82           C  
ATOM  10901  CD  GLU B 511      70.841 -27.580  50.280  1.00  0.82           C  
ATOM  10902  OE1 GLU B 511      71.424 -28.587  49.809  1.00  0.82           O  
ATOM  10903  OE2 GLU B 511      71.128 -27.056  51.384  1.00  0.82           O  
ATOM  10904  N   PHE B 512      67.993 -28.299  45.263  1.00  0.89           N  
ATOM  10905  CA  PHE B 512      68.069 -28.611  43.843  1.00  0.89           C  
ATOM  10906  C   PHE B 512      67.382 -27.626  42.903  1.00  0.89           C  
ATOM  10907  O   PHE B 512      67.761 -27.476  41.743  1.00  0.89           O  
ATOM  10908  CB  PHE B 512      67.599 -30.063  43.545  1.00  0.89           C  
ATOM  10909  CG  PHE B 512      66.117 -30.244  43.670  1.00  0.89           C  
ATOM  10910  CD1 PHE B 512      65.540 -30.522  44.911  1.00  0.89           C  
ATOM  10911  CD2 PHE B 512      65.289 -30.090  42.548  1.00  0.89           C  
ATOM  10912  CE1 PHE B 512      64.152 -30.600  45.045  1.00  0.89           C  
ATOM  10913  CE2 PHE B 512      63.899 -30.181  42.681  1.00  0.89           C  
ATOM  10914  CZ  PHE B 512      63.325 -30.429  43.930  1.00  0.89           C  
ATOM  10915  N   LEU B 513      66.358 -26.905  43.393  1.00  0.91           N  
ATOM  10916  CA  LEU B 513      65.625 -25.908  42.642  1.00  0.91           C  
ATOM  10917  C   LEU B 513      66.505 -24.769  42.139  1.00  0.91           C  
ATOM  10918  O   LEU B 513      66.215 -24.148  41.113  1.00  0.91           O  
ATOM  10919  CB  LEU B 513      64.484 -25.339  43.522  1.00  0.91           C  
ATOM  10920  CG  LEU B 513      63.370 -26.359  43.846  1.00  0.91           C  
ATOM  10921  CD1 LEU B 513      62.394 -25.792  44.882  1.00  0.91           C  
ATOM  10922  CD2 LEU B 513      62.583 -26.777  42.598  1.00  0.91           C  
ATOM  10923  N   THR B 514      67.608 -24.469  42.848  1.00  0.89           N  
ATOM  10924  CA  THR B 514      68.572 -23.453  42.438  1.00  0.89           C  
ATOM  10925  C   THR B 514      69.962 -24.012  42.242  1.00  0.89           C  
ATOM  10926  O   THR B 514      70.905 -23.264  42.003  1.00  0.89           O  
ATOM  10927  CB  THR B 514      68.665 -22.303  43.416  1.00  0.89           C  
ATOM  10928  OG1 THR B 514      68.747 -22.768  44.760  1.00  0.89           O  
ATOM  10929  CG2 THR B 514      67.377 -21.498  43.311  1.00  0.89           C  
ATOM  10930  N   ASP B 515      70.102 -25.346  42.275  1.00  0.87           N  
ATOM  10931  CA  ASP B 515      71.362 -26.032  42.079  1.00  0.87           C  
ATOM  10932  C   ASP B 515      71.052 -27.436  41.597  1.00  0.87           C  
ATOM  10933  O   ASP B 515      71.005 -28.411  42.340  1.00  0.87           O  
ATOM  10934  CB  ASP B 515      72.210 -26.088  43.371  1.00  0.87           C  
ATOM  10935  CG  ASP B 515      73.607 -26.632  43.098  1.00  0.87           C  
ATOM  10936  OD1 ASP B 515      73.998 -26.736  41.899  1.00  0.87           O  
ATOM  10937  OD2 ASP B 515      74.291 -26.981  44.087  1.00  0.87           O  
ATOM  10938  N   LEU B 516      70.786 -27.600  40.296  1.00  0.91           N  
ATOM  10939  CA  LEU B 516      70.193 -28.821  39.784  1.00  0.91           C  
ATOM  10940  C   LEU B 516      71.137 -30.017  39.806  1.00  0.91           C  
ATOM  10941  O   LEU B 516      70.716 -31.167  39.689  1.00  0.91           O  
ATOM  10942  CB  LEU B 516      69.614 -28.562  38.376  1.00  0.91           C  
ATOM  10943  CG  LEU B 516      68.480 -29.511  37.935  1.00  0.91           C  
ATOM  10944  CD1 LEU B 516      67.228 -29.308  38.798  1.00  0.91           C  
ATOM  10945  CD2 LEU B 516      68.149 -29.332  36.444  1.00  0.91           C  
ATOM  10946  N   SER B 517      72.453 -29.801  40.041  1.00  0.90           N  
ATOM  10947  CA  SER B 517      73.424 -30.882  40.181  1.00  0.90           C  
ATOM  10948  C   SER B 517      73.181 -31.743  41.404  1.00  0.90           C  
ATOM  10949  O   SER B 517      73.513 -32.930  41.435  1.00  0.90           O  
ATOM  10950  CB  SER B 517      74.903 -30.403  40.114  1.00  0.90           C  
ATOM  10951  OG  SER B 517      75.419 -29.787  41.287  1.00  0.90           O  
ATOM  10952  N   GLN B 518      72.469 -31.168  42.388  1.00  0.84           N  
ATOM  10953  CA  GLN B 518      71.972 -31.785  43.595  1.00  0.84           C  
ATOM  10954  C   GLN B 518      71.116 -33.020  43.347  1.00  0.84           C  
ATOM  10955  O   GLN B 518      71.079 -33.944  44.158  1.00  0.84           O  
ATOM  10956  CB  GLN B 518      71.140 -30.731  44.354  1.00  0.84           C  
ATOM  10957  CG  GLN B 518      70.951 -30.951  45.865  1.00  0.84           C  
ATOM  10958  CD  GLN B 518      72.207 -30.627  46.659  1.00  0.84           C  
ATOM  10959  OE1 GLN B 518      73.343 -30.589  46.162  1.00  0.84           O  
ATOM  10960  NE2 GLN B 518      72.048 -30.467  47.978  1.00  0.84           N  
ATOM  10961  N   LEU B 519      70.444 -33.098  42.172  1.00  0.89           N  
ATOM  10962  CA  LEU B 519      69.677 -34.257  41.748  1.00  0.89           C  
ATOM  10963  C   LEU B 519      70.486 -35.546  41.659  1.00  0.89           C  
ATOM  10964  O   LEU B 519      69.924 -36.632  41.763  1.00  0.89           O  
ATOM  10965  CB  LEU B 519      68.997 -34.025  40.376  1.00  0.89           C  
ATOM  10966  CG  LEU B 519      67.870 -32.973  40.353  1.00  0.89           C  
ATOM  10967  CD1 LEU B 519      67.264 -32.900  38.946  1.00  0.89           C  
ATOM  10968  CD2 LEU B 519      66.755 -33.291  41.354  1.00  0.89           C  
ATOM  10969  N   LYS B 520      71.836 -35.483  41.558  1.00  0.83           N  
ATOM  10970  CA  LYS B 520      72.701 -36.656  41.614  1.00  0.83           C  
ATOM  10971  C   LYS B 520      72.536 -37.450  42.906  1.00  0.83           C  
ATOM  10972  O   LYS B 520      72.737 -38.661  42.945  1.00  0.83           O  
ATOM  10973  CB  LYS B 520      74.195 -36.276  41.441  1.00  0.83           C  
ATOM  10974  CG  LYS B 520      74.540 -35.744  40.038  1.00  0.83           C  
ATOM  10975  CD  LYS B 520      76.030 -35.380  39.897  1.00  0.83           C  
ATOM  10976  CE  LYS B 520      76.400 -34.858  38.502  1.00  0.83           C  
ATOM  10977  NZ  LYS B 520      77.845 -34.539  38.448  1.00  0.83           N  
ATOM  10978  N   LYS B 521      72.090 -36.796  43.998  1.00  0.80           N  
ATOM  10979  CA  LYS B 521      71.685 -37.464  45.220  1.00  0.80           C  
ATOM  10980  C   LYS B 521      70.445 -38.368  45.106  1.00  0.80           C  
ATOM  10981  O   LYS B 521      70.033 -38.966  46.104  1.00  0.80           O  
ATOM  10982  CB  LYS B 521      71.391 -36.431  46.330  1.00  0.80           C  
ATOM  10983  CG  LYS B 521      72.570 -35.536  46.752  1.00  0.80           C  
ATOM  10984  CD  LYS B 521      72.102 -34.556  47.847  1.00  0.80           C  
ATOM  10985  CE  LYS B 521      73.136 -33.560  48.383  1.00  0.80           C  
ATOM  10986  NZ  LYS B 521      74.168 -34.268  49.164  1.00  0.80           N  
ATOM  10987  N   LEU B 522      69.839 -38.564  43.919  1.00  0.83           N  
ATOM  10988  CA  LEU B 522      68.749 -39.515  43.727  1.00  0.83           C  
ATOM  10989  C   LEU B 522      69.267 -40.872  43.255  1.00  0.83           C  
ATOM  10990  O   LEU B 522      68.565 -41.877  43.336  1.00  0.83           O  
ATOM  10991  CB  LEU B 522      67.727 -38.966  42.697  1.00  0.83           C  
ATOM  10992  CG  LEU B 522      66.640 -38.012  43.242  1.00  0.83           C  
ATOM  10993  CD1 LEU B 522      67.101 -37.067  44.353  1.00  0.83           C  
ATOM  10994  CD2 LEU B 522      66.060 -37.193  42.082  1.00  0.83           C  
ATOM  10995  N   LEU B 523      70.554 -40.970  42.852  1.00  0.83           N  
ATOM  10996  CA  LEU B 523      71.248 -42.235  42.614  1.00  0.83           C  
ATOM  10997  C   LEU B 523      71.290 -43.152  43.847  1.00  0.83           C  
ATOM  10998  O   LEU B 523      71.096 -44.356  43.663  1.00  0.83           O  
ATOM  10999  CB  LEU B 523      72.703 -41.985  42.113  1.00  0.83           C  
ATOM  11000  CG  LEU B 523      73.004 -42.103  40.600  1.00  0.83           C  
ATOM  11001  CD1 LEU B 523      71.806 -41.894  39.674  1.00  0.83           C  
ATOM  11002  CD2 LEU B 523      74.101 -41.093  40.229  1.00  0.83           C  
ATOM  11003  N   PRO B 524      71.489 -42.697  45.101  1.00  0.83           N  
ATOM  11004  CA  PRO B 524      71.347 -43.518  46.297  1.00  0.83           C  
ATOM  11005  C   PRO B 524      69.994 -44.172  46.470  1.00  0.83           C  
ATOM  11006  O   PRO B 524      69.888 -45.113  47.248  1.00  0.83           O  
ATOM  11007  CB  PRO B 524      71.659 -42.582  47.480  1.00  0.83           C  
ATOM  11008  CG  PRO B 524      72.547 -41.486  46.892  1.00  0.83           C  
ATOM  11009  CD  PRO B 524      72.151 -41.436  45.417  1.00  0.83           C  
ATOM  11010  N   LEU B 525      68.944 -43.676  45.794  1.00  0.83           N  
ATOM  11011  CA  LEU B 525      67.603 -44.194  45.941  1.00  0.83           C  
ATOM  11012  C   LEU B 525      67.147 -44.979  44.730  1.00  0.83           C  
ATOM  11013  O   LEU B 525      65.972 -45.312  44.595  1.00  0.83           O  
ATOM  11014  CB  LEU B 525      66.599 -43.050  46.173  1.00  0.83           C  
ATOM  11015  CG  LEU B 525      66.818 -42.248  47.465  1.00  0.83           C  
ATOM  11016  CD1 LEU B 525      65.817 -41.098  47.504  1.00  0.83           C  
ATOM  11017  CD2 LEU B 525      66.653 -43.098  48.732  1.00  0.83           C  
ATOM  11018  N   VAL B 526      68.064 -45.379  43.828  1.00  0.82           N  
ATOM  11019  CA  VAL B 526      67.712 -46.164  42.650  1.00  0.82           C  
ATOM  11020  C   VAL B 526      67.229 -47.573  43.005  1.00  0.82           C  
ATOM  11021  O   VAL B 526      66.579 -48.265  42.225  1.00  0.82           O  
ATOM  11022  CB  VAL B 526      68.885 -46.212  41.675  1.00  0.82           C  
ATOM  11023  CG1 VAL B 526      69.977 -47.195  42.147  1.00  0.82           C  
ATOM  11024  CG2 VAL B 526      68.369 -46.555  40.267  1.00  0.82           C  
ATOM  11025  N   SER B 527      67.538 -48.027  44.231  1.00  0.79           N  
ATOM  11026  CA  SER B 527      67.095 -49.291  44.783  1.00  0.79           C  
ATOM  11027  C   SER B 527      66.129 -49.131  45.944  1.00  0.79           C  
ATOM  11028  O   SER B 527      65.771 -50.115  46.586  1.00  0.79           O  
ATOM  11029  CB  SER B 527      68.309 -50.110  45.278  1.00  0.79           C  
ATOM  11030  OG  SER B 527      69.146 -49.322  46.129  1.00  0.79           O  
ATOM  11031  N   ASP B 528      65.648 -47.903  46.224  1.00  0.79           N  
ATOM  11032  CA  ASP B 528      64.653 -47.664  47.256  1.00  0.79           C  
ATOM  11033  C   ASP B 528      63.268 -47.997  46.717  1.00  0.79           C  
ATOM  11034  O   ASP B 528      62.748 -47.344  45.813  1.00  0.79           O  
ATOM  11035  CB  ASP B 528      64.736 -46.191  47.754  1.00  0.79           C  
ATOM  11036  CG  ASP B 528      63.799 -45.870  48.912  1.00  0.79           C  
ATOM  11037  OD1 ASP B 528      63.968 -46.481  49.991  1.00  0.79           O  
ATOM  11038  OD2 ASP B 528      62.891 -45.009  48.745  1.00  0.79           O  
ATOM  11039  N   GLU B 529      62.622 -49.033  47.287  1.00  0.76           N  
ATOM  11040  CA  GLU B 529      61.316 -49.513  46.862  1.00  0.76           C  
ATOM  11041  C   GLU B 529      60.234 -48.449  46.970  1.00  0.76           C  
ATOM  11042  O   GLU B 529      59.366 -48.306  46.108  1.00  0.76           O  
ATOM  11043  CB  GLU B 529      60.887 -50.753  47.685  1.00  0.76           C  
ATOM  11044  CG  GLU B 529      61.745 -52.024  47.430  1.00  0.76           C  
ATOM  11045  CD  GLU B 529      61.549 -52.676  46.052  1.00  0.76           C  
ATOM  11046  OE1 GLU B 529      62.308 -53.633  45.746  1.00  0.76           O  
ATOM  11047  OE2 GLU B 529      60.633 -52.264  45.292  1.00  0.76           O  
ATOM  11048  N   VAL B 530      60.277 -47.628  48.041  1.00  0.83           N  
ATOM  11049  CA  VAL B 530      59.377 -46.501  48.199  1.00  0.83           C  
ATOM  11050  C   VAL B 530      59.572 -45.452  47.113  1.00  0.83           C  
ATOM  11051  O   VAL B 530      58.621 -45.091  46.430  1.00  0.83           O  
ATOM  11052  CB  VAL B 530      59.547 -45.906  49.595  1.00  0.83           C  
ATOM  11053  CG1 VAL B 530      58.765 -44.594  49.779  1.00  0.83           C  
ATOM  11054  CG2 VAL B 530      59.070 -46.942  50.631  1.00  0.83           C  
ATOM  11055  N   PHE B 531      60.818 -45.010  46.843  1.00  0.81           N  
ATOM  11056  CA  PHE B 531      61.111 -44.051  45.791  1.00  0.81           C  
ATOM  11057  C   PHE B 531      60.734 -44.530  44.398  1.00  0.81           C  
ATOM  11058  O   PHE B 531      60.114 -43.794  43.634  1.00  0.81           O  
ATOM  11059  CB  PHE B 531      62.616 -43.687  45.832  1.00  0.81           C  
ATOM  11060  CG  PHE B 531      62.952 -42.456  45.041  1.00  0.81           C  
ATOM  11061  CD1 PHE B 531      62.346 -41.223  45.329  1.00  0.81           C  
ATOM  11062  CD2 PHE B 531      63.912 -42.519  44.021  1.00  0.81           C  
ATOM  11063  CE1 PHE B 531      62.690 -40.071  44.614  1.00  0.81           C  
ATOM  11064  CE2 PHE B 531      64.258 -41.371  43.301  1.00  0.81           C  
ATOM  11065  CZ  PHE B 531      63.638 -40.150  43.590  1.00  0.81           C  
ATOM  11066  N   ILE B 532      61.033 -45.799  44.046  1.00  0.83           N  
ATOM  11067  CA  ILE B 532      60.636 -46.388  42.771  1.00  0.83           C  
ATOM  11068  C   ILE B 532      59.123 -46.360  42.601  1.00  0.83           C  
ATOM  11069  O   ILE B 532      58.590 -45.944  41.570  1.00  0.83           O  
ATOM  11070  CB  ILE B 532      61.140 -47.828  42.654  1.00  0.83           C  
ATOM  11071  CG1 ILE B 532      62.685 -47.863  42.620  1.00  0.83           C  
ATOM  11072  CG2 ILE B 532      60.557 -48.535  41.405  1.00  0.83           C  
ATOM  11073  CD1 ILE B 532      63.240 -49.275  42.825  1.00  0.83           C  
ATOM  11074  N   ARG B 533      58.381 -46.747  43.654  1.00  0.76           N  
ATOM  11075  CA  ARG B 533      56.937 -46.676  43.665  1.00  0.76           C  
ATOM  11076  C   ARG B 533      56.387 -45.258  43.559  1.00  0.76           C  
ATOM  11077  O   ARG B 533      55.478 -44.994  42.772  1.00  0.76           O  
ATOM  11078  CB  ARG B 533      56.420 -47.354  44.953  1.00  0.76           C  
ATOM  11079  CG  ARG B 533      54.888 -47.376  45.088  1.00  0.76           C  
ATOM  11080  CD  ARG B 533      54.376 -48.007  46.395  1.00  0.76           C  
ATOM  11081  NE  ARG B 533      55.029 -47.368  47.592  1.00  0.76           N  
ATOM  11082  CZ  ARG B 533      54.868 -46.087  47.966  1.00  0.76           C  
ATOM  11083  NH1 ARG B 533      54.129 -45.243  47.261  1.00  0.76           N  
ATOM  11084  NH2 ARG B 533      55.443 -45.641  49.076  1.00  0.76           N  
ATOM  11085  N   ASP B 534      56.928 -44.300  44.332  1.00  0.87           N  
ATOM  11086  CA  ASP B 534      56.501 -42.917  44.297  1.00  0.87           C  
ATOM  11087  C   ASP B 534      56.804 -42.200  42.973  1.00  0.87           C  
ATOM  11088  O   ASP B 534      55.967 -41.462  42.458  1.00  0.87           O  
ATOM  11089  CB  ASP B 534      57.035 -42.152  45.533  1.00  0.87           C  
ATOM  11090  CG  ASP B 534      56.397 -42.695  46.806  1.00  0.87           C  
ATOM  11091  OD1 ASP B 534      55.149 -42.903  46.826  1.00  0.87           O  
ATOM  11092  OD2 ASP B 534      57.129 -42.953  47.792  1.00  0.87           O  
ATOM  11093  N   VAL B 535      57.973 -42.431  42.332  1.00  0.90           N  
ATOM  11094  CA  VAL B 535      58.275 -41.897  40.999  1.00  0.90           C  
ATOM  11095  C   VAL B 535      57.310 -42.395  39.925  1.00  0.90           C  
ATOM  11096  O   VAL B 535      56.795 -41.624  39.112  1.00  0.90           O  
ATOM  11097  CB  VAL B 535      59.707 -42.237  40.581  1.00  0.90           C  
ATOM  11098  CG1 VAL B 535      59.987 -41.891  39.102  1.00  0.90           C  
ATOM  11099  CG2 VAL B 535      60.698 -41.455  41.461  1.00  0.90           C  
ATOM  11100  N   ALA B 536      57.002 -43.708  39.919  1.00  0.88           N  
ATOM  11101  CA  ALA B 536      56.029 -44.292  39.015  1.00  0.88           C  
ATOM  11102  C   ALA B 536      54.615 -43.761  39.228  1.00  0.88           C  
ATOM  11103  O   ALA B 536      53.866 -43.507  38.284  1.00  0.88           O  
ATOM  11104  CB  ALA B 536      56.041 -45.821  39.179  1.00  0.88           C  
ATOM  11105  N   LYS B 537      54.227 -43.561  40.500  1.00  0.85           N  
ATOM  11106  CA  LYS B 537      52.954 -42.990  40.880  1.00  0.85           C  
ATOM  11107  C   LYS B 537      52.726 -41.573  40.396  1.00  0.85           C  
ATOM  11108  O   LYS B 537      51.680 -41.288  39.819  1.00  0.85           O  
ATOM  11109  CB  LYS B 537      52.833 -43.019  42.412  1.00  0.85           C  
ATOM  11110  CG  LYS B 537      51.477 -42.541  42.935  1.00  0.85           C  
ATOM  11111  CD  LYS B 537      51.411 -42.637  44.460  1.00  0.85           C  
ATOM  11112  CE  LYS B 537      50.068 -42.150  44.993  1.00  0.85           C  
ATOM  11113  NZ  LYS B 537      50.064 -42.231  46.464  1.00  0.85           N  
ATOM  11114  N   VAL B 538      53.728 -40.675  40.533  1.00  0.90           N  
ATOM  11115  CA  VAL B 538      53.663 -39.314  40.004  1.00  0.90           C  
ATOM  11116  C   VAL B 538      53.443 -39.330  38.507  1.00  0.90           C  
ATOM  11117  O   VAL B 538      52.654 -38.575  37.940  1.00  0.90           O  
ATOM  11118  CB  VAL B 538      54.959 -38.551  40.259  1.00  0.90           C  
ATOM  11119  CG1 VAL B 538      54.960 -37.195  39.526  1.00  0.90           C  
ATOM  11120  CG2 VAL B 538      55.125 -38.304  41.767  1.00  0.90           C  
ATOM  11121  N   LYS B 539      54.139 -40.242  37.805  1.00  0.90           N  
ATOM  11122  CA  LYS B 539      53.971 -40.392  36.383  1.00  0.90           C  
ATOM  11123  C   LYS B 539      52.569 -40.813  35.985  1.00  0.90           C  
ATOM  11124  O   LYS B 539      51.961 -40.215  35.102  1.00  0.90           O  
ATOM  11125  CB  LYS B 539      55.017 -41.385  35.825  1.00  0.90           C  
ATOM  11126  CG  LYS B 539      55.374 -41.099  34.366  1.00  0.90           C  
ATOM  11127  CD  LYS B 539      56.142 -39.775  34.228  1.00  0.90           C  
ATOM  11128  CE  LYS B 539      56.439 -39.477  32.775  1.00  0.90           C  
ATOM  11129  NZ  LYS B 539      56.977 -38.115  32.605  1.00  0.90           N  
ATOM  11130  N   GLN B 540      51.996 -41.799  36.699  1.00  0.86           N  
ATOM  11131  CA  GLN B 540      50.629 -42.242  36.514  1.00  0.86           C  
ATOM  11132  C   GLN B 540      49.607 -41.143  36.806  1.00  0.86           C  
ATOM  11133  O   GLN B 540      48.680 -40.911  36.029  1.00  0.86           O  
ATOM  11134  CB  GLN B 540      50.390 -43.517  37.366  1.00  0.86           C  
ATOM  11135  CG  GLN B 540      49.143 -44.343  36.969  1.00  0.86           C  
ATOM  11136  CD  GLN B 540      49.241 -44.882  35.539  1.00  0.86           C  
ATOM  11137  OE1 GLN B 540      48.916 -44.212  34.562  1.00  0.86           O  
ATOM  11138  NE2 GLN B 540      49.710 -46.144  35.400  1.00  0.86           N  
ATOM  11139  N   GLU B 541      49.803 -40.367  37.891  1.00  0.85           N  
ATOM  11140  CA  GLU B 541      49.007 -39.190  38.207  1.00  0.85           C  
ATOM  11141  C   GLU B 541      49.044 -38.133  37.110  1.00  0.85           C  
ATOM  11142  O   GLU B 541      48.006 -37.639  36.665  1.00  0.85           O  
ATOM  11143  CB  GLU B 541      49.510 -38.553  39.525  1.00  0.85           C  
ATOM  11144  CG  GLU B 541      49.037 -39.311  40.788  1.00  0.85           C  
ATOM  11145  CD  GLU B 541      49.666 -38.780  42.074  1.00  0.85           C  
ATOM  11146  OE1 GLU B 541      50.060 -37.589  42.114  1.00  0.85           O  
ATOM  11147  OE2 GLU B 541      49.736 -39.581  43.045  1.00  0.85           O  
ATOM  11148  N   ASN B 542      50.241 -37.809  36.582  1.00  0.90           N  
ATOM  11149  CA  ASN B 542      50.397 -36.901  35.460  1.00  0.90           C  
ATOM  11150  C   ASN B 542      49.734 -37.397  34.186  1.00  0.90           C  
ATOM  11151  O   ASN B 542      49.100 -36.622  33.472  1.00  0.90           O  
ATOM  11152  CB  ASN B 542      51.885 -36.624  35.159  1.00  0.90           C  
ATOM  11153  CG  ASN B 542      52.486 -35.749  36.251  1.00  0.90           C  
ATOM  11154  OD1 ASN B 542      51.813 -34.963  36.914  1.00  0.90           O  
ATOM  11155  ND2 ASN B 542      53.827 -35.843  36.397  1.00  0.90           N  
ATOM  11156  N   LYS B 543      49.823 -38.704  33.872  1.00  0.89           N  
ATOM  11157  CA  LYS B 543      49.105 -39.285  32.751  1.00  0.89           C  
ATOM  11158  C   LYS B 543      47.599 -39.150  32.851  1.00  0.89           C  
ATOM  11159  O   LYS B 543      46.950 -38.691  31.917  1.00  0.89           O  
ATOM  11160  CB  LYS B 543      49.380 -40.793  32.655  1.00  0.89           C  
ATOM  11161  CG  LYS B 543      50.777 -41.127  32.150  1.00  0.89           C  
ATOM  11162  CD  LYS B 543      50.917 -42.640  32.022  1.00  0.89           C  
ATOM  11163  CE  LYS B 543      52.116 -43.012  31.184  1.00  0.89           C  
ATOM  11164  NZ  LYS B 543      52.107 -44.439  30.841  1.00  0.89           N  
ATOM  11165  N   LEU B 544      47.009 -39.488  34.014  1.00  0.87           N  
ATOM  11166  CA  LEU B 544      45.591 -39.315  34.286  1.00  0.87           C  
ATOM  11167  C   LEU B 544      45.154 -37.863  34.204  1.00  0.87           C  
ATOM  11168  O   LEU B 544      44.124 -37.532  33.616  1.00  0.87           O  
ATOM  11169  CB  LEU B 544      45.252 -39.826  35.706  1.00  0.87           C  
ATOM  11170  CG  LEU B 544      45.350 -41.351  35.888  1.00  0.87           C  
ATOM  11171  CD1 LEU B 544      45.301 -41.709  37.378  1.00  0.87           C  
ATOM  11172  CD2 LEU B 544      44.220 -42.066  35.145  1.00  0.87           C  
ATOM  11173  N   LYS B 545      45.959 -36.945  34.768  1.00  0.83           N  
ATOM  11174  CA  LYS B 545      45.720 -35.519  34.697  1.00  0.83           C  
ATOM  11175  C   LYS B 545      45.752 -34.971  33.278  1.00  0.83           C  
ATOM  11176  O   LYS B 545      44.878 -34.204  32.875  1.00  0.83           O  
ATOM  11177  CB  LYS B 545      46.767 -34.771  35.553  1.00  0.83           C  
ATOM  11178  CG  LYS B 545      46.513 -33.261  35.679  1.00  0.83           C  
ATOM  11179  CD  LYS B 545      47.620 -32.573  36.489  1.00  0.83           C  
ATOM  11180  CE  LYS B 545      47.413 -31.064  36.686  1.00  0.83           C  
ATOM  11181  NZ  LYS B 545      46.229 -30.774  37.538  1.00  0.83           N  
ATOM  11182  N   PHE B 546      46.750 -35.375  32.469  1.00  0.88           N  
ATOM  11183  CA  PHE B 546      46.842 -34.984  31.079  1.00  0.88           C  
ATOM  11184  C   PHE B 546      45.703 -35.524  30.247  1.00  0.88           C  
ATOM  11185  O   PHE B 546      45.094 -34.775  29.489  1.00  0.88           O  
ATOM  11186  CB  PHE B 546      48.195 -35.439  30.490  1.00  0.88           C  
ATOM  11187  CG  PHE B 546      48.420 -34.860  29.125  1.00  0.88           C  
ATOM  11188  CD1 PHE B 546      48.523 -33.470  28.955  1.00  0.88           C  
ATOM  11189  CD2 PHE B 546      48.486 -35.695  28.004  1.00  0.88           C  
ATOM  11190  CE1 PHE B 546      48.670 -32.916  27.677  1.00  0.88           C  
ATOM  11191  CE2 PHE B 546      48.652 -35.142  26.733  1.00  0.88           C  
ATOM  11192  CZ  PHE B 546      48.738 -33.759  26.562  1.00  0.88           C  
ATOM  11193  N   SER B 547      45.341 -36.808  30.443  1.00  0.86           N  
ATOM  11194  CA  SER B 547      44.204 -37.475  29.833  1.00  0.86           C  
ATOM  11195  C   SER B 547      42.910 -36.740  30.101  1.00  0.86           C  
ATOM  11196  O   SER B 547      42.117 -36.471  29.202  1.00  0.86           O  
ATOM  11197  CB  SER B 547      44.012 -38.885  30.455  1.00  0.86           C  
ATOM  11198  OG  SER B 547      45.060 -39.790  30.096  1.00  0.86           O  
ATOM  11199  N   ALA B 548      42.696 -36.341  31.369  1.00  0.85           N  
ATOM  11200  CA  ALA B 548      41.565 -35.542  31.767  1.00  0.85           C  
ATOM  11201  C   ALA B 548      41.529 -34.167  31.132  1.00  0.85           C  
ATOM  11202  O   ALA B 548      40.489 -33.747  30.639  1.00  0.85           O  
ATOM  11203  CB  ALA B 548      41.573 -35.397  33.298  1.00  0.85           C  
ATOM  11204  N   PHE B 549      42.654 -33.430  31.088  1.00  0.80           N  
ATOM  11205  CA  PHE B 549      42.711 -32.131  30.434  1.00  0.80           C  
ATOM  11206  C   PHE B 549      42.405 -32.239  28.939  1.00  0.80           C  
ATOM  11207  O   PHE B 549      41.608 -31.492  28.377  1.00  0.80           O  
ATOM  11208  CB  PHE B 549      44.104 -31.495  30.709  1.00  0.80           C  
ATOM  11209  CG  PHE B 549      44.249 -30.128  30.094  1.00  0.80           C  
ATOM  11210  CD1 PHE B 549      44.974 -29.978  28.901  1.00  0.80           C  
ATOM  11211  CD2 PHE B 549      43.632 -29.004  30.666  1.00  0.80           C  
ATOM  11212  CE1 PHE B 549      45.057 -28.731  28.269  1.00  0.80           C  
ATOM  11213  CE2 PHE B 549      43.715 -27.753  30.039  1.00  0.80           C  
ATOM  11214  CZ  PHE B 549      44.420 -27.620  28.835  1.00  0.80           C  
ATOM  11215  N   LEU B 550      42.988 -33.251  28.285  1.00  0.78           N  
ATOM  11216  CA  LEU B 550      42.789 -33.560  26.891  1.00  0.78           C  
ATOM  11217  C   LEU B 550      41.355 -33.891  26.503  1.00  0.78           C  
ATOM  11218  O   LEU B 550      40.892 -33.421  25.471  1.00  0.78           O  
ATOM  11219  CB  LEU B 550      43.723 -34.733  26.533  1.00  0.78           C  
ATOM  11220  CG  LEU B 550      44.790 -34.490  25.464  1.00  0.78           C  
ATOM  11221  CD1 LEU B 550      45.643 -33.276  25.790  1.00  0.78           C  
ATOM  11222  CD2 LEU B 550      45.677 -35.744  25.379  1.00  0.78           C  
ATOM  11223  N   GLU B 551      40.596 -34.680  27.300  1.00  0.73           N  
ATOM  11224  CA  GLU B 551      39.226 -35.014  26.915  1.00  0.73           C  
ATOM  11225  C   GLU B 551      38.195 -34.018  27.439  1.00  0.73           C  
ATOM  11226  O   GLU B 551      37.008 -34.086  27.126  1.00  0.73           O  
ATOM  11227  CB  GLU B 551      38.838 -36.462  27.326  1.00  0.73           C  
ATOM  11228  CG  GLU B 551      37.627 -36.997  26.512  1.00  0.73           C  
ATOM  11229  CD  GLU B 551      37.461 -38.510  26.482  1.00  0.73           C  
ATOM  11230  OE1 GLU B 551      36.485 -38.947  25.802  1.00  0.73           O  
ATOM  11231  OE2 GLU B 551      38.315 -39.252  27.024  1.00  0.73           O  
ATOM  11232  N   LYS B 552      38.622 -33.018  28.233  1.00  0.74           N  
ATOM  11233  CA  LYS B 552      37.718 -31.987  28.712  1.00  0.74           C  
ATOM  11234  C   LYS B 552      37.881 -30.660  27.986  1.00  0.74           C  
ATOM  11235  O   LYS B 552      36.927 -29.891  27.916  1.00  0.74           O  
ATOM  11236  CB  LYS B 552      37.940 -31.765  30.227  1.00  0.74           C  
ATOM  11237  CG  LYS B 552      37.522 -32.977  31.079  1.00  0.74           C  
ATOM  11238  CD  LYS B 552      37.861 -32.787  32.566  1.00  0.74           C  
ATOM  11239  CE  LYS B 552      37.571 -34.034  33.402  1.00  0.74           C  
ATOM  11240  NZ  LYS B 552      37.824 -33.733  34.828  1.00  0.74           N  
ATOM  11241  N   GLU B 553      39.062 -30.375  27.398  1.00  0.72           N  
ATOM  11242  CA  GLU B 553      39.289 -29.151  26.632  1.00  0.72           C  
ATOM  11243  C   GLU B 553      39.274 -29.425  25.126  1.00  0.72           C  
ATOM  11244  O   GLU B 553      39.208 -28.536  24.280  1.00  0.72           O  
ATOM  11245  CB  GLU B 553      40.663 -28.570  27.052  1.00  0.72           C  
ATOM  11246  CG  GLU B 553      40.925 -27.106  26.616  1.00  0.72           C  
ATOM  11247  CD  GLU B 553      39.987 -26.103  27.288  1.00  0.72           C  
ATOM  11248  OE1 GLU B 553      40.002 -26.050  28.546  1.00  0.72           O  
ATOM  11249  OE2 GLU B 553      39.293 -25.353  26.556  1.00  0.72           O  
ATOM  11250  N   TYR B 554      39.280 -30.714  24.744  1.00  0.77           N  
ATOM  11251  CA  TYR B 554      39.278 -31.172  23.368  1.00  0.77           C  
ATOM  11252  C   TYR B 554      38.567 -32.517  23.344  1.00  0.77           C  
ATOM  11253  O   TYR B 554      38.090 -33.003  24.365  1.00  0.77           O  
ATOM  11254  CB  TYR B 554      40.701 -31.414  22.787  1.00  0.77           C  
ATOM  11255  CG  TYR B 554      41.579 -30.200  22.846  1.00  0.77           C  
ATOM  11256  CD1 TYR B 554      41.431 -29.145  21.928  1.00  0.77           C  
ATOM  11257  CD2 TYR B 554      42.602 -30.131  23.805  1.00  0.77           C  
ATOM  11258  CE1 TYR B 554      42.293 -28.037  21.970  1.00  0.77           C  
ATOM  11259  CE2 TYR B 554      43.460 -29.026  23.852  1.00  0.77           C  
ATOM  11260  CZ  TYR B 554      43.304 -27.981  22.933  1.00  0.77           C  
ATOM  11261  OH  TYR B 554      44.195 -26.894  22.998  1.00  0.77           O  
ATOM  11262  N   LYS B 555      38.467 -33.192  22.179  1.00  0.64           N  
ATOM  11263  CA  LYS B 555      38.067 -34.589  22.178  1.00  0.64           C  
ATOM  11264  C   LYS B 555      39.310 -35.470  22.257  1.00  0.64           C  
ATOM  11265  O   LYS B 555      40.207 -35.370  21.421  1.00  0.64           O  
ATOM  11266  CB  LYS B 555      37.248 -34.978  20.914  1.00  0.64           C  
ATOM  11267  CG  LYS B 555      36.183 -36.086  21.102  1.00  0.64           C  
ATOM  11268  CD  LYS B 555      36.656 -37.325  21.875  1.00  0.64           C  
ATOM  11269  CE  LYS B 555      35.559 -38.320  22.222  1.00  0.64           C  
ATOM  11270  NZ  LYS B 555      36.062 -39.259  23.240  1.00  0.64           N  
ATOM  11271  N   VAL B 556      39.379 -36.389  23.236  1.00  0.71           N  
ATOM  11272  CA  VAL B 556      40.463 -37.340  23.335  1.00  0.71           C  
ATOM  11273  C   VAL B 556      39.976 -38.747  23.596  1.00  0.71           C  
ATOM  11274  O   VAL B 556      38.777 -38.996  23.752  1.00  0.71           O  
ATOM  11275  CB  VAL B 556      41.525 -36.822  24.295  1.00  0.71           C  
ATOM  11276  CG1 VAL B 556      41.879 -37.756  25.479  1.00  0.71           C  
ATOM  11277  CG2 VAL B 556      42.728 -36.505  23.397  1.00  0.71           C  
ATOM  11278  N   LYS B 557      40.869 -39.748  23.557  1.00  0.70           N  
ATOM  11279  CA  LYS B 557      40.574 -41.023  24.169  1.00  0.70           C  
ATOM  11280  C   LYS B 557      41.825 -41.569  24.786  1.00  0.70           C  
ATOM  11281  O   LYS B 557      42.902 -41.518  24.194  1.00  0.70           O  
ATOM  11282  CB  LYS B 557      40.114 -42.113  23.177  1.00  0.70           C  
ATOM  11283  CG  LYS B 557      38.784 -41.796  22.502  1.00  0.70           C  
ATOM  11284  CD  LYS B 557      38.401 -42.858  21.477  1.00  0.70           C  
ATOM  11285  CE  LYS B 557      37.103 -42.492  20.773  1.00  0.70           C  
ATOM  11286  NZ  LYS B 557      36.797 -43.525  19.769  1.00  0.70           N  
ATOM  11287  N   ILE B 558      41.730 -42.173  25.973  1.00  0.80           N  
ATOM  11288  CA  ILE B 558      42.916 -42.598  26.683  1.00  0.80           C  
ATOM  11289  C   ILE B 558      42.824 -44.004  27.178  1.00  0.80           C  
ATOM  11290  O   ILE B 558      41.773 -44.633  27.225  1.00  0.80           O  
ATOM  11291  CB  ILE B 558      43.274 -41.706  27.850  1.00  0.80           C  
ATOM  11292  CG1 ILE B 558      42.161 -41.624  28.935  1.00  0.80           C  
ATOM  11293  CG2 ILE B 558      43.672 -40.353  27.237  1.00  0.80           C  
ATOM  11294  CD1 ILE B 558      40.931 -40.758  28.628  1.00  0.80           C  
ATOM  11295  N   ASN B 559      43.986 -44.571  27.474  1.00  0.84           N  
ATOM  11296  CA  ASN B 559      44.101 -45.774  28.240  1.00  0.84           C  
ATOM  11297  C   ASN B 559      45.340 -45.460  29.039  1.00  0.84           C  
ATOM  11298  O   ASN B 559      46.413 -45.766  28.535  1.00  0.84           O  
ATOM  11299  CB  ASN B 559      44.289 -46.983  27.289  1.00  0.84           C  
ATOM  11300  CG  ASN B 559      44.800 -48.220  28.021  1.00  0.84           C  
ATOM  11301  OD1 ASN B 559      44.372 -48.493  29.143  1.00  0.84           O  
ATOM  11302  ND2 ASN B 559      45.765 -48.930  27.399  1.00  0.84           N  
ATOM  11303  N   PRO B 560      45.316 -44.821  30.198  1.00  0.89           N  
ATOM  11304  CA  PRO B 560      46.515 -44.236  30.813  1.00  0.89           C  
ATOM  11305  C   PRO B 560      47.563 -45.255  31.225  1.00  0.89           C  
ATOM  11306  O   PRO B 560      48.679 -44.892  31.558  1.00  0.89           O  
ATOM  11307  CB  PRO B 560      45.957 -43.465  32.027  1.00  0.89           C  
ATOM  11308  CG  PRO B 560      44.523 -43.982  32.211  1.00  0.89           C  
ATOM  11309  CD  PRO B 560      44.091 -44.297  30.796  1.00  0.89           C  
ATOM  11310  N   SER B 561      47.260 -46.557  31.161  1.00  0.89           N  
ATOM  11311  CA  SER B 561      48.272 -47.580  31.318  1.00  0.89           C  
ATOM  11312  C   SER B 561      49.181 -47.715  30.105  1.00  0.89           C  
ATOM  11313  O   SER B 561      50.315 -48.190  30.215  1.00  0.89           O  
ATOM  11314  CB  SER B 561      47.593 -48.928  31.642  1.00  0.89           C  
ATOM  11315  OG  SER B 561      46.783 -49.390  30.563  1.00  0.89           O  
ATOM  11316  N   SER B 562      48.732 -47.237  28.926  1.00  0.94           N  
ATOM  11317  CA  SER B 562      49.514 -47.208  27.708  1.00  0.94           C  
ATOM  11318  C   SER B 562      50.779 -46.392  27.815  1.00  0.94           C  
ATOM  11319  O   SER B 562      50.885 -45.431  28.578  1.00  0.94           O  
ATOM  11320  CB  SER B 562      48.751 -46.735  26.439  1.00  0.94           C  
ATOM  11321  OG  SER B 562      48.451 -45.340  26.451  1.00  0.94           O  
ATOM  11322  N   MET B 563      51.795 -46.782  27.037  1.00  0.93           N  
ATOM  11323  CA  MET B 563      53.024 -46.038  26.938  1.00  0.93           C  
ATOM  11324  C   MET B 563      52.803 -44.743  26.170  1.00  0.93           C  
ATOM  11325  O   MET B 563      52.324 -44.735  25.035  1.00  0.93           O  
ATOM  11326  CB  MET B 563      54.133 -46.921  26.320  1.00  0.93           C  
ATOM  11327  CG  MET B 563      55.567 -46.486  26.673  1.00  0.93           C  
ATOM  11328  SD  MET B 563      56.162 -45.027  25.785  1.00  0.93           S  
ATOM  11329  CE  MET B 563      56.489 -45.811  24.197  1.00  0.93           C  
ATOM  11330  N   PHE B 564      53.108 -43.600  26.802  1.00  0.95           N  
ATOM  11331  CA  PHE B 564      52.897 -42.291  26.218  1.00  0.95           C  
ATOM  11332  C   PHE B 564      54.143 -41.879  25.453  1.00  0.95           C  
ATOM  11333  O   PHE B 564      55.132 -41.409  26.017  1.00  0.95           O  
ATOM  11334  CB  PHE B 564      52.536 -41.211  27.283  1.00  0.95           C  
ATOM  11335  CG  PHE B 564      51.081 -41.182  27.710  1.00  0.95           C  
ATOM  11336  CD1 PHE B 564      50.199 -42.270  27.563  1.00  0.95           C  
ATOM  11337  CD2 PHE B 564      50.581 -40.001  28.294  1.00  0.95           C  
ATOM  11338  CE1 PHE B 564      48.859 -42.173  27.959  1.00  0.95           C  
ATOM  11339  CE2 PHE B 564      49.238 -39.893  28.681  1.00  0.95           C  
ATOM  11340  CZ  PHE B 564      48.375 -40.980  28.507  1.00  0.95           C  
ATOM  11341  N   ASP B 565      54.083 -42.054  24.124  1.00  0.97           N  
ATOM  11342  CA  ASP B 565      55.129 -41.778  23.171  1.00  0.97           C  
ATOM  11343  C   ASP B 565      54.894 -40.392  22.603  1.00  0.97           C  
ATOM  11344  O   ASP B 565      53.904 -40.149  21.913  1.00  0.97           O  
ATOM  11345  CB  ASP B 565      55.033 -42.875  22.079  1.00  0.97           C  
ATOM  11346  CG  ASP B 565      56.187 -42.890  21.101  1.00  0.97           C  
ATOM  11347  OD1 ASP B 565      57.104 -42.048  21.221  1.00  0.97           O  
ATOM  11348  OD2 ASP B 565      56.207 -43.819  20.246  1.00  0.97           O  
ATOM  11349  N   VAL B 566      55.761 -39.423  22.937  1.00  0.99           N  
ATOM  11350  CA  VAL B 566      55.470 -38.029  22.656  1.00  0.99           C  
ATOM  11351  C   VAL B 566      56.583 -37.358  21.878  1.00  0.99           C  
ATOM  11352  O   VAL B 566      57.741 -37.277  22.299  1.00  0.99           O  
ATOM  11353  CB  VAL B 566      55.159 -37.231  23.927  1.00  0.99           C  
ATOM  11354  CG1 VAL B 566      54.871 -35.750  23.612  1.00  0.99           C  
ATOM  11355  CG2 VAL B 566      53.936 -37.821  24.659  1.00  0.99           C  
ATOM  11356  N   HIS B 567      56.224 -36.790  20.711  1.00  0.97           N  
ATOM  11357  CA  HIS B 567      57.116 -35.949  19.941  1.00  0.97           C  
ATOM  11358  C   HIS B 567      56.506 -34.568  19.830  1.00  0.97           C  
ATOM  11359  O   HIS B 567      55.635 -34.317  18.997  1.00  0.97           O  
ATOM  11360  CB  HIS B 567      57.328 -36.518  18.517  1.00  0.97           C  
ATOM  11361  CG  HIS B 567      58.384 -35.823  17.691  1.00  0.97           C  
ATOM  11362  ND1 HIS B 567      59.668 -36.323  17.617  1.00  0.97           N  
ATOM  11363  CD2 HIS B 567      58.251 -34.786  16.831  1.00  0.97           C  
ATOM  11364  CE1 HIS B 567      60.285 -35.606  16.711  1.00  0.97           C  
ATOM  11365  NE2 HIS B 567      59.474 -34.656  16.199  1.00  0.97           N  
ATOM  11366  N   VAL B 568      56.970 -33.609  20.653  1.00  0.97           N  
ATOM  11367  CA  VAL B 568      56.468 -32.242  20.600  1.00  0.97           C  
ATOM  11368  C   VAL B 568      57.594 -31.260  20.358  1.00  0.97           C  
ATOM  11369  O   VAL B 568      58.623 -31.265  21.038  1.00  0.97           O  
ATOM  11370  CB  VAL B 568      55.643 -31.789  21.799  1.00  0.97           C  
ATOM  11371  CG1 VAL B 568      54.270 -32.483  21.786  1.00  0.97           C  
ATOM  11372  CG2 VAL B 568      56.375 -32.057  23.120  1.00  0.97           C  
ATOM  11373  N   LYS B 569      57.406 -30.388  19.347  1.00  0.89           N  
ATOM  11374  CA  LYS B 569      58.405 -29.485  18.802  1.00  0.89           C  
ATOM  11375  C   LYS B 569      57.880 -28.987  17.476  1.00  0.89           C  
ATOM  11376  O   LYS B 569      56.948 -29.556  16.919  1.00  0.89           O  
ATOM  11377  CB  LYS B 569      59.819 -30.103  18.588  1.00  0.89           C  
ATOM  11378  CG  LYS B 569      59.838 -31.411  17.777  1.00  0.89           C  
ATOM  11379  CD  LYS B 569      61.225 -32.076  17.773  1.00  0.89           C  
ATOM  11380  CE  LYS B 569      61.596 -32.795  19.075  1.00  0.89           C  
ATOM  11381  NZ  LYS B 569      63.069 -32.887  19.179  1.00  0.89           N  
ATOM  11382  N   ARG B 570      58.431 -27.883  16.930  1.00  0.87           N  
ATOM  11383  CA  ARG B 570      58.041 -27.393  15.616  1.00  0.87           C  
ATOM  11384  C   ARG B 570      58.206 -28.432  14.511  1.00  0.87           C  
ATOM  11385  O   ARG B 570      59.091 -29.286  14.554  1.00  0.87           O  
ATOM  11386  CB  ARG B 570      58.824 -26.109  15.239  1.00  0.87           C  
ATOM  11387  CG  ARG B 570      58.454 -24.870  16.081  1.00  0.87           C  
ATOM  11388  CD  ARG B 570      57.028 -24.346  15.873  1.00  0.87           C  
ATOM  11389  NE  ARG B 570      56.898 -23.855  14.463  1.00  0.87           N  
ATOM  11390  CZ  ARG B 570      57.026 -22.570  14.101  1.00  0.87           C  
ATOM  11391  NH1 ARG B 570      57.282 -21.625  14.991  1.00  0.87           N  
ATOM  11392  NH2 ARG B 570      56.878 -22.238  12.821  1.00  0.87           N  
ATOM  11393  N   ILE B 571      57.305 -28.412  13.514  1.00  0.95           N  
ATOM  11394  CA  ILE B 571      57.290 -29.409  12.461  1.00  0.95           C  
ATOM  11395  C   ILE B 571      58.355 -29.096  11.432  1.00  0.95           C  
ATOM  11396  O   ILE B 571      58.371 -28.025  10.828  1.00  0.95           O  
ATOM  11397  CB  ILE B 571      55.932 -29.544  11.789  1.00  0.95           C  
ATOM  11398  CG1 ILE B 571      54.780 -29.679  12.813  1.00  0.95           C  
ATOM  11399  CG2 ILE B 571      55.942 -30.737  10.807  1.00  0.95           C  
ATOM  11400  CD1 ILE B 571      54.836 -30.907  13.729  1.00  0.95           C  
ATOM  11401  N   HIS B 572      59.296 -30.033  11.239  1.00  0.92           N  
ATOM  11402  CA  HIS B 572      60.423 -29.836  10.357  1.00  0.92           C  
ATOM  11403  C   HIS B 572      60.850 -31.165   9.808  1.00  0.92           C  
ATOM  11404  O   HIS B 572      60.902 -32.162  10.526  1.00  0.92           O  
ATOM  11405  CB  HIS B 572      61.658 -29.294  11.112  1.00  0.92           C  
ATOM  11406  CG  HIS B 572      61.749 -27.811  11.143  1.00  0.92           C  
ATOM  11407  ND1 HIS B 572      62.214 -27.158  10.017  1.00  0.92           N  
ATOM  11408  CD2 HIS B 572      61.518 -26.931  12.147  1.00  0.92           C  
ATOM  11409  CE1 HIS B 572      62.251 -25.882  10.361  1.00  0.92           C  
ATOM  11410  NE2 HIS B 572      61.843 -25.697  11.640  1.00  0.92           N  
ATOM  11411  N   GLU B 573      61.277 -31.203   8.537  1.00  0.93           N  
ATOM  11412  CA  GLU B 573      61.858 -32.390   7.942  1.00  0.93           C  
ATOM  11413  C   GLU B 573      63.108 -32.879   8.675  1.00  0.93           C  
ATOM  11414  O   GLU B 573      63.278 -34.070   8.917  1.00  0.93           O  
ATOM  11415  CB  GLU B 573      62.183 -32.109   6.467  1.00  0.93           C  
ATOM  11416  CG  GLU B 573      60.926 -31.818   5.617  1.00  0.93           C  
ATOM  11417  CD  GLU B 573      61.305 -31.462   4.183  1.00  0.93           C  
ATOM  11418  OE1 GLU B 573      62.026 -32.265   3.545  1.00  0.93           O  
ATOM  11419  OE2 GLU B 573      60.865 -30.380   3.715  1.00  0.93           O  
ATOM  11420  N   TYR B 574      63.978 -31.950   9.134  1.00  0.89           N  
ATOM  11421  CA  TYR B 574      65.157 -32.272   9.929  1.00  0.89           C  
ATOM  11422  C   TYR B 574      64.884 -32.948  11.269  1.00  0.89           C  
ATOM  11423  O   TYR B 574      65.639 -33.806  11.718  1.00  0.89           O  
ATOM  11424  CB  TYR B 574      66.112 -31.045  10.062  1.00  0.89           C  
ATOM  11425  CG  TYR B 574      65.896 -30.114  11.233  1.00  0.89           C  
ATOM  11426  CD1 TYR B 574      66.418 -30.443  12.497  1.00  0.89           C  
ATOM  11427  CD2 TYR B 574      65.270 -28.868  11.066  1.00  0.89           C  
ATOM  11428  CE1 TYR B 574      66.335 -29.543  13.564  1.00  0.89           C  
ATOM  11429  CE2 TYR B 574      65.191 -27.960  12.135  1.00  0.89           C  
ATOM  11430  CZ  TYR B 574      65.747 -28.293  13.379  1.00  0.89           C  
ATOM  11431  OH  TYR B 574      65.717 -27.395  14.466  1.00  0.89           O  
ATOM  11432  N   LYS B 575      63.776 -32.563  11.934  1.00  0.90           N  
ATOM  11433  CA  LYS B 575      63.347 -33.110  13.208  1.00  0.90           C  
ATOM  11434  C   LYS B 575      62.603 -34.424  13.034  1.00  0.90           C  
ATOM  11435  O   LYS B 575      62.369 -35.143  14.004  1.00  0.90           O  
ATOM  11436  CB  LYS B 575      62.417 -32.110  13.937  1.00  0.90           C  
ATOM  11437  CG  LYS B 575      63.137 -30.831  14.403  1.00  0.90           C  
ATOM  11438  CD  LYS B 575      62.169 -29.794  14.990  1.00  0.90           C  
ATOM  11439  CE  LYS B 575      62.798 -28.458  15.407  1.00  0.90           C  
ATOM  11440  NZ  LYS B 575      63.811 -28.617  16.467  1.00  0.90           N  
ATOM  11441  N   ARG B 576      62.241 -34.752  11.777  1.00  0.91           N  
ATOM  11442  CA  ARG B 576      61.759 -36.042  11.333  1.00  0.91           C  
ATOM  11443  C   ARG B 576      60.493 -36.572  11.982  1.00  0.91           C  
ATOM  11444  O   ARG B 576      60.406 -37.750  12.326  1.00  0.91           O  
ATOM  11445  CB  ARG B 576      62.850 -37.135  11.436  1.00  0.91           C  
ATOM  11446  CG  ARG B 576      64.100 -36.952  10.554  1.00  0.91           C  
ATOM  11447  CD  ARG B 576      65.272 -37.726  11.155  1.00  0.91           C  
ATOM  11448  NE  ARG B 576      66.005 -38.538  10.139  1.00  0.91           N  
ATOM  11449  CZ  ARG B 576      66.945 -39.398  10.537  1.00  0.91           C  
ATOM  11450  NH1 ARG B 576      67.208 -39.615  11.825  1.00  0.91           N  
ATOM  11451  NH2 ARG B 576      67.652 -40.090   9.653  1.00  0.91           N  
ATOM  11452  N   GLN B 577      59.412 -35.768  12.055  1.00  0.95           N  
ATOM  11453  CA  GLN B 577      58.097 -36.274  12.434  1.00  0.95           C  
ATOM  11454  C   GLN B 577      57.645 -37.415  11.509  1.00  0.95           C  
ATOM  11455  O   GLN B 577      57.018 -38.381  11.929  1.00  0.95           O  
ATOM  11456  CB  GLN B 577      57.033 -35.144  12.452  1.00  0.95           C  
ATOM  11457  CG  GLN B 577      57.133 -34.160  13.647  1.00  0.95           C  
ATOM  11458  CD  GLN B 577      58.171 -33.047  13.480  1.00  0.95           C  
ATOM  11459  OE1 GLN B 577      58.802 -32.867  12.440  1.00  0.95           O  
ATOM  11460  NE2 GLN B 577      58.360 -32.241  14.553  1.00  0.95           N  
ATOM  11461  N   LEU B 578      58.055 -37.371  10.224  1.00  0.97           N  
ATOM  11462  CA  LEU B 578      57.883 -38.452   9.270  1.00  0.97           C  
ATOM  11463  C   LEU B 578      58.519 -39.782   9.651  1.00  0.97           C  
ATOM  11464  O   LEU B 578      57.918 -40.829   9.435  1.00  0.97           O  
ATOM  11465  CB  LEU B 578      58.443 -38.042   7.890  1.00  0.97           C  
ATOM  11466  CG  LEU B 578      57.586 -36.987   7.177  1.00  0.97           C  
ATOM  11467  CD1 LEU B 578      58.304 -36.440   5.943  1.00  0.97           C  
ATOM  11468  CD2 LEU B 578      56.225 -37.566   6.774  1.00  0.97           C  
ATOM  11469  N   LEU B 579      59.727 -39.803  10.254  1.00  0.97           N  
ATOM  11470  CA  LEU B 579      60.329 -41.039  10.746  1.00  0.97           C  
ATOM  11471  C   LEU B 579      59.476 -41.687  11.835  1.00  0.97           C  
ATOM  11472  O   LEU B 579      59.219 -42.892  11.827  1.00  0.97           O  
ATOM  11473  CB  LEU B 579      61.777 -40.789  11.243  1.00  0.97           C  
ATOM  11474  CG  LEU B 579      62.537 -42.024  11.772  1.00  0.97           C  
ATOM  11475  CD1 LEU B 579      62.662 -43.153  10.738  1.00  0.97           C  
ATOM  11476  CD2 LEU B 579      63.933 -41.632  12.274  1.00  0.97           C  
ATOM  11477  N   ASN B 580      58.930 -40.865  12.760  1.00  0.97           N  
ATOM  11478  CA  ASN B 580      57.961 -41.295  13.750  1.00  0.97           C  
ATOM  11479  C   ASN B 580      56.689 -41.832  13.110  1.00  0.97           C  
ATOM  11480  O   ASN B 580      56.227 -42.905  13.484  1.00  0.97           O  
ATOM  11481  CB  ASN B 580      57.648 -40.122  14.717  1.00  0.97           C  
ATOM  11482  CG  ASN B 580      56.924 -40.481  16.021  1.00  0.97           C  
ATOM  11483  OD1 ASN B 580      56.678 -39.586  16.827  1.00  0.97           O  
ATOM  11484  ND2 ASN B 580      56.587 -41.769  16.255  1.00  0.97           N  
ATOM  11485  N   CYS B 581      56.143 -41.143  12.090  1.00  0.97           N  
ATOM  11486  CA  CYS B 581      54.982 -41.601  11.340  1.00  0.97           C  
ATOM  11487  C   CYS B 581      55.188 -42.941  10.653  1.00  0.97           C  
ATOM  11488  O   CYS B 581      54.302 -43.792  10.692  1.00  0.97           O  
ATOM  11489  CB  CYS B 581      54.523 -40.577  10.272  1.00  0.97           C  
ATOM  11490  SG  CYS B 581      53.928 -39.022  11.022  1.00  0.97           S  
ATOM  11491  N   LEU B 582      56.371 -43.199  10.052  1.00  0.96           N  
ATOM  11492  CA  LEU B 582      56.681 -44.508   9.496  1.00  0.96           C  
ATOM  11493  C   LEU B 582      56.636 -45.613  10.541  1.00  0.96           C  
ATOM  11494  O   LEU B 582      56.011 -46.644  10.324  1.00  0.96           O  
ATOM  11495  CB  LEU B 582      58.065 -44.536   8.794  1.00  0.96           C  
ATOM  11496  CG  LEU B 582      58.190 -43.668   7.523  1.00  0.96           C  
ATOM  11497  CD1 LEU B 582      59.562 -43.893   6.873  1.00  0.96           C  
ATOM  11498  CD2 LEU B 582      57.083 -43.946   6.496  1.00  0.96           C  
ATOM  11499  N   HIS B 583      57.213 -45.398  11.745  1.00  0.95           N  
ATOM  11500  CA  HIS B 583      57.104 -46.362  12.838  1.00  0.95           C  
ATOM  11501  C   HIS B 583      55.679 -46.641  13.292  1.00  0.95           C  
ATOM  11502  O   HIS B 583      55.316 -47.794  13.522  1.00  0.95           O  
ATOM  11503  CB  HIS B 583      57.934 -45.935  14.069  1.00  0.95           C  
ATOM  11504  CG  HIS B 583      57.736 -46.794  15.287  1.00  0.95           C  
ATOM  11505  ND1 HIS B 583      57.230 -46.214  16.432  1.00  0.95           N  
ATOM  11506  CD2 HIS B 583      57.858 -48.137  15.456  1.00  0.95           C  
ATOM  11507  CE1 HIS B 583      57.050 -47.210  17.277  1.00  0.95           C  
ATOM  11508  NE2 HIS B 583      57.412 -48.399  16.736  1.00  0.95           N  
ATOM  11509  N   VAL B 584      54.828 -45.602  13.395  1.00  0.96           N  
ATOM  11510  CA  VAL B 584      53.423 -45.738  13.752  1.00  0.96           C  
ATOM  11511  C   VAL B 584      52.664 -46.629  12.779  1.00  0.96           C  
ATOM  11512  O   VAL B 584      51.942 -47.547  13.173  1.00  0.96           O  
ATOM  11513  CB  VAL B 584      52.759 -44.365  13.782  1.00  0.96           C  
ATOM  11514  CG1 VAL B 584      51.246 -44.474  14.013  1.00  0.96           C  
ATOM  11515  CG2 VAL B 584      53.357 -43.533  14.925  1.00  0.96           C  
ATOM  11516  N   VAL B 585      52.855 -46.413  11.463  1.00  0.95           N  
ATOM  11517  CA  VAL B 585      52.251 -47.232  10.424  1.00  0.95           C  
ATOM  11518  C   VAL B 585      52.758 -48.669  10.450  1.00  0.95           C  
ATOM  11519  O   VAL B 585      51.979 -49.623  10.397  1.00  0.95           O  
ATOM  11520  CB  VAL B 585      52.462 -46.604   9.053  1.00  0.95           C  
ATOM  11521  CG1 VAL B 585      51.929 -47.505   7.926  1.00  0.95           C  
ATOM  11522  CG2 VAL B 585      51.733 -45.248   9.007  1.00  0.95           C  
ATOM  11523  N   THR B 586      54.081 -48.867  10.618  1.00  0.93           N  
ATOM  11524  CA  THR B 586      54.710 -50.180  10.751  1.00  0.93           C  
ATOM  11525  C   THR B 586      54.162 -50.959  11.930  1.00  0.93           C  
ATOM  11526  O   THR B 586      53.847 -52.145  11.832  1.00  0.93           O  
ATOM  11527  CB  THR B 586      56.222 -50.058  10.912  1.00  0.93           C  
ATOM  11528  OG1 THR B 586      56.751 -49.409   9.770  1.00  0.93           O  
ATOM  11529  CG2 THR B 586      56.922 -51.418  11.021  1.00  0.93           C  
ATOM  11530  N   LEU B 587      53.980 -50.296  13.089  1.00  0.92           N  
ATOM  11531  CA  LEU B 587      53.367 -50.882  14.265  1.00  0.92           C  
ATOM  11532  C   LEU B 587      51.908 -51.270  14.065  1.00  0.92           C  
ATOM  11533  O   LEU B 587      51.499 -52.373  14.421  1.00  0.92           O  
ATOM  11534  CB  LEU B 587      53.534 -49.919  15.463  1.00  0.92           C  
ATOM  11535  CG  LEU B 587      53.246 -50.514  16.856  1.00  0.92           C  
ATOM  11536  CD1 LEU B 587      54.038 -51.804  17.117  1.00  0.92           C  
ATOM  11537  CD2 LEU B 587      53.582 -49.479  17.939  1.00  0.92           C  
ATOM  11538  N   TYR B 588      51.105 -50.409  13.406  1.00  0.93           N  
ATOM  11539  CA  TYR B 588      49.730 -50.697  13.013  1.00  0.93           C  
ATOM  11540  C   TYR B 588      49.619 -51.933  12.122  1.00  0.93           C  
ATOM  11541  O   TYR B 588      48.813 -52.834  12.359  1.00  0.93           O  
ATOM  11542  CB  TYR B 588      49.186 -49.439  12.269  1.00  0.93           C  
ATOM  11543  CG  TYR B 588      47.840 -49.618  11.611  1.00  0.93           C  
ATOM  11544  CD1 TYR B 588      46.670 -49.655  12.379  1.00  0.93           C  
ATOM  11545  CD2 TYR B 588      47.744 -49.764  10.215  1.00  0.93           C  
ATOM  11546  CE1 TYR B 588      45.420 -49.833  11.765  1.00  0.93           C  
ATOM  11547  CE2 TYR B 588      46.499 -49.949   9.601  1.00  0.93           C  
ATOM  11548  CZ  TYR B 588      45.343 -49.985  10.379  1.00  0.93           C  
ATOM  11549  OH  TYR B 588      44.104 -50.189   9.755  1.00  0.93           O  
ATOM  11550  N   ASN B 589      50.478 -52.029  11.091  1.00  0.91           N  
ATOM  11551  CA  ASN B 589      50.533 -53.188  10.226  1.00  0.91           C  
ATOM  11552  C   ASN B 589      50.943 -54.453  10.966  1.00  0.91           C  
ATOM  11553  O   ASN B 589      50.370 -55.515  10.739  1.00  0.91           O  
ATOM  11554  CB  ASN B 589      51.480 -52.947   9.027  1.00  0.91           C  
ATOM  11555  CG  ASN B 589      51.037 -51.796   8.124  1.00  0.91           C  
ATOM  11556  OD1 ASN B 589      51.876 -51.110   7.544  1.00  0.91           O  
ATOM  11557  ND2 ASN B 589      49.710 -51.606   7.938  1.00  0.91           N  
ATOM  11558  N   ARG B 590      51.910 -54.370  11.900  1.00  0.85           N  
ATOM  11559  CA  ARG B 590      52.306 -55.484  12.744  1.00  0.85           C  
ATOM  11560  C   ARG B 590      51.208 -56.024  13.653  1.00  0.85           C  
ATOM  11561  O   ARG B 590      51.026 -57.236  13.746  1.00  0.85           O  
ATOM  11562  CB  ARG B 590      53.546 -55.099  13.599  1.00  0.85           C  
ATOM  11563  CG  ARG B 590      54.843 -55.774  13.118  1.00  0.85           C  
ATOM  11564  CD  ARG B 590      55.913 -54.824  12.564  1.00  0.85           C  
ATOM  11565  NE  ARG B 590      56.665 -54.238  13.722  1.00  0.85           N  
ATOM  11566  CZ  ARG B 590      58.004 -54.212  13.777  1.00  0.85           C  
ATOM  11567  NH1 ARG B 590      58.777 -54.582  12.761  1.00  0.85           N  
ATOM  11568  NH2 ARG B 590      58.599 -53.832  14.911  1.00  0.85           N  
ATOM  11569  N   ILE B 591      50.433 -55.138  14.314  1.00  0.86           N  
ATOM  11570  CA  ILE B 591      49.301 -55.515  15.159  1.00  0.86           C  
ATOM  11571  C   ILE B 591      48.209 -56.223  14.371  1.00  0.86           C  
ATOM  11572  O   ILE B 591      47.630 -57.216  14.808  1.00  0.86           O  
ATOM  11573  CB  ILE B 591      48.725 -54.296  15.885  1.00  0.86           C  
ATOM  11574  CG1 ILE B 591      49.770 -53.719  16.871  1.00  0.86           C  
ATOM  11575  CG2 ILE B 591      47.427 -54.672  16.636  1.00  0.86           C  
ATOM  11576  CD1 ILE B 591      49.346 -52.402  17.531  1.00  0.86           C  
ATOM  11577  N   LYS B 592      47.912 -55.726  13.157  1.00  0.84           N  
ATOM  11578  CA  LYS B 592      47.006 -56.375  12.232  1.00  0.84           C  
ATOM  11579  C   LYS B 592      47.467 -57.732  11.732  1.00  0.84           C  
ATOM  11580  O   LYS B 592      46.663 -58.647  11.577  1.00  0.84           O  
ATOM  11581  CB  LYS B 592      46.759 -55.463  11.011  1.00  0.84           C  
ATOM  11582  CG  LYS B 592      45.613 -54.479  11.256  1.00  0.84           C  
ATOM  11583  CD  LYS B 592      45.204 -53.772   9.959  1.00  0.84           C  
ATOM  11584  CE  LYS B 592      43.783 -53.218   9.979  1.00  0.84           C  
ATOM  11585  NZ  LYS B 592      42.764 -54.273  10.144  1.00  0.84           N  
ATOM  11586  N   ARG B 593      48.771 -57.876  11.434  1.00  0.80           N  
ATOM  11587  CA  ARG B 593      49.349 -59.091  10.897  1.00  0.80           C  
ATOM  11588  C   ARG B 593      49.253 -60.275  11.838  1.00  0.80           C  
ATOM  11589  O   ARG B 593      48.923 -61.386  11.430  1.00  0.80           O  
ATOM  11590  CB  ARG B 593      50.843 -58.854  10.569  1.00  0.80           C  
ATOM  11591  CG  ARG B 593      51.311 -59.549   9.280  1.00  0.80           C  
ATOM  11592  CD  ARG B 593      52.836 -59.717   9.161  1.00  0.80           C  
ATOM  11593  NE  ARG B 593      53.574 -58.485   9.624  1.00  0.80           N  
ATOM  11594  CZ  ARG B 593      53.656 -57.309   8.985  1.00  0.80           C  
ATOM  11595  NH1 ARG B 593      52.967 -57.040   7.884  1.00  0.80           N  
ATOM  11596  NH2 ARG B 593      54.446 -56.361   9.474  1.00  0.80           N  
ATOM  11597  N   ASP B 594      49.535 -60.033  13.130  1.00  0.81           N  
ATOM  11598  CA  ASP B 594      49.504 -61.052  14.150  1.00  0.81           C  
ATOM  11599  C   ASP B 594      48.547 -60.610  15.255  1.00  0.81           C  
ATOM  11600  O   ASP B 594      48.960 -60.038  16.268  1.00  0.81           O  
ATOM  11601  CB  ASP B 594      50.945 -61.258  14.668  1.00  0.81           C  
ATOM  11602  CG  ASP B 594      51.119 -62.563  15.419  1.00  0.81           C  
ATOM  11603  OD1 ASP B 594      50.101 -63.226  15.741  1.00  0.81           O  
ATOM  11604  OD2 ASP B 594      52.307 -62.876  15.706  1.00  0.81           O  
ATOM  11605  N   PRO B 595      47.238 -60.836  15.135  1.00  0.77           N  
ATOM  11606  CA  PRO B 595      46.272 -60.282  16.072  1.00  0.77           C  
ATOM  11607  C   PRO B 595      46.337 -61.004  17.393  1.00  0.77           C  
ATOM  11608  O   PRO B 595      45.854 -60.457  18.384  1.00  0.77           O  
ATOM  11609  CB  PRO B 595      44.919 -60.508  15.374  1.00  0.77           C  
ATOM  11610  CG  PRO B 595      45.165 -61.698  14.443  1.00  0.77           C  
ATOM  11611  CD  PRO B 595      46.592 -61.445  13.971  1.00  0.77           C  
ATOM  11612  N   ALA B 596      46.937 -62.205  17.421  1.00  0.67           N  
ATOM  11613  CA  ALA B 596      47.017 -63.060  18.580  1.00  0.67           C  
ATOM  11614  C   ALA B 596      48.343 -62.921  19.310  1.00  0.67           C  
ATOM  11615  O   ALA B 596      48.702 -63.732  20.165  1.00  0.67           O  
ATOM  11616  CB  ALA B 596      46.773 -64.509  18.134  1.00  0.67           C  
ATOM  11617  N   LYS B 597      49.079 -61.839  19.024  1.00  0.73           N  
ATOM  11618  CA  LYS B 597      50.329 -61.521  19.665  1.00  0.73           C  
ATOM  11619  C   LYS B 597      50.180 -60.356  20.629  1.00  0.73           C  
ATOM  11620  O   LYS B 597      49.434 -59.393  20.417  1.00  0.73           O  
ATOM  11621  CB  LYS B 597      51.386 -61.198  18.596  1.00  0.73           C  
ATOM  11622  CG  LYS B 597      52.812 -60.969  19.113  1.00  0.73           C  
ATOM  11623  CD  LYS B 597      53.791 -60.831  17.940  1.00  0.73           C  
ATOM  11624  CE  LYS B 597      55.253 -60.886  18.359  1.00  0.73           C  
ATOM  11625  NZ  LYS B 597      56.102 -60.880  17.150  1.00  0.73           N  
ATOM  11626  N   ALA B 598      50.901 -60.431  21.767  1.00  0.79           N  
ATOM  11627  CA  ALA B 598      50.942 -59.372  22.743  1.00  0.79           C  
ATOM  11628  C   ALA B 598      51.795 -58.182  22.322  1.00  0.79           C  
ATOM  11629  O   ALA B 598      53.008 -58.271  22.098  1.00  0.79           O  
ATOM  11630  CB  ALA B 598      51.437 -59.896  24.100  1.00  0.79           C  
ATOM  11631  N   PHE B 599      51.152 -57.011  22.255  1.00  0.86           N  
ATOM  11632  CA  PHE B 599      51.781 -55.762  21.904  1.00  0.86           C  
ATOM  11633  C   PHE B 599      51.611 -54.842  23.078  1.00  0.86           C  
ATOM  11634  O   PHE B 599      50.557 -54.817  23.713  1.00  0.86           O  
ATOM  11635  CB  PHE B 599      51.131 -55.110  20.662  1.00  0.86           C  
ATOM  11636  CG  PHE B 599      51.464 -55.908  19.434  1.00  0.86           C  
ATOM  11637  CD1 PHE B 599      52.687 -55.724  18.768  1.00  0.86           C  
ATOM  11638  CD2 PHE B 599      50.551 -56.837  18.921  1.00  0.86           C  
ATOM  11639  CE1 PHE B 599      52.993 -56.465  17.617  1.00  0.86           C  
ATOM  11640  CE2 PHE B 599      50.857 -57.592  17.786  1.00  0.86           C  
ATOM  11641  CZ  PHE B 599      52.076 -57.405  17.127  1.00  0.86           C  
ATOM  11642  N   VAL B 600      52.663 -54.080  23.424  1.00  0.90           N  
ATOM  11643  CA  VAL B 600      52.592 -53.108  24.494  1.00  0.90           C  
ATOM  11644  C   VAL B 600      51.637 -51.983  24.099  1.00  0.90           C  
ATOM  11645  O   VAL B 600      51.845 -51.390  23.039  1.00  0.90           O  
ATOM  11646  CB  VAL B 600      53.982 -52.582  24.815  1.00  0.90           C  
ATOM  11647  CG1 VAL B 600      53.948 -51.375  25.769  1.00  0.90           C  
ATOM  11648  CG2 VAL B 600      54.796 -53.729  25.445  1.00  0.90           C  
ATOM  11649  N   PRO B 601      50.567 -51.670  24.841  1.00  0.94           N  
ATOM  11650  CA  PRO B 601      49.676 -50.568  24.508  1.00  0.94           C  
ATOM  11651  C   PRO B 601      50.394 -49.238  24.430  1.00  0.94           C  
ATOM  11652  O   PRO B 601      51.123 -48.887  25.357  1.00  0.94           O  
ATOM  11653  CB  PRO B 601      48.592 -50.605  25.596  1.00  0.94           C  
ATOM  11654  CG  PRO B 601      49.278 -51.284  26.782  1.00  0.94           C  
ATOM  11655  CD  PRO B 601      50.171 -52.316  26.097  1.00  0.94           C  
ATOM  11656  N   ARG B 602      50.205 -48.477  23.341  1.00  0.90           N  
ATOM  11657  CA  ARG B 602      50.953 -47.257  23.126  1.00  0.90           C  
ATOM  11658  C   ARG B 602      50.070 -46.123  22.622  1.00  0.90           C  
ATOM  11659  O   ARG B 602      49.254 -46.279  21.717  1.00  0.90           O  
ATOM  11660  CB  ARG B 602      52.128 -47.524  22.147  1.00  0.90           C  
ATOM  11661  CG  ARG B 602      53.176 -46.399  22.103  1.00  0.90           C  
ATOM  11662  CD  ARG B 602      54.271 -46.572  21.039  1.00  0.90           C  
ATOM  11663  NE  ARG B 602      55.302 -47.568  21.493  1.00  0.90           N  
ATOM  11664  CZ  ARG B 602      56.610 -47.421  21.244  1.00  0.90           C  
ATOM  11665  NH1 ARG B 602      57.124 -46.330  20.690  1.00  0.90           N  
ATOM  11666  NH2 ARG B 602      57.443 -48.403  21.562  1.00  0.90           N  
ATOM  11667  N   THR B 603      50.223 -44.920  23.201  1.00  0.94           N  
ATOM  11668  CA  THR B 603      49.557 -43.713  22.719  1.00  0.94           C  
ATOM  11669  C   THR B 603      50.631 -42.856  22.109  1.00  0.94           C  
ATOM  11670  O   THR B 603      51.501 -42.348  22.815  1.00  0.94           O  
ATOM  11671  CB  THR B 603      48.859 -42.887  23.794  1.00  0.94           C  
ATOM  11672  OG1 THR B 603      47.830 -43.648  24.411  1.00  0.94           O  
ATOM  11673  CG2 THR B 603      48.150 -41.667  23.187  1.00  0.94           C  
ATOM  11674  N   VAL B 604      50.614 -42.675  20.778  1.00  0.96           N  
ATOM  11675  CA  VAL B 604      51.596 -41.867  20.082  1.00  0.96           C  
ATOM  11676  C   VAL B 604      51.026 -40.488  19.860  1.00  0.96           C  
ATOM  11677  O   VAL B 604      49.996 -40.303  19.210  1.00  0.96           O  
ATOM  11678  CB  VAL B 604      52.034 -42.461  18.750  1.00  0.96           C  
ATOM  11679  CG1 VAL B 604      53.066 -41.535  18.071  1.00  0.96           C  
ATOM  11680  CG2 VAL B 604      52.665 -43.844  18.993  1.00  0.96           C  
ATOM  11681  N   MET B 605      51.690 -39.467  20.414  1.00  0.93           N  
ATOM  11682  CA  MET B 605      51.249 -38.101  20.317  1.00  0.93           C  
ATOM  11683  C   MET B 605      52.298 -37.265  19.628  1.00  0.93           C  
ATOM  11684  O   MET B 605      53.445 -37.163  20.060  1.00  0.93           O  
ATOM  11685  CB  MET B 605      51.003 -37.485  21.705  1.00  0.93           C  
ATOM  11686  CG  MET B 605      49.941 -38.214  22.534  1.00  0.93           C  
ATOM  11687  SD  MET B 605      49.696 -37.408  24.124  1.00  0.93           S  
ATOM  11688  CE  MET B 605      49.834 -38.881  25.160  1.00  0.93           C  
ATOM  11689  N   ILE B 606      51.912 -36.612  18.528  1.00  0.96           N  
ATOM  11690  CA  ILE B 606      52.805 -35.759  17.774  1.00  0.96           C  
ATOM  11691  C   ILE B 606      52.187 -34.385  17.810  1.00  0.96           C  
ATOM  11692  O   ILE B 606      50.998 -34.225  17.565  1.00  0.96           O  
ATOM  11693  CB  ILE B 606      52.988 -36.263  16.346  1.00  0.96           C  
ATOM  11694  CG1 ILE B 606      53.611 -37.682  16.383  1.00  0.96           C  
ATOM  11695  CG2 ILE B 606      53.853 -35.274  15.533  1.00  0.96           C  
ATOM  11696  CD1 ILE B 606      53.786 -38.343  15.012  1.00  0.96           C  
ATOM  11697  N   GLY B 607      52.944 -33.336  18.165  1.00  0.98           N  
ATOM  11698  CA  GLY B 607      52.373 -31.995  18.225  1.00  0.98           C  
ATOM  11699  C   GLY B 607      53.366 -30.944  17.860  1.00  0.98           C  
ATOM  11700  O   GLY B 607      54.555 -31.046  18.151  1.00  0.98           O  
ATOM  11701  N   GLY B 608      52.902 -29.863  17.221  1.00  0.98           N  
ATOM  11702  CA  GLY B 608      53.821 -28.843  16.758  1.00  0.98           C  
ATOM  11703  C   GLY B 608      53.226 -27.972  15.710  1.00  0.98           C  
ATOM  11704  O   GLY B 608      52.281 -28.327  15.017  1.00  0.98           O  
ATOM  11705  N   LYS B 609      53.788 -26.772  15.547  1.00  0.92           N  
ATOM  11706  CA  LYS B 609      53.345 -25.859  14.518  1.00  0.92           C  
ATOM  11707  C   LYS B 609      54.259 -25.890  13.314  1.00  0.92           C  
ATOM  11708  O   LYS B 609      55.472 -26.102  13.409  1.00  0.92           O  
ATOM  11709  CB  LYS B 609      53.230 -24.424  15.073  1.00  0.92           C  
ATOM  11710  CG  LYS B 609      52.070 -24.293  16.065  1.00  0.92           C  
ATOM  11711  CD  LYS B 609      52.059 -22.954  16.813  1.00  0.92           C  
ATOM  11712  CE  LYS B 609      50.913 -22.936  17.820  1.00  0.92           C  
ATOM  11713  NZ  LYS B 609      50.885 -21.702  18.628  1.00  0.92           N  
ATOM  11714  N   ALA B 610      53.678 -25.647  12.135  1.00  0.94           N  
ATOM  11715  CA  ALA B 610      54.389 -25.513  10.892  1.00  0.94           C  
ATOM  11716  C   ALA B 610      54.352 -24.054  10.487  1.00  0.94           C  
ATOM  11717  O   ALA B 610      53.377 -23.352  10.740  1.00  0.94           O  
ATOM  11718  CB  ALA B 610      53.686 -26.365   9.826  1.00  0.94           C  
ATOM  11719  N   ALA B 611      55.420 -23.512   9.870  1.00  0.91           N  
ATOM  11720  CA  ALA B 611      55.335 -22.173   9.313  1.00  0.91           C  
ATOM  11721  C   ALA B 611      54.291 -22.092   8.181  1.00  0.91           C  
ATOM  11722  O   ALA B 611      54.178 -23.072   7.443  1.00  0.91           O  
ATOM  11723  CB  ALA B 611      56.720 -21.700   8.840  1.00  0.91           C  
ATOM  11724  N   PRO B 612      53.510 -21.025   7.978  1.00  0.88           N  
ATOM  11725  CA  PRO B 612      52.422 -21.000   7.002  1.00  0.88           C  
ATOM  11726  C   PRO B 612      52.822 -21.334   5.584  1.00  0.88           C  
ATOM  11727  O   PRO B 612      52.063 -22.008   4.889  1.00  0.88           O  
ATOM  11728  CB  PRO B 612      51.834 -19.594   7.133  1.00  0.88           C  
ATOM  11729  CG  PRO B 612      52.008 -19.308   8.622  1.00  0.88           C  
ATOM  11730  CD  PRO B 612      53.375 -19.919   8.921  1.00  0.88           C  
ATOM  11731  N   GLY B 613      54.016 -20.882   5.152  1.00  0.84           N  
ATOM  11732  CA  GLY B 613      54.570 -21.192   3.840  1.00  0.84           C  
ATOM  11733  C   GLY B 613      55.278 -22.521   3.723  1.00  0.84           C  
ATOM  11734  O   GLY B 613      55.703 -22.910   2.638  1.00  0.84           O  
ATOM  11735  N   TYR B 614      55.439 -23.281   4.822  1.00  0.88           N  
ATOM  11736  CA  TYR B 614      56.160 -24.541   4.797  1.00  0.88           C  
ATOM  11737  C   TYR B 614      55.212 -25.671   4.439  1.00  0.88           C  
ATOM  11738  O   TYR B 614      54.641 -26.354   5.290  1.00  0.88           O  
ATOM  11739  CB  TYR B 614      56.842 -24.784   6.170  1.00  0.88           C  
ATOM  11740  CG  TYR B 614      57.930 -25.835   6.243  1.00  0.88           C  
ATOM  11741  CD1 TYR B 614      58.349 -26.674   5.186  1.00  0.88           C  
ATOM  11742  CD2 TYR B 614      58.577 -25.956   7.484  1.00  0.88           C  
ATOM  11743  CE1 TYR B 614      59.395 -27.596   5.378  1.00  0.88           C  
ATOM  11744  CE2 TYR B 614      59.618 -26.869   7.671  1.00  0.88           C  
ATOM  11745  CZ  TYR B 614      60.038 -27.680   6.618  1.00  0.88           C  
ATOM  11746  OH  TYR B 614      61.134 -28.539   6.826  1.00  0.88           O  
ATOM  11747  N   HIS B 615      55.051 -25.898   3.121  1.00  0.86           N  
ATOM  11748  CA  HIS B 615      54.122 -26.871   2.566  1.00  0.86           C  
ATOM  11749  C   HIS B 615      54.344 -28.289   3.062  1.00  0.86           C  
ATOM  11750  O   HIS B 615      53.415 -28.954   3.513  1.00  0.86           O  
ATOM  11751  CB  HIS B 615      54.215 -26.852   1.020  1.00  0.86           C  
ATOM  11752  CG  HIS B 615      53.339 -27.848   0.319  1.00  0.86           C  
ATOM  11753  ND1 HIS B 615      51.979 -27.850   0.555  1.00  0.86           N  
ATOM  11754  CD2 HIS B 615      53.670 -28.830  -0.558  1.00  0.86           C  
ATOM  11755  CE1 HIS B 615      51.509 -28.839  -0.189  1.00  0.86           C  
ATOM  11756  NE2 HIS B 615      52.492 -29.461  -0.883  1.00  0.86           N  
ATOM  11757  N   MET B 616      55.605 -28.769   3.079  1.00  0.90           N  
ATOM  11758  CA  MET B 616      55.905 -30.108   3.553  1.00  0.90           C  
ATOM  11759  C   MET B 616      55.539 -30.341   5.009  1.00  0.90           C  
ATOM  11760  O   MET B 616      54.910 -31.334   5.355  1.00  0.90           O  
ATOM  11761  CB  MET B 616      57.391 -30.446   3.325  1.00  0.90           C  
ATOM  11762  CG  MET B 616      57.756 -31.919   3.607  1.00  0.90           C  
ATOM  11763  SD  MET B 616      56.779 -33.148   2.691  1.00  0.90           S  
ATOM  11764  CE  MET B 616      57.478 -32.786   1.058  1.00  0.90           C  
ATOM  11765  N   ALA B 617      55.841 -29.383   5.901  1.00  0.95           N  
ATOM  11766  CA  ALA B 617      55.443 -29.448   7.288  1.00  0.95           C  
ATOM  11767  C   ALA B 617      53.931 -29.494   7.507  1.00  0.95           C  
ATOM  11768  O   ALA B 617      53.430 -30.248   8.340  1.00  0.95           O  
ATOM  11769  CB  ALA B 617      56.071 -28.261   8.024  1.00  0.95           C  
ATOM  11770  N   LYS B 618      53.147 -28.727   6.724  1.00  0.91           N  
ATOM  11771  CA  LYS B 618      51.696 -28.835   6.728  1.00  0.91           C  
ATOM  11772  C   LYS B 618      51.171 -30.193   6.284  1.00  0.91           C  
ATOM  11773  O   LYS B 618      50.261 -30.749   6.899  1.00  0.91           O  
ATOM  11774  CB  LYS B 618      51.045 -27.751   5.841  1.00  0.91           C  
ATOM  11775  CG  LYS B 618      51.212 -26.346   6.423  1.00  0.91           C  
ATOM  11776  CD  LYS B 618      50.211 -25.334   5.840  1.00  0.91           C  
ATOM  11777  CE  LYS B 618      50.118 -24.108   6.747  1.00  0.91           C  
ATOM  11778  NZ  LYS B 618      49.041 -23.180   6.368  1.00  0.91           N  
ATOM  11779  N   LEU B 619      51.764 -30.786   5.229  1.00  0.93           N  
ATOM  11780  CA  LEU B 619      51.456 -32.141   4.803  1.00  0.93           C  
ATOM  11781  C   LEU B 619      51.756 -33.173   5.882  1.00  0.93           C  
ATOM  11782  O   LEU B 619      50.991 -34.110   6.090  1.00  0.93           O  
ATOM  11783  CB  LEU B 619      52.260 -32.546   3.549  1.00  0.93           C  
ATOM  11784  CG  LEU B 619      51.972 -31.753   2.265  1.00  0.93           C  
ATOM  11785  CD1 LEU B 619      53.007 -32.167   1.219  1.00  0.93           C  
ATOM  11786  CD2 LEU B 619      50.555 -31.982   1.722  1.00  0.93           C  
ATOM  11787  N   ILE B 620      52.872 -33.017   6.623  1.00  0.95           N  
ATOM  11788  CA  ILE B 620      53.221 -33.867   7.754  1.00  0.95           C  
ATOM  11789  C   ILE B 620      52.181 -33.811   8.870  1.00  0.95           C  
ATOM  11790  O   ILE B 620      51.770 -34.848   9.385  1.00  0.95           O  
ATOM  11791  CB  ILE B 620      54.612 -33.533   8.294  1.00  0.95           C  
ATOM  11792  CG1 ILE B 620      55.696 -33.813   7.227  1.00  0.95           C  
ATOM  11793  CG2 ILE B 620      54.912 -34.359   9.562  1.00  0.95           C  
ATOM  11794  CD1 ILE B 620      57.093 -33.286   7.588  1.00  0.95           C  
ATOM  11795  N   ILE B 621      51.667 -32.612   9.230  1.00  0.95           N  
ATOM  11796  CA  ILE B 621      50.563 -32.459  10.185  1.00  0.95           C  
ATOM  11797  C   ILE B 621      49.310 -33.184   9.714  1.00  0.95           C  
ATOM  11798  O   ILE B 621      48.665 -33.924  10.459  1.00  0.95           O  
ATOM  11799  CB  ILE B 621      50.230 -30.981  10.415  1.00  0.95           C  
ATOM  11800  CG1 ILE B 621      51.412 -30.293  11.129  1.00  0.95           C  
ATOM  11801  CG2 ILE B 621      48.922 -30.828  11.231  1.00  0.95           C  
ATOM  11802  CD1 ILE B 621      51.251 -28.776  11.277  1.00  0.95           C  
ATOM  11803  N   LYS B 622      48.980 -33.031   8.418  1.00  0.92           N  
ATOM  11804  CA  LYS B 622      47.890 -33.731   7.771  1.00  0.92           C  
ATOM  11805  C   LYS B 622      48.050 -35.246   7.766  1.00  0.92           C  
ATOM  11806  O   LYS B 622      47.085 -35.999   7.877  1.00  0.92           O  
ATOM  11807  CB  LYS B 622      47.710 -33.210   6.326  1.00  0.92           C  
ATOM  11808  CG  LYS B 622      46.514 -33.809   5.569  1.00  0.92           C  
ATOM  11809  CD  LYS B 622      45.173 -33.440   6.215  1.00  0.92           C  
ATOM  11810  CE  LYS B 622      43.965 -34.057   5.516  1.00  0.92           C  
ATOM  11811  NZ  LYS B 622      43.773 -35.443   5.977  1.00  0.92           N  
ATOM  11812  N   LEU B 623      49.291 -35.743   7.635  1.00  0.94           N  
ATOM  11813  CA  LEU B 623      49.609 -37.151   7.732  1.00  0.94           C  
ATOM  11814  C   LEU B 623      49.292 -37.734   9.108  1.00  0.94           C  
ATOM  11815  O   LEU B 623      48.680 -38.793   9.218  1.00  0.94           O  
ATOM  11816  CB  LEU B 623      51.102 -37.379   7.378  1.00  0.94           C  
ATOM  11817  CG  LEU B 623      51.465 -38.683   6.625  1.00  0.94           C  
ATOM  11818  CD1 LEU B 623      52.866 -39.146   7.040  1.00  0.94           C  
ATOM  11819  CD2 LEU B 623      50.486 -39.842   6.812  1.00  0.94           C  
ATOM  11820  N   VAL B 624      49.644 -37.026  10.204  1.00  0.94           N  
ATOM  11821  CA  VAL B 624      49.376 -37.483  11.569  1.00  0.94           C  
ATOM  11822  C   VAL B 624      47.891 -37.671  11.843  1.00  0.94           C  
ATOM  11823  O   VAL B 624      47.461 -38.697  12.370  1.00  0.94           O  
ATOM  11824  CB  VAL B 624      49.936 -36.526  12.625  1.00  0.94           C  
ATOM  11825  CG1 VAL B 624      49.677 -37.055  14.052  1.00  0.94           C  
ATOM  11826  CG2 VAL B 624      51.453 -36.361  12.438  1.00  0.94           C  
ATOM  11827  N   THR B 625      47.055 -36.694  11.441  1.00  0.92           N  
ATOM  11828  CA  THR B 625      45.605 -36.785  11.575  1.00  0.92           C  
ATOM  11829  C   THR B 625      44.999 -37.878  10.718  1.00  0.92           C  
ATOM  11830  O   THR B 625      44.235 -38.696  11.215  1.00  0.92           O  
ATOM  11831  CB  THR B 625      44.909 -35.460  11.304  1.00  0.92           C  
ATOM  11832  OG1 THR B 625      45.324 -34.907  10.062  1.00  0.92           O  
ATOM  11833  CG2 THR B 625      45.300 -34.456  12.400  1.00  0.92           C  
ATOM  11834  N   SER B 626      45.415 -37.995   9.439  1.00  0.93           N  
ATOM  11835  CA  SER B 626      44.998 -39.065   8.537  1.00  0.93           C  
ATOM  11836  C   SER B 626      45.335 -40.465   9.043  1.00  0.93           C  
ATOM  11837  O   SER B 626      44.539 -41.396   8.924  1.00  0.93           O  
ATOM  11838  CB  SER B 626      45.685 -38.949   7.154  1.00  0.93           C  
ATOM  11839  OG  SER B 626      45.200 -37.865   6.353  1.00  0.93           O  
ATOM  11840  N   ILE B 627      46.534 -40.672   9.636  1.00  0.93           N  
ATOM  11841  CA  ILE B 627      46.876 -41.930  10.296  1.00  0.93           C  
ATOM  11842  C   ILE B 627      45.960 -42.184  11.476  1.00  0.93           C  
ATOM  11843  O   ILE B 627      45.418 -43.278  11.619  1.00  0.93           O  
ATOM  11844  CB  ILE B 627      48.334 -41.970  10.761  1.00  0.93           C  
ATOM  11845  CG1 ILE B 627      49.290 -41.970   9.551  1.00  0.93           C  
ATOM  11846  CG2 ILE B 627      48.614 -43.219  11.625  1.00  0.93           C  
ATOM  11847  CD1 ILE B 627      50.761 -41.763   9.947  1.00  0.93           C  
ATOM  11848  N   GLY B 628      45.729 -41.152  12.318  1.00  0.92           N  
ATOM  11849  CA  GLY B 628      44.769 -41.170  13.418  1.00  0.92           C  
ATOM  11850  C   GLY B 628      43.398 -41.655  13.056  1.00  0.92           C  
ATOM  11851  O   GLY B 628      42.902 -42.597  13.665  1.00  0.92           O  
ATOM  11852  N   ASP B 629      42.786 -41.062  12.020  1.00  0.88           N  
ATOM  11853  CA  ASP B 629      41.465 -41.403  11.523  1.00  0.88           C  
ATOM  11854  C   ASP B 629      41.335 -42.883  11.130  1.00  0.88           C  
ATOM  11855  O   ASP B 629      40.294 -43.512  11.298  1.00  0.88           O  
ATOM  11856  CB  ASP B 629      41.118 -40.504  10.303  1.00  0.88           C  
ATOM  11857  CG  ASP B 629      41.040 -39.021  10.652  1.00  0.88           C  
ATOM  11858  OD1 ASP B 629      40.898 -38.679  11.853  1.00  0.88           O  
ATOM  11859  OD2 ASP B 629      41.104 -38.209   9.687  1.00  0.88           O  
ATOM  11860  N   VAL B 630      42.410 -43.501  10.598  1.00  0.91           N  
ATOM  11861  CA  VAL B 630      42.421 -44.936  10.334  1.00  0.91           C  
ATOM  11862  C   VAL B 630      42.705 -45.783  11.575  1.00  0.91           C  
ATOM  11863  O   VAL B 630      41.973 -46.719  11.892  1.00  0.91           O  
ATOM  11864  CB  VAL B 630      43.449 -45.258   9.250  1.00  0.91           C  
ATOM  11865  CG1 VAL B 630      43.656 -46.776   9.070  1.00  0.91           C  
ATOM  11866  CG2 VAL B 630      42.971 -44.647   7.919  1.00  0.91           C  
ATOM  11867  N   VAL B 631      43.788 -45.486  12.323  1.00  0.91           N  
ATOM  11868  CA  VAL B 631      44.232 -46.287  13.462  1.00  0.91           C  
ATOM  11869  C   VAL B 631      43.270 -46.277  14.634  1.00  0.91           C  
ATOM  11870  O   VAL B 631      42.964 -47.314  15.222  1.00  0.91           O  
ATOM  11871  CB  VAL B 631      45.616 -45.852  13.948  1.00  0.91           C  
ATOM  11872  CG1 VAL B 631      46.051 -46.652  15.193  1.00  0.91           C  
ATOM  11873  CG2 VAL B 631      46.651 -46.071  12.830  1.00  0.91           C  
ATOM  11874  N   ASN B 632      42.724 -45.101  14.989  1.00  0.87           N  
ATOM  11875  CA  ASN B 632      41.967 -44.907  16.215  1.00  0.87           C  
ATOM  11876  C   ASN B 632      40.574 -45.504  16.146  1.00  0.87           C  
ATOM  11877  O   ASN B 632      39.843 -45.546  17.141  1.00  0.87           O  
ATOM  11878  CB  ASN B 632      41.811 -43.398  16.518  1.00  0.87           C  
ATOM  11879  CG  ASN B 632      43.168 -42.756  16.774  1.00  0.87           C  
ATOM  11880  OD1 ASN B 632      44.157 -43.390  17.139  1.00  0.87           O  
ATOM  11881  ND2 ASN B 632      43.214 -41.412  16.627  1.00  0.87           N  
ATOM  11882  N   HIS B 633      40.177 -45.948  14.947  1.00  0.84           N  
ATOM  11883  CA  HIS B 633      38.889 -46.538  14.704  1.00  0.84           C  
ATOM  11884  C   HIS B 633      38.969 -47.946  14.148  1.00  0.84           C  
ATOM  11885  O   HIS B 633      37.941 -48.495  13.752  1.00  0.84           O  
ATOM  11886  CB  HIS B 633      38.094 -45.643  13.735  1.00  0.84           C  
ATOM  11887  CG  HIS B 633      37.826 -44.276  14.307  1.00  0.84           C  
ATOM  11888  ND1 HIS B 633      38.731 -43.255  14.102  1.00  0.84           N  
ATOM  11889  CD2 HIS B 633      36.768 -43.814  15.026  1.00  0.84           C  
ATOM  11890  CE1 HIS B 633      38.213 -42.195  14.673  1.00  0.84           C  
ATOM  11891  NE2 HIS B 633      37.021 -42.475  15.257  1.00  0.84           N  
ATOM  11892  N   ASP B 634      40.153 -48.600  14.139  1.00  0.88           N  
ATOM  11893  CA  ASP B 634      40.246 -49.986  13.712  1.00  0.88           C  
ATOM  11894  C   ASP B 634      39.950 -50.932  14.893  1.00  0.88           C  
ATOM  11895  O   ASP B 634      40.638 -50.894  15.919  1.00  0.88           O  
ATOM  11896  CB  ASP B 634      41.608 -50.324  13.046  1.00  0.88           C  
ATOM  11897  CG  ASP B 634      41.573 -51.674  12.344  1.00  0.88           C  
ATOM  11898  OD1 ASP B 634      41.605 -52.706  13.057  1.00  0.88           O  
ATOM  11899  OD2 ASP B 634      41.503 -51.748  11.091  1.00  0.88           O  
ATOM  11900  N   PRO B 635      38.954 -51.812  14.816  1.00  0.87           N  
ATOM  11901  CA  PRO B 635      38.588 -52.692  15.920  1.00  0.87           C  
ATOM  11902  C   PRO B 635      39.595 -53.801  16.148  1.00  0.87           C  
ATOM  11903  O   PRO B 635      39.620 -54.362  17.239  1.00  0.87           O  
ATOM  11904  CB  PRO B 635      37.229 -53.262  15.475  1.00  0.87           C  
ATOM  11905  CG  PRO B 635      37.272 -53.207  13.946  1.00  0.87           C  
ATOM  11906  CD  PRO B 635      38.009 -51.901  13.701  1.00  0.87           C  
ATOM  11907  N   VAL B 636      40.421 -54.167  15.152  1.00  0.84           N  
ATOM  11908  CA  VAL B 636      41.462 -55.175  15.308  1.00  0.84           C  
ATOM  11909  C   VAL B 636      42.592 -54.634  16.178  1.00  0.84           C  
ATOM  11910  O   VAL B 636      43.200 -55.336  16.993  1.00  0.84           O  
ATOM  11911  CB  VAL B 636      41.962 -55.645  13.940  1.00  0.84           C  
ATOM  11912  CG1 VAL B 636      43.111 -56.663  14.034  1.00  0.84           C  
ATOM  11913  CG2 VAL B 636      40.773 -56.234  13.154  1.00  0.84           C  
ATOM  11914  N   VAL B 637      42.885 -53.331  16.033  1.00  0.88           N  
ATOM  11915  CA  VAL B 637      43.813 -52.585  16.866  1.00  0.88           C  
ATOM  11916  C   VAL B 637      43.339 -52.346  18.295  1.00  0.88           C  
ATOM  11917  O   VAL B 637      44.132 -52.404  19.233  1.00  0.88           O  
ATOM  11918  CB  VAL B 637      44.188 -51.273  16.205  1.00  0.88           C  
ATOM  11919  CG1 VAL B 637      45.216 -50.501  17.049  1.00  0.88           C  
ATOM  11920  CG2 VAL B 637      44.804 -51.587  14.832  1.00  0.88           C  
ATOM  11921  N   GLY B 638      42.040 -52.069  18.531  1.00  0.87           N  
ATOM  11922  CA  GLY B 638      41.537 -51.690  19.858  1.00  0.87           C  
ATOM  11923  C   GLY B 638      42.243 -50.493  20.449  1.00  0.87           C  
ATOM  11924  O   GLY B 638      42.560 -49.531  19.758  1.00  0.87           O  
ATOM  11925  N   ASP B 639      42.538 -50.517  21.757  1.00  0.86           N  
ATOM  11926  CA  ASP B 639      43.276 -49.456  22.418  1.00  0.86           C  
ATOM  11927  C   ASP B 639      44.754 -49.799  22.599  1.00  0.86           C  
ATOM  11928  O   ASP B 639      45.477 -49.160  23.370  1.00  0.86           O  
ATOM  11929  CB  ASP B 639      42.610 -49.056  23.755  1.00  0.86           C  
ATOM  11930  CG  ASP B 639      42.108 -50.257  24.528  1.00  0.86           C  
ATOM  11931  OD1 ASP B 639      42.859 -51.257  24.631  1.00  0.86           O  
ATOM  11932  OD2 ASP B 639      40.943 -50.173  24.984  1.00  0.86           O  
ATOM  11933  N   ARG B 640      45.253 -50.784  21.821  1.00  0.85           N  
ATOM  11934  CA  ARG B 640      46.652 -51.183  21.789  1.00  0.85           C  
ATOM  11935  C   ARG B 640      47.513 -50.138  21.080  1.00  0.85           C  
ATOM  11936  O   ARG B 640      48.714 -50.033  21.319  1.00  0.85           O  
ATOM  11937  CB  ARG B 640      46.830 -52.565  21.086  1.00  0.85           C  
ATOM  11938  CG  ARG B 640      46.053 -53.722  21.760  1.00  0.85           C  
ATOM  11939  CD  ARG B 640      45.486 -54.802  20.813  1.00  0.85           C  
ATOM  11940  NE  ARG B 640      46.543 -55.757  20.328  1.00  0.85           N  
ATOM  11941  CZ  ARG B 640      46.269 -56.706  19.416  1.00  0.85           C  
ATOM  11942  NH1 ARG B 640      45.140 -56.685  18.710  1.00  0.85           N  
ATOM  11943  NH2 ARG B 640      47.113 -57.716  19.201  1.00  0.85           N  
ATOM  11944  N   LEU B 641      46.907 -49.308  20.211  1.00  0.92           N  
ATOM  11945  CA  LEU B 641      47.587 -48.198  19.582  1.00  0.92           C  
ATOM  11946  C   LEU B 641      46.619 -47.048  19.384  1.00  0.92           C  
ATOM  11947  O   LEU B 641      45.502 -47.232  18.911  1.00  0.92           O  
ATOM  11948  CB  LEU B 641      48.185 -48.640  18.227  1.00  0.92           C  
ATOM  11949  CG  LEU B 641      48.993 -47.592  17.438  1.00  0.92           C  
ATOM  11950  CD1 LEU B 641      50.227 -47.109  18.210  1.00  0.92           C  
ATOM  11951  CD2 LEU B 641      49.412 -48.193  16.088  1.00  0.92           C  
ATOM  11952  N   LYS B 642      47.027 -45.820  19.751  1.00  0.90           N  
ATOM  11953  CA  LYS B 642      46.260 -44.614  19.497  1.00  0.90           C  
ATOM  11954  C   LYS B 642      47.201 -43.560  18.954  1.00  0.90           C  
ATOM  11955  O   LYS B 642      48.315 -43.409  19.450  1.00  0.90           O  
ATOM  11956  CB  LYS B 642      45.569 -44.058  20.773  1.00  0.90           C  
ATOM  11957  CG  LYS B 642      44.505 -45.012  21.338  1.00  0.90           C  
ATOM  11958  CD  LYS B 642      43.806 -44.502  22.608  1.00  0.90           C  
ATOM  11959  CE  LYS B 642      42.820 -45.553  23.121  1.00  0.90           C  
ATOM  11960  NZ  LYS B 642      42.169 -45.109  24.362  1.00  0.90           N  
ATOM  11961  N   VAL B 643      46.794 -42.817  17.909  1.00  0.93           N  
ATOM  11962  CA  VAL B 643      47.631 -41.801  17.283  1.00  0.93           C  
ATOM  11963  C   VAL B 643      46.927 -40.467  17.341  1.00  0.93           C  
ATOM  11964  O   VAL B 643      45.835 -40.292  16.800  1.00  0.93           O  
ATOM  11965  CB  VAL B 643      47.966 -42.103  15.829  1.00  0.93           C  
ATOM  11966  CG1 VAL B 643      49.024 -41.107  15.307  1.00  0.93           C  
ATOM  11967  CG2 VAL B 643      48.489 -43.544  15.723  1.00  0.93           C  
ATOM  11968  N   ILE B 644      47.532 -39.482  18.025  1.00  0.90           N  
ATOM  11969  CA  ILE B 644      46.917 -38.188  18.255  1.00  0.90           C  
ATOM  11970  C   ILE B 644      47.816 -37.081  17.749  1.00  0.90           C  
ATOM  11971  O   ILE B 644      49.022 -37.062  17.993  1.00  0.90           O  
ATOM  11972  CB  ILE B 644      46.611 -37.980  19.742  1.00  0.90           C  
ATOM  11973  CG1 ILE B 644      45.610 -39.036  20.279  1.00  0.90           C  
ATOM  11974  CG2 ILE B 644      46.096 -36.554  20.035  1.00  0.90           C  
ATOM  11975  CD1 ILE B 644      44.228 -39.004  19.611  1.00  0.90           C  
ATOM  11976  N   PHE B 645      47.241 -36.085  17.041  1.00  0.92           N  
ATOM  11977  CA  PHE B 645      47.936 -34.843  16.789  1.00  0.92           C  
ATOM  11978  C   PHE B 645      47.576 -33.862  17.897  1.00  0.92           C  
ATOM  11979  O   PHE B 645      46.404 -33.555  18.110  1.00  0.92           O  
ATOM  11980  CB  PHE B 645      47.575 -34.257  15.402  1.00  0.92           C  
ATOM  11981  CG  PHE B 645      48.425 -33.055  15.093  1.00  0.92           C  
ATOM  11982  CD1 PHE B 645      49.773 -33.203  14.729  1.00  0.92           C  
ATOM  11983  CD2 PHE B 645      47.893 -31.765  15.234  1.00  0.92           C  
ATOM  11984  CE1 PHE B 645      50.584 -32.081  14.527  1.00  0.92           C  
ATOM  11985  CE2 PHE B 645      48.698 -30.639  15.029  1.00  0.92           C  
ATOM  11986  CZ  PHE B 645      50.041 -30.800  14.675  1.00  0.92           C  
ATOM  11987  N   LEU B 646      48.566 -33.349  18.647  1.00  0.92           N  
ATOM  11988  CA  LEU B 646      48.292 -32.423  19.729  1.00  0.92           C  
ATOM  11989  C   LEU B 646      48.210 -30.997  19.213  1.00  0.92           C  
ATOM  11990  O   LEU B 646      49.219 -30.357  18.910  1.00  0.92           O  
ATOM  11991  CB  LEU B 646      49.338 -32.493  20.870  1.00  0.92           C  
ATOM  11992  CG  LEU B 646      49.419 -33.843  21.608  1.00  0.92           C  
ATOM  11993  CD1 LEU B 646      50.504 -33.788  22.690  1.00  0.92           C  
ATOM  11994  CD2 LEU B 646      48.086 -34.244  22.255  1.00  0.92           C  
ATOM  11995  N   GLU B 647      46.967 -30.482  19.107  1.00  0.90           N  
ATOM  11996  CA  GLU B 647      46.655 -29.151  18.627  1.00  0.90           C  
ATOM  11997  C   GLU B 647      47.273 -28.014  19.439  1.00  0.90           C  
ATOM  11998  O   GLU B 647      47.248 -27.993  20.671  1.00  0.90           O  
ATOM  11999  CB  GLU B 647      45.117 -28.932  18.574  1.00  0.90           C  
ATOM  12000  CG  GLU B 647      44.691 -27.633  17.838  1.00  0.90           C  
ATOM  12001  CD  GLU B 647      43.185 -27.381  17.808  1.00  0.90           C  
ATOM  12002  OE1 GLU B 647      42.448 -28.262  17.300  1.00  0.90           O  
ATOM  12003  OE2 GLU B 647      42.769 -26.265  18.216  1.00  0.90           O  
ATOM  12004  N   ASN B 648      47.837 -27.010  18.733  1.00  0.92           N  
ATOM  12005  CA  ASN B 648      48.285 -25.752  19.289  1.00  0.92           C  
ATOM  12006  C   ASN B 648      49.362 -25.872  20.352  1.00  0.92           C  
ATOM  12007  O   ASN B 648      49.271 -25.263  21.420  1.00  0.92           O  
ATOM  12008  CB  ASN B 648      47.078 -24.894  19.762  1.00  0.92           C  
ATOM  12009  CG  ASN B 648      47.429 -23.417  19.881  1.00  0.92           C  
ATOM  12010  OD1 ASN B 648      48.307 -22.890  19.192  1.00  0.92           O  
ATOM  12011  ND2 ASN B 648      46.741 -22.705  20.799  1.00  0.92           N  
ATOM  12012  N   TYR B 649      50.431 -26.637  20.053  1.00  0.93           N  
ATOM  12013  CA  TYR B 649      51.593 -26.760  20.915  1.00  0.93           C  
ATOM  12014  C   TYR B 649      52.249 -25.407  21.217  1.00  0.93           C  
ATOM  12015  O   TYR B 649      52.514 -24.589  20.332  1.00  0.93           O  
ATOM  12016  CB  TYR B 649      52.604 -27.783  20.324  1.00  0.93           C  
ATOM  12017  CG  TYR B 649      53.779 -28.036  21.239  1.00  0.93           C  
ATOM  12018  CD1 TYR B 649      53.589 -28.618  22.504  1.00  0.93           C  
ATOM  12019  CD2 TYR B 649      55.077 -27.657  20.855  1.00  0.93           C  
ATOM  12020  CE1 TYR B 649      54.671 -28.792  23.377  1.00  0.93           C  
ATOM  12021  CE2 TYR B 649      56.163 -27.843  21.723  1.00  0.93           C  
ATOM  12022  CZ  TYR B 649      55.959 -28.410  22.986  1.00  0.93           C  
ATOM  12023  OH  TYR B 649      57.063 -28.654  23.828  1.00  0.93           O  
ATOM  12024  N   ARG B 650      52.473 -25.156  22.515  1.00  0.90           N  
ATOM  12025  CA  ARG B 650      52.891 -23.884  23.059  1.00  0.90           C  
ATOM  12026  C   ARG B 650      53.441 -24.152  24.446  1.00  0.90           C  
ATOM  12027  O   ARG B 650      53.380 -25.287  24.923  1.00  0.90           O  
ATOM  12028  CB  ARG B 650      51.735 -22.853  23.112  1.00  0.90           C  
ATOM  12029  CG  ARG B 650      50.678 -23.159  24.188  1.00  0.90           C  
ATOM  12030  CD  ARG B 650      49.369 -22.375  24.037  1.00  0.90           C  
ATOM  12031  NE  ARG B 650      48.335 -23.328  23.537  1.00  0.90           N  
ATOM  12032  CZ  ARG B 650      47.754 -24.252  24.309  1.00  0.90           C  
ATOM  12033  NH1 ARG B 650      47.952 -24.324  25.624  1.00  0.90           N  
ATOM  12034  NH2 ARG B 650      46.952 -25.143  23.733  1.00  0.90           N  
ATOM  12035  N   VAL B 651      53.996 -23.134  25.136  1.00  0.95           N  
ATOM  12036  CA  VAL B 651      54.630 -23.283  26.442  1.00  0.95           C  
ATOM  12037  C   VAL B 651      53.709 -23.841  27.517  1.00  0.95           C  
ATOM  12038  O   VAL B 651      54.049 -24.821  28.176  1.00  0.95           O  
ATOM  12039  CB  VAL B 651      55.215 -21.947  26.897  1.00  0.95           C  
ATOM  12040  CG1 VAL B 651      55.883 -22.046  28.281  1.00  0.95           C  
ATOM  12041  CG2 VAL B 651      56.257 -21.477  25.869  1.00  0.95           C  
ATOM  12042  N   SER B 652      52.482 -23.311  27.660  1.00  0.94           N  
ATOM  12043  CA  SER B 652      51.507 -23.833  28.609  1.00  0.94           C  
ATOM  12044  C   SER B 652      51.033 -25.251  28.318  1.00  0.94           C  
ATOM  12045  O   SER B 652      50.670 -25.994  29.226  1.00  0.94           O  
ATOM  12046  CB  SER B 652      50.272 -22.911  28.724  1.00  0.94           C  
ATOM  12047  OG  SER B 652      49.531 -22.837  27.500  1.00  0.94           O  
ATOM  12048  N   LEU B 653      51.005 -25.690  27.036  1.00  0.93           N  
ATOM  12049  CA  LEU B 653      50.745 -27.084  26.706  1.00  0.93           C  
ATOM  12050  C   LEU B 653      51.916 -27.993  27.029  1.00  0.93           C  
ATOM  12051  O   LEU B 653      51.741 -29.092  27.551  1.00  0.93           O  
ATOM  12052  CB  LEU B 653      50.329 -27.280  25.228  1.00  0.93           C  
ATOM  12053  CG  LEU B 653      49.718 -28.668  24.912  1.00  0.93           C  
ATOM  12054  CD1 LEU B 653      48.422 -28.931  25.694  1.00  0.93           C  
ATOM  12055  CD2 LEU B 653      49.439 -28.825  23.412  1.00  0.93           C  
ATOM  12056  N   ALA B 654      53.156 -27.531  26.767  1.00  0.98           N  
ATOM  12057  CA  ALA B 654      54.384 -28.229  27.084  1.00  0.98           C  
ATOM  12058  C   ALA B 654      54.517 -28.523  28.567  1.00  0.98           C  
ATOM  12059  O   ALA B 654      54.890 -29.623  28.969  1.00  0.98           O  
ATOM  12060  CB  ALA B 654      55.572 -27.386  26.595  1.00  0.98           C  
ATOM  12061  N   GLU B 655      54.110 -27.554  29.408  1.00  0.93           N  
ATOM  12062  CA  GLU B 655      54.008 -27.703  30.845  1.00  0.93           C  
ATOM  12063  C   GLU B 655      52.995 -28.770  31.284  1.00  0.93           C  
ATOM  12064  O   GLU B 655      53.044 -29.261  32.404  1.00  0.93           O  
ATOM  12065  CB  GLU B 655      53.648 -26.336  31.491  1.00  0.93           C  
ATOM  12066  CG  GLU B 655      54.776 -25.268  31.414  1.00  0.93           C  
ATOM  12067  CD  GLU B 655      54.339 -23.889  31.917  1.00  0.93           C  
ATOM  12068  OE1 GLU B 655      53.462 -23.798  32.805  1.00  0.93           O  
ATOM  12069  OE2 GLU B 655      54.901 -22.871  31.424  1.00  0.93           O  
ATOM  12070  N   LYS B 656      52.052 -29.199  30.421  1.00  0.91           N  
ATOM  12071  CA  LYS B 656      51.121 -30.262  30.772  1.00  0.91           C  
ATOM  12072  C   LYS B 656      51.455 -31.611  30.145  1.00  0.91           C  
ATOM  12073  O   LYS B 656      51.341 -32.644  30.800  1.00  0.91           O  
ATOM  12074  CB  LYS B 656      49.678 -29.865  30.369  1.00  0.91           C  
ATOM  12075  CG  LYS B 656      49.209 -28.547  31.006  1.00  0.91           C  
ATOM  12076  CD  LYS B 656      47.766 -28.195  30.617  1.00  0.91           C  
ATOM  12077  CE  LYS B 656      47.371 -26.744  30.920  1.00  0.91           C  
ATOM  12078  NZ  LYS B 656      47.512 -26.481  32.359  1.00  0.91           N  
ATOM  12079  N   VAL B 657      51.883 -31.665  28.866  1.00  0.95           N  
ATOM  12080  CA  VAL B 657      52.184 -32.933  28.201  1.00  0.95           C  
ATOM  12081  C   VAL B 657      53.505 -33.575  28.596  1.00  0.95           C  
ATOM  12082  O   VAL B 657      53.597 -34.785  28.799  1.00  0.95           O  
ATOM  12083  CB  VAL B 657      52.057 -32.839  26.682  1.00  0.95           C  
ATOM  12084  CG1 VAL B 657      53.120 -31.932  26.041  1.00  0.95           C  
ATOM  12085  CG2 VAL B 657      52.102 -34.251  26.067  1.00  0.95           C  
ATOM  12086  N   ILE B 658      54.586 -32.789  28.748  1.00  0.96           N  
ATOM  12087  CA  ILE B 658      55.907 -33.305  29.088  1.00  0.96           C  
ATOM  12088  C   ILE B 658      55.966 -34.036  30.441  1.00  0.96           C  
ATOM  12089  O   ILE B 658      56.568 -35.116  30.504  1.00  0.96           O  
ATOM  12090  CB  ILE B 658      56.964 -32.206  28.960  1.00  0.96           C  
ATOM  12091  CG1 ILE B 658      57.047 -31.720  27.491  1.00  0.96           C  
ATOM  12092  CG2 ILE B 658      58.335 -32.710  29.444  1.00  0.96           C  
ATOM  12093  CD1 ILE B 658      58.002 -30.539  27.274  1.00  0.96           C  
ATOM  12094  N   PRO B 659      55.343 -33.593  31.541  1.00  0.97           N  
ATOM  12095  CA  PRO B 659      55.258 -34.368  32.777  1.00  0.97           C  
ATOM  12096  C   PRO B 659      54.563 -35.703  32.624  1.00  0.97           C  
ATOM  12097  O   PRO B 659      54.830 -36.608  33.417  1.00  0.97           O  
ATOM  12098  CB  PRO B 659      54.576 -33.418  33.769  1.00  0.97           C  
ATOM  12099  CG  PRO B 659      54.981 -32.040  33.253  1.00  0.97           C  
ATOM  12100  CD  PRO B 659      54.868 -32.222  31.752  1.00  0.97           C  
ATOM  12101  N   ALA B 660      53.698 -35.875  31.616  1.00  0.96           N  
ATOM  12102  CA  ALA B 660      52.923 -37.079  31.428  1.00  0.96           C  
ATOM  12103  C   ALA B 660      53.506 -38.064  30.433  1.00  0.96           C  
ATOM  12104  O   ALA B 660      53.014 -39.179  30.286  1.00  0.96           O  
ATOM  12105  CB  ALA B 660      51.545 -36.641  30.919  1.00  0.96           C  
ATOM  12106  N   ALA B 661      54.598 -37.712  29.747  1.00  0.98           N  
ATOM  12107  CA  ALA B 661      55.156 -38.570  28.726  1.00  0.98           C  
ATOM  12108  C   ALA B 661      56.138 -39.612  29.225  1.00  0.98           C  
ATOM  12109  O   ALA B 661      57.037 -39.298  30.002  1.00  0.98           O  
ATOM  12110  CB  ALA B 661      55.909 -37.700  27.732  1.00  0.98           C  
ATOM  12111  N   ASP B 662      56.009 -40.866  28.764  1.00  0.97           N  
ATOM  12112  CA  ASP B 662      56.952 -41.929  29.070  1.00  0.97           C  
ATOM  12113  C   ASP B 662      58.160 -41.929  28.154  1.00  0.97           C  
ATOM  12114  O   ASP B 662      59.292 -42.112  28.594  1.00  0.97           O  
ATOM  12115  CB  ASP B 662      56.319 -43.309  28.877  1.00  0.97           C  
ATOM  12116  CG  ASP B 662      55.191 -43.519  29.830  1.00  0.97           C  
ATOM  12117  OD1 ASP B 662      55.320 -43.257  31.047  1.00  0.97           O  
ATOM  12118  OD2 ASP B 662      54.139 -43.978  29.315  1.00  0.97           O  
ATOM  12119  N   LEU B 663      57.933 -41.742  26.840  1.00  0.98           N  
ATOM  12120  CA  LEU B 663      58.977 -41.776  25.840  1.00  0.98           C  
ATOM  12121  C   LEU B 663      59.079 -40.440  25.149  1.00  0.98           C  
ATOM  12122  O   LEU B 663      58.103 -39.845  24.694  1.00  0.98           O  
ATOM  12123  CB  LEU B 663      58.754 -42.891  24.792  1.00  0.98           C  
ATOM  12124  CG  LEU B 663      59.887 -43.107  23.767  1.00  0.98           C  
ATOM  12125  CD1 LEU B 663      61.170 -43.605  24.442  1.00  0.98           C  
ATOM  12126  CD2 LEU B 663      59.442 -44.107  22.693  1.00  0.98           C  
ATOM  12127  N   SER B 664      60.317 -39.939  25.087  1.00  0.99           N  
ATOM  12128  CA  SER B 664      60.690 -38.689  24.475  1.00  0.99           C  
ATOM  12129  C   SER B 664      61.315 -38.958  23.135  1.00  0.99           C  
ATOM  12130  O   SER B 664      62.377 -39.577  23.043  1.00  0.99           O  
ATOM  12131  CB  SER B 664      61.745 -37.994  25.359  1.00  0.99           C  
ATOM  12132  OG  SER B 664      62.180 -36.735  24.846  1.00  0.99           O  
ATOM  12133  N   GLN B 665      60.668 -38.490  22.058  1.00  0.96           N  
ATOM  12134  CA  GLN B 665      61.191 -38.614  20.716  1.00  0.96           C  
ATOM  12135  C   GLN B 665      62.109 -37.459  20.344  1.00  0.96           C  
ATOM  12136  O   GLN B 665      61.715 -36.295  20.227  1.00  0.96           O  
ATOM  12137  CB  GLN B 665      60.036 -38.634  19.710  1.00  0.96           C  
ATOM  12138  CG  GLN B 665      59.144 -39.885  19.773  1.00  0.96           C  
ATOM  12139  CD  GLN B 665      59.893 -41.119  19.293  1.00  0.96           C  
ATOM  12140  OE1 GLN B 665      60.930 -41.059  18.632  1.00  0.96           O  
ATOM  12141  NE2 GLN B 665      59.357 -42.303  19.646  1.00  0.96           N  
ATOM  12142  N   GLN B 666      63.402 -37.750  20.135  1.00  0.95           N  
ATOM  12143  CA  GLN B 666      64.398 -36.739  19.847  1.00  0.95           C  
ATOM  12144  C   GLN B 666      65.219 -37.229  18.672  1.00  0.95           C  
ATOM  12145  O   GLN B 666      66.417 -37.479  18.760  1.00  0.95           O  
ATOM  12146  CB  GLN B 666      65.272 -36.432  21.086  1.00  0.95           C  
ATOM  12147  CG  GLN B 666      64.455 -36.058  22.352  1.00  0.95           C  
ATOM  12148  CD  GLN B 666      63.590 -34.806  22.174  1.00  0.95           C  
ATOM  12149  OE1 GLN B 666      63.937 -33.843  21.483  1.00  0.95           O  
ATOM  12150  NE2 GLN B 666      62.416 -34.777  22.840  1.00  0.95           N  
ATOM  12151  N   ILE B 667      64.537 -37.436  17.534  1.00  0.97           N  
ATOM  12152  CA  ILE B 667      65.003 -38.272  16.433  1.00  0.97           C  
ATOM  12153  C   ILE B 667      65.560 -37.557  15.217  1.00  0.97           C  
ATOM  12154  O   ILE B 667      65.649 -38.130  14.129  1.00  0.97           O  
ATOM  12155  CB  ILE B 667      63.872 -39.181  15.979  1.00  0.97           C  
ATOM  12156  CG1 ILE B 667      62.633 -38.387  15.504  1.00  0.97           C  
ATOM  12157  CG2 ILE B 667      63.509 -40.089  17.165  1.00  0.97           C  
ATOM  12158  CD1 ILE B 667      61.479 -39.293  15.067  1.00  0.97           C  
ATOM  12159  N   SER B 668      65.989 -36.295  15.363  1.00  0.96           N  
ATOM  12160  CA  SER B 668      66.623 -35.508  14.315  1.00  0.96           C  
ATOM  12161  C   SER B 668      67.834 -36.141  13.658  1.00  0.96           C  
ATOM  12162  O   SER B 668      68.547 -36.963  14.228  1.00  0.96           O  
ATOM  12163  CB  SER B 668      67.083 -34.131  14.835  1.00  0.96           C  
ATOM  12164  OG  SER B 668      67.878 -34.276  16.014  1.00  0.96           O  
ATOM  12165  N   THR B 669      68.082 -35.820  12.379  1.00  0.94           N  
ATOM  12166  CA  THR B 669      69.219 -36.376  11.654  1.00  0.94           C  
ATOM  12167  C   THR B 669      70.533 -35.945  12.259  1.00  0.94           C  
ATOM  12168  O   THR B 669      70.741 -34.761  12.471  1.00  0.94           O  
ATOM  12169  CB  THR B 669      69.255 -35.961  10.193  1.00  0.94           C  
ATOM  12170  OG1 THR B 669      67.976 -36.106   9.611  1.00  0.94           O  
ATOM  12171  CG2 THR B 669      70.233 -36.824   9.390  1.00  0.94           C  
ATOM  12172  N   ALA B 670      71.468 -36.876  12.541  1.00  0.94           N  
ATOM  12173  CA  ALA B 670      72.729 -36.546  13.180  1.00  0.94           C  
ATOM  12174  C   ALA B 670      73.502 -35.386  12.551  1.00  0.94           C  
ATOM  12175  O   ALA B 670      73.934 -35.443  11.398  1.00  0.94           O  
ATOM  12176  CB  ALA B 670      73.616 -37.797  13.262  1.00  0.94           C  
ATOM  12177  N   GLY B 671      73.658 -34.293  13.323  1.00  0.90           N  
ATOM  12178  CA  GLY B 671      74.260 -33.047  12.893  1.00  0.90           C  
ATOM  12179  C   GLY B 671      73.300 -31.948  12.514  1.00  0.90           C  
ATOM  12180  O   GLY B 671      73.757 -30.888  12.090  1.00  0.90           O  
ATOM  12181  N   THR B 672      71.965 -32.132  12.622  1.00  0.91           N  
ATOM  12182  CA  THR B 672      71.008 -31.094  12.218  1.00  0.91           C  
ATOM  12183  C   THR B 672      70.358 -30.338  13.358  1.00  0.91           C  
ATOM  12184  O   THR B 672      70.102 -29.141  13.221  1.00  0.91           O  
ATOM  12185  CB  THR B 672      69.874 -31.585  11.312  1.00  0.91           C  
ATOM  12186  OG1 THR B 672      69.024 -32.535  11.939  1.00  0.91           O  
ATOM  12187  CG2 THR B 672      70.452 -32.245  10.052  1.00  0.91           C  
ATOM  12188  N   GLU B 673      70.092 -30.956  14.524  1.00  0.90           N  
ATOM  12189  CA  GLU B 673      69.540 -30.237  15.659  1.00  0.90           C  
ATOM  12190  C   GLU B 673      70.707 -29.703  16.466  1.00  0.90           C  
ATOM  12191  O   GLU B 673      71.492 -30.434  17.064  1.00  0.90           O  
ATOM  12192  CB  GLU B 673      68.613 -31.156  16.507  1.00  0.90           C  
ATOM  12193  CG  GLU B 673      67.828 -30.557  17.716  1.00  0.90           C  
ATOM  12194  CD  GLU B 673      66.467 -29.909  17.453  1.00  0.90           C  
ATOM  12195  OE1 GLU B 673      66.350 -28.661  17.564  1.00  0.90           O  
ATOM  12196  OE2 GLU B 673      65.450 -30.629  17.220  1.00  0.90           O  
ATOM  12197  N   ALA B 674      70.868 -28.364  16.514  1.00  0.94           N  
ATOM  12198  CA  ALA B 674      72.000 -27.721  17.154  1.00  0.94           C  
ATOM  12199  C   ALA B 674      72.101 -28.029  18.637  1.00  0.94           C  
ATOM  12200  O   ALA B 674      73.179 -28.032  19.223  1.00  0.94           O  
ATOM  12201  CB  ALA B 674      71.895 -26.205  16.971  1.00  0.94           C  
ATOM  12202  N   SER B 675      70.953 -28.314  19.274  1.00  0.94           N  
ATOM  12203  CA  SER B 675      70.938 -28.725  20.663  1.00  0.94           C  
ATOM  12204  C   SER B 675      69.633 -29.366  21.035  1.00  0.94           C  
ATOM  12205  O   SER B 675      69.592 -30.510  21.489  1.00  0.94           O  
ATOM  12206  CB  SER B 675      71.177 -27.521  21.594  1.00  0.94           C  
ATOM  12207  OG  SER B 675      71.181 -27.845  22.980  1.00  0.94           O  
ATOM  12208  N   GLY B 676      68.526 -28.623  20.843  1.00  0.95           N  
ATOM  12209  CA  GLY B 676      67.236 -28.970  21.409  1.00  0.95           C  
ATOM  12210  C   GLY B 676      67.137 -28.530  22.851  1.00  0.95           C  
ATOM  12211  O   GLY B 676      68.124 -28.380  23.557  1.00  0.95           O  
ATOM  12212  N   THR B 677      65.911 -28.286  23.338  1.00  0.95           N  
ATOM  12213  CA  THR B 677      65.697 -28.002  24.760  1.00  0.95           C  
ATOM  12214  C   THR B 677      64.512 -28.772  25.277  1.00  0.95           C  
ATOM  12215  O   THR B 677      64.350 -28.949  26.480  1.00  0.95           O  
ATOM  12216  CB  THR B 677      65.467 -26.531  25.108  1.00  0.95           C  
ATOM  12217  OG1 THR B 677      64.427 -25.941  24.333  1.00  0.95           O  
ATOM  12218  CG2 THR B 677      66.754 -25.732  24.853  1.00  0.95           C  
ATOM  12219  N   GLY B 678      63.637 -29.304  24.385  1.00  0.98           N  
ATOM  12220  CA  GLY B 678      62.539 -30.176  24.795  1.00  0.98           C  
ATOM  12221  C   GLY B 678      63.041 -31.458  25.372  1.00  0.98           C  
ATOM  12222  O   GLY B 678      62.539 -31.923  26.386  1.00  0.98           O  
ATOM  12223  N   ASN B 679      64.126 -31.992  24.797  1.00  0.95           N  
ATOM  12224  CA  ASN B 679      64.807 -33.198  25.225  1.00  0.95           C  
ATOM  12225  C   ASN B 679      65.216 -33.188  26.694  1.00  0.95           C  
ATOM  12226  O   ASN B 679      64.977 -34.144  27.432  1.00  0.95           O  
ATOM  12227  CB  ASN B 679      66.039 -33.453  24.306  1.00  0.95           C  
ATOM  12228  CG  ASN B 679      67.000 -32.269  24.149  1.00  0.95           C  
ATOM  12229  OD1 ASN B 679      66.767 -31.159  24.623  1.00  0.95           O  
ATOM  12230  ND2 ASN B 679      68.094 -32.507  23.395  1.00  0.95           N  
ATOM  12231  N   MET B 680      65.770 -32.058  27.155  1.00  0.95           N  
ATOM  12232  CA  MET B 680      66.076 -31.791  28.540  1.00  0.95           C  
ATOM  12233  C   MET B 680      64.849 -31.791  29.443  1.00  0.95           C  
ATOM  12234  O   MET B 680      64.859 -32.384  30.518  1.00  0.95           O  
ATOM  12235  CB  MET B 680      66.758 -30.409  28.642  1.00  0.95           C  
ATOM  12236  CG  MET B 680      68.042 -30.285  27.803  1.00  0.95           C  
ATOM  12237  SD  MET B 680      68.657 -28.584  27.711  1.00  0.95           S  
ATOM  12238  CE  MET B 680      69.886 -28.995  26.447  1.00  0.95           C  
ATOM  12239  N   LYS B 681      63.737 -31.153  29.011  1.00  0.95           N  
ATOM  12240  CA  LYS B 681      62.498 -31.078  29.777  1.00  0.95           C  
ATOM  12241  C   LYS B 681      61.889 -32.446  30.008  1.00  0.95           C  
ATOM  12242  O   LYS B 681      61.463 -32.782  31.110  1.00  0.95           O  
ATOM  12243  CB  LYS B 681      61.437 -30.195  29.070  1.00  0.95           C  
ATOM  12244  CG  LYS B 681      61.885 -28.758  28.771  1.00  0.95           C  
ATOM  12245  CD  LYS B 681      60.932 -28.065  27.786  1.00  0.95           C  
ATOM  12246  CE  LYS B 681      61.527 -26.808  27.152  1.00  0.95           C  
ATOM  12247  NZ  LYS B 681      60.610 -26.295  26.110  1.00  0.95           N  
ATOM  12248  N   PHE B 682      61.881 -33.291  28.964  1.00  0.96           N  
ATOM  12249  CA  PHE B 682      61.426 -34.664  29.036  1.00  0.96           C  
ATOM  12250  C   PHE B 682      62.220 -35.515  30.015  1.00  0.96           C  
ATOM  12251  O   PHE B 682      61.649 -36.220  30.846  1.00  0.96           O  
ATOM  12252  CB  PHE B 682      61.569 -35.303  27.639  1.00  0.96           C  
ATOM  12253  CG  PHE B 682      60.363 -35.039  26.781  1.00  0.96           C  
ATOM  12254  CD1 PHE B 682      59.214 -35.828  26.932  1.00  0.96           C  
ATOM  12255  CD2 PHE B 682      60.383 -34.082  25.754  1.00  0.96           C  
ATOM  12256  CE1 PHE B 682      58.111 -35.631  26.096  1.00  0.96           C  
ATOM  12257  CE2 PHE B 682      59.269 -33.852  24.944  1.00  0.96           C  
ATOM  12258  CZ  PHE B 682      58.130 -34.634  25.123  1.00  0.96           C  
ATOM  12259  N   MET B 683      63.563 -35.425  29.966  1.00  0.95           N  
ATOM  12260  CA  MET B 683      64.448 -36.118  30.886  1.00  0.95           C  
ATOM  12261  C   MET B 683      64.268 -35.693  32.334  1.00  0.95           C  
ATOM  12262  O   MET B 683      64.180 -36.519  33.242  1.00  0.95           O  
ATOM  12263  CB  MET B 683      65.914 -35.875  30.460  1.00  0.95           C  
ATOM  12264  CG  MET B 683      66.961 -36.512  31.397  1.00  0.95           C  
ATOM  12265  SD  MET B 683      68.665 -36.516  30.780  1.00  0.95           S  
ATOM  12266  CE  MET B 683      68.784 -34.720  30.616  1.00  0.95           C  
ATOM  12267  N   LEU B 684      64.142 -34.373  32.583  1.00  0.96           N  
ATOM  12268  CA  LEU B 684      63.921 -33.811  33.904  1.00  0.96           C  
ATOM  12269  C   LEU B 684      62.621 -34.316  34.528  1.00  0.96           C  
ATOM  12270  O   LEU B 684      62.505 -34.547  35.728  1.00  0.96           O  
ATOM  12271  CB  LEU B 684      63.878 -32.259  33.800  1.00  0.96           C  
ATOM  12272  CG  LEU B 684      64.579 -31.449  34.914  1.00  0.96           C  
ATOM  12273  CD1 LEU B 684      63.998 -30.028  34.966  1.00  0.96           C  
ATOM  12274  CD2 LEU B 684      64.493 -32.092  36.299  1.00  0.96           C  
ATOM  12275  N   ASN B 685      61.595 -34.523  33.686  1.00  0.96           N  
ATOM  12276  CA  ASN B 685      60.262 -34.877  34.122  1.00  0.96           C  
ATOM  12277  C   ASN B 685      59.952 -36.361  34.070  1.00  0.96           C  
ATOM  12278  O   ASN B 685      58.798 -36.783  34.191  1.00  0.96           O  
ATOM  12279  CB  ASN B 685      59.251 -34.121  33.244  1.00  0.96           C  
ATOM  12280  CG  ASN B 685      59.161 -32.705  33.779  1.00  0.96           C  
ATOM  12281  OD1 ASN B 685      58.413 -32.473  34.724  1.00  0.96           O  
ATOM  12282  ND2 ASN B 685      59.939 -31.771  33.204  1.00  0.96           N  
ATOM  12283  N   GLY B 686      60.972 -37.213  33.922  1.00  0.98           N  
ATOM  12284  CA  GLY B 686      60.802 -38.646  34.092  1.00  0.98           C  
ATOM  12285  C   GLY B 686      60.365 -39.407  32.881  1.00  0.98           C  
ATOM  12286  O   GLY B 686      59.699 -40.430  33.005  1.00  0.98           O  
ATOM  12287  N   ALA B 687      60.707 -38.928  31.681  1.00  0.99           N  
ATOM  12288  CA  ALA B 687      60.580 -39.707  30.471  1.00  0.99           C  
ATOM  12289  C   ALA B 687      61.918 -40.327  30.097  1.00  0.99           C  
ATOM  12290  O   ALA B 687      62.982 -39.766  30.360  1.00  0.99           O  
ATOM  12291  CB  ALA B 687      60.105 -38.814  29.314  1.00  0.99           C  
ATOM  12292  N   LEU B 688      61.899 -41.503  29.447  1.00  0.96           N  
ATOM  12293  CA  LEU B 688      63.078 -42.064  28.819  1.00  0.96           C  
ATOM  12294  C   LEU B 688      63.181 -41.523  27.405  1.00  0.96           C  
ATOM  12295  O   LEU B 688      62.189 -41.112  26.806  1.00  0.96           O  
ATOM  12296  CB  LEU B 688      63.057 -43.614  28.793  1.00  0.96           C  
ATOM  12297  CG  LEU B 688      63.036 -44.270  30.191  1.00  0.96           C  
ATOM  12298  CD1 LEU B 688      63.144 -45.797  30.103  1.00  0.96           C  
ATOM  12299  CD2 LEU B 688      64.169 -43.756  31.083  1.00  0.96           C  
ATOM  12300  N   THR B 689      64.390 -41.485  26.820  1.00  0.97           N  
ATOM  12301  CA  THR B 689      64.596 -40.820  25.532  1.00  0.97           C  
ATOM  12302  C   THR B 689      65.023 -41.803  24.479  1.00  0.97           C  
ATOM  12303  O   THR B 689      65.980 -42.556  24.660  1.00  0.97           O  
ATOM  12304  CB  THR B 689      65.634 -39.695  25.595  1.00  0.97           C  
ATOM  12305  OG1 THR B 689      65.184 -38.661  26.460  1.00  0.97           O  
ATOM  12306  CG2 THR B 689      65.877 -39.038  24.226  1.00  0.97           C  
ATOM  12307  N   ILE B 690      64.329 -41.781  23.321  1.00  0.96           N  
ATOM  12308  CA  ILE B 690      64.761 -42.442  22.109  1.00  0.96           C  
ATOM  12309  C   ILE B 690      65.241 -41.351  21.173  1.00  0.96           C  
ATOM  12310  O   ILE B 690      64.588 -40.333  20.931  1.00  0.96           O  
ATOM  12311  CB  ILE B 690      63.704 -43.342  21.480  1.00  0.96           C  
ATOM  12312  CG1 ILE B 690      64.239 -44.072  20.232  1.00  0.96           C  
ATOM  12313  CG2 ILE B 690      62.449 -42.522  21.150  1.00  0.96           C  
ATOM  12314  CD1 ILE B 690      63.310 -45.189  19.755  1.00  0.96           C  
ATOM  12315  N   GLY B 691      66.472 -41.480  20.667  1.00  0.98           N  
ATOM  12316  CA  GLY B 691      67.026 -40.384  19.905  1.00  0.98           C  
ATOM  12317  C   GLY B 691      68.296 -40.755  19.238  1.00  0.98           C  
ATOM  12318  O   GLY B 691      68.897 -41.799  19.481  1.00  0.98           O  
ATOM  12319  N   THR B 692      68.745 -39.870  18.359  1.00  0.95           N  
ATOM  12320  CA  THR B 692      70.005 -39.976  17.661  1.00  0.95           C  
ATOM  12321  C   THR B 692      71.085 -39.302  18.477  1.00  0.95           C  
ATOM  12322  O   THR B 692      70.820 -38.517  19.391  1.00  0.95           O  
ATOM  12323  CB  THR B 692      69.920 -39.290  16.311  1.00  0.95           C  
ATOM  12324  OG1 THR B 692      69.371 -37.991  16.495  1.00  0.95           O  
ATOM  12325  CG2 THR B 692      68.955 -40.074  15.412  1.00  0.95           C  
ATOM  12326  N   MET B 693      72.365 -39.578  18.169  1.00  0.91           N  
ATOM  12327  CA  MET B 693      73.462 -38.820  18.743  1.00  0.91           C  
ATOM  12328  C   MET B 693      73.606 -37.467  18.063  1.00  0.91           C  
ATOM  12329  O   MET B 693      74.510 -37.246  17.261  1.00  0.91           O  
ATOM  12330  CB  MET B 693      74.795 -39.593  18.659  1.00  0.91           C  
ATOM  12331  CG  MET B 693      74.841 -40.802  19.605  1.00  0.91           C  
ATOM  12332  SD  MET B 693      74.893 -40.346  21.363  1.00  0.91           S  
ATOM  12333  CE  MET B 693      76.513 -41.104  21.668  1.00  0.91           C  
ATOM  12334  N   ASP B 694      72.692 -36.540  18.380  1.00  0.91           N  
ATOM  12335  CA  ASP B 694      72.620 -35.235  17.774  1.00  0.91           C  
ATOM  12336  C   ASP B 694      72.430 -34.207  18.873  1.00  0.91           C  
ATOM  12337  O   ASP B 694      71.978 -34.540  19.971  1.00  0.91           O  
ATOM  12338  CB  ASP B 694      71.439 -35.235  16.770  1.00  0.91           C  
ATOM  12339  CG  ASP B 694      71.446 -34.018  15.875  1.00  0.91           C  
ATOM  12340  OD1 ASP B 694      72.550 -33.453  15.682  1.00  0.91           O  
ATOM  12341  OD2 ASP B 694      70.362 -33.646  15.361  1.00  0.91           O  
ATOM  12342  N   GLY B 695      72.802 -32.936  18.621  1.00  0.94           N  
ATOM  12343  CA  GLY B 695      72.731 -31.830  19.574  1.00  0.94           C  
ATOM  12344  C   GLY B 695      73.081 -32.140  21.012  1.00  0.94           C  
ATOM  12345  O   GLY B 695      74.141 -32.677  21.332  1.00  0.94           O  
ATOM  12346  N   ALA B 696      72.170 -31.810  21.940  1.00  0.94           N  
ATOM  12347  CA  ALA B 696      72.372 -32.042  23.349  1.00  0.94           C  
ATOM  12348  C   ALA B 696      72.082 -33.470  23.769  1.00  0.94           C  
ATOM  12349  O   ALA B 696      72.465 -33.880  24.864  1.00  0.94           O  
ATOM  12350  CB  ALA B 696      71.516 -31.064  24.163  1.00  0.94           C  
ATOM  12351  N   ASN B 697      71.471 -34.300  22.887  1.00  0.93           N  
ATOM  12352  CA  ASN B 697      71.185 -35.706  23.154  1.00  0.93           C  
ATOM  12353  C   ASN B 697      72.456 -36.471  23.504  1.00  0.93           C  
ATOM  12354  O   ASN B 697      72.462 -37.336  24.374  1.00  0.93           O  
ATOM  12355  CB  ASN B 697      70.552 -36.463  21.955  1.00  0.93           C  
ATOM  12356  CG  ASN B 697      69.239 -35.862  21.462  1.00  0.93           C  
ATOM  12357  OD1 ASN B 697      68.540 -35.101  22.136  1.00  0.93           O  
ATOM  12358  ND2 ASN B 697      68.865 -36.285  20.230  1.00  0.93           N  
ATOM  12359  N   VAL B 698      73.583 -36.123  22.847  1.00  0.94           N  
ATOM  12360  CA  VAL B 698      74.900 -36.681  23.115  1.00  0.94           C  
ATOM  12361  C   VAL B 698      75.378 -36.450  24.540  1.00  0.94           C  
ATOM  12362  O   VAL B 698      75.861 -37.349  25.221  1.00  0.94           O  
ATOM  12363  CB  VAL B 698      75.938 -36.051  22.189  1.00  0.94           C  
ATOM  12364  CG1 VAL B 698      77.313 -36.724  22.372  1.00  0.94           C  
ATOM  12365  CG2 VAL B 698      75.483 -36.186  20.728  1.00  0.94           C  
ATOM  12366  N   GLU B 699      75.228 -35.215  25.045  1.00  0.93           N  
ATOM  12367  CA  GLU B 699      75.584 -34.872  26.405  1.00  0.93           C  
ATOM  12368  C   GLU B 699      74.644 -35.474  27.426  1.00  0.93           C  
ATOM  12369  O   GLU B 699      75.071 -35.919  28.484  1.00  0.93           O  
ATOM  12370  CB  GLU B 699      75.697 -33.345  26.559  1.00  0.93           C  
ATOM  12371  CG  GLU B 699      76.904 -32.814  25.755  1.00  0.93           C  
ATOM  12372  CD  GLU B 699      76.940 -31.302  25.708  1.00  0.93           C  
ATOM  12373  OE1 GLU B 699      77.380 -30.689  26.719  1.00  0.93           O  
ATOM  12374  OE2 GLU B 699      76.557 -30.731  24.660  1.00  0.93           O  
ATOM  12375  N   MET B 700      73.332 -35.549  27.124  1.00  0.93           N  
ATOM  12376  CA  MET B 700      72.361 -36.260  27.943  1.00  0.93           C  
ATOM  12377  C   MET B 700      72.716 -37.742  28.078  1.00  0.93           C  
ATOM  12378  O   MET B 700      72.631 -38.328  29.156  1.00  0.93           O  
ATOM  12379  CB  MET B 700      70.939 -36.115  27.343  1.00  0.93           C  
ATOM  12380  CG  MET B 700      70.399 -34.669  27.313  1.00  0.93           C  
ATOM  12381  SD  MET B 700      68.926 -34.442  26.275  1.00  0.93           S  
ATOM  12382  CE  MET B 700      67.837 -35.704  26.998  1.00  0.93           C  
ATOM  12383  N   ALA B 701      73.181 -38.360  26.973  1.00  0.93           N  
ATOM  12384  CA  ALA B 701      73.703 -39.710  26.935  1.00  0.93           C  
ATOM  12385  C   ALA B 701      74.930 -39.961  27.760  1.00  0.93           C  
ATOM  12386  O   ALA B 701      75.029 -40.970  28.459  1.00  0.93           O  
ATOM  12387  CB  ALA B 701      73.902 -40.124  25.453  1.00  0.93           C  
ATOM  12388  N   GLU B 702      75.872 -39.023  27.730  1.00  0.90           N  
ATOM  12389  CA  GLU B 702      77.050 -39.025  28.573  1.00  0.90           C  
ATOM  12390  C   GLU B 702      76.736 -38.909  30.061  1.00  0.90           C  
ATOM  12391  O   GLU B 702      77.222 -39.701  30.861  1.00  0.90           O  
ATOM  12392  CB  GLU B 702      77.973 -37.877  28.093  1.00  0.90           C  
ATOM  12393  CG  GLU B 702      79.328 -37.689  28.827  1.00  0.90           C  
ATOM  12394  CD  GLU B 702      80.186 -36.706  28.050  1.00  0.90           C  
ATOM  12395  OE1 GLU B 702      80.631 -37.053  26.926  1.00  0.90           O  
ATOM  12396  OE2 GLU B 702      80.338 -35.525  28.465  1.00  0.90           O  
ATOM  12397  N   GLU B 703      75.857 -37.962  30.461  1.00  0.92           N  
ATOM  12398  CA  GLU B 703      75.466 -37.793  31.854  1.00  0.92           C  
ATOM  12399  C   GLU B 703      74.662 -38.960  32.437  1.00  0.92           C  
ATOM  12400  O   GLU B 703      74.954 -39.452  33.527  1.00  0.92           O  
ATOM  12401  CB  GLU B 703      74.616 -36.508  32.041  1.00  0.92           C  
ATOM  12402  CG  GLU B 703      75.310 -35.155  31.723  1.00  0.92           C  
ATOM  12403  CD  GLU B 703      76.403 -34.687  32.687  1.00  0.92           C  
ATOM  12404  OE1 GLU B 703      76.171 -34.648  33.925  1.00  0.92           O  
ATOM  12405  OE2 GLU B 703      77.456 -34.235  32.160  1.00  0.92           O  
ATOM  12406  N   ALA B 704      73.620 -39.461  31.736  1.00  0.93           N  
ATOM  12407  CA  ALA B 704      72.779 -40.518  32.279  1.00  0.93           C  
ATOM  12408  C   ALA B 704      73.354 -41.905  32.103  1.00  0.93           C  
ATOM  12409  O   ALA B 704      72.919 -42.855  32.753  1.00  0.93           O  
ATOM  12410  CB  ALA B 704      71.394 -40.495  31.603  1.00  0.93           C  
ATOM  12411  N   GLY B 705      74.344 -42.046  31.209  1.00  0.91           N  
ATOM  12412  CA  GLY B 705      74.853 -43.328  30.760  1.00  0.91           C  
ATOM  12413  C   GLY B 705      74.069 -43.845  29.580  1.00  0.91           C  
ATOM  12414  O   GLY B 705      72.841 -43.773  29.514  1.00  0.91           O  
ATOM  12415  N   ALA B 706      74.771 -44.425  28.593  1.00  0.90           N  
ATOM  12416  CA  ALA B 706      74.182 -44.886  27.355  1.00  0.90           C  
ATOM  12417  C   ALA B 706      73.264 -46.093  27.519  1.00  0.90           C  
ATOM  12418  O   ALA B 706      72.345 -46.299  26.731  1.00  0.90           O  
ATOM  12419  CB  ALA B 706      75.303 -45.188  26.343  1.00  0.90           C  
ATOM  12420  N   GLU B 707      73.441 -46.883  28.595  1.00  0.85           N  
ATOM  12421  CA  GLU B 707      72.599 -48.025  28.927  1.00  0.85           C  
ATOM  12422  C   GLU B 707      71.254 -47.614  29.491  1.00  0.85           C  
ATOM  12423  O   GLU B 707      70.368 -48.442  29.722  1.00  0.85           O  
ATOM  12424  CB  GLU B 707      73.228 -48.983  29.980  1.00  0.85           C  
ATOM  12425  CG  GLU B 707      74.707 -48.722  30.327  1.00  0.85           C  
ATOM  12426  CD  GLU B 707      74.854 -47.452  31.159  1.00  0.85           C  
ATOM  12427  OE1 GLU B 707      74.287 -47.395  32.281  1.00  0.85           O  
ATOM  12428  OE2 GLU B 707      75.462 -46.497  30.612  1.00  0.85           O  
ATOM  12429  N   ASN B 708      71.090 -46.320  29.798  1.00  0.89           N  
ATOM  12430  CA  ASN B 708      69.874 -45.801  30.377  1.00  0.89           C  
ATOM  12431  C   ASN B 708      69.088 -45.012  29.343  1.00  0.89           C  
ATOM  12432  O   ASN B 708      68.116 -44.331  29.671  1.00  0.89           O  
ATOM  12433  CB  ASN B 708      70.216 -44.972  31.638  1.00  0.89           C  
ATOM  12434  CG  ASN B 708      70.955 -45.891  32.612  1.00  0.89           C  
ATOM  12435  OD1 ASN B 708      70.486 -46.984  32.955  1.00  0.89           O  
ATOM  12436  ND2 ASN B 708      72.147 -45.470  33.075  1.00  0.89           N  
ATOM  12437  N   LEU B 709      69.471 -45.145  28.058  1.00  0.89           N  
ATOM  12438  CA  LEU B 709      68.870 -44.454  26.939  1.00  0.89           C  
ATOM  12439  C   LEU B 709      68.659 -45.374  25.753  1.00  0.89           C  
ATOM  12440  O   LEU B 709      69.230 -46.456  25.646  1.00  0.89           O  
ATOM  12441  CB  LEU B 709      69.789 -43.348  26.380  1.00  0.89           C  
ATOM  12442  CG  LEU B 709      70.137 -42.180  27.296  1.00  0.89           C  
ATOM  12443  CD1 LEU B 709      70.993 -41.262  26.452  1.00  0.89           C  
ATOM  12444  CD2 LEU B 709      68.931 -41.418  27.839  1.00  0.89           C  
ATOM  12445  N   PHE B 710      67.834 -44.917  24.796  1.00  0.93           N  
ATOM  12446  CA  PHE B 710      67.537 -45.614  23.565  1.00  0.93           C  
ATOM  12447  C   PHE B 710      68.155 -44.878  22.378  1.00  0.93           C  
ATOM  12448  O   PHE B 710      67.482 -44.299  21.523  1.00  0.93           O  
ATOM  12449  CB  PHE B 710      66.005 -45.741  23.441  1.00  0.93           C  
ATOM  12450  CG  PHE B 710      65.490 -46.628  24.533  1.00  0.93           C  
ATOM  12451  CD1 PHE B 710      65.700 -48.015  24.463  1.00  0.93           C  
ATOM  12452  CD2 PHE B 710      64.787 -46.094  25.628  1.00  0.93           C  
ATOM  12453  CE1 PHE B 710      65.195 -48.860  25.457  1.00  0.93           C  
ATOM  12454  CE2 PHE B 710      64.272 -46.939  26.618  1.00  0.93           C  
ATOM  12455  CZ  PHE B 710      64.470 -48.322  26.526  1.00  0.93           C  
ATOM  12456  N   ILE B 711      69.500 -44.866  22.314  1.00  0.93           N  
ATOM  12457  CA  ILE B 711      70.261 -44.328  21.192  1.00  0.93           C  
ATOM  12458  C   ILE B 711      70.155 -45.200  19.950  1.00  0.93           C  
ATOM  12459  O   ILE B 711      70.319 -46.417  20.004  1.00  0.93           O  
ATOM  12460  CB  ILE B 711      71.733 -44.095  21.551  1.00  0.93           C  
ATOM  12461  CG1 ILE B 711      71.884 -43.001  22.638  1.00  0.93           C  
ATOM  12462  CG2 ILE B 711      72.579 -43.737  20.305  1.00  0.93           C  
ATOM  12463  CD1 ILE B 711      71.418 -41.602  22.203  1.00  0.93           C  
ATOM  12464  N   PHE B 712      69.932 -44.587  18.772  1.00  0.93           N  
ATOM  12465  CA  PHE B 712      69.851 -45.316  17.523  1.00  0.93           C  
ATOM  12466  C   PHE B 712      70.415 -44.503  16.373  1.00  0.93           C  
ATOM  12467  O   PHE B 712      70.808 -43.346  16.527  1.00  0.93           O  
ATOM  12468  CB  PHE B 712      68.404 -45.802  17.198  1.00  0.93           C  
ATOM  12469  CG  PHE B 712      67.485 -44.693  16.753  1.00  0.93           C  
ATOM  12470  CD1 PHE B 712      66.910 -43.825  17.689  1.00  0.93           C  
ATOM  12471  CD2 PHE B 712      67.260 -44.468  15.383  1.00  0.93           C  
ATOM  12472  CE1 PHE B 712      66.159 -42.726  17.262  1.00  0.93           C  
ATOM  12473  CE2 PHE B 712      66.522 -43.361  14.954  1.00  0.93           C  
ATOM  12474  CZ  PHE B 712      65.975 -42.486  15.895  1.00  0.93           C  
ATOM  12475  N   GLY B 713      70.438 -45.126  15.178  1.00  0.95           N  
ATOM  12476  CA  GLY B 713      70.696 -44.436  13.923  1.00  0.95           C  
ATOM  12477  C   GLY B 713      72.109 -44.041  13.633  1.00  0.95           C  
ATOM  12478  O   GLY B 713      73.038 -44.268  14.413  1.00  0.95           O  
ATOM  12479  N   LEU B 714      72.283 -43.429  12.454  1.00  0.91           N  
ATOM  12480  CA  LEU B 714      73.527 -42.878  11.967  1.00  0.91           C  
ATOM  12481  C   LEU B 714      74.131 -41.838  12.905  1.00  0.91           C  
ATOM  12482  O   LEU B 714      73.444 -41.044  13.552  1.00  0.91           O  
ATOM  12483  CB  LEU B 714      73.325 -42.208  10.579  1.00  0.91           C  
ATOM  12484  CG  LEU B 714      72.882 -43.137   9.423  1.00  0.91           C  
ATOM  12485  CD1 LEU B 714      72.621 -42.313   8.150  1.00  0.91           C  
ATOM  12486  CD2 LEU B 714      73.876 -44.258   9.095  1.00  0.91           C  
ATOM  12487  N   ARG B 715      75.467 -41.827  13.008  1.00  0.84           N  
ATOM  12488  CA  ARG B 715      76.226 -40.784  13.655  1.00  0.84           C  
ATOM  12489  C   ARG B 715      76.540 -39.711  12.624  1.00  0.84           C  
ATOM  12490  O   ARG B 715      76.230 -39.857  11.441  1.00  0.84           O  
ATOM  12491  CB  ARG B 715      77.525 -41.361  14.262  1.00  0.84           C  
ATOM  12492  CG  ARG B 715      77.298 -42.484  15.295  1.00  0.84           C  
ATOM  12493  CD  ARG B 715      76.594 -42.003  16.557  1.00  0.84           C  
ATOM  12494  NE  ARG B 715      76.542 -43.146  17.529  1.00  0.84           N  
ATOM  12495  CZ  ARG B 715      75.495 -43.972  17.664  1.00  0.84           C  
ATOM  12496  NH1 ARG B 715      74.447 -43.924  16.851  1.00  0.84           N  
ATOM  12497  NH2 ARG B 715      75.490 -44.850  18.667  1.00  0.84           N  
ATOM  12498  N   VAL B 716      77.152 -38.579  13.028  1.00  0.85           N  
ATOM  12499  CA  VAL B 716      77.470 -37.466  12.133  1.00  0.85           C  
ATOM  12500  C   VAL B 716      78.393 -37.917  11.006  1.00  0.85           C  
ATOM  12501  O   VAL B 716      78.205 -37.595   9.832  1.00  0.85           O  
ATOM  12502  CB  VAL B 716      78.115 -36.319  12.917  1.00  0.85           C  
ATOM  12503  CG1 VAL B 716      78.635 -35.204  11.987  1.00  0.85           C  
ATOM  12504  CG2 VAL B 716      77.079 -35.726  13.889  1.00  0.85           C  
ATOM  12505  N   GLU B 717      79.380 -38.753  11.359  1.00  0.77           N  
ATOM  12506  CA  GLU B 717      80.348 -39.369  10.487  1.00  0.77           C  
ATOM  12507  C   GLU B 717      79.712 -40.203   9.381  1.00  0.77           C  
ATOM  12508  O   GLU B 717      80.054 -40.082   8.203  1.00  0.77           O  
ATOM  12509  CB  GLU B 717      81.274 -40.302  11.319  1.00  0.77           C  
ATOM  12510  CG  GLU B 717      81.840 -39.717  12.647  1.00  0.77           C  
ATOM  12511  CD  GLU B 717      80.908 -39.847  13.860  1.00  0.77           C  
ATOM  12512  OE1 GLU B 717      79.945 -39.040  13.962  1.00  0.77           O  
ATOM  12513  OE2 GLU B 717      81.147 -40.744  14.703  1.00  0.77           O  
ATOM  12514  N   ASP B 718      78.721 -41.042   9.740  1.00  0.84           N  
ATOM  12515  CA  ASP B 718      77.988 -41.876   8.815  1.00  0.84           C  
ATOM  12516  C   ASP B 718      77.159 -41.065   7.825  1.00  0.84           C  
ATOM  12517  O   ASP B 718      77.119 -41.361   6.629  1.00  0.84           O  
ATOM  12518  CB  ASP B 718      77.070 -42.869   9.556  1.00  0.84           C  
ATOM  12519  CG  ASP B 718      77.772 -43.596  10.683  1.00  0.84           C  
ATOM  12520  OD1 ASP B 718      78.830 -44.213  10.423  1.00  0.84           O  
ATOM  12521  OD2 ASP B 718      77.222 -43.546  11.815  1.00  0.84           O  
ATOM  12522  N   VAL B 719      76.504 -39.977   8.294  1.00  0.87           N  
ATOM  12523  CA  VAL B 719      75.739 -39.071   7.443  1.00  0.87           C  
ATOM  12524  C   VAL B 719      76.614 -38.443   6.365  1.00  0.87           C  
ATOM  12525  O   VAL B 719      76.284 -38.500   5.182  1.00  0.87           O  
ATOM  12526  CB  VAL B 719      75.076 -37.964   8.264  1.00  0.87           C  
ATOM  12527  CG1 VAL B 719      74.347 -36.939   7.376  1.00  0.87           C  
ATOM  12528  CG2 VAL B 719      74.047 -38.559   9.241  1.00  0.87           C  
ATOM  12529  N   GLU B 720      77.801 -37.935   6.750  1.00  0.79           N  
ATOM  12530  CA  GLU B 720      78.808 -37.395   5.849  1.00  0.79           C  
ATOM  12531  C   GLU B 720      79.350 -38.408   4.849  1.00  0.79           C  
ATOM  12532  O   GLU B 720      79.503 -38.132   3.658  1.00  0.79           O  
ATOM  12533  CB  GLU B 720      79.964 -36.835   6.709  1.00  0.79           C  
ATOM  12534  CG  GLU B 720      81.178 -36.255   5.946  1.00  0.79           C  
ATOM  12535  CD  GLU B 720      80.926 -34.925   5.247  1.00  0.79           C  
ATOM  12536  OE1 GLU B 720      81.900 -34.486   4.567  1.00  0.79           O  
ATOM  12537  OE2 GLU B 720      79.842 -34.328   5.384  1.00  0.79           O  
ATOM  12538  N   ALA B 721      79.620 -39.659   5.283  1.00  0.85           N  
ATOM  12539  CA  ALA B 721      80.048 -40.724   4.395  1.00  0.85           C  
ATOM  12540  C   ALA B 721      79.039 -41.014   3.290  1.00  0.85           C  
ATOM  12541  O   ALA B 721      79.390 -41.265   2.136  1.00  0.85           O  
ATOM  12542  CB  ALA B 721      80.291 -42.007   5.210  1.00  0.85           C  
ATOM  12543  N   LEU B 722      77.747 -40.964   3.645  1.00  0.82           N  
ATOM  12544  CA  LEU B 722      76.638 -41.058   2.728  1.00  0.82           C  
ATOM  12545  C   LEU B 722      76.502 -39.846   1.816  1.00  0.82           C  
ATOM  12546  O   LEU B 722      76.307 -39.993   0.614  1.00  0.82           O  
ATOM  12547  CB  LEU B 722      75.364 -41.304   3.571  1.00  0.82           C  
ATOM  12548  CG  LEU B 722      74.307 -42.261   2.990  1.00  0.82           C  
ATOM  12549  CD1 LEU B 722      74.911 -43.602   2.550  1.00  0.82           C  
ATOM  12550  CD2 LEU B 722      73.252 -42.518   4.075  1.00  0.82           C  
ATOM  12551  N   ASP B 723      76.652 -38.611   2.337  1.00  0.81           N  
ATOM  12552  CA  ASP B 723      76.612 -37.399   1.533  1.00  0.81           C  
ATOM  12553  C   ASP B 723      77.712 -37.288   0.478  1.00  0.81           C  
ATOM  12554  O   ASP B 723      77.451 -36.902  -0.660  1.00  0.81           O  
ATOM  12555  CB  ASP B 723      76.566 -36.145   2.438  1.00  0.81           C  
ATOM  12556  CG  ASP B 723      75.163 -36.008   2.974  1.00  0.81           C  
ATOM  12557  OD1 ASP B 723      74.194 -36.010   2.164  1.00  0.81           O  
ATOM  12558  OD2 ASP B 723      74.944 -35.948   4.208  1.00  0.81           O  
ATOM  12559  N   ARG B 724      78.963 -37.677   0.789  1.00  0.72           N  
ATOM  12560  CA  ARG B 724      80.035 -37.731  -0.196  1.00  0.72           C  
ATOM  12561  C   ARG B 724      79.829 -38.737  -1.326  1.00  0.72           C  
ATOM  12562  O   ARG B 724      80.281 -38.522  -2.447  1.00  0.72           O  
ATOM  12563  CB  ARG B 724      81.390 -38.039   0.478  1.00  0.72           C  
ATOM  12564  CG  ARG B 724      81.854 -36.945   1.455  1.00  0.72           C  
ATOM  12565  CD  ARG B 724      83.204 -37.279   2.085  1.00  0.72           C  
ATOM  12566  NE  ARG B 724      83.437 -36.261   3.146  1.00  0.72           N  
ATOM  12567  CZ  ARG B 724      84.361 -36.341   4.108  1.00  0.72           C  
ATOM  12568  NH1 ARG B 724      84.287 -35.438   5.077  1.00  0.72           N  
ATOM  12569  NH2 ARG B 724      85.297 -37.280   4.131  1.00  0.72           N  
ATOM  12570  N   LYS B 725      79.171 -39.883  -1.064  1.00  0.73           N  
ATOM  12571  CA  LYS B 725      78.872 -40.842  -2.116  1.00  0.73           C  
ATOM  12572  C   LYS B 725      77.591 -40.514  -2.861  1.00  0.73           C  
ATOM  12573  O   LYS B 725      77.407 -40.902  -4.012  1.00  0.73           O  
ATOM  12574  CB  LYS B 725      78.713 -42.251  -1.500  1.00  0.73           C  
ATOM  12575  CG  LYS B 725      80.017 -42.786  -0.893  1.00  0.73           C  
ATOM  12576  CD  LYS B 725      79.841 -44.183  -0.281  1.00  0.73           C  
ATOM  12577  CE  LYS B 725      81.136 -44.719   0.326  1.00  0.73           C  
ATOM  12578  NZ  LYS B 725      80.893 -46.060   0.898  1.00  0.73           N  
ATOM  12579  N   GLY B 726      76.682 -39.772  -2.207  1.00  0.82           N  
ATOM  12580  CA  GLY B 726      75.347 -39.500  -2.703  1.00  0.82           C  
ATOM  12581  C   GLY B 726      74.330 -40.397  -2.050  1.00  0.82           C  
ATOM  12582  O   GLY B 726      74.381 -41.620  -2.127  1.00  0.82           O  
ATOM  12583  N   TYR B 727      73.331 -39.798  -1.382  1.00  0.84           N  
ATOM  12584  CA  TYR B 727      72.237 -40.536  -0.781  1.00  0.84           C  
ATOM  12585  C   TYR B 727      71.232 -41.033  -1.814  1.00  0.84           C  
ATOM  12586  O   TYR B 727      70.686 -40.263  -2.602  1.00  0.84           O  
ATOM  12587  CB  TYR B 727      71.518 -39.640   0.264  1.00  0.84           C  
ATOM  12588  CG  TYR B 727      70.314 -40.281   0.916  1.00  0.84           C  
ATOM  12589  CD1 TYR B 727      70.424 -41.435   1.711  1.00  0.84           C  
ATOM  12590  CD2 TYR B 727      69.044 -39.716   0.714  1.00  0.84           C  
ATOM  12591  CE1 TYR B 727      69.282 -42.000   2.305  1.00  0.84           C  
ATOM  12592  CE2 TYR B 727      67.910 -40.278   1.312  1.00  0.84           C  
ATOM  12593  CZ  TYR B 727      68.028 -41.414   2.112  1.00  0.84           C  
ATOM  12594  OH  TYR B 727      66.883 -41.943   2.739  1.00  0.84           O  
ATOM  12595  N   ASN B 728      70.930 -42.340  -1.797  1.00  0.85           N  
ATOM  12596  CA  ASN B 728      69.905 -42.909  -2.643  1.00  0.85           C  
ATOM  12597  C   ASN B 728      68.924 -43.676  -1.773  1.00  0.85           C  
ATOM  12598  O   ASN B 728      69.181 -44.780  -1.300  1.00  0.85           O  
ATOM  12599  CB  ASN B 728      70.622 -43.803  -3.683  1.00  0.85           C  
ATOM  12600  CG  ASN B 728      69.760 -44.414  -4.779  1.00  0.85           C  
ATOM  12601  OD1 ASN B 728      68.588 -44.112  -5.019  1.00  0.85           O  
ATOM  12602  ND2 ASN B 728      70.396 -45.340  -5.537  1.00  0.85           N  
ATOM  12603  N   ALA B 729      67.722 -43.110  -1.556  1.00  0.91           N  
ATOM  12604  CA  ALA B 729      66.699 -43.698  -0.714  1.00  0.91           C  
ATOM  12605  C   ALA B 729      66.170 -45.024  -1.243  1.00  0.91           C  
ATOM  12606  O   ALA B 729      65.791 -45.918  -0.486  1.00  0.91           O  
ATOM  12607  CB  ALA B 729      65.560 -42.693  -0.536  1.00  0.91           C  
ATOM  12608  N   ARG B 730      66.211 -45.200  -2.577  1.00  0.80           N  
ATOM  12609  CA  ARG B 730      65.824 -46.421  -3.258  1.00  0.80           C  
ATOM  12610  C   ARG B 730      66.557 -47.662  -2.763  1.00  0.80           C  
ATOM  12611  O   ARG B 730      65.966 -48.720  -2.617  1.00  0.80           O  
ATOM  12612  CB  ARG B 730      66.058 -46.304  -4.781  1.00  0.80           C  
ATOM  12613  CG  ARG B 730      65.262 -45.163  -5.447  1.00  0.80           C  
ATOM  12614  CD  ARG B 730      65.469 -45.058  -6.962  1.00  0.80           C  
ATOM  12615  NE  ARG B 730      66.916 -44.759  -7.204  1.00  0.80           N  
ATOM  12616  CZ  ARG B 730      67.529 -44.919  -8.384  1.00  0.80           C  
ATOM  12617  NH1 ARG B 730      68.848 -44.763  -8.451  1.00  0.80           N  
ATOM  12618  NH2 ARG B 730      66.852 -45.234  -9.485  1.00  0.80           N  
ATOM  12619  N   GLU B 731      67.852 -47.556  -2.415  1.00  0.79           N  
ATOM  12620  CA  GLU B 731      68.644 -48.676  -1.933  1.00  0.79           C  
ATOM  12621  C   GLU B 731      68.099 -49.324  -0.663  1.00  0.79           C  
ATOM  12622  O   GLU B 731      68.049 -50.540  -0.518  1.00  0.79           O  
ATOM  12623  CB  GLU B 731      70.102 -48.205  -1.714  1.00  0.79           C  
ATOM  12624  CG  GLU B 731      70.667 -47.530  -2.984  1.00  0.79           C  
ATOM  12625  CD  GLU B 731      72.090 -46.997  -2.869  1.00  0.79           C  
ATOM  12626  OE1 GLU B 731      72.557 -46.705  -1.743  1.00  0.79           O  
ATOM  12627  OE2 GLU B 731      72.660 -46.766  -3.971  1.00  0.79           O  
ATOM  12628  N   TYR B 732      67.621 -48.515   0.295  1.00  0.86           N  
ATOM  12629  CA  TYR B 732      66.924 -48.997   1.477  1.00  0.86           C  
ATOM  12630  C   TYR B 732      65.547 -49.547   1.140  1.00  0.86           C  
ATOM  12631  O   TYR B 732      65.110 -50.569   1.656  1.00  0.86           O  
ATOM  12632  CB  TYR B 732      66.765 -47.874   2.531  1.00  0.86           C  
ATOM  12633  CG  TYR B 732      68.088 -47.207   2.767  1.00  0.86           C  
ATOM  12634  CD1 TYR B 732      69.018 -47.748   3.668  1.00  0.86           C  
ATOM  12635  CD2 TYR B 732      68.439 -46.069   2.022  1.00  0.86           C  
ATOM  12636  CE1 TYR B 732      70.292 -47.174   3.799  1.00  0.86           C  
ATOM  12637  CE2 TYR B 732      69.716 -45.510   2.134  1.00  0.86           C  
ATOM  12638  CZ  TYR B 732      70.640 -46.065   3.020  1.00  0.86           C  
ATOM  12639  OH  TYR B 732      71.929 -45.517   3.094  1.00  0.86           O  
ATOM  12640  N   TYR B 733      64.824 -48.884   0.221  1.00  0.84           N  
ATOM  12641  CA  TYR B 733      63.495 -49.281  -0.214  1.00  0.84           C  
ATOM  12642  C   TYR B 733      63.455 -50.676  -0.818  1.00  0.84           C  
ATOM  12643  O   TYR B 733      62.609 -51.503  -0.474  1.00  0.84           O  
ATOM  12644  CB  TYR B 733      63.026 -48.260  -1.278  1.00  0.84           C  
ATOM  12645  CG  TYR B 733      61.569 -48.385  -1.583  1.00  0.84           C  
ATOM  12646  CD1 TYR B 733      60.665 -47.811  -0.690  1.00  0.84           C  
ATOM  12647  CD2 TYR B 733      61.092 -48.997  -2.760  1.00  0.84           C  
ATOM  12648  CE1 TYR B 733      59.308 -47.795  -0.996  1.00  0.84           C  
ATOM  12649  CE2 TYR B 733      59.716 -48.984  -3.058  1.00  0.84           C  
ATOM  12650  CZ  TYR B 733      58.828 -48.353  -2.178  1.00  0.84           C  
ATOM  12651  OH  TYR B 733      57.453 -48.182  -2.433  1.00  0.84           O  
ATOM  12652  N   ASP B 734      64.432 -50.972  -1.685  1.00  0.81           N  
ATOM  12653  CA  ASP B 734      64.518 -52.204  -2.426  1.00  0.81           C  
ATOM  12654  C   ASP B 734      64.886 -53.396  -1.538  1.00  0.81           C  
ATOM  12655  O   ASP B 734      64.640 -54.548  -1.891  1.00  0.81           O  
ATOM  12656  CB  ASP B 734      65.572 -52.007  -3.549  1.00  0.81           C  
ATOM  12657  CG  ASP B 734      65.144 -50.963  -4.579  1.00  0.81           C  
ATOM  12658  OD1 ASP B 734      63.946 -50.576  -4.608  1.00  0.81           O  
ATOM  12659  OD2 ASP B 734      66.034 -50.539  -5.364  1.00  0.81           O  
ATOM  12660  N   HIS B 735      65.444 -53.147  -0.332  1.00  0.80           N  
ATOM  12661  CA  HIS B 735      65.819 -54.212   0.589  1.00  0.80           C  
ATOM  12662  C   HIS B 735      64.947 -54.337   1.824  1.00  0.80           C  
ATOM  12663  O   HIS B 735      65.117 -55.281   2.592  1.00  0.80           O  
ATOM  12664  CB  HIS B 735      67.269 -54.015   1.088  1.00  0.80           C  
ATOM  12665  CG  HIS B 735      68.283 -54.352   0.044  1.00  0.80           C  
ATOM  12666  ND1 HIS B 735      68.422 -55.671  -0.344  1.00  0.80           N  
ATOM  12667  CD2 HIS B 735      69.120 -53.562  -0.674  1.00  0.80           C  
ATOM  12668  CE1 HIS B 735      69.331 -55.656  -1.293  1.00  0.80           C  
ATOM  12669  NE2 HIS B 735      69.789 -54.404  -1.535  1.00  0.80           N  
ATOM  12670  N   LEU B 736      63.980 -53.432   2.071  1.00  0.87           N  
ATOM  12671  CA  LEU B 736      63.204 -53.464   3.310  1.00  0.87           C  
ATOM  12672  C   LEU B 736      61.706 -53.663   3.023  1.00  0.87           C  
ATOM  12673  O   LEU B 736      60.997 -52.686   2.764  1.00  0.87           O  
ATOM  12674  CB  LEU B 736      63.362 -52.117   4.074  1.00  0.87           C  
ATOM  12675  CG  LEU B 736      64.646 -51.881   4.914  1.00  0.87           C  
ATOM  12676  CD1 LEU B 736      65.952 -52.402   4.307  1.00  0.87           C  
ATOM  12677  CD2 LEU B 736      64.802 -50.379   5.188  1.00  0.87           C  
ATOM  12678  N   PRO B 737      61.132 -54.874   3.123  1.00  0.88           N  
ATOM  12679  CA  PRO B 737      59.741 -55.122   2.726  1.00  0.88           C  
ATOM  12680  C   PRO B 737      58.703 -54.402   3.560  1.00  0.88           C  
ATOM  12681  O   PRO B 737      57.699 -53.946   3.015  1.00  0.88           O  
ATOM  12682  CB  PRO B 737      59.591 -56.647   2.826  1.00  0.88           C  
ATOM  12683  CG  PRO B 737      60.992 -57.163   2.499  1.00  0.88           C  
ATOM  12684  CD  PRO B 737      61.906 -56.122   3.142  1.00  0.88           C  
ATOM  12685  N   GLU B 738      58.920 -54.276   4.882  1.00  0.87           N  
ATOM  12686  CA  GLU B 738      58.039 -53.525   5.762  1.00  0.87           C  
ATOM  12687  C   GLU B 738      57.977 -52.043   5.421  1.00  0.87           C  
ATOM  12688  O   GLU B 738      56.922 -51.417   5.459  1.00  0.87           O  
ATOM  12689  CB  GLU B 738      58.446 -53.672   7.247  1.00  0.87           C  
ATOM  12690  CG  GLU B 738      58.223 -55.096   7.810  1.00  0.87           C  
ATOM  12691  CD  GLU B 738      57.960 -55.117   9.312  1.00  0.87           C  
ATOM  12692  OE1 GLU B 738      58.707 -54.477  10.094  1.00  0.87           O  
ATOM  12693  OE2 GLU B 738      56.979 -55.790   9.725  1.00  0.87           O  
ATOM  12694  N   LEU B 739      59.124 -51.439   5.045  1.00  0.90           N  
ATOM  12695  CA  LEU B 739      59.166 -50.057   4.602  1.00  0.90           C  
ATOM  12696  C   LEU B 739      58.416 -49.842   3.308  1.00  0.90           C  
ATOM  12697  O   LEU B 739      57.621 -48.912   3.187  1.00  0.90           O  
ATOM  12698  CB  LEU B 739      60.626 -49.593   4.419  1.00  0.90           C  
ATOM  12699  CG  LEU B 739      60.812 -48.144   3.925  1.00  0.90           C  
ATOM  12700  CD1 LEU B 739      60.132 -47.122   4.845  1.00  0.90           C  
ATOM  12701  CD2 LEU B 739      62.307 -47.836   3.795  1.00  0.90           C  
ATOM  12702  N   LYS B 740      58.596 -50.748   2.325  1.00  0.85           N  
ATOM  12703  CA  LYS B 740      57.843 -50.698   1.088  1.00  0.85           C  
ATOM  12704  C   LYS B 740      56.336 -50.788   1.325  1.00  0.85           C  
ATOM  12705  O   LYS B 740      55.564 -50.010   0.776  1.00  0.85           O  
ATOM  12706  CB  LYS B 740      58.313 -51.802   0.111  1.00  0.85           C  
ATOM  12707  CG  LYS B 740      57.579 -51.740  -1.238  1.00  0.85           C  
ATOM  12708  CD  LYS B 740      58.104 -52.722  -2.293  1.00  0.85           C  
ATOM  12709  CE  LYS B 740      57.486 -52.492  -3.679  1.00  0.85           C  
ATOM  12710  NZ  LYS B 740      56.019 -52.636  -3.623  1.00  0.85           N  
ATOM  12711  N   GLN B 741      55.893 -51.680   2.240  1.00  0.86           N  
ATOM  12712  CA  GLN B 741      54.506 -51.773   2.671  1.00  0.86           C  
ATOM  12713  C   GLN B 741      53.957 -50.469   3.250  1.00  0.86           C  
ATOM  12714  O   GLN B 741      52.857 -50.035   2.908  1.00  0.86           O  
ATOM  12715  CB  GLN B 741      54.365 -52.916   3.721  1.00  0.86           C  
ATOM  12716  CG  GLN B 741      52.937 -53.098   4.301  1.00  0.86           C  
ATOM  12717  CD  GLN B 741      52.761 -54.371   5.145  1.00  0.86           C  
ATOM  12718  OE1 GLN B 741      53.347 -54.631   6.200  1.00  0.86           O  
ATOM  12719  NE2 GLN B 741      51.839 -55.244   4.669  1.00  0.86           N  
ATOM  12720  N   ALA B 742      54.722 -49.775   4.113  1.00  0.93           N  
ATOM  12721  CA  ALA B 742      54.336 -48.477   4.629  1.00  0.93           C  
ATOM  12722  C   ALA B 742      54.225 -47.381   3.570  1.00  0.93           C  
ATOM  12723  O   ALA B 742      53.230 -46.660   3.508  1.00  0.93           O  
ATOM  12724  CB  ALA B 742      55.315 -48.052   5.736  1.00  0.93           C  
ATOM  12725  N   VAL B 743      55.224 -47.263   2.676  1.00  0.89           N  
ATOM  12726  CA  VAL B 743      55.231 -46.293   1.588  1.00  0.89           C  
ATOM  12727  C   VAL B 743      54.141 -46.522   0.560  1.00  0.89           C  
ATOM  12728  O   VAL B 743      53.449 -45.581   0.167  1.00  0.89           O  
ATOM  12729  CB  VAL B 743      56.581 -46.278   0.894  1.00  0.89           C  
ATOM  12730  CG1 VAL B 743      56.608 -45.349  -0.339  1.00  0.89           C  
ATOM  12731  CG2 VAL B 743      57.671 -45.832   1.888  1.00  0.89           C  
ATOM  12732  N   ASP B 744      53.905 -47.778   0.132  1.00  0.88           N  
ATOM  12733  CA  ASP B 744      52.846 -48.106  -0.797  1.00  0.88           C  
ATOM  12734  C   ASP B 744      51.460 -47.760  -0.240  1.00  0.88           C  
ATOM  12735  O   ASP B 744      50.616 -47.270  -0.978  1.00  0.88           O  
ATOM  12736  CB  ASP B 744      52.919 -49.597  -1.224  1.00  0.88           C  
ATOM  12737  CG  ASP B 744      54.081 -49.925  -2.158  1.00  0.88           C  
ATOM  12738  OD1 ASP B 744      54.622 -49.034  -2.853  1.00  0.88           O  
ATOM  12739  OD2 ASP B 744      54.426 -51.138  -2.247  1.00  0.88           O  
ATOM  12740  N   GLN B 745      51.193 -47.931   1.079  1.00  0.87           N  
ATOM  12741  CA  GLN B 745      49.965 -47.433   1.703  1.00  0.87           C  
ATOM  12742  C   GLN B 745      49.788 -45.914   1.631  1.00  0.87           C  
ATOM  12743  O   GLN B 745      48.695 -45.415   1.366  1.00  0.87           O  
ATOM  12744  CB  GLN B 745      49.884 -47.810   3.204  1.00  0.87           C  
ATOM  12745  CG  GLN B 745      49.698 -49.320   3.467  1.00  0.87           C  
ATOM  12746  CD  GLN B 745      49.788 -49.635   4.960  1.00  0.87           C  
ATOM  12747  OE1 GLN B 745      48.852 -50.089   5.617  1.00  0.87           O  
ATOM  12748  NE2 GLN B 745      50.989 -49.398   5.525  1.00  0.87           N  
ATOM  12749  N   ILE B 746      50.862 -45.130   1.872  1.00  0.90           N  
ATOM  12750  CA  ILE B 746      50.841 -43.674   1.741  1.00  0.90           C  
ATOM  12751  C   ILE B 746      50.578 -43.260   0.298  1.00  0.90           C  
ATOM  12752  O   ILE B 746      49.762 -42.388   0.015  1.00  0.90           O  
ATOM  12753  CB  ILE B 746      52.173 -43.069   2.209  1.00  0.90           C  
ATOM  12754  CG1 ILE B 746      52.462 -43.389   3.694  1.00  0.90           C  
ATOM  12755  CG2 ILE B 746      52.219 -41.539   2.007  1.00  0.90           C  
ATOM  12756  CD1 ILE B 746      53.915 -43.099   4.096  1.00  0.90           C  
ATOM  12757  N   SER B 747      51.271 -43.919  -0.647  1.00  0.86           N  
ATOM  12758  CA  SER B 747      51.169 -43.695  -2.082  1.00  0.86           C  
ATOM  12759  C   SER B 747      49.846 -44.096  -2.717  1.00  0.86           C  
ATOM  12760  O   SER B 747      49.331 -43.419  -3.599  1.00  0.86           O  
ATOM  12761  CB  SER B 747      52.323 -44.441  -2.794  1.00  0.86           C  
ATOM  12762  OG  SER B 747      52.491 -44.007  -4.144  1.00  0.86           O  
ATOM  12763  N   SER B 748      49.240 -45.221  -2.288  1.00  0.88           N  
ATOM  12764  CA  SER B 748      48.025 -45.739  -2.906  1.00  0.88           C  
ATOM  12765  C   SER B 748      46.744 -45.153  -2.348  1.00  0.88           C  
ATOM  12766  O   SER B 748      45.661 -45.407  -2.872  1.00  0.88           O  
ATOM  12767  CB  SER B 748      47.930 -47.287  -2.770  1.00  0.88           C  
ATOM  12768  OG  SER B 748      47.753 -47.720  -1.414  1.00  0.88           O  
ATOM  12769  N   GLY B 749      46.833 -44.333  -1.281  1.00  0.90           N  
ATOM  12770  CA  GLY B 749      45.669 -43.672  -0.705  1.00  0.90           C  
ATOM  12771  C   GLY B 749      44.987 -44.400   0.412  1.00  0.90           C  
ATOM  12772  O   GLY B 749      43.841 -44.109   0.739  1.00  0.90           O  
ATOM  12773  N   PHE B 750      45.669 -45.341   1.088  1.00  0.90           N  
ATOM  12774