CNRS Nantes University UFIP UFIP
home |  start a new run |  job status |  references&downloads |  examples |  help  

Should you encounter any unexpected behaviour,
please let us know.


***    ***

elNémo ID: 211208145231143907

Job options:

ID        	=	 211208145231143907
JOBID     	=	 
USERID    	=	 unknown
PRIVAT    	=	 0

NMODES    	=	 5
DQMIN     	=	 -100
DQMAX     	=	 100
DQSTEP    	=	 20
DOGRAPHS  	=	 on

DOPROJMODS	=	 0
DORMSD    	=	 0

NRBL      	=	 0
CUTOFF    	=	 0
CAONLY    	=	 0


Input data for this run:


TITLE     SWISS-MODEL SERVER (https://swissmodel.expasy.org)
TITLE    2 Untitled Project
EXPDTA    THEORETICAL MODEL (SWISS-MODEL SERVER)
AUTHOR    SWISS-MODEL SERVER (SEE REFERENCE IN JRNL Records)
REVDAT   1   08-DEC-21 1MOD    1       14:35
JRNL        AUTH   A.WATERHOUSE,M.BERTONI,S.BIENERT,G.STUDER,G.TAURIELLO,
JRNL        AUTH 2 R.GUMIENNY,F.T.HEER,T.A.P.DE BEER,C.REMPFER,L.BORDOLI,
JRNL        AUTH 3 R.LEPORE,T.SCHWEDE
JRNL        TITL   SWISS-MODEL: HOMOLOGY MODELLING OF PROTEIN STRUCTURES AND
JRNL        TITL 2 COMPLEXES
JRNL        REF    NUCLEIC.ACIDS.RES..           V.  46 W296  2018
JRNL        PMID   29788355
JRNL        DOI    10.1093/nar/gky427
REMARK   1
REMARK   1 REFERENCE 1
REMARK   1  AUTH   S.BIENERT,A.WATERHOUSE,T.A.P.DE BEER,G.TAURIELLO,G.STUDER,
REMARK   1  AUTH 2 L.BORDOLI,T.SCHWEDE
REMARK   1  TITL   THE SWISS-MODEL REPOSITORY - NEW FEATURES AND FUNCTIONALITY
REMARK   1  REF    NUCLEIC.ACIDS.RES..           V.  45       2017
REMARK   1  REFN                   ISSN 0305-1048
REMARK   1  PMID   27899672
REMARK   1  DOI    10.1093/nar/gkw1132
REMARK   1
REMARK   1 REFERENCE 2
REMARK   1  AUTH   N.GUEX,M.C.PEITSCH,T.SCHWEDE
REMARK   1  TITL   AUTOMATED COMPARATIVE PROTEIN STRUCTURE MODELING WITH
REMARK   1  TITL 2 SWISS-MODEL AND SWISS-PDBVIEWER: A HISTORICAL PERSPECTIVE
REMARK   1  REF    ELECTROPHORESIS               V.  30       2009
REMARK   1  REFN                   ISSN 0173-0835
REMARK   1  PMID   19517507
REMARK   1  DOI    10.1002/elps.200900140
REMARK   1
REMARK   1 REFERENCE 3
REMARK   1  AUTH   G.STUDER,G.TAURIELLO,S.BIENERT,M.BIASINI,N.JOHNER,T.SCHWEDE
REMARK   1  TITL   PROMOD3 - A VERSATILE HOMOLOGY MODELLING TOOLBOX
REMARK   1  REF    PLOS COMP. BIOL.              V.  17       2021
REMARK   1  REFN                   ISSN 
REMARK   1  PMID   33507980
REMARK   1  DOI    https://doi.org/10.1371/journal.pcbi.1008667
REMARK   1
REMARK   1 REFERENCE 4
REMARK   1  AUTH   G.STUDER,C.REMPFER,A.WATERHOUSE,R.GUMIENNY,J.HAAS,T.SCHWEDE
REMARK   1  TITL   QMEANDISCO - DISTANCE CONSTRAINTS APPLIED ON MODEL QUALITY 
REMARK   1  TITL 2 ESTIMATION
REMARK   1  REF    BIOINFORMATICS                V.  36       2020
REMARK   1  REFN                   ISSN 
REMARK   1  PMID   31697312
REMARK   1  DOI    https://doi.org/10.1093/bioinformatics/btz828
REMARK   1
REMARK   1 REFERENCE 5
REMARK   1  AUTH   P.BENKERT,M.BIASINI,T.SCHWEDE
REMARK   1  TITL   TOWARD THE ESTIMATION OF THE ABSOLUTE QUALITY OF INDIVIDUAL
REMARK   1  TITL 2 PROTEIN STRUCTURE MODELS
REMARK   1  REF    BIOINFORMATICS                V.  27       2011
REMARK   1  REFN                   ISSN 1367-4803
REMARK   1  PMID   21134891
REMARK   1  DOI    10.1093/bioinformatics/btq662
REMARK   1
REMARK   1 REFERENCE 6
REMARK   1  AUTH   M.BERTONI,F.KIEFER,M.BIASINI,L.BORDOLI,T.SCHWEDE
REMARK   1  TITL   MODELING PROTEIN QUATERNARY STRUCTURE OF HOMO- AND
REMARK   1  TITL 2 HETERO-OLIGOMERS BEYOND BINARY INTERACTIONS BY HOMOLOGY
REMARK   1  REF    SCI.REP.                      V.   7       2017
REMARK   1  REFN                   ISSN
REMARK   1  PMID   28874689
REMARK   1  DOI    10.1038/s41598-017-09654-8
REMARK   1
REMARK   1 DISCLAIMER
REMARK   1 The SWISS-MODEL SERVER produces theoretical models for proteins.
REMARK   1 The results of any theoretical modelling procedure is
REMARK   1 NON-EXPERIMENTAL and MUST be considered with care. These models may
REMARK   1 contain significant errors. This is especially true for automated
REMARK   1 modeling since there is no human intervention during model
REMARK   1 building. Please read the header section and the logfile carefully
REMARK   1 to know what templates and alignments were used during the model
REMARK   1 building process. All information by the SWISS-MODEL SERVER is
REMARK   1 provided "AS-IS", without any warranty, expressed or implied.
REMARK   2
REMARK   2 COPYRIGHT NOTICE
REMARK   2 This SWISS-MODEL protein model is copyright. It is produced by the
REMARK   2 SWISS-MODEL server, developed by the Computational Structural
REMARK   2 Biology Group at the SIB Swiss Institute of Bioinformatics at the
REMARK   2 Biozentrum, University of Basel (https://swissmodel.expasy.org). This
REMARK   2 model is licensed under the CC BY-SA 4.0 Creative Commons
REMARK   2 Attribution-ShareAlike 4.0 International License
REMARK   2 (https://creativecommons.org/licenses/by-sa/4.0/legalcode), i.e. you
REMARK   2 can copy and redistribute the model in any medium or format,
REMARK   2 transform and build upon the model for any purpose, even
REMARK   2 commercially, under the following terms:
REMARK   2 Attribution - You must give appropriate credit, provide a link to
REMARK   2 the license, and indicate if changes were made. You may do so in any
REMARK   2 reasonable manner, but not in any way that suggests the licensor
REMARK   2 endorses you or your use. When you publish, patent or distribute
REMARK   2 results that were fully or partially based on the model, please cite
REMARK   2 the corresponding papers mentioned under JRNL.
REMARK   2 ShareAlike - If you remix, transform, or build upon the material,
REMARK   2 you must distribute your contributions under the same license as the
REMARK   2 original.
REMARK   2 No additional restrictions - you may not apply legal terms or
REMARK   2 technological measures that legally restrict others from doing
REMARK   2 anything the license permits.
REMARK   2 Find a human-readable summary of (and not a substitute for) the
REMARK   2 CC BY-SA 4.0 license at this link:
REMARK   2 https://creativecommons.org/licenses/by-sa/4.0/
REMARK   3 
REMARK   3 MODEL INFORMATION
REMARK   3  ENGIN   PROMOD3
REMARK   3  VERSN   3.2.1
REMARK   3  OSTAT   homo-dimer
REMARK   3  OSRSN   PREDICTION
REMARK   3  QSPRD   0.899
REMARK   3  GMQE    0.91
REMARK   3  QMNV    4.3.0
REMARK   3  QMNDG   0.88
REMARK   3  MODT    FALSE
REMARK   3 
REMARK   3 MODEL LIGAND 1
REMARK   3  NAME    GLC
REMARK   3  BIND    A.136
REMARK   3  BIND 2  A.137
REMARK   3  BIND 3  A.140
REMARK   3  BIND 4  A.285
REMARK   3  BIND 5  A.378
REMARK   3  BIND 6  A.456
REMARK   3  BIND 7  A.485
REMARK   3  BIND 8  A.574
REMARK   3  BIND 9  A.673
REMARK   3  BIND 10  A.674
REMARK   3  BIND 11  A.675
REMARK   3  BIND 12  A.676
REMARK   3  BIND 13  A.677
REMARK   3  BIND 14  _.1
REMARK   3 
REMARK   3 MODEL LIGAND 2
REMARK   3  NAME    GLC
REMARK   3  BIND    B.136
REMARK   3  BIND 2  B.137
REMARK   3  BIND 3  B.140
REMARK   3  BIND 4  B.285
REMARK   3  BIND 5  B.378
REMARK   3  BIND 6  B.456
REMARK   3  BIND 7  B.485
REMARK   3  BIND 8  B.574
REMARK   3  BIND 9  B.673
REMARK   3  BIND 10  B.674
REMARK   3  BIND 11  B.675
REMARK   3  BIND 12  B.676
REMARK   3  BIND 13  B.677
REMARK   3  BIND 14  _.4
REMARK   3 
REMARK   3 MODEL LIGAND 3
REMARK   3  NAME    AMP
REMARK   3  BIND    A.68
REMARK   3  BIND 2  A.72
REMARK   3  BIND 3  A.76
REMARK   3  BIND 4  A.310
REMARK   3  BIND 5  A.311
REMARK   3  BIND 6  A.316
REMARK   3  BIND 7  A.317
REMARK   3  BIND 8  A.318
REMARK   3  BIND 9  A.319
REMARK   3  BIND 10  B.41
REMARK   3  BIND 11  B.43
REMARK   3  BIND 12  B.45
REMARK   3  BIND 13  B.46
REMARK   3  BIND 14  _.2
REMARK   3 
REMARK   3 MODEL LIGAND 4
REMARK   3  NAME    AMP
REMARK   3  BIND    A.41
REMARK   3  BIND 2  A.43
REMARK   3  BIND 3  A.45
REMARK   3  BIND 4  A.46
REMARK   3  BIND 5  B.68
REMARK   3  BIND 6  B.72
REMARK   3  BIND 7  B.76
REMARK   3  BIND 8  B.310
REMARK   3  BIND 9  B.311
REMARK   3  BIND 10  B.316
REMARK   3  BIND 11  B.317
REMARK   3  BIND 12  B.318
REMARK   3  BIND 13  B.319
REMARK   3  BIND 14  _.5
REMARK   3 
REMARK   3 MODEL LIGAND 5
REMARK   3  NAME    ADE
REMARK   3  BIND    A.283
REMARK   3  BIND 2  A.286
REMARK   3  BIND 3  A.611
REMARK   3  BIND 4  A.613
REMARK   3  BIND 5  A.614
REMARK   3  BIND 6  _.3
REMARK   3 
REMARK   3 MODEL LIGAND 6
REMARK   3  NAME    ADE
REMARK   3  BIND    B.283
REMARK   3  BIND 2  B.286
REMARK   3  BIND 3  B.611
REMARK   3  BIND 4  B.613
REMARK   3  BIND 5  B.614
REMARK   3  BIND 6  _.6
REMARK   3 
REMARK   3 TEMPLATE 1
REMARK   3  PDBID   1z8d
REMARK   3  CHAIN   A
REMARK   3  MMCIF   A
REMARK   3  PDBV    2021-12-03
REMARK   3  SMTLE   1z8d.1.A
REMARK   3  SMTLV   2021-12-08
REMARK   3  MTHD    X-RAY DIFFRACTION 2.30 A
REMARK   3  FOUND   HHblits
REMARK   3  GMQE    0.97
REMARK   3  SIM     0.62
REMARK   3  SID     100.00
REMARK   3  OSTAT   homo-dimer
REMARK   3  LIGND   GLC
REMARK   3  LIGND 2 GLC
REMARK   3  LIGND 3 AMP
REMARK   3  LIGND 4 AMP
REMARK   3  LIGND 5 ADE
REMARK   3  LIGND 6 ADE
REMARK   3  ALN A TRG MSRPLSDQEKRKQISVRGLAGVENVTELKKNFNRHLHFTLVKDRNVATPRDYYFALAH
REMARK   3  ALN A TRG TVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEFYMGRTLQNTMVNLALENACDEATYQL
REMARK   3  ALN A TRG GLDMEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEFGIFNQKISGG
REMARK   3  ALN A TRG WQMEEADDWLRYGNPWEKARPEFTLPVHFYGHVEHTSQGAKWVDTQVVLAMPYDTPVP
REMARK   3  ALN A TRG GYRNNVVNTMRLWSAKAPNDFNLKDFNVGGYIQAVLDRNLAENISRVLYPNDNFFEGK
REMARK   3  ALN A TRG ELRLKQEYFVVAATLQDIIRRFKSSKFGCRDPVRTNFDAFPDKVAIQLNDTHPSLAIP
REMARK   3  ALN A TRG ELMRILVDLERMDWDKAWDVTVRTCAYTNHTVLPEALERWPVHLLETLLPRHLQIIYE
REMARK   3  ALN A TRG INQRFLNRVAAAFPGDVDRLRRMSLVEEGAVKRINMAHLCIAGSHAVNGVARIHSEIL
REMARK   3  ALN A TRG KKTIFKDFYELEPHKFQNKTNGITPRRWLVLCNPGLAEVIAERIGEDFISDLDQLRKL
REMARK   3  ALN A TRG LSFVDDEAFIRDVAKVKQENKLKFAAYLEREYKVHINPNSLFDIQVKRIHEYKRQLLN
REMARK   3  ALN A TRG CLHVITLYNRIKREPNKFFVPRTVMIGGKAAPGYHMAKMIIRLVTAIGDVVNHDPAVG
REMARK   3  ALN A TRG DRLRVIFLENYRVSLAEKVIPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGA
REMARK   3  ALN A TRG NVEMAEEAGEENFFIFGMRVEDVDKLDQRGYNAQEYYDRIPELRQVIEQLSSGFFSPK
REMARK   3  ALN A TRG QPDLFKDIVNMLMHHDRFKVFADYEDYIKCQEKVSALYKNPREWTRMVIRNIATSGKF
REMARK   3  ALN A TRG SSDRTIAQYAREIWGVEPSRQRLPAPDEAI
REMARK   3  ALN A TPL MSRPLSDQEKRKQISVRGLAGVENVTELKKNFNRHLHFTLVKDRNVATPRDYYFALAH
REMARK   3  ALN A TPL TVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEFYMGRTLQNTMVNLALENACDEATYQL
REMARK   3  ALN A TPL GLDMEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEFGIFNQKISGG
REMARK   3  ALN A TPL WQMEEADDWLRYGNPWEKARPEFTLPVHFYGHVEHTSQGAKWVDTQVVLAMPYDTPVP
REMARK   3  ALN A TPL GYRNNVVNTMRLWSAKAPNDFNLKDFNVGGYIQAVLDRNLAENISRVLYPNDNFFEGK
REMARK   3  ALN A TPL ELRLKQEYFVVAATLQDIIRRFKSSKFGCRDPVRTNFDAFPDKVAIQLNDTHPSLAIP
REMARK   3  ALN A TPL ELMRILVDLERMDWDKAWDVTVRTCAYTNHTVLPEALERWPVHLLETLLPRHLQIIYE
REMARK   3  ALN A TPL INQRFLNRVAAAFPGDVDRLRRMSLVEEGAVKRINMAHLCIAGSHAVNGVARIHSEIL
REMARK   3  ALN A TPL KKTIFKDFYELEPHKFQNKTNGITPRRWLVLCNPGLAEVIAERIGEDFISDLDQLRKL
REMARK   3  ALN A TPL LSFVDDEAFIRDVAKVKQENKLKFAAYLEREYKVHINPNSLFDIQVKRIHEYKRQLLN
REMARK   3  ALN A TPL CLHVITLYNRIKREPNKFFVPRTVMIGGKAAPGYHMAKMIIRLVTAIGDVVNHDPAVG
REMARK   3  ALN A TPL DRLRVIFLENYRVSLAEKVIPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGA
REMARK   3  ALN A TPL NVEMAEEAGEENFFIFGMRVEDVDKLDQRGYNAQEYYDRIPELRQVIEQLSSGFFSPK
REMARK   3  ALN A TPL QPDLFKDIVNMLMHHDRFKVFADYEDYIKCQEKVSALYKNPREWTRMVIRNIATSGKF
REMARK   3  ALN A TPL SSDRTIAQYAREIWGVEPSRQRLPAPDEAI
REMARK   3  ALN A OFF 0
ATOM      1  N   ARG A   3      31.023 -23.620  61.243  1.00  0.67           N  
ATOM      2  CA  ARG A   3      30.475 -24.459  60.124  1.00  0.67           C  
ATOM      3  C   ARG A   3      31.288 -24.175  58.888  1.00  0.67           C  
ATOM      4  O   ARG A   3      31.630 -23.006  58.719  1.00  0.67           O  
ATOM      5  CB  ARG A   3      28.990 -24.047  59.898  1.00  0.67           C  
ATOM      6  CG  ARG A   3      28.299 -24.690  58.672  1.00  0.67           C  
ATOM      7  CD  ARG A   3      26.889 -24.148  58.361  1.00  0.67           C  
ATOM      8  NE  ARG A   3      26.944 -22.648  58.205  1.00  0.67           N  
ATOM      9  CZ  ARG A   3      27.329 -22.000  57.093  1.00  0.67           C  
ATOM     10  NH1 ARG A   3      27.795 -22.649  56.034  1.00  0.67           N  
ATOM     11  NH2 ARG A   3      27.241 -20.671  57.042  1.00  0.67           N  
ATOM     12  N   PRO A   4      31.638 -25.096  58.004  1.00  0.79           N  
ATOM     13  CA  PRO A   4      32.185 -24.739  56.713  1.00  0.79           C  
ATOM     14  C   PRO A   4      31.338 -23.819  55.876  1.00  0.79           C  
ATOM     15  O   PRO A   4      30.165 -24.157  55.591  1.00  0.79           O  
ATOM     16  CB  PRO A   4      32.447 -26.072  56.009  1.00  0.79           C  
ATOM     17  CG  PRO A   4      32.676 -27.028  57.180  1.00  0.79           C  
ATOM     18  CD  PRO A   4      31.672 -26.543  58.224  1.00  0.79           C  
ATOM     19  N   LEU A   5      31.855 -22.674  55.457  1.00  0.61           N  
ATOM     20  CA  LEU A   5      31.190 -21.807  54.509  1.00  0.61           C  
ATOM     21  C   LEU A   5      31.389 -22.330  53.095  1.00  0.61           C  
ATOM     22  O   LEU A   5      32.448 -22.823  52.727  1.00  0.61           O  
ATOM     23  CB  LEU A   5      31.704 -20.350  54.605  1.00  0.61           C  
ATOM     24  CG  LEU A   5      31.079 -19.459  55.706  1.00  0.61           C  
ATOM     25  CD1 LEU A   5      31.075 -20.101  57.102  1.00  0.61           C  
ATOM     26  CD2 LEU A   5      31.834 -18.120  55.787  1.00  0.61           C  
ATOM     27  N   SER A   6      30.342 -22.214  52.260  1.00  0.67           N  
ATOM     28  CA  SER A   6      30.410 -22.502  50.842  1.00  0.67           C  
ATOM     29  C   SER A   6      30.962 -21.299  50.121  1.00  0.67           C  
ATOM     30  O   SER A   6      31.070 -20.210  50.687  1.00  0.67           O  
ATOM     31  CB  SER A   6      29.026 -22.872  50.238  1.00  0.67           C  
ATOM     32  OG  SER A   6      28.033 -21.873  50.515  1.00  0.67           O  
ATOM     33  N   ASP A   7      31.333 -21.456  48.839  1.00  0.72           N  
ATOM     34  CA  ASP A   7      31.941 -20.410  48.050  1.00  0.72           C  
ATOM     35  C   ASP A   7      31.075 -19.172  47.880  1.00  0.72           C  
ATOM     36  O   ASP A   7      31.575 -18.058  47.883  1.00  0.72           O  
ATOM     37  CB  ASP A   7      32.395 -20.968  46.693  1.00  0.72           C  
ATOM     38  CG  ASP A   7      33.339 -22.127  46.971  1.00  0.72           C  
ATOM     39  OD1 ASP A   7      34.359 -21.912  47.679  1.00  0.72           O  
ATOM     40  OD2 ASP A   7      32.987 -23.256  46.556  1.00  0.72           O  
ATOM     41  N   GLN A   8      29.730 -19.325  47.806  1.00  0.69           N  
ATOM     42  CA  GLN A   8      28.827 -18.190  47.814  1.00  0.69           C  
ATOM     43  C   GLN A   8      28.975 -17.308  49.043  1.00  0.69           C  
ATOM     44  O   GLN A   8      28.897 -16.089  48.943  1.00  0.69           O  
ATOM     45  CB  GLN A   8      27.329 -18.578  47.667  1.00  0.69           C  
ATOM     46  CG  GLN A   8      26.674 -19.315  48.866  1.00  0.69           C  
ATOM     47  CD  GLN A   8      25.150 -19.180  48.800  1.00  0.69           C  
ATOM     48  OE1 GLN A   8      24.630 -18.093  48.609  1.00  0.69           O  
ATOM     49  NE2 GLN A   8      24.410 -20.298  49.001  1.00  0.69           N  
ATOM     50  N   GLU A   9      29.205 -17.911  50.230  1.00  0.70           N  
ATOM     51  CA  GLU A   9      29.263 -17.179  51.474  1.00  0.70           C  
ATOM     52  C   GLU A   9      30.631 -16.613  51.742  1.00  0.70           C  
ATOM     53  O   GLU A   9      30.796 -15.509  52.257  1.00  0.70           O  
ATOM     54  CB  GLU A   9      28.745 -18.062  52.636  1.00  0.70           C  
ATOM     55  CG  GLU A   9      28.332 -17.319  53.950  1.00  0.70           C  
ATOM     56  CD  GLU A   9      27.113 -16.445  53.814  1.00  0.70           C  
ATOM     57  OE1 GLU A   9      26.419 -16.083  54.815  1.00  0.70           O  
ATOM     58  OE2 GLU A   9      26.801 -16.138  52.631  1.00  0.70           O  
ATOM     59  N   LYS A  10      31.684 -17.319  51.310  1.00  0.69           N  
ATOM     60  CA  LYS A  10      33.024 -16.781  51.320  1.00  0.69           C  
ATOM     61  C   LYS A  10      33.188 -15.559  50.421  1.00  0.69           C  
ATOM     62  O   LYS A  10      33.802 -14.568  50.816  1.00  0.69           O  
ATOM     63  CB  LYS A  10      34.012 -17.864  50.891  1.00  0.69           C  
ATOM     64  CG  LYS A  10      34.108 -19.059  51.846  1.00  0.69           C  
ATOM     65  CD  LYS A  10      35.069 -20.077  51.229  1.00  0.69           C  
ATOM     66  CE  LYS A  10      35.415 -21.296  52.075  1.00  0.69           C  
ATOM     67  NZ  LYS A  10      36.285 -22.161  51.255  1.00  0.69           N  
ATOM     68  N   ARG A  11      32.573 -15.569  49.215  1.00  0.65           N  
ATOM     69  CA  ARG A  11      32.624 -14.459  48.287  1.00  0.65           C  
ATOM     70  C   ARG A  11      31.891 -13.214  48.779  1.00  0.65           C  
ATOM     71  O   ARG A  11      32.044 -12.144  48.212  1.00  0.65           O  
ATOM     72  CB  ARG A  11      32.084 -14.839  46.881  1.00  0.65           C  
ATOM     73  CG  ARG A  11      32.991 -15.835  46.124  1.00  0.65           C  
ATOM     74  CD  ARG A  11      32.528 -16.153  44.697  1.00  0.65           C  
ATOM     75  NE  ARG A  11      33.257 -17.383  44.236  1.00  0.65           N  
ATOM     76  CZ  ARG A  11      33.201 -17.926  43.011  1.00  0.65           C  
ATOM     77  NH1 ARG A  11      32.609 -17.317  41.990  1.00  0.65           N  
ATOM     78  NH2 ARG A  11      33.785 -19.106  42.812  1.00  0.65           N  
ATOM     79  N   LYS A  12      31.104 -13.281  49.882  1.00  0.72           N  
ATOM     80  CA  LYS A  12      30.482 -12.111  50.495  1.00  0.72           C  
ATOM     81  C   LYS A  12      31.520 -11.127  51.021  1.00  0.72           C  
ATOM     82  O   LYS A  12      31.285  -9.918  51.052  1.00  0.72           O  
ATOM     83  CB  LYS A  12      29.513 -12.490  51.642  1.00  0.72           C  
ATOM     84  CG  LYS A  12      28.417 -13.507  51.266  1.00  0.72           C  
ATOM     85  CD  LYS A  12      27.334 -13.009  50.293  1.00  0.72           C  
ATOM     86  CE  LYS A  12      26.322 -14.085  49.842  1.00  0.72           C  
ATOM     87  NZ  LYS A  12      25.616 -14.700  50.979  1.00  0.72           N  
ATOM     88  N   GLN A  13      32.730 -11.642  51.355  1.00  0.64           N  
ATOM     89  CA  GLN A  13      33.897 -10.866  51.735  1.00  0.64           C  
ATOM     90  C   GLN A  13      34.465 -10.055  50.579  1.00  0.64           C  
ATOM     91  O   GLN A  13      35.248  -9.133  50.773  1.00  0.64           O  
ATOM     92  CB  GLN A  13      35.049 -11.771  52.249  1.00  0.64           C  
ATOM     93  CG  GLN A  13      34.738 -12.551  53.547  1.00  0.64           C  
ATOM     94  CD  GLN A  13      35.817 -13.609  53.815  1.00  0.64           C  
ATOM     95  OE1 GLN A  13      36.862 -13.402  54.425  1.00  0.64           O  
ATOM     96  NE2 GLN A  13      35.553 -14.826  53.280  1.00  0.64           N  
ATOM     97  N   ILE A  14      34.063 -10.342  49.323  1.00  0.61           N  
ATOM     98  CA  ILE A  14      34.347  -9.494  48.179  1.00  0.61           C  
ATOM     99  C   ILE A  14      33.413  -8.277  48.249  1.00  0.61           C  
ATOM    100  O   ILE A  14      32.380  -8.206  47.578  1.00  0.61           O  
ATOM    101  CB  ILE A  14      34.275 -10.262  46.855  1.00  0.61           C  
ATOM    102  CG1 ILE A  14      35.183 -11.518  46.941  1.00  0.61           C  
ATOM    103  CG2 ILE A  14      34.699  -9.358  45.672  1.00  0.61           C  
ATOM    104  CD1 ILE A  14      35.057 -12.480  45.755  1.00  0.61           C  
ATOM    105  N   SER A  15      33.765  -7.335  49.164  1.00  0.71           N  
ATOM    106  CA  SER A  15      33.069  -6.121  49.616  1.00  0.71           C  
ATOM    107  C   SER A  15      33.675  -4.868  49.012  1.00  0.71           C  
ATOM    108  O   SER A  15      34.858  -4.838  48.721  1.00  0.71           O  
ATOM    109  CB  SER A  15      31.501  -6.191  49.559  1.00  0.71           C  
ATOM    110  OG  SER A  15      30.762  -5.256  50.334  1.00  0.71           O  
ATOM    111  N   VAL A  16      32.898  -3.780  48.846  1.00  0.77           N  
ATOM    112  CA  VAL A  16      33.422  -2.484  48.405  1.00  0.77           C  
ATOM    113  C   VAL A  16      33.883  -1.711  49.632  1.00  0.77           C  
ATOM    114  O   VAL A  16      33.085  -1.043  50.312  1.00  0.77           O  
ATOM    115  CB  VAL A  16      32.389  -1.645  47.638  1.00  0.77           C  
ATOM    116  CG1 VAL A  16      32.905  -0.233  47.255  1.00  0.77           C  
ATOM    117  CG2 VAL A  16      31.959  -2.374  46.355  1.00  0.77           C  
ATOM    118  N   ARG A  17      35.182  -1.790  49.976  1.00  0.57           N  
ATOM    119  CA  ARG A  17      35.734  -1.155  51.161  1.00  0.57           C  
ATOM    120  C   ARG A  17      37.151  -0.656  50.990  1.00  0.57           C  
ATOM    121  O   ARG A  17      37.784  -0.812  49.951  1.00  0.57           O  
ATOM    122  CB  ARG A  17      35.637  -2.059  52.422  1.00  0.57           C  
ATOM    123  CG  ARG A  17      34.266  -2.033  53.141  1.00  0.57           C  
ATOM    124  CD  ARG A  17      33.870  -0.700  53.823  1.00  0.57           C  
ATOM    125  NE  ARG A  17      33.346   0.240  52.773  1.00  0.57           N  
ATOM    126  CZ  ARG A  17      33.104   1.554  52.933  1.00  0.57           C  
ATOM    127  NH1 ARG A  17      33.182   2.157  54.108  1.00  0.57           N  
ATOM    128  NH2 ARG A  17      32.763   2.290  51.873  1.00  0.57           N  
ATOM    129  N   GLY A  18      37.661   0.067  52.015  1.00  0.61           N  
ATOM    130  CA  GLY A  18      38.940   0.744  51.934  1.00  0.61           C  
ATOM    131  C   GLY A  18      38.763   2.088  51.315  1.00  0.61           C  
ATOM    132  O   GLY A  18      38.487   3.071  51.976  1.00  0.61           O  
ATOM    133  N   LEU A  19      38.910   2.124  49.976  1.00  0.48           N  
ATOM    134  CA  LEU A  19      39.149   3.310  49.205  1.00  0.48           C  
ATOM    135  C   LEU A  19      38.022   4.301  49.244  1.00  0.48           C  
ATOM    136  O   LEU A  19      38.235   5.498  49.203  1.00  0.48           O  
ATOM    137  CB  LEU A  19      39.505   2.953  47.749  1.00  0.48           C  
ATOM    138  CG  LEU A  19      40.904   2.334  47.502  1.00  0.48           C  
ATOM    139  CD1 LEU A  19      42.037   3.359  47.675  1.00  0.48           C  
ATOM    140  CD2 LEU A  19      41.181   1.072  48.306  1.00  0.48           C  
ATOM    141  N   ALA A  20      36.787   3.804  49.390  1.00  0.54           N  
ATOM    142  CA  ALA A  20      35.613   4.632  49.345  1.00  0.54           C  
ATOM    143  C   ALA A  20      35.211   5.188  50.704  1.00  0.54           C  
ATOM    144  O   ALA A  20      34.192   5.856  50.816  1.00  0.54           O  
ATOM    145  CB  ALA A  20      34.465   3.754  48.816  1.00  0.54           C  
ATOM    146  N   GLY A  21      36.012   4.929  51.761  1.00  0.57           N  
ATOM    147  CA  GLY A  21      35.700   5.339  53.122  1.00  0.57           C  
ATOM    148  C   GLY A  21      36.858   6.063  53.756  1.00  0.57           C  
ATOM    149  O   GLY A  21      37.077   5.977  54.946  1.00  0.57           O  
ATOM    150  N   VAL A  22      37.616   6.812  52.924  1.00  0.65           N  
ATOM    151  CA  VAL A  22      38.726   7.635  53.426  1.00  0.65           C  
ATOM    152  C   VAL A  22      38.894   8.859  52.514  1.00  0.65           C  
ATOM    153  O   VAL A  22      38.771   8.847  51.400  1.00  0.65           O  
ATOM    154  CB  VAL A  22      40.087   6.935  53.379  1.00  0.65           C  
ATOM    155  CG1 VAL A  22      40.238   5.974  54.567  1.00  0.65           C  
ATOM    156  CG2 VAL A  22      40.282   6.188  52.045  1.00  0.65           C  
ATOM    157  N   GLU A  23      39.196  10.041  53.179  1.00  0.67           N  
ATOM    158  CA  GLU A  23      39.377  11.252  52.374  1.00  0.67           C  
ATOM    159  C   GLU A  23      40.422  12.099  53.090  1.00  0.67           C  
ATOM    160  O   GLU A  23      40.577  13.296  52.898  1.00  0.67           O  
ATOM    161  CB  GLU A  23      38.042  12.016  52.167  1.00  0.67           C  
ATOM    162  CG  GLU A  23      37.212  12.362  53.428  1.00  0.67           C  
ATOM    163  CD  GLU A  23      35.858  12.980  53.057  1.00  0.67           C  
ATOM    164  OE1 GLU A  23      35.499  12.973  51.850  1.00  0.67           O  
ATOM    165  OE2 GLU A  23      35.162  13.442  53.998  1.00  0.67           O  
ATOM    166  N   ASN A  24      41.214  11.421  53.943  1.00  0.75           N  
ATOM    167  CA  ASN A  24      42.199  12.017  54.813  1.00  0.75           C  
ATOM    168  C   ASN A  24      43.484  12.402  54.089  1.00  0.75           C  
ATOM    169  O   ASN A  24      43.975  11.655  53.254  1.00  0.75           O  
ATOM    170  CB  ASN A  24      42.524  10.988  55.931  1.00  0.75           C  
ATOM    171  CG  ASN A  24      42.694  11.670  57.277  1.00  0.75           C  
ATOM    172  OD1 ASN A  24      41.732  12.077  57.903  1.00  0.75           O  
ATOM    173  ND2 ASN A  24      43.950  11.821  57.749  1.00  0.75           N  
ATOM    174  N   VAL A  25      44.123  13.541  54.456  1.00  0.77           N  
ATOM    175  CA  VAL A  25      45.391  14.005  53.882  1.00  0.77           C  
ATOM    176  C   VAL A  25      46.488  12.964  54.041  1.00  0.77           C  
ATOM    177  O   VAL A  25      47.253  12.663  53.129  1.00  0.77           O  
ATOM    178  CB  VAL A  25      45.850  15.312  54.539  1.00  0.77           C  
ATOM    179  CG1 VAL A  25      47.264  15.716  54.066  1.00  0.77           C  
ATOM    180  CG2 VAL A  25      44.872  16.455  54.196  1.00  0.77           C  
ATOM    181  N   THR A  26      46.536  12.328  55.225  1.00  0.76           N  
ATOM    182  CA  THR A  26      47.445  11.235  55.527  1.00  0.76           C  
ATOM    183  C   THR A  26      47.227   9.995  54.668  1.00  0.76           C  
ATOM    184  O   THR A  26      48.185   9.320  54.296  1.00  0.76           O  
ATOM    185  CB  THR A  26      47.442  10.838  57.003  1.00  0.76           C  
ATOM    186  OG1 THR A  26      46.224  10.217  57.387  1.00  0.76           O  
ATOM    187  CG2 THR A  26      47.585  12.090  57.877  1.00  0.76           C  
ATOM    188  N   GLU A  27      45.967   9.647  54.349  1.00  0.75           N  
ATOM    189  CA  GLU A  27      45.622   8.535  53.477  1.00  0.75           C  
ATOM    190  C   GLU A  27      45.793   8.837  52.001  1.00  0.75           C  
ATOM    191  O   GLU A  27      46.205   7.986  51.217  1.00  0.75           O  
ATOM    192  CB  GLU A  27      44.179   8.052  53.726  1.00  0.75           C  
ATOM    193  CG  GLU A  27      43.973   7.443  55.136  1.00  0.75           C  
ATOM    194  CD  GLU A  27      45.036   6.411  55.490  1.00  0.75           C  
ATOM    195  OE1 GLU A  27      45.708   6.610  56.539  1.00  0.75           O  
ATOM    196  OE2 GLU A  27      45.280   5.480  54.687  1.00  0.75           O  
ATOM    197  N   LEU A  28      45.506  10.077  51.564  1.00  0.82           N  
ATOM    198  CA  LEU A  28      45.748  10.530  50.206  1.00  0.82           C  
ATOM    199  C   LEU A  28      47.225  10.481  49.873  1.00  0.82           C  
ATOM    200  O   LEU A  28      47.608  10.024  48.800  1.00  0.82           O  
ATOM    201  CB  LEU A  28      45.207  11.959  49.985  1.00  0.82           C  
ATOM    202  CG  LEU A  28      43.669  12.072  49.984  1.00  0.82           C  
ATOM    203  CD1 LEU A  28      43.261  13.548  50.035  1.00  0.82           C  
ATOM    204  CD2 LEU A  28      43.037  11.420  48.745  1.00  0.82           C  
ATOM    205  N   LYS A  29      48.093  10.867  50.837  1.00  0.82           N  
ATOM    206  CA  LYS A  29      49.526  10.659  50.754  1.00  0.82           C  
ATOM    207  C   LYS A  29      49.926   9.206  50.538  1.00  0.82           C  
ATOM    208  O   LYS A  29      50.678   8.906  49.618  1.00  0.82           O  
ATOM    209  CB  LYS A  29      50.210  11.115  52.065  1.00  0.82           C  
ATOM    210  CG  LYS A  29      50.474  12.620  52.169  1.00  0.82           C  
ATOM    211  CD  LYS A  29      51.068  12.979  53.544  1.00  0.82           C  
ATOM    212  CE  LYS A  29      52.325  13.844  53.441  1.00  0.82           C  
ATOM    213  NZ  LYS A  29      52.824  14.193  54.786  1.00  0.82           N  
ATOM    214  N   LYS A  30      49.400   8.256  51.350  1.00  0.79           N  
ATOM    215  CA  LYS A  30      49.734   6.847  51.204  1.00  0.79           C  
ATOM    216  C   LYS A  30      49.304   6.274  49.867  1.00  0.79           C  
ATOM    217  O   LYS A  30      50.047   5.557  49.208  1.00  0.79           O  
ATOM    218  CB  LYS A  30      49.083   5.959  52.289  1.00  0.79           C  
ATOM    219  CG  LYS A  30      49.557   6.209  53.724  1.00  0.79           C  
ATOM    220  CD  LYS A  30      48.776   5.298  54.685  1.00  0.79           C  
ATOM    221  CE  LYS A  30      48.915   5.643  56.166  1.00  0.79           C  
ATOM    222  NZ  LYS A  30      48.247   6.916  56.442  1.00  0.79           N  
ATOM    223  N   ASN A  31      48.078   6.600  49.416  1.00  0.81           N  
ATOM    224  CA  ASN A  31      47.575   6.177  48.127  1.00  0.81           C  
ATOM    225  C   ASN A  31      48.326   6.800  46.951  1.00  0.81           C  
ATOM    226  O   ASN A  31      48.627   6.109  45.985  1.00  0.81           O  
ATOM    227  CB  ASN A  31      46.047   6.381  48.045  1.00  0.81           C  
ATOM    228  CG  ASN A  31      45.364   5.364  48.961  1.00  0.81           C  
ATOM    229  OD1 ASN A  31      45.422   4.152  48.715  1.00  0.81           O  
ATOM    230  ND2 ASN A  31      44.714   5.830  50.047  1.00  0.81           N  
ATOM    231  N   PHE A  32      48.718   8.094  47.032  1.00  0.87           N  
ATOM    232  CA  PHE A  32      49.571   8.742  46.046  1.00  0.87           C  
ATOM    233  C   PHE A  32      50.913   8.042  45.933  1.00  0.87           C  
ATOM    234  O   PHE A  32      51.397   7.744  44.840  1.00  0.87           O  
ATOM    235  CB  PHE A  32      49.747  10.236  46.460  1.00  0.87           C  
ATOM    236  CG  PHE A  32      50.574  11.033  45.491  1.00  0.87           C  
ATOM    237  CD1 PHE A  32      51.976  10.942  45.512  1.00  0.87           C  
ATOM    238  CD2 PHE A  32      49.961  11.883  44.560  1.00  0.87           C  
ATOM    239  CE1 PHE A  32      52.751  11.650  44.590  1.00  0.87           C  
ATOM    240  CE2 PHE A  32      50.736  12.601  43.642  1.00  0.87           C  
ATOM    241  CZ  PHE A  32      52.126  12.469  43.646  1.00  0.87           C  
ATOM    242  N   ASN A  33      51.517   7.726  47.090  1.00  0.85           N  
ATOM    243  CA  ASN A  33      52.766   7.019  47.199  1.00  0.85           C  
ATOM    244  C   ASN A  33      52.671   5.611  46.612  1.00  0.85           C  
ATOM    245  O   ASN A  33      53.457   5.211  45.772  1.00  0.85           O  
ATOM    246  CB  ASN A  33      53.137   7.008  48.706  1.00  0.85           C  
ATOM    247  CG  ASN A  33      54.566   6.578  48.995  1.00  0.85           C  
ATOM    248  OD1 ASN A  33      54.815   5.779  49.886  1.00  0.85           O  
ATOM    249  ND2 ASN A  33      55.540   7.143  48.247  1.00  0.85           N  
ATOM    250  N   ARG A  34      51.608   4.869  46.980  1.00  0.80           N  
ATOM    251  CA  ARG A  34      51.324   3.550  46.456  1.00  0.80           C  
ATOM    252  C   ARG A  34      51.085   3.531  44.957  1.00  0.80           C  
ATOM    253  O   ARG A  34      51.599   2.671  44.244  1.00  0.80           O  
ATOM    254  CB  ARG A  34      50.084   2.978  47.187  1.00  0.80           C  
ATOM    255  CG  ARG A  34      49.647   1.557  46.772  1.00  0.80           C  
ATOM    256  CD  ARG A  34      48.407   1.031  47.526  1.00  0.80           C  
ATOM    257  NE  ARG A  34      47.228   1.960  47.369  1.00  0.80           N  
ATOM    258  CZ  ARG A  34      46.516   2.157  46.244  1.00  0.80           C  
ATOM    259  NH1 ARG A  34      46.856   1.633  45.083  1.00  0.80           N  
ATOM    260  NH2 ARG A  34      45.435   2.929  46.313  1.00  0.80           N  
ATOM    261  N   HIS A  35      50.314   4.487  44.413  1.00  0.84           N  
ATOM    262  CA  HIS A  35      50.127   4.600  42.981  1.00  0.84           C  
ATOM    263  C   HIS A  35      51.403   4.968  42.225  1.00  0.84           C  
ATOM    264  O   HIS A  35      51.681   4.406  41.167  1.00  0.84           O  
ATOM    265  CB  HIS A  35      48.957   5.543  42.616  1.00  0.84           C  
ATOM    266  CG  HIS A  35      47.602   4.944  42.899  1.00  0.84           C  
ATOM    267  ND1 HIS A  35      47.194   3.812  42.201  1.00  0.84           N  
ATOM    268  CD2 HIS A  35      46.594   5.389  43.684  1.00  0.84           C  
ATOM    269  CE1 HIS A  35      45.945   3.613  42.570  1.00  0.84           C  
ATOM    270  NE2 HIS A  35      45.532   4.533  43.473  1.00  0.84           N  
ATOM    271  N   LEU A  36      52.240   5.889  42.750  1.00  0.88           N  
ATOM    272  CA  LEU A  36      53.488   6.282  42.115  1.00  0.88           C  
ATOM    273  C   LEU A  36      54.455   5.115  41.970  1.00  0.88           C  
ATOM    274  O   LEU A  36      55.003   4.865  40.895  1.00  0.88           O  
ATOM    275  CB  LEU A  36      54.121   7.448  42.927  1.00  0.88           C  
ATOM    276  CG  LEU A  36      55.344   8.181  42.315  1.00  0.88           C  
ATOM    277  CD1 LEU A  36      56.658   7.409  42.498  1.00  0.88           C  
ATOM    278  CD2 LEU A  36      55.150   8.560  40.838  1.00  0.88           C  
ATOM    279  N   HIS A  37      54.658   4.323  43.036  1.00  0.83           N  
ATOM    280  CA  HIS A  37      55.531   3.175  42.941  1.00  0.83           C  
ATOM    281  C   HIS A  37      54.904   1.958  42.284  1.00  0.83           C  
ATOM    282  O   HIS A  37      55.471   1.395  41.353  1.00  0.83           O  
ATOM    283  CB  HIS A  37      56.112   2.791  44.315  1.00  0.83           C  
ATOM    284  CG  HIS A  37      56.953   3.890  44.891  1.00  0.83           C  
ATOM    285  ND1 HIS A  37      56.385   4.813  45.742  1.00  0.83           N  
ATOM    286  CD2 HIS A  37      58.251   4.202  44.677  1.00  0.83           C  
ATOM    287  CE1 HIS A  37      57.339   5.657  46.029  1.00  0.83           C  
ATOM    288  NE2 HIS A  37      58.502   5.342  45.413  1.00  0.83           N  
ATOM    289  N   PHE A  38      53.713   1.505  42.716  1.00  0.86           N  
ATOM    290  CA  PHE A  38      53.225   0.191  42.304  1.00  0.86           C  
ATOM    291  C   PHE A  38      52.454   0.221  40.988  1.00  0.86           C  
ATOM    292  O   PHE A  38      52.698  -0.580  40.084  1.00  0.86           O  
ATOM    293  CB  PHE A  38      52.447  -0.531  43.446  1.00  0.86           C  
ATOM    294  CG  PHE A  38      53.342  -0.603  44.660  1.00  0.86           C  
ATOM    295  CD1 PHE A  38      54.428  -1.489  44.682  1.00  0.86           C  
ATOM    296  CD2 PHE A  38      53.208   0.306  45.722  1.00  0.86           C  
ATOM    297  CE1 PHE A  38      55.417  -1.374  45.666  1.00  0.86           C  
ATOM    298  CE2 PHE A  38      54.190   0.430  46.708  1.00  0.86           C  
ATOM    299  CZ  PHE A  38      55.316  -0.393  46.658  1.00  0.86           C  
ATOM    300  N   THR A  39      51.521   1.180  40.824  1.00  0.84           N  
ATOM    301  CA  THR A  39      50.733   1.371  39.608  1.00  0.84           C  
ATOM    302  C   THR A  39      51.545   1.894  38.438  1.00  0.84           C  
ATOM    303  O   THR A  39      51.468   1.381  37.320  1.00  0.84           O  
ATOM    304  CB  THR A  39      49.563   2.318  39.831  1.00  0.84           C  
ATOM    305  OG1 THR A  39      48.748   1.811  40.876  1.00  0.84           O  
ATOM    306  CG2 THR A  39      48.668   2.441  38.593  1.00  0.84           C  
ATOM    307  N   LEU A  40      52.374   2.933  38.675  1.00  0.84           N  
ATOM    308  CA  LEU A  40      53.170   3.567  37.642  1.00  0.84           C  
ATOM    309  C   LEU A  40      54.516   2.900  37.405  1.00  0.84           C  
ATOM    310  O   LEU A  40      55.115   3.096  36.344  1.00  0.84           O  
ATOM    311  CB  LEU A  40      53.428   5.048  37.988  1.00  0.84           C  
ATOM    312  CG  LEU A  40      52.345   6.046  37.544  1.00  0.84           C  
ATOM    313  CD1 LEU A  40      50.919   5.685  37.982  1.00  0.84           C  
ATOM    314  CD2 LEU A  40      52.718   7.418  38.102  1.00  0.84           C  
ATOM    315  N   VAL A  41      55.021   2.076  38.350  1.00  0.83           N  
ATOM    316  CA  VAL A  41      56.318   1.412  38.255  1.00  0.83           C  
ATOM    317  C   VAL A  41      57.453   2.432  38.163  1.00  0.83           C  
ATOM    318  O   VAL A  41      58.234   2.462  37.214  1.00  0.83           O  
ATOM    319  CB  VAL A  41      56.381   0.329  37.176  1.00  0.83           C  
ATOM    320  CG1 VAL A  41      57.599  -0.589  37.383  1.00  0.83           C  
ATOM    321  CG2 VAL A  41      55.111  -0.540  37.237  1.00  0.83           C  
ATOM    322  N   LYS A  42      57.493   3.343  39.155  1.00  0.81           N  
ATOM    323  CA  LYS A  42      58.359   4.506  39.225  1.00  0.81           C  
ATOM    324  C   LYS A  42      58.832   4.711  40.656  1.00  0.81           C  
ATOM    325  O   LYS A  42      58.460   3.991  41.573  1.00  0.81           O  
ATOM    326  CB  LYS A  42      57.611   5.811  38.830  1.00  0.81           C  
ATOM    327  CG  LYS A  42      57.150   5.913  37.372  1.00  0.81           C  
ATOM    328  CD  LYS A  42      58.302   6.067  36.376  1.00  0.81           C  
ATOM    329  CE  LYS A  42      57.782   6.366  34.972  1.00  0.81           C  
ATOM    330  NZ  LYS A  42      58.891   6.665  34.066  1.00  0.81           N  
ATOM    331  N   ASP A  43      59.686   5.724  40.870  1.00  0.81           N  
ATOM    332  CA  ASP A  43      60.133   6.151  42.170  1.00  0.81           C  
ATOM    333  C   ASP A  43      60.465   7.627  42.059  1.00  0.81           C  
ATOM    334  O   ASP A  43      60.344   8.215  40.986  1.00  0.81           O  
ATOM    335  CB  ASP A  43      61.335   5.306  42.678  1.00  0.81           C  
ATOM    336  CG  ASP A  43      62.553   5.334  41.761  1.00  0.81           C  
ATOM    337  OD1 ASP A  43      62.741   6.331  41.017  1.00  0.81           O  
ATOM    338  OD2 ASP A  43      63.343   4.364  41.856  1.00  0.81           O  
ATOM    339  N   ARG A  44      60.910   8.283  43.151  1.00  0.75           N  
ATOM    340  CA  ARG A  44      61.270   9.686  43.084  1.00  0.75           C  
ATOM    341  C   ARG A  44      62.565   9.972  42.344  1.00  0.75           C  
ATOM    342  O   ARG A  44      62.873  11.127  42.060  1.00  0.75           O  
ATOM    343  CB  ARG A  44      61.357  10.333  44.485  1.00  0.75           C  
ATOM    344  CG  ARG A  44      62.563   9.911  45.348  1.00  0.75           C  
ATOM    345  CD  ARG A  44      62.592  10.661  46.678  1.00  0.75           C  
ATOM    346  NE  ARG A  44      63.834  10.249  47.411  1.00  0.75           N  
ATOM    347  CZ  ARG A  44      63.884   9.179  48.212  1.00  0.75           C  
ATOM    348  NH1 ARG A  44      62.838   8.382  48.370  1.00  0.75           N  
ATOM    349  NH2 ARG A  44      65.008   8.898  48.872  1.00  0.75           N  
ATOM    350  N   ASN A  45      63.374   8.938  42.039  1.00  0.78           N  
ATOM    351  CA  ASN A  45      64.613   9.091  41.317  1.00  0.78           C  
ATOM    352  C   ASN A  45      64.371   9.387  39.843  1.00  0.78           C  
ATOM    353  O   ASN A  45      65.113  10.150  39.222  1.00  0.78           O  
ATOM    354  CB  ASN A  45      65.502   7.837  41.509  1.00  0.78           C  
ATOM    355  CG  ASN A  45      65.816   7.616  42.985  1.00  0.78           C  
ATOM    356  OD1 ASN A  45      65.533   6.597  43.606  1.00  0.78           O  
ATOM    357  ND2 ASN A  45      66.454   8.630  43.618  1.00  0.78           N  
ATOM    358  N   VAL A  46      63.308   8.799  39.250  1.00  0.80           N  
ATOM    359  CA  VAL A  46      62.976   9.028  37.852  1.00  0.80           C  
ATOM    360  C   VAL A  46      61.649   9.744  37.586  1.00  0.80           C  
ATOM    361  O   VAL A  46      61.408  10.213  36.470  1.00  0.80           O  
ATOM    362  CB  VAL A  46      63.058   7.701  37.098  1.00  0.80           C  
ATOM    363  CG1 VAL A  46      61.942   6.744  37.559  1.00  0.80           C  
ATOM    364  CG2 VAL A  46      63.041   7.901  35.567  1.00  0.80           C  
ATOM    365  N   ALA A  47      60.762   9.893  38.589  1.00  0.86           N  
ATOM    366  CA  ALA A  47      59.449  10.495  38.414  1.00  0.86           C  
ATOM    367  C   ALA A  47      59.411  11.940  37.917  1.00  0.86           C  
ATOM    368  O   ALA A  47      60.010  12.858  38.480  1.00  0.86           O  
ATOM    369  CB  ALA A  47      58.665  10.444  39.734  1.00  0.86           C  
ATOM    370  N   THR A  48      58.646  12.160  36.833  1.00  0.84           N  
ATOM    371  CA  THR A  48      58.444  13.439  36.177  1.00  0.84           C  
ATOM    372  C   THR A  48      57.214  14.136  36.730  1.00  0.84           C  
ATOM    373  O   THR A  48      56.426  13.490  37.420  1.00  0.84           O  
ATOM    374  CB  THR A  48      58.353  13.312  34.639  1.00  0.84           C  
ATOM    375  OG1 THR A  48      57.214  12.626  34.153  1.00  0.84           O  
ATOM    376  CG2 THR A  48      59.520  12.499  34.098  1.00  0.84           C  
ATOM    377  N   PRO A  49      56.946  15.424  36.469  1.00  0.88           N  
ATOM    378  CA  PRO A  49      55.660  16.042  36.802  1.00  0.88           C  
ATOM    379  C   PRO A  49      54.474  15.297  36.221  1.00  0.88           C  
ATOM    380  O   PRO A  49      53.404  15.278  36.818  1.00  0.88           O  
ATOM    381  CB  PRO A  49      55.781  17.479  36.269  1.00  0.88           C  
ATOM    382  CG  PRO A  49      57.284  17.766  36.342  1.00  0.88           C  
ATOM    383  CD  PRO A  49      57.910  16.417  35.984  1.00  0.88           C  
ATOM    384  N   ARG A  50      54.652  14.636  35.060  1.00  0.83           N  
ATOM    385  CA  ARG A  50      53.642  13.790  34.475  1.00  0.83           C  
ATOM    386  C   ARG A  50      53.341  12.549  35.297  1.00  0.83           C  
ATOM    387  O   ARG A  50      52.179  12.193  35.490  1.00  0.83           O  
ATOM    388  CB  ARG A  50      54.022  13.439  33.020  1.00  0.83           C  
ATOM    389  CG  ARG A  50      52.924  12.666  32.270  1.00  0.83           C  
ATOM    390  CD  ARG A  50      53.308  12.231  30.849  1.00  0.83           C  
ATOM    391  NE  ARG A  50      53.656  13.435  30.023  1.00  0.83           N  
ATOM    392  CZ  ARG A  50      52.776  14.314  29.518  1.00  0.83           C  
ATOM    393  NH1 ARG A  50      51.469  14.194  29.710  1.00  0.83           N  
ATOM    394  NH2 ARG A  50      53.228  15.334  28.788  1.00  0.83           N  
ATOM    395  N   ASP A  51      54.376  11.889  35.849  1.00  0.89           N  
ATOM    396  CA  ASP A  51      54.224  10.758  36.743  1.00  0.89           C  
ATOM    397  C   ASP A  51      53.484  11.126  38.021  1.00  0.89           C  
ATOM    398  O   ASP A  51      52.580  10.435  38.480  1.00  0.89           O  
ATOM    399  CB  ASP A  51      55.605  10.165  37.103  1.00  0.89           C  
ATOM    400  CG  ASP A  51      56.270   9.675  35.835  1.00  0.89           C  
ATOM    401  OD1 ASP A  51      55.613   8.909  35.093  1.00  0.89           O  
ATOM    402  OD2 ASP A  51      57.440  10.067  35.573  1.00  0.89           O  
ATOM    403  N   TYR A  52      53.817  12.284  38.609  1.00  0.88           N  
ATOM    404  CA  TYR A  52      53.113  12.811  39.758  1.00  0.88           C  
ATOM    405  C   TYR A  52      51.656  13.167  39.474  1.00  0.88           C  
ATOM    406  O   TYR A  52      50.777  12.902  40.294  1.00  0.88           O  
ATOM    407  CB  TYR A  52      53.892  14.001  40.364  1.00  0.88           C  
ATOM    408  CG  TYR A  52      55.234  13.569  40.915  1.00  0.88           C  
ATOM    409  CD1 TYR A  52      55.367  12.430  41.733  1.00  0.88           C  
ATOM    410  CD2 TYR A  52      56.385  14.329  40.642  1.00  0.88           C  
ATOM    411  CE1 TYR A  52      56.612  12.067  42.260  1.00  0.88           C  
ATOM    412  CE2 TYR A  52      57.632  13.971  41.177  1.00  0.88           C  
ATOM    413  CZ  TYR A  52      57.741  12.847  41.997  1.00  0.88           C  
ATOM    414  OH  TYR A  52      58.996  12.495  42.538  1.00  0.88           O  
ATOM    415  N   TYR A  53      51.342  13.718  38.278  1.00  0.91           N  
ATOM    416  CA  TYR A  53      49.972  13.908  37.825  1.00  0.91           C  
ATOM    417  C   TYR A  53      49.212  12.581  37.774  1.00  0.91           C  
ATOM    418  O   TYR A  53      48.109  12.472  38.302  1.00  0.91           O  
ATOM    419  CB  TYR A  53      49.952  14.660  36.444  1.00  0.91           C  
ATOM    420  CG  TYR A  53      48.674  14.429  35.666  1.00  0.91           C  
ATOM    421  CD1 TYR A  53      47.464  14.948  36.143  1.00  0.91           C  
ATOM    422  CD2 TYR A  53      48.649  13.501  34.607  1.00  0.91           C  
ATOM    423  CE1 TYR A  53      46.245  14.510  35.611  1.00  0.91           C  
ATOM    424  CE2 TYR A  53      47.428  13.074  34.064  1.00  0.91           C  
ATOM    425  CZ  TYR A  53      46.228  13.561  34.589  1.00  0.91           C  
ATOM    426  OH  TYR A  53      44.989  13.061  34.151  1.00  0.91           O  
ATOM    427  N   PHE A  54      49.806  11.528  37.183  1.00  0.90           N  
ATOM    428  CA  PHE A  54      49.192  10.216  37.111  1.00  0.90           C  
ATOM    429  C   PHE A  54      48.980   9.573  38.472  1.00  0.90           C  
ATOM    430  O   PHE A  54      47.935   8.979  38.733  1.00  0.90           O  
ATOM    431  CB  PHE A  54      50.011   9.268  36.206  1.00  0.90           C  
ATOM    432  CG  PHE A  54      49.762   9.526  34.749  1.00  0.90           C  
ATOM    433  CD1 PHE A  54      48.461   9.475  34.221  1.00  0.90           C  
ATOM    434  CD2 PHE A  54      50.839   9.746  33.875  1.00  0.90           C  
ATOM    435  CE1 PHE A  54      48.242   9.665  32.853  1.00  0.90           C  
ATOM    436  CE2 PHE A  54      50.618   9.926  32.504  1.00  0.90           C  
ATOM    437  CZ  PHE A  54      49.317   9.895  31.994  1.00  0.90           C  
ATOM    438  N   ALA A  55      49.945   9.714  39.400  1.00  0.92           N  
ATOM    439  CA  ALA A  55      49.800   9.271  40.769  1.00  0.92           C  
ATOM    440  C   ALA A  55      48.630   9.943  41.490  1.00  0.92           C  
ATOM    441  O   ALA A  55      47.841   9.286  42.166  1.00  0.92           O  
ATOM    442  CB  ALA A  55      51.122   9.531  41.515  1.00  0.92           C  
ATOM    443  N   LEU A  56      48.452  11.270  41.313  1.00  0.91           N  
ATOM    444  CA  LEU A  56      47.294  11.990  41.811  1.00  0.91           C  
ATOM    445  C   LEU A  56      45.998  11.575  41.143  1.00  0.91           C  
ATOM    446  O   LEU A  56      44.985  11.366  41.810  1.00  0.91           O  
ATOM    447  CB  LEU A  56      47.487  13.515  41.663  1.00  0.91           C  
ATOM    448  CG  LEU A  56      46.395  14.388  42.319  1.00  0.91           C  
ATOM    449  CD1 LEU A  56      46.243  14.112  43.824  1.00  0.91           C  
ATOM    450  CD2 LEU A  56      46.717  15.873  42.104  1.00  0.91           C  
ATOM    451  N   ALA A  57      46.010  11.398  39.806  1.00  0.95           N  
ATOM    452  CA  ALA A  57      44.854  10.984  39.046  1.00  0.95           C  
ATOM    453  C   ALA A  57      44.320   9.631  39.491  1.00  0.95           C  
ATOM    454  O   ALA A  57      43.131   9.489  39.757  1.00  0.95           O  
ATOM    455  CB  ALA A  57      45.193  10.952  37.541  1.00  0.95           C  
ATOM    456  N   HIS A  58      45.203   8.629  39.674  1.00  0.87           N  
ATOM    457  CA  HIS A  58      44.840   7.329  40.213  1.00  0.87           C  
ATOM    458  C   HIS A  58      44.318   7.383  41.647  1.00  0.87           C  
ATOM    459  O   HIS A  58      43.304   6.764  41.963  1.00  0.87           O  
ATOM    460  CB  HIS A  58      46.011   6.334  40.093  1.00  0.87           C  
ATOM    461  CG  HIS A  58      46.248   5.839  38.693  1.00  0.87           C  
ATOM    462  ND1 HIS A  58      45.367   4.938  38.123  1.00  0.87           N  
ATOM    463  CD2 HIS A  58      47.265   6.100  37.832  1.00  0.87           C  
ATOM    464  CE1 HIS A  58      45.866   4.669  36.936  1.00  0.87           C  
ATOM    465  NE2 HIS A  58      47.015   5.348  36.704  1.00  0.87           N  
ATOM    466  N   THR A  59      44.937   8.179  42.546  1.00  0.87           N  
ATOM    467  CA  THR A  59      44.447   8.385  43.915  1.00  0.87           C  
ATOM    468  C   THR A  59      43.052   8.958  43.986  1.00  0.87           C  
ATOM    469  O   THR A  59      42.198   8.477  44.727  1.00  0.87           O  
ATOM    470  CB  THR A  59      45.347   9.335  44.683  1.00  0.87           C  
ATOM    471  OG1 THR A  59      46.619   8.738  44.815  1.00  0.87           O  
ATOM    472  CG2 THR A  59      44.871   9.601  46.117  1.00  0.87           C  
ATOM    473  N   VAL A  60      42.761   9.998  43.181  1.00  0.89           N  
ATOM    474  CA  VAL A  60      41.422  10.548  43.051  1.00  0.89           C  
ATOM    475  C   VAL A  60      40.465   9.538  42.411  1.00  0.89           C  
ATOM    476  O   VAL A  60      39.295   9.424  42.787  1.00  0.89           O  
ATOM    477  CB  VAL A  60      41.440  11.875  42.296  1.00  0.89           C  
ATOM    478  CG1 VAL A  60      40.015  12.437  42.164  1.00  0.89           C  
ATOM    479  CG2 VAL A  60      42.303  12.908  43.051  1.00  0.89           C  
ATOM    480  N   ARG A  61      40.947   8.744  41.435  1.00  0.84           N  
ATOM    481  CA  ARG A  61      40.175   7.727  40.753  1.00  0.84           C  
ATOM    482  C   ARG A  61      39.623   6.632  41.646  1.00  0.84           C  
ATOM    483  O   ARG A  61      38.482   6.227  41.466  1.00  0.84           O  
ATOM    484  CB  ARG A  61      40.963   7.050  39.618  1.00  0.84           C  
ATOM    485  CG  ARG A  61      40.055   6.566  38.478  1.00  0.84           C  
ATOM    486  CD  ARG A  61      40.737   5.566  37.556  1.00  0.84           C  
ATOM    487  NE  ARG A  61      40.624   4.192  38.141  1.00  0.84           N  
ATOM    488  CZ  ARG A  61      41.092   3.120  37.486  1.00  0.84           C  
ATOM    489  NH1 ARG A  61      41.740   3.255  36.334  1.00  0.84           N  
ATOM    490  NH2 ARG A  61      40.892   1.901  37.977  1.00  0.84           N  
ATOM    491  N   ASP A  62      40.387   6.150  42.648  1.00  0.84           N  
ATOM    492  CA  ASP A  62      39.931   5.159  43.610  1.00  0.84           C  
ATOM    493  C   ASP A  62      38.673   5.643  44.347  1.00  0.84           C  
ATOM    494  O   ASP A  62      37.673   4.927  44.457  1.00  0.84           O  
ATOM    495  CB  ASP A  62      41.058   4.868  44.647  1.00  0.84           C  
ATOM    496  CG  ASP A  62      42.206   4.007  44.125  1.00  0.84           C  
ATOM    497  OD1 ASP A  62      42.051   3.390  43.045  1.00  0.84           O  
ATOM    498  OD2 ASP A  62      43.267   3.908  44.815  1.00  0.84           O  
ATOM    499  N   HIS A  63      38.663   6.930  44.775  1.00  0.82           N  
ATOM    500  CA  HIS A  63      37.502   7.589  45.350  1.00  0.82           C  
ATOM    501  C   HIS A  63      36.323   7.640  44.399  1.00  0.82           C  
ATOM    502  O   HIS A  63      35.205   7.314  44.761  1.00  0.82           O  
ATOM    503  CB  HIS A  63      37.826   9.039  45.789  1.00  0.82           C  
ATOM    504  CG  HIS A  63      38.772   9.052  46.927  1.00  0.82           C  
ATOM    505  ND1 HIS A  63      38.299   8.480  48.080  1.00  0.82           N  
ATOM    506  CD2 HIS A  63      40.110   9.225  46.990  1.00  0.82           C  
ATOM    507  CE1 HIS A  63      39.367   8.295  48.813  1.00  0.82           C  
ATOM    508  NE2 HIS A  63      40.501   8.727  48.213  1.00  0.82           N  
ATOM    509  N   LEU A  64      36.584   8.011  43.127  1.00  0.85           N  
ATOM    510  CA  LEU A  64      35.603   8.070  42.065  1.00  0.85           C  
ATOM    511  C   LEU A  64      34.957   6.720  41.773  1.00  0.85           C  
ATOM    512  O   LEU A  64      33.734   6.591  41.720  1.00  0.85           O  
ATOM    513  CB  LEU A  64      36.330   8.587  40.794  1.00  0.85           C  
ATOM    514  CG  LEU A  64      35.610   9.656  39.955  1.00  0.85           C  
ATOM    515  CD1 LEU A  64      36.291   9.767  38.578  1.00  0.85           C  
ATOM    516  CD2 LEU A  64      34.110   9.416  39.802  1.00  0.85           C  
ATOM    517  N   VAL A  65      35.780   5.661  41.649  1.00  0.82           N  
ATOM    518  CA  VAL A  65      35.359   4.292  41.395  1.00  0.82           C  
ATOM    519  C   VAL A  65      34.489   3.734  42.513  1.00  0.82           C  
ATOM    520  O   VAL A  65      33.481   3.076  42.266  1.00  0.82           O  
ATOM    521  CB  VAL A  65      36.550   3.379  41.118  1.00  0.82           C  
ATOM    522  CG1 VAL A  65      36.110   1.907  40.990  1.00  0.82           C  
ATOM    523  CG2 VAL A  65      37.231   3.812  39.802  1.00  0.82           C  
ATOM    524  N   GLY A  66      34.811   4.013  43.793  1.00  0.81           N  
ATOM    525  CA  GLY A  66      34.002   3.518  44.905  1.00  0.81           C  
ATOM    526  C   GLY A  66      32.617   4.099  44.995  1.00  0.81           C  
ATOM    527  O   GLY A  66      31.662   3.425  45.379  1.00  0.81           O  
ATOM    528  N   ARG A  67      32.473   5.375  44.605  1.00  0.79           N  
ATOM    529  CA  ARG A  67      31.186   6.016  44.440  1.00  0.79           C  
ATOM    530  C   ARG A  67      30.446   5.466  43.228  1.00  0.79           C  
ATOM    531  O   ARG A  67      29.238   5.260  43.284  1.00  0.79           O  
ATOM    532  CB  ARG A  67      31.330   7.541  44.273  1.00  0.79           C  
ATOM    533  CG  ARG A  67      32.179   8.307  45.308  1.00  0.79           C  
ATOM    534  CD  ARG A  67      31.535   8.549  46.675  1.00  0.79           C  
ATOM    535  NE  ARG A  67      32.092   9.820  47.267  1.00  0.79           N  
ATOM    536  CZ  ARG A  67      33.339  10.014  47.727  1.00  0.79           C  
ATOM    537  NH1 ARG A  67      34.291   9.098  47.600  1.00  0.79           N  
ATOM    538  NH2 ARG A  67      33.636  11.170  48.324  1.00  0.79           N  
ATOM    539  N   TRP A  68      31.166   5.171  42.119  1.00  0.87           N  
ATOM    540  CA  TRP A  68      30.620   4.596  40.900  1.00  0.87           C  
ATOM    541  C   TRP A  68      30.009   3.228  41.116  1.00  0.87           C  
ATOM    542  O   TRP A  68      28.862   2.993  40.738  1.00  0.87           O  
ATOM    543  CB  TRP A  68      31.707   4.522  39.787  1.00  0.87           C  
ATOM    544  CG  TRP A  68      31.202   4.117  38.411  1.00  0.87           C  
ATOM    545  CD1 TRP A  68      30.654   4.901  37.439  1.00  0.87           C  
ATOM    546  CD2 TRP A  68      31.156   2.769  37.905  1.00  0.87           C  
ATOM    547  NE1 TRP A  68      30.296   4.140  36.350  1.00  0.87           N  
ATOM    548  CE2 TRP A  68      30.597   2.830  36.619  1.00  0.87           C  
ATOM    549  CE3 TRP A  68      31.534   1.551  38.465  1.00  0.87           C  
ATOM    550  CZ2 TRP A  68      30.411   1.681  35.861  1.00  0.87           C  
ATOM    551  CZ3 TRP A  68      31.284   0.382  37.730  1.00  0.87           C  
ATOM    552  CH2 TRP A  68      30.740   0.446  36.441  1.00  0.87           C  
ATOM    553  N   ILE A  69      30.722   2.309  41.802  1.00  0.85           N  
ATOM    554  CA  ILE A  69      30.234   0.969  42.091  1.00  0.85           C  
ATOM    555  C   ILE A  69      28.963   1.016  42.928  1.00  0.85           C  
ATOM    556  O   ILE A  69      27.969   0.393  42.608  1.00  0.85           O  
ATOM    557  CB  ILE A  69      31.303   0.105  42.760  1.00  0.85           C  
ATOM    558  CG1 ILE A  69      32.517  -0.092  41.821  1.00  0.85           C  
ATOM    559  CG2 ILE A  69      30.715  -1.274  43.137  1.00  0.85           C  
ATOM    560  CD1 ILE A  69      33.731  -0.719  42.512  1.00  0.85           C  
ATOM    561  N   ARG A  70      28.930   1.844  43.996  1.00  0.80           N  
ATOM    562  CA  ARG A  70      27.724   2.021  44.783  1.00  0.80           C  
ATOM    563  C   ARG A  70      26.582   2.674  44.022  1.00  0.80           C  
ATOM    564  O   ARG A  70      25.434   2.252  44.141  1.00  0.80           O  
ATOM    565  CB  ARG A  70      28.027   2.792  46.090  1.00  0.80           C  
ATOM    566  CG  ARG A  70      28.891   2.011  47.110  1.00  0.80           C  
ATOM    567  CD  ARG A  70      28.340   0.614  47.438  1.00  0.80           C  
ATOM    568  NE  ARG A  70      29.037   0.095  48.659  1.00  0.80           N  
ATOM    569  CZ  ARG A  70      29.002  -1.192  49.033  1.00  0.80           C  
ATOM    570  NH1 ARG A  70      28.463  -2.135  48.269  1.00  0.80           N  
ATOM    571  NH2 ARG A  70      29.561  -1.558  50.187  1.00  0.80           N  
ATOM    572  N   THR A  71      26.871   3.685  43.180  1.00  0.87           N  
ATOM    573  CA  THR A  71      25.873   4.309  42.311  1.00  0.87           C  
ATOM    574  C   THR A  71      25.245   3.317  41.347  1.00  0.87           C  
ATOM    575  O   THR A  71      24.026   3.204  41.228  1.00  0.87           O  
ATOM    576  CB  THR A  71      26.437   5.431  41.472  1.00  0.87           C  
ATOM    577  OG1 THR A  71      27.047   6.404  42.304  1.00  0.87           O  
ATOM    578  CG2 THR A  71      25.328   6.098  40.658  1.00  0.87           C  
ATOM    579  N   GLN A  72      26.075   2.507  40.663  1.00  0.85           N  
ATOM    580  CA  GLN A  72      25.588   1.491  39.759  1.00  0.85           C  
ATOM    581  C   GLN A  72      24.832   0.360  40.449  1.00  0.85           C  
ATOM    582  O   GLN A  72      23.782  -0.054  39.971  1.00  0.85           O  
ATOM    583  CB  GLN A  72      26.703   0.942  38.840  1.00  0.85           C  
ATOM    584  CG  GLN A  72      27.366   1.998  37.914  1.00  0.85           C  
ATOM    585  CD  GLN A  72      26.379   2.815  37.072  1.00  0.85           C  
ATOM    586  OE1 GLN A  72      25.586   2.306  36.269  1.00  0.85           O  
ATOM    587  NE2 GLN A  72      26.439   4.159  37.242  1.00  0.85           N  
ATOM    588  N   GLN A  73      25.302  -0.125  41.623  1.00  0.80           N  
ATOM    589  CA  GLN A  73      24.610  -1.114  42.437  1.00  0.80           C  
ATOM    590  C   GLN A  73      23.234  -0.640  42.883  1.00  0.80           C  
ATOM    591  O   GLN A  73      22.252  -1.370  42.789  1.00  0.80           O  
ATOM    592  CB  GLN A  73      25.452  -1.475  43.689  1.00  0.80           C  
ATOM    593  CG  GLN A  73      26.673  -2.368  43.376  1.00  0.80           C  
ATOM    594  CD  GLN A  73      27.528  -2.631  44.617  1.00  0.80           C  
ATOM    595  OE1 GLN A  73      27.394  -2.042  45.699  1.00  0.80           O  
ATOM    596  NE2 GLN A  73      28.490  -3.566  44.457  1.00  0.80           N  
ATOM    597  N   HIS A  74      23.128   0.640  43.299  1.00  0.81           N  
ATOM    598  CA  HIS A  74      21.878   1.294  43.657  1.00  0.81           C  
ATOM    599  C   HIS A  74      20.852   1.302  42.524  1.00  0.81           C  
ATOM    600  O   HIS A  74      19.660   1.078  42.722  1.00  0.81           O  
ATOM    601  CB  HIS A  74      22.177   2.748  44.094  1.00  0.81           C  
ATOM    602  CG  HIS A  74      20.988   3.559  44.490  1.00  0.81           C  
ATOM    603  ND1 HIS A  74      20.341   3.271  45.670  1.00  0.81           N  
ATOM    604  CD2 HIS A  74      20.391   4.608  43.868  1.00  0.81           C  
ATOM    605  CE1 HIS A  74      19.366   4.145  45.750  1.00  0.81           C  
ATOM    606  NE2 HIS A  74      19.345   4.980  44.683  1.00  0.81           N  
ATOM    607  N   TYR A  75      21.280   1.525  41.265  1.00  0.85           N  
ATOM    608  CA  TYR A  75      20.392   1.456  40.114  1.00  0.85           C  
ATOM    609  C   TYR A  75      19.873   0.058  39.805  1.00  0.85           C  
ATOM    610  O   TYR A  75      18.769  -0.108  39.295  1.00  0.85           O  
ATOM    611  CB  TYR A  75      21.054   2.048  38.842  1.00  0.85           C  
ATOM    612  CG  TYR A  75      21.409   3.509  38.973  1.00  0.85           C  
ATOM    613  CD1 TYR A  75      20.714   4.392  39.822  1.00  0.85           C  
ATOM    614  CD2 TYR A  75      22.469   4.019  38.201  1.00  0.85           C  
ATOM    615  CE1 TYR A  75      21.101   5.733  39.929  1.00  0.85           C  
ATOM    616  CE2 TYR A  75      22.845   5.366  38.296  1.00  0.85           C  
ATOM    617  CZ  TYR A  75      22.168   6.215  39.174  1.00  0.85           C  
ATOM    618  OH  TYR A  75      22.552   7.560  39.298  1.00  0.85           O  
ATOM    619  N   TYR A  76      20.649  -1.004  40.079  1.00  0.82           N  
ATOM    620  CA  TYR A  76      20.129  -2.362  40.040  1.00  0.82           C  
ATOM    621  C   TYR A  76      19.203  -2.657  41.212  1.00  0.82           C  
ATOM    622  O   TYR A  76      18.216  -3.365  41.045  1.00  0.82           O  
ATOM    623  CB  TYR A  76      21.249  -3.424  39.913  1.00  0.82           C  
ATOM    624  CG  TYR A  76      21.770  -3.444  38.495  1.00  0.82           C  
ATOM    625  CD1 TYR A  76      22.861  -2.649  38.104  1.00  0.82           C  
ATOM    626  CD2 TYR A  76      21.163  -4.267  37.529  1.00  0.82           C  
ATOM    627  CE1 TYR A  76      23.334  -2.673  36.783  1.00  0.82           C  
ATOM    628  CE2 TYR A  76      21.642  -4.303  36.211  1.00  0.82           C  
ATOM    629  CZ  TYR A  76      22.740  -3.519  35.845  1.00  0.82           C  
ATOM    630  OH  TYR A  76      23.284  -3.644  34.551  1.00  0.82           O  
ATOM    631  N   GLU A  77      19.468  -2.099  42.416  1.00  0.78           N  
ATOM    632  CA  GLU A  77      18.590  -2.236  43.571  1.00  0.78           C  
ATOM    633  C   GLU A  77      17.213  -1.626  43.348  1.00  0.78           C  
ATOM    634  O   GLU A  77      16.186  -2.208  43.693  1.00  0.78           O  
ATOM    635  CB  GLU A  77      19.208  -1.594  44.846  1.00  0.78           C  
ATOM    636  CG  GLU A  77      18.392  -1.897  46.136  1.00  0.78           C  
ATOM    637  CD  GLU A  77      18.737  -1.030  47.345  1.00  0.78           C  
ATOM    638  OE1 GLU A  77      19.929  -0.944  47.713  1.00  0.78           O  
ATOM    639  OE2 GLU A  77      17.770  -0.456  47.926  1.00  0.78           O  
ATOM    640  N   LYS A  78      17.157  -0.420  42.748  1.00  0.81           N  
ATOM    641  CA  LYS A  78      15.906   0.303  42.636  1.00  0.81           C  
ATOM    642  C   LYS A  78      15.240   0.227  41.280  1.00  0.81           C  
ATOM    643  O   LYS A  78      14.083   0.622  41.152  1.00  0.81           O  
ATOM    644  CB  LYS A  78      16.149   1.805  42.929  1.00  0.81           C  
ATOM    645  CG  LYS A  78      16.684   2.092  44.339  1.00  0.81           C  
ATOM    646  CD  LYS A  78      15.753   1.577  45.447  1.00  0.81           C  
ATOM    647  CE  LYS A  78      16.282   1.901  46.841  1.00  0.81           C  
ATOM    648  NZ  LYS A  78      15.578   1.084  47.854  1.00  0.81           N  
ATOM    649  N   ASP A  79      15.943  -0.260  40.238  1.00  0.87           N  
ATOM    650  CA  ASP A  79      15.468  -0.286  38.859  1.00  0.87           C  
ATOM    651  C   ASP A  79      14.797   1.025  38.366  1.00  0.87           C  
ATOM    652  O   ASP A  79      13.657   1.018  37.889  1.00  0.87           O  
ATOM    653  CB  ASP A  79      14.629  -1.577  38.673  1.00  0.87           C  
ATOM    654  CG  ASP A  79      14.084  -1.796  37.280  1.00  0.87           C  
ATOM    655  OD1 ASP A  79      14.829  -2.074  36.302  1.00  0.87           O  
ATOM    656  OD2 ASP A  79      12.833  -1.711  37.144  1.00  0.87           O  
ATOM    657  N   PRO A  80      15.428   2.195  38.474  1.00  0.93           N  
ATOM    658  CA  PRO A  80      14.857   3.430  37.970  1.00  0.93           C  
ATOM    659  C   PRO A  80      14.858   3.466  36.459  1.00  0.93           C  
ATOM    660  O   PRO A  80      15.547   2.682  35.806  1.00  0.93           O  
ATOM    661  CB  PRO A  80      15.801   4.498  38.530  1.00  0.93           C  
ATOM    662  CG  PRO A  80      17.168   3.813  38.471  1.00  0.93           C  
ATOM    663  CD  PRO A  80      16.844   2.358  38.803  1.00  0.93           C  
ATOM    664  N   LYS A  81      14.082   4.393  35.870  1.00  0.91           N  
ATOM    665  CA  LYS A  81      14.129   4.619  34.445  1.00  0.91           C  
ATOM    666  C   LYS A  81      15.490   5.135  34.002  1.00  0.91           C  
ATOM    667  O   LYS A  81      15.989   6.145  34.491  1.00  0.91           O  
ATOM    668  CB  LYS A  81      12.993   5.564  33.994  1.00  0.91           C  
ATOM    669  CG  LYS A  81      12.967   5.815  32.481  1.00  0.91           C  
ATOM    670  CD  LYS A  81      11.673   6.489  32.004  1.00  0.91           C  
ATOM    671  CE  LYS A  81      11.651   6.613  30.480  1.00  0.91           C  
ATOM    672  NZ  LYS A  81      10.366   7.156  30.000  1.00  0.91           N  
ATOM    673  N   ARG A  82      16.137   4.404  33.075  1.00  0.91           N  
ATOM    674  CA  ARG A  82      17.484   4.689  32.652  1.00  0.91           C  
ATOM    675  C   ARG A  82      17.509   5.555  31.414  1.00  0.91           C  
ATOM    676  O   ARG A  82      16.778   5.346  30.448  1.00  0.91           O  
ATOM    677  CB  ARG A  82      18.273   3.389  32.400  1.00  0.91           C  
ATOM    678  CG  ARG A  82      18.582   2.625  33.703  1.00  0.91           C  
ATOM    679  CD  ARG A  82      19.418   1.370  33.442  1.00  0.91           C  
ATOM    680  NE  ARG A  82      20.135   0.941  34.686  1.00  0.91           N  
ATOM    681  CZ  ARG A  82      19.643   0.059  35.576  1.00  0.91           C  
ATOM    682  NH1 ARG A  82      18.373  -0.315  35.549  1.00  0.91           N  
ATOM    683  NH2 ARG A  82      20.453  -0.460  36.496  1.00  0.91           N  
ATOM    684  N   ILE A  83      18.375   6.577  31.430  1.00  0.97           N  
ATOM    685  CA  ILE A  83      18.388   7.605  30.410  1.00  0.97           C  
ATOM    686  C   ILE A  83      19.666   7.501  29.629  1.00  0.97           C  
ATOM    687  O   ILE A  83      20.769   7.609  30.158  1.00  0.97           O  
ATOM    688  CB  ILE A  83      18.262   8.999  31.001  1.00  0.97           C  
ATOM    689  CG1 ILE A  83      16.923   9.110  31.760  1.00  0.97           C  
ATOM    690  CG2 ILE A  83      18.348  10.065  29.877  1.00  0.97           C  
ATOM    691  CD1 ILE A  83      16.872  10.306  32.704  1.00  0.97           C  
ATOM    692  N   TYR A  84      19.540   7.287  28.317  1.00  0.97           N  
ATOM    693  CA  TYR A  84      20.660   7.049  27.451  1.00  0.97           C  
ATOM    694  C   TYR A  84      20.789   8.211  26.498  1.00  0.97           C  
ATOM    695  O   TYR A  84      19.973   8.427  25.603  1.00  0.97           O  
ATOM    696  CB  TYR A  84      20.458   5.728  26.675  1.00  0.97           C  
ATOM    697  CG  TYR A  84      20.440   4.573  27.644  1.00  0.97           C  
ATOM    698  CD1 TYR A  84      21.650   4.050  28.105  1.00  0.97           C  
ATOM    699  CD2 TYR A  84      19.245   3.992  28.095  1.00  0.97           C  
ATOM    700  CE1 TYR A  84      21.682   2.944  28.967  1.00  0.97           C  
ATOM    701  CE2 TYR A  84      19.266   2.878  28.954  1.00  0.97           C  
ATOM    702  CZ  TYR A  84      20.491   2.333  29.362  1.00  0.97           C  
ATOM    703  OH  TYR A  84      20.539   1.123  30.095  1.00  0.97           O  
ATOM    704  N   TYR A  85      21.854   9.009  26.682  1.00  0.98           N  
ATOM    705  CA  TYR A  85      22.143  10.145  25.843  1.00  0.98           C  
ATOM    706  C   TYR A  85      23.095   9.673  24.765  1.00  0.98           C  
ATOM    707  O   TYR A  85      24.274   9.409  25.014  1.00  0.98           O  
ATOM    708  CB  TYR A  85      22.762  11.291  26.685  1.00  0.98           C  
ATOM    709  CG  TYR A  85      22.653  12.609  25.966  1.00  0.98           C  
ATOM    710  CD1 TYR A  85      21.461  13.343  26.048  1.00  0.98           C  
ATOM    711  CD2 TYR A  85      23.718  13.125  25.207  1.00  0.98           C  
ATOM    712  CE1 TYR A  85      21.333  14.571  25.388  1.00  0.98           C  
ATOM    713  CE2 TYR A  85      23.588  14.356  24.542  1.00  0.98           C  
ATOM    714  CZ  TYR A  85      22.392  15.078  24.635  1.00  0.98           C  
ATOM    715  OH  TYR A  85      22.229  16.340  24.026  1.00  0.98           O  
ATOM    716  N   LEU A  86      22.588   9.526  23.530  1.00  0.98           N  
ATOM    717  CA  LEU A  86      23.371   9.030  22.422  1.00  0.98           C  
ATOM    718  C   LEU A  86      23.929  10.213  21.671  1.00  0.98           C  
ATOM    719  O   LEU A  86      23.208  11.110  21.233  1.00  0.98           O  
ATOM    720  CB  LEU A  86      22.557   8.137  21.449  1.00  0.98           C  
ATOM    721  CG  LEU A  86      22.490   6.642  21.829  1.00  0.98           C  
ATOM    722  CD1 LEU A  86      21.871   6.425  23.217  1.00  0.98           C  
ATOM    723  CD2 LEU A  86      21.716   5.853  20.757  1.00  0.98           C  
ATOM    724  N   SER A  87      25.257  10.241  21.505  1.00  0.98           N  
ATOM    725  CA  SER A  87      25.922  11.348  20.854  1.00  0.98           C  
ATOM    726  C   SER A  87      27.138  10.814  20.150  1.00  0.98           C  
ATOM    727  O   SER A  87      27.768   9.857  20.586  1.00  0.98           O  
ATOM    728  CB  SER A  87      26.373  12.438  21.865  1.00  0.98           C  
ATOM    729  OG  SER A  87      26.960  13.585  21.238  1.00  0.98           O  
ATOM    730  N   LEU A  88      27.528  11.451  19.035  1.00  0.97           N  
ATOM    731  CA  LEU A  88      28.737  11.108  18.318  1.00  0.97           C  
ATOM    732  C   LEU A  88      29.871  11.976  18.833  1.00  0.97           C  
ATOM    733  O   LEU A  88      31.003  11.868  18.370  1.00  0.97           O  
ATOM    734  CB  LEU A  88      28.553  11.351  16.796  1.00  0.97           C  
ATOM    735  CG  LEU A  88      27.976  10.159  15.994  1.00  0.97           C  
ATOM    736  CD1 LEU A  88      29.003   9.025  15.853  1.00  0.97           C  
ATOM    737  CD2 LEU A  88      26.642   9.625  16.540  1.00  0.97           C  
ATOM    738  N   GLU A  89      29.593  12.838  19.829  1.00  0.95           N  
ATOM    739  CA  GLU A  89      30.569  13.732  20.399  1.00  0.95           C  
ATOM    740  C   GLU A  89      30.380  13.915  21.897  1.00  0.95           C  
ATOM    741  O   GLU A  89      29.272  14.099  22.401  1.00  0.95           O  
ATOM    742  CB  GLU A  89      30.474  15.135  19.771  1.00  0.95           C  
ATOM    743  CG  GLU A  89      30.854  15.195  18.278  1.00  0.95           C  
ATOM    744  CD  GLU A  89      30.824  16.620  17.753  1.00  0.95           C  
ATOM    745  OE1 GLU A  89      30.891  17.576  18.574  1.00  0.95           O  
ATOM    746  OE2 GLU A  89      30.806  16.778  16.509  1.00  0.95           O  
ATOM    747  N   PHE A  90      31.495  13.902  22.643  1.00  0.96           N  
ATOM    748  CA  PHE A  90      31.539  14.171  24.065  1.00  0.96           C  
ATOM    749  C   PHE A  90      32.772  15.009  24.354  1.00  0.96           C  
ATOM    750  O   PHE A  90      33.877  14.504  24.537  1.00  0.96           O  
ATOM    751  CB  PHE A  90      31.612  12.858  24.891  1.00  0.96           C  
ATOM    752  CG  PHE A  90      30.242  12.270  25.055  1.00  0.96           C  
ATOM    753  CD1 PHE A  90      29.375  12.802  26.021  1.00  0.96           C  
ATOM    754  CD2 PHE A  90      29.797  11.209  24.249  1.00  0.96           C  
ATOM    755  CE1 PHE A  90      28.071  12.309  26.156  1.00  0.96           C  
ATOM    756  CE2 PHE A  90      28.497  10.708  24.391  1.00  0.96           C  
ATOM    757  CZ  PHE A  90      27.627  11.268  25.335  1.00  0.96           C  
ATOM    758  N   TYR A  91      32.615  16.345  24.419  1.00  0.94           N  
ATOM    759  CA  TYR A  91      33.721  17.282  24.529  1.00  0.94           C  
ATOM    760  C   TYR A  91      34.028  17.565  25.993  1.00  0.94           C  
ATOM    761  O   TYR A  91      33.815  18.660  26.521  1.00  0.94           O  
ATOM    762  CB  TYR A  91      33.353  18.578  23.759  1.00  0.94           C  
ATOM    763  CG  TYR A  91      34.476  19.398  23.180  1.00  0.94           C  
ATOM    764  CD1 TYR A  91      35.843  19.114  23.346  1.00  0.94           C  
ATOM    765  CD2 TYR A  91      34.110  20.494  22.381  1.00  0.94           C  
ATOM    766  CE1 TYR A  91      36.816  19.897  22.701  1.00  0.94           C  
ATOM    767  CE2 TYR A  91      35.076  21.269  21.731  1.00  0.94           C  
ATOM    768  CZ  TYR A  91      36.428  20.962  21.885  1.00  0.94           C  
ATOM    769  OH  TYR A  91      37.390  21.733  21.208  1.00  0.94           O  
ATOM    770  N   MET A  92      34.490  16.524  26.706  1.00  0.94           N  
ATOM    771  CA  MET A  92      34.640  16.499  28.143  1.00  0.94           C  
ATOM    772  C   MET A  92      35.661  17.464  28.719  1.00  0.94           C  
ATOM    773  O   MET A  92      35.400  18.114  29.725  1.00  0.94           O  
ATOM    774  CB  MET A  92      34.985  15.077  28.616  1.00  0.94           C  
ATOM    775  CG  MET A  92      33.942  14.017  28.219  1.00  0.94           C  
ATOM    776  SD  MET A  92      32.264  14.330  28.852  1.00  0.94           S  
ATOM    777  CE  MET A  92      32.546  13.754  30.550  1.00  0.94           C  
ATOM    778  N   GLY A  93      36.837  17.594  28.063  1.00  0.97           N  
ATOM    779  CA  GLY A  93      37.925  18.418  28.582  1.00  0.97           C  
ATOM    780  C   GLY A  93      38.785  17.660  29.558  1.00  0.97           C  
ATOM    781  O   GLY A  93      38.954  16.451  29.437  1.00  0.97           O  
ATOM    782  N   ARG A  94      39.381  18.369  30.533  1.00  0.91           N  
ATOM    783  CA  ARG A  94      40.126  17.770  31.632  1.00  0.91           C  
ATOM    784  C   ARG A  94      39.225  17.201  32.738  1.00  0.91           C  
ATOM    785  O   ARG A  94      38.137  17.726  33.006  1.00  0.91           O  
ATOM    786  CB  ARG A  94      41.063  18.816  32.276  1.00  0.91           C  
ATOM    787  CG  ARG A  94      42.227  19.283  31.380  1.00  0.91           C  
ATOM    788  CD  ARG A  94      43.046  20.352  32.101  1.00  0.91           C  
ATOM    789  NE  ARG A  94      44.239  20.688  31.273  1.00  0.91           N  
ATOM    790  CZ  ARG A  94      44.931  21.810  31.435  1.00  0.91           C  
ATOM    791  NH1 ARG A  94      44.511  22.698  32.322  1.00  0.91           N  
ATOM    792  NH2 ARG A  94      46.081  22.022  30.803  1.00  0.91           N  
ATOM    793  N   THR A  95      39.661  16.138  33.445  1.00  0.96           N  
ATOM    794  CA  THR A  95      38.850  15.465  34.451  1.00  0.96           C  
ATOM    795  C   THR A  95      39.360  15.655  35.879  1.00  0.96           C  
ATOM    796  O   THR A  95      38.575  15.637  36.813  1.00  0.96           O  
ATOM    797  CB  THR A  95      38.798  13.963  34.193  1.00  0.96           C  
ATOM    798  OG1 THR A  95      38.166  13.681  32.955  1.00  0.96           O  
ATOM    799  CG2 THR A  95      38.012  13.177  35.253  1.00  0.96           C  
ATOM    800  N   LEU A  96      40.684  15.876  36.119  1.00  0.94           N  
ATOM    801  CA  LEU A  96      41.238  15.814  37.476  1.00  0.94           C  
ATOM    802  C   LEU A  96      40.612  16.794  38.467  1.00  0.94           C  
ATOM    803  O   LEU A  96      40.034  16.387  39.478  1.00  0.94           O  
ATOM    804  CB  LEU A  96      42.783  16.041  37.450  1.00  0.94           C  
ATOM    805  CG  LEU A  96      43.657  15.260  38.470  1.00  0.94           C  
ATOM    806  CD1 LEU A  96      44.987  15.990  38.724  1.00  0.94           C  
ATOM    807  CD2 LEU A  96      42.993  14.972  39.824  1.00  0.94           C  
ATOM    808  N   GLN A  97      40.614  18.108  38.151  1.00  0.92           N  
ATOM    809  CA  GLN A  97      40.008  19.126  38.995  1.00  0.92           C  
ATOM    810  C   GLN A  97      38.501  18.968  39.131  1.00  0.92           C  
ATOM    811  O   GLN A  97      37.930  19.092  40.210  1.00  0.92           O  
ATOM    812  CB  GLN A  97      40.331  20.561  38.517  1.00  0.92           C  
ATOM    813  CG  GLN A  97      39.771  21.622  39.492  1.00  0.92           C  
ATOM    814  CD  GLN A  97      40.138  23.058  39.122  1.00  0.92           C  
ATOM    815  OE1 GLN A  97      40.164  23.442  37.951  1.00  0.92           O  
ATOM    816  NE2 GLN A  97      40.348  23.890  40.167  1.00  0.92           N  
ATOM    817  N   ASN A  98      37.800  18.632  38.025  1.00  0.94           N  
ATOM    818  CA  ASN A  98      36.358  18.460  38.024  1.00  0.94           C  
ATOM    819  C   ASN A  98      35.931  17.345  38.968  1.00  0.94           C  
ATOM    820  O   ASN A  98      35.003  17.508  39.759  1.00  0.94           O  
ATOM    821  CB  ASN A  98      35.859  18.233  36.570  1.00  0.94           C  
ATOM    822  CG  ASN A  98      34.339  18.151  36.431  1.00  0.94           C  
ATOM    823  OD1 ASN A  98      33.812  17.126  36.026  1.00  0.94           O  
ATOM    824  ND2 ASN A  98      33.622  19.262  36.726  1.00  0.94           N  
ATOM    825  N   THR A  99      36.658  16.215  38.964  1.00  0.95           N  
ATOM    826  CA  THR A  99      36.460  15.142  39.928  1.00  0.95           C  
ATOM    827  C   THR A  99      36.736  15.566  41.356  1.00  0.95           C  
ATOM    828  O   THR A  99      35.947  15.304  42.263  1.00  0.95           O  
ATOM    829  CB  THR A  99      37.319  13.929  39.632  1.00  0.95           C  
ATOM    830  OG1 THR A  99      36.976  13.387  38.370  1.00  0.95           O  
ATOM    831  CG2 THR A  99      37.018  12.819  40.638  1.00  0.95           C  
ATOM    832  N   MET A 100      37.852  16.278  41.611  1.00  0.89           N  
ATOM    833  CA  MET A 100      38.162  16.753  42.945  1.00  0.89           C  
ATOM    834  C   MET A 100      37.136  17.730  43.513  1.00  0.89           C  
ATOM    835  O   MET A 100      36.718  17.573  44.658  1.00  0.89           O  
ATOM    836  CB  MET A 100      39.582  17.354  43.025  1.00  0.89           C  
ATOM    837  CG  MET A 100      40.699  16.306  42.844  1.00  0.89           C  
ATOM    838  SD  MET A 100      42.376  16.907  43.188  1.00  0.89           S  
ATOM    839  CE  MET A 100      42.364  18.244  41.968  1.00  0.89           C  
ATOM    840  N   VAL A 101      36.648  18.729  42.743  1.00  0.92           N  
ATOM    841  CA  VAL A 101      35.598  19.620  43.225  1.00  0.92           C  
ATOM    842  C   VAL A 101      34.268  18.932  43.424  1.00  0.92           C  
ATOM    843  O   VAL A 101      33.588  19.185  44.418  1.00  0.92           O  
ATOM    844  CB  VAL A 101      35.378  20.907  42.439  1.00  0.92           C  
ATOM    845  CG1 VAL A 101      36.732  21.597  42.250  1.00  0.92           C  
ATOM    846  CG2 VAL A 101      34.679  20.675  41.087  1.00  0.92           C  
ATOM    847  N   ASN A 102      33.864  18.019  42.513  1.00  0.93           N  
ATOM    848  CA  ASN A 102      32.624  17.279  42.634  1.00  0.93           C  
ATOM    849  C   ASN A 102      32.589  16.374  43.861  1.00  0.93           C  
ATOM    850  O   ASN A 102      31.554  16.269  44.517  1.00  0.93           O  
ATOM    851  CB  ASN A 102      32.279  16.498  41.338  1.00  0.93           C  
ATOM    852  CG  ASN A 102      31.628  17.439  40.323  1.00  0.93           C  
ATOM    853  OD1 ASN A 102      30.753  18.229  40.670  1.00  0.93           O  
ATOM    854  ND2 ASN A 102      32.031  17.347  39.040  1.00  0.93           N  
ATOM    855  N   LEU A 103      33.724  15.744  44.237  1.00  0.87           N  
ATOM    856  CA  LEU A 103      33.768  14.839  45.373  1.00  0.87           C  
ATOM    857  C   LEU A 103      34.261  15.484  46.675  1.00  0.87           C  
ATOM    858  O   LEU A 103      34.308  14.812  47.699  1.00  0.87           O  
ATOM    859  CB  LEU A 103      34.682  13.624  45.057  1.00  0.87           C  
ATOM    860  CG  LEU A 103      34.304  12.796  43.805  1.00  0.87           C  
ATOM    861  CD1 LEU A 103      35.137  11.504  43.764  1.00  0.87           C  
ATOM    862  CD2 LEU A 103      32.809  12.444  43.719  1.00  0.87           C  
ATOM    863  N   ALA A 104      34.623  16.789  46.658  1.00  0.86           N  
ATOM    864  CA  ALA A 104      35.092  17.583  47.796  1.00  0.86           C  
ATOM    865  C   ALA A 104      36.543  17.339  48.202  1.00  0.86           C  
ATOM    866  O   ALA A 104      36.976  17.684  49.297  1.00  0.86           O  
ATOM    867  CB  ALA A 104      34.167  17.555  49.037  1.00  0.86           C  
ATOM    868  N   LEU A 105      37.368  16.814  47.283  1.00  0.84           N  
ATOM    869  CA  LEU A 105      38.700  16.354  47.612  1.00  0.84           C  
ATOM    870  C   LEU A 105      39.781  17.390  47.353  1.00  0.84           C  
ATOM    871  O   LEU A 105      40.926  17.200  47.743  1.00  0.84           O  
ATOM    872  CB  LEU A 105      39.042  15.106  46.763  1.00  0.84           C  
ATOM    873  CG  LEU A 105      38.195  13.859  47.083  1.00  0.84           C  
ATOM    874  CD1 LEU A 105      38.437  12.765  46.031  1.00  0.84           C  
ATOM    875  CD2 LEU A 105      38.507  13.320  48.489  1.00  0.84           C  
ATOM    876  N   GLU A 106      39.455  18.536  46.721  1.00  0.83           N  
ATOM    877  CA  GLU A 106      40.425  19.520  46.258  1.00  0.83           C  
ATOM    878  C   GLU A 106      41.331  20.103  47.341  1.00  0.83           C  
ATOM    879  O   GLU A 106      42.550  20.046  47.228  1.00  0.83           O  
ATOM    880  CB  GLU A 106      39.631  20.621  45.521  1.00  0.83           C  
ATOM    881  CG  GLU A 106      40.465  21.711  44.806  1.00  0.83           C  
ATOM    882  CD  GLU A 106      39.551  22.664  44.036  1.00  0.83           C  
ATOM    883  OE1 GLU A 106      38.597  23.184  44.673  1.00  0.83           O  
ATOM    884  OE2 GLU A 106      39.761  22.841  42.808  1.00  0.83           O  
ATOM    885  N   ASN A 107      40.771  20.568  48.480  1.00  0.81           N  
ATOM    886  CA  ASN A 107      41.558  21.047  49.612  1.00  0.81           C  
ATOM    887  C   ASN A 107      42.442  19.968  50.240  1.00  0.81           C  
ATOM    888  O   ASN A 107      43.602  20.193  50.573  1.00  0.81           O  
ATOM    889  CB  ASN A 107      40.633  21.617  50.719  1.00  0.81           C  
ATOM    890  CG  ASN A 107      39.809  22.774  50.168  1.00  0.81           C  
ATOM    891  OD1 ASN A 107      40.328  23.766  49.668  1.00  0.81           O  
ATOM    892  ND2 ASN A 107      38.464  22.661  50.269  1.00  0.81           N  
ATOM    893  N   ALA A 108      41.906  18.741  50.415  1.00  0.84           N  
ATOM    894  CA  ALA A 108      42.644  17.633  50.980  1.00  0.84           C  
ATOM    895  C   ALA A 108      43.774  17.144  50.083  1.00  0.84           C  
ATOM    896  O   ALA A 108      44.878  16.859  50.542  1.00  0.84           O  
ATOM    897  CB  ALA A 108      41.665  16.493  51.315  1.00  0.84           C  
ATOM    898  N   CYS A 109      43.524  17.060  48.762  1.00  0.87           N  
ATOM    899  CA  CYS A 109      44.528  16.736  47.770  1.00  0.87           C  
ATOM    900  C   CYS A 109      45.625  17.772  47.660  1.00  0.87           C  
ATOM    901  O   CYS A 109      46.793  17.400  47.583  1.00  0.87           O  
ATOM    902  CB  CYS A 109      43.893  16.502  46.383  1.00  0.87           C  
ATOM    903  SG  CYS A 109      42.983  14.919  46.334  1.00  0.87           S  
ATOM    904  N   ASP A 110      45.283  19.078  47.688  1.00  0.86           N  
ATOM    905  CA  ASP A 110      46.231  20.173  47.634  1.00  0.86           C  
ATOM    906  C   ASP A 110      47.211  20.152  48.807  1.00  0.86           C  
ATOM    907  O   ASP A 110      48.427  20.206  48.645  1.00  0.86           O  
ATOM    908  CB  ASP A 110      45.414  21.490  47.603  1.00  0.86           C  
ATOM    909  CG  ASP A 110      46.302  22.693  47.350  1.00  0.86           C  
ATOM    910  OD1 ASP A 110      47.101  22.631  46.382  1.00  0.86           O  
ATOM    911  OD2 ASP A 110      46.182  23.672  48.126  1.00  0.86           O  
ATOM    912  N   GLU A 111      46.693  19.959  50.035  1.00  0.81           N  
ATOM    913  CA  GLU A 111      47.508  19.792  51.224  1.00  0.81           C  
ATOM    914  C   GLU A 111      48.387  18.544  51.164  1.00  0.81           C  
ATOM    915  O   GLU A 111      49.574  18.553  51.494  1.00  0.81           O  
ATOM    916  CB  GLU A 111      46.568  19.784  52.450  1.00  0.81           C  
ATOM    917  CG  GLU A 111      47.248  19.726  53.840  1.00  0.81           C  
ATOM    918  CD  GLU A 111      48.242  20.861  54.071  1.00  0.81           C  
ATOM    919  OE1 GLU A 111      47.831  22.043  54.007  1.00  0.81           O  
ATOM    920  OE2 GLU A 111      49.425  20.539  54.367  1.00  0.81           O  
ATOM    921  N   ALA A 112      47.839  17.416  50.665  1.00  0.87           N  
ATOM    922  CA  ALA A 112      48.602  16.200  50.478  1.00  0.87           C  
ATOM    923  C   ALA A 112      49.764  16.332  49.493  1.00  0.87           C  
ATOM    924  O   ALA A 112      50.880  15.899  49.783  1.00  0.87           O  
ATOM    925  CB  ALA A 112      47.659  15.051  50.064  1.00  0.87           C  
ATOM    926  N   THR A 113      49.554  16.972  48.325  1.00  0.86           N  
ATOM    927  CA  THR A 113      50.615  17.266  47.367  1.00  0.86           C  
ATOM    928  C   THR A 113      51.613  18.282  47.890  1.00  0.86           C  
ATOM    929  O   THR A 113      52.824  18.094  47.756  1.00  0.86           O  
ATOM    930  CB  THR A 113      50.111  17.720  46.004  1.00  0.86           C  
ATOM    931  OG1 THR A 113      49.211  18.802  46.133  1.00  0.86           O  
ATOM    932  CG2 THR A 113      49.332  16.574  45.347  1.00  0.86           C  
ATOM    933  N   TYR A 114      51.147  19.355  48.566  1.00  0.85           N  
ATOM    934  CA  TYR A 114      51.980  20.386  49.163  1.00  0.85           C  
ATOM    935  C   TYR A 114      52.952  19.823  50.199  1.00  0.85           C  
ATOM    936  O   TYR A 114      54.129  20.199  50.259  1.00  0.85           O  
ATOM    937  CB  TYR A 114      51.087  21.497  49.797  1.00  0.85           C  
ATOM    938  CG  TYR A 114      51.916  22.552  50.483  1.00  0.85           C  
ATOM    939  CD1 TYR A 114      52.769  23.368  49.728  1.00  0.85           C  
ATOM    940  CD2 TYR A 114      51.976  22.607  51.885  1.00  0.85           C  
ATOM    941  CE1 TYR A 114      53.709  24.190  50.363  1.00  0.85           C  
ATOM    942  CE2 TYR A 114      52.914  23.431  52.524  1.00  0.85           C  
ATOM    943  CZ  TYR A 114      53.793  24.204  51.760  1.00  0.85           C  
ATOM    944  OH  TYR A 114      54.844  24.900  52.386  1.00  0.85           O  
ATOM    945  N   GLN A 115      52.491  18.869  51.027  1.00  0.81           N  
ATOM    946  CA  GLN A 115      53.323  18.195  52.000  1.00  0.81           C  
ATOM    947  C   GLN A 115      54.305  17.211  51.381  1.00  0.81           C  
ATOM    948  O   GLN A 115      55.257  16.810  52.044  1.00  0.81           O  
ATOM    949  CB  GLN A 115      52.462  17.422  53.017  1.00  0.81           C  
ATOM    950  CG  GLN A 115      51.762  18.315  54.056  1.00  0.81           C  
ATOM    951  CD  GLN A 115      50.922  17.475  55.020  1.00  0.81           C  
ATOM    952  OE1 GLN A 115      51.218  16.307  55.304  1.00  0.81           O  
ATOM    953  NE2 GLN A 115      49.849  18.094  55.548  1.00  0.81           N  
ATOM    954  N   LEU A 116      54.119  16.812  50.106  1.00  0.84           N  
ATOM    955  CA  LEU A 116      55.053  15.966  49.380  1.00  0.84           C  
ATOM    956  C   LEU A 116      55.952  16.783  48.463  1.00  0.84           C  
ATOM    957  O   LEU A 116      56.788  16.234  47.755  1.00  0.84           O  
ATOM    958  CB  LEU A 116      54.323  14.918  48.503  1.00  0.84           C  
ATOM    959  CG  LEU A 116      53.551  13.839  49.285  1.00  0.84           C  
ATOM    960  CD1 LEU A 116      52.733  12.978  48.312  1.00  0.84           C  
ATOM    961  CD2 LEU A 116      54.493  12.942  50.105  1.00  0.84           C  
ATOM    962  N   GLY A 117      55.838  18.129  48.470  1.00  0.83           N  
ATOM    963  CA  GLY A 117      56.711  19.004  47.691  1.00  0.83           C  
ATOM    964  C   GLY A 117      56.364  19.057  46.237  1.00  0.83           C  
ATOM    965  O   GLY A 117      57.231  19.109  45.361  1.00  0.83           O  
ATOM    966  N   LEU A 118      55.060  19.007  45.950  1.00  0.84           N  
ATOM    967  CA  LEU A 118      54.506  19.022  44.622  1.00  0.84           C  
ATOM    968  C   LEU A 118      53.434  20.094  44.576  1.00  0.84           C  
ATOM    969  O   LEU A 118      52.622  20.198  45.489  1.00  0.84           O  
ATOM    970  CB  LEU A 118      53.846  17.655  44.322  1.00  0.84           C  
ATOM    971  CG  LEU A 118      54.819  16.462  44.338  1.00  0.84           C  
ATOM    972  CD1 LEU A 118      54.039  15.145  44.285  1.00  0.84           C  
ATOM    973  CD2 LEU A 118      55.807  16.543  43.169  1.00  0.84           C  
ATOM    974  N   ASP A 119      53.385  20.920  43.513  1.00  0.85           N  
ATOM    975  CA  ASP A 119      52.288  21.841  43.292  1.00  0.85           C  
ATOM    976  C   ASP A 119      51.146  21.111  42.598  1.00  0.85           C  
ATOM    977  O   ASP A 119      51.346  20.457  41.576  1.00  0.85           O  
ATOM    978  CB  ASP A 119      52.786  23.026  42.420  1.00  0.85           C  
ATOM    979  CG  ASP A 119      51.646  23.932  41.976  1.00  0.85           C  
ATOM    980  OD1 ASP A 119      50.642  24.034  42.723  1.00  0.85           O  
ATOM    981  OD2 ASP A 119      51.718  24.430  40.829  1.00  0.85           O  
ATOM    982  N   MET A 120      49.905  21.200  43.116  1.00  0.85           N  
ATOM    983  CA  MET A 120      48.762  20.618  42.452  1.00  0.85           C  
ATOM    984  C   MET A 120      48.391  21.309  41.146  1.00  0.85           C  
ATOM    985  O   MET A 120      48.056  20.638  40.180  1.00  0.85           O  
ATOM    986  CB  MET A 120      47.547  20.518  43.387  1.00  0.85           C  
ATOM    987  CG  MET A 120      46.426  19.628  42.823  1.00  0.85           C  
ATOM    988  SD  MET A 120      45.250  19.078  44.088  1.00  0.85           S  
ATOM    989  CE  MET A 120      44.325  20.639  44.119  1.00  0.85           C  
ATOM    990  N   GLU A 121      48.500  22.659  41.076  1.00  0.82           N  
ATOM    991  CA  GLU A 121      48.165  23.427  39.885  1.00  0.82           C  
ATOM    992  C   GLU A 121      49.054  23.036  38.702  1.00  0.82           C  
ATOM    993  O   GLU A 121      48.581  22.829  37.579  1.00  0.82           O  
ATOM    994  CB  GLU A 121      48.275  24.960  40.135  1.00  0.82           C  
ATOM    995  CG  GLU A 121      47.170  25.587  41.029  1.00  0.82           C  
ATOM    996  CD  GLU A 121      47.133  27.124  40.970  1.00  0.82           C  
ATOM    997  OE1 GLU A 121      46.922  27.702  39.858  1.00  0.82           O  
ATOM    998  OE2 GLU A 121      47.278  27.770  42.040  1.00  0.82           O  
ATOM    999  N   GLU A 122      50.371  22.841  38.940  1.00  0.83           N  
ATOM   1000  CA  GLU A 122      51.311  22.301  37.970  1.00  0.83           C  
ATOM   1001  C   GLU A 122      50.928  20.919  37.457  1.00  0.83           C  
ATOM   1002  O   GLU A 122      50.935  20.661  36.253  1.00  0.83           O  
ATOM   1003  CB  GLU A 122      52.727  22.214  38.600  1.00  0.83           C  
ATOM   1004  CG  GLU A 122      53.880  21.824  37.634  1.00  0.83           C  
ATOM   1005  CD  GLU A 122      55.155  21.418  38.381  1.00  0.83           C  
ATOM   1006  OE1 GLU A 122      55.683  22.236  39.174  1.00  0.83           O  
ATOM   1007  OE2 GLU A 122      55.625  20.268  38.163  1.00  0.83           O  
ATOM   1008  N   LEU A 123      50.520  19.993  38.355  1.00  0.89           N  
ATOM   1009  CA  LEU A 123      50.084  18.662  37.968  1.00  0.89           C  
ATOM   1010  C   LEU A 123      48.828  18.664  37.103  1.00  0.89           C  
ATOM   1011  O   LEU A 123      48.737  17.929  36.127  1.00  0.89           O  
ATOM   1012  CB  LEU A 123      49.851  17.727  39.183  1.00  0.89           C  
ATOM   1013  CG  LEU A 123      51.074  17.510  40.103  1.00  0.89           C  
ATOM   1014  CD1 LEU A 123      50.752  16.499  41.217  1.00  0.89           C  
ATOM   1015  CD2 LEU A 123      52.345  17.098  39.346  1.00  0.89           C  
ATOM   1016  N   GLU A 124      47.830  19.512  37.418  1.00  0.89           N  
ATOM   1017  CA  GLU A 124      46.604  19.649  36.648  1.00  0.89           C  
ATOM   1018  C   GLU A 124      46.818  20.121  35.218  1.00  0.89           C  
ATOM   1019  O   GLU A 124      46.144  19.673  34.291  1.00  0.89           O  
ATOM   1020  CB  GLU A 124      45.606  20.576  37.370  1.00  0.89           C  
ATOM   1021  CG  GLU A 124      45.127  19.985  38.716  1.00  0.89           C  
ATOM   1022  CD  GLU A 124      44.217  20.937  39.482  1.00  0.89           C  
ATOM   1023  OE1 GLU A 124      44.502  22.156  39.502  1.00  0.89           O  
ATOM   1024  OE2 GLU A 124      43.227  20.421  40.059  1.00  0.89           O  
ATOM   1025  N   GLU A 125      47.801  21.013  34.975  1.00  0.86           N  
ATOM   1026  CA  GLU A 125      48.112  21.461  33.629  1.00  0.86           C  
ATOM   1027  C   GLU A 125      48.721  20.411  32.721  1.00  0.86           C  
ATOM   1028  O   GLU A 125      48.636  20.522  31.499  1.00  0.86           O  
ATOM   1029  CB  GLU A 125      49.013  22.711  33.631  1.00  0.86           C  
ATOM   1030  CG  GLU A 125      48.253  24.007  33.997  1.00  0.86           C  
ATOM   1031  CD  GLU A 125      47.071  24.288  33.107  1.00  0.86           C  
ATOM   1032  OE1 GLU A 125      47.166  24.253  31.855  1.00  0.86           O  
ATOM   1033  OE2 GLU A 125      45.964  24.563  33.637  1.00  0.86           O  
ATOM   1034  N   ILE A 126      49.288  19.332  33.290  1.00  0.89           N  
ATOM   1035  CA  ILE A 126      49.750  18.173  32.544  1.00  0.89           C  
ATOM   1036  C   ILE A 126      48.622  17.470  31.786  1.00  0.89           C  
ATOM   1037  O   ILE A 126      48.836  16.940  30.694  1.00  0.89           O  
ATOM   1038  CB  ILE A 126      50.448  17.177  33.469  1.00  0.89           C  
ATOM   1039  CG1 ILE A 126      51.685  17.784  34.185  1.00  0.89           C  
ATOM   1040  CG2 ILE A 126      50.832  15.873  32.738  1.00  0.89           C  
ATOM   1041  CD1 ILE A 126      52.823  18.243  33.261  1.00  0.89           C  
ATOM   1042  N   GLU A 127      47.397  17.416  32.356  1.00  0.90           N  
ATOM   1043  CA  GLU A 127      46.273  16.718  31.753  1.00  0.90           C  
ATOM   1044  C   GLU A 127      45.809  17.268  30.397  1.00  0.90           C  
ATOM   1045  O   GLU A 127      45.532  18.455  30.227  1.00  0.90           O  
ATOM   1046  CB  GLU A 127      45.088  16.646  32.743  1.00  0.90           C  
ATOM   1047  CG  GLU A 127      43.905  15.765  32.269  1.00  0.90           C  
ATOM   1048  CD  GLU A 127      42.826  15.593  33.329  1.00  0.90           C  
ATOM   1049  OE1 GLU A 127      42.625  16.490  34.181  1.00  0.90           O  
ATOM   1050  OE2 GLU A 127      42.097  14.568  33.260  1.00  0.90           O  
ATOM   1051  N   GLU A 128      45.707  16.384  29.382  1.00  0.89           N  
ATOM   1052  CA  GLU A 128      45.218  16.722  28.057  1.00  0.89           C  
ATOM   1053  C   GLU A 128      43.694  16.718  28.002  1.00  0.89           C  
ATOM   1054  O   GLU A 128      43.021  15.999  28.729  1.00  0.89           O  
ATOM   1055  CB  GLU A 128      45.826  15.772  26.984  1.00  0.89           C  
ATOM   1056  CG  GLU A 128      47.334  16.080  26.755  1.00  0.89           C  
ATOM   1057  CD  GLU A 128      48.093  15.174  25.778  1.00  0.89           C  
ATOM   1058  OE1 GLU A 128      47.713  15.112  24.585  1.00  0.89           O  
ATOM   1059  OE2 GLU A 128      49.128  14.591  26.219  1.00  0.89           O  
ATOM   1060  N   ASP A 129      43.095  17.571  27.141  1.00  0.93           N  
ATOM   1061  CA  ASP A 129      41.666  17.575  26.899  1.00  0.93           C  
ATOM   1062  C   ASP A 129      41.159  16.281  26.292  1.00  0.93           C  
ATOM   1063  O   ASP A 129      41.624  15.833  25.271  1.00  0.93           O  
ATOM   1064  CB  ASP A 129      41.262  18.663  25.869  1.00  0.93           C  
ATOM   1065  CG  ASP A 129      41.468  20.032  26.437  1.00  0.93           C  
ATOM   1066  OD1 ASP A 129      42.650  20.391  26.662  1.00  0.93           O  
ATOM   1067  OD2 ASP A 129      40.477  20.788  26.629  1.00  0.93           O  
ATOM   1068  N   ALA A 130      40.085  15.690  26.876  1.00  0.96           N  
ATOM   1069  CA  ALA A 130      39.348  14.670  26.162  1.00  0.96           C  
ATOM   1070  C   ALA A 130      38.504  15.330  25.067  1.00  0.96           C  
ATOM   1071  O   ALA A 130      37.328  15.629  25.240  1.00  0.96           O  
ATOM   1072  CB  ALA A 130      38.500  13.831  27.143  1.00  0.96           C  
ATOM   1073  N   GLY A 131      39.149  15.630  23.910  1.00  0.87           N  
ATOM   1074  CA  GLY A 131      38.613  16.456  22.834  1.00  0.87           C  
ATOM   1075  C   GLY A 131      37.780  15.732  21.822  1.00  0.87           C  
ATOM   1076  O   GLY A 131      37.899  15.946  20.622  1.00  0.87           O  
ATOM   1077  N   LEU A 132      36.861  14.866  22.275  1.00  0.93           N  
ATOM   1078  CA  LEU A 132      36.045  14.047  21.401  1.00  0.93           C  
ATOM   1079  C   LEU A 132      34.803  14.791  20.937  1.00  0.93           C  
ATOM   1080  O   LEU A 132      33.699  14.256  20.942  1.00  0.93           O  
ATOM   1081  CB  LEU A 132      35.641  12.728  22.103  1.00  0.93           C  
ATOM   1082  CG  LEU A 132      36.810  11.968  22.762  1.00  0.93           C  
ATOM   1083  CD1 LEU A 132      36.328  10.596  23.249  1.00  0.93           C  
ATOM   1084  CD2 LEU A 132      38.020  11.785  21.834  1.00  0.93           C  
ATOM   1085  N   GLY A 133      34.958  16.067  20.530  1.00  0.95           N  
ATOM   1086  CA  GLY A 133      33.850  16.881  20.068  1.00  0.95           C  
ATOM   1087  C   GLY A 133      34.301  18.063  19.258  1.00  0.95           C  
ATOM   1088  O   GLY A 133      35.381  18.602  19.440  1.00  0.95           O  
ATOM   1089  N   ASN A 134      33.442  18.489  18.314  1.00  0.87           N  
ATOM   1090  CA  ASN A 134      33.694  19.593  17.419  1.00  0.87           C  
ATOM   1091  C   ASN A 134      33.493  20.945  18.063  1.00  0.87           C  
ATOM   1092  O   ASN A 134      34.276  21.872  17.837  1.00  0.87           O  
ATOM   1093  CB  ASN A 134      32.767  19.486  16.184  1.00  0.87           C  
ATOM   1094  CG  ASN A 134      33.448  18.595  15.161  1.00  0.87           C  
ATOM   1095  OD1 ASN A 134      34.419  19.030  14.536  1.00  0.87           O  
ATOM   1096  ND2 ASN A 134      32.960  17.358  14.990  1.00  0.87           N  
ATOM   1097  N   GLY A 135      32.423  21.095  18.859  1.00  0.94           N  
ATOM   1098  CA  GLY A 135      32.062  22.400  19.374  1.00  0.94           C  
ATOM   1099  C   GLY A 135      30.913  22.359  20.337  1.00  0.94           C  
ATOM   1100  O   GLY A 135      30.917  21.638  21.333  1.00  0.94           O  
ATOM   1101  N   GLY A 136      29.886  23.194  20.074  1.00  0.94           N  
ATOM   1102  CA  GLY A 136      28.695  23.351  20.911  1.00  0.94           C  
ATOM   1103  C   GLY A 136      27.972  22.081  21.262  1.00  0.94           C  
ATOM   1104  O   GLY A 136      27.694  21.829  22.430  1.00  0.94           O  
ATOM   1105  N   LEU A 137      27.677  21.251  20.245  1.00  0.93           N  
ATOM   1106  CA  LEU A 137      26.944  20.004  20.342  1.00  0.93           C  
ATOM   1107  C   LEU A 137      27.619  18.992  21.257  1.00  0.93           C  
ATOM   1108  O   LEU A 137      27.001  18.423  22.157  1.00  0.93           O  
ATOM   1109  CB  LEU A 137      26.816  19.477  18.888  1.00  0.93           C  
ATOM   1110  CG  LEU A 137      26.131  18.115  18.654  1.00  0.93           C  
ATOM   1111  CD1 LEU A 137      25.531  18.095  17.241  1.00  0.93           C  
ATOM   1112  CD2 LEU A 137      27.113  16.936  18.774  1.00  0.93           C  
ATOM   1113  N   GLY A 138      28.945  18.785  21.096  1.00  0.96           N  
ATOM   1114  CA  GLY A 138      29.698  17.887  21.960  1.00  0.96           C  
ATOM   1115  C   GLY A 138      29.923  18.405  23.348  1.00  0.96           C  
ATOM   1116  O   GLY A 138      29.995  17.643  24.311  1.00  0.96           O  
ATOM   1117  N   ARG A 139      30.068  19.733  23.510  1.00  0.91           N  
ATOM   1118  CA  ARG A 139      30.223  20.328  24.820  1.00  0.91           C  
ATOM   1119  C   ARG A 139      28.939  20.338  25.614  1.00  0.91           C  
ATOM   1120  O   ARG A 139      28.951  20.199  26.837  1.00  0.91           O  
ATOM   1121  CB  ARG A 139      30.840  21.744  24.731  1.00  0.91           C  
ATOM   1122  CG  ARG A 139      31.178  22.374  26.100  1.00  0.91           C  
ATOM   1123  CD  ARG A 139      32.148  21.517  26.932  1.00  0.91           C  
ATOM   1124  NE  ARG A 139      31.484  21.168  28.218  1.00  0.91           N  
ATOM   1125  CZ  ARG A 139      32.071  20.451  29.195  1.00  0.91           C  
ATOM   1126  NH1 ARG A 139      33.275  19.955  29.026  1.00  0.91           N  
ATOM   1127  NH2 ARG A 139      31.383  20.212  30.310  1.00  0.91           N  
ATOM   1128  N   LEU A 140      27.791  20.462  24.927  1.00  0.96           N  
ATOM   1129  CA  LEU A 140      26.481  20.339  25.524  1.00  0.96           C  
ATOM   1130  C   LEU A 140      26.275  18.976  26.154  1.00  0.96           C  
ATOM   1131  O   LEU A 140      25.866  18.871  27.308  1.00  0.96           O  
ATOM   1132  CB  LEU A 140      25.396  20.585  24.454  1.00  0.96           C  
ATOM   1133  CG  LEU A 140      23.968  20.701  25.006  1.00  0.96           C  
ATOM   1134  CD1 LEU A 140      23.818  21.984  25.837  1.00  0.96           C  
ATOM   1135  CD2 LEU A 140      22.956  20.675  23.850  1.00  0.96           C  
ATOM   1136  N   ALA A 141      26.674  17.903  25.441  1.00  0.99           N  
ATOM   1137  CA  ALA A 141      26.626  16.547  25.934  1.00  0.99           C  
ATOM   1138  C   ALA A 141      27.454  16.351  27.199  1.00  0.99           C  
ATOM   1139  O   ALA A 141      27.002  15.771  28.182  1.00  0.99           O  
ATOM   1140  CB  ALA A 141      27.119  15.617  24.809  1.00  0.99           C  
ATOM   1141  N   ALA A 142      28.674  16.915  27.231  1.00  0.99           N  
ATOM   1142  CA  ALA A 142      29.517  16.949  28.402  1.00  0.99           C  
ATOM   1143  C   ALA A 142      28.962  17.748  29.581  1.00  0.99           C  
ATOM   1144  O   ALA A 142      29.103  17.350  30.736  1.00  0.99           O  
ATOM   1145  CB  ALA A 142      30.889  17.493  27.984  1.00  0.99           C  
ATOM   1146  N   CYS A 143      28.318  18.914  29.349  1.00  0.98           N  
ATOM   1147  CA  CYS A 143      27.610  19.633  30.401  1.00  0.98           C  
ATOM   1148  C   CYS A 143      26.446  18.829  30.956  1.00  0.98           C  
ATOM   1149  O   CYS A 143      26.249  18.724  32.151  1.00  0.98           O  
ATOM   1150  CB  CYS A 143      27.103  21.015  29.921  1.00  0.98           C  
ATOM   1151  SG  CYS A 143      28.482  22.165  29.576  1.00  0.98           S  
ATOM   1152  N   PHE A 144      25.687  18.186  30.043  1.00  0.98           N  
ATOM   1153  CA  PHE A 144      24.542  17.367  30.364  1.00  0.98           C  
ATOM   1154  C   PHE A 144      24.890  16.177  31.243  1.00  0.98           C  
ATOM   1155  O   PHE A 144      24.157  15.875  32.173  1.00  0.98           O  
ATOM   1156  CB  PHE A 144      23.810  16.904  29.069  1.00  0.98           C  
ATOM   1157  CG  PHE A 144      22.924  17.951  28.414  1.00  0.98           C  
ATOM   1158  CD1 PHE A 144      22.863  19.306  28.797  1.00  0.98           C  
ATOM   1159  CD2 PHE A 144      22.077  17.523  27.378  1.00  0.98           C  
ATOM   1160  CE1 PHE A 144      21.977  20.192  28.169  1.00  0.98           C  
ATOM   1161  CE2 PHE A 144      21.190  18.403  26.745  1.00  0.98           C  
ATOM   1162  CZ  PHE A 144      21.140  19.742  27.143  1.00  0.98           C  
ATOM   1163  N   LEU A 145      26.033  15.489  31.016  1.00  0.98           N  
ATOM   1164  CA  LEU A 145      26.447  14.392  31.880  1.00  0.98           C  
ATOM   1165  C   LEU A 145      26.692  14.820  33.336  1.00  0.98           C  
ATOM   1166  O   LEU A 145      26.228  14.152  34.262  1.00  0.98           O  
ATOM   1167  CB  LEU A 145      27.699  13.629  31.355  1.00  0.98           C  
ATOM   1168  CG  LEU A 145      27.643  13.011  29.939  1.00  0.98           C  
ATOM   1169  CD1 LEU A 145      28.864  12.102  29.725  1.00  0.98           C  
ATOM   1170  CD2 LEU A 145      26.363  12.207  29.672  1.00  0.98           C  
ATOM   1171  N   ASP A 146      27.370  15.973  33.563  1.00  0.98           N  
ATOM   1172  CA  ASP A 146      27.601  16.585  34.870  1.00  0.98           C  
ATOM   1173  C   ASP A 146      26.280  16.923  35.569  1.00  0.98           C  
ATOM   1174  O   ASP A 146      26.034  16.554  36.719  1.00  0.98           O  
ATOM   1175  CB  ASP A 146      28.483  17.855  34.605  1.00  0.98           C  
ATOM   1176  CG  ASP A 146      28.810  18.767  35.781  1.00  0.98           C  
ATOM   1177  OD1 ASP A 146      27.856  19.310  36.398  1.00  0.98           O  
ATOM   1178  OD2 ASP A 146      30.008  19.087  36.000  1.00  0.98           O  
ATOM   1179  N   SER A 147      25.358  17.582  34.843  1.00  0.99           N  
ATOM   1180  CA  SER A 147      24.026  17.916  35.335  1.00  0.99           C  
ATOM   1181  C   SER A 147      23.144  16.734  35.652  1.00  0.99           C  
ATOM   1182  O   SER A 147      22.476  16.714  36.681  1.00  0.99           O  
ATOM   1183  CB  SER A 147      23.234  18.774  34.353  1.00  0.99           C  
ATOM   1184  OG  SER A 147      23.784  20.095  34.354  1.00  0.99           O  
ATOM   1185  N   MET A 148      23.097  15.695  34.794  1.00  0.97           N  
ATOM   1186  CA  MET A 148      22.306  14.505  35.055  1.00  0.97           C  
ATOM   1187  C   MET A 148      22.772  13.744  36.285  1.00  0.97           C  
ATOM   1188  O   MET A 148      21.952  13.313  37.093  1.00  0.97           O  
ATOM   1189  CB  MET A 148      22.242  13.559  33.830  1.00  0.97           C  
ATOM   1190  CG  MET A 148      21.466  14.143  32.630  1.00  0.97           C  
ATOM   1191  SD  MET A 148      21.209  13.014  31.226  1.00  0.97           S  
ATOM   1192  CE  MET A 148      22.939  12.853  30.706  1.00  0.97           C  
ATOM   1193  N   ALA A 149      24.099  13.615  36.486  1.00  0.99           N  
ATOM   1194  CA  ALA A 149      24.659  13.055  37.696  1.00  0.99           C  
ATOM   1195  C   ALA A 149      24.392  13.899  38.941  1.00  0.99           C  
ATOM   1196  O   ALA A 149      24.033  13.383  39.995  1.00  0.99           O  
ATOM   1197  CB  ALA A 149      26.162  12.806  37.475  1.00  0.99           C  
ATOM   1198  N   THR A 150      24.514  15.240  38.836  1.00  0.96           N  
ATOM   1199  CA  THR A 150      24.181  16.214  39.879  1.00  0.96           C  
ATOM   1200  C   THR A 150      22.723  16.177  40.289  1.00  0.96           C  
ATOM   1201  O   THR A 150      22.370  16.376  41.453  1.00  0.96           O  
ATOM   1202  CB  THR A 150      24.549  17.631  39.449  1.00  0.96           C  
ATOM   1203  OG1 THR A 150      25.958  17.803  39.490  1.00  0.96           O  
ATOM   1204  CG2 THR A 150      23.972  18.714  40.367  1.00  0.96           C  
ATOM   1205  N   LEU A 151      21.823  15.917  39.334  1.00  0.95           N  
ATOM   1206  CA  LEU A 151      20.409  15.790  39.594  1.00  0.95           C  
ATOM   1207  C   LEU A 151      19.991  14.350  39.822  1.00  0.95           C  
ATOM   1208  O   LEU A 151      18.803  14.030  39.768  1.00  0.95           O  
ATOM   1209  CB  LEU A 151      19.583  16.393  38.438  1.00  0.95           C  
ATOM   1210  CG  LEU A 151      19.781  17.909  38.238  1.00  0.95           C  
ATOM   1211  CD1 LEU A 151      18.809  18.420  37.169  1.00  0.95           C  
ATOM   1212  CD2 LEU A 151      19.590  18.715  39.534  1.00  0.95           C  
ATOM   1213  N   GLY A 152      20.945  13.439  40.110  1.00  0.96           N  
ATOM   1214  CA  GLY A 152      20.640  12.105  40.612  1.00  0.96           C  
ATOM   1215  C   GLY A 152      19.924  11.192  39.661  1.00  0.96           C  
ATOM   1216  O   GLY A 152      19.273  10.235  40.072  1.00  0.96           O  
ATOM   1217  N   LEU A 153      20.019  11.464  38.351  1.00  0.95           N  
ATOM   1218  CA  LEU A 153      19.366  10.664  37.347  1.00  0.95           C  
ATOM   1219  C   LEU A 153      20.189   9.422  37.044  1.00  0.95           C  
ATOM   1220  O   LEU A 153      21.420   9.428  37.069  1.00  0.95           O  
ATOM   1221  CB  LEU A 153      19.140  11.468  36.041  1.00  0.95           C  
ATOM   1222  CG  LEU A 153      18.332  12.779  36.192  1.00  0.95           C  
ATOM   1223  CD1 LEU A 153      18.110  13.416  34.812  1.00  0.95           C  
ATOM   1224  CD2 LEU A 153      16.975  12.569  36.881  1.00  0.95           C  
ATOM   1225  N   ALA A 154      19.519   8.297  36.713  1.00  0.97           N  
ATOM   1226  CA  ALA A 154      20.176   7.093  36.255  1.00  0.97           C  
ATOM   1227  C   ALA A 154      20.553   7.220  34.791  1.00  0.97           C  
ATOM   1228  O   ALA A 154      20.041   6.533  33.909  1.00  0.97           O  
ATOM   1229  CB  ALA A 154      19.292   5.858  36.504  1.00  0.97           C  
ATOM   1230  N   ALA A 155      21.462   8.166  34.515  1.00  0.98           N  
ATOM   1231  CA  ALA A 155      21.820   8.550  33.186  1.00  0.98           C  
ATOM   1232  C   ALA A 155      23.137   7.964  32.725  1.00  0.98           C  
ATOM   1233  O   ALA A 155      24.017   7.575  33.494  1.00  0.98           O  
ATOM   1234  CB  ALA A 155      21.864  10.077  33.084  1.00  0.98           C  
ATOM   1235  N   TYR A 156      23.269   7.883  31.396  1.00  0.96           N  
ATOM   1236  CA  TYR A 156      24.393   7.284  30.733  1.00  0.96           C  
ATOM   1237  C   TYR A 156      24.682   8.084  29.474  1.00  0.96           C  
ATOM   1238  O   TYR A 156      23.771   8.497  28.758  1.00  0.96           O  
ATOM   1239  CB  TYR A 156      24.072   5.840  30.252  1.00  0.96           C  
ATOM   1240  CG  TYR A 156      23.782   4.832  31.345  1.00  0.96           C  
ATOM   1241  CD1 TYR A 156      22.536   4.797  31.997  1.00  0.96           C  
ATOM   1242  CD2 TYR A 156      24.727   3.842  31.669  1.00  0.96           C  
ATOM   1243  CE1 TYR A 156      22.276   3.858  33.009  1.00  0.96           C  
ATOM   1244  CE2 TYR A 156      24.472   2.907  32.684  1.00  0.96           C  
ATOM   1245  CZ  TYR A 156      23.257   2.923  33.373  1.00  0.96           C  
ATOM   1246  OH  TYR A 156      23.064   2.012  34.447  1.00  0.96           O  
ATOM   1247  N   GLY A 157      25.972   8.302  29.148  1.00  0.99           N  
ATOM   1248  CA  GLY A 157      26.354   8.860  27.852  1.00  0.99           C  
ATOM   1249  C   GLY A 157      26.942   7.786  26.996  1.00  0.99           C  
ATOM   1250  O   GLY A 157      27.843   7.084  27.435  1.00  0.99           O  
ATOM   1251  N   TYR A 158      26.460   7.626  25.754  1.00  0.97           N  
ATOM   1252  CA  TYR A 158      26.947   6.600  24.852  1.00  0.97           C  
ATOM   1253  C   TYR A 158      27.439   7.215  23.554  1.00  0.97           C  
ATOM   1254  O   TYR A 158      26.721   7.947  22.871  1.00  0.97           O  
ATOM   1255  CB  TYR A 158      25.858   5.553  24.517  1.00  0.97           C  
ATOM   1256  CG  TYR A 158      25.766   4.456  25.542  1.00  0.97           C  
ATOM   1257  CD1 TYR A 158      25.152   4.659  26.784  1.00  0.97           C  
ATOM   1258  CD2 TYR A 158      26.231   3.170  25.231  1.00  0.97           C  
ATOM   1259  CE1 TYR A 158      24.994   3.591  27.677  1.00  0.97           C  
ATOM   1260  CE2 TYR A 158      26.031   2.092  26.102  1.00  0.97           C  
ATOM   1261  CZ  TYR A 158      25.428   2.318  27.341  1.00  0.97           C  
ATOM   1262  OH  TYR A 158      25.248   1.292  28.278  1.00  0.97           O  
ATOM   1263  N   GLY A 159      28.709   6.928  23.198  1.00  0.99           N  
ATOM   1264  CA  GLY A 159      29.360   7.506  22.033  1.00  0.99           C  
ATOM   1265  C   GLY A 159      30.483   6.650  21.515  1.00  0.99           C  
ATOM   1266  O   GLY A 159      30.590   5.461  21.805  1.00  0.99           O  
ATOM   1267  N   ILE A 160      31.388   7.257  20.730  1.00  0.97           N  
ATOM   1268  CA  ILE A 160      32.535   6.573  20.156  1.00  0.97           C  
ATOM   1269  C   ILE A 160      33.790   7.036  20.853  1.00  0.97           C  
ATOM   1270  O   ILE A 160      34.021   8.221  21.078  1.00  0.97           O  
ATOM   1271  CB  ILE A 160      32.692   6.809  18.656  1.00  0.97           C  
ATOM   1272  CG1 ILE A 160      31.459   6.248  17.927  1.00  0.97           C  
ATOM   1273  CG2 ILE A 160      33.982   6.143  18.113  1.00  0.97           C  
ATOM   1274  CD1 ILE A 160      31.503   6.469  16.420  1.00  0.97           C  
ATOM   1275  N   ARG A 161      34.661   6.074  21.211  1.00  0.91           N  
ATOM   1276  CA  ARG A 161      35.972   6.370  21.730  1.00  0.91           C  
ATOM   1277  C   ARG A 161      36.916   6.576  20.575  1.00  0.91           C  
ATOM   1278  O   ARG A 161      37.607   5.660  20.138  1.00  0.91           O  
ATOM   1279  CB  ARG A 161      36.502   5.216  22.605  1.00  0.91           C  
ATOM   1280  CG  ARG A 161      37.882   5.503  23.230  1.00  0.91           C  
ATOM   1281  CD  ARG A 161      38.303   4.373  24.163  1.00  0.91           C  
ATOM   1282  NE  ARG A 161      39.674   4.622  24.686  1.00  0.91           N  
ATOM   1283  CZ  ARG A 161      40.791   4.171  24.101  1.00  0.91           C  
ATOM   1284  NH1 ARG A 161      40.815   3.840  22.812  1.00  0.91           N  
ATOM   1285  NH2 ARG A 161      41.898   4.068  24.827  1.00  0.91           N  
ATOM   1286  N   TYR A 162      36.943   7.808  20.031  1.00  0.92           N  
ATOM   1287  CA  TYR A 162      37.868   8.141  18.975  1.00  0.92           C  
ATOM   1288  C   TYR A 162      39.292   8.073  19.480  1.00  0.92           C  
ATOM   1289  O   TYR A 162      39.616   8.594  20.543  1.00  0.92           O  
ATOM   1290  CB  TYR A 162      37.636   9.534  18.341  1.00  0.92           C  
ATOM   1291  CG  TYR A 162      36.217   9.723  17.893  1.00  0.92           C  
ATOM   1292  CD1 TYR A 162      35.735   9.102  16.728  1.00  0.92           C  
ATOM   1293  CD2 TYR A 162      35.359  10.566  18.617  1.00  0.92           C  
ATOM   1294  CE1 TYR A 162      34.425   9.338  16.287  1.00  0.92           C  
ATOM   1295  CE2 TYR A 162      34.048  10.794  18.181  1.00  0.92           C  
ATOM   1296  CZ  TYR A 162      33.589  10.191  17.006  1.00  0.92           C  
ATOM   1297  OH  TYR A 162      32.298  10.473  16.521  1.00  0.92           O  
ATOM   1298  N   GLU A 163      40.183   7.410  18.731  1.00  0.87           N  
ATOM   1299  CA  GLU A 163      41.595   7.376  19.037  1.00  0.87           C  
ATOM   1300  C   GLU A 163      42.225   8.747  18.861  1.00  0.87           C  
ATOM   1301  O   GLU A 163      43.057   9.183  19.647  1.00  0.87           O  
ATOM   1302  CB  GLU A 163      42.266   6.283  18.184  1.00  0.87           C  
ATOM   1303  CG  GLU A 163      43.745   6.009  18.536  1.00  0.87           C  
ATOM   1304  CD  GLU A 163      44.261   4.705  17.938  1.00  0.87           C  
ATOM   1305  OE1 GLU A 163      45.491   4.480  17.991  1.00  0.87           O  
ATOM   1306  OE2 GLU A 163      43.444   3.908  17.396  1.00  0.87           O  
ATOM   1307  N   PHE A 164      41.749   9.477  17.836  1.00  0.89           N  
ATOM   1308  CA  PHE A 164      42.114  10.846  17.565  1.00  0.89           C  
ATOM   1309  C   PHE A 164      40.879  11.735  17.619  1.00  0.89           C  
ATOM   1310  O   PHE A 164      39.901  11.522  16.896  1.00  0.89           O  
ATOM   1311  CB  PHE A 164      42.787  10.971  16.173  1.00  0.89           C  
ATOM   1312  CG  PHE A 164      43.987  10.063  16.117  1.00  0.89           C  
ATOM   1313  CD1 PHE A 164      45.195  10.449  16.709  1.00  0.89           C  
ATOM   1314  CD2 PHE A 164      43.895   8.773  15.567  1.00  0.89           C  
ATOM   1315  CE1 PHE A 164      46.265   9.552  16.812  1.00  0.89           C  
ATOM   1316  CE2 PHE A 164      44.974   7.888  15.620  1.00  0.89           C  
ATOM   1317  CZ  PHE A 164      46.149   8.266  16.274  1.00  0.89           C  
ATOM   1318  N   GLY A 165      40.878  12.756  18.503  1.00  0.93           N  
ATOM   1319  CA  GLY A 165      39.753  13.668  18.676  1.00  0.93           C  
ATOM   1320  C   GLY A 165      39.699  14.759  17.637  1.00  0.93           C  
ATOM   1321  O   GLY A 165      40.068  14.584  16.477  1.00  0.93           O  
ATOM   1322  N   ILE A 166      39.207  15.955  18.014  1.00  0.87           N  
ATOM   1323  CA  ILE A 166      39.364  17.131  17.168  1.00  0.87           C  
ATOM   1324  C   ILE A 166      40.832  17.504  17.035  1.00  0.87           C  
ATOM   1325  O   ILE A 166      41.559  17.561  18.020  1.00  0.87           O  
ATOM   1326  CB  ILE A 166      38.544  18.337  17.642  1.00  0.87           C  
ATOM   1327  CG1 ILE A 166      38.546  19.507  16.628  1.00  0.87           C  
ATOM   1328  CG2 ILE A 166      39.038  18.832  19.021  1.00  0.87           C  
ATOM   1329  CD1 ILE A 166      37.845  19.179  15.306  1.00  0.87           C  
ATOM   1330  N   PHE A 167      41.333  17.785  15.814  1.00  0.89           N  
ATOM   1331  CA  PHE A 167      42.743  18.054  15.594  1.00  0.89           C  
ATOM   1332  C   PHE A 167      43.320  19.176  16.458  1.00  0.89           C  
ATOM   1333  O   PHE A 167      42.667  20.174  16.756  1.00  0.89           O  
ATOM   1334  CB  PHE A 167      43.038  18.307  14.086  1.00  0.89           C  
ATOM   1335  CG  PHE A 167      42.375  19.568  13.586  1.00  0.89           C  
ATOM   1336  CD1 PHE A 167      43.011  20.814  13.738  1.00  0.89           C  
ATOM   1337  CD2 PHE A 167      41.102  19.525  12.998  1.00  0.89           C  
ATOM   1338  CE1 PHE A 167      42.374  21.995  13.348  1.00  0.89           C  
ATOM   1339  CE2 PHE A 167      40.462  20.706  12.604  1.00  0.89           C  
ATOM   1340  CZ  PHE A 167      41.093  21.939  12.795  1.00  0.89           C  
ATOM   1341  N   ASN A 168      44.590  19.046  16.879  1.00  0.88           N  
ATOM   1342  CA  ASN A 168      45.309  20.128  17.504  1.00  0.88           C  
ATOM   1343  C   ASN A 168      45.701  21.107  16.419  1.00  0.88           C  
ATOM   1344  O   ASN A 168      46.414  20.789  15.479  1.00  0.88           O  
ATOM   1345  CB  ASN A 168      46.548  19.638  18.292  1.00  0.88           C  
ATOM   1346  CG  ASN A 168      46.052  19.149  19.652  1.00  0.88           C  
ATOM   1347  OD1 ASN A 168      45.533  19.957  20.416  1.00  0.88           O  
ATOM   1348  ND2 ASN A 168      46.214  17.839  19.942  1.00  0.88           N  
ATOM   1349  N   GLN A 169      45.182  22.336  16.505  1.00  0.88           N  
ATOM   1350  CA  GLN A 169      45.455  23.362  15.530  1.00  0.88           C  
ATOM   1351  C   GLN A 169      46.785  24.002  15.821  1.00  0.88           C  
ATOM   1352  O   GLN A 169      47.056  24.390  16.949  1.00  0.88           O  
ATOM   1353  CB  GLN A 169      44.344  24.427  15.583  1.00  0.88           C  
ATOM   1354  CG  GLN A 169      44.524  25.651  14.658  1.00  0.88           C  
ATOM   1355  CD  GLN A 169      43.452  26.686  14.993  1.00  0.88           C  
ATOM   1356  OE1 GLN A 169      43.391  27.185  16.113  1.00  0.88           O  
ATOM   1357  NE2 GLN A 169      42.559  26.988  14.025  1.00  0.88           N  
ATOM   1358  N   LYS A 170      47.634  24.109  14.796  1.00  0.85           N  
ATOM   1359  CA  LYS A 170      48.870  24.840  14.850  1.00  0.85           C  
ATOM   1360  C   LYS A 170      48.721  25.982  13.882  1.00  0.85           C  
ATOM   1361  O   LYS A 170      47.972  25.896  12.907  1.00  0.85           O  
ATOM   1362  CB  LYS A 170      50.068  23.969  14.401  1.00  0.85           C  
ATOM   1363  CG  LYS A 170      50.362  22.783  15.329  1.00  0.85           C  
ATOM   1364  CD  LYS A 170      50.770  23.224  16.747  1.00  0.85           C  
ATOM   1365  CE  LYS A 170      51.504  22.157  17.561  1.00  0.85           C  
ATOM   1366  NZ  LYS A 170      50.678  20.962  17.630  1.00  0.85           N  
ATOM   1367  N   ILE A 171      49.422  27.095  14.130  1.00  0.89           N  
ATOM   1368  CA  ILE A 171      49.421  28.211  13.209  1.00  0.89           C  
ATOM   1369  C   ILE A 171      50.820  28.403  12.653  1.00  0.89           C  
ATOM   1370  O   ILE A 171      51.797  28.615  13.368  1.00  0.89           O  
ATOM   1371  CB  ILE A 171      48.899  29.489  13.862  1.00  0.89           C  
ATOM   1372  CG1 ILE A 171      47.408  29.363  14.276  1.00  0.89           C  
ATOM   1373  CG2 ILE A 171      49.092  30.703  12.928  1.00  0.89           C  
ATOM   1374  CD1 ILE A 171      46.415  29.272  13.109  1.00  0.89           C  
ATOM   1375  N   SER A 172      50.970  28.344  11.314  1.00  0.90           N  
ATOM   1376  CA  SER A 172      52.250  28.631  10.681  1.00  0.90           C  
ATOM   1377  C   SER A 172      52.029  29.503   9.472  1.00  0.90           C  
ATOM   1378  O   SER A 172      51.129  29.290   8.662  1.00  0.90           O  
ATOM   1379  CB  SER A 172      53.122  27.385  10.333  1.00  0.90           C  
ATOM   1380  OG  SER A 172      52.717  26.720   9.136  1.00  0.90           O  
ATOM   1381  N   GLY A 173      52.788  30.617   9.364  1.00  0.93           N  
ATOM   1382  CA  GLY A 173      52.608  31.565   8.263  1.00  0.93           C  
ATOM   1383  C   GLY A 173      51.291  32.298   8.322  1.00  0.93           C  
ATOM   1384  O   GLY A 173      50.842  32.877   7.340  1.00  0.93           O  
ATOM   1385  N   GLY A 174      50.626  32.240   9.491  1.00  0.93           N  
ATOM   1386  CA  GLY A 174      49.282  32.730   9.718  1.00  0.93           C  
ATOM   1387  C   GLY A 174      48.169  31.779   9.345  1.00  0.93           C  
ATOM   1388  O   GLY A 174      47.003  32.109   9.530  1.00  0.93           O  
ATOM   1389  N   TRP A 175      48.482  30.577   8.825  1.00  0.88           N  
ATOM   1390  CA  TRP A 175      47.497  29.612   8.368  1.00  0.88           C  
ATOM   1391  C   TRP A 175      47.197  28.537   9.398  1.00  0.88           C  
ATOM   1392  O   TRP A 175      48.075  28.111  10.139  1.00  0.88           O  
ATOM   1393  CB  TRP A 175      48.011  28.859   7.113  1.00  0.88           C  
ATOM   1394  CG  TRP A 175      48.285  29.731   5.927  1.00  0.88           C  
ATOM   1395  CD1 TRP A 175      49.449  30.321   5.521  1.00  0.88           C  
ATOM   1396  CD2 TRP A 175      47.312  30.125   4.921  1.00  0.88           C  
ATOM   1397  NE1 TRP A 175      49.292  31.051   4.341  1.00  0.88           N  
ATOM   1398  CE2 TRP A 175      47.940  30.885   3.999  1.00  0.88           C  
ATOM   1399  CE3 TRP A 175      45.943  29.800   4.836  1.00  0.88           C  
ATOM   1400  CZ2 TRP A 175      47.278  31.420   2.876  1.00  0.88           C  
ATOM   1401  CZ3 TRP A 175      45.251  30.337   3.734  1.00  0.88           C  
ATOM   1402  CH2 TRP A 175      45.896  31.124   2.780  1.00  0.88           C  
ATOM   1403  N   GLN A 176      45.936  28.029   9.439  1.00  0.87           N  
ATOM   1404  CA  GLN A 176      45.629  26.798  10.159  1.00  0.87           C  
ATOM   1405  C   GLN A 176      46.359  25.617   9.562  1.00  0.87           C  
ATOM   1406  O   GLN A 176      46.155  25.265   8.403  1.00  0.87           O  
ATOM   1407  CB  GLN A 176      44.114  26.433  10.210  1.00  0.87           C  
ATOM   1408  CG  GLN A 176      43.822  24.966  10.650  1.00  0.87           C  
ATOM   1409  CD  GLN A 176      42.330  24.722  10.851  1.00  0.87           C  
ATOM   1410  OE1 GLN A 176      41.675  25.427  11.616  1.00  0.87           O  
ATOM   1411  NE2 GLN A 176      41.782  23.687  10.168  1.00  0.87           N  
ATOM   1412  N   MET A 177      47.185  24.967  10.396  1.00  0.82           N  
ATOM   1413  CA  MET A 177      47.810  23.713  10.085  1.00  0.82           C  
ATOM   1414  C   MET A 177      47.231  22.732  11.076  1.00  0.82           C  
ATOM   1415  O   MET A 177      47.434  22.836  12.282  1.00  0.82           O  
ATOM   1416  CB  MET A 177      49.348  23.779  10.276  1.00  0.82           C  
ATOM   1417  CG  MET A 177      50.027  24.901   9.475  1.00  0.82           C  
ATOM   1418  SD  MET A 177      49.949  24.688   7.673  1.00  0.82           S  
ATOM   1419  CE  MET A 177      51.487  23.729   7.578  1.00  0.82           C  
ATOM   1420  N   GLU A 178      46.429  21.767  10.614  1.00  0.80           N  
ATOM   1421  CA  GLU A 178      45.930  20.721  11.480  1.00  0.80           C  
ATOM   1422  C   GLU A 178      47.020  19.731  11.931  1.00  0.80           C  
ATOM   1423  O   GLU A 178      47.932  19.386  11.188  1.00  0.80           O  
ATOM   1424  CB  GLU A 178      44.671  20.028  10.880  1.00  0.80           C  
ATOM   1425  CG  GLU A 178      44.616  19.889   9.339  1.00  0.80           C  
ATOM   1426  CD  GLU A 178      44.222  21.179   8.646  1.00  0.80           C  
ATOM   1427  OE1 GLU A 178      43.065  21.660   8.780  1.00  0.80           O  
ATOM   1428  OE2 GLU A 178      45.070  21.751   7.919  1.00  0.80           O  
ATOM   1429  N   GLU A 179      46.933  19.204  13.178  1.00  0.80           N  
ATOM   1430  CA  GLU A 179      47.842  18.182  13.684  1.00  0.80           C  
ATOM   1431  C   GLU A 179      47.039  17.200  14.519  1.00  0.80           C  
ATOM   1432  O   GLU A 179      46.161  17.575  15.278  1.00  0.80           O  
ATOM   1433  CB  GLU A 179      48.933  18.816  14.576  1.00  0.80           C  
ATOM   1434  CG  GLU A 179      50.157  17.926  14.909  1.00  0.80           C  
ATOM   1435  CD  GLU A 179      50.974  18.629  15.948  1.00  0.80           C  
ATOM   1436  OE1 GLU A 179      51.063  18.207  17.131  1.00  0.80           O  
ATOM   1437  OE2 GLU A 179      51.430  19.744  15.581  1.00  0.80           O  
ATOM   1438  N   ALA A 180      47.260  15.881  14.371  1.00  0.85           N  
ATOM   1439  CA  ALA A 180      46.426  14.866  14.994  1.00  0.85           C  
ATOM   1440  C   ALA A 180      46.407  14.896  16.516  1.00  0.85           C  
ATOM   1441  O   ALA A 180      47.426  15.085  17.172  1.00  0.85           O  
ATOM   1442  CB  ALA A 180      46.805  13.443  14.527  1.00  0.85           C  
ATOM   1443  N   ASP A 181      45.217  14.702  17.109  1.00  0.87           N  
ATOM   1444  CA  ASP A 181      45.032  14.752  18.534  1.00  0.87           C  
ATOM   1445  C   ASP A 181      45.253  13.384  19.165  1.00  0.87           C  
ATOM   1446  O   ASP A 181      44.339  12.623  19.402  1.00  0.87           O  
ATOM   1447  CB  ASP A 181      43.620  15.319  18.773  1.00  0.87           C  
ATOM   1448  CG  ASP A 181      43.289  15.440  20.245  1.00  0.87           C  
ATOM   1449  OD1 ASP A 181      44.083  16.113  20.949  1.00  0.87           O  
ATOM   1450  OD2 ASP A 181      42.265  14.842  20.660  1.00  0.87           O  
ATOM   1451  N   ASP A 182      46.535  13.048  19.431  1.00  0.84           N  
ATOM   1452  CA  ASP A 182      46.954  11.812  20.056  1.00  0.84           C  
ATOM   1453  C   ASP A 182      46.793  11.898  21.573  1.00  0.84           C  
ATOM   1454  O   ASP A 182      47.743  11.807  22.349  1.00  0.84           O  
ATOM   1455  CB  ASP A 182      48.406  11.555  19.583  1.00  0.84           C  
ATOM   1456  CG  ASP A 182      48.951  10.191  19.957  1.00  0.84           C  
ATOM   1457  OD1 ASP A 182      48.158   9.237  20.121  1.00  0.84           O  
ATOM   1458  OD2 ASP A 182      50.205  10.107  20.038  1.00  0.84           O  
ATOM   1459  N   TRP A 183      45.535  12.069  22.020  1.00  0.86           N  
ATOM   1460  CA  TRP A 183      45.167  12.356  23.393  1.00  0.86           C  
ATOM   1461  C   TRP A 183      45.350  11.150  24.303  1.00  0.86           C  
ATOM   1462  O   TRP A 183      45.376  11.239  25.528  1.00  0.86           O  
ATOM   1463  CB  TRP A 183      43.688  12.848  23.449  1.00  0.86           C  
ATOM   1464  CG  TRP A 183      42.617  11.820  23.112  1.00  0.86           C  
ATOM   1465  CD1 TRP A 183      42.270  11.305  21.896  1.00  0.86           C  
ATOM   1466  CD2 TRP A 183      41.761  11.155  24.066  1.00  0.86           C  
ATOM   1467  NE1 TRP A 183      41.292  10.338  22.026  1.00  0.86           N  
ATOM   1468  CE2 TRP A 183      40.976  10.248  23.364  1.00  0.86           C  
ATOM   1469  CE3 TRP A 183      41.641  11.299  25.450  1.00  0.86           C  
ATOM   1470  CZ2 TRP A 183      40.049   9.424  23.999  1.00  0.86           C  
ATOM   1471  CZ3 TRP A 183      40.698  10.489  26.101  1.00  0.86           C  
ATOM   1472  CH2 TRP A 183      39.919   9.563  25.393  1.00  0.86           C  
ATOM   1473  N   LEU A 184      45.504   9.964  23.690  1.00  0.87           N  
ATOM   1474  CA  LEU A 184      45.704   8.717  24.380  1.00  0.87           C  
ATOM   1475  C   LEU A 184      47.170   8.345  24.471  1.00  0.87           C  
ATOM   1476  O   LEU A 184      47.497   7.266  24.968  1.00  0.87           O  
ATOM   1477  CB  LEU A 184      44.971   7.590  23.623  1.00  0.87           C  
ATOM   1478  CG  LEU A 184      43.440   7.705  23.670  1.00  0.87           C  
ATOM   1479  CD1 LEU A 184      42.822   6.714  22.680  1.00  0.87           C  
ATOM   1480  CD2 LEU A 184      42.902   7.463  25.088  1.00  0.87           C  
ATOM   1481  N   ARG A 185      48.106   9.224  24.044  1.00  0.78           N  
ATOM   1482  CA  ARG A 185      49.522   8.904  23.954  1.00  0.78           C  
ATOM   1483  C   ARG A 185      50.142   8.436  25.255  1.00  0.78           C  
ATOM   1484  O   ARG A 185      50.889   7.463  25.298  1.00  0.78           O  
ATOM   1485  CB  ARG A 185      50.318  10.144  23.500  1.00  0.78           C  
ATOM   1486  CG  ARG A 185      51.782   9.853  23.099  1.00  0.78           C  
ATOM   1487  CD  ARG A 185      52.663  11.100  23.025  1.00  0.78           C  
ATOM   1488  NE  ARG A 185      51.969  12.057  22.120  1.00  0.78           N  
ATOM   1489  CZ  ARG A 185      52.318  13.339  21.958  1.00  0.78           C  
ATOM   1490  NH1 ARG A 185      53.447  13.816  22.482  1.00  0.78           N  
ATOM   1491  NH2 ARG A 185      51.512  14.158  21.291  1.00  0.78           N  
ATOM   1492  N   TYR A 186      49.804   9.106  26.372  1.00  0.83           N  
ATOM   1493  CA  TYR A 186      50.343   8.772  27.672  1.00  0.83           C  
ATOM   1494  C   TYR A 186      49.379   7.890  28.450  1.00  0.83           C  
ATOM   1495  O   TYR A 186      49.553   7.640  29.641  1.00  0.83           O  
ATOM   1496  CB  TYR A 186      50.670  10.051  28.476  1.00  0.83           C  
ATOM   1497  CG  TYR A 186      51.697  10.879  27.749  1.00  0.83           C  
ATOM   1498  CD1 TYR A 186      53.044  10.479  27.710  1.00  0.83           C  
ATOM   1499  CD2 TYR A 186      51.326  12.065  27.094  1.00  0.83           C  
ATOM   1500  CE1 TYR A 186      54.001  11.251  27.036  1.00  0.83           C  
ATOM   1501  CE2 TYR A 186      52.281  12.843  26.428  1.00  0.83           C  
ATOM   1502  CZ  TYR A 186      53.619  12.438  26.402  1.00  0.83           C  
ATOM   1503  OH  TYR A 186      54.571  13.231  25.732  1.00  0.83           O  
ATOM   1504  N   GLY A 187      48.343   7.371  27.763  1.00  0.86           N  
ATOM   1505  CA  GLY A 187      47.224   6.662  28.355  1.00  0.86           C  
ATOM   1506  C   GLY A 187      46.216   7.568  29.012  1.00  0.86           C  
ATOM   1507  O   GLY A 187      46.466   8.730  29.323  1.00  0.86           O  
ATOM   1508  N   ASN A 188      45.017   7.022  29.261  1.00  0.89           N  
ATOM   1509  CA  ASN A 188      43.916   7.727  29.878  1.00  0.89           C  
ATOM   1510  C   ASN A 188      43.623   6.989  31.185  1.00  0.89           C  
ATOM   1511  O   ASN A 188      43.280   5.810  31.129  1.00  0.89           O  
ATOM   1512  CB  ASN A 188      42.698   7.704  28.912  1.00  0.89           C  
ATOM   1513  CG  ASN A 188      41.433   8.349  29.472  1.00  0.89           C  
ATOM   1514  OD1 ASN A 188      41.410   8.954  30.544  1.00  0.89           O  
ATOM   1515  ND2 ASN A 188      40.315   8.190  28.726  1.00  0.89           N  
ATOM   1516  N   PRO A 189      43.745   7.583  32.373  1.00  0.91           N  
ATOM   1517  CA  PRO A 189      43.645   6.838  33.619  1.00  0.91           C  
ATOM   1518  C   PRO A 189      42.204   6.713  34.032  1.00  0.91           C  
ATOM   1519  O   PRO A 189      41.888   5.854  34.851  1.00  0.91           O  
ATOM   1520  CB  PRO A 189      44.428   7.693  34.633  1.00  0.91           C  
ATOM   1521  CG  PRO A 189      44.336   9.119  34.079  1.00  0.91           C  
ATOM   1522  CD  PRO A 189      44.346   8.900  32.568  1.00  0.91           C  
ATOM   1523  N   TRP A 190      41.339   7.600  33.511  1.00  0.89           N  
ATOM   1524  CA  TRP A 190      39.956   7.716  33.901  1.00  0.89           C  
ATOM   1525  C   TRP A 190      39.045   6.716  33.231  1.00  0.89           C  
ATOM   1526  O   TRP A 190      37.977   6.410  33.754  1.00  0.89           O  
ATOM   1527  CB  TRP A 190      39.431   9.126  33.531  1.00  0.89           C  
ATOM   1528  CG  TRP A 190      40.303  10.238  33.981  1.00  0.89           C  
ATOM   1529  CD1 TRP A 190      41.104  11.068  33.246  1.00  0.89           C  
ATOM   1530  CD2 TRP A 190      40.539  10.700  35.357  1.00  0.89           C  
ATOM   1531  NE1 TRP A 190      41.814  12.002  34.017  1.00  0.89           N  
ATOM   1532  CE2 TRP A 190      41.400  11.677  35.339  1.00  0.89           C  
ATOM   1533  CE3 TRP A 190      39.925  10.207  36.546  1.00  0.89           C  
ATOM   1534  CZ2 TRP A 190      41.863  12.358  36.504  1.00  0.89           C  
ATOM   1535  CZ3 TRP A 190      40.354  10.847  37.735  1.00  0.89           C  
ATOM   1536  CH2 TRP A 190      41.291  11.873  37.720  1.00  0.89           C  
ATOM   1537  N   GLU A 191      39.440   6.177  32.064  1.00  0.90           N  
ATOM   1538  CA  GLU A 191      38.663   5.166  31.387  1.00  0.90           C  
ATOM   1539  C   GLU A 191      39.003   3.775  31.888  1.00  0.90           C  
ATOM   1540  O   GLU A 191      40.116   3.472  32.309  1.00  0.90           O  
ATOM   1541  CB  GLU A 191      38.883   5.197  29.855  1.00  0.90           C  
ATOM   1542  CG  GLU A 191      40.318   4.808  29.416  1.00  0.90           C  
ATOM   1543  CD  GLU A 191      40.581   4.961  27.928  1.00  0.90           C  
ATOM   1544  OE1 GLU A 191      39.789   5.640  27.225  1.00  0.90           O  
ATOM   1545  OE2 GLU A 191      41.598   4.411  27.428  1.00  0.90           O  
ATOM   1546  N   LYS A 192      38.024   2.861  31.832  1.00  0.83           N  
ATOM   1547  CA  LYS A 192      38.271   1.459  32.032  1.00  0.83           C  
ATOM   1548  C   LYS A 192      37.767   0.660  30.848  1.00  0.83           C  
ATOM   1549  O   LYS A 192      36.569   0.514  30.615  1.00  0.83           O  
ATOM   1550  CB  LYS A 192      37.625   0.939  33.340  1.00  0.83           C  
ATOM   1551  CG  LYS A 192      37.940  -0.535  33.644  1.00  0.83           C  
ATOM   1552  CD  LYS A 192      39.436  -0.776  33.901  1.00  0.83           C  
ATOM   1553  CE  LYS A 192      39.800  -2.252  34.075  1.00  0.83           C  
ATOM   1554  NZ  LYS A 192      39.609  -3.016  32.821  1.00  0.83           N  
ATOM   1555  N   ALA A 193      38.708   0.070  30.083  1.00  0.89           N  
ATOM   1556  CA  ALA A 193      38.429  -0.884  29.033  1.00  0.89           C  
ATOM   1557  C   ALA A 193      37.671  -2.118  29.512  1.00  0.89           C  
ATOM   1558  O   ALA A 193      38.021  -2.705  30.541  1.00  0.89           O  
ATOM   1559  CB  ALA A 193      39.772  -1.364  28.448  1.00  0.89           C  
ATOM   1560  N   ARG A 194      36.634  -2.541  28.759  1.00  0.82           N  
ATOM   1561  CA  ARG A 194      35.892  -3.756  29.024  1.00  0.82           C  
ATOM   1562  C   ARG A 194      36.013  -4.742  27.867  1.00  0.82           C  
ATOM   1563  O   ARG A 194      35.059  -4.925  27.104  1.00  0.82           O  
ATOM   1564  CB  ARG A 194      34.392  -3.461  29.248  1.00  0.82           C  
ATOM   1565  CG  ARG A 194      34.077  -2.398  30.316  1.00  0.82           C  
ATOM   1566  CD  ARG A 194      34.678  -2.718  31.682  1.00  0.82           C  
ATOM   1567  NE  ARG A 194      34.054  -1.781  32.644  1.00  0.82           N  
ATOM   1568  CZ  ARG A 194      34.123  -1.875  33.970  1.00  0.82           C  
ATOM   1569  NH1 ARG A 194      34.896  -2.761  34.576  1.00  0.82           N  
ATOM   1570  NH2 ARG A 194      33.364  -1.067  34.698  1.00  0.82           N  
ATOM   1571  N   PRO A 195      37.141  -5.411  27.668  1.00  0.83           N  
ATOM   1572  CA  PRO A 195      37.301  -6.381  26.591  1.00  0.83           C  
ATOM   1573  C   PRO A 195      36.438  -7.624  26.743  1.00  0.83           C  
ATOM   1574  O   PRO A 195      36.378  -8.416  25.799  1.00  0.83           O  
ATOM   1575  CB  PRO A 195      38.794  -6.715  26.669  1.00  0.83           C  
ATOM   1576  CG  PRO A 195      39.146  -6.553  28.148  1.00  0.83           C  
ATOM   1577  CD  PRO A 195      38.311  -5.355  28.549  1.00  0.83           C  
ATOM   1578  N   GLU A 196      35.758  -7.837  27.882  1.00  0.80           N  
ATOM   1579  CA  GLU A 196      34.874  -8.947  28.121  1.00  0.80           C  
ATOM   1580  C   GLU A 196      33.452  -8.685  27.655  1.00  0.80           C  
ATOM   1581  O   GLU A 196      32.640  -9.600  27.574  1.00  0.80           O  
ATOM   1582  CB  GLU A 196      34.852  -9.300  29.637  1.00  0.80           C  
ATOM   1583  CG  GLU A 196      34.156  -8.286  30.598  1.00  0.80           C  
ATOM   1584  CD  GLU A 196      34.892  -6.972  30.883  1.00  0.80           C  
ATOM   1585  OE1 GLU A 196      34.343  -6.190  31.709  1.00  0.80           O  
ATOM   1586  OE2 GLU A 196      35.985  -6.698  30.334  1.00  0.80           O  
ATOM   1587  N   PHE A 197      33.117  -7.421  27.313  1.00  0.85           N  
ATOM   1588  CA  PHE A 197      31.772  -7.043  26.913  1.00  0.85           C  
ATOM   1589  C   PHE A 197      31.708  -6.572  25.470  1.00  0.85           C  
ATOM   1590  O   PHE A 197      30.912  -5.702  25.119  1.00  0.85           O  
ATOM   1591  CB  PHE A 197      31.174  -5.940  27.836  1.00  0.85           C  
ATOM   1592  CG  PHE A 197      30.949  -6.409  29.252  1.00  0.85           C  
ATOM   1593  CD1 PHE A 197      30.396  -7.671  29.542  1.00  0.85           C  
ATOM   1594  CD2 PHE A 197      31.255  -5.550  30.321  1.00  0.85           C  
ATOM   1595  CE1 PHE A 197      30.198  -8.079  30.867  1.00  0.85           C  
ATOM   1596  CE2 PHE A 197      31.047  -5.949  31.647  1.00  0.85           C  
ATOM   1597  CZ  PHE A 197      30.529  -7.221  31.920  1.00  0.85           C  
ATOM   1598  N   THR A 198      32.564  -7.109  24.581  1.00  0.85           N  
ATOM   1599  CA  THR A 198      32.497  -6.817  23.155  1.00  0.85           C  
ATOM   1600  C   THR A 198      31.215  -7.289  22.479  1.00  0.85           C  
ATOM   1601  O   THR A 198      30.706  -8.375  22.746  1.00  0.85           O  
ATOM   1602  CB  THR A 198      33.694  -7.326  22.360  1.00  0.85           C  
ATOM   1603  OG1 THR A 198      33.827  -8.738  22.441  1.00  0.85           O  
ATOM   1604  CG2 THR A 198      34.983  -6.735  22.942  1.00  0.85           C  
ATOM   1605  N   LEU A 199      30.648  -6.463  21.575  1.00  0.90           N  
ATOM   1606  CA  LEU A 199      29.387  -6.759  20.912  1.00  0.90           C  
ATOM   1607  C   LEU A 199      29.546  -6.750  19.396  1.00  0.90           C  
ATOM   1608  O   LEU A 199      30.293  -5.919  18.875  1.00  0.90           O  
ATOM   1609  CB  LEU A 199      28.298  -5.728  21.298  1.00  0.90           C  
ATOM   1610  CG  LEU A 199      27.891  -5.769  22.786  1.00  0.90           C  
ATOM   1611  CD1 LEU A 199      26.960  -4.598  23.118  1.00  0.90           C  
ATOM   1612  CD2 LEU A 199      27.209  -7.098  23.155  1.00  0.90           C  
ATOM   1613  N   PRO A 200      28.913  -7.629  18.621  1.00  0.91           N  
ATOM   1614  CA  PRO A 200      29.032  -7.617  17.171  1.00  0.91           C  
ATOM   1615  C   PRO A 200      28.210  -6.519  16.515  1.00  0.91           C  
ATOM   1616  O   PRO A 200      27.062  -6.277  16.886  1.00  0.91           O  
ATOM   1617  CB  PRO A 200      28.522  -9.012  16.767  1.00  0.91           C  
ATOM   1618  CG  PRO A 200      27.468  -9.342  17.830  1.00  0.91           C  
ATOM   1619  CD  PRO A 200      28.050  -8.713  19.099  1.00  0.91           C  
ATOM   1620  N   VAL A 201      28.783  -5.854  15.498  1.00  0.93           N  
ATOM   1621  CA  VAL A 201      28.100  -4.884  14.668  1.00  0.93           C  
ATOM   1622  C   VAL A 201      28.181  -5.375  13.236  1.00  0.93           C  
ATOM   1623  O   VAL A 201      29.251  -5.696  12.728  1.00  0.93           O  
ATOM   1624  CB  VAL A 201      28.715  -3.491  14.756  1.00  0.93           C  
ATOM   1625  CG1 VAL A 201      27.933  -2.495  13.874  1.00  0.93           C  
ATOM   1626  CG2 VAL A 201      28.695  -3.028  16.228  1.00  0.93           C  
ATOM   1627  N   HIS A 202      27.022  -5.462  12.557  1.00  0.90           N  
ATOM   1628  CA  HIS A 202      26.912  -5.987  11.207  1.00  0.90           C  
ATOM   1629  C   HIS A 202      26.882  -4.916  10.129  1.00  0.90           C  
ATOM   1630  O   HIS A 202      26.262  -3.875  10.279  1.00  0.90           O  
ATOM   1631  CB  HIS A 202      25.613  -6.804  11.050  1.00  0.90           C  
ATOM   1632  CG  HIS A 202      25.574  -7.978  11.963  1.00  0.90           C  
ATOM   1633  ND1 HIS A 202      26.341  -9.082  11.667  1.00  0.90           N  
ATOM   1634  CD2 HIS A 202      24.956  -8.136  13.160  1.00  0.90           C  
ATOM   1635  CE1 HIS A 202      26.184  -9.895  12.693  1.00  0.90           C  
ATOM   1636  NE2 HIS A 202      25.353  -9.370  13.628  1.00  0.90           N  
ATOM   1637  N   PHE A 203      27.534  -5.179   8.983  1.00  0.90           N  
ATOM   1638  CA  PHE A 203      27.549  -4.279   7.846  1.00  0.90           C  
ATOM   1639  C   PHE A 203      27.394  -5.071   6.554  1.00  0.90           C  
ATOM   1640  O   PHE A 203      27.720  -6.250   6.482  1.00  0.90           O  
ATOM   1641  CB  PHE A 203      28.895  -3.504   7.769  1.00  0.90           C  
ATOM   1642  CG  PHE A 203      29.061  -2.508   8.885  1.00  0.90           C  
ATOM   1643  CD1 PHE A 203      28.354  -1.297   8.855  1.00  0.90           C  
ATOM   1644  CD2 PHE A 203      29.963  -2.736   9.939  1.00  0.90           C  
ATOM   1645  CE1 PHE A 203      28.556  -0.324   9.839  1.00  0.90           C  
ATOM   1646  CE2 PHE A 203      30.168  -1.764  10.928  1.00  0.90           C  
ATOM   1647  CZ  PHE A 203      29.460  -0.557  10.881  1.00  0.90           C  
ATOM   1648  N   TYR A 204      26.919  -4.418   5.474  1.00  0.90           N  
ATOM   1649  CA  TYR A 204      26.706  -5.013   4.161  1.00  0.90           C  
ATOM   1650  C   TYR A 204      25.778  -6.221   4.151  1.00  0.90           C  
ATOM   1651  O   TYR A 204      24.715  -6.189   4.766  1.00  0.90           O  
ATOM   1652  CB  TYR A 204      28.040  -5.337   3.440  1.00  0.90           C  
ATOM   1653  CG  TYR A 204      29.000  -4.178   3.497  1.00  0.90           C  
ATOM   1654  CD1 TYR A 204      28.862  -3.044   2.682  1.00  0.90           C  
ATOM   1655  CD2 TYR A 204      30.090  -4.240   4.369  1.00  0.90           C  
ATOM   1656  CE1 TYR A 204      29.836  -2.022   2.703  1.00  0.90           C  
ATOM   1657  CE2 TYR A 204      31.047  -3.222   4.402  1.00  0.90           C  
ATOM   1658  CZ  TYR A 204      30.963  -2.139   3.536  1.00  0.90           C  
ATOM   1659  OH  TYR A 204      32.098  -1.308   3.467  1.00  0.90           O  
ATOM   1660  N   GLY A 205      26.125  -7.313   3.431  1.00  0.91           N  
ATOM   1661  CA  GLY A 205      25.237  -8.451   3.212  1.00  0.91           C  
ATOM   1662  C   GLY A 205      23.931  -8.116   2.550  1.00  0.91           C  
ATOM   1663  O   GLY A 205      23.811  -7.139   1.813  1.00  0.91           O  
ATOM   1664  N   HIS A 206      22.902  -8.938   2.784  1.00  0.87           N  
ATOM   1665  CA  HIS A 206      21.613  -8.721   2.170  1.00  0.87           C  
ATOM   1666  C   HIS A 206      20.517  -9.345   3.009  1.00  0.87           C  
ATOM   1667  O   HIS A 206      20.761  -9.983   4.027  1.00  0.87           O  
ATOM   1668  CB  HIS A 206      21.544  -9.230   0.707  1.00  0.87           C  
ATOM   1669  CG  HIS A 206      21.540 -10.718   0.572  1.00  0.87           C  
ATOM   1670  ND1 HIS A 206      22.692 -11.420   0.837  1.00  0.87           N  
ATOM   1671  CD2 HIS A 206      20.520 -11.565   0.289  1.00  0.87           C  
ATOM   1672  CE1 HIS A 206      22.358 -12.694   0.713  1.00  0.87           C  
ATOM   1673  NE2 HIS A 206      21.051 -12.830   0.380  1.00  0.87           N  
ATOM   1674  N   VAL A 207      19.243  -9.120   2.630  1.00  0.90           N  
ATOM   1675  CA  VAL A 207      18.120  -9.576   3.434  1.00  0.90           C  
ATOM   1676  C   VAL A 207      17.344 -10.659   2.728  1.00  0.90           C  
ATOM   1677  O   VAL A 207      16.790 -10.454   1.660  1.00  0.90           O  
ATOM   1678  CB  VAL A 207      17.135  -8.463   3.749  1.00  0.90           C  
ATOM   1679  CG1 VAL A 207      15.968  -8.979   4.624  1.00  0.90           C  
ATOM   1680  CG2 VAL A 207      17.875  -7.337   4.486  1.00  0.90           C  
ATOM   1681  N   GLU A 208      17.254 -11.826   3.390  1.00  0.84           N  
ATOM   1682  CA  GLU A 208      16.442 -12.936   2.961  1.00  0.84           C  
ATOM   1683  C   GLU A 208      15.153 -12.899   3.751  1.00  0.84           C  
ATOM   1684  O   GLU A 208      15.145 -12.916   4.982  1.00  0.84           O  
ATOM   1685  CB  GLU A 208      17.163 -14.276   3.240  1.00  0.84           C  
ATOM   1686  CG  GLU A 208      18.425 -14.490   2.371  1.00  0.84           C  
ATOM   1687  CD  GLU A 208      18.134 -14.727   0.891  1.00  0.84           C  
ATOM   1688  OE1 GLU A 208      16.948 -14.908   0.515  1.00  0.84           O  
ATOM   1689  OE2 GLU A 208      19.131 -14.730   0.123  1.00  0.84           O  
ATOM   1690  N   HIS A 209      14.005 -12.822   3.062  1.00  0.83           N  
ATOM   1691  CA  HIS A 209      12.719 -12.777   3.732  1.00  0.83           C  
ATOM   1692  C   HIS A 209      12.176 -14.182   3.855  1.00  0.83           C  
ATOM   1693  O   HIS A 209      11.885 -14.834   2.858  1.00  0.83           O  
ATOM   1694  CB  HIS A 209      11.695 -11.914   2.965  1.00  0.83           C  
ATOM   1695  CG  HIS A 209      12.055 -10.462   2.947  1.00  0.83           C  
ATOM   1696  ND1 HIS A 209      12.037  -9.740   4.127  1.00  0.83           N  
ATOM   1697  CD2 HIS A 209      12.402  -9.657   1.909  1.00  0.83           C  
ATOM   1698  CE1 HIS A 209      12.373  -8.516   3.784  1.00  0.83           C  
ATOM   1699  NE2 HIS A 209      12.604  -8.407   2.453  1.00  0.83           N  
ATOM   1700  N   THR A 210      12.030 -14.696   5.096  1.00  0.85           N  
ATOM   1701  CA  THR A 210      11.670 -16.088   5.310  1.00  0.85           C  
ATOM   1702  C   THR A 210      10.481 -16.217   6.231  1.00  0.85           C  
ATOM   1703  O   THR A 210      10.098 -15.312   6.955  1.00  0.85           O  
ATOM   1704  CB  THR A 210      12.810 -16.955   5.870  1.00  0.85           C  
ATOM   1705  OG1 THR A 210      13.040 -16.801   7.269  1.00  0.85           O  
ATOM   1706  CG2 THR A 210      14.137 -16.608   5.182  1.00  0.85           C  
ATOM   1707  N   SER A 211       9.878 -17.430   6.248  1.00  0.82           N  
ATOM   1708  CA  SER A 211       8.744 -17.778   7.095  1.00  0.82           C  
ATOM   1709  C   SER A 211       9.033 -17.789   8.584  1.00  0.82           C  
ATOM   1710  O   SER A 211       8.179 -18.117   9.401  1.00  0.82           O  
ATOM   1711  CB  SER A 211       8.175 -19.169   6.726  1.00  0.82           C  
ATOM   1712  OG  SER A 211       7.941 -19.233   5.319  1.00  0.82           O  
ATOM   1713  N   GLN A 212      10.259 -17.414   8.989  1.00  0.75           N  
ATOM   1714  CA  GLN A 212      10.644 -17.286  10.367  1.00  0.75           C  
ATOM   1715  C   GLN A 212      11.335 -15.949  10.603  1.00  0.75           C  
ATOM   1716  O   GLN A 212      12.098 -15.767  11.558  1.00  0.75           O  
ATOM   1717  CB  GLN A 212      11.462 -18.512  10.859  1.00  0.75           C  
ATOM   1718  CG  GLN A 212      12.474 -19.138   9.860  1.00  0.75           C  
ATOM   1719  CD  GLN A 212      11.882 -20.039   8.763  1.00  0.75           C  
ATOM   1720  OE1 GLN A 212      12.451 -20.171   7.688  1.00  0.75           O  
ATOM   1721  NE2 GLN A 212      10.718 -20.668   9.038  1.00  0.75           N  
ATOM   1722  N   GLY A 213      11.022 -14.952   9.748  1.00  0.87           N  
ATOM   1723  CA  GLY A 213      11.436 -13.563   9.898  1.00  0.87           C  
ATOM   1724  C   GLY A 213      12.354 -13.102   8.813  1.00  0.87           C  
ATOM   1725  O   GLY A 213      12.830 -13.879   7.992  1.00  0.87           O  
ATOM   1726  N   ALA A 214      12.659 -11.794   8.795  1.00  0.92           N  
ATOM   1727  CA  ALA A 214      13.650 -11.270   7.890  1.00  0.92           C  
ATOM   1728  C   ALA A 214      15.040 -11.596   8.411  1.00  0.92           C  
ATOM   1729  O   ALA A 214      15.356 -11.418   9.590  1.00  0.92           O  
ATOM   1730  CB  ALA A 214      13.475  -9.755   7.687  1.00  0.92           C  
ATOM   1731  N   LYS A 215      15.904 -12.145   7.546  1.00  0.86           N  
ATOM   1732  CA  LYS A 215      17.223 -12.569   7.944  1.00  0.86           C  
ATOM   1733  C   LYS A 215      18.249 -11.749   7.214  1.00  0.86           C  
ATOM   1734  O   LYS A 215      18.363 -11.787   5.994  1.00  0.86           O  
ATOM   1735  CB  LYS A 215      17.470 -14.072   7.657  1.00  0.86           C  
ATOM   1736  CG  LYS A 215      16.445 -15.023   8.302  1.00  0.86           C  
ATOM   1737  CD  LYS A 215      16.369 -14.911   9.834  1.00  0.86           C  
ATOM   1738  CE  LYS A 215      15.188 -15.695  10.406  1.00  0.86           C  
ATOM   1739  NZ  LYS A 215      15.021 -15.412  11.847  1.00  0.86           N  
ATOM   1740  N   TRP A 216      19.041 -10.970   7.971  1.00  0.83           N  
ATOM   1741  CA  TRP A 216      20.140 -10.215   7.423  1.00  0.83           C  
ATOM   1742  C   TRP A 216      21.350 -11.137   7.431  1.00  0.83           C  
ATOM   1743  O   TRP A 216      21.830 -11.534   8.488  1.00  0.83           O  
ATOM   1744  CB  TRP A 216      20.364  -8.931   8.270  1.00  0.83           C  
ATOM   1745  CG  TRP A 216      21.313  -7.887   7.724  1.00  0.83           C  
ATOM   1746  CD1 TRP A 216      21.819  -7.737   6.466  1.00  0.83           C  
ATOM   1747  CD2 TRP A 216      21.850  -6.777   8.481  1.00  0.83           C  
ATOM   1748  NE1 TRP A 216      22.629  -6.624   6.384  1.00  0.83           N  
ATOM   1749  CE2 TRP A 216      22.654  -6.040   7.634  1.00  0.83           C  
ATOM   1750  CE3 TRP A 216      21.666  -6.402   9.818  1.00  0.83           C  
ATOM   1751  CZ2 TRP A 216      23.364  -4.917   8.064  1.00  0.83           C  
ATOM   1752  CZ3 TRP A 216      22.357  -5.265  10.266  1.00  0.83           C  
ATOM   1753  CH2 TRP A 216      23.195  -4.538   9.411  1.00  0.83           C  
ATOM   1754  N   VAL A 217      21.811 -11.543   6.235  1.00  0.89           N  
ATOM   1755  CA  VAL A 217      22.810 -12.578   6.068  1.00  0.89           C  
ATOM   1756  C   VAL A 217      23.972 -12.042   5.270  1.00  0.89           C  
ATOM   1757  O   VAL A 217      23.921 -10.936   4.738  1.00  0.89           O  
ATOM   1758  CB  VAL A 217      22.274 -13.829   5.382  1.00  0.89           C  
ATOM   1759  CG1 VAL A 217      21.235 -14.520   6.284  1.00  0.89           C  
ATOM   1760  CG2 VAL A 217      21.645 -13.485   4.018  1.00  0.89           C  
ATOM   1761  N   ASP A 218      25.080 -12.814   5.237  1.00  0.86           N  
ATOM   1762  CA  ASP A 218      26.310 -12.534   4.524  1.00  0.86           C  
ATOM   1763  C   ASP A 218      26.932 -11.177   4.856  1.00  0.86           C  
ATOM   1764  O   ASP A 218      27.492 -10.463   4.030  1.00  0.86           O  
ATOM   1765  CB  ASP A 218      26.116 -12.816   3.017  1.00  0.86           C  
ATOM   1766  CG  ASP A 218      25.604 -14.241   2.820  1.00  0.86           C  
ATOM   1767  OD1 ASP A 218      25.896 -15.108   3.689  1.00  0.86           O  
ATOM   1768  OD2 ASP A 218      24.900 -14.473   1.807  1.00  0.86           O  
ATOM   1769  N   THR A 219      26.847 -10.816   6.151  1.00  0.87           N  
ATOM   1770  CA  THR A 219      27.322  -9.567   6.706  1.00  0.87           C  
ATOM   1771  C   THR A 219      28.801  -9.555   7.036  1.00  0.87           C  
ATOM   1772  O   THR A 219      29.435 -10.546   7.379  1.00  0.87           O  
ATOM   1773  CB  THR A 219      26.560  -9.135   7.958  1.00  0.87           C  
ATOM   1774  OG1 THR A 219      26.602 -10.123   8.983  1.00  0.87           O  
ATOM   1775  CG2 THR A 219      25.085  -8.939   7.590  1.00  0.87           C  
ATOM   1776  N   GLN A 220      29.398  -8.352   6.969  1.00  0.80           N  
ATOM   1777  CA  GLN A 220      30.711  -8.086   7.511  1.00  0.80           C  
ATOM   1778  C   GLN A 220      30.528  -7.713   8.967  1.00  0.80           C  
ATOM   1779  O   GLN A 220      29.737  -6.836   9.289  1.00  0.80           O  
ATOM   1780  CB  GLN A 220      31.376  -6.881   6.801  1.00  0.80           C  
ATOM   1781  CG  GLN A 220      32.733  -6.434   7.400  1.00  0.80           C  
ATOM   1782  CD  GLN A 220      33.139  -5.062   6.868  1.00  0.80           C  
ATOM   1783  OE1 GLN A 220      33.563  -4.896   5.725  1.00  0.80           O  
ATOM   1784  NE2 GLN A 220      32.995  -4.016   7.715  1.00  0.80           N  
ATOM   1785  N   VAL A 221      31.268  -8.356   9.885  1.00  0.86           N  
ATOM   1786  CA  VAL A 221      31.182  -8.042  11.299  1.00  0.86           C  
ATOM   1787  C   VAL A 221      32.372  -7.192  11.721  1.00  0.86           C  
ATOM   1788  O   VAL A 221      33.501  -7.409  11.326  1.00  0.86           O  
ATOM   1789  CB  VAL A 221      31.086  -9.305  12.145  1.00  0.86           C  
ATOM   1790  CG1 VAL A 221      31.105  -8.979  13.655  1.00  0.86           C  
ATOM   1791  CG2 VAL A 221      29.773 -10.034  11.795  1.00  0.86           C  
ATOM   1792  N   VAL A 222      32.115  -6.162  12.552  1.00  0.90           N  
ATOM   1793  CA  VAL A 222      33.135  -5.419  13.273  1.00  0.90           C  
ATOM   1794  C   VAL A 222      32.702  -5.523  14.719  1.00  0.90           C  
ATOM   1795  O   VAL A 222      31.511  -5.513  15.012  1.00  0.90           O  
ATOM   1796  CB  VAL A 222      33.232  -3.956  12.834  1.00  0.90           C  
ATOM   1797  CG1 VAL A 222      34.256  -3.185  13.693  1.00  0.90           C  
ATOM   1798  CG2 VAL A 222      33.674  -3.910  11.357  1.00  0.90           C  
ATOM   1799  N   LEU A 223      33.631  -5.690  15.677  1.00  0.88           N  
ATOM   1800  CA  LEU A 223      33.247  -5.788  17.071  1.00  0.88           C  
ATOM   1801  C   LEU A 223      33.343  -4.444  17.760  1.00  0.88           C  
ATOM   1802  O   LEU A 223      34.223  -3.635  17.479  1.00  0.88           O  
ATOM   1803  CB  LEU A 223      34.106  -6.803  17.856  1.00  0.88           C  
ATOM   1804  CG  LEU A 223      34.027  -8.256  17.351  1.00  0.88           C  
ATOM   1805  CD1 LEU A 223      34.906  -9.153  18.233  1.00  0.88           C  
ATOM   1806  CD2 LEU A 223      32.588  -8.789  17.340  1.00  0.88           C  
ATOM   1807  N   ALA A 224      32.425  -4.176  18.703  1.00  0.93           N  
ATOM   1808  CA  ALA A 224      32.414  -2.959  19.474  1.00  0.93           C  
ATOM   1809  C   ALA A 224      32.800  -3.232  20.912  1.00  0.93           C  
ATOM   1810  O   ALA A 224      32.114  -3.943  21.639  1.00  0.93           O  
ATOM   1811  CB  ALA A 224      31.021  -2.309  19.415  1.00  0.93           C  
ATOM   1812  N   MET A 225      33.933  -2.659  21.356  1.00  0.91           N  
ATOM   1813  CA  MET A 225      34.459  -2.835  22.693  1.00  0.91           C  
ATOM   1814  C   MET A 225      34.189  -1.607  23.556  1.00  0.91           C  
ATOM   1815  O   MET A 225      34.646  -0.523  23.185  1.00  0.91           O  
ATOM   1816  CB  MET A 225      35.983  -3.084  22.610  1.00  0.91           C  
ATOM   1817  CG  MET A 225      36.665  -3.268  23.977  1.00  0.91           C  
ATOM   1818  SD  MET A 225      38.344  -3.938  23.856  1.00  0.91           S  
ATOM   1819  CE  MET A 225      38.919  -3.187  25.399  1.00  0.91           C  
ATOM   1820  N   PRO A 226      33.461  -1.663  24.669  1.00  0.96           N  
ATOM   1821  CA  PRO A 226      33.165  -0.479  25.451  1.00  0.96           C  
ATOM   1822  C   PRO A 226      34.261  -0.117  26.424  1.00  0.96           C  
ATOM   1823  O   PRO A 226      34.947  -0.974  26.975  1.00  0.96           O  
ATOM   1824  CB  PRO A 226      31.880  -0.831  26.199  1.00  0.96           C  
ATOM   1825  CG  PRO A 226      31.907  -2.353  26.354  1.00  0.96           C  
ATOM   1826  CD  PRO A 226      32.788  -2.851  25.199  1.00  0.96           C  
ATOM   1827  N   TYR A 227      34.423   1.196  26.636  1.00  0.94           N  
ATOM   1828  CA  TYR A 227      35.283   1.758  27.644  1.00  0.94           C  
ATOM   1829  C   TYR A 227      34.383   2.591  28.545  1.00  0.94           C  
ATOM   1830  O   TYR A 227      33.635   3.446  28.070  1.00  0.94           O  
ATOM   1831  CB  TYR A 227      36.376   2.666  27.011  1.00  0.94           C  
ATOM   1832  CG  TYR A 227      37.503   1.892  26.356  1.00  0.94           C  
ATOM   1833  CD1 TYR A 227      37.307   1.115  25.197  1.00  0.94           C  
ATOM   1834  CD2 TYR A 227      38.811   2.019  26.854  1.00  0.94           C  
ATOM   1835  CE1 TYR A 227      38.385   0.475  24.570  1.00  0.94           C  
ATOM   1836  CE2 TYR A 227      39.893   1.393  26.218  1.00  0.94           C  
ATOM   1837  CZ  TYR A 227      39.678   0.624  25.071  1.00  0.94           C  
ATOM   1838  OH  TYR A 227      40.760   0.018  24.400  1.00  0.94           O  
ATOM   1839  N   ASP A 228      34.429   2.330  29.867  1.00  0.93           N  
ATOM   1840  CA  ASP A 228      33.638   3.028  30.861  1.00  0.93           C  
ATOM   1841  C   ASP A 228      34.449   4.156  31.501  1.00  0.93           C  
ATOM   1842  O   ASP A 228      35.527   3.929  32.043  1.00  0.93           O  
ATOM   1843  CB  ASP A 228      33.243   2.073  32.027  1.00  0.93           C  
ATOM   1844  CG  ASP A 228      32.240   0.993  31.682  1.00  0.93           C  
ATOM   1845  OD1 ASP A 228      31.631   0.994  30.589  1.00  0.93           O  
ATOM   1846  OD2 ASP A 228      32.064   0.085  32.545  1.00  0.93           O  
ATOM   1847  N   THR A 229      33.923   5.393  31.504  1.00  0.95           N  
ATOM   1848  CA  THR A 229      34.529   6.527  32.204  1.00  0.95           C  
ATOM   1849  C   THR A 229      33.555   7.014  33.268  1.00  0.95           C  
ATOM   1850  O   THR A 229      32.406   7.308  32.920  1.00  0.95           O  
ATOM   1851  CB  THR A 229      34.840   7.710  31.297  1.00  0.95           C  
ATOM   1852  OG1 THR A 229      35.861   7.357  30.376  1.00  0.95           O  
ATOM   1853  CG2 THR A 229      35.368   8.924  32.081  1.00  0.95           C  
ATOM   1854  N   PRO A 230      33.899   7.138  34.554  1.00  0.96           N  
ATOM   1855  CA  PRO A 230      32.969   7.621  35.569  1.00  0.96           C  
ATOM   1856  C   PRO A 230      32.670   9.112  35.469  1.00  0.96           C  
ATOM   1857  O   PRO A 230      33.576   9.906  35.228  1.00  0.96           O  
ATOM   1858  CB  PRO A 230      33.676   7.306  36.904  1.00  0.96           C  
ATOM   1859  CG  PRO A 230      34.723   6.243  36.574  1.00  0.96           C  
ATOM   1860  CD  PRO A 230      35.128   6.614  35.152  1.00  0.96           C  
ATOM   1861  N   VAL A 231      31.403   9.511  35.678  1.00  0.98           N  
ATOM   1862  CA  VAL A 231      30.968  10.901  35.640  1.00  0.98           C  
ATOM   1863  C   VAL A 231      30.418  11.315  37.008  1.00  0.98           C  
ATOM   1864  O   VAL A 231      29.324  10.870  37.365  1.00  0.98           O  
ATOM   1865  CB  VAL A 231      29.854  11.087  34.619  1.00  0.98           C  
ATOM   1866  CG1 VAL A 231      29.319  12.536  34.646  1.00  0.98           C  
ATOM   1867  CG2 VAL A 231      30.379  10.721  33.214  1.00  0.98           C  
ATOM   1868  N   PRO A 232      31.072  12.136  37.820  1.00  0.98           N  
ATOM   1869  CA  PRO A 232      30.586  12.478  39.150  1.00  0.98           C  
ATOM   1870  C   PRO A 232      29.635  13.660  39.176  1.00  0.98           C  
ATOM   1871  O   PRO A 232      29.868  14.666  38.519  1.00  0.98           O  
ATOM   1872  CB  PRO A 232      31.874  12.842  39.895  1.00  0.98           C  
ATOM   1873  CG  PRO A 232      32.744  13.494  38.814  1.00  0.98           C  
ATOM   1874  CD  PRO A 232      32.393  12.703  37.551  1.00  0.98           C  
ATOM   1875  N   GLY A 233      28.557  13.573  39.981  1.00  0.98           N  
ATOM   1876  CA  GLY A 233      27.685  14.714  40.233  1.00  0.98           C  
ATOM   1877  C   GLY A 233      28.130  15.494  41.443  1.00  0.98           C  
ATOM   1878  O   GLY A 233      28.811  14.978  42.326  1.00  0.98           O  
ATOM   1879  N   TYR A 234      27.708  16.767  41.549  1.00  0.93           N  
ATOM   1880  CA  TYR A 234      28.141  17.660  42.609  1.00  0.93           C  
ATOM   1881  C   TYR A 234      27.701  17.284  44.028  1.00  0.93           C  
ATOM   1882  O   TYR A 234      26.548  17.475  44.430  1.00  0.93           O  
ATOM   1883  CB  TYR A 234      27.740  19.126  42.281  1.00  0.93           C  
ATOM   1884  CG  TYR A 234      28.413  20.119  43.205  1.00  0.93           C  
ATOM   1885  CD1 TYR A 234      29.797  20.326  43.118  1.00  0.93           C  
ATOM   1886  CD2 TYR A 234      27.689  20.819  44.187  1.00  0.93           C  
ATOM   1887  CE1 TYR A 234      30.451  21.198  43.996  1.00  0.93           C  
ATOM   1888  CE2 TYR A 234      28.339  21.701  45.067  1.00  0.93           C  
ATOM   1889  CZ  TYR A 234      29.724  21.884  44.972  1.00  0.93           C  
ATOM   1890  OH  TYR A 234      30.413  22.750  45.843  1.00  0.93           O  
ATOM   1891  N   ARG A 235      28.663  16.769  44.829  1.00  0.85           N  
ATOM   1892  CA  ARG A 235      28.584  16.529  46.264  1.00  0.85           C  
ATOM   1893  C   ARG A 235      27.464  15.591  46.690  1.00  0.85           C  
ATOM   1894  O   ARG A 235      26.927  15.688  47.794  1.00  0.85           O  
ATOM   1895  CB  ARG A 235      28.538  17.851  47.076  1.00  0.85           C  
ATOM   1896  CG  ARG A 235      29.679  18.840  46.751  1.00  0.85           C  
ATOM   1897  CD  ARG A 235      31.075  18.375  47.180  1.00  0.85           C  
ATOM   1898  NE  ARG A 235      32.096  19.347  46.670  1.00  0.85           N  
ATOM   1899  CZ  ARG A 235      32.426  20.520  47.227  1.00  0.85           C  
ATOM   1900  NH1 ARG A 235      31.845  20.964  48.334  1.00  0.85           N  
ATOM   1901  NH2 ARG A 235      33.358  21.274  46.645  1.00  0.85           N  
ATOM   1902  N   ASN A 236      27.100  14.643  45.804  1.00  0.87           N  
ATOM   1903  CA  ASN A 236      25.982  13.747  46.041  1.00  0.87           C  
ATOM   1904  C   ASN A 236      26.308  12.284  46.025  1.00  0.87           C  
ATOM   1905  O   ASN A 236      25.444  11.442  46.243  1.00  0.87           O  
ATOM   1906  CB  ASN A 236      24.782  14.066  45.107  1.00  0.87           C  
ATOM   1907  CG  ASN A 236      25.057  14.052  43.603  1.00  0.87           C  
ATOM   1908  OD1 ASN A 236      24.228  14.546  42.847  1.00  0.87           O  
ATOM   1909  ND2 ASN A 236      26.206  13.524  43.132  1.00  0.87           N  
ATOM   1910  N   ASN A 237      27.581  11.958  45.759  1.00  0.85           N  
ATOM   1911  CA  ASN A 237      28.088  10.602  45.726  1.00  0.85           C  
ATOM   1912  C   ASN A 237      27.515   9.746  44.595  1.00  0.85           C  
ATOM   1913  O   ASN A 237      27.856   8.586  44.459  1.00  0.85           O  
ATOM   1914  CB  ASN A 237      27.972   9.913  47.112  1.00  0.85           C  
ATOM   1915  CG  ASN A 237      28.745  10.722  48.145  1.00  0.85           C  
ATOM   1916  OD1 ASN A 237      29.841  11.231  47.881  1.00  0.85           O  
ATOM   1917  ND2 ASN A 237      28.169  10.868  49.353  1.00  0.85           N  
ATOM   1918  N   VAL A 238      26.686  10.359  43.719  1.00  0.92           N  
ATOM   1919  CA  VAL A 238      26.196   9.815  42.475  1.00  0.92           C  
ATOM   1920  C   VAL A 238      27.260   9.932  41.410  1.00  0.92           C  
ATOM   1921  O   VAL A 238      27.680  11.019  41.037  1.00  0.92           O  
ATOM   1922  CB  VAL A 238      24.966  10.568  41.965  1.00  0.92           C  
ATOM   1923  CG1 VAL A 238      24.488   9.971  40.627  1.00  0.92           C  
ATOM   1924  CG2 VAL A 238      23.839  10.501  43.011  1.00  0.92           C  
ATOM   1925  N   VAL A 239      27.719   8.785  40.882  1.00  0.95           N  
ATOM   1926  CA  VAL A 239      28.650   8.764  39.776  1.00  0.95           C  
ATOM   1927  C   VAL A 239      28.088   7.911  38.646  1.00  0.95           C  
ATOM   1928  O   VAL A 239      27.859   6.711  38.767  1.00  0.95           O  
ATOM   1929  CB  VAL A 239      30.012   8.281  40.224  1.00  0.95           C  
ATOM   1930  CG1 VAL A 239      31.026   8.314  39.073  1.00  0.95           C  
ATOM   1931  CG2 VAL A 239      30.496   9.178  41.383  1.00  0.95           C  
ATOM   1932  N   ASN A 240      27.819   8.547  37.488  1.00  0.96           N  
ATOM   1933  CA  ASN A 240      27.219   7.926  36.319  1.00  0.96           C  
ATOM   1934  C   ASN A 240      28.290   7.367  35.389  1.00  0.96           C  
ATOM   1935  O   ASN A 240      29.479   7.434  35.671  1.00  0.96           O  
ATOM   1936  CB  ASN A 240      26.314   8.909  35.532  1.00  0.96           C  
ATOM   1937  CG  ASN A 240      25.049   9.366  36.264  1.00  0.96           C  
ATOM   1938  OD1 ASN A 240      24.424  10.331  35.839  1.00  0.96           O  
ATOM   1939  ND2 ASN A 240      24.632   8.679  37.354  1.00  0.96           N  
ATOM   1940  N   THR A 241      27.875   6.777  34.248  1.00  0.97           N  
ATOM   1941  CA  THR A 241      28.793   6.117  33.321  1.00  0.97           C  
ATOM   1942  C   THR A 241      28.770   6.782  31.964  1.00  0.97           C  
ATOM   1943  O   THR A 241      27.735   6.897  31.323  1.00  0.97           O  
ATOM   1944  CB  THR A 241      28.419   4.665  33.057  1.00  0.97           C  
ATOM   1945  OG1 THR A 241      28.301   3.976  34.288  1.00  0.97           O  
ATOM   1946  CG2 THR A 241      29.502   3.936  32.247  1.00  0.97           C  
ATOM   1947  N   MET A 242      29.948   7.201  31.457  1.00  0.95           N  
ATOM   1948  CA  MET A 242      30.100   7.522  30.053  1.00  0.95           C  
ATOM   1949  C   MET A 242      30.669   6.274  29.403  1.00  0.95           C  
ATOM   1950  O   MET A 242      31.680   5.739  29.843  1.00  0.95           O  
ATOM   1951  CB  MET A 242      31.008   8.757  29.814  1.00  0.95           C  
ATOM   1952  CG  MET A 242      31.191   9.106  28.322  1.00  0.95           C  
ATOM   1953  SD  MET A 242      32.101  10.646  28.000  1.00  0.95           S  
ATOM   1954  CE  MET A 242      33.733  10.034  28.502  1.00  0.95           C  
ATOM   1955  N   ARG A 243      29.986   5.748  28.373  1.00  0.92           N  
ATOM   1956  CA  ARG A 243      30.319   4.507  27.715  1.00  0.92           C  
ATOM   1957  C   ARG A 243      30.724   4.820  26.291  1.00  0.92           C  
ATOM   1958  O   ARG A 243      29.924   5.276  25.482  1.00  0.92           O  
ATOM   1959  CB  ARG A 243      29.069   3.592  27.664  1.00  0.92           C  
ATOM   1960  CG  ARG A 243      29.316   2.134  27.223  1.00  0.92           C  
ATOM   1961  CD  ARG A 243      29.727   1.224  28.382  1.00  0.92           C  
ATOM   1962  NE  ARG A 243      29.008  -0.099  28.280  1.00  0.92           N  
ATOM   1963  CZ  ARG A 243      29.334  -1.158  29.025  1.00  0.92           C  
ATOM   1964  NH1 ARG A 243      30.326  -1.136  29.901  1.00  0.92           N  
ATOM   1965  NH2 ARG A 243      28.638  -2.287  28.932  1.00  0.92           N  
ATOM   1966  N   LEU A 244      31.997   4.588  25.933  1.00  0.97           N  
ATOM   1967  CA  LEU A 244      32.459   4.930  24.603  1.00  0.97           C  
ATOM   1968  C   LEU A 244      32.987   3.702  23.887  1.00  0.97           C  
ATOM   1969  O   LEU A 244      33.853   2.988  24.380  1.00  0.97           O  
ATOM   1970  CB  LEU A 244      33.546   6.021  24.638  1.00  0.97           C  
ATOM   1971  CG  LEU A 244      33.169   7.343  25.332  1.00  0.97           C  
ATOM   1972  CD1 LEU A 244      34.342   8.319  25.187  1.00  0.97           C  
ATOM   1973  CD2 LEU A 244      31.903   7.998  24.758  1.00  0.97           C  
ATOM   1974  N   TRP A 245      32.453   3.419  22.681  1.00  0.94           N  
ATOM   1975  CA  TRP A 245      32.778   2.213  21.942  1.00  0.94           C  
ATOM   1976  C   TRP A 245      34.029   2.334  21.079  1.00  0.94           C  
ATOM   1977  O   TRP A 245      34.300   3.356  20.453  1.00  0.94           O  
ATOM   1978  CB  TRP A 245      31.604   1.767  21.032  1.00  0.94           C  
ATOM   1979  CG  TRP A 245      30.294   1.569  21.736  1.00  0.94           C  
ATOM   1980  CD1 TRP A 245      29.223   2.411  21.814  1.00  0.94           C  
ATOM   1981  CD2 TRP A 245      29.867   0.395  22.490  1.00  0.94           C  
ATOM   1982  NE1 TRP A 245      28.161   1.880  22.549  1.00  0.94           N  
ATOM   1983  CE2 TRP A 245      28.638   0.618  22.966  1.00  0.94           C  
ATOM   1984  CE3 TRP A 245      30.557  -0.824  22.696  1.00  0.94           C  
ATOM   1985  CZ2 TRP A 245      27.930  -0.318  23.754  1.00  0.94           C  
ATOM   1986  CZ3 TRP A 245      29.856  -1.801  23.433  1.00  0.94           C  
ATOM   1987  CH2 TRP A 245      28.599  -1.549  23.970  1.00  0.94           C  
ATOM   1988  N   SER A 246      34.822   1.250  21.026  1.00  0.94           N  
ATOM   1989  CA  SER A 246      36.070   1.165  20.282  1.00  0.94           C  
ATOM   1990  C   SER A 246      35.994  -0.025  19.356  1.00  0.94           C  
ATOM   1991  O   SER A 246      35.716  -1.144  19.787  1.00  0.94           O  
ATOM   1992  CB  SER A 246      37.257   1.001  21.268  1.00  0.94           C  
ATOM   1993  OG  SER A 246      38.548   1.093  20.659  1.00  0.94           O  
ATOM   1994  N   ALA A 247      36.168   0.192  18.040  1.00  0.91           N  
ATOM   1995  CA  ALA A 247      36.118  -0.846  17.037  1.00  0.91           C  
ATOM   1996  C   ALA A 247      37.269  -1.837  17.149  1.00  0.91           C  
ATOM   1997  O   ALA A 247      38.407  -1.455  17.401  1.00  0.91           O  
ATOM   1998  CB  ALA A 247      36.004  -0.230  15.629  1.00  0.91           C  
ATOM   1999  N   LYS A 248      36.962  -3.142  16.984  1.00  0.82           N  
ATOM   2000  CA  LYS A 248      37.931  -4.222  17.023  1.00  0.82           C  
ATOM   2001  C   LYS A 248      37.655  -5.225  15.925  1.00  0.82           C  
ATOM   2002  O   LYS A 248      36.511  -5.479  15.541  1.00  0.82           O  
ATOM   2003  CB  LYS A 248      37.949  -5.003  18.370  1.00  0.82           C  
ATOM   2004  CG  LYS A 248      38.142  -4.121  19.614  1.00  0.82           C  
ATOM   2005  CD  LYS A 248      39.513  -3.428  19.620  1.00  0.82           C  
ATOM   2006  CE  LYS A 248      39.612  -2.247  20.577  1.00  0.82           C  
ATOM   2007  NZ  LYS A 248      40.844  -1.490  20.276  1.00  0.82           N  
ATOM   2008  N   ALA A 249      38.723  -5.830  15.373  1.00  0.80           N  
ATOM   2009  CA  ALA A 249      38.599  -6.931  14.442  1.00  0.80           C  
ATOM   2010  C   ALA A 249      37.972  -8.205  15.044  1.00  0.80           C  
ATOM   2011  O   ALA A 249      38.351  -8.593  16.151  1.00  0.80           O  
ATOM   2012  CB  ALA A 249      39.974  -7.284  13.868  1.00  0.80           C  
ATOM   2013  N   PRO A 250      37.038  -8.905  14.393  1.00  0.79           N  
ATOM   2014  CA  PRO A 250      36.470 -10.150  14.905  1.00  0.79           C  
ATOM   2015  C   PRO A 250      37.456 -11.288  15.029  1.00  0.79           C  
ATOM   2016  O   PRO A 250      38.440 -11.330  14.295  1.00  0.79           O  
ATOM   2017  CB  PRO A 250      35.365 -10.519  13.903  1.00  0.79           C  
ATOM   2018  CG  PRO A 250      35.005  -9.193  13.249  1.00  0.79           C  
ATOM   2019  CD  PRO A 250      36.326  -8.434  13.211  1.00  0.79           C  
ATOM   2020  N   ASN A 251      37.170 -12.252  15.932  1.00  0.66           N  
ATOM   2021  CA  ASN A 251      37.978 -13.438  16.150  1.00  0.66           C  
ATOM   2022  C   ASN A 251      38.090 -14.301  14.891  1.00  0.66           C  
ATOM   2023  O   ASN A 251      39.149 -14.798  14.549  1.00  0.66           O  
ATOM   2024  CB  ASN A 251      37.435 -14.287  17.334  1.00  0.66           C  
ATOM   2025  CG  ASN A 251      37.545 -13.518  18.650  1.00  0.66           C  
ATOM   2026  OD1 ASN A 251      38.351 -12.613  18.831  1.00  0.66           O  
ATOM   2027  ND2 ASN A 251      36.701 -13.885  19.645  1.00  0.66           N  
ATOM   2028  N   ASP A 252      36.986 -14.461  14.123  1.00  0.70           N  
ATOM   2029  CA  ASP A 252      37.001 -15.253  12.905  1.00  0.70           C  
ATOM   2030  C   ASP A 252      37.729 -14.592  11.739  1.00  0.70           C  
ATOM   2031  O   ASP A 252      38.225 -15.263  10.840  1.00  0.70           O  
ATOM   2032  CB  ASP A 252      35.564 -15.542  12.435  1.00  0.70           C  
ATOM   2033  CG  ASP A 252      34.942 -16.550  13.358  1.00  0.70           C  
ATOM   2034  OD1 ASP A 252      35.416 -17.716  13.303  1.00  0.70           O  
ATOM   2035  OD2 ASP A 252      33.997 -16.176  14.097  1.00  0.70           O  
ATOM   2036  N   PHE A 253      37.864 -13.253  11.779  1.00  0.64           N  
ATOM   2037  CA  PHE A 253      38.631 -12.462  10.839  1.00  0.64           C  
ATOM   2038  C   PHE A 253      40.020 -12.195  11.415  1.00  0.64           C  
ATOM   2039  O   PHE A 253      40.661 -11.178  11.215  1.00  0.64           O  
ATOM   2040  CB  PHE A 253      37.950 -11.106  10.521  1.00  0.64           C  
ATOM   2041  CG  PHE A 253      36.642 -11.205   9.763  1.00  0.64           C  
ATOM   2042  CD1 PHE A 253      36.296 -12.280   8.922  1.00  0.64           C  
ATOM   2043  CD2 PHE A 253      35.772 -10.106   9.814  1.00  0.64           C  
ATOM   2044  CE1 PHE A 253      35.098 -12.268   8.192  1.00  0.64           C  
ATOM   2045  CE2 PHE A 253      34.579 -10.082   9.085  1.00  0.64           C  
ATOM   2046  CZ  PHE A 253      34.236 -11.169   8.276  1.00  0.64           C  
ATOM   2047  N   ASN A 254      40.549 -13.144  12.212  1.00  0.61           N  
ATOM   2048  CA  ASN A 254      41.934 -13.120  12.605  1.00  0.61           C  
ATOM   2049  C   ASN A 254      42.864 -13.354  11.433  1.00  0.61           C  
ATOM   2050  O   ASN A 254      43.888 -12.683  11.328  1.00  0.61           O  
ATOM   2051  CB  ASN A 254      42.200 -14.185  13.693  1.00  0.61           C  
ATOM   2052  CG  ASN A 254      41.769 -13.692  15.073  1.00  0.61           C  
ATOM   2053  OD1 ASN A 254      41.129 -12.676  15.250  1.00  0.61           O  
ATOM   2054  ND2 ASN A 254      42.245 -14.392  16.134  1.00  0.61           N  
ATOM   2055  N   LEU A 255      42.532 -14.300  10.539  1.00  0.63           N  
ATOM   2056  CA  LEU A 255      43.447 -14.748   9.514  1.00  0.63           C  
ATOM   2057  C   LEU A 255      42.751 -15.423   8.328  1.00  0.63           C  
ATOM   2058  O   LEU A 255      43.378 -15.822   7.375  1.00  0.63           O  
ATOM   2059  CB  LEU A 255      44.424 -15.820  10.069  1.00  0.63           C  
ATOM   2060  CG  LEU A 255      45.547 -15.410  11.036  1.00  0.63           C  
ATOM   2061  CD1 LEU A 255      46.509 -16.554  11.315  1.00  0.63           C  
ATOM   2062  CD2 LEU A 255      46.429 -14.266  10.580  1.00  0.63           C  
ATOM   2063  N   LYS A 256      41.409 -15.548   8.298  1.00  0.61           N  
ATOM   2064  CA  LYS A 256      40.777 -16.310   7.227  1.00  0.61           C  
ATOM   2065  C   LYS A 256      40.571 -15.474   5.988  1.00  0.61           C  
ATOM   2066  O   LYS A 256      40.177 -15.983   4.941  1.00  0.61           O  
ATOM   2067  CB  LYS A 256      39.420 -16.880   7.693  1.00  0.61           C  
ATOM   2068  CG  LYS A 256      39.578 -18.005   8.729  1.00  0.61           C  
ATOM   2069  CD  LYS A 256      38.225 -18.426   9.323  1.00  0.61           C  
ATOM   2070  CE  LYS A 256      38.314 -19.486  10.425  1.00  0.61           C  
ATOM   2071  NZ  LYS A 256      36.981 -19.648  11.054  1.00  0.61           N  
ATOM   2072  N   ASP A 257      40.925 -14.185   6.077  1.00  0.56           N  
ATOM   2073  CA  ASP A 257      40.792 -13.236   5.016  1.00  0.56           C  
ATOM   2074  C   ASP A 257      42.037 -13.224   4.115  1.00  0.56           C  
ATOM   2075  O   ASP A 257      42.119 -12.443   3.178  1.00  0.56           O  
ATOM   2076  CB  ASP A 257      40.573 -11.844   5.668  1.00  0.56           C  
ATOM   2077  CG  ASP A 257      39.390 -11.855   6.631  1.00  0.56           C  
ATOM   2078  OD1 ASP A 257      38.387 -12.566   6.374  1.00  0.56           O  
ATOM   2079  OD2 ASP A 257      39.523 -11.187   7.686  1.00  0.56           O  
ATOM   2080  N   PHE A 258      43.040 -14.120   4.354  1.00  0.59           N  
ATOM   2081  CA  PHE A 258      44.264 -14.160   3.574  1.00  0.59           C  
ATOM   2082  C   PHE A 258      44.511 -15.434   2.795  1.00  0.59           C  
ATOM   2083  O   PHE A 258      44.092 -16.523   3.160  1.00  0.59           O  
ATOM   2084  CB  PHE A 258      45.489 -13.828   4.458  1.00  0.59           C  
ATOM   2085  CG  PHE A 258      46.095 -14.915   5.340  1.00  0.59           C  
ATOM   2086  CD1 PHE A 258      46.935 -15.851   4.740  1.00  0.59           C  
ATOM   2087  CD2 PHE A 258      45.978 -14.992   6.739  1.00  0.59           C  
ATOM   2088  CE1 PHE A 258      47.502 -16.909   5.430  1.00  0.59           C  
ATOM   2089  CE2 PHE A 258      46.609 -16.027   7.440  1.00  0.59           C  
ATOM   2090  CZ  PHE A 258      47.296 -17.028   6.781  1.00  0.59           C  
ATOM   2091  N   ASN A 259      45.298 -15.328   1.700  1.00  0.41           N  
ATOM   2092  CA  ASN A 259      45.741 -16.477   0.915  1.00  0.41           C  
ATOM   2093  C   ASN A 259      47.003 -17.053   1.546  1.00  0.41           C  
ATOM   2094  O   ASN A 259      47.921 -16.254   1.675  1.00  0.41           O  
ATOM   2095  CB  ASN A 259      46.280 -16.024  -0.484  1.00  0.41           C  
ATOM   2096  CG  ASN A 259      45.231 -15.494  -1.447  1.00  0.41           C  
ATOM   2097  OD1 ASN A 259      44.040 -15.762  -1.354  1.00  0.41           O  
ATOM   2098  ND2 ASN A 259      45.711 -14.732  -2.464  1.00  0.41           N  
ATOM   2099  N   VAL A 260      47.155 -18.367   1.902  1.00  0.39           N  
ATOM   2100  CA  VAL A 260      48.293 -19.017   2.593  1.00  0.39           C  
ATOM   2101  C   VAL A 260      49.682 -18.338   2.585  1.00  0.39           C  
ATOM   2102  O   VAL A 260      50.294 -18.168   3.640  1.00  0.39           O  
ATOM   2103  CB  VAL A 260      48.416 -20.496   2.209  1.00  0.39           C  
ATOM   2104  CG1 VAL A 260      49.561 -21.206   2.965  1.00  0.39           C  
ATOM   2105  CG2 VAL A 260      47.113 -21.247   2.560  1.00  0.39           C  
ATOM   2106  N   GLY A 261      50.226 -17.878   1.428  1.00  0.38           N  
ATOM   2107  CA  GLY A 261      51.517 -17.187   1.394  1.00  0.38           C  
ATOM   2108  C   GLY A 261      51.506 -15.755   1.898  1.00  0.38           C  
ATOM   2109  O   GLY A 261      52.518 -15.101   1.979  1.00  0.38           O  
ATOM   2110  N   GLY A 262      50.312 -15.235   2.241  1.00  0.54           N  
ATOM   2111  CA  GLY A 262      50.093 -13.882   2.696  1.00  0.54           C  
ATOM   2112  C   GLY A 262      49.774 -13.728   4.153  1.00  0.54           C  
ATOM   2113  O   GLY A 262      49.155 -12.744   4.524  1.00  0.54           O  
ATOM   2114  N   TYR A 263      50.183 -14.692   5.014  1.00  0.44           N  
ATOM   2115  CA  TYR A 263      49.862 -14.738   6.441  1.00  0.44           C  
ATOM   2116  C   TYR A 263      50.062 -13.420   7.170  1.00  0.44           C  
ATOM   2117  O   TYR A 263      49.187 -12.951   7.892  1.00  0.44           O  
ATOM   2118  CB  TYR A 263      50.669 -15.897   7.117  1.00  0.44           C  
ATOM   2119  CG  TYR A 263      50.739 -15.802   8.625  1.00  0.44           C  
ATOM   2120  CD1 TYR A 263      49.695 -16.201   9.464  1.00  0.44           C  
ATOM   2121  CD2 TYR A 263      51.868 -15.212   9.206  1.00  0.44           C  
ATOM   2122  CE1 TYR A 263      49.830 -16.089  10.858  1.00  0.44           C  
ATOM   2123  CE2 TYR A 263      51.962 -15.021  10.584  1.00  0.44           C  
ATOM   2124  CZ  TYR A 263      50.955 -15.488  11.415  1.00  0.44           C  
ATOM   2125  OH  TYR A 263      51.105 -15.313  12.805  1.00  0.44           O  
ATOM   2126  N   ILE A 264      51.228 -12.785   6.957  1.00  0.58           N  
ATOM   2127  CA  ILE A 264      51.586 -11.524   7.577  1.00  0.58           C  
ATOM   2128  C   ILE A 264      50.634 -10.399   7.216  1.00  0.58           C  
ATOM   2129  O   ILE A 264      50.204  -9.659   8.091  1.00  0.58           O  
ATOM   2130  CB  ILE A 264      53.027 -11.154   7.230  1.00  0.58           C  
ATOM   2131  CG1 ILE A 264      54.015 -12.250   7.706  1.00  0.58           C  
ATOM   2132  CG2 ILE A 264      53.422  -9.779   7.815  1.00  0.58           C  
ATOM   2133  CD1 ILE A 264      54.082 -12.430   9.229  1.00  0.58           C  
ATOM   2134  N   GLN A 265      50.225 -10.276   5.934  1.00  0.56           N  
ATOM   2135  CA  GLN A 265      49.395  -9.185   5.448  1.00  0.56           C  
ATOM   2136  C   GLN A 265      48.054  -9.147   6.139  1.00  0.56           C  
ATOM   2137  O   GLN A 265      47.589  -8.110   6.580  1.00  0.56           O  
ATOM   2138  CB  GLN A 265      49.243  -9.265   3.907  1.00  0.56           C  
ATOM   2139  CG  GLN A 265      48.540  -8.051   3.248  1.00  0.56           C  
ATOM   2140  CD  GLN A 265      49.239  -6.729   3.578  1.00  0.56           C  
ATOM   2141  OE1 GLN A 265      50.428  -6.552   3.320  1.00  0.56           O  
ATOM   2142  NE2 GLN A 265      48.492  -5.777   4.183  1.00  0.56           N  
ATOM   2143  N   ALA A 266      47.460 -10.323   6.375  1.00  0.61           N  
ATOM   2144  CA  ALA A 266      46.229 -10.422   7.093  1.00  0.61           C  
ATOM   2145  C   ALA A 266      46.250  -9.884   8.511  1.00  0.61           C  
ATOM   2146  O   ALA A 266      45.304  -9.290   8.991  1.00  0.61           O  
ATOM   2147  CB  ALA A 266      45.852 -11.880   7.144  1.00  0.61           C  
ATOM   2148  N   VAL A 267      47.363 -10.097   9.232  1.00  0.58           N  
ATOM   2149  CA  VAL A 267      47.553  -9.624  10.582  1.00  0.58           C  
ATOM   2150  C   VAL A 267      47.666  -8.102  10.647  1.00  0.58           C  
ATOM   2151  O   VAL A 267      47.169  -7.456  11.554  1.00  0.58           O  
ATOM   2152  CB  VAL A 267      48.738 -10.311  11.232  1.00  0.58           C  
ATOM   2153  CG1 VAL A 267      48.826  -9.910  12.705  1.00  0.58           C  
ATOM   2154  CG2 VAL A 267      48.577 -11.836  11.138  1.00  0.58           C  
ATOM   2155  N   LEU A 268      48.315  -7.500   9.621  1.00  0.57           N  
ATOM   2156  CA  LEU A 268      48.315  -6.073   9.373  1.00  0.57           C  
ATOM   2157  C   LEU A 268      46.921  -5.540   8.995  1.00  0.57           C  
ATOM   2158  O   LEU A 268      46.464  -4.531   9.535  1.00  0.57           O  
ATOM   2159  CB  LEU A 268      49.368  -5.746   8.278  1.00  0.57           C  
ATOM   2160  CG  LEU A 268      50.770  -6.391   8.460  1.00  0.57           C  
ATOM   2161  CD1 LEU A 268      51.768  -5.863   7.415  1.00  0.57           C  
ATOM   2162  CD2 LEU A 268      51.362  -6.253   9.873  1.00  0.57           C  
ATOM   2163  N   ASP A 269      46.194  -6.253   8.106  1.00  0.60           N  
ATOM   2164  CA  ASP A 269      44.850  -5.938   7.646  1.00  0.60           C  
ATOM   2165  C   ASP A 269      43.757  -6.052   8.700  1.00  0.60           C  
ATOM   2166  O   ASP A 269      42.753  -5.345   8.612  1.00  0.60           O  
ATOM   2167  CB  ASP A 269      44.430  -6.805   6.435  1.00  0.60           C  
ATOM   2168  CG  ASP A 269      45.275  -6.519   5.206  1.00  0.60           C  
ATOM   2169  OD1 ASP A 269      45.910  -5.435   5.137  1.00  0.60           O  
ATOM   2170  OD2 ASP A 269      45.293  -7.388   4.299  1.00  0.60           O  
ATOM   2171  N   ARG A 270      43.914  -6.879   9.764  1.00  0.58           N  
ATOM   2172  CA  ARG A 270      42.990  -6.928  10.896  1.00  0.58           C  
ATOM   2173  C   ARG A 270      42.648  -5.547  11.448  1.00  0.58           C  
ATOM   2174  O   ARG A 270      41.492  -5.195  11.649  1.00  0.58           O  
ATOM   2175  CB  ARG A 270      43.601  -7.686  12.107  1.00  0.58           C  
ATOM   2176  CG  ARG A 270      43.543  -9.222  12.061  1.00  0.58           C  
ATOM   2177  CD  ARG A 270      44.183  -9.906  13.285  1.00  0.58           C  
ATOM   2178  NE  ARG A 270      43.648  -9.359  14.575  1.00  0.58           N  
ATOM   2179  CZ  ARG A 270      42.439  -9.614  15.111  1.00  0.58           C  
ATOM   2180  NH1 ARG A 270      41.454 -10.128  14.406  1.00  0.58           N  
ATOM   2181  NH2 ARG A 270      42.238  -9.318  16.398  1.00  0.58           N  
ATOM   2182  N   ASN A 271      43.691  -4.706  11.629  1.00  0.70           N  
ATOM   2183  CA  ASN A 271      43.593  -3.348  12.112  1.00  0.70           C  
ATOM   2184  C   ASN A 271      42.676  -2.485  11.242  1.00  0.70           C  
ATOM   2185  O   ASN A 271      42.086  -1.532  11.728  1.00  0.70           O  
ATOM   2186  CB  ASN A 271      45.014  -2.721  12.256  1.00  0.70           C  
ATOM   2187  CG  ASN A 271      44.946  -1.204  12.413  1.00  0.70           C  
ATOM   2188  OD1 ASN A 271      44.842  -0.653  13.502  1.00  0.70           O  
ATOM   2189  ND2 ASN A 271      44.888  -0.499  11.247  1.00  0.70           N  
ATOM   2190  N   LEU A 272      42.554  -2.751   9.925  1.00  0.69           N  
ATOM   2191  CA  LEU A 272      41.768  -1.912   9.036  1.00  0.69           C  
ATOM   2192  C   LEU A 272      40.291  -1.863   9.418  1.00  0.69           C  
ATOM   2193  O   LEU A 272      39.612  -0.855   9.211  1.00  0.69           O  
ATOM   2194  CB  LEU A 272      41.919  -2.359   7.566  1.00  0.69           C  
ATOM   2195  CG  LEU A 272      43.325  -2.169   6.955  1.00  0.69           C  
ATOM   2196  CD1 LEU A 272      43.404  -2.885   5.598  1.00  0.69           C  
ATOM   2197  CD2 LEU A 272      43.676  -0.684   6.770  1.00  0.69           C  
ATOM   2198  N   ALA A 273      39.780  -2.932  10.064  1.00  0.75           N  
ATOM   2199  CA  ALA A 273      38.452  -2.996  10.628  1.00  0.75           C  
ATOM   2200  C   ALA A 273      38.240  -2.023  11.791  1.00  0.75           C  
ATOM   2201  O   ALA A 273      37.121  -1.604  12.074  1.00  0.75           O  
ATOM   2202  CB  ALA A 273      38.208  -4.442  11.099  1.00  0.75           C  
ATOM   2203  N   GLU A 274      39.331  -1.583  12.453  1.00  0.82           N  
ATOM   2204  CA  GLU A 274      39.282  -0.699  13.598  1.00  0.82           C  
ATOM   2205  C   GLU A 274      39.327   0.769  13.202  1.00  0.82           C  
ATOM   2206  O   GLU A 274      39.226   1.674  14.029  1.00  0.82           O  
ATOM   2207  CB  GLU A 274      40.469  -0.964  14.547  1.00  0.82           C  
ATOM   2208  CG  GLU A 274      40.688  -2.463  14.848  1.00  0.82           C  
ATOM   2209  CD  GLU A 274      41.552  -2.678  16.086  1.00  0.82           C  
ATOM   2210  OE1 GLU A 274      42.496  -1.881  16.314  1.00  0.82           O  
ATOM   2211  OE2 GLU A 274      41.248  -3.646  16.833  1.00  0.82           O  
ATOM   2212  N   ASN A 275      39.391   1.066  11.886  1.00  0.83           N  
ATOM   2213  CA  ASN A 275      39.432   2.426  11.379  1.00  0.83           C  
ATOM   2214  C   ASN A 275      38.131   3.190  11.579  1.00  0.83           C  
ATOM   2215  O   ASN A 275      38.096   4.415  11.489  1.00  0.83           O  
ATOM   2216  CB  ASN A 275      39.858   2.454   9.893  1.00  0.83           C  
ATOM   2217  CG  ASN A 275      41.360   2.207   9.764  1.00  0.83           C  
ATOM   2218  OD1 ASN A 275      42.149   2.377  10.689  1.00  0.83           O  
ATOM   2219  ND2 ASN A 275      41.780   1.831   8.530  1.00  0.83           N  
ATOM   2220  N   ILE A 276      37.041   2.481  11.924  1.00  0.89           N  
ATOM   2221  CA  ILE A 276      35.756   3.054  12.289  1.00  0.89           C  
ATOM   2222  C   ILE A 276      35.841   3.982  13.497  1.00  0.89           C  
ATOM   2223  O   ILE A 276      35.308   5.087  13.469  1.00  0.89           O  
ATOM   2224  CB  ILE A 276      34.719   1.949  12.471  1.00  0.89           C  
ATOM   2225  CG1 ILE A 276      34.477   1.254  11.104  1.00  0.89           C  
ATOM   2226  CG2 ILE A 276      33.398   2.519  13.041  1.00  0.89           C  
ATOM   2227  CD1 ILE A 276      33.606  -0.004  11.192  1.00  0.89           C  
ATOM   2228  N   SER A 277      36.567   3.608  14.573  1.00  0.91           N  
ATOM   2229  CA  SER A 277      36.718   4.456  15.746  1.00  0.91           C  
ATOM   2230  C   SER A 277      38.054   5.167  15.804  1.00  0.91           C  
ATOM   2231  O   SER A 277      38.464   5.634  16.859  1.00  0.91           O  
ATOM   2232  CB  SER A 277      36.498   3.700  17.091  1.00  0.91           C  
ATOM   2233  OG  SER A 277      37.427   2.652  17.332  1.00  0.91           O  
ATOM   2234  N   ARG A 278      38.794   5.283  14.687  1.00  0.83           N  
ATOM   2235  CA  ARG A 278      40.047   6.013  14.675  1.00  0.83           C  
ATOM   2236  C   ARG A 278      39.938   7.520  14.872  1.00  0.83           C  
ATOM   2237  O   ARG A 278      40.676   8.086  15.648  1.00  0.83           O  
ATOM   2238  CB  ARG A 278      40.802   5.782  13.354  1.00  0.83           C  
ATOM   2239  CG  ARG A 278      41.625   4.489  13.328  1.00  0.83           C  
ATOM   2240  CD  ARG A 278      43.010   4.657  13.945  1.00  0.83           C  
ATOM   2241  NE  ARG A 278      43.337   3.476  14.783  1.00  0.83           N  
ATOM   2242  CZ  ARG A 278      43.484   2.198  14.431  1.00  0.83           C  
ATOM   2243  NH1 ARG A 278      43.297   1.720  13.209  1.00  0.83           N  
ATOM   2244  NH2 ARG A 278      43.836   1.347  15.391  1.00  0.83           N  
ATOM   2245  N   VAL A 279      39.013   8.218  14.170  1.00  0.88           N  
ATOM   2246  CA  VAL A 279      39.063   9.676  14.176  1.00  0.88           C  
ATOM   2247  C   VAL A 279      37.703  10.338  14.085  1.00  0.88           C  
ATOM   2248  O   VAL A 279      36.824   9.945  13.336  1.00  0.88           O  
ATOM   2249  CB  VAL A 279      39.995  10.201  13.091  1.00  0.88           C  
ATOM   2250  CG1 VAL A 279      39.548   9.758  11.685  1.00  0.88           C  
ATOM   2251  CG2 VAL A 279      40.167  11.733  13.179  1.00  0.88           C  
ATOM   2252  N   LEU A 280      37.510  11.399  14.908  1.00  0.91           N  
ATOM   2253  CA  LEU A 280      36.358  12.271  14.836  1.00  0.91           C  
ATOM   2254  C   LEU A 280      36.313  13.036  13.529  1.00  0.91           C  
ATOM   2255  O   LEU A 280      37.283  13.662  13.104  1.00  0.91           O  
ATOM   2256  CB  LEU A 280      36.396  13.263  16.022  1.00  0.91           C  
ATOM   2257  CG  LEU A 280      35.343  14.392  16.023  1.00  0.91           C  
ATOM   2258  CD1 LEU A 280      33.901  13.870  16.114  1.00  0.91           C  
ATOM   2259  CD2 LEU A 280      35.625  15.338  17.194  1.00  0.91           C  
ATOM   2260  N   TYR A 281      35.154  13.018  12.840  1.00  0.88           N  
ATOM   2261  CA  TYR A 281      34.958  13.863  11.686  1.00  0.88           C  
ATOM   2262  C   TYR A 281      34.929  15.338  12.110  1.00  0.88           C  
ATOM   2263  O   TYR A 281      34.109  15.686  12.958  1.00  0.88           O  
ATOM   2264  CB  TYR A 281      33.652  13.509  10.927  1.00  0.88           C  
ATOM   2265  CG  TYR A 281      33.946  12.514   9.838  1.00  0.88           C  
ATOM   2266  CD1 TYR A 281      34.103  11.145  10.108  1.00  0.88           C  
ATOM   2267  CD2 TYR A 281      34.127  12.965   8.523  1.00  0.88           C  
ATOM   2268  CE1 TYR A 281      34.437  10.248   9.081  1.00  0.88           C  
ATOM   2269  CE2 TYR A 281      34.460  12.077   7.494  1.00  0.88           C  
ATOM   2270  CZ  TYR A 281      34.620  10.717   7.775  1.00  0.88           C  
ATOM   2271  OH  TYR A 281      34.971   9.832   6.739  1.00  0.88           O  
ATOM   2272  N   PRO A 282      35.727  16.250  11.563  1.00  0.90           N  
ATOM   2273  CA  PRO A 282      35.989  17.546  12.194  1.00  0.90           C  
ATOM   2274  C   PRO A 282      35.030  18.587  11.652  1.00  0.90           C  
ATOM   2275  O   PRO A 282      35.366  19.769  11.561  1.00  0.90           O  
ATOM   2276  CB  PRO A 282      37.413  17.867  11.714  1.00  0.90           C  
ATOM   2277  CG  PRO A 282      37.471  17.213  10.334  1.00  0.90           C  
ATOM   2278  CD  PRO A 282      36.744  15.910  10.574  1.00  0.90           C  
ATOM   2279  N   ASN A 283      33.793  18.171  11.353  1.00  0.85           N  
ATOM   2280  CA  ASN A 283      32.777  19.023  10.794  1.00  0.85           C  
ATOM   2281  C   ASN A 283      31.846  19.552  11.873  1.00  0.85           C  
ATOM   2282  O   ASN A 283      31.233  18.801  12.615  1.00  0.85           O  
ATOM   2283  CB  ASN A 283      31.953  18.248   9.751  1.00  0.85           C  
ATOM   2284  CG  ASN A 283      32.878  17.845   8.612  1.00  0.85           C  
ATOM   2285  OD1 ASN A 283      33.654  18.651   8.090  1.00  0.85           O  
ATOM   2286  ND2 ASN A 283      32.774  16.557   8.224  1.00  0.85           N  
ATOM   2287  N   ASP A 284      31.709  20.892  11.950  1.00  0.85           N  
ATOM   2288  CA  ASP A 284      30.831  21.574  12.875  1.00  0.85           C  
ATOM   2289  C   ASP A 284      29.772  22.222  12.010  1.00  0.85           C  
ATOM   2290  O   ASP A 284      30.098  22.943  11.069  1.00  0.85           O  
ATOM   2291  CB  ASP A 284      31.637  22.633  13.677  1.00  0.85           C  
ATOM   2292  CG  ASP A 284      30.798  23.399  14.682  1.00  0.85           C  
ATOM   2293  OD1 ASP A 284      30.802  23.047  15.887  1.00  0.85           O  
ATOM   2294  OD2 ASP A 284      30.162  24.393  14.246  1.00  0.85           O  
ATOM   2295  N   ASN A 285      28.478  21.926  12.269  1.00  0.79           N  
ATOM   2296  CA  ASN A 285      27.355  22.437  11.496  1.00  0.79           C  
ATOM   2297  C   ASN A 285      27.480  22.197   9.990  1.00  0.79           C  
ATOM   2298  O   ASN A 285      27.147  23.050   9.179  1.00  0.79           O  
ATOM   2299  CB  ASN A 285      27.128  23.947  11.768  1.00  0.79           C  
ATOM   2300  CG  ASN A 285      26.580  24.155  13.169  1.00  0.79           C  
ATOM   2301  OD1 ASN A 285      25.375  24.094  13.393  1.00  0.79           O  
ATOM   2302  ND2 ASN A 285      27.462  24.437  14.153  1.00  0.79           N  
ATOM   2303  N   PHE A 286      27.968  21.007   9.591  1.00  0.83           N  
ATOM   2304  CA  PHE A 286      28.130  20.683   8.194  1.00  0.83           C  
ATOM   2305  C   PHE A 286      27.967  19.183   8.002  1.00  0.83           C  
ATOM   2306  O   PHE A 286      28.550  18.384   8.734  1.00  0.83           O  
ATOM   2307  CB  PHE A 286      29.530  21.150   7.710  1.00  0.83           C  
ATOM   2308  CG  PHE A 286      29.702  20.964   6.230  1.00  0.83           C  
ATOM   2309  CD1 PHE A 286      29.007  21.786   5.329  1.00  0.83           C  
ATOM   2310  CD2 PHE A 286      30.524  19.941   5.729  1.00  0.83           C  
ATOM   2311  CE1 PHE A 286      29.119  21.578   3.948  1.00  0.83           C  
ATOM   2312  CE2 PHE A 286      30.634  19.729   4.350  1.00  0.83           C  
ATOM   2313  CZ  PHE A 286      29.924  20.542   3.459  1.00  0.83           C  
ATOM   2314  N   PHE A 287      27.178  18.767   6.994  1.00  0.85           N  
ATOM   2315  CA  PHE A 287      26.966  17.377   6.651  1.00  0.85           C  
ATOM   2316  C   PHE A 287      27.944  16.963   5.561  1.00  0.85           C  
ATOM   2317  O   PHE A 287      27.886  17.427   4.426  1.00  0.85           O  
ATOM   2318  CB  PHE A 287      25.492  17.156   6.189  1.00  0.85           C  
ATOM   2319  CG  PHE A 287      25.208  15.758   5.686  1.00  0.85           C  
ATOM   2320  CD1 PHE A 287      25.459  14.633   6.487  1.00  0.85           C  
ATOM   2321  CD2 PHE A 287      24.702  15.561   4.389  1.00  0.85           C  
ATOM   2322  CE1 PHE A 287      25.213  13.344   6.004  1.00  0.85           C  
ATOM   2323  CE2 PHE A 287      24.457  14.270   3.901  1.00  0.85           C  
ATOM   2324  CZ  PHE A 287      24.719  13.159   4.709  1.00  0.85           C  
ATOM   2325  N   GLU A 288      28.856  16.025   5.880  1.00  0.78           N  
ATOM   2326  CA  GLU A 288      29.750  15.460   4.892  1.00  0.78           C  
ATOM   2327  C   GLU A 288      29.356  14.013   4.733  1.00  0.78           C  
ATOM   2328  O   GLU A 288      29.479  13.194   5.638  1.00  0.78           O  
ATOM   2329  CB  GLU A 288      31.230  15.555   5.326  1.00  0.78           C  
ATOM   2330  CG  GLU A 288      32.282  15.091   4.283  1.00  0.78           C  
ATOM   2331  CD  GLU A 288      33.636  14.788   4.924  1.00  0.78           C  
ATOM   2332  OE1 GLU A 288      33.831  15.102   6.123  1.00  0.78           O  
ATOM   2333  OE2 GLU A 288      34.506  14.186   4.231  1.00  0.78           O  
ATOM   2334  N   GLY A 289      28.838  13.660   3.543  1.00  0.88           N  
ATOM   2335  CA  GLY A 289      28.196  12.369   3.331  1.00  0.88           C  
ATOM   2336  C   GLY A 289      29.133  11.239   3.008  1.00  0.88           C  
ATOM   2337  O   GLY A 289      29.007  10.592   1.973  1.00  0.88           O  
ATOM   2338  N   LYS A 290      30.098  10.945   3.893  1.00  0.85           N  
ATOM   2339  CA  LYS A 290      31.021   9.839   3.711  1.00  0.85           C  
ATOM   2340  C   LYS A 290      30.536   8.546   4.353  1.00  0.85           C  
ATOM   2341  O   LYS A 290      29.970   8.537   5.442  1.00  0.85           O  
ATOM   2342  CB  LYS A 290      32.429  10.159   4.278  1.00  0.85           C  
ATOM   2343  CG  LYS A 290      33.110  11.397   3.676  1.00  0.85           C  
ATOM   2344  CD  LYS A 290      33.211  11.386   2.144  1.00  0.85           C  
ATOM   2345  CE  LYS A 290      33.711  12.692   1.511  1.00  0.85           C  
ATOM   2346  NZ  LYS A 290      35.031  13.089   2.027  1.00  0.85           N  
ATOM   2347  N   GLU A 291      30.807   7.388   3.704  1.00  0.87           N  
ATOM   2348  CA  GLU A 291      30.466   6.069   4.221  1.00  0.87           C  
ATOM   2349  C   GLU A 291      31.080   5.768   5.578  1.00  0.87           C  
ATOM   2350  O   GLU A 291      30.434   5.196   6.450  1.00  0.87           O  
ATOM   2351  CB  GLU A 291      30.911   4.949   3.249  1.00  0.87           C  
ATOM   2352  CG  GLU A 291      30.370   3.549   3.635  1.00  0.87           C  
ATOM   2353  CD  GLU A 291      31.117   2.406   2.952  1.00  0.87           C  
ATOM   2354  OE1 GLU A 291      32.314   2.198   3.291  1.00  0.87           O  
ATOM   2355  OE2 GLU A 291      30.489   1.681   2.150  1.00  0.87           O  
ATOM   2356  N   LEU A 292      32.344   6.180   5.818  1.00  0.89           N  
ATOM   2357  CA  LEU A 292      33.013   5.970   7.089  1.00  0.89           C  
ATOM   2358  C   LEU A 292      32.264   6.627   8.245  1.00  0.89           C  
ATOM   2359  O   LEU A 292      32.028   6.003   9.274  1.00  0.89           O  
ATOM   2360  CB  LEU A 292      34.476   6.485   7.030  1.00  0.89           C  
ATOM   2361  CG  LEU A 292      35.549   5.669   7.795  1.00  0.89           C  
ATOM   2362  CD1 LEU A 292      36.717   6.585   8.202  1.00  0.89           C  
ATOM   2363  CD2 LEU A 292      35.039   4.930   9.041  1.00  0.89           C  
ATOM   2364  N   ARG A 293      31.782   7.872   8.063  1.00  0.87           N  
ATOM   2365  CA  ARG A 293      30.936   8.557   9.019  1.00  0.87           C  
ATOM   2366  C   ARG A 293      29.623   7.826   9.290  1.00  0.87           C  
ATOM   2367  O   ARG A 293      29.243   7.629  10.436  1.00  0.87           O  
ATOM   2368  CB  ARG A 293      30.663   9.997   8.526  1.00  0.87           C  
ATOM   2369  CG  ARG A 293      29.702  10.800   9.421  1.00  0.87           C  
ATOM   2370  CD  ARG A 293      30.168  10.939  10.873  1.00  0.87           C  
ATOM   2371  NE  ARG A 293      29.069  11.673  11.537  1.00  0.87           N  
ATOM   2372  CZ  ARG A 293      29.123  12.436  12.628  1.00  0.87           C  
ATOM   2373  NH1 ARG A 293      30.224  12.557  13.361  1.00  0.87           N  
ATOM   2374  NH2 ARG A 293      27.995  13.053  12.961  1.00  0.87           N  
ATOM   2375  N   LEU A 294      28.946   7.327   8.238  1.00  0.94           N  
ATOM   2376  CA  LEU A 294      27.754   6.510   8.376  1.00  0.94           C  
ATOM   2377  C   LEU A 294      28.009   5.204   9.126  1.00  0.94           C  
ATOM   2378  O   LEU A 294      27.215   4.763   9.959  1.00  0.94           O  
ATOM   2379  CB  LEU A 294      27.192   6.222   6.971  1.00  0.94           C  
ATOM   2380  CG  LEU A 294      25.884   5.416   6.917  1.00  0.94           C  
ATOM   2381  CD1 LEU A 294      24.722   6.148   7.604  1.00  0.94           C  
ATOM   2382  CD2 LEU A 294      25.548   5.142   5.447  1.00  0.94           C  
ATOM   2383  N   LYS A 295      29.173   4.556   8.891  1.00  0.92           N  
ATOM   2384  CA  LYS A 295      29.606   3.414   9.678  1.00  0.92           C  
ATOM   2385  C   LYS A 295      29.801   3.736  11.137  1.00  0.92           C  
ATOM   2386  O   LYS A 295      29.419   2.940  11.986  1.00  0.92           O  
ATOM   2387  CB  LYS A 295      30.928   2.775   9.197  1.00  0.92           C  
ATOM   2388  CG  LYS A 295      30.804   2.085   7.846  1.00  0.92           C  
ATOM   2389  CD  LYS A 295      32.116   1.428   7.389  1.00  0.92           C  
ATOM   2390  CE  LYS A 295      31.919   0.911   5.969  1.00  0.92           C  
ATOM   2391  NZ  LYS A 295      33.152   0.629   5.216  1.00  0.92           N  
ATOM   2392  N   GLN A 296      30.376   4.911  11.471  1.00  0.93           N  
ATOM   2393  CA  GLN A 296      30.535   5.358  12.842  1.00  0.93           C  
ATOM   2394  C   GLN A 296      29.200   5.479  13.547  1.00  0.93           C  
ATOM   2395  O   GLN A 296      29.010   4.994  14.658  1.00  0.93           O  
ATOM   2396  CB  GLN A 296      31.236   6.742  12.912  1.00  0.93           C  
ATOM   2397  CG  GLN A 296      32.690   6.720  12.406  1.00  0.93           C  
ATOM   2398  CD  GLN A 296      33.428   8.039  12.646  1.00  0.93           C  
ATOM   2399  OE1 GLN A 296      32.866   9.134  12.569  1.00  0.93           O  
ATOM   2400  NE2 GLN A 296      34.749   7.924  12.920  1.00  0.93           N  
ATOM   2401  N   GLU A 297      28.222   6.087  12.866  1.00  0.95           N  
ATOM   2402  CA  GLU A 297      26.885   6.279  13.360  1.00  0.95           C  
ATOM   2403  C   GLU A 297      26.127   4.983  13.579  1.00  0.95           C  
ATOM   2404  O   GLU A 297      25.522   4.774  14.626  1.00  0.95           O  
ATOM   2405  CB  GLU A 297      26.179   7.252  12.413  1.00  0.95           C  
ATOM   2406  CG  GLU A 297      26.840   8.652  12.489  1.00  0.95           C  
ATOM   2407  CD  GLU A 297      26.317   9.626  11.443  1.00  0.95           C  
ATOM   2408  OE1 GLU A 297      25.710   9.169  10.445  1.00  0.95           O  
ATOM   2409  OE2 GLU A 297      26.627  10.839  11.603  1.00  0.95           O  
ATOM   2410  N   TYR A 298      26.197   4.020  12.637  1.00  0.96           N  
ATOM   2411  CA  TYR A 298      25.643   2.699  12.868  1.00  0.96           C  
ATOM   2412  C   TYR A 298      26.377   1.927  13.968  1.00  0.96           C  
ATOM   2413  O   TYR A 298      25.758   1.265  14.799  1.00  0.96           O  
ATOM   2414  CB  TYR A 298      25.572   1.888  11.548  1.00  0.96           C  
ATOM   2415  CG  TYR A 298      24.814   0.608  11.775  1.00  0.96           C  
ATOM   2416  CD1 TYR A 298      23.463   0.654  12.147  1.00  0.96           C  
ATOM   2417  CD2 TYR A 298      25.473  -0.632  11.763  1.00  0.96           C  
ATOM   2418  CE1 TYR A 298      22.792  -0.515  12.523  1.00  0.96           C  
ATOM   2419  CE2 TYR A 298      24.796  -1.800  12.132  1.00  0.96           C  
ATOM   2420  CZ  TYR A 298      23.454  -1.744  12.497  1.00  0.96           C  
ATOM   2421  OH  TYR A 298      22.797  -2.928  12.871  1.00  0.96           O  
ATOM   2422  N   PHE A 299      27.720   2.024  14.021  1.00  0.95           N  
ATOM   2423  CA  PHE A 299      28.552   1.365  15.008  1.00  0.95           C  
ATOM   2424  C   PHE A 299      28.199   1.753  16.440  1.00  0.95           C  
ATOM   2425  O   PHE A 299      27.984   0.888  17.289  1.00  0.95           O  
ATOM   2426  CB  PHE A 299      30.038   1.677  14.657  1.00  0.95           C  
ATOM   2427  CG  PHE A 299      31.033   1.122  15.624  1.00  0.95           C  
ATOM   2428  CD1 PHE A 299      31.403  -0.228  15.574  1.00  0.95           C  
ATOM   2429  CD2 PHE A 299      31.597   1.959  16.600  1.00  0.95           C  
ATOM   2430  CE1 PHE A 299      32.297  -0.747  16.517  1.00  0.95           C  
ATOM   2431  CE2 PHE A 299      32.485   1.443  17.547  1.00  0.95           C  
ATOM   2432  CZ  PHE A 299      32.814   0.086  17.516  1.00  0.95           C  
ATOM   2433  N   VAL A 300      28.055   3.063  16.731  1.00  0.98           N  
ATOM   2434  CA  VAL A 300      27.610   3.509  18.039  1.00  0.98           C  
ATOM   2435  C   VAL A 300      26.183   3.092  18.346  1.00  0.98           C  
ATOM   2436  O   VAL A 300      25.881   2.660  19.451  1.00  0.98           O  
ATOM   2437  CB  VAL A 300      27.816   5.005  18.261  1.00  0.98           C  
ATOM   2438  CG1 VAL A 300      27.058   5.842  17.220  1.00  0.98           C  
ATOM   2439  CG2 VAL A 300      27.390   5.428  19.681  1.00  0.98           C  
ATOM   2440  N   VAL A 301      25.260   3.187  17.371  1.00  0.98           N  
ATOM   2441  CA  VAL A 301      23.876   2.800  17.555  1.00  0.98           C  
ATOM   2442  C   VAL A 301      23.676   1.317  17.854  1.00  0.98           C  
ATOM   2443  O   VAL A 301      23.023   0.961  18.835  1.00  0.98           O  
ATOM   2444  CB  VAL A 301      23.098   3.223  16.318  1.00  0.98           C  
ATOM   2445  CG1 VAL A 301      21.753   2.492  16.203  1.00  0.98           C  
ATOM   2446  CG2 VAL A 301      22.876   4.749  16.381  1.00  0.98           C  
ATOM   2447  N   ALA A 302      24.263   0.407  17.052  1.00  0.98           N  
ATOM   2448  CA  ALA A 302      24.066  -1.020  17.193  1.00  0.98           C  
ATOM   2449  C   ALA A 302      24.631  -1.590  18.482  1.00  0.98           C  
ATOM   2450  O   ALA A 302      24.016  -2.405  19.157  1.00  0.98           O  
ATOM   2451  CB  ALA A 302      24.702  -1.726  15.987  1.00  0.98           C  
ATOM   2452  N   ALA A 303      25.843  -1.151  18.868  1.00  0.97           N  
ATOM   2453  CA  ALA A 303      26.451  -1.551  20.112  1.00  0.97           C  
ATOM   2454  C   ALA A 303      25.699  -1.031  21.334  1.00  0.97           C  
ATOM   2455  O   ALA A 303      25.397  -1.770  22.273  1.00  0.97           O  
ATOM   2456  CB  ALA A 303      27.902  -1.058  20.077  1.00  0.97           C  
ATOM   2457  N   THR A 304      25.307   0.258  21.312  1.00  0.97           N  
ATOM   2458  CA  THR A 304      24.542   0.896  22.374  1.00  0.97           C  
ATOM   2459  C   THR A 304      23.192   0.260  22.611  1.00  0.97           C  
ATOM   2460  O   THR A 304      22.852  -0.081  23.734  1.00  0.97           O  
ATOM   2461  CB  THR A 304      24.317   2.369  22.078  1.00  0.97           C  
ATOM   2462  OG1 THR A 304      25.546   3.074  22.114  1.00  0.97           O  
ATOM   2463  CG2 THR A 304      23.411   3.043  23.109  1.00  0.97           C  
ATOM   2464  N   LEU A 305      22.388   0.029  21.555  1.00  0.97           N  
ATOM   2465  CA  LEU A 305      21.059  -0.542  21.694  1.00  0.97           C  
ATOM   2466  C   LEU A 305      21.093  -1.974  22.220  1.00  0.97           C  
ATOM   2467  O   LEU A 305      20.286  -2.347  23.072  1.00  0.97           O  
ATOM   2468  CB  LEU A 305      20.256  -0.391  20.379  1.00  0.97           C  
ATOM   2469  CG  LEU A 305      19.460   0.936  20.260  1.00  0.97           C  
ATOM   2470  CD1 LEU A 305      20.310   2.212  20.395  1.00  0.97           C  
ATOM   2471  CD2 LEU A 305      18.713   0.978  18.923  1.00  0.97           C  
ATOM   2472  N   GLN A 306      22.080  -2.795  21.795  1.00  0.92           N  
ATOM   2473  CA  GLN A 306      22.316  -4.101  22.389  1.00  0.92           C  
ATOM   2474  C   GLN A 306      22.642  -4.043  23.892  1.00  0.92           C  
ATOM   2475  O   GLN A 306      22.054  -4.778  24.685  1.00  0.92           O  
ATOM   2476  CB  GLN A 306      23.464  -4.838  21.649  1.00  0.92           C  
ATOM   2477  CG  GLN A 306      23.129  -5.306  20.214  1.00  0.92           C  
ATOM   2478  CD  GLN A 306      24.349  -5.947  19.542  1.00  0.92           C  
ATOM   2479  OE1 GLN A 306      24.583  -7.151  19.631  1.00  0.92           O  
ATOM   2480  NE2 GLN A 306      25.148  -5.117  18.835  1.00  0.92           N  
ATOM   2481  N   ASP A 307      23.543  -3.131  24.337  1.00  0.93           N  
ATOM   2482  CA  ASP A 307      23.888  -2.927  25.741  1.00  0.93           C  
ATOM   2483  C   ASP A 307      22.696  -2.415  26.566  1.00  0.93           C  
ATOM   2484  O   ASP A 307      22.470  -2.866  27.692  1.00  0.93           O  
ATOM   2485  CB  ASP A 307      25.160  -2.022  25.819  1.00  0.93           C  
ATOM   2486  CG  ASP A 307      25.970  -2.043  27.109  1.00  0.93           C  
ATOM   2487  OD1 ASP A 307      26.464  -3.112  27.541  1.00  0.93           O  
ATOM   2488  OD2 ASP A 307      26.221  -0.955  27.695  1.00  0.93           O  
ATOM   2489  N   ILE A 308      21.866  -1.502  26.003  1.00  0.95           N  
ATOM   2490  CA  ILE A 308      20.617  -1.038  26.609  1.00  0.95           C  
ATOM   2491  C   ILE A 308      19.617  -2.162  26.841  1.00  0.95           C  
ATOM   2492  O   ILE A 308      19.107  -2.326  27.948  1.00  0.95           O  
ATOM   2493  CB  ILE A 308      19.931   0.045  25.761  1.00  0.95           C  
ATOM   2494  CG1 ILE A 308      20.784   1.334  25.727  1.00  0.95           C  
ATOM   2495  CG2 ILE A 308      18.511   0.369  26.295  1.00  0.95           C  
ATOM   2496  CD1 ILE A 308      20.225   2.424  24.802  1.00  0.95           C  
ATOM   2497  N   ILE A 309      19.336  -2.992  25.811  1.00  0.91           N  
ATOM   2498  CA  ILE A 309      18.402  -4.109  25.904  1.00  0.91           C  
ATOM   2499  C   ILE A 309      18.905  -5.187  26.845  1.00  0.91           C  
ATOM   2500  O   ILE A 309      18.161  -5.703  27.676  1.00  0.91           O  
ATOM   2501  CB  ILE A 309      18.045  -4.669  24.528  1.00  0.91           C  
ATOM   2502  CG1 ILE A 309      17.224  -3.612  23.745  1.00  0.91           C  
ATOM   2503  CG2 ILE A 309      17.251  -5.994  24.654  1.00  0.91           C  
ATOM   2504  CD1 ILE A 309      17.011  -3.959  22.268  1.00  0.91           C  
ATOM   2505  N   ARG A 310      20.209  -5.520  26.796  1.00  0.81           N  
ATOM   2506  CA  ARG A 310      20.820  -6.454  27.722  1.00  0.81           C  
ATOM   2507  C   ARG A 310      20.714  -5.996  29.172  1.00  0.81           C  
ATOM   2508  O   ARG A 310      20.370  -6.774  30.055  1.00  0.81           O  
ATOM   2509  CB  ARG A 310      22.313  -6.607  27.361  1.00  0.81           C  
ATOM   2510  CG  ARG A 310      23.097  -7.643  28.195  1.00  0.81           C  
ATOM   2511  CD  ARG A 310      24.528  -7.196  28.520  1.00  0.81           C  
ATOM   2512  NE  ARG A 310      24.427  -6.063  29.493  1.00  0.81           N  
ATOM   2513  CZ  ARG A 310      25.338  -5.104  29.645  1.00  0.81           C  
ATOM   2514  NH1 ARG A 310      26.546  -5.174  29.121  1.00  0.81           N  
ATOM   2515  NH2 ARG A 310      25.023  -3.981  30.267  1.00  0.81           N  
ATOM   2516  N   ARG A 311      20.983  -4.698  29.441  1.00  0.83           N  
ATOM   2517  CA  ARG A 311      20.810  -4.091  30.749  1.00  0.83           C  
ATOM   2518  C   ARG A 311      19.371  -4.048  31.221  1.00  0.83           C  
ATOM   2519  O   ARG A 311      19.094  -4.229  32.401  1.00  0.83           O  
ATOM   2520  CB  ARG A 311      21.422  -2.668  30.796  1.00  0.83           C  
ATOM   2521  CG  ARG A 311      21.399  -2.045  32.213  1.00  0.83           C  
ATOM   2522  CD  ARG A 311      22.217  -0.765  32.450  1.00  0.83           C  
ATOM   2523  NE  ARG A 311      23.647  -1.015  32.078  1.00  0.83           N  
ATOM   2524  CZ  ARG A 311      24.191  -0.572  30.938  1.00  0.83           C  
ATOM   2525  NH1 ARG A 311      23.452   0.009  30.002  1.00  0.83           N  
ATOM   2526  NH2 ARG A 311      25.494  -0.734  30.705  1.00  0.83           N  
ATOM   2527  N   PHE A 312      18.410  -3.805  30.306  1.00  0.85           N  
ATOM   2528  CA  PHE A 312      16.998  -3.884  30.613  1.00  0.85           C  
ATOM   2529  C   PHE A 312      16.613  -5.286  31.068  1.00  0.85           C  
ATOM   2530  O   PHE A 312      15.993  -5.423  32.120  1.00  0.85           O  
ATOM   2531  CB  PHE A 312      16.189  -3.435  29.359  1.00  0.85           C  
ATOM   2532  CG  PHE A 312      14.697  -3.603  29.478  1.00  0.85           C  
ATOM   2533  CD1 PHE A 312      13.919  -2.692  30.207  1.00  0.85           C  
ATOM   2534  CD2 PHE A 312      14.063  -4.675  28.826  1.00  0.85           C  
ATOM   2535  CE1 PHE A 312      12.526  -2.834  30.259  1.00  0.85           C  
ATOM   2536  CE2 PHE A 312      12.669  -4.809  28.863  1.00  0.85           C  
ATOM   2537  CZ  PHE A 312      11.898  -3.882  29.573  1.00  0.85           C  
ATOM   2538  N   LYS A 313      17.020  -6.340  30.327  1.00  0.76           N  
ATOM   2539  CA  LYS A 313      16.678  -7.717  30.631  1.00  0.76           C  
ATOM   2540  C   LYS A 313      17.223  -8.246  31.960  1.00  0.76           C  
ATOM   2541  O   LYS A 313      16.496  -8.898  32.712  1.00  0.76           O  
ATOM   2542  CB  LYS A 313      17.086  -8.684  29.485  1.00  0.76           C  
ATOM   2543  CG  LYS A 313      16.311  -8.490  28.168  1.00  0.76           C  
ATOM   2544  CD  LYS A 313      16.517  -9.631  27.152  1.00  0.76           C  
ATOM   2545  CE  LYS A 313      15.678  -9.415  25.881  1.00  0.76           C  
ATOM   2546  NZ  LYS A 313      15.786 -10.548  24.946  1.00  0.76           N  
ATOM   2547  N   SER A 314      18.502  -7.977  32.307  1.00  0.76           N  
ATOM   2548  CA  SER A 314      19.112  -8.434  33.556  1.00  0.76           C  
ATOM   2549  C   SER A 314      18.873  -7.498  34.728  1.00  0.76           C  
ATOM   2550  O   SER A 314      19.777  -7.013  35.390  1.00  0.76           O  
ATOM   2551  CB  SER A 314      20.631  -8.725  33.433  1.00  0.76           C  
ATOM   2552  OG  SER A 314      21.364  -7.620  32.893  1.00  0.76           O  
ATOM   2553  N   SER A 315      17.592  -7.231  35.030  1.00  0.73           N  
ATOM   2554  CA  SER A 315      17.195  -6.254  36.027  1.00  0.73           C  
ATOM   2555  C   SER A 315      17.357  -6.613  37.492  1.00  0.73           C  
ATOM   2556  O   SER A 315      17.414  -5.725  38.338  1.00  0.73           O  
ATOM   2557  CB  SER A 315      15.717  -5.850  35.833  1.00  0.73           C  
ATOM   2558  OG  SER A 315      14.825  -6.968  35.903  1.00  0.73           O  
ATOM   2559  N   LYS A 316      17.411  -7.904  37.861  1.00  0.57           N  
ATOM   2560  CA  LYS A 316      17.458  -8.303  39.257  1.00  0.57           C  
ATOM   2561  C   LYS A 316      18.808  -8.071  39.927  1.00  0.57           C  
ATOM   2562  O   LYS A 316      19.842  -8.540  39.467  1.00  0.57           O  
ATOM   2563  CB  LYS A 316      17.065  -9.794  39.412  1.00  0.57           C  
ATOM   2564  CG  LYS A 316      17.038 -10.297  40.868  1.00  0.57           C  
ATOM   2565  CD  LYS A 316      16.508 -11.734  41.010  1.00  0.57           C  
ATOM   2566  CE  LYS A 316      16.496 -12.186  42.476  1.00  0.57           C  
ATOM   2567  NZ  LYS A 316      15.943 -13.553  42.619  1.00  0.57           N  
ATOM   2568  N   PHE A 317      18.833  -7.371  41.086  1.00  0.50           N  
ATOM   2569  CA  PHE A 317      20.045  -7.190  41.869  1.00  0.50           C  
ATOM   2570  C   PHE A 317      20.731  -8.504  42.243  1.00  0.50           C  
ATOM   2571  O   PHE A 317      20.127  -9.433  42.776  1.00  0.50           O  
ATOM   2572  CB  PHE A 317      19.752  -6.357  43.151  1.00  0.50           C  
ATOM   2573  CG  PHE A 317      21.005  -5.991  43.920  1.00  0.50           C  
ATOM   2574  CD1 PHE A 317      21.609  -6.909  44.802  1.00  0.50           C  
ATOM   2575  CD2 PHE A 317      21.590  -4.727  43.769  1.00  0.50           C  
ATOM   2576  CE1 PHE A 317      22.784  -6.578  45.490  1.00  0.50           C  
ATOM   2577  CE2 PHE A 317      22.754  -4.388  44.465  1.00  0.50           C  
ATOM   2578  CZ  PHE A 317      23.360  -5.315  45.319  1.00  0.50           C  
ATOM   2579  N   GLY A 318      22.049  -8.584  41.961  1.00  0.66           N  
ATOM   2580  CA  GLY A 318      22.875  -9.732  42.304  1.00  0.66           C  
ATOM   2581  C   GLY A 318      22.740 -10.897  41.376  1.00  0.66           C  
ATOM   2582  O   GLY A 318      23.348 -11.936  41.603  1.00  0.66           O  
ATOM   2583  N   CYS A 319      21.946 -10.757  40.307  1.00  0.67           N  
ATOM   2584  CA  CYS A 319      21.661 -11.831  39.392  1.00  0.67           C  
ATOM   2585  C   CYS A 319      21.851 -11.312  37.985  1.00  0.67           C  
ATOM   2586  O   CYS A 319      21.463 -10.194  37.670  1.00  0.67           O  
ATOM   2587  CB  CYS A 319      20.202 -12.287  39.607  1.00  0.67           C  
ATOM   2588  SG  CYS A 319      19.646 -13.577  38.450  1.00  0.67           S  
ATOM   2589  N   ARG A 320      22.474 -12.097  37.086  1.00  0.56           N  
ATOM   2590  CA  ARG A 320      22.719 -11.609  35.741  1.00  0.56           C  
ATOM   2591  C   ARG A 320      21.859 -12.293  34.708  1.00  0.56           C  
ATOM   2592  O   ARG A 320      21.989 -12.018  33.518  1.00  0.56           O  
ATOM   2593  CB  ARG A 320      24.208 -11.731  35.356  1.00  0.56           C  
ATOM   2594  CG  ARG A 320      25.097 -10.766  36.161  1.00  0.56           C  
ATOM   2595  CD  ARG A 320      26.511 -10.614  35.600  1.00  0.56           C  
ATOM   2596  NE  ARG A 320      27.192 -11.935  35.760  1.00  0.56           N  
ATOM   2597  CZ  ARG A 320      28.374 -12.261  35.228  1.00  0.56           C  
ATOM   2598  NH1 ARG A 320      29.081 -11.402  34.503  1.00  0.56           N  
ATOM   2599  NH2 ARG A 320      28.862 -13.484  35.429  1.00  0.56           N  
ATOM   2600  N   ASP A 321      20.944 -13.180  35.142  1.00  0.60           N  
ATOM   2601  CA  ASP A 321      20.030 -13.868  34.264  1.00  0.60           C  
ATOM   2602  C   ASP A 321      19.091 -12.904  33.535  1.00  0.60           C  
ATOM   2603  O   ASP A 321      18.674 -11.908  34.135  1.00  0.60           O  
ATOM   2604  CB  ASP A 321      19.174 -14.902  35.026  1.00  0.60           C  
ATOM   2605  CG  ASP A 321      20.051 -15.934  35.710  1.00  0.60           C  
ATOM   2606  OD1 ASP A 321      21.116 -16.284  35.142  1.00  0.60           O  
ATOM   2607  OD2 ASP A 321      19.656 -16.371  36.820  1.00  0.60           O  
ATOM   2608  N   PRO A 322      18.703 -13.120  32.279  1.00  0.64           N  
ATOM   2609  CA  PRO A 322      17.772 -12.227  31.593  1.00  0.64           C  
ATOM   2610  C   PRO A 322      16.333 -12.455  32.036  1.00  0.64           C  
ATOM   2611  O   PRO A 322      15.507 -12.901  31.252  1.00  0.64           O  
ATOM   2612  CB  PRO A 322      17.980 -12.565  30.097  1.00  0.64           C  
ATOM   2613  CG  PRO A 322      19.394 -13.141  30.038  1.00  0.64           C  
ATOM   2614  CD  PRO A 322      19.474 -13.929  31.337  1.00  0.64           C  
ATOM   2615  N   VAL A 323      16.024 -12.131  33.307  1.00  0.66           N  
ATOM   2616  CA  VAL A 323      14.754 -12.366  33.967  1.00  0.66           C  
ATOM   2617  C   VAL A 323      13.582 -11.639  33.334  1.00  0.66           C  
ATOM   2618  O   VAL A 323      12.468 -12.148  33.253  1.00  0.66           O  
ATOM   2619  CB  VAL A 323      14.809 -12.070  35.470  1.00  0.66           C  
ATOM   2620  CG1 VAL A 323      15.840 -13.013  36.122  1.00  0.66           C  
ATOM   2621  CG2 VAL A 323      15.153 -10.595  35.776  1.00  0.66           C  
ATOM   2622  N   ARG A 324      13.810 -10.406  32.861  1.00  0.57           N  
ATOM   2623  CA  ARG A 324      12.799  -9.569  32.266  1.00  0.57           C  
ATOM   2624  C   ARG A 324      12.822  -9.692  30.750  1.00  0.57           C  
ATOM   2625  O   ARG A 324      13.513  -8.970  30.036  1.00  0.57           O  
ATOM   2626  CB  ARG A 324      13.089  -8.135  32.730  1.00  0.57           C  
ATOM   2627  CG  ARG A 324      12.210  -6.996  32.186  1.00  0.57           C  
ATOM   2628  CD  ARG A 324      12.946  -5.675  32.422  1.00  0.57           C  
ATOM   2629  NE  ARG A 324      12.310  -4.920  33.530  1.00  0.57           N  
ATOM   2630  CZ  ARG A 324      12.916  -3.935  34.207  1.00  0.57           C  
ATOM   2631  NH1 ARG A 324      14.153  -3.526  33.962  1.00  0.57           N  
ATOM   2632  NH2 ARG A 324      12.258  -3.382  35.212  1.00  0.57           N  
ATOM   2633  N   THR A 325      12.017 -10.619  30.211  1.00  0.70           N  
ATOM   2634  CA  THR A 325      11.936 -10.882  28.779  1.00  0.70           C  
ATOM   2635  C   THR A 325      10.789 -10.131  28.136  1.00  0.70           C  
ATOM   2636  O   THR A 325      10.679 -10.056  26.916  1.00  0.70           O  
ATOM   2637  CB  THR A 325      11.732 -12.368  28.520  1.00  0.70           C  
ATOM   2638  OG1 THR A 325      10.690 -12.887  29.338  1.00  0.70           O  
ATOM   2639  CG2 THR A 325      13.019 -13.110  28.907  1.00  0.70           C  
ATOM   2640  N   ASN A 326       9.923  -9.509  28.958  1.00  0.71           N  
ATOM   2641  CA  ASN A 326       8.791  -8.734  28.508  1.00  0.71           C  
ATOM   2642  C   ASN A 326       9.160  -7.262  28.344  1.00  0.71           C  
ATOM   2643  O   ASN A 326       9.762  -6.635  29.215  1.00  0.71           O  
ATOM   2644  CB  ASN A 326       7.602  -8.910  29.495  1.00  0.71           C  
ATOM   2645  CG  ASN A 326       6.350  -8.221  28.963  1.00  0.71           C  
ATOM   2646  OD1 ASN A 326       6.167  -8.170  27.750  1.00  0.71           O  
ATOM   2647  ND2 ASN A 326       5.524  -7.650  29.870  1.00  0.71           N  
ATOM   2648  N   PHE A 327       8.753  -6.681  27.201  1.00  0.83           N  
ATOM   2649  CA  PHE A 327       9.114  -5.341  26.791  1.00  0.83           C  
ATOM   2650  C   PHE A 327       8.019  -4.321  27.025  1.00  0.83           C  
ATOM   2651  O   PHE A 327       8.195  -3.150  26.695  1.00  0.83           O  
ATOM   2652  CB  PHE A 327       9.413  -5.309  25.278  1.00  0.83           C  
ATOM   2653  CG  PHE A 327      10.802  -5.783  24.986  1.00  0.83           C  
ATOM   2654  CD1 PHE A 327      11.865  -4.866  24.974  1.00  0.83           C  
ATOM   2655  CD2 PHE A 327      11.054  -7.122  24.659  1.00  0.83           C  
ATOM   2656  CE1 PHE A 327      13.161  -5.276  24.647  1.00  0.83           C  
ATOM   2657  CE2 PHE A 327      12.349  -7.538  24.330  1.00  0.83           C  
ATOM   2658  CZ  PHE A 327      13.404  -6.616  24.325  1.00  0.83           C  
ATOM   2659  N   ASP A 328       6.873  -4.691  27.626  1.00  0.81           N  
ATOM   2660  CA  ASP A 328       5.775  -3.770  27.865  1.00  0.81           C  
ATOM   2661  C   ASP A 328       6.201  -2.560  28.717  1.00  0.81           C  
ATOM   2662  O   ASP A 328       5.804  -1.428  28.461  1.00  0.81           O  
ATOM   2663  CB  ASP A 328       4.593  -4.533  28.508  1.00  0.81           C  
ATOM   2664  CG  ASP A 328       4.079  -5.695  27.666  1.00  0.81           C  
ATOM   2665  OD1 ASP A 328       4.287  -5.743  26.431  1.00  0.81           O  
ATOM   2666  OD2 ASP A 328       3.469  -6.593  28.291  1.00  0.81           O  
ATOM   2667  N   ALA A 329       7.109  -2.782  29.697  1.00  0.85           N  
ATOM   2668  CA  ALA A 329       7.675  -1.735  30.522  1.00  0.85           C  
ATOM   2669  C   ALA A 329       8.981  -1.141  29.983  1.00  0.85           C  
ATOM   2670  O   ALA A 329       9.675  -0.415  30.691  1.00  0.85           O  
ATOM   2671  CB  ALA A 329       7.949  -2.315  31.926  1.00  0.85           C  
ATOM   2672  N   PHE A 330       9.375  -1.410  28.718  1.00  0.90           N  
ATOM   2673  CA  PHE A 330      10.575  -0.830  28.120  1.00  0.90           C  
ATOM   2674  C   PHE A 330      10.546   0.692  28.026  1.00  0.90           C  
ATOM   2675  O   PHE A 330      11.527   1.300  28.458  1.00  0.90           O  
ATOM   2676  CB  PHE A 330      10.905  -1.513  26.762  1.00  0.90           C  
ATOM   2677  CG  PHE A 330      12.268  -1.182  26.205  1.00  0.90           C  
ATOM   2678  CD1 PHE A 330      13.386  -1.961  26.538  1.00  0.90           C  
ATOM   2679  CD2 PHE A 330      12.435  -0.138  25.285  1.00  0.90           C  
ATOM   2680  CE1 PHE A 330      14.644  -1.708  25.977  1.00  0.90           C  
ATOM   2681  CE2 PHE A 330      13.689   0.125  24.717  1.00  0.90           C  
ATOM   2682  CZ  PHE A 330      14.796  -0.657  25.066  1.00  0.90           C  
ATOM   2683  N   PRO A 331       9.497   1.394  27.596  1.00  0.95           N  
ATOM   2684  CA  PRO A 331       9.546   2.847  27.516  1.00  0.95           C  
ATOM   2685  C   PRO A 331       9.489   3.509  28.870  1.00  0.95           C  
ATOM   2686  O   PRO A 331       9.705   4.713  28.956  1.00  0.95           O  
ATOM   2687  CB  PRO A 331       8.318   3.217  26.675  1.00  0.95           C  
ATOM   2688  CG  PRO A 331       8.048   1.955  25.859  1.00  0.95           C  
ATOM   2689  CD  PRO A 331       8.342   0.862  26.872  1.00  0.95           C  
ATOM   2690  N   ASP A 332       9.197   2.755  29.942  1.00  0.90           N  
ATOM   2691  CA  ASP A 332       9.109   3.282  31.282  1.00  0.90           C  
ATOM   2692  C   ASP A 332      10.367   2.940  32.065  1.00  0.90           C  
ATOM   2693  O   ASP A 332      10.544   3.355  33.210  1.00  0.90           O  
ATOM   2694  CB  ASP A 332       7.839   2.723  31.956  1.00  0.90           C  
ATOM   2695  CG  ASP A 332       6.663   3.108  31.071  1.00  0.90           C  
ATOM   2696  OD1 ASP A 332       6.439   4.333  30.899  1.00  0.90           O  
ATOM   2697  OD2 ASP A 332       6.024   2.189  30.492  1.00  0.90           O  
ATOM   2698  N   LYS A 333      11.314   2.207  31.437  1.00  0.90           N  
ATOM   2699  CA  LYS A 333      12.594   1.890  32.037  1.00  0.90           C  
ATOM   2700  C   LYS A 333      13.765   2.335  31.181  1.00  0.90           C  
ATOM   2701  O   LYS A 333      14.912   2.286  31.621  1.00  0.90           O  
ATOM   2702  CB  LYS A 333      12.714   0.371  32.289  1.00  0.90           C  
ATOM   2703  CG  LYS A 333      11.679  -0.163  33.292  1.00  0.90           C  
ATOM   2704  CD  LYS A 333      11.857   0.427  34.699  1.00  0.90           C  
ATOM   2705  CE  LYS A 333      10.759  -0.007  35.668  1.00  0.90           C  
ATOM   2706  NZ  LYS A 333      11.148   0.355  37.039  1.00  0.90           N  
ATOM   2707  N   VAL A 334      13.499   2.829  29.958  1.00  0.95           N  
ATOM   2708  CA  VAL A 334      14.518   3.264  29.021  1.00  0.95           C  
ATOM   2709  C   VAL A 334      14.070   4.553  28.344  1.00  0.95           C  
ATOM   2710  O   VAL A 334      12.946   4.686  27.886  1.00  0.95           O  
ATOM   2711  CB  VAL A 334      14.773   2.214  27.937  1.00  0.95           C  
ATOM   2712  CG1 VAL A 334      15.868   2.668  26.949  1.00  0.95           C  
ATOM   2713  CG2 VAL A 334      15.162   0.869  28.589  1.00  0.95           C  
ATOM   2714  N   ALA A 335      14.967   5.560  28.275  1.00  0.98           N  
ATOM   2715  CA  ALA A 335      14.814   6.714  27.411  1.00  0.98           C  
ATOM   2716  C   ALA A 335      16.048   6.814  26.534  1.00  0.98           C  
ATOM   2717  O   ALA A 335      17.168   6.679  27.017  1.00  0.98           O  
ATOM   2718  CB  ALA A 335      14.670   8.038  28.197  1.00  0.98           C  
ATOM   2719  N   ILE A 336      15.876   7.052  25.221  1.00  0.97           N  
ATOM   2720  CA  ILE A 336      16.990   7.264  24.309  1.00  0.97           C  
ATOM   2721  C   ILE A 336      16.869   8.666  23.743  1.00  0.97           C  
ATOM   2722  O   ILE A 336      15.956   8.991  22.990  1.00  0.97           O  
ATOM   2723  CB  ILE A 336      17.044   6.229  23.178  1.00  0.97           C  
ATOM   2724  CG1 ILE A 336      17.265   4.813  23.759  1.00  0.97           C  
ATOM   2725  CG2 ILE A 336      18.177   6.560  22.182  1.00  0.97           C  
ATOM   2726  CD1 ILE A 336      17.239   3.694  22.708  1.00  0.97           C  
ATOM   2727  N   GLN A 337      17.818   9.553  24.093  1.00  0.97           N  
ATOM   2728  CA  GLN A 337      17.833  10.909  23.590  1.00  0.97           C  
ATOM   2729  C   GLN A 337      18.840  11.003  22.462  1.00  0.97           C  
ATOM   2730  O   GLN A 337      20.031  10.744  22.639  1.00  0.97           O  
ATOM   2731  CB  GLN A 337      18.209  11.925  24.698  1.00  0.97           C  
ATOM   2732  CG  GLN A 337      18.012  13.413  24.301  1.00  0.97           C  
ATOM   2733  CD  GLN A 337      16.534  13.764  24.121  1.00  0.97           C  
ATOM   2734  OE1 GLN A 337      15.684  13.370  24.922  1.00  0.97           O  
ATOM   2735  NE2 GLN A 337      16.213  14.549  23.072  1.00  0.97           N  
ATOM   2736  N   LEU A 338      18.372  11.372  21.257  1.00  0.98           N  
ATOM   2737  CA  LEU A 338      19.210  11.525  20.089  1.00  0.98           C  
ATOM   2738  C   LEU A 338      19.774  12.932  20.055  1.00  0.98           C  
ATOM   2739  O   LEU A 338      19.058  13.911  19.841  1.00  0.98           O  
ATOM   2740  CB  LEU A 338      18.428  11.297  18.760  1.00  0.98           C  
ATOM   2741  CG  LEU A 338      18.125   9.835  18.337  1.00  0.98           C  
ATOM   2742  CD1 LEU A 338      18.552   8.765  19.351  1.00  0.98           C  
ATOM   2743  CD2 LEU A 338      16.634   9.666  17.999  1.00  0.98           C  
ATOM   2744  N   ASN A 339      21.104  13.059  20.252  1.00  0.96           N  
ATOM   2745  CA  ASN A 339      21.798  14.314  20.075  1.00  0.96           C  
ATOM   2746  C   ASN A 339      22.030  14.539  18.582  1.00  0.96           C  
ATOM   2747  O   ASN A 339      22.888  13.902  17.973  1.00  0.96           O  
ATOM   2748  CB  ASN A 339      23.132  14.282  20.878  1.00  0.96           C  
ATOM   2749  CG  ASN A 339      23.707  15.670  21.137  1.00  0.96           C  
ATOM   2750  OD1 ASN A 339      22.966  16.612  21.392  1.00  0.96           O  
ATOM   2751  ND2 ASN A 339      25.056  15.791  21.166  1.00  0.96           N  
ATOM   2752  N   ASP A 340      21.239  15.449  17.973  1.00  0.95           N  
ATOM   2753  CA  ASP A 340      21.171  15.672  16.538  1.00  0.95           C  
ATOM   2754  C   ASP A 340      20.696  14.455  15.737  1.00  0.95           C  
ATOM   2755  O   ASP A 340      20.153  13.494  16.287  1.00  0.95           O  
ATOM   2756  CB  ASP A 340      22.496  16.288  16.014  1.00  0.95           C  
ATOM   2757  CG  ASP A 340      22.228  17.358  14.970  1.00  0.95           C  
ATOM   2758  OD1 ASP A 340      21.718  16.985  13.887  1.00  0.95           O  
ATOM   2759  OD2 ASP A 340      22.476  18.555  15.256  1.00  0.95           O  
ATOM   2760  N   THR A 341      20.858  14.456  14.394  1.00  0.95           N  
ATOM   2761  CA  THR A 341      20.424  13.297  13.579  1.00  0.95           C  
ATOM   2762  C   THR A 341      21.453  12.216  13.454  1.00  0.95           C  
ATOM   2763  O   THR A 341      21.175  11.156  12.910  1.00  0.95           O  
ATOM   2764  CB  THR A 341      19.835  13.531  12.248  1.00  0.95           C  
ATOM   2765  OG1 THR A 341      20.852  14.153  11.382  1.00  0.95           O  
ATOM   2766  CG2 THR A 341      18.642  14.417  12.386  1.00  0.95           C  
ATOM   2767  N   HIS A 342      22.651  12.449  14.001  1.00  0.95           N  
ATOM   2768  CA  HIS A 342      23.773  11.535  13.935  1.00  0.95           C  
ATOM   2769  C   HIS A 342      23.499  10.161  14.550  1.00  0.95           C  
ATOM   2770  O   HIS A 342      23.992   9.174  14.014  1.00  0.95           O  
ATOM   2771  CB  HIS A 342      25.049  12.151  14.557  1.00  0.95           C  
ATOM   2772  CG  HIS A 342      25.307  13.599  14.255  1.00  0.95           C  
ATOM   2773  ND1 HIS A 342      26.173  14.295  15.085  1.00  0.95           N  
ATOM   2774  CD2 HIS A 342      24.791  14.430  13.315  1.00  0.95           C  
ATOM   2775  CE1 HIS A 342      26.142  15.541  14.639  1.00  0.95           C  
ATOM   2776  NE2 HIS A 342      25.325  15.673  13.568  1.00  0.95           N  
ATOM   2777  N   PRO A 343      22.715   9.966  15.623  1.00  0.99           N  
ATOM   2778  CA  PRO A 343      22.403   8.614  16.074  1.00  0.99           C  
ATOM   2779  C   PRO A 343      20.977   8.275  15.703  1.00  0.99           C  
ATOM   2780  O   PRO A 343      20.362   7.428  16.352  1.00  0.99           O  
ATOM   2781  CB  PRO A 343      22.576   8.719  17.592  1.00  0.99           C  
ATOM   2782  CG  PRO A 343      22.069  10.122  17.910  1.00  0.99           C  
ATOM   2783  CD  PRO A 343      22.578  10.935  16.721  1.00  0.99           C  
ATOM   2784  N   SER A 344      20.443   8.851  14.605  1.00  0.98           N  
ATOM   2785  CA  SER A 344      19.082   8.627  14.122  1.00  0.98           C  
ATOM   2786  C   SER A 344      18.761   7.185  13.796  1.00  0.98           C  
ATOM   2787  O   SER A 344      17.653   6.725  14.011  1.00  0.98           O  
ATOM   2788  CB  SER A 344      18.668   9.500  12.916  1.00  0.98           C  
ATOM   2789  OG  SER A 344      19.527   9.320  11.779  1.00  0.98           O  
ATOM   2790  N   LEU A 345      19.773   6.421  13.322  1.00  0.97           N  
ATOM   2791  CA  LEU A 345      19.665   5.006  13.032  1.00  0.97           C  
ATOM   2792  C   LEU A 345      19.230   4.135  14.206  1.00  0.97           C  
ATOM   2793  O   LEU A 345      18.843   2.988  14.015  1.00  0.97           O  
ATOM   2794  CB  LEU A 345      21.001   4.469  12.464  1.00  0.97           C  
ATOM   2795  CG  LEU A 345      21.336   4.994  11.052  1.00  0.97           C  
ATOM   2796  CD1 LEU A 345      22.730   4.513  10.625  1.00  0.97           C  
ATOM   2797  CD2 LEU A 345      20.298   4.545  10.007  1.00  0.97           C  
ATOM   2798  N   ALA A 346      19.193   4.686  15.440  1.00  0.99           N  
ATOM   2799  CA  ALA A 346      18.607   4.061  16.604  1.00  0.99           C  
ATOM   2800  C   ALA A 346      17.136   3.718  16.415  1.00  0.99           C  
ATOM   2801  O   ALA A 346      16.675   2.669  16.856  1.00  0.99           O  
ATOM   2802  CB  ALA A 346      18.794   4.973  17.834  1.00  0.99           C  
ATOM   2803  N   ILE A 347      16.364   4.569  15.716  1.00  0.97           N  
ATOM   2804  CA  ILE A 347      14.968   4.308  15.389  1.00  0.97           C  
ATOM   2805  C   ILE A 347      14.754   3.083  14.490  1.00  0.97           C  
ATOM   2806  O   ILE A 347      13.963   2.218  14.877  1.00  0.97           O  
ATOM   2807  CB  ILE A 347      14.326   5.568  14.812  1.00  0.97           C  
ATOM   2808  CG1 ILE A 347      14.329   6.688  15.878  1.00  0.97           C  
ATOM   2809  CG2 ILE A 347      12.886   5.293  14.322  1.00  0.97           C  
ATOM   2810  CD1 ILE A 347      13.981   8.064  15.313  1.00  0.97           C  
ATOM   2811  N   PRO A 348      15.424   2.864  13.348  1.00  0.99           N  
ATOM   2812  CA  PRO A 348      15.234   1.633  12.598  1.00  0.99           C  
ATOM   2813  C   PRO A 348      15.992   0.468  13.206  1.00  0.99           C  
ATOM   2814  O   PRO A 348      15.548  -0.661  13.019  1.00  0.99           O  
ATOM   2815  CB  PRO A 348      15.684   1.980  11.168  1.00  0.99           C  
ATOM   2816  CG  PRO A 348      16.674   3.127  11.357  1.00  0.99           C  
ATOM   2817  CD  PRO A 348      16.045   3.898  12.517  1.00  0.99           C  
ATOM   2818  N   GLU A 349      17.115   0.673  13.923  1.00  0.95           N  
ATOM   2819  CA  GLU A 349      17.810  -0.399  14.619  1.00  0.95           C  
ATOM   2820  C   GLU A 349      17.008  -0.987  15.768  1.00  0.95           C  
ATOM   2821  O   GLU A 349      16.918  -2.200  15.928  1.00  0.95           O  
ATOM   2822  CB  GLU A 349      19.207   0.067  15.094  1.00  0.95           C  
ATOM   2823  CG  GLU A 349      20.032  -0.958  15.929  1.00  0.95           C  
ATOM   2824  CD  GLU A 349      20.362  -2.261  15.212  1.00  0.95           C  
ATOM   2825  OE1 GLU A 349      20.000  -2.409  14.018  1.00  0.95           O  
ATOM   2826  OE2 GLU A 349      20.965  -3.178  15.830  1.00  0.95           O  
ATOM   2827  N   LEU A 350      16.329  -0.147  16.576  1.00  0.96           N  
ATOM   2828  CA  LEU A 350      15.453  -0.621  17.632  1.00  0.96           C  
ATOM   2829  C   LEU A 350      14.292  -1.420  17.076  1.00  0.96           C  
ATOM   2830  O   LEU A 350      13.977  -2.506  17.556  1.00  0.96           O  
ATOM   2831  CB  LEU A 350      14.975   0.559  18.507  1.00  0.96           C  
ATOM   2832  CG  LEU A 350      14.111   0.188  19.728  1.00  0.96           C  
ATOM   2833  CD1 LEU A 350      14.773  -0.872  20.626  1.00  0.96           C  
ATOM   2834  CD2 LEU A 350      13.811   1.453  20.545  1.00  0.96           C  
ATOM   2835  N   MET A 351      13.695  -0.950  15.964  1.00  0.93           N  
ATOM   2836  CA  MET A 351      12.711  -1.717  15.227  1.00  0.93           C  
ATOM   2837  C   MET A 351      13.232  -3.034  14.684  1.00  0.93           C  
ATOM   2838  O   MET A 351      12.565  -4.058  14.811  1.00  0.93           O  
ATOM   2839  CB  MET A 351      12.124  -0.876  14.070  1.00  0.93           C  
ATOM   2840  CG  MET A 351      11.145   0.200  14.559  1.00  0.93           C  
ATOM   2841  SD  MET A 351       9.752  -0.505  15.488  1.00  0.93           S  
ATOM   2842  CE  MET A 351       8.859  -1.215  14.080  1.00  0.93           C  
ATOM   2843  N   ARG A 352      14.454  -3.059  14.118  1.00  0.91           N  
ATOM   2844  CA  ARG A 352      15.087  -4.278  13.652  1.00  0.91           C  
ATOM   2845  C   ARG A 352      15.299  -5.303  14.761  1.00  0.91           C  
ATOM   2846  O   ARG A 352      14.990  -6.484  14.610  1.00  0.91           O  
ATOM   2847  CB  ARG A 352      16.462  -3.950  13.021  1.00  0.91           C  
ATOM   2848  CG  ARG A 352      17.102  -5.137  12.278  1.00  0.91           C  
ATOM   2849  CD  ARG A 352      18.514  -4.836  11.766  1.00  0.91           C  
ATOM   2850  NE  ARG A 352      19.440  -4.732  12.931  1.00  0.91           N  
ATOM   2851  CZ  ARG A 352      20.081  -5.740  13.525  1.00  0.91           C  
ATOM   2852  NH1 ARG A 352      19.880  -7.010  13.171  1.00  0.91           N  
ATOM   2853  NH2 ARG A 352      20.939  -5.475  14.504  1.00  0.91           N  
ATOM   2854  N   ILE A 353      15.800  -4.869  15.937  1.00  0.93           N  
ATOM   2855  CA  ILE A 353      15.986  -5.747  17.082  1.00  0.93           C  
ATOM   2856  C   ILE A 353      14.664  -6.288  17.612  1.00  0.93           C  
ATOM   2857  O   ILE A 353      14.511  -7.491  17.822  1.00  0.93           O  
ATOM   2858  CB  ILE A 353      16.782  -5.079  18.206  1.00  0.93           C  
ATOM   2859  CG1 ILE A 353      18.204  -4.699  17.721  1.00  0.93           C  
ATOM   2860  CG2 ILE A 353      16.869  -6.040  19.416  1.00  0.93           C  
ATOM   2861  CD1 ILE A 353      18.988  -3.815  18.705  1.00  0.93           C  
ATOM   2862  N   LEU A 354      13.642  -5.430  17.798  1.00  0.90           N  
ATOM   2863  CA  LEU A 354      12.357  -5.874  18.304  1.00  0.90           C  
ATOM   2864  C   LEU A 354      11.600  -6.794  17.345  1.00  0.90           C  
ATOM   2865  O   LEU A 354      11.098  -7.839  17.751  1.00  0.90           O  
ATOM   2866  CB  LEU A 354      11.465  -4.666  18.699  1.00  0.90           C  
ATOM   2867  CG  LEU A 354      12.032  -3.763  19.824  1.00  0.90           C  
ATOM   2868  CD1 LEU A 354      11.121  -2.544  20.066  1.00  0.90           C  
ATOM   2869  CD2 LEU A 354      12.246  -4.528  21.138  1.00  0.90           C  
ATOM   2870  N   VAL A 355      11.523  -6.445  16.041  1.00  0.91           N  
ATOM   2871  CA  VAL A 355      10.754  -7.200  15.060  1.00  0.91           C  
ATOM   2872  C   VAL A 355      11.463  -8.451  14.580  1.00  0.91           C  
ATOM   2873  O   VAL A 355      10.901  -9.548  14.594  1.00  0.91           O  
ATOM   2874  CB  VAL A 355      10.376  -6.323  13.863  1.00  0.91           C  
ATOM   2875  CG1 VAL A 355       9.671  -7.118  12.739  1.00  0.91           C  
ATOM   2876  CG2 VAL A 355       9.437  -5.210  14.370  1.00  0.91           C  
ATOM   2877  N   ASP A 356      12.736  -8.360  14.152  1.00  0.91           N  
ATOM   2878  CA  ASP A 356      13.416  -9.506  13.586  1.00  0.91           C  
ATOM   2879  C   ASP A 356      13.942 -10.455  14.659  1.00  0.91           C  
ATOM   2880  O   ASP A 356      13.749 -11.669  14.575  1.00  0.91           O  
ATOM   2881  CB  ASP A 356      14.523  -9.061  12.602  1.00  0.91           C  
ATOM   2882  CG  ASP A 356      13.904  -8.304  11.438  1.00  0.91           C  
ATOM   2883  OD1 ASP A 356      12.878  -8.783  10.887  1.00  0.91           O  
ATOM   2884  OD2 ASP A 356      14.445  -7.236  11.042  1.00  0.91           O  
ATOM   2885  N   LEU A 357      14.584  -9.919  15.718  1.00  0.88           N  
ATOM   2886  CA  LEU A 357      15.226 -10.728  16.739  1.00  0.88           C  
ATOM   2887  C   LEU A 357      14.305 -11.143  17.884  1.00  0.88           C  
ATOM   2888  O   LEU A 357      14.209 -12.327  18.190  1.00  0.88           O  
ATOM   2889  CB  LEU A 357      16.515 -10.040  17.253  1.00  0.88           C  
ATOM   2890  CG  LEU A 357      17.467  -9.587  16.118  1.00  0.88           C  
ATOM   2891  CD1 LEU A 357      18.692  -8.868  16.695  1.00  0.88           C  
ATOM   2892  CD2 LEU A 357      17.932 -10.750  15.222  1.00  0.88           C  
ATOM   2893  N   GLU A 358      13.545 -10.213  18.506  1.00  0.82           N  
ATOM   2894  CA  GLU A 358      12.700 -10.549  19.655  1.00  0.82           C  
ATOM   2895  C   GLU A 358      11.293 -10.978  19.231  1.00  0.82           C  
ATOM   2896  O   GLU A 358      10.470 -11.381  20.050  1.00  0.82           O  
ATOM   2897  CB  GLU A 358      12.565  -9.337  20.615  1.00  0.82           C  
ATOM   2898  CG  GLU A 358      13.909  -8.784  21.177  1.00  0.82           C  
ATOM   2899  CD  GLU A 358      14.633  -9.564  22.269  1.00  0.82           C  
ATOM   2900  OE1 GLU A 358      14.035 -10.390  23.002  1.00  0.82           O  
ATOM   2901  OE2 GLU A 358      15.839  -9.272  22.503  1.00  0.82           O  
ATOM   2902  N   ARG A 359      10.992 -10.917  17.914  1.00  0.81           N  
ATOM   2903  CA  ARG A 359       9.784 -11.449  17.292  1.00  0.81           C  
ATOM   2904  C   ARG A 359       8.509 -10.709  17.652  1.00  0.81           C  
ATOM   2905  O   ARG A 359       7.405 -11.241  17.552  1.00  0.81           O  
ATOM   2906  CB  ARG A 359       9.601 -12.975  17.532  1.00  0.81           C  
ATOM   2907  CG  ARG A 359      10.799 -13.860  17.126  1.00  0.81           C  
ATOM   2908  CD  ARG A 359      10.822 -14.308  15.657  1.00  0.81           C  
ATOM   2909  NE  ARG A 359      11.065 -13.116  14.778  1.00  0.81           N  
ATOM   2910  CZ  ARG A 359      10.476 -12.886  13.597  1.00  0.81           C  
ATOM   2911  NH1 ARG A 359       9.753 -13.821  12.994  1.00  0.81           N  
ATOM   2912  NH2 ARG A 359      10.620 -11.709  13.004  1.00  0.81           N  
ATOM   2913  N   MET A 360       8.638  -9.434  18.045  1.00  0.82           N  
ATOM   2914  CA  MET A 360       7.525  -8.549  18.292  1.00  0.82           C  
ATOM   2915  C   MET A 360       6.827  -8.157  17.000  1.00  0.82           C  
ATOM   2916  O   MET A 360       7.452  -8.046  15.945  1.00  0.82           O  
ATOM   2917  CB  MET A 360       8.056  -7.301  19.033  1.00  0.82           C  
ATOM   2918  CG  MET A 360       7.010  -6.476  19.802  1.00  0.82           C  
ATOM   2919  SD  MET A 360       7.736  -5.123  20.781  1.00  0.82           S  
ATOM   2920  CE  MET A 360       8.774  -6.093  21.910  1.00  0.82           C  
ATOM   2921  N   ASP A 361       5.499  -7.932  17.027  1.00  0.85           N  
ATOM   2922  CA  ASP A 361       4.798  -7.357  15.905  1.00  0.85           C  
ATOM   2923  C   ASP A 361       5.252  -5.925  15.630  1.00  0.85           C  
ATOM   2924  O   ASP A 361       5.777  -5.229  16.504  1.00  0.85           O  
ATOM   2925  CB  ASP A 361       3.269  -7.478  16.096  1.00  0.85           C  
ATOM   2926  CG  ASP A 361       2.833  -6.618  17.257  1.00  0.85           C  
ATOM   2927  OD1 ASP A 361       2.794  -7.130  18.405  1.00  0.85           O  
ATOM   2928  OD2 ASP A 361       2.596  -5.408  17.008  1.00  0.85           O  
ATOM   2929  N   TRP A 362       5.094  -5.455  14.380  1.00  0.85           N  
ATOM   2930  CA  TRP A 362       5.557  -4.138  14.006  1.00  0.85           C  
ATOM   2931  C   TRP A 362       4.875  -3.018  14.779  1.00  0.85           C  
ATOM   2932  O   TRP A 362       5.530  -2.077  15.222  1.00  0.85           O  
ATOM   2933  CB  TRP A 362       5.354  -3.903  12.482  1.00  0.85           C  
ATOM   2934  CG  TRP A 362       5.766  -2.524  11.980  1.00  0.85           C  
ATOM   2935  CD1 TRP A 362       5.088  -1.343  12.121  1.00  0.85           C  
ATOM   2936  CD2 TRP A 362       7.016  -2.178  11.357  1.00  0.85           C  
ATOM   2937  NE1 TRP A 362       5.814  -0.290  11.621  1.00  0.85           N  
ATOM   2938  CE2 TRP A 362       7.004  -0.793  11.155  1.00  0.85           C  
ATOM   2939  CE3 TRP A 362       8.114  -2.958  10.993  1.00  0.85           C  
ATOM   2940  CZ2 TRP A 362       8.079  -0.135  10.584  1.00  0.85           C  
ATOM   2941  CZ3 TRP A 362       9.206  -2.295  10.410  1.00  0.85           C  
ATOM   2942  CH2 TRP A 362       9.184  -0.909  10.205  1.00  0.85           C  
ATOM   2943  N   ASP A 363       3.546  -3.079  14.943  1.00  0.86           N  
ATOM   2944  CA  ASP A 363       2.782  -1.984  15.489  1.00  0.86           C  
ATOM   2945  C   ASP A 363       3.066  -1.811  16.986  1.00  0.86           C  
ATOM   2946  O   ASP A 363       3.295  -0.696  17.466  1.00  0.86           O  
ATOM   2947  CB  ASP A 363       1.287  -2.164  15.118  1.00  0.86           C  
ATOM   2948  CG  ASP A 363       1.080  -2.216  13.604  1.00  0.86           C  
ATOM   2949  OD1 ASP A 363       1.856  -1.577  12.843  1.00  0.86           O  
ATOM   2950  OD2 ASP A 363       0.136  -2.912  13.164  1.00  0.86           O  
ATOM   2951  N   LYS A 364       3.163  -2.917  17.756  1.00  0.83           N  
ATOM   2952  CA  LYS A 364       3.620  -2.914  19.135  1.00  0.83           C  
ATOM   2953  C   LYS A 364       5.064  -2.452  19.279  1.00  0.83           C  
ATOM   2954  O   LYS A 364       5.398  -1.662  20.163  1.00  0.83           O  
ATOM   2955  CB  LYS A 364       3.445  -4.309  19.796  1.00  0.83           C  
ATOM   2956  CG  LYS A 364       3.796  -4.351  21.294  1.00  0.83           C  
ATOM   2957  CD  LYS A 364       3.576  -5.722  21.970  1.00  0.83           C  
ATOM   2958  CE  LYS A 364       4.022  -5.681  23.442  1.00  0.83           C  
ATOM   2959  NZ  LYS A 364       3.765  -6.927  24.206  1.00  0.83           N  
ATOM   2960  N   ALA A 365       5.970  -2.903  18.388  1.00  0.91           N  
ATOM   2961  CA  ALA A 365       7.346  -2.457  18.366  1.00  0.91           C  
ATOM   2962  C   ALA A 365       7.500  -0.972  18.068  1.00  0.91           C  
ATOM   2963  O   ALA A 365       8.328  -0.283  18.653  1.00  0.91           O  
ATOM   2964  CB  ALA A 365       8.152  -3.299  17.362  1.00  0.91           C  
ATOM   2965  N   TRP A 366       6.682  -0.433  17.146  1.00  0.88           N  
ATOM   2966  CA  TRP A 366       6.653   0.972  16.813  1.00  0.88           C  
ATOM   2967  C   TRP A 366       6.200   1.855  17.968  1.00  0.88           C  
ATOM   2968  O   TRP A 366       6.818   2.886  18.221  1.00  0.88           O  
ATOM   2969  CB  TRP A 366       5.839   1.197  15.513  1.00  0.88           C  
ATOM   2970  CG  TRP A 366       5.913   2.595  14.940  1.00  0.88           C  
ATOM   2971  CD1 TRP A 366       4.911   3.509  14.790  1.00  0.88           C  
ATOM   2972  CD2 TRP A 366       7.109   3.261  14.470  1.00  0.88           C  
ATOM   2973  NE1 TRP A 366       5.388   4.698  14.259  1.00  0.88           N  
ATOM   2974  CE2 TRP A 366       6.751   4.532  14.064  1.00  0.88           C  
ATOM   2975  CE3 TRP A 366       8.430   2.814  14.398  1.00  0.88           C  
ATOM   2976  CZ2 TRP A 366       7.691   5.436  13.559  1.00  0.88           C  
ATOM   2977  CZ3 TRP A 366       9.391   3.716  13.919  1.00  0.88           C  
ATOM   2978  CH2 TRP A 366       9.029   4.998  13.501  1.00  0.88           C  
ATOM   2979  N   ASP A 367       5.173   1.451  18.753  1.00  0.89           N  
ATOM   2980  CA  ASP A 367       4.785   2.156  19.972  1.00  0.89           C  
ATOM   2981  C   ASP A 367       5.942   2.223  20.979  1.00  0.89           C  
ATOM   2982  O   ASP A 367       6.279   3.286  21.504  1.00  0.89           O  
ATOM   2983  CB  ASP A 367       3.520   1.474  20.581  1.00  0.89           C  
ATOM   2984  CG  ASP A 367       3.181   1.968  21.981  1.00  0.89           C  
ATOM   2985  OD1 ASP A 367       3.106   3.196  22.230  1.00  0.89           O  
ATOM   2986  OD2 ASP A 367       3.099   1.102  22.888  1.00  0.89           O  
ATOM   2987  N   VAL A 368       6.635   1.089  21.207  1.00  0.92           N  
ATOM   2988  CA  VAL A 368       7.801   1.031  22.073  1.00  0.92           C  
ATOM   2989  C   VAL A 368       8.949   1.911  21.581  1.00  0.92           C  
ATOM   2990  O   VAL A 368       9.582   2.631  22.345  1.00  0.92           O  
ATOM   2991  CB  VAL A 368       8.275  -0.409  22.251  1.00  0.92           C  
ATOM   2992  CG1 VAL A 368       9.611  -0.480  23.020  1.00  0.92           C  
ATOM   2993  CG2 VAL A 368       7.205  -1.210  23.022  1.00  0.92           C  
ATOM   2994  N   THR A 369       9.238   1.895  20.266  1.00  0.94           N  
ATOM   2995  CA  THR A 369      10.255   2.750  19.664  1.00  0.94           C  
ATOM   2996  C   THR A 369       9.961   4.229  19.779  1.00  0.94           C  
ATOM   2997  O   THR A 369      10.822   5.002  20.191  1.00  0.94           O  
ATOM   2998  CB  THR A 369      10.464   2.397  18.201  1.00  0.94           C  
ATOM   2999  OG1 THR A 369      11.058   1.112  18.112  1.00  0.94           O  
ATOM   3000  CG2 THR A 369      11.427   3.358  17.491  1.00  0.94           C  
ATOM   3001  N   VAL A 370       8.721   4.661  19.469  1.00  0.94           N  
ATOM   3002  CA  VAL A 370       8.324   6.058  19.557  1.00  0.94           C  
ATOM   3003  C   VAL A 370       8.325   6.575  20.985  1.00  0.94           C  
ATOM   3004  O   VAL A 370       8.784   7.683  21.233  1.00  0.94           O  
ATOM   3005  CB  VAL A 370       6.982   6.318  18.874  1.00  0.94           C  
ATOM   3006  CG1 VAL A 370       6.558   7.798  19.003  1.00  0.94           C  
ATOM   3007  CG2 VAL A 370       7.093   5.979  17.372  1.00  0.94           C  
ATOM   3008  N   ARG A 371       7.845   5.793  21.977  1.00  0.90           N  
ATOM   3009  CA  ARG A 371       7.859   6.225  23.366  1.00  0.90           C  
ATOM   3010  C   ARG A 371       9.238   6.175  24.035  1.00  0.90           C  
ATOM   3011  O   ARG A 371       9.462   6.817  25.058  1.00  0.90           O  
ATOM   3012  CB  ARG A 371       6.868   5.379  24.212  1.00  0.90           C  
ATOM   3013  CG  ARG A 371       5.375   5.688  23.970  1.00  0.90           C  
ATOM   3014  CD  ARG A 371       4.423   5.067  25.010  1.00  0.90           C  
ATOM   3015  NE  ARG A 371       4.282   3.602  24.729  1.00  0.90           N  
ATOM   3016  CZ  ARG A 371       4.367   2.619  25.637  1.00  0.90           C  
ATOM   3017  NH1 ARG A 371       4.682   2.845  26.913  1.00  0.90           N  
ATOM   3018  NH2 ARG A 371       4.129   1.367  25.265  1.00  0.90           N  
ATOM   3019  N   THR A 372      10.197   5.394  23.494  1.00  0.96           N  
ATOM   3020  CA  THR A 372      11.577   5.386  23.986  1.00  0.96           C  
ATOM   3021  C   THR A 372      12.392   6.573  23.485  1.00  0.96           C  
ATOM   3022  O   THR A 372      13.187   7.161  24.224  1.00  0.96           O  
ATOM   3023  CB  THR A 372      12.338   4.110  23.613  1.00  0.96           C  
ATOM   3024  OG1 THR A 372      11.727   2.950  24.149  1.00  0.96           O  
ATOM   3025  CG2 THR A 372      13.755   4.103  24.195  1.00  0.96           C  
ATOM   3026  N   CYS A 373      12.252   6.935  22.195  1.00  0.97           N  
ATOM   3027  CA  CYS A 373      13.150   7.861  21.528  1.00  0.97           C  
ATOM   3028  C   CYS A 373      12.696   9.311  21.522  1.00  0.97           C  
ATOM   3029  O   CYS A 373      11.533   9.644  21.312  1.00  0.97           O  
ATOM   3030  CB  CYS A 373      13.415   7.427  20.067  1.00  0.97           C  
ATOM   3031  SG  CYS A 373      14.286   5.820  20.003  1.00  0.97           S  
ATOM   3032  N   ALA A 374      13.654  10.235  21.715  1.00  0.99           N  
ATOM   3033  CA  ALA A 374      13.409  11.653  21.588  1.00  0.99           C  
ATOM   3034  C   ALA A 374      14.551  12.312  20.831  1.00  0.99           C  
ATOM   3035  O   ALA A 374      15.692  11.867  20.891  1.00  0.99           O  
ATOM   3036  CB  ALA A 374      13.218  12.300  22.969  1.00  0.99           C  
ATOM   3037  N   TYR A 375      14.259  13.387  20.067  1.00  0.97           N  
ATOM   3038  CA  TYR A 375      15.207  14.012  19.154  1.00  0.97           C  
ATOM   3039  C   TYR A 375      15.469  15.484  19.463  1.00  0.97           C  
ATOM   3040  O   TYR A 375      14.562  16.305  19.569  1.00  0.97           O  
ATOM   3041  CB  TYR A 375      14.683  13.823  17.696  1.00  0.97           C  
ATOM   3042  CG  TYR A 375      15.265  14.728  16.622  1.00  0.97           C  
ATOM   3043  CD1 TYR A 375      16.650  14.879  16.425  1.00  0.97           C  
ATOM   3044  CD2 TYR A 375      14.388  15.405  15.757  1.00  0.97           C  
ATOM   3045  CE1 TYR A 375      17.137  15.731  15.421  1.00  0.97           C  
ATOM   3046  CE2 TYR A 375      14.873  16.226  14.732  1.00  0.97           C  
ATOM   3047  CZ  TYR A 375      16.248  16.402  14.576  1.00  0.97           C  
ATOM   3048  OH  TYR A 375      16.722  17.254  13.560  1.00  0.97           O  
ATOM   3049  N   THR A 376      16.767  15.849  19.543  1.00  0.98           N  
ATOM   3050  CA  THR A 376      17.200  17.226  19.749  1.00  0.98           C  
ATOM   3051  C   THR A 376      17.779  17.795  18.473  1.00  0.98           C  
ATOM   3052  O   THR A 376      18.767  17.287  17.951  1.00  0.98           O  
ATOM   3053  CB  THR A 376      18.283  17.360  20.811  1.00  0.98           C  
ATOM   3054  OG1 THR A 376      17.821  16.827  22.043  1.00  0.98           O  
ATOM   3055  CG2 THR A 376      18.634  18.836  21.051  1.00  0.98           C  
ATOM   3056  N   ASN A 377      17.192  18.886  17.939  1.00  0.94           N  
ATOM   3057  CA  ASN A 377      17.693  19.571  16.758  1.00  0.94           C  
ATOM   3058  C   ASN A 377      18.542  20.776  17.154  1.00  0.94           C  
ATOM   3059  O   ASN A 377      18.117  21.635  17.921  1.00  0.94           O  
ATOM   3060  CB  ASN A 377      16.515  20.013  15.841  1.00  0.94           C  
ATOM   3061  CG  ASN A 377      16.973  20.883  14.671  1.00  0.94           C  
ATOM   3062  OD1 ASN A 377      17.134  22.089  14.823  1.00  0.94           O  
ATOM   3063  ND2 ASN A 377      17.258  20.270  13.507  1.00  0.94           N  
ATOM   3064  N   HIS A 378      19.753  20.879  16.559  1.00  0.92           N  
ATOM   3065  CA  HIS A 378      20.696  21.922  16.899  1.00  0.92           C  
ATOM   3066  C   HIS A 378      20.947  22.923  15.781  1.00  0.92           C  
ATOM   3067  O   HIS A 378      21.834  23.760  15.910  1.00  0.92           O  
ATOM   3068  CB  HIS A 378      22.065  21.292  17.226  1.00  0.92           C  
ATOM   3069  CG  HIS A 378      21.992  20.296  18.333  1.00  0.92           C  
ATOM   3070  ND1 HIS A 378      22.267  20.678  19.637  1.00  0.92           N  
ATOM   3071  CD2 HIS A 378      21.705  18.979  18.279  1.00  0.92           C  
ATOM   3072  CE1 HIS A 378      22.147  19.575  20.339  1.00  0.92           C  
ATOM   3073  NE2 HIS A 378      21.805  18.513  19.570  1.00  0.92           N  
ATOM   3074  N   THR A 379      20.203  22.888  14.654  1.00  0.89           N  
ATOM   3075  CA  THR A 379      20.485  23.803  13.547  1.00  0.89           C  
ATOM   3076  C   THR A 379      19.373  23.784  12.515  1.00  0.89           C  
ATOM   3077  O   THR A 379      18.706  22.779  12.303  1.00  0.89           O  
ATOM   3078  CB  THR A 379      21.830  23.545  12.853  1.00  0.89           C  
ATOM   3079  OG1 THR A 379      22.096  24.435  11.768  1.00  0.89           O  
ATOM   3080  CG2 THR A 379      21.916  22.105  12.334  1.00  0.89           C  
ATOM   3081  N   VAL A 380      19.168  24.932  11.825  1.00  0.87           N  
ATOM   3082  CA  VAL A 380      18.202  25.061  10.747  1.00  0.87           C  
ATOM   3083  C   VAL A 380      18.890  25.203   9.401  1.00  0.87           C  
ATOM   3084  O   VAL A 380      18.240  25.342   8.367  1.00  0.87           O  
ATOM   3085  CB  VAL A 380      17.276  26.267  10.927  1.00  0.87           C  
ATOM   3086  CG1 VAL A 380      16.557  26.171  12.283  1.00  0.87           C  
ATOM   3087  CG2 VAL A 380      18.043  27.603  10.835  1.00  0.87           C  
ATOM   3088  N   LEU A 381      20.238  25.187   9.373  1.00  0.83           N  
ATOM   3089  CA  LEU A 381      21.001  25.469   8.171  1.00  0.83           C  
ATOM   3090  C   LEU A 381      21.015  24.281   7.198  1.00  0.83           C  
ATOM   3091  O   LEU A 381      21.388  23.186   7.620  1.00  0.83           O  
ATOM   3092  CB  LEU A 381      22.457  25.880   8.505  1.00  0.83           C  
ATOM   3093  CG  LEU A 381      22.606  27.185   9.323  1.00  0.83           C  
ATOM   3094  CD1 LEU A 381      24.093  27.453   9.609  1.00  0.83           C  
ATOM   3095  CD2 LEU A 381      22.003  28.399   8.594  1.00  0.83           C  
ATOM   3096  N   PRO A 382      20.643  24.392   5.912  1.00  0.86           N  
ATOM   3097  CA  PRO A 382      20.452  23.246   5.022  1.00  0.86           C  
ATOM   3098  C   PRO A 382      21.662  22.364   4.817  1.00  0.86           C  
ATOM   3099  O   PRO A 382      21.502  21.162   4.610  1.00  0.86           O  
ATOM   3100  CB  PRO A 382      20.024  23.875   3.687  1.00  0.86           C  
ATOM   3101  CG  PRO A 382      19.297  25.149   4.111  1.00  0.86           C  
ATOM   3102  CD  PRO A 382      20.112  25.617   5.317  1.00  0.86           C  
ATOM   3103  N   GLU A 383      22.881  22.927   4.852  1.00  0.83           N  
ATOM   3104  CA  GLU A 383      24.105  22.191   4.673  1.00  0.83           C  
ATOM   3105  C   GLU A 383      24.495  21.355   5.880  1.00  0.83           C  
ATOM   3106  O   GLU A 383      25.376  20.503   5.789  1.00  0.83           O  
ATOM   3107  CB  GLU A 383      25.267  23.150   4.308  1.00  0.83           C  
ATOM   3108  CG  GLU A 383      25.620  24.239   5.364  1.00  0.83           C  
ATOM   3109  CD  GLU A 383      24.785  25.520   5.288  1.00  0.83           C  
ATOM   3110  OE1 GLU A 383      23.756  25.591   4.561  1.00  0.83           O  
ATOM   3111  OE2 GLU A 383      25.203  26.541   5.898  1.00  0.83           O  
ATOM   3112  N   ALA A 384      23.850  21.562   7.046  1.00  0.88           N  
ATOM   3113  CA  ALA A 384      24.177  20.856   8.260  1.00  0.88           C  
ATOM   3114  C   ALA A 384      23.269  19.669   8.527  1.00  0.88           C  
ATOM   3115  O   ALA A 384      23.508  18.889   9.444  1.00  0.88           O  
ATOM   3116  CB  ALA A 384      24.022  21.843   9.427  1.00  0.88           C  
ATOM   3117  N   LEU A 385      22.213  19.489   7.716  1.00  0.89           N  
ATOM   3118  CA  LEU A 385      21.192  18.485   7.951  1.00  0.89           C  
ATOM   3119  C   LEU A 385      21.496  17.219   7.185  1.00  0.89           C  
ATOM   3120  O   LEU A 385      21.742  17.230   5.979  1.00  0.89           O  
ATOM   3121  CB  LEU A 385      19.806  18.995   7.481  1.00  0.89           C  
ATOM   3122  CG  LEU A 385      19.014  19.858   8.491  1.00  0.89           C  
ATOM   3123  CD1 LEU A 385      19.886  20.685   9.449  1.00  0.89           C  
ATOM   3124  CD2 LEU A 385      18.052  20.774   7.721  1.00  0.89           C  
ATOM   3125  N   GLU A 386      21.465  16.068   7.879  1.00  0.89           N  
ATOM   3126  CA  GLU A 386      21.789  14.800   7.281  1.00  0.89           C  
ATOM   3127  C   GLU A 386      20.768  14.226   6.327  1.00  0.89           C  
ATOM   3128  O   GLU A 386      19.585  14.034   6.617  1.00  0.89           O  
ATOM   3129  CB  GLU A 386      22.132  13.767   8.345  1.00  0.89           C  
ATOM   3130  CG  GLU A 386      23.210  14.315   9.295  1.00  0.89           C  
ATOM   3131  CD  GLU A 386      23.741  13.248  10.232  1.00  0.89           C  
ATOM   3132  OE1 GLU A 386      22.918  12.642  10.955  1.00  0.89           O  
ATOM   3133  OE2 GLU A 386      24.980  13.115  10.312  1.00  0.89           O  
ATOM   3134  N   ARG A 387      21.258  13.930   5.114  1.00  0.85           N  
ATOM   3135  CA  ARG A 387      20.454  13.462   4.020  1.00  0.85           C  
ATOM   3136  C   ARG A 387      21.261  12.426   3.268  1.00  0.85           C  
ATOM   3137  O   ARG A 387      21.870  12.692   2.227  1.00  0.85           O  
ATOM   3138  CB  ARG A 387      20.055  14.608   3.062  1.00  0.85           C  
ATOM   3139  CG  ARG A 387      19.384  15.816   3.743  1.00  0.85           C  
ATOM   3140  CD  ARG A 387      18.865  16.859   2.755  1.00  0.85           C  
ATOM   3141  NE  ARG A 387      20.057  17.374   2.011  1.00  0.85           N  
ATOM   3142  CZ  ARG A 387      20.054  17.671   0.708  1.00  0.85           C  
ATOM   3143  NH1 ARG A 387      18.937  17.751   0.006  1.00  0.85           N  
ATOM   3144  NH2 ARG A 387      21.208  17.938   0.100  1.00  0.85           N  
ATOM   3145  N   TRP A 388      21.315  11.203   3.825  1.00  0.89           N  
ATOM   3146  CA  TRP A 388      22.105  10.116   3.287  1.00  0.89           C  
ATOM   3147  C   TRP A 388      21.541   9.580   1.973  1.00  0.89           C  
ATOM   3148  O   TRP A 388      20.363   9.221   1.944  1.00  0.89           O  
ATOM   3149  CB  TRP A 388      22.243   8.940   4.285  1.00  0.89           C  
ATOM   3150  CG  TRP A 388      23.018   9.291   5.539  1.00  0.89           C  
ATOM   3151  CD1 TRP A 388      22.557   9.494   6.806  1.00  0.89           C  
ATOM   3152  CD2 TRP A 388      24.443   9.453   5.607  1.00  0.89           C  
ATOM   3153  NE1 TRP A 388      23.589   9.844   7.646  1.00  0.89           N  
ATOM   3154  CE2 TRP A 388      24.756   9.807   6.934  1.00  0.89           C  
ATOM   3155  CE3 TRP A 388      25.437   9.308   4.650  1.00  0.89           C  
ATOM   3156  CZ2 TRP A 388      26.064  10.032   7.328  1.00  0.89           C  
ATOM   3157  CZ3 TRP A 388      26.762   9.520   5.050  1.00  0.89           C  
ATOM   3158  CH2 TRP A 388      27.072   9.897   6.364  1.00  0.89           C  
ATOM   3159  N   PRO A 389      22.279   9.517   0.861  1.00  0.94           N  
ATOM   3160  CA  PRO A 389      21.802   8.926  -0.383  1.00  0.94           C  
ATOM   3161  C   PRO A 389      21.390   7.470  -0.237  1.00  0.94           C  
ATOM   3162  O   PRO A 389      22.054   6.710   0.467  1.00  0.94           O  
ATOM   3163  CB  PRO A 389      22.959   9.139  -1.366  1.00  0.94           C  
ATOM   3164  CG  PRO A 389      24.207   9.228  -0.489  1.00  0.94           C  
ATOM   3165  CD  PRO A 389      23.679   9.930   0.759  1.00  0.94           C  
ATOM   3166  N   VAL A 390      20.279   7.058  -0.880  1.00  0.91           N  
ATOM   3167  CA  VAL A 390      19.713   5.729  -0.698  1.00  0.91           C  
ATOM   3168  C   VAL A 390      20.615   4.588  -1.114  1.00  0.91           C  
ATOM   3169  O   VAL A 390      20.663   3.573  -0.433  1.00  0.91           O  
ATOM   3170  CB  VAL A 390      18.342   5.525  -1.324  1.00  0.91           C  
ATOM   3171  CG1 VAL A 390      17.332   6.487  -0.676  1.00  0.91           C  
ATOM   3172  CG2 VAL A 390      18.378   5.712  -2.851  1.00  0.91           C  
ATOM   3173  N   HIS A 391      21.395   4.734  -2.208  1.00  0.86           N  
ATOM   3174  CA  HIS A 391      22.307   3.710  -2.681  1.00  0.86           C  
ATOM   3175  C   HIS A 391      23.377   3.357  -1.660  1.00  0.86           C  
ATOM   3176  O   HIS A 391      23.789   2.209  -1.522  1.00  0.86           O  
ATOM   3177  CB  HIS A 391      22.987   4.148  -4.002  1.00  0.86           C  
ATOM   3178  CG  HIS A 391      23.854   5.373  -3.907  1.00  0.86           C  
ATOM   3179  ND1 HIS A 391      23.285   6.627  -4.016  1.00  0.86           N  
ATOM   3180  CD2 HIS A 391      25.203   5.478  -3.780  1.00  0.86           C  
ATOM   3181  CE1 HIS A 391      24.300   7.468  -3.968  1.00  0.86           C  
ATOM   3182  NE2 HIS A 391      25.483   6.827  -3.819  1.00  0.86           N  
ATOM   3183  N   LEU A 392      23.856   4.360  -0.898  1.00  0.90           N  
ATOM   3184  CA  LEU A 392      24.798   4.155   0.180  1.00  0.90           C  
ATOM   3185  C   LEU A 392      24.211   3.368   1.343  1.00  0.90           C  
ATOM   3186  O   LEU A 392      24.804   2.408   1.832  1.00  0.90           O  
ATOM   3187  CB  LEU A 392      25.310   5.535   0.642  1.00  0.90           C  
ATOM   3188  CG  LEU A 392      26.446   5.518   1.678  1.00  0.90           C  
ATOM   3189  CD1 LEU A 392      27.654   4.723   1.170  1.00  0.90           C  
ATOM   3190  CD2 LEU A 392      26.865   6.956   2.021  1.00  0.90           C  
ATOM   3191  N   LEU A 393      22.982   3.719   1.774  1.00  0.92           N  
ATOM   3192  CA  LEU A 393      22.261   2.981   2.794  1.00  0.92           C  
ATOM   3193  C   LEU A 393      21.917   1.568   2.354  1.00  0.92           C  
ATOM   3194  O   LEU A 393      22.042   0.631   3.135  1.00  0.92           O  
ATOM   3195  CB  LEU A 393      20.968   3.716   3.215  1.00  0.92           C  
ATOM   3196  CG  LEU A 393      21.190   5.005   4.032  1.00  0.92           C  
ATOM   3197  CD1 LEU A 393      19.877   5.789   4.127  1.00  0.92           C  
ATOM   3198  CD2 LEU A 393      21.697   4.708   5.452  1.00  0.92           C  
ATOM   3199  N   GLU A 394      21.506   1.382   1.088  1.00  0.88           N  
ATOM   3200  CA  GLU A 394      21.183   0.106   0.485  1.00  0.88           C  
ATOM   3201  C   GLU A 394      22.334  -0.876   0.457  1.00  0.88           C  
ATOM   3202  O   GLU A 394      22.199  -2.018   0.886  1.00  0.88           O  
ATOM   3203  CB  GLU A 394      20.696   0.387  -0.950  1.00  0.88           C  
ATOM   3204  CG  GLU A 394      20.244  -0.837  -1.776  1.00  0.88           C  
ATOM   3205  CD  GLU A 394      19.221  -0.416  -2.829  1.00  0.88           C  
ATOM   3206  OE1 GLU A 394      19.421   0.651  -3.469  1.00  0.88           O  
ATOM   3207  OE2 GLU A 394      18.205  -1.144  -2.969  1.00  0.88           O  
ATOM   3208  N   THR A 395      23.526  -0.436   0.018  1.00  0.91           N  
ATOM   3209  CA  THR A 395      24.734  -1.245   0.100  1.00  0.91           C  
ATOM   3210  C   THR A 395      25.201  -1.527   1.523  1.00  0.91           C  
ATOM   3211  O   THR A 395      25.516  -2.662   1.869  1.00  0.91           O  
ATOM   3212  CB  THR A 395      25.879  -0.586  -0.655  1.00  0.91           C  
ATOM   3213  OG1 THR A 395      25.545  -0.470  -2.029  1.00  0.91           O  
ATOM   3214  CG2 THR A 395      27.163  -1.422  -0.599  1.00  0.91           C  
ATOM   3215  N   LEU A 396      25.275  -0.503   2.402  1.00  0.91           N  
ATOM   3216  CA  LEU A 396      25.835  -0.659   3.735  1.00  0.91           C  
ATOM   3217  C   LEU A 396      24.914  -1.315   4.756  1.00  0.91           C  
ATOM   3218  O   LEU A 396      25.348  -2.096   5.593  1.00  0.91           O  
ATOM   3219  CB  LEU A 396      26.309   0.702   4.293  1.00  0.91           C  
ATOM   3220  CG  LEU A 396      27.096   0.626   5.622  1.00  0.91           C  
ATOM   3221  CD1 LEU A 396      28.402  -0.164   5.464  1.00  0.91           C  
ATOM   3222  CD2 LEU A 396      27.379   2.035   6.152  1.00  0.91           C  
ATOM   3223  N   LEU A 397      23.610  -0.989   4.718  1.00  0.93           N  
ATOM   3224  CA  LEU A 397      22.652  -1.394   5.731  1.00  0.93           C  
ATOM   3225  C   LEU A 397      21.309  -1.758   5.086  1.00  0.93           C  
ATOM   3226  O   LEU A 397      20.306  -1.079   5.343  1.00  0.93           O  
ATOM   3227  CB  LEU A 397      22.402  -0.243   6.742  1.00  0.93           C  
ATOM   3228  CG  LEU A 397      23.637   0.281   7.505  1.00  0.93           C  
ATOM   3229  CD1 LEU A 397      23.243   1.508   8.338  1.00  0.93           C  
ATOM   3230  CD2 LEU A 397      24.252  -0.785   8.425  1.00  0.93           C  
ATOM   3231  N   PRO A 398      21.198  -2.795   4.244  1.00  0.93           N  
ATOM   3232  CA  PRO A 398      20.033  -3.029   3.389  1.00  0.93           C  
ATOM   3233  C   PRO A 398      18.747  -3.226   4.166  1.00  0.93           C  
ATOM   3234  O   PRO A 398      17.690  -2.772   3.750  1.00  0.93           O  
ATOM   3235  CB  PRO A 398      20.398  -4.295   2.590  1.00  0.93           C  
ATOM   3236  CG  PRO A 398      21.473  -4.982   3.437  1.00  0.93           C  
ATOM   3237  CD  PRO A 398      22.241  -3.798   4.017  1.00  0.93           C  
ATOM   3238  N   ARG A 399      18.824  -3.915   5.317  1.00  0.89           N  
ATOM   3239  CA  ARG A 399      17.715  -4.147   6.211  1.00  0.89           C  
ATOM   3240  C   ARG A 399      17.146  -2.875   6.804  1.00  0.89           C  
ATOM   3241  O   ARG A 399      15.933  -2.679   6.813  1.00  0.89           O  
ATOM   3242  CB  ARG A 399      18.215  -5.072   7.337  1.00  0.89           C  
ATOM   3243  CG  ARG A 399      17.233  -5.361   8.490  1.00  0.89           C  
ATOM   3244  CD  ARG A 399      16.121  -6.403   8.273  1.00  0.89           C  
ATOM   3245  NE  ARG A 399      15.012  -5.858   7.414  1.00  0.89           N  
ATOM   3246  CZ  ARG A 399      13.706  -6.014   7.682  1.00  0.89           C  
ATOM   3247  NH1 ARG A 399      13.234  -6.423   8.846  1.00  0.89           N  
ATOM   3248  NH2 ARG A 399      12.833  -5.772   6.704  1.00  0.89           N  
ATOM   3249  N   HIS A 400      18.010  -1.954   7.271  1.00  0.93           N  
ATOM   3250  CA  HIS A 400      17.611  -0.672   7.808  1.00  0.93           C  
ATOM   3251  C   HIS A 400      16.914   0.189   6.788  1.00  0.93           C  
ATOM   3252  O   HIS A 400      15.937   0.847   7.107  1.00  0.93           O  
ATOM   3253  CB  HIS A 400      18.798   0.100   8.409  1.00  0.93           C  
ATOM   3254  CG  HIS A 400      19.365  -0.629   9.581  1.00  0.93           C  
ATOM   3255  ND1 HIS A 400      20.227  -1.692   9.388  1.00  0.93           N  
ATOM   3256  CD2 HIS A 400      19.103  -0.462  10.902  1.00  0.93           C  
ATOM   3257  CE1 HIS A 400      20.485  -2.140  10.601  1.00  0.93           C  
ATOM   3258  NE2 HIS A 400      19.821  -1.437  11.544  1.00  0.93           N  
ATOM   3259  N   LEU A 401      17.364   0.167   5.517  1.00  0.93           N  
ATOM   3260  CA  LEU A 401      16.695   0.854   4.429  1.00  0.93           C  
ATOM   3261  C   LEU A 401      15.281   0.321   4.191  1.00  0.93           C  
ATOM   3262  O   LEU A 401      14.327   1.083   4.045  1.00  0.93           O  
ATOM   3263  CB  LEU A 401      17.551   0.749   3.142  1.00  0.93           C  
ATOM   3264  CG  LEU A 401      17.506   1.938   2.145  1.00  0.93           C  
ATOM   3265  CD1 LEU A 401      17.527   1.406   0.704  1.00  0.93           C  
ATOM   3266  CD2 LEU A 401      16.331   2.913   2.322  1.00  0.93           C  
ATOM   3267  N   GLN A 402      15.086  -1.017   4.238  1.00  0.90           N  
ATOM   3268  CA  GLN A 402      13.756  -1.614   4.166  1.00  0.90           C  
ATOM   3269  C   GLN A 402      12.838  -1.159   5.299  1.00  0.90           C  
ATOM   3270  O   GLN A 402      11.676  -0.823   5.084  1.00  0.90           O  
ATOM   3271  CB  GLN A 402      13.788  -3.164   4.201  1.00  0.90           C  
ATOM   3272  CG  GLN A 402      14.558  -3.835   3.042  1.00  0.90           C  
ATOM   3273  CD  GLN A 402      14.526  -5.352   3.205  1.00  0.90           C  
ATOM   3274  OE1 GLN A 402      14.157  -5.871   4.266  1.00  0.90           O  
ATOM   3275  NE2 GLN A 402      14.915  -6.093   2.142  1.00  0.90           N  
ATOM   3276  N   ILE A 403      13.368  -1.106   6.537  1.00  0.94           N  
ATOM   3277  CA  ILE A 403      12.677  -0.597   7.713  1.00  0.94           C  
ATOM   3278  C   ILE A 403      12.348   0.887   7.580  1.00  0.94           C  
ATOM   3279  O   ILE A 403      11.234   1.308   7.865  1.00  0.94           O  
ATOM   3280  CB  ILE A 403      13.480  -0.915   8.974  1.00  0.94           C  
ATOM   3281  CG1 ILE A 403      13.543  -2.452   9.167  1.00  0.94           C  
ATOM   3282  CG2 ILE A 403      12.889  -0.245  10.237  1.00  0.94           C  
ATOM   3283  CD1 ILE A 403      14.456  -2.884  10.315  1.00  0.94           C  
ATOM   3284  N   ILE A 404      13.284   1.719   7.074  1.00  0.94           N  
ATOM   3285  CA  ILE A 404      13.060   3.131   6.784  1.00  0.94           C  
ATOM   3286  C   ILE A 404      11.956   3.337   5.749  1.00  0.94           C  
ATOM   3287  O   ILE A 404      11.085   4.188   5.925  1.00  0.94           O  
ATOM   3288  CB  ILE A 404      14.359   3.813   6.341  1.00  0.94           C  
ATOM   3289  CG1 ILE A 404      15.362   3.912   7.520  1.00  0.94           C  
ATOM   3290  CG2 ILE A 404      14.090   5.226   5.774  1.00  0.94           C  
ATOM   3291  CD1 ILE A 404      16.802   4.198   7.067  1.00  0.94           C  
ATOM   3292  N   TYR A 405      11.927   2.534   4.662  1.00  0.92           N  
ATOM   3293  CA  TYR A 405      10.854   2.564   3.678  1.00  0.92           C  
ATOM   3294  C   TYR A 405       9.479   2.194   4.247  1.00  0.92           C  
ATOM   3295  O   TYR A 405       8.501   2.895   3.980  1.00  0.92           O  
ATOM   3296  CB  TYR A 405      11.177   1.666   2.442  1.00  0.92           C  
ATOM   3297  CG  TYR A 405      12.195   2.236   1.464  1.00  0.92           C  
ATOM   3298  CD1 TYR A 405      12.187   3.585   1.054  1.00  0.92           C  
ATOM   3299  CD2 TYR A 405      13.108   1.365   0.839  1.00  0.92           C  
ATOM   3300  CE1 TYR A 405      13.070   4.045   0.061  1.00  0.92           C  
ATOM   3301  CE2 TYR A 405      13.990   1.823  -0.153  1.00  0.92           C  
ATOM   3302  CZ  TYR A 405      13.974   3.165  -0.539  1.00  0.92           C  
ATOM   3303  OH  TYR A 405      14.856   3.626  -1.543  1.00  0.92           O  
ATOM   3304  N   GLU A 406       9.364   1.137   5.086  1.00  0.89           N  
ATOM   3305  CA  GLU A 406       8.135   0.799   5.802  1.00  0.89           C  
ATOM   3306  C   GLU A 406       7.706   1.905   6.760  1.00  0.89           C  
ATOM   3307  O   GLU A 406       6.567   2.350   6.743  1.00  0.89           O  
ATOM   3308  CB  GLU A 406       8.293  -0.553   6.539  1.00  0.89           C  
ATOM   3309  CG  GLU A 406       7.176  -0.974   7.536  1.00  0.89           C  
ATOM   3310  CD  GLU A 406       5.826  -1.413   6.979  1.00  0.89           C  
ATOM   3311  OE1 GLU A 406       5.102  -0.595   6.356  1.00  0.89           O  
ATOM   3312  OE2 GLU A 406       5.390  -2.555   7.305  1.00  0.89           O  
ATOM   3313  N   ILE A 407       8.643   2.480   7.556  1.00  0.93           N  
ATOM   3314  CA  ILE A 407       8.344   3.612   8.432  1.00  0.93           C  
ATOM   3315  C   ILE A 407       7.802   4.791   7.637  1.00  0.93           C  
ATOM   3316  O   ILE A 407       6.798   5.398   8.012  1.00  0.93           O  
ATOM   3317  CB  ILE A 407       9.565   4.067   9.242  1.00  0.93           C  
ATOM   3318  CG1 ILE A 407       9.997   2.998  10.274  1.00  0.93           C  
ATOM   3319  CG2 ILE A 407       9.270   5.399   9.978  1.00  0.93           C  
ATOM   3320  CD1 ILE A 407      11.365   3.288  10.908  1.00  0.93           C  
ATOM   3321  N   ASN A 408       8.415   5.102   6.476  1.00  0.91           N  
ATOM   3322  CA  ASN A 408       7.938   6.137   5.587  1.00  0.91           C  
ATOM   3323  C   ASN A 408       6.531   5.872   5.058  1.00  0.91           C  
ATOM   3324  O   ASN A 408       5.686   6.755   5.092  1.00  0.91           O  
ATOM   3325  CB  ASN A 408       8.934   6.316   4.412  1.00  0.91           C  
ATOM   3326  CG  ASN A 408       8.582   7.557   3.602  1.00  0.91           C  
ATOM   3327  OD1 ASN A 408       8.360   8.629   4.154  1.00  0.91           O  
ATOM   3328  ND2 ASN A 408       8.518   7.426   2.259  1.00  0.91           N  
ATOM   3329  N   GLN A 409       6.221   4.641   4.602  1.00  0.86           N  
ATOM   3330  CA  GLN A 409       4.888   4.291   4.147  1.00  0.86           C  
ATOM   3331  C   GLN A 409       3.842   4.401   5.247  1.00  0.86           C  
ATOM   3332  O   GLN A 409       2.780   4.996   5.061  1.00  0.86           O  
ATOM   3333  CB  GLN A 409       4.893   2.857   3.565  1.00  0.86           C  
ATOM   3334  CG  GLN A 409       3.523   2.407   3.003  1.00  0.86           C  
ATOM   3335  CD  GLN A 409       3.574   0.992   2.424  1.00  0.86           C  
ATOM   3336  OE1 GLN A 409       3.990   0.777   1.290  1.00  0.86           O  
ATOM   3337  NE2 GLN A 409       3.108  -0.004   3.216  1.00  0.86           N  
ATOM   3338  N   ARG A 410       4.135   3.888   6.462  1.00  0.84           N  
ATOM   3339  CA  ARG A 410       3.239   4.012   7.596  1.00  0.84           C  
ATOM   3340  C   ARG A 410       2.980   5.469   7.974  1.00  0.84           C  
ATOM   3341  O   ARG A 410       1.846   5.867   8.241  1.00  0.84           O  
ATOM   3342  CB  ARG A 410       3.765   3.250   8.847  1.00  0.84           C  
ATOM   3343  CG  ARG A 410       4.009   1.727   8.691  1.00  0.84           C  
ATOM   3344  CD  ARG A 410       2.820   0.910   8.169  1.00  0.84           C  
ATOM   3345  NE  ARG A 410       3.191  -0.531   8.231  1.00  0.84           N  
ATOM   3346  CZ  ARG A 410       3.014  -1.340   9.284  1.00  0.84           C  
ATOM   3347  NH1 ARG A 410       2.287  -0.941  10.326  1.00  0.84           N  
ATOM   3348  NH2 ARG A 410       3.584  -2.537   9.294  1.00  0.84           N  
ATOM   3349  N   PHE A 411       4.037   6.304   7.972  1.00  0.90           N  
ATOM   3350  CA  PHE A 411       3.950   7.724   8.224  1.00  0.90           C  
ATOM   3351  C   PHE A 411       3.182   8.497   7.150  1.00  0.90           C  
ATOM   3352  O   PHE A 411       2.280   9.269   7.463  1.00  0.90           O  
ATOM   3353  CB  PHE A 411       5.392   8.264   8.409  1.00  0.90           C  
ATOM   3354  CG  PHE A 411       5.412   9.694   8.861  1.00  0.90           C  
ATOM   3355  CD1 PHE A 411       4.965  10.050  10.143  1.00  0.90           C  
ATOM   3356  CD2 PHE A 411       5.859  10.696   7.988  1.00  0.90           C  
ATOM   3357  CE1 PHE A 411       4.937  11.393  10.537  1.00  0.90           C  
ATOM   3358  CE2 PHE A 411       5.827  12.039   8.377  1.00  0.90           C  
ATOM   3359  CZ  PHE A 411       5.354  12.389   9.646  1.00  0.90           C  
ATOM   3360  N   LEU A 412       3.460   8.264   5.854  1.00  0.88           N  
ATOM   3361  CA  LEU A 412       2.786   8.918   4.744  1.00  0.88           C  
ATOM   3362  C   LEU A 412       1.297   8.621   4.671  1.00  0.88           C  
ATOM   3363  O   LEU A 412       0.490   9.503   4.389  1.00  0.88           O  
ATOM   3364  CB  LEU A 412       3.513   8.601   3.414  1.00  0.88           C  
ATOM   3365  CG  LEU A 412       4.288   9.775   2.767  1.00  0.88           C  
ATOM   3366  CD1 LEU A 412       5.014  10.687   3.773  1.00  0.88           C  
ATOM   3367  CD2 LEU A 412       5.304   9.223   1.756  1.00  0.88           C  
ATOM   3368  N   ASN A 413       0.880   7.381   4.998  1.00  0.85           N  
ATOM   3369  CA  ASN A 413      -0.529   7.032   5.126  1.00  0.85           C  
ATOM   3370  C   ASN A 413      -1.237   7.858   6.199  1.00  0.85           C  
ATOM   3371  O   ASN A 413      -2.361   8.317   6.015  1.00  0.85           O  
ATOM   3372  CB  ASN A 413      -0.718   5.528   5.454  1.00  0.85           C  
ATOM   3373  CG  ASN A 413      -0.266   4.660   4.282  1.00  0.85           C  
ATOM   3374  OD1 ASN A 413      -0.380   5.014   3.118  1.00  0.85           O  
ATOM   3375  ND2 ASN A 413       0.235   3.439   4.602  1.00  0.85           N  
ATOM   3376  N   ARG A 414      -0.575   8.108   7.347  1.00  0.81           N  
ATOM   3377  CA  ARG A 414      -1.077   9.015   8.363  1.00  0.81           C  
ATOM   3378  C   ARG A 414      -1.158  10.469   7.901  1.00  0.81           C  
ATOM   3379  O   ARG A 414      -2.126  11.162   8.200  1.00  0.81           O  
ATOM   3380  CB  ARG A 414      -0.227   8.938   9.647  1.00  0.81           C  
ATOM   3381  CG  ARG A 414      -0.295   7.581  10.382  1.00  0.81           C  
ATOM   3382  CD  ARG A 414       0.765   7.435  11.482  1.00  0.81           C  
ATOM   3383  NE  ARG A 414       0.562   8.608  12.391  1.00  0.81           N  
ATOM   3384  CZ  ARG A 414       1.520   9.362  12.934  1.00  0.81           C  
ATOM   3385  NH1 ARG A 414       2.799   9.008  12.961  1.00  0.81           N  
ATOM   3386  NH2 ARG A 414       1.187  10.507  13.516  1.00  0.81           N  
ATOM   3387  N   VAL A 415      -0.153  10.964   7.140  1.00  0.87           N  
ATOM   3388  CA  VAL A 415      -0.177  12.297   6.540  1.00  0.87           C  
ATOM   3389  C   VAL A 415      -1.337  12.454   5.568  1.00  0.87           C  
ATOM   3390  O   VAL A 415      -2.060  13.447   5.594  1.00  0.87           O  
ATOM   3391  CB  VAL A 415       1.126  12.629   5.808  1.00  0.87           C  
ATOM   3392  CG1 VAL A 415       1.053  14.028   5.156  1.00  0.87           C  
ATOM   3393  CG2 VAL A 415       2.315  12.609   6.788  1.00  0.87           C  
ATOM   3394  N   ALA A 416      -1.566  11.436   4.717  1.00  0.89           N  
ATOM   3395  CA  ALA A 416      -2.670  11.367   3.789  1.00  0.89           C  
ATOM   3396  C   ALA A 416      -4.032  11.337   4.466  1.00  0.89           C  
ATOM   3397  O   ALA A 416      -4.974  11.981   4.014  1.00  0.89           O  
ATOM   3398  CB  ALA A 416      -2.486  10.127   2.891  1.00  0.89           C  
ATOM   3399  N   ALA A 417      -4.164  10.596   5.583  1.00  0.88           N  
ATOM   3400  CA  ALA A 417      -5.363  10.573   6.391  1.00  0.88           C  
ATOM   3401  C   ALA A 417      -5.693  11.903   7.060  1.00  0.88           C  
ATOM   3402  O   ALA A 417      -6.838  12.345   7.063  1.00  0.88           O  
ATOM   3403  CB  ALA A 417      -5.206   9.478   7.462  1.00  0.88           C  
ATOM   3404  N   ALA A 418      -4.683  12.578   7.642  1.00  0.88           N  
ATOM   3405  CA  ALA A 418      -4.851  13.879   8.248  1.00  0.88           C  
ATOM   3406  C   ALA A 418      -5.132  14.999   7.253  1.00  0.88           C  
ATOM   3407  O   ALA A 418      -5.959  15.874   7.501  1.00  0.88           O  
ATOM   3408  CB  ALA A 418      -3.600  14.209   9.078  1.00  0.88           C  
ATOM   3409  N   PHE A 419      -4.446  14.993   6.094  1.00  0.87           N  
ATOM   3410  CA  PHE A 419      -4.583  16.031   5.089  1.00  0.87           C  
ATOM   3411  C   PHE A 419      -5.036  15.447   3.745  1.00  0.87           C  
ATOM   3412  O   PHE A 419      -4.248  15.428   2.792  1.00  0.87           O  
ATOM   3413  CB  PHE A 419      -3.243  16.787   4.894  1.00  0.87           C  
ATOM   3414  CG  PHE A 419      -2.764  17.405   6.186  1.00  0.87           C  
ATOM   3415  CD1 PHE A 419      -1.954  16.669   7.071  1.00  0.87           C  
ATOM   3416  CD2 PHE A 419      -3.087  18.732   6.516  1.00  0.87           C  
ATOM   3417  CE1 PHE A 419      -1.504  17.232   8.271  1.00  0.87           C  
ATOM   3418  CE2 PHE A 419      -2.635  19.300   7.716  1.00  0.87           C  
ATOM   3419  CZ  PHE A 419      -1.851  18.547   8.598  1.00  0.87           C  
ATOM   3420  N   PRO A 420      -6.265  14.939   3.603  1.00  0.89           N  
ATOM   3421  CA  PRO A 420      -6.737  14.299   2.380  1.00  0.89           C  
ATOM   3422  C   PRO A 420      -6.645  15.183   1.145  1.00  0.89           C  
ATOM   3423  O   PRO A 420      -7.209  16.271   1.109  1.00  0.89           O  
ATOM   3424  CB  PRO A 420      -8.176  13.867   2.712  1.00  0.89           C  
ATOM   3425  CG  PRO A 420      -8.619  14.855   3.793  1.00  0.89           C  
ATOM   3426  CD  PRO A 420      -7.337  15.043   4.597  1.00  0.89           C  
ATOM   3427  N   GLY A 421      -5.943  14.702   0.098  1.00  0.88           N  
ATOM   3428  CA  GLY A 421      -5.767  15.424  -1.157  1.00  0.88           C  
ATOM   3429  C   GLY A 421      -4.611  16.397  -1.217  1.00  0.88           C  
ATOM   3430  O   GLY A 421      -4.371  16.982  -2.271  1.00  0.88           O  
ATOM   3431  N   ASP A 422      -3.824  16.579  -0.133  1.00  0.88           N  
ATOM   3432  CA  ASP A 422      -2.667  17.462  -0.135  1.00  0.88           C  
ATOM   3433  C   ASP A 422      -1.446  16.766  -0.758  1.00  0.88           C  
ATOM   3434  O   ASP A 422      -0.585  16.194  -0.091  1.00  0.88           O  
ATOM   3435  CB  ASP A 422      -2.419  18.007   1.299  1.00  0.88           C  
ATOM   3436  CG  ASP A 422      -1.476  19.203   1.355  1.00  0.88           C  
ATOM   3437  OD1 ASP A 422      -0.721  19.435   0.372  1.00  0.88           O  
ATOM   3438  OD2 ASP A 422      -1.432  19.863   2.431  1.00  0.88           O  
ATOM   3439  N   VAL A 423      -1.376  16.796  -2.107  1.00  0.82           N  
ATOM   3440  CA  VAL A 423      -0.368  16.135  -2.924  1.00  0.82           C  
ATOM   3441  C   VAL A 423       1.067  16.582  -2.645  1.00  0.82           C  
ATOM   3442  O   VAL A 423       1.967  15.758  -2.506  1.00  0.82           O  
ATOM   3443  CB  VAL A 423      -0.686  16.321  -4.411  1.00  0.82           C  
ATOM   3444  CG1 VAL A 423       0.395  15.681  -5.310  1.00  0.82           C  
ATOM   3445  CG2 VAL A 423      -2.055  15.688  -4.744  1.00  0.82           C  
ATOM   3446  N   ASP A 424       1.331  17.905  -2.523  1.00  0.86           N  
ATOM   3447  CA  ASP A 424       2.663  18.406  -2.237  1.00  0.86           C  
ATOM   3448  C   ASP A 424       3.113  18.040  -0.825  1.00  0.86           C  
ATOM   3449  O   ASP A 424       4.281  17.764  -0.577  1.00  0.86           O  
ATOM   3450  CB  ASP A 424       2.748  19.930  -2.501  1.00  0.86           C  
ATOM   3451  CG  ASP A 424       4.194  20.374  -2.499  1.00  0.86           C  
ATOM   3452  OD1 ASP A 424       4.947  19.953  -3.411  1.00  0.86           O  
ATOM   3453  OD2 ASP A 424       4.619  21.102  -1.565  1.00  0.86           O  
ATOM   3454  N   ARG A 425       2.194  17.985   0.150  1.00  0.85           N  
ATOM   3455  CA  ARG A 425       2.523  17.609   1.506  1.00  0.85           C  
ATOM   3456  C   ARG A 425       3.085  16.209   1.670  1.00  0.85           C  
ATOM   3457  O   ARG A 425       4.011  15.996   2.451  1.00  0.85           O  
ATOM   3458  CB  ARG A 425       1.274  17.772   2.359  1.00  0.85           C  
ATOM   3459  CG  ARG A 425       1.526  17.745   3.865  1.00  0.85           C  
ATOM   3460  CD  ARG A 425       0.241  17.997   4.637  1.00  0.85           C  
ATOM   3461  NE  ARG A 425       0.650  18.520   5.964  1.00  0.85           N  
ATOM   3462  CZ  ARG A 425       0.572  19.810   6.301  1.00  0.85           C  
ATOM   3463  NH1 ARG A 425      -0.009  20.730   5.543  1.00  0.85           N  
ATOM   3464  NH2 ARG A 425       1.082  20.185   7.467  1.00  0.85           N  
ATOM   3465  N   LEU A 426       2.588  15.220   0.893  1.00  0.87           N  
ATOM   3466  CA  LEU A 426       3.218  13.907   0.827  1.00  0.87           C  
ATOM   3467  C   LEU A 426       4.667  13.982   0.340  1.00  0.87           C  
ATOM   3468  O   LEU A 426       5.544  13.308   0.870  1.00  0.87           O  
ATOM   3469  CB  LEU A 426       2.466  12.887  -0.082  1.00  0.87           C  
ATOM   3470  CG  LEU A 426       1.160  12.237   0.453  1.00  0.87           C  
ATOM   3471  CD1 LEU A 426       1.082  12.141   1.983  1.00  0.87           C  
ATOM   3472  CD2 LEU A 426      -0.108  12.901  -0.107  1.00  0.87           C  
ATOM   3473  N   ARG A 427       4.960  14.832  -0.667  1.00  0.82           N  
ATOM   3474  CA  ARG A 427       6.315  15.090  -1.124  1.00  0.82           C  
ATOM   3475  C   ARG A 427       7.197  15.769  -0.076  1.00  0.82           C  
ATOM   3476  O   ARG A 427       8.347  15.387   0.111  1.00  0.82           O  
ATOM   3477  CB  ARG A 427       6.276  15.950  -2.414  1.00  0.82           C  
ATOM   3478  CG  ARG A 427       7.636  16.203  -3.102  1.00  0.82           C  
ATOM   3479  CD  ARG A 427       7.570  17.274  -4.202  1.00  0.82           C  
ATOM   3480  NE  ARG A 427       7.194  18.581  -3.573  1.00  0.82           N  
ATOM   3481  CZ  ARG A 427       7.994  19.440  -2.932  1.00  0.82           C  
ATOM   3482  NH1 ARG A 427       9.291  19.213  -2.768  1.00  0.82           N  
ATOM   3483  NH2 ARG A 427       7.448  20.555  -2.447  1.00  0.82           N  
ATOM   3484  N   ARG A 428       6.687  16.795   0.637  1.00  0.85           N  
ATOM   3485  CA  ARG A 428       7.431  17.506   1.665  1.00  0.85           C  
ATOM   3486  C   ARG A 428       7.740  16.714   2.928  1.00  0.85           C  
ATOM   3487  O   ARG A 428       8.823  16.848   3.496  1.00  0.85           O  
ATOM   3488  CB  ARG A 428       6.721  18.813   2.081  1.00  0.85           C  
ATOM   3489  CG  ARG A 428       6.489  19.797   0.923  1.00  0.85           C  
ATOM   3490  CD  ARG A 428       6.119  21.225   1.362  1.00  0.85           C  
ATOM   3491  NE  ARG A 428       4.970  21.196   2.326  1.00  0.85           N  
ATOM   3492  CZ  ARG A 428       3.677  21.301   1.986  1.00  0.85           C  
ATOM   3493  NH1 ARG A 428       3.287  21.428   0.730  1.00  0.85           N  
ATOM   3494  NH2 ARG A 428       2.739  21.287   2.932  1.00  0.85           N  
ATOM   3495  N   MET A 429       6.793  15.885   3.411  1.00  0.90           N  
ATOM   3496  CA  MET A 429       6.951  15.183   4.673  1.00  0.90           C  
ATOM   3497  C   MET A 429       7.494  13.776   4.521  1.00  0.90           C  
ATOM   3498  O   MET A 429       7.663  13.057   5.504  1.00  0.90           O  
ATOM   3499  CB  MET A 429       5.588  15.060   5.389  1.00  0.90           C  
ATOM   3500  CG  MET A 429       4.952  16.419   5.703  1.00  0.90           C  
ATOM   3501  SD  MET A 429       3.418  16.297   6.678  1.00  0.90           S  
ATOM   3502  CE  MET A 429       4.210  15.848   8.240  1.00  0.90           C  
ATOM   3503  N   SER A 430       7.773  13.336   3.281  1.00  0.92           N  
ATOM   3504  CA  SER A 430       8.398  12.047   3.023  1.00  0.92           C  
ATOM   3505  C   SER A 430       9.782  11.929   3.621  1.00  0.92           C  
ATOM   3506  O   SER A 430      10.605  12.832   3.534  1.00  0.92           O  
ATOM   3507  CB  SER A 430       8.494  11.750   1.504  1.00  0.92           C  
ATOM   3508  OG  SER A 430       9.023  10.456   1.183  1.00  0.92           O  
ATOM   3509  N   LEU A 431      10.104  10.752   4.193  1.00  0.93           N  
ATOM   3510  CA  LEU A 431      11.434  10.467   4.689  1.00  0.93           C  
ATOM   3511  C   LEU A 431      12.386  10.278   3.526  1.00  0.93           C  
ATOM   3512  O   LEU A 431      13.599  10.386   3.669  1.00  0.93           O  
ATOM   3513  CB  LEU A 431      11.519   9.168   5.539  1.00  0.93           C  
ATOM   3514  CG  LEU A 431      10.527   9.013   6.713  1.00  0.93           C  
ATOM   3515  CD1 LEU A 431      11.049   7.928   7.670  1.00  0.93           C  
ATOM   3516  CD2 LEU A 431      10.255  10.325   7.457  1.00  0.93           C  
ATOM   3517  N   VAL A 432      11.830   9.993   2.338  1.00  0.93           N  
ATOM   3518  CA  VAL A 432      12.557   9.832   1.103  1.00  0.93           C  
ATOM   3519  C   VAL A 432      12.537  11.139   0.312  1.00  0.93           C  
ATOM   3520  O   VAL A 432      11.481  11.627  -0.088  1.00  0.93           O  
ATOM   3521  CB  VAL A 432      11.948   8.718   0.261  1.00  0.93           C  
ATOM   3522  CG1 VAL A 432      12.800   8.490  -0.997  1.00  0.93           C  
ATOM   3523  CG2 VAL A 432      11.865   7.415   1.084  1.00  0.93           C  
ATOM   3524  N   GLU A 433      13.723  11.728   0.062  1.00  0.86           N  
ATOM   3525  CA  GLU A 433      13.886  12.950  -0.703  1.00  0.86           C  
ATOM   3526  C   GLU A 433      14.302  12.626  -2.127  1.00  0.86           C  
ATOM   3527  O   GLU A 433      15.315  11.978  -2.367  1.00  0.86           O  
ATOM   3528  CB  GLU A 433      14.981  13.869  -0.089  1.00  0.86           C  
ATOM   3529  CG  GLU A 433      15.256  15.183  -0.875  1.00  0.86           C  
ATOM   3530  CD  GLU A 433      16.550  15.881  -0.484  1.00  0.86           C  
ATOM   3531  OE1 GLU A 433      16.582  16.574   0.568  1.00  0.86           O  
ATOM   3532  OE2 GLU A 433      17.561  15.779  -1.233  1.00  0.86           O  
ATOM   3533  N   GLU A 434      13.515  13.110  -3.108  1.00  0.80           N  
ATOM   3534  CA  GLU A 434      13.851  13.018  -4.515  1.00  0.80           C  
ATOM   3535  C   GLU A 434      14.617  14.259  -4.958  1.00  0.80           C  
ATOM   3536  O   GLU A 434      14.571  15.312  -4.332  1.00  0.80           O  
ATOM   3537  CB  GLU A 434      12.594  12.887  -5.409  1.00  0.80           C  
ATOM   3538  CG  GLU A 434      11.621  11.739  -5.027  1.00  0.80           C  
ATOM   3539  CD  GLU A 434      12.218  10.332  -5.052  1.00  0.80           C  
ATOM   3540  OE1 GLU A 434      12.927   9.961  -6.022  1.00  0.80           O  
ATOM   3541  OE2 GLU A 434      11.921   9.577  -4.089  1.00  0.80           O  
ATOM   3542  N   GLY A 435      15.334  14.179  -6.097  1.00  0.79           N  
ATOM   3543  CA  GLY A 435      16.098  15.313  -6.586  1.00  0.79           C  
ATOM   3544  C   GLY A 435      17.191  14.853  -7.503  1.00  0.79           C  
ATOM   3545  O   GLY A 435      17.031  13.897  -8.251  1.00  0.79           O  
ATOM   3546  N   ALA A 436      18.363  15.523  -7.463  1.00  0.72           N  
ATOM   3547  CA  ALA A 436      19.546  15.103  -8.193  1.00  0.72           C  
ATOM   3548  C   ALA A 436      20.079  13.752  -7.727  1.00  0.72           C  
ATOM   3549  O   ALA A 436      20.581  12.948  -8.506  1.00  0.72           O  
ATOM   3550  CB  ALA A 436      20.653  16.171  -8.046  1.00  0.72           C  
ATOM   3551  N   VAL A 437      19.979  13.492  -6.412  1.00  0.83           N  
ATOM   3552  CA  VAL A 437      20.377  12.237  -5.808  1.00  0.83           C  
ATOM   3553  C   VAL A 437      19.273  11.894  -4.844  1.00  0.83           C  
ATOM   3554  O   VAL A 437      18.900  12.735  -4.035  1.00  0.83           O  
ATOM   3555  CB  VAL A 437      21.672  12.333  -4.998  1.00  0.83           C  
ATOM   3556  CG1 VAL A 437      22.085  10.942  -4.474  1.00  0.83           C  
ATOM   3557  CG2 VAL A 437      22.803  12.928  -5.858  1.00  0.83           C  
ATOM   3558  N   LYS A 438      18.720  10.667  -4.913  1.00  0.86           N  
ATOM   3559  CA  LYS A 438      17.690  10.211  -4.003  1.00  0.86           C  
ATOM   3560  C   LYS A 438      18.245   9.913  -2.612  1.00  0.86           C  
ATOM   3561  O   LYS A 438      19.243   9.208  -2.463  1.00  0.86           O  
ATOM   3562  CB  LYS A 438      16.988   8.970  -4.593  1.00  0.86           C  
ATOM   3563  CG  LYS A 438      15.724   8.528  -3.850  1.00  0.86           C  
ATOM   3564  CD  LYS A 438      15.094   7.302  -4.525  1.00  0.86           C  
ATOM   3565  CE  LYS A 438      13.808   6.873  -3.827  1.00  0.86           C  
ATOM   3566  NZ  LYS A 438      13.184   5.727  -4.510  1.00  0.86           N  
ATOM   3567  N   ARG A 439      17.623  10.468  -1.553  1.00  0.88           N  
ATOM   3568  CA  ARG A 439      18.169  10.444  -0.207  1.00  0.88           C  
ATOM   3569  C   ARG A 439      17.135  10.110   0.846  1.00  0.88           C  
ATOM   3570  O   ARG A 439      15.933  10.167   0.623  1.00  0.88           O  
ATOM   3571  CB  ARG A 439      18.761  11.821   0.193  1.00  0.88           C  
ATOM   3572  CG  ARG A 439      19.827  12.364  -0.771  1.00  0.88           C  
ATOM   3573  CD  ARG A 439      20.164  13.824  -0.497  1.00  0.88           C  
ATOM   3574  NE  ARG A 439      21.098  14.288  -1.561  1.00  0.88           N  
ATOM   3575  CZ  ARG A 439      22.428  14.182  -1.478  1.00  0.88           C  
ATOM   3576  NH1 ARG A 439      23.025  13.656  -0.410  1.00  0.88           N  
ATOM   3577  NH2 ARG A 439      23.176  14.627  -2.487  1.00  0.88           N  
ATOM   3578  N   ILE A 440      17.603   9.772   2.061  1.00  0.94           N  
ATOM   3579  CA  ILE A 440      16.756   9.667   3.236  1.00  0.94           C  
ATOM   3580  C   ILE A 440      17.011  10.879   4.110  1.00  0.94           C  
ATOM   3581  O   ILE A 440      18.148  11.171   4.475  1.00  0.94           O  
ATOM   3582  CB  ILE A 440      17.002   8.400   4.050  1.00  0.94           C  
ATOM   3583  CG1 ILE A 440      16.793   7.123   3.199  1.00  0.94           C  
ATOM   3584  CG2 ILE A 440      16.095   8.383   5.304  1.00  0.94           C  
ATOM   3585  CD1 ILE A 440      15.390   6.971   2.599  1.00  0.94           C  
ATOM   3586  N   ASN A 441      15.950  11.629   4.468  1.00  0.94           N  
ATOM   3587  CA  ASN A 441      16.033  12.769   5.354  1.00  0.94           C  
ATOM   3588  C   ASN A 441      15.992  12.288   6.797  1.00  0.94           C  
ATOM   3589  O   ASN A 441      14.977  11.802   7.300  1.00  0.94           O  
ATOM   3590  CB  ASN A 441      14.875  13.761   5.058  1.00  0.94           C  
ATOM   3591  CG  ASN A 441      15.028  15.082   5.808  1.00  0.94           C  
ATOM   3592  OD1 ASN A 441      15.175  15.131   7.029  1.00  0.94           O  
ATOM   3593  ND2 ASN A 441      14.994  16.202   5.050  1.00  0.94           N  
ATOM   3594  N   MET A 442      17.122  12.424   7.517  1.00  0.95           N  
ATOM   3595  CA  MET A 442      17.239  11.831   8.829  1.00  0.95           C  
ATOM   3596  C   MET A 442      16.548  12.636   9.911  1.00  0.95           C  
ATOM   3597  O   MET A 442      16.146  12.106  10.944  1.00  0.95           O  
ATOM   3598  CB  MET A 442      18.717  11.622   9.203  1.00  0.95           C  
ATOM   3599  CG  MET A 442      19.546  10.860   8.151  1.00  0.95           C  
ATOM   3600  SD  MET A 442      18.801   9.335   7.465  1.00  0.95           S  
ATOM   3601  CE  MET A 442      19.422   8.107   8.647  1.00  0.95           C  
ATOM   3602  N   ALA A 443      16.324  13.944   9.674  1.00  0.97           N  
ATOM   3603  CA  ALA A 443      15.538  14.776  10.557  1.00  0.97           C  
ATOM   3604  C   ALA A 443      14.085  14.356  10.545  1.00  0.97           C  
ATOM   3605  O   ALA A 443      13.452  14.210  11.586  1.00  0.97           O  
ATOM   3606  CB  ALA A 443      15.689  16.257  10.166  1.00  0.97           C  
ATOM   3607  N   HIS A 444      13.549  14.079   9.343  1.00  0.94           N  
ATOM   3608  CA  HIS A 444      12.214  13.547   9.164  1.00  0.94           C  
ATOM   3609  C   HIS A 444      12.043  12.167   9.788  1.00  0.94           C  
ATOM   3610  O   HIS A 444      11.038  11.904  10.450  1.00  0.94           O  
ATOM   3611  CB  HIS A 444      11.831  13.516   7.671  1.00  0.94           C  
ATOM   3612  CG  HIS A 444      11.814  14.857   7.000  1.00  0.94           C  
ATOM   3613  ND1 HIS A 444      11.457  14.881   5.674  1.00  0.94           N  
ATOM   3614  CD2 HIS A 444      12.003  16.124   7.453  1.00  0.94           C  
ATOM   3615  CE1 HIS A 444      11.420  16.150   5.335  1.00  0.94           C  
ATOM   3616  NE2 HIS A 444      11.748  16.952   6.377  1.00  0.94           N  
ATOM   3617  N   LEU A 445      13.047  11.265   9.648  1.00  0.96           N  
ATOM   3618  CA  LEU A 445      13.066   9.964  10.310  1.00  0.96           C  
ATOM   3619  C   LEU A 445      13.010  10.091  11.824  1.00  0.96           C  
ATOM   3620  O   LEU A 445      12.218   9.427  12.497  1.00  0.96           O  
ATOM   3621  CB  LEU A 445      14.335   9.166   9.897  1.00  0.96           C  
ATOM   3622  CG  LEU A 445      14.585   7.822  10.626  1.00  0.96           C  
ATOM   3623  CD1 LEU A 445      13.441   6.812  10.440  1.00  0.96           C  
ATOM   3624  CD2 LEU A 445      15.909   7.204  10.148  1.00  0.96           C  
ATOM   3625  N   CYS A 446      13.805  11.019  12.392  1.00  0.98           N  
ATOM   3626  CA  CYS A 446      13.765  11.347  13.801  1.00  0.98           C  
ATOM   3627  C   CYS A 446      12.433  11.885  14.289  1.00  0.98           C  
ATOM   3628  O   CYS A 446      11.979  11.524  15.367  1.00  0.98           O  
ATOM   3629  CB  CYS A 446      14.859  12.362  14.180  1.00  0.98           C  
ATOM   3630  SG  CYS A 446      16.493  11.609  14.402  1.00  0.98           S  
ATOM   3631  N   ILE A 447      11.763  12.767  13.524  1.00  0.96           N  
ATOM   3632  CA  ILE A 447      10.445  13.278  13.880  1.00  0.96           C  
ATOM   3633  C   ILE A 447       9.389  12.190  13.879  1.00  0.96           C  
ATOM   3634  O   ILE A 447       8.579  12.084  14.802  1.00  0.96           O  
ATOM   3635  CB  ILE A 447      10.003  14.425  12.978  1.00  0.96           C  
ATOM   3636  CG1 ILE A 447      10.942  15.640  13.157  1.00  0.96           C  
ATOM   3637  CG2 ILE A 447       8.545  14.832  13.302  1.00  0.96           C  
ATOM   3638  CD1 ILE A 447      10.716  16.742  12.121  1.00  0.96           C  
ATOM   3639  N   ALA A 448       9.391  11.319  12.852  1.00  0.96           N  
ATOM   3640  CA  ALA A 448       8.454  10.228  12.735  1.00  0.96           C  
ATOM   3641  C   ALA A 448       8.558   9.214  13.868  1.00  0.96           C  
ATOM   3642  O   ALA A 448       7.547   8.784  14.421  1.00  0.96           O  
ATOM   3643  CB  ALA A 448       8.684   9.519  11.388  1.00  0.96           C  
ATOM   3644  N   GLY A 449       9.798   8.841  14.251  1.00  0.97           N  
ATOM   3645  CA  GLY A 449      10.047   7.808  15.249  1.00  0.97           C  
ATOM   3646  C   GLY A 449      10.317   8.240  16.667  1.00  0.97           C  
ATOM   3647  O   GLY A 449      10.740   7.416  17.465  1.00  0.97           O  
ATOM   3648  N   SER A 450      10.098   9.520  17.020  1.00  0.97           N  
ATOM   3649  CA  SER A 450      10.314  10.030  18.375  1.00  0.97           C  
ATOM   3650  C   SER A 450       9.047  10.620  18.960  1.00  0.97           C  
ATOM   3651  O   SER A 450       8.269  11.242  18.240  1.00  0.97           O  
ATOM   3652  CB  SER A 450      11.322  11.202  18.391  1.00  0.97           C  
ATOM   3653  OG  SER A 450      12.656  10.755  18.155  1.00  0.97           O  
ATOM   3654  N   HIS A 451       8.793  10.489  20.286  1.00  0.95           N  
ATOM   3655  CA  HIS A 451       7.628  11.101  20.920  1.00  0.95           C  
ATOM   3656  C   HIS A 451       7.811  12.576  21.212  1.00  0.95           C  
ATOM   3657  O   HIS A 451       6.848  13.290  21.459  1.00  0.95           O  
ATOM   3658  CB  HIS A 451       7.206  10.427  22.254  1.00  0.95           C  
ATOM   3659  CG  HIS A 451       8.150  10.608  23.408  1.00  0.95           C  
ATOM   3660  ND1 HIS A 451       9.272   9.823  23.469  1.00  0.95           N  
ATOM   3661  CD2 HIS A 451       8.094  11.427  24.492  1.00  0.95           C  
ATOM   3662  CE1 HIS A 451       9.884  10.161  24.581  1.00  0.95           C  
ATOM   3663  NE2 HIS A 451       9.213  11.134  25.246  1.00  0.95           N  
ATOM   3664  N   ALA A 452       9.063  13.062  21.177  1.00  0.97           N  
ATOM   3665  CA  ALA A 452       9.371  14.444  21.438  1.00  0.97           C  
ATOM   3666  C   ALA A 452      10.472  14.911  20.513  1.00  0.97           C  
ATOM   3667  O   ALA A 452      11.464  14.230  20.276  1.00  0.97           O  
ATOM   3668  CB  ALA A 452       9.834  14.646  22.892  1.00  0.97           C  
ATOM   3669  N   VAL A 453      10.288  16.122  19.963  1.00  0.97           N  
ATOM   3670  CA  VAL A 453      11.264  16.778  19.124  1.00  0.97           C  
ATOM   3671  C   VAL A 453      11.487  18.131  19.738  1.00  0.97           C  
ATOM   3672  O   VAL A 453      10.557  18.917  19.896  1.00  0.97           O  
ATOM   3673  CB  VAL A 453      10.788  16.971  17.689  1.00  0.97           C  
ATOM   3674  CG1 VAL A 453      11.860  17.730  16.873  1.00  0.97           C  
ATOM   3675  CG2 VAL A 453      10.506  15.593  17.061  1.00  0.97           C  
ATOM   3676  N   ASN A 454      12.732  18.457  20.123  1.00  0.96           N  
ATOM   3677  CA  ASN A 454      12.986  19.744  20.732  1.00  0.96           C  
ATOM   3678  C   ASN A 454      14.044  20.561  20.026  1.00  0.96           C  
ATOM   3679  O   ASN A 454      15.077  20.085  19.599  1.00  0.96           O  
ATOM   3680  CB  ASN A 454      13.243  19.677  22.255  1.00  0.96           C  
ATOM   3681  CG  ASN A 454      14.559  19.005  22.622  1.00  0.96           C  
ATOM   3682  OD1 ASN A 454      14.623  17.801  22.851  1.00  0.96           O  
ATOM   3683  ND2 ASN A 454      15.623  19.828  22.751  1.00  0.96           N  
ATOM   3684  N   GLY A 455      13.767  21.881  19.938  1.00  0.97           N  
ATOM   3685  CA  GLY A 455      14.802  22.858  19.647  1.00  0.97           C  
ATOM   3686  C   GLY A 455      15.512  23.222  20.929  1.00  0.97           C  
ATOM   3687  O   GLY A 455      15.135  22.780  22.015  1.00  0.97           O  
ATOM   3688  N   VAL A 456      16.566  24.045  20.823  1.00  0.96           N  
ATOM   3689  CA  VAL A 456      17.635  24.147  21.794  1.00  0.96           C  
ATOM   3690  C   VAL A 456      17.841  25.593  22.297  1.00  0.96           C  
ATOM   3691  O   VAL A 456      18.738  25.903  23.084  1.00  0.96           O  
ATOM   3692  CB  VAL A 456      18.827  23.493  21.089  1.00  0.96           C  
ATOM   3693  CG1 VAL A 456      19.729  24.523  20.398  1.00  0.96           C  
ATOM   3694  CG2 VAL A 456      19.580  22.535  22.020  1.00  0.96           C  
ATOM   3695  N   ALA A 457      16.933  26.508  21.880  1.00  0.96           N  
ATOM   3696  CA  ALA A 457      16.723  27.840  22.429  1.00  0.96           C  
ATOM   3697  C   ALA A 457      15.344  28.267  21.964  1.00  0.96           C  
ATOM   3698  O   ALA A 457      14.831  27.715  20.990  1.00  0.96           O  
ATOM   3699  CB  ALA A 457      17.757  28.894  21.986  1.00  0.96           C  
ATOM   3700  N   ARG A 458      14.688  29.223  22.655  1.00  0.88           N  
ATOM   3701  CA  ARG A 458      13.295  29.575  22.410  1.00  0.88           C  
ATOM   3702  C   ARG A 458      13.015  30.062  20.993  1.00  0.88           C  
ATOM   3703  O   ARG A 458      12.069  29.620  20.343  1.00  0.88           O  
ATOM   3704  CB  ARG A 458      12.829  30.616  23.466  1.00  0.88           C  
ATOM   3705  CG  ARG A 458      11.342  31.035  23.382  1.00  0.88           C  
ATOM   3706  CD  ARG A 458      10.817  31.799  24.609  1.00  0.88           C  
ATOM   3707  NE  ARG A 458      11.538  33.103  24.604  1.00  0.88           N  
ATOM   3708  CZ  ARG A 458      11.826  33.863  25.666  1.00  0.88           C  
ATOM   3709  NH1 ARG A 458      11.446  33.608  26.904  1.00  0.88           N  
ATOM   3710  NH2 ARG A 458      12.527  34.970  25.445  1.00  0.88           N  
ATOM   3711  N   ILE A 459      13.871  30.946  20.442  1.00  0.90           N  
ATOM   3712  CA  ILE A 459      13.737  31.460  19.092  1.00  0.90           C  
ATOM   3713  C   ILE A 459      13.897  30.380  18.026  1.00  0.90           C  
ATOM   3714  O   ILE A 459      13.125  30.292  17.095  1.00  0.90           O  
ATOM   3715  CB  ILE A 459      14.650  32.655  18.871  1.00  0.90           C  
ATOM   3716  CG1 ILE A 459      14.315  33.387  17.555  1.00  0.90           C  
ATOM   3717  CG2 ILE A 459      16.129  32.228  18.941  1.00  0.90           C  
ATOM   3718  CD1 ILE A 459      15.014  34.744  17.441  1.00  0.90           C  
ATOM   3719  N   HIS A 460      14.889  29.478  18.205  1.00  0.90           N  
ATOM   3720  CA  HIS A 460      15.136  28.334  17.348  1.00  0.90           C  
ATOM   3721  C   HIS A 460      13.998  27.328  17.332  1.00  0.90           C  
ATOM   3722  O   HIS A 460      13.558  26.909  16.263  1.00  0.90           O  
ATOM   3723  CB  HIS A 460      16.472  27.690  17.769  1.00  0.90           C  
ATOM   3724  CG  HIS A 460      16.812  26.398  17.109  1.00  0.90           C  
ATOM   3725  ND1 HIS A 460      16.918  26.361  15.742  1.00  0.90           N  
ATOM   3726  CD2 HIS A 460      17.018  25.163  17.626  1.00  0.90           C  
ATOM   3727  CE1 HIS A 460      17.179  25.102  15.452  1.00  0.90           C  
ATOM   3728  NE2 HIS A 460      17.249  24.335  16.559  1.00  0.90           N  
ATOM   3729  N   SER A 461      13.403  26.957  18.487  1.00  0.93           N  
ATOM   3730  CA  SER A 461      12.219  26.099  18.493  1.00  0.93           C  
ATOM   3731  C   SER A 461      11.031  26.704  17.756  1.00  0.93           C  
ATOM   3732  O   SER A 461      10.338  26.041  16.998  1.00  0.93           O  
ATOM   3733  CB  SER A 461      11.737  25.743  19.922  1.00  0.93           C  
ATOM   3734  OG  SER A 461      12.672  24.922  20.624  1.00  0.93           O  
ATOM   3735  N   GLU A 462      10.798  28.020  17.940  1.00  0.86           N  
ATOM   3736  CA  GLU A 462       9.790  28.744  17.194  1.00  0.86           C  
ATOM   3737  C   GLU A 462      10.057  28.826  15.701  1.00  0.86           C  
ATOM   3738  O   GLU A 462       9.114  28.738  14.912  1.00  0.86           O  
ATOM   3739  CB  GLU A 462       9.559  30.148  17.791  1.00  0.86           C  
ATOM   3740  CG  GLU A 462       8.782  30.120  19.133  1.00  0.86           C  
ATOM   3741  CD  GLU A 462       7.509  29.285  19.097  1.00  0.86           C  
ATOM   3742  OE1 GLU A 462       6.604  29.583  18.267  1.00  0.86           O  
ATOM   3743  OE2 GLU A 462       7.412  28.295  19.868  1.00  0.86           O  
ATOM   3744  N   ILE A 463      11.327  28.977  15.270  1.00  0.84           N  
ATOM   3745  CA  ILE A 463      11.733  28.869  13.877  1.00  0.84           C  
ATOM   3746  C   ILE A 463      11.458  27.477  13.315  1.00  0.84           C  
ATOM   3747  O   ILE A 463      10.870  27.354  12.252  1.00  0.84           O  
ATOM   3748  CB  ILE A 463      13.193  29.275  13.664  1.00  0.84           C  
ATOM   3749  CG1 ILE A 463      13.381  30.785  13.956  1.00  0.84           C  
ATOM   3750  CG2 ILE A 463      13.642  28.970  12.215  1.00  0.84           C  
ATOM   3751  CD1 ILE A 463      14.852  31.206  14.079  1.00  0.84           C  
ATOM   3752  N   LEU A 464      11.792  26.385  14.047  1.00  0.89           N  
ATOM   3753  CA  LEU A 464      11.549  25.016  13.603  1.00  0.89           C  
ATOM   3754  C   LEU A 464      10.084  24.743  13.314  1.00  0.89           C  
ATOM   3755  O   LEU A 464       9.736  24.187  12.273  1.00  0.89           O  
ATOM   3756  CB  LEU A 464      11.998  23.980  14.671  1.00  0.89           C  
ATOM   3757  CG  LEU A 464      13.516  23.827  14.882  1.00  0.89           C  
ATOM   3758  CD1 LEU A 464      13.793  22.852  16.040  1.00  0.89           C  
ATOM   3759  CD2 LEU A 464      14.218  23.352  13.606  1.00  0.89           C  
ATOM   3760  N   LYS A 465       9.187  25.200  14.208  1.00  0.86           N  
ATOM   3761  CA  LYS A 465       7.752  25.060  14.069  1.00  0.86           C  
ATOM   3762  C   LYS A 465       7.158  25.898  12.941  1.00  0.86           C  
ATOM   3763  O   LYS A 465       6.033  25.648  12.519  1.00  0.86           O  
ATOM   3764  CB  LYS A 465       7.060  25.492  15.386  1.00  0.86           C  
ATOM   3765  CG  LYS A 465       7.236  24.517  16.565  1.00  0.86           C  
ATOM   3766  CD  LYS A 465       6.960  25.181  17.930  1.00  0.86           C  
ATOM   3767  CE  LYS A 465       5.632  25.943  18.004  1.00  0.86           C  
ATOM   3768  NZ  LYS A 465       5.484  26.621  19.303  1.00  0.86           N  
ATOM   3769  N   LYS A 466       7.879  26.923  12.437  1.00  0.79           N  
ATOM   3770  CA  LYS A 466       7.357  27.806  11.411  1.00  0.79           C  
ATOM   3771  C   LYS A 466       8.031  27.633  10.058  1.00  0.79           C  
ATOM   3772  O   LYS A 466       7.477  28.065   9.048  1.00  0.79           O  
ATOM   3773  CB  LYS A 466       7.475  29.285  11.849  1.00  0.79           C  
ATOM   3774  CG  LYS A 466       6.571  29.637  13.041  1.00  0.79           C  
ATOM   3775  CD  LYS A 466       6.706  31.115  13.446  1.00  0.79           C  
ATOM   3776  CE  LYS A 466       5.928  31.486  14.716  1.00  0.79           C  
ATOM   3777  NZ  LYS A 466       6.479  30.719  15.849  1.00  0.79           N  
ATOM   3778  N   THR A 467       9.209  26.979   9.975  1.00  0.84           N  
ATOM   3779  CA  THR A 467       9.903  26.767   8.709  1.00  0.84           C  
ATOM   3780  C   THR A 467      10.056  25.286   8.377  1.00  0.84           C  
ATOM   3781  O   THR A 467       9.153  24.648   7.849  1.00  0.84           O  
ATOM   3782  CB  THR A 467      11.261  27.490   8.621  1.00  0.84           C  
ATOM   3783  OG1 THR A 467      12.191  27.089   9.625  1.00  0.84           O  
ATOM   3784  CG2 THR A 467      11.074  29.002   8.798  1.00  0.84           C  
ATOM   3785  N   ILE A 468      11.223  24.684   8.666  1.00  0.82           N  
ATOM   3786  CA  ILE A 468      11.609  23.355   8.221  1.00  0.82           C  
ATOM   3787  C   ILE A 468      10.774  22.212   8.759  1.00  0.82           C  
ATOM   3788  O   ILE A 468      10.584  21.210   8.081  1.00  0.82           O  
ATOM   3789  CB  ILE A 468      13.086  23.051   8.431  1.00  0.82           C  
ATOM   3790  CG1 ILE A 468      13.543  23.244   9.896  1.00  0.82           C  
ATOM   3791  CG2 ILE A 468      13.878  23.955   7.465  1.00  0.82           C  
ATOM   3792  CD1 ILE A 468      14.993  22.802  10.126  1.00  0.82           C  
ATOM   3793  N   PHE A 469      10.251  22.317   9.997  1.00  0.90           N  
ATOM   3794  CA  PHE A 469       9.456  21.258  10.585  1.00  0.90           C  
ATOM   3795  C   PHE A 469       8.000  21.683  10.710  1.00  0.90           C  
ATOM   3796  O   PHE A 469       7.227  21.067  11.445  1.00  0.90           O  
ATOM   3797  CB  PHE A 469      10.020  20.833  11.971  1.00  0.90           C  
ATOM   3798  CG  PHE A 469      11.422  20.252  11.931  1.00  0.90           C  
ATOM   3799  CD1 PHE A 469      12.034  19.734  10.770  1.00  0.90           C  
ATOM   3800  CD2 PHE A 469      12.141  20.189  13.136  1.00  0.90           C  
ATOM   3801  CE1 PHE A 469      13.338  19.222  10.807  1.00  0.90           C  
ATOM   3802  CE2 PHE A 469      13.444  19.679  13.179  1.00  0.90           C  
ATOM   3803  CZ  PHE A 469      14.048  19.209  12.010  1.00  0.90           C  
ATOM   3804  N   LYS A 470       7.560  22.720   9.961  1.00  0.89           N  
ATOM   3805  CA  LYS A 470       6.207  23.248  10.013  1.00  0.89           C  
ATOM   3806  C   LYS A 470       5.130  22.238   9.657  1.00  0.89           C  
ATOM   3807  O   LYS A 470       4.140  22.095  10.354  1.00  0.89           O  
ATOM   3808  CB  LYS A 470       6.059  24.464   9.069  1.00  0.89           C  
ATOM   3809  CG  LYS A 470       4.703  25.186   9.161  1.00  0.89           C  
ATOM   3810  CD  LYS A 470       4.569  26.294   8.109  1.00  0.89           C  
ATOM   3811  CE  LYS A 470       3.269  27.099   8.223  1.00  0.89           C  
ATOM   3812  NZ  LYS A 470       2.085  26.287   7.874  1.00  0.89           N  
ATOM   3813  N   ASP A 471       5.328  21.455   8.571  1.00  0.93           N  
ATOM   3814  CA  ASP A 471       4.364  20.455   8.170  1.00  0.93           C  
ATOM   3815  C   ASP A 471       4.160  19.377   9.221  1.00  0.93           C  
ATOM   3816  O   ASP A 471       3.042  18.918   9.472  1.00  0.93           O  
ATOM   3817  CB  ASP A 471       4.805  19.772   6.862  1.00  0.93           C  
ATOM   3818  CG  ASP A 471       4.648  20.694   5.681  1.00  0.93           C  
ATOM   3819  OD1 ASP A 471       3.509  21.173   5.459  1.00  0.93           O  
ATOM   3820  OD2 ASP A 471       5.629  20.899   4.925  1.00  0.93           O  
ATOM   3821  N   PHE A 472       5.269  18.972   9.859  1.00  0.94           N  
ATOM   3822  CA  PHE A 472       5.310  18.020  10.941  1.00  0.94           C  
ATOM   3823  C   PHE A 472       4.633  18.524  12.199  1.00  0.94           C  
ATOM   3824  O   PHE A 472       3.879  17.797  12.838  1.00  0.94           O  
ATOM   3825  CB  PHE A 472       6.770  17.641  11.263  1.00  0.94           C  
ATOM   3826  CG  PHE A 472       7.427  16.951  10.098  1.00  0.94           C  
ATOM   3827  CD1 PHE A 472       8.092  17.690   9.103  1.00  0.94           C  
ATOM   3828  CD2 PHE A 472       7.398  15.551   9.992  1.00  0.94           C  
ATOM   3829  CE1 PHE A 472       8.695  17.045   8.018  1.00  0.94           C  
ATOM   3830  CE2 PHE A 472       8.014  14.902   8.914  1.00  0.94           C  
ATOM   3831  CZ  PHE A 472       8.653  15.650   7.923  1.00  0.94           C  
ATOM   3832  N   TYR A 473       4.853  19.805  12.562  1.00  0.93           N  
ATOM   3833  CA  TYR A 473       4.201  20.456  13.683  1.00  0.93           C  
ATOM   3834  C   TYR A 473       2.690  20.484  13.514  1.00  0.93           C  
ATOM   3835  O   TYR A 473       1.948  20.218  14.449  1.00  0.93           O  
ATOM   3836  CB  TYR A 473       4.804  21.882  13.867  1.00  0.93           C  
ATOM   3837  CG  TYR A 473       4.067  22.722  14.880  1.00  0.93           C  
ATOM   3838  CD1 TYR A 473       4.085  22.381  16.239  1.00  0.93           C  
ATOM   3839  CD2 TYR A 473       3.306  23.829  14.465  1.00  0.93           C  
ATOM   3840  CE1 TYR A 473       3.350  23.127  17.171  1.00  0.93           C  
ATOM   3841  CE2 TYR A 473       2.565  24.572  15.394  1.00  0.93           C  
ATOM   3842  CZ  TYR A 473       2.581  24.215  16.744  1.00  0.93           C  
ATOM   3843  OH  TYR A 473       1.836  24.968  17.673  1.00  0.93           O  
ATOM   3844  N   GLU A 474       2.192  20.762  12.303  1.00  0.89           N  
ATOM   3845  CA  GLU A 474       0.775  20.683  12.020  1.00  0.89           C  
ATOM   3846  C   GLU A 474       0.181  19.278  12.151  1.00  0.89           C  
ATOM   3847  O   GLU A 474      -0.926  19.111  12.654  1.00  0.89           O  
ATOM   3848  CB  GLU A 474       0.502  21.277  10.630  1.00  0.89           C  
ATOM   3849  CG  GLU A 474       0.895  22.770  10.553  1.00  0.89           C  
ATOM   3850  CD  GLU A 474       0.692  23.408   9.189  1.00  0.89           C  
ATOM   3851  OE1 GLU A 474       0.734  22.703   8.146  1.00  0.89           O  
ATOM   3852  OE2 GLU A 474       0.596  24.666   9.164  1.00  0.89           O  
ATOM   3853  N   LEU A 475       0.898  18.218  11.714  1.00  0.91           N  
ATOM   3854  CA  LEU A 475       0.472  16.843  11.935  1.00  0.91           C  
ATOM   3855  C   LEU A 475       0.502  16.395  13.397  1.00  0.91           C  
ATOM   3856  O   LEU A 475      -0.421  15.748  13.890  1.00  0.91           O  
ATOM   3857  CB  LEU A 475       1.356  15.879  11.106  1.00  0.91           C  
ATOM   3858  CG  LEU A 475       0.917  14.397  11.118  1.00  0.91           C  
ATOM   3859  CD1 LEU A 475      -0.364  14.164  10.311  1.00  0.91           C  
ATOM   3860  CD2 LEU A 475       2.042  13.505  10.583  1.00  0.91           C  
ATOM   3861  N   GLU A 476       1.584  16.720  14.131  1.00  0.91           N  
ATOM   3862  CA  GLU A 476       1.810  16.207  15.470  1.00  0.91           C  
ATOM   3863  C   GLU A 476       2.282  17.307  16.418  1.00  0.91           C  
ATOM   3864  O   GLU A 476       3.430  17.270  16.868  1.00  0.91           O  
ATOM   3865  CB  GLU A 476       2.854  15.050  15.458  1.00  0.91           C  
ATOM   3866  CG  GLU A 476       2.398  13.804  14.652  1.00  0.91           C  
ATOM   3867  CD  GLU A 476       3.446  12.711  14.518  1.00  0.91           C  
ATOM   3868  OE1 GLU A 476       4.581  12.965  14.049  1.00  0.91           O  
ATOM   3869  OE2 GLU A 476       3.148  11.541  14.888  1.00  0.91           O  
ATOM   3870  N   PRO A 477       1.456  18.300  16.785  1.00  0.94           N  
ATOM   3871  CA  PRO A 477       1.897  19.499  17.503  1.00  0.94           C  
ATOM   3872  C   PRO A 477       2.440  19.210  18.880  1.00  0.94           C  
ATOM   3873  O   PRO A 477       3.285  19.949  19.375  1.00  0.94           O  
ATOM   3874  CB  PRO A 477       0.646  20.396  17.545  1.00  0.94           C  
ATOM   3875  CG  PRO A 477      -0.531  19.430  17.372  1.00  0.94           C  
ATOM   3876  CD  PRO A 477       0.041  18.392  16.410  1.00  0.94           C  
ATOM   3877  N   HIS A 478       1.954  18.135  19.510  1.00  0.90           N  
ATOM   3878  CA  HIS A 478       2.315  17.681  20.833  1.00  0.90           C  
ATOM   3879  C   HIS A 478       3.776  17.288  20.998  1.00  0.90           C  
ATOM   3880  O   HIS A 478       4.351  17.442  22.073  1.00  0.90           O  
ATOM   3881  CB  HIS A 478       1.376  16.515  21.207  1.00  0.90           C  
ATOM   3882  CG  HIS A 478       1.332  15.416  20.180  1.00  0.90           C  
ATOM   3883  ND1 HIS A 478       2.191  14.345  20.294  1.00  0.90           N  
ATOM   3884  CD2 HIS A 478       0.549  15.269  19.077  1.00  0.90           C  
ATOM   3885  CE1 HIS A 478       1.917  13.565  19.271  1.00  0.90           C  
ATOM   3886  NE2 HIS A 478       0.930  14.078  18.498  1.00  0.90           N  
ATOM   3887  N   LYS A 479       4.419  16.789  19.925  1.00  0.91           N  
ATOM   3888  CA  LYS A 479       5.815  16.415  19.927  1.00  0.91           C  
ATOM   3889  C   LYS A 479       6.773  17.577  20.120  1.00  0.91           C  
ATOM   3890  O   LYS A 479       7.861  17.415  20.667  1.00  0.91           O  
ATOM   3891  CB  LYS A 479       6.191  15.719  18.602  1.00  0.91           C  
ATOM   3892  CG  LYS A 479       5.565  14.329  18.442  1.00  0.91           C  
ATOM   3893  CD  LYS A 479       6.089  13.624  17.183  1.00  0.91           C  
ATOM   3894  CE  LYS A 479       5.602  12.179  17.052  1.00  0.91           C  
ATOM   3895  NZ  LYS A 479       6.086  11.598  15.789  1.00  0.91           N  
ATOM   3896  N   PHE A 480       6.417  18.777  19.628  1.00  0.93           N  
ATOM   3897  CA  PHE A 480       7.370  19.859  19.500  1.00  0.93           C  
ATOM   3898  C   PHE A 480       7.538  20.696  20.753  1.00  0.93           C  
ATOM   3899  O   PHE A 480       6.641  21.395  21.215  1.00  0.93           O  
ATOM   3900  CB  PHE A 480       7.033  20.780  18.310  1.00  0.93           C  
ATOM   3901  CG  PHE A 480       7.295  20.026  17.039  1.00  0.93           C  
ATOM   3902  CD1 PHE A 480       6.325  19.163  16.508  1.00  0.93           C  
ATOM   3903  CD2 PHE A 480       8.549  20.110  16.409  1.00  0.93           C  
ATOM   3904  CE1 PHE A 480       6.606  18.378  15.384  1.00  0.93           C  
ATOM   3905  CE2 PHE A 480       8.832  19.329  15.282  1.00  0.93           C  
ATOM   3906  CZ  PHE A 480       7.862  18.458  14.774  1.00  0.93           C  
ATOM   3907  N   GLN A 481       8.766  20.667  21.303  1.00  0.92           N  
ATOM   3908  CA  GLN A 481       9.107  21.298  22.556  1.00  0.92           C  
ATOM   3909  C   GLN A 481      10.304  22.226  22.413  1.00  0.92           C  
ATOM   3910  O   GLN A 481      11.022  22.297  21.417  1.00  0.92           O  
ATOM   3911  CB  GLN A 481       9.444  20.248  23.651  1.00  0.92           C  
ATOM   3912  CG  GLN A 481       8.270  19.312  24.031  1.00  0.92           C  
ATOM   3913  CD  GLN A 481       8.650  18.423  25.217  1.00  0.92           C  
ATOM   3914  OE1 GLN A 481       9.518  18.774  26.021  1.00  0.92           O  
ATOM   3915  NE2 GLN A 481       7.976  17.261  25.348  1.00  0.92           N  
ATOM   3916  N   ASN A 482      10.549  23.003  23.475  1.00  0.94           N  
ATOM   3917  CA  ASN A 482      11.728  23.816  23.609  1.00  0.94           C  
ATOM   3918  C   ASN A 482      12.480  23.320  24.827  1.00  0.94           C  
ATOM   3919  O   ASN A 482      11.897  23.035  25.862  1.00  0.94           O  
ATOM   3920  CB  ASN A 482      11.351  25.324  23.710  1.00  0.94           C  
ATOM   3921  CG  ASN A 482      12.544  26.197  24.067  1.00  0.94           C  
ATOM   3922  OD1 ASN A 482      12.502  26.944  25.040  1.00  0.94           O  
ATOM   3923  ND2 ASN A 482      13.655  26.043  23.323  1.00  0.94           N  
ATOM   3924  N   LYS A 483      13.813  23.185  24.692  1.00  0.94           N  
ATOM   3925  CA  LYS A 483      14.682  23.001  25.826  1.00  0.94           C  
ATOM   3926  C   LYS A 483      15.883  23.903  25.633  1.00  0.94           C  
ATOM   3927  O   LYS A 483      16.906  23.484  25.101  1.00  0.94           O  
ATOM   3928  CB  LYS A 483      15.177  21.535  25.943  1.00  0.94           C  
ATOM   3929  CG  LYS A 483      14.073  20.507  26.228  1.00  0.94           C  
ATOM   3930  CD  LYS A 483      13.528  20.627  27.657  1.00  0.94           C  
ATOM   3931  CE  LYS A 483      12.193  19.912  27.883  1.00  0.94           C  
ATOM   3932  NZ  LYS A 483      11.079  20.635  27.263  1.00  0.94           N  
ATOM   3933  N   THR A 484      15.789  25.182  26.061  1.00  0.96           N  
ATOM   3934  CA  THR A 484      16.888  26.146  25.978  1.00  0.96           C  
ATOM   3935  C   THR A 484      18.133  25.655  26.678  1.00  0.96           C  
ATOM   3936  O   THR A 484      18.091  25.274  27.849  1.00  0.96           O  
ATOM   3937  CB  THR A 484      16.527  27.520  26.535  1.00  0.96           C  
ATOM   3938  OG1 THR A 484      15.421  28.023  25.799  1.00  0.96           O  
ATOM   3939  CG2 THR A 484      17.671  28.546  26.432  1.00  0.96           C  
ATOM   3940  N   ASN A 485      19.272  25.618  25.966  1.00  0.95           N  
ATOM   3941  CA  ASN A 485      20.567  25.203  26.477  1.00  0.95           C  
ATOM   3942  C   ASN A 485      21.013  25.788  27.807  1.00  0.95           C  
ATOM   3943  O   ASN A 485      20.507  26.784  28.319  1.00  0.95           O  
ATOM   3944  CB  ASN A 485      21.701  25.416  25.443  1.00  0.95           C  
ATOM   3945  CG  ASN A 485      21.643  24.321  24.398  1.00  0.95           C  
ATOM   3946  OD1 ASN A 485      21.175  23.224  24.692  1.00  0.95           O  
ATOM   3947  ND2 ASN A 485      22.190  24.591  23.192  1.00  0.95           N  
ATOM   3948  N   GLY A 486      21.999  25.108  28.413  1.00  0.98           N  
ATOM   3949  CA  GLY A 486      22.652  25.595  29.603  1.00  0.98           C  
ATOM   3950  C   GLY A 486      24.059  25.095  29.626  1.00  0.98           C  
ATOM   3951  O   GLY A 486      24.466  24.286  28.796  1.00  0.98           O  
ATOM   3952  N   ILE A 487      24.827  25.542  30.624  1.00  0.97           N  
ATOM   3953  CA  ILE A 487      26.192  25.127  30.846  1.00  0.97           C  
ATOM   3954  C   ILE A 487      26.309  24.719  32.296  1.00  0.97           C  
ATOM   3955  O   ILE A 487      25.554  25.179  33.146  1.00  0.97           O  
ATOM   3956  CB  ILE A 487      27.186  26.247  30.557  1.00  0.97           C  
ATOM   3957  CG1 ILE A 487      26.871  27.506  31.403  1.00  0.97           C  
ATOM   3958  CG2 ILE A 487      27.130  26.543  29.042  1.00  0.97           C  
ATOM   3959  CD1 ILE A 487      27.849  28.649  31.176  1.00  0.97           C  
ATOM   3960  N   THR A 488      27.246  23.816  32.644  1.00  0.98           N  
ATOM   3961  CA  THR A 488      27.408  23.418  34.041  1.00  0.98           C  
ATOM   3962  C   THR A 488      28.131  24.502  34.845  1.00  0.98           C  
ATOM   3963  O   THR A 488      29.233  24.910  34.465  1.00  0.98           O  
ATOM   3964  CB  THR A 488      28.052  22.053  34.267  1.00  0.98           C  
ATOM   3965  OG1 THR A 488      28.441  21.856  35.625  1.00  0.98           O  
ATOM   3966  CG2 THR A 488      29.322  21.904  33.432  1.00  0.98           C  
ATOM   3967  N   PRO A 489      27.590  24.987  35.961  1.00  0.99           N  
ATOM   3968  CA  PRO A 489      28.243  26.003  36.768  1.00  0.99           C  
ATOM   3969  C   PRO A 489      29.378  25.429  37.585  1.00  0.99           C  
ATOM   3970  O   PRO A 489      30.134  26.199  38.174  1.00  0.99           O  
ATOM   3971  CB  PRO A 489      27.113  26.521  37.664  1.00  0.99           C  
ATOM   3972  CG  PRO A 489      26.198  25.312  37.841  1.00  0.99           C  
ATOM   3973  CD  PRO A 489      26.252  24.664  36.465  1.00  0.99           C  
ATOM   3974  N   ARG A 490      29.553  24.093  37.659  1.00  0.93           N  
ATOM   3975  CA  ARG A 490      30.729  23.547  38.309  1.00  0.93           C  
ATOM   3976  C   ARG A 490      31.962  23.804  37.461  1.00  0.93           C  
ATOM   3977  O   ARG A 490      32.913  24.447  37.887  1.00  0.93           O  
ATOM   3978  CB  ARG A 490      30.602  22.022  38.564  1.00  0.93           C  
ATOM   3979  CG  ARG A 490      29.815  21.639  39.835  1.00  0.93           C  
ATOM   3980  CD  ARG A 490      28.330  21.997  39.841  1.00  0.93           C  
ATOM   3981  NE  ARG A 490      27.662  21.208  38.768  1.00  0.93           N  
ATOM   3982  CZ  ARG A 490      26.342  21.258  38.552  1.00  0.93           C  
ATOM   3983  NH1 ARG A 490      25.561  22.095  39.220  1.00  0.93           N  
ATOM   3984  NH2 ARG A 490      25.812  20.482  37.621  1.00  0.93           N  
ATOM   3985  N   ARG A 491      31.948  23.372  36.190  1.00  0.93           N  
ATOM   3986  CA  ARG A 491      33.050  23.636  35.284  1.00  0.93           C  
ATOM   3987  C   ARG A 491      33.159  25.083  34.836  1.00  0.93           C  
ATOM   3988  O   ARG A 491      34.234  25.667  34.841  1.00  0.93           O  
ATOM   3989  CB  ARG A 491      33.009  22.678  34.080  1.00  0.93           C  
ATOM   3990  CG  ARG A 491      33.910  23.075  32.897  1.00  0.93           C  
ATOM   3991  CD  ARG A 491      34.018  21.967  31.854  1.00  0.93           C  
ATOM   3992  NE  ARG A 491      35.402  21.451  31.912  1.00  0.93           N  
ATOM   3993  CZ  ARG A 491      35.867  20.305  32.408  1.00  0.93           C  
ATOM   3994  NH1 ARG A 491      35.100  19.327  32.873  1.00  0.93           N  
ATOM   3995  NH2 ARG A 491      37.191  20.170  32.424  1.00  0.93           N  
ATOM   3996  N   TRP A 492      32.033  25.722  34.469  1.00  0.93           N  
ATOM   3997  CA  TRP A 492      32.081  27.028  33.839  1.00  0.93           C  
ATOM   3998  C   TRP A 492      31.929  28.178  34.818  1.00  0.93           C  
ATOM   3999  O   TRP A 492      31.672  29.309  34.420  1.00  0.93           O  
ATOM   4000  CB  TRP A 492      31.067  27.124  32.678  1.00  0.93           C  
ATOM   4001  CG  TRP A 492      31.341  26.093  31.605  1.00  0.93           C  
ATOM   4002  CD1 TRP A 492      30.661  24.944  31.324  1.00  0.93           C  
ATOM   4003  CD2 TRP A 492      32.489  26.091  30.732  1.00  0.93           C  
ATOM   4004  NE1 TRP A 492      31.282  24.232  30.312  1.00  0.93           N  
ATOM   4005  CE2 TRP A 492      32.425  24.931  29.963  1.00  0.93           C  
ATOM   4006  CE3 TRP A 492      33.551  26.991  30.608  1.00  0.93           C  
ATOM   4007  CZ2 TRP A 492      33.415  24.617  29.035  1.00  0.93           C  
ATOM   4008  CZ3 TRP A 492      34.562  26.671  29.690  1.00  0.93           C  
ATOM   4009  CH2 TRP A 492      34.502  25.502  28.923  1.00  0.93           C  
ATOM   4010  N   LEU A 493      32.148  27.916  36.121  1.00  0.97           N  
ATOM   4011  CA  LEU A 493      32.290  28.956  37.115  1.00  0.97           C  
ATOM   4012  C   LEU A 493      33.293  28.522  38.172  1.00  0.97           C  
ATOM   4013  O   LEU A 493      34.356  29.120  38.306  1.00  0.97           O  
ATOM   4014  CB  LEU A 493      30.923  29.266  37.765  1.00  0.97           C  
ATOM   4015  CG  LEU A 493      30.709  30.713  38.249  1.00  0.97           C  
ATOM   4016  CD1 LEU A 493      29.414  30.736  39.071  1.00  0.97           C  
ATOM   4017  CD2 LEU A 493      31.870  31.294  39.072  1.00  0.97           C  
ATOM   4018  N   VAL A 494      32.993  27.451  38.945  1.00  0.96           N  
ATOM   4019  CA  VAL A 494      33.809  27.014  40.078  1.00  0.96           C  
ATOM   4020  C   VAL A 494      35.227  26.631  39.687  1.00  0.96           C  
ATOM   4021  O   VAL A 494      36.181  27.057  40.335  1.00  0.96           O  
ATOM   4022  CB  VAL A 494      33.143  25.865  40.842  1.00  0.96           C  
ATOM   4023  CG1 VAL A 494      34.002  25.380  42.029  1.00  0.96           C  
ATOM   4024  CG2 VAL A 494      31.778  26.337  41.378  1.00  0.96           C  
ATOM   4025  N   LEU A 495      35.407  25.854  38.597  1.00  0.93           N  
ATOM   4026  CA  LEU A 495      36.735  25.502  38.124  1.00  0.93           C  
ATOM   4027  C   LEU A 495      37.458  26.617  37.401  1.00  0.93           C  
ATOM   4028  O   LEU A 495      38.601  26.947  37.704  1.00  0.93           O  
ATOM   4029  CB  LEU A 495      36.696  24.322  37.119  1.00  0.93           C  
ATOM   4030  CG  LEU A 495      35.999  23.045  37.603  1.00  0.93           C  
ATOM   4031  CD1 LEU A 495      36.316  21.896  36.640  1.00  0.93           C  
ATOM   4032  CD2 LEU A 495      36.376  22.712  39.039  1.00  0.93           C  
ATOM   4033  N   CYS A 496      36.799  27.245  36.406  1.00  0.95           N  
ATOM   4034  CA  CYS A 496      37.484  28.171  35.531  1.00  0.95           C  
ATOM   4035  C   CYS A 496      37.744  29.528  36.166  1.00  0.95           C  
ATOM   4036  O   CYS A 496      38.681  30.240  35.816  1.00  0.95           O  
ATOM   4037  CB  CYS A 496      36.714  28.324  34.194  1.00  0.95           C  
ATOM   4038  SG  CYS A 496      35.084  29.125  34.318  1.00  0.95           S  
ATOM   4039  N   ASN A 497      36.922  29.904  37.160  1.00  0.94           N  
ATOM   4040  CA  ASN A 497      36.976  31.206  37.775  1.00  0.94           C  
ATOM   4041  C   ASN A 497      36.773  31.112  39.285  1.00  0.94           C  
ATOM   4042  O   ASN A 497      35.782  31.630  39.815  1.00  0.94           O  
ATOM   4043  CB  ASN A 497      35.878  32.044  37.101  1.00  0.94           C  
ATOM   4044  CG  ASN A 497      36.081  33.538  37.256  1.00  0.94           C  
ATOM   4045  OD1 ASN A 497      36.857  34.051  38.062  1.00  0.94           O  
ATOM   4046  ND2 ASN A 497      35.327  34.286  36.416  1.00  0.94           N  
ATOM   4047  N   PRO A 498      37.688  30.480  40.034  1.00  0.93           N  
ATOM   4048  CA  PRO A 498      37.559  30.293  41.473  1.00  0.93           C  
ATOM   4049  C   PRO A 498      37.492  31.607  42.216  1.00  0.93           C  
ATOM   4050  O   PRO A 498      36.813  31.671  43.236  1.00  0.93           O  
ATOM   4051  CB  PRO A 498      38.789  29.458  41.864  1.00  0.93           C  
ATOM   4052  CG  PRO A 498      39.818  29.772  40.776  1.00  0.93           C  
ATOM   4053  CD  PRO A 498      38.939  29.899  39.536  1.00  0.93           C  
ATOM   4054  N   GLY A 499      38.148  32.675  41.714  1.00  0.93           N  
ATOM   4055  CA  GLY A 499      38.090  33.990  42.338  1.00  0.93           C  
ATOM   4056  C   GLY A 499      36.726  34.626  42.256  1.00  0.93           C  
ATOM   4057  O   GLY A 499      36.250  35.230  43.209  1.00  0.93           O  
ATOM   4058  N   LEU A 500      35.999  34.478  41.126  1.00  0.93           N  
ATOM   4059  CA  LEU A 500      34.624  34.947  41.050  1.00  0.93           C  
ATOM   4060  C   LEU A 500      33.712  34.111  41.920  1.00  0.93           C  
ATOM   4061  O   LEU A 500      32.851  34.629  42.625  1.00  0.93           O  
ATOM   4062  CB  LEU A 500      34.096  34.978  39.599  1.00  0.93           C  
ATOM   4063  CG  LEU A 500      32.728  35.667  39.403  1.00  0.93           C  
ATOM   4064  CD1 LEU A 500      32.778  37.156  39.783  1.00  0.93           C  
ATOM   4065  CD2 LEU A 500      32.255  35.515  37.950  1.00  0.93           C  
ATOM   4066  N   ALA A 501      33.925  32.781  41.933  1.00  0.94           N  
ATOM   4067  CA  ALA A 501      33.174  31.870  42.765  1.00  0.94           C  
ATOM   4068  C   ALA A 501      33.306  32.176  44.256  1.00  0.94           C  
ATOM   4069  O   ALA A 501      32.308  32.208  44.971  1.00  0.94           O  
ATOM   4070  CB  ALA A 501      33.600  30.420  42.456  1.00  0.94           C  
ATOM   4071  N   GLU A 502      34.530  32.475  44.732  1.00  0.86           N  
ATOM   4072  CA  GLU A 502      34.821  32.911  46.084  1.00  0.86           C  
ATOM   4073  C   GLU A 502      34.150  34.226  46.468  1.00  0.86           C  
ATOM   4074  O   GLU A 502      33.427  34.290  47.461  1.00  0.86           O  
ATOM   4075  CB  GLU A 502      36.357  33.006  46.191  1.00  0.86           C  
ATOM   4076  CG  GLU A 502      36.933  33.394  47.568  1.00  0.86           C  
ATOM   4077  CD  GLU A 502      38.452  33.222  47.555  1.00  0.86           C  
ATOM   4078  OE1 GLU A 502      39.110  33.801  46.652  1.00  0.86           O  
ATOM   4079  OE2 GLU A 502      38.962  32.462  48.420  1.00  0.86           O  
ATOM   4080  N   VAL A 503      34.253  35.271  45.615  1.00  0.88           N  
ATOM   4081  CA  VAL A 503      33.607  36.565  45.824  1.00  0.88           C  
ATOM   4082  C   VAL A 503      32.083  36.455  45.892  1.00  0.88           C  
ATOM   4083  O   VAL A 503      31.414  37.106  46.696  1.00  0.88           O  
ATOM   4084  CB  VAL A 503      34.046  37.557  44.743  1.00  0.88           C  
ATOM   4085  CG1 VAL A 503      33.219  38.860  44.764  1.00  0.88           C  
ATOM   4086  CG2 VAL A 503      35.529  37.912  44.975  1.00  0.88           C  
ATOM   4087  N   ILE A 504      31.471  35.598  45.048  1.00  0.90           N  
ATOM   4088  CA  ILE A 504      30.055  35.264  45.140  1.00  0.90           C  
ATOM   4089  C   ILE A 504      29.704  34.509  46.423  1.00  0.90           C  
ATOM   4090  O   ILE A 504      28.749  34.856  47.121  1.00  0.90           O  
ATOM   4091  CB  ILE A 504      29.614  34.477  43.904  1.00  0.90           C  
ATOM   4092  CG1 ILE A 504      29.739  35.370  42.642  1.00  0.90           C  
ATOM   4093  CG2 ILE A 504      28.168  33.952  44.063  1.00  0.90           C  
ATOM   4094  CD1 ILE A 504      29.378  34.656  41.332  1.00  0.90           C  
ATOM   4095  N   ALA A 505      30.491  33.479  46.797  1.00  0.90           N  
ATOM   4096  CA  ALA A 505      30.262  32.641  47.958  1.00  0.90           C  
ATOM   4097  C   ALA A 505      30.314  33.391  49.282  1.00  0.90           C  
ATOM   4098  O   ALA A 505      29.495  33.157  50.169  1.00  0.90           O  
ATOM   4099  CB  ALA A 505      31.254  31.464  47.945  1.00  0.90           C  
ATOM   4100  N   GLU A 506      31.229  34.374  49.417  1.00  0.85           N  
ATOM   4101  CA  GLU A 506      31.296  35.288  50.545  1.00  0.85           C  
ATOM   4102  C   GLU A 506      29.987  36.019  50.799  1.00  0.85           C  
ATOM   4103  O   GLU A 506      29.602  36.280  51.934  1.00  0.85           O  
ATOM   4104  CB  GLU A 506      32.365  36.373  50.282  1.00  0.85           C  
ATOM   4105  CG  GLU A 506      33.830  35.899  50.408  1.00  0.85           C  
ATOM   4106  CD  GLU A 506      34.789  37.036  50.054  1.00  0.85           C  
ATOM   4107  OE1 GLU A 506      34.445  38.210  50.355  1.00  0.85           O  
ATOM   4108  OE2 GLU A 506      35.863  36.742  49.476  1.00  0.85           O  
ATOM   4109  N   ARG A 507      29.275  36.389  49.716  1.00  0.83           N  
ATOM   4110  CA  ARG A 507      28.031  37.111  49.816  1.00  0.83           C  
ATOM   4111  C   ARG A 507      26.792  36.247  49.982  1.00  0.83           C  
ATOM   4112  O   ARG A 507      25.916  36.590  50.770  1.00  0.83           O  
ATOM   4113  CB  ARG A 507      27.854  38.056  48.606  1.00  0.83           C  
ATOM   4114  CG  ARG A 507      28.982  39.102  48.444  1.00  0.83           C  
ATOM   4115  CD  ARG A 507      29.256  39.940  49.701  1.00  0.83           C  
ATOM   4116  NE  ARG A 507      30.279  40.974  49.350  1.00  0.83           N  
ATOM   4117  CZ  ARG A 507      30.140  42.294  49.539  1.00  0.83           C  
ATOM   4118  NH1 ARG A 507      29.049  42.829  50.069  1.00  0.83           N  
ATOM   4119  NH2 ARG A 507      31.094  43.127  49.156  1.00  0.83           N  
ATOM   4120  N   ILE A 508      26.656  35.129  49.230  1.00  0.90           N  
ATOM   4121  CA  ILE A 508      25.404  34.377  49.233  1.00  0.90           C  
ATOM   4122  C   ILE A 508      25.523  32.918  49.636  1.00  0.90           C  
ATOM   4123  O   ILE A 508      24.552  32.166  49.533  1.00  0.90           O  
ATOM   4124  CB  ILE A 508      24.687  34.445  47.889  1.00  0.90           C  
ATOM   4125  CG1 ILE A 508      25.514  33.818  46.745  1.00  0.90           C  
ATOM   4126  CG2 ILE A 508      24.379  35.925  47.590  1.00  0.90           C  
ATOM   4127  CD1 ILE A 508      24.704  33.586  45.466  1.00  0.90           C  
ATOM   4128  N   GLY A 509      26.689  32.458  50.129  1.00  0.91           N  
ATOM   4129  CA  GLY A 509      26.902  31.040  50.408  1.00  0.91           C  
ATOM   4130  C   GLY A 509      27.112  30.218  49.157  1.00  0.91           C  
ATOM   4131  O   GLY A 509      27.134  30.740  48.050  1.00  0.91           O  
ATOM   4132  N   GLU A 510      27.309  28.892  49.296  1.00  0.83           N  
ATOM   4133  CA  GLU A 510      27.713  28.030  48.191  1.00  0.83           C  
ATOM   4134  C   GLU A 510      26.572  27.305  47.485  1.00  0.83           C  
ATOM   4135  O   GLU A 510      26.791  26.564  46.528  1.00  0.83           O  
ATOM   4136  CB  GLU A 510      28.733  26.974  48.674  1.00  0.83           C  
ATOM   4137  CG  GLU A 510      30.162  27.541  48.833  1.00  0.83           C  
ATOM   4138  CD  GLU A 510      31.138  26.463  49.299  1.00  0.83           C  
ATOM   4139  OE1 GLU A 510      31.248  25.409  48.611  1.00  0.83           O  
ATOM   4140  OE2 GLU A 510      31.782  26.687  50.354  1.00  0.83           O  
ATOM   4141  N   ASP A 511      25.306  27.541  47.876  1.00  0.85           N  
ATOM   4142  CA  ASP A 511      24.135  26.902  47.296  1.00  0.85           C  
ATOM   4143  C   ASP A 511      23.975  27.113  45.789  1.00  0.85           C  
ATOM   4144  O   ASP A 511      23.516  26.242  45.059  1.00  0.85           O  
ATOM   4145  CB  ASP A 511      22.866  27.410  48.011  1.00  0.85           C  
ATOM   4146  CG  ASP A 511      22.899  27.088  49.496  1.00  0.85           C  
ATOM   4147  OD1 ASP A 511      23.594  26.122  49.896  1.00  0.85           O  
ATOM   4148  OD2 ASP A 511      22.251  27.862  50.246  1.00  0.85           O  
ATOM   4149  N   PHE A 512      24.424  28.279  45.269  1.00  0.90           N  
ATOM   4150  CA  PHE A 512      24.357  28.629  43.859  1.00  0.90           C  
ATOM   4151  C   PHE A 512      25.026  27.637  42.909  1.00  0.90           C  
ATOM   4152  O   PHE A 512      24.663  27.511  41.741  1.00  0.90           O  
ATOM   4153  CB  PHE A 512      24.857  30.083  43.604  1.00  0.90           C  
ATOM   4154  CG  PHE A 512      26.350  30.224  43.728  1.00  0.90           C  
ATOM   4155  CD1 PHE A 512      26.936  30.441  44.979  1.00  0.90           C  
ATOM   4156  CD2 PHE A 512      27.181  30.111  42.600  1.00  0.90           C  
ATOM   4157  CE1 PHE A 512      28.328  30.512  45.116  1.00  0.90           C  
ATOM   4158  CE2 PHE A 512      28.573  30.184  42.736  1.00  0.90           C  
ATOM   4159  CZ  PHE A 512      29.149  30.376  43.995  1.00  0.90           C  
ATOM   4160  N   ILE A 513      26.025  26.881  43.398  1.00  0.93           N  
ATOM   4161  CA  ILE A 513      26.777  25.898  42.640  1.00  0.93           C  
ATOM   4162  C   ILE A 513      25.895  24.761  42.121  1.00  0.93           C  
ATOM   4163  O   ILE A 513      26.161  24.156  41.077  1.00  0.93           O  
ATOM   4164  CB  ILE A 513      27.928  25.360  43.484  1.00  0.93           C  
ATOM   4165  CG1 ILE A 513      28.831  26.532  43.947  1.00  0.93           C  
ATOM   4166  CG2 ILE A 513      28.741  24.319  42.680  1.00  0.93           C  
ATOM   4167  CD1 ILE A 513      29.881  26.122  44.984  1.00  0.93           C  
ATOM   4168  N   SER A 514      24.808  24.435  42.849  1.00  0.91           N  
ATOM   4169  CA  SER A 514      23.854  23.409  42.459  1.00  0.91           C  
ATOM   4170  C   SER A 514      22.441  23.938  42.285  1.00  0.91           C  
ATOM   4171  O   SER A 514      21.507  23.158  42.120  1.00  0.91           O  
ATOM   4172  CB  SER A 514      23.858  22.224  43.461  1.00  0.91           C  
ATOM   4173  OG  SER A 514      23.577  22.634  44.803  1.00  0.91           O  
ATOM   4174  N   ASP A 515      22.285  25.276  42.263  1.00  0.89           N  
ATOM   4175  CA  ASP A 515      21.022  25.965  42.102  1.00  0.89           C  
ATOM   4176  C   ASP A 515      21.329  27.376  41.609  1.00  0.89           C  
ATOM   4177  O   ASP A 515      21.463  28.327  42.364  1.00  0.89           O  
ATOM   4178  CB  ASP A 515      20.256  26.030  43.450  1.00  0.89           C  
ATOM   4179  CG  ASP A 515      18.848  26.574  43.271  1.00  0.89           C  
ATOM   4180  OD1 ASP A 515      18.409  26.711  42.099  1.00  0.89           O  
ATOM   4181  OD2 ASP A 515      18.205  26.867  44.309  1.00  0.89           O  
ATOM   4182  N   LEU A 516      21.517  27.573  40.292  1.00  0.92           N  
ATOM   4183  CA  LEU A 516      22.154  28.789  39.816  1.00  0.92           C  
ATOM   4184  C   LEU A 516      21.248  30.016  39.859  1.00  0.92           C  
ATOM   4185  O   LEU A 516      21.710  31.157  39.843  1.00  0.92           O  
ATOM   4186  CB  LEU A 516      22.744  28.550  38.410  1.00  0.92           C  
ATOM   4187  CG  LEU A 516      23.865  29.518  37.965  1.00  0.92           C  
ATOM   4188  CD1 LEU A 516      25.120  29.336  38.832  1.00  0.92           C  
ATOM   4189  CD2 LEU A 516      24.209  29.345  36.473  1.00  0.92           C  
ATOM   4190  N   ASP A 517      19.922  29.829  40.019  1.00  0.91           N  
ATOM   4191  CA  ASP A 517      18.966  30.906  40.168  1.00  0.91           C  
ATOM   4192  C   ASP A 517      19.127  31.639  41.499  1.00  0.91           C  
ATOM   4193  O   ASP A 517      18.673  32.769  41.680  1.00  0.91           O  
ATOM   4194  CB  ASP A 517      17.534  30.377  39.948  1.00  0.91           C  
ATOM   4195  CG  ASP A 517      17.344  30.182  38.453  1.00  0.91           C  
ATOM   4196  OD1 ASP A 517      17.454  31.214  37.736  1.00  0.91           O  
ATOM   4197  OD2 ASP A 517      17.116  29.034  38.000  1.00  0.91           O  
ATOM   4198  N   GLN A 518      19.909  31.052  42.429  1.00  0.84           N  
ATOM   4199  CA  GLN A 518      20.395  31.686  43.636  1.00  0.84           C  
ATOM   4200  C   GLN A 518      21.248  32.933  43.375  1.00  0.84           C  
ATOM   4201  O   GLN A 518      21.314  33.842  44.205  1.00  0.84           O  
ATOM   4202  CB  GLN A 518      21.211  30.649  44.441  1.00  0.84           C  
ATOM   4203  CG  GLN A 518      21.431  30.941  45.951  1.00  0.84           C  
ATOM   4204  CD  GLN A 518      20.143  30.746  46.802  1.00  0.84           C  
ATOM   4205  OE1 GLN A 518      19.091  31.043  46.492  1.00  0.84           O  
ATOM   4206  NE2 GLN A 518      20.472  30.342  48.108  1.00  0.84           N  
ATOM   4207  N   LEU A 519      21.891  33.046  42.183  1.00  0.90           N  
ATOM   4208  CA  LEU A 519      22.673  34.210  41.784  1.00  0.90           C  
ATOM   4209  C   LEU A 519      21.878  35.514  41.742  1.00  0.90           C  
ATOM   4210  O   LEU A 519      22.448  36.593  41.873  1.00  0.90           O  
ATOM   4211  CB  LEU A 519      23.363  34.017  40.409  1.00  0.90           C  
ATOM   4212  CG  LEU A 519      24.495  32.969  40.364  1.00  0.90           C  
ATOM   4213  CD1 LEU A 519      25.096  32.905  38.952  1.00  0.90           C  
ATOM   4214  CD2 LEU A 519      25.621  33.281  41.359  1.00  0.90           C  
ATOM   4215  N   ARG A 520      20.528  35.461  41.646  1.00  0.83           N  
ATOM   4216  CA  ARG A 520      19.655  36.628  41.644  1.00  0.83           C  
ATOM   4217  C   ARG A 520      19.765  37.477  42.905  1.00  0.83           C  
ATOM   4218  O   ARG A 520      19.433  38.659  42.913  1.00  0.83           O  
ATOM   4219  CB  ARG A 520      18.173  36.218  41.441  1.00  0.83           C  
ATOM   4220  CG  ARG A 520      17.913  35.511  40.093  1.00  0.83           C  
ATOM   4221  CD  ARG A 520      16.444  35.167  39.809  1.00  0.83           C  
ATOM   4222  NE  ARG A 520      15.714  36.453  39.530  1.00  0.83           N  
ATOM   4223  CZ  ARG A 520      15.736  37.083  38.343  1.00  0.83           C  
ATOM   4224  NH1 ARG A 520      16.350  36.567  37.283  1.00  0.83           N  
ATOM   4225  NH2 ARG A 520      15.123  38.263  38.229  1.00  0.83           N  
ATOM   4226  N   LYS A 521      20.305  36.905  43.999  1.00  0.82           N  
ATOM   4227  CA  LYS A 521      20.589  37.607  45.232  1.00  0.82           C  
ATOM   4228  C   LYS A 521      21.715  38.632  45.089  1.00  0.82           C  
ATOM   4229  O   LYS A 521      21.859  39.519  45.927  1.00  0.82           O  
ATOM   4230  CB  LYS A 521      20.958  36.592  46.343  1.00  0.82           C  
ATOM   4231  CG  LYS A 521      19.826  35.638  46.770  1.00  0.82           C  
ATOM   4232  CD  LYS A 521      20.319  34.641  47.839  1.00  0.82           C  
ATOM   4233  CE  LYS A 521      19.277  33.638  48.348  1.00  0.82           C  
ATOM   4234  NZ  LYS A 521      18.224  34.350  49.101  1.00  0.82           N  
ATOM   4235  N   LEU A 522      22.521  38.580  44.004  1.00  0.86           N  
ATOM   4236  CA  LEU A 522      23.593  39.528  43.747  1.00  0.86           C  
ATOM   4237  C   LEU A 522      23.075  40.892  43.293  1.00  0.86           C  
ATOM   4238  O   LEU A 522      23.794  41.886  43.356  1.00  0.86           O  
ATOM   4239  CB  LEU A 522      24.597  38.969  42.710  1.00  0.86           C  
ATOM   4240  CG  LEU A 522      25.696  38.024  43.253  1.00  0.86           C  
ATOM   4241  CD1 LEU A 522      25.240  37.062  44.358  1.00  0.86           C  
ATOM   4242  CD2 LEU A 522      26.285  37.229  42.078  1.00  0.86           C  
ATOM   4243  N   LEU A 523      21.786  40.999  42.890  1.00  0.85           N  
ATOM   4244  CA  LEU A 523      21.114  42.257  42.578  1.00  0.85           C  
ATOM   4245  C   LEU A 523      21.107  43.212  43.762  1.00  0.85           C  
ATOM   4246  O   LEU A 523      21.266  44.419  43.606  1.00  0.85           O  
ATOM   4247  CB  LEU A 523      19.651  41.997  42.113  1.00  0.85           C  
ATOM   4248  CG  LEU A 523      19.322  42.106  40.599  1.00  0.85           C  
ATOM   4249  CD1 LEU A 523      20.515  41.898  39.656  1.00  0.85           C  
ATOM   4250  CD2 LEU A 523      18.209  41.102  40.245  1.00  0.85           C  
ATOM   4251  N   SER A 524      20.991  42.668  44.989  1.00  0.82           N  
ATOM   4252  CA  SER A 524      21.020  43.417  46.236  1.00  0.82           C  
ATOM   4253  C   SER A 524      22.367  44.038  46.532  1.00  0.82           C  
ATOM   4254  O   SER A 524      22.485  44.903  47.390  1.00  0.82           O  
ATOM   4255  CB  SER A 524      20.698  42.517  47.451  1.00  0.82           C  
ATOM   4256  OG  SER A 524      19.443  41.860  47.266  1.00  0.82           O  
ATOM   4257  N   PHE A 525      23.423  43.608  45.815  1.00  0.86           N  
ATOM   4258  CA  PHE A 525      24.770  44.086  46.008  1.00  0.86           C  
ATOM   4259  C   PHE A 525      25.229  44.911  44.818  1.00  0.86           C  
ATOM   4260  O   PHE A 525      26.404  45.239  44.702  1.00  0.86           O  
ATOM   4261  CB  PHE A 525      25.751  42.901  46.184  1.00  0.86           C  
ATOM   4262  CG  PHE A 525      25.429  42.118  47.422  1.00  0.86           C  
ATOM   4263  CD1 PHE A 525      24.489  41.079  47.380  1.00  0.86           C  
ATOM   4264  CD2 PHE A 525      26.053  42.418  48.643  1.00  0.86           C  
ATOM   4265  CE1 PHE A 525      24.177  40.347  48.529  1.00  0.86           C  
ATOM   4266  CE2 PHE A 525      25.743  41.689  49.800  1.00  0.86           C  
ATOM   4267  CZ  PHE A 525      24.804  40.652  49.742  1.00  0.86           C  
ATOM   4268  N   VAL A 526      24.314  45.311  43.904  1.00  0.85           N  
ATOM   4269  CA  VAL A 526      24.664  46.073  42.712  1.00  0.85           C  
ATOM   4270  C   VAL A 526      25.254  47.437  43.031  1.00  0.85           C  
ATOM   4271  O   VAL A 526      26.096  47.946  42.295  1.00  0.85           O  
ATOM   4272  CB  VAL A 526      23.505  46.163  41.721  1.00  0.85           C  
ATOM   4273  CG1 VAL A 526      22.416  47.155  42.172  1.00  0.85           C  
ATOM   4274  CG2 VAL A 526      24.049  46.547  40.331  1.00  0.85           C  
ATOM   4275  N   ASP A 527      24.835  48.024  44.168  1.00  0.83           N  
ATOM   4276  CA  ASP A 527      25.316  49.283  44.685  1.00  0.83           C  
ATOM   4277  C   ASP A 527      26.234  49.116  45.907  1.00  0.83           C  
ATOM   4278  O   ASP A 527      26.564  50.080  46.588  1.00  0.83           O  
ATOM   4279  CB  ASP A 527      24.095  50.174  45.017  1.00  0.83           C  
ATOM   4280  CG  ASP A 527      23.361  50.462  43.721  1.00  0.83           C  
ATOM   4281  OD1 ASP A 527      23.996  51.054  42.807  1.00  0.83           O  
ATOM   4282  OD2 ASP A 527      22.180  50.057  43.575  1.00  0.83           O  
ATOM   4283  N   ASP A 528      26.708  47.882  46.215  1.00  0.83           N  
ATOM   4284  CA  ASP A 528      27.696  47.653  47.260  1.00  0.83           C  
ATOM   4285  C   ASP A 528      29.091  47.977  46.736  1.00  0.83           C  
ATOM   4286  O   ASP A 528      29.615  47.332  45.828  1.00  0.83           O  
ATOM   4287  CB  ASP A 528      27.580  46.189  47.783  1.00  0.83           C  
ATOM   4288  CG  ASP A 528      28.514  45.781  48.912  1.00  0.83           C  
ATOM   4289  OD1 ASP A 528      28.050  45.592  50.061  1.00  0.83           O  
ATOM   4290  OD2 ASP A 528      29.709  45.496  48.646  1.00  0.83           O  
ATOM   4291  N   GLU A 529      29.736  49.002  47.332  1.00  0.80           N  
ATOM   4292  CA  GLU A 529      31.039  49.504  46.937  1.00  0.80           C  
ATOM   4293  C   GLU A 529      32.141  48.478  47.005  1.00  0.80           C  
ATOM   4294  O   GLU A 529      33.005  48.395  46.130  1.00  0.80           O  
ATOM   4295  CB  GLU A 529      31.463  50.700  47.825  1.00  0.80           C  
ATOM   4296  CG  GLU A 529      30.544  51.926  47.700  1.00  0.80           C  
ATOM   4297  CD  GLU A 529      30.465  52.412  46.279  1.00  0.80           C  
ATOM   4298  OE1 GLU A 529      29.339  52.787  45.867  1.00  0.80           O  
ATOM   4299  OE2 GLU A 529      31.475  52.428  45.523  1.00  0.80           O  
ATOM   4300  N   ALA A 530      32.138  47.635  48.054  1.00  0.89           N  
ATOM   4301  CA  ALA A 530      33.059  46.535  48.131  1.00  0.89           C  
ATOM   4302  C   ALA A 530      32.826  45.511  47.022  1.00  0.89           C  
ATOM   4303  O   ALA A 530      33.752  45.161  46.309  1.00  0.89           O  
ATOM   4304  CB  ALA A 530      32.988  45.922  49.542  1.00  0.89           C  
ATOM   4305  N   PHE A 531      31.575  45.078  46.767  1.00  0.85           N  
ATOM   4306  CA  PHE A 531      31.246  44.094  45.752  1.00  0.85           C  
ATOM   4307  C   PHE A 531      31.597  44.555  44.344  1.00  0.85           C  
ATOM   4308  O   PHE A 531      32.189  43.811  43.568  1.00  0.85           O  
ATOM   4309  CB  PHE A 531      29.746  43.714  45.863  1.00  0.85           C  
ATOM   4310  CG  PHE A 531      29.400  42.466  45.102  1.00  0.85           C  
ATOM   4311  CD1 PHE A 531      29.953  41.230  45.471  1.00  0.85           C  
ATOM   4312  CD2 PHE A 531      28.505  42.515  44.022  1.00  0.85           C  
ATOM   4313  CE1 PHE A 531      29.638  40.067  44.756  1.00  0.85           C  
ATOM   4314  CE2 PHE A 531      28.196  41.356  43.300  1.00  0.85           C  
ATOM   4315  CZ  PHE A 531      28.776  40.134  43.657  1.00  0.85           C  
ATOM   4316  N   ILE A 532      31.315  45.830  44.006  1.00  0.86           N  
ATOM   4317  CA  ILE A 532      31.738  46.433  42.747  1.00  0.86           C  
ATOM   4318  C   ILE A 532      33.256  46.403  42.591  1.00  0.86           C  
ATOM   4319  O   ILE A 532      33.790  46.012  41.552  1.00  0.86           O  
ATOM   4320  CB  ILE A 532      31.234  47.874  42.636  1.00  0.86           C  
ATOM   4321  CG1 ILE A 532      29.688  47.916  42.612  1.00  0.86           C  
ATOM   4322  CG2 ILE A 532      31.808  48.572  41.377  1.00  0.86           C  
ATOM   4323  CD1 ILE A 532      29.139  49.332  42.821  1.00  0.86           C  
ATOM   4324  N   ARG A 533      34.001  46.766  43.651  1.00  0.80           N  
ATOM   4325  CA  ARG A 533      35.447  46.694  43.657  1.00  0.80           C  
ATOM   4326  C   ARG A 533      35.990  45.267  43.552  1.00  0.80           C  
ATOM   4327  O   ARG A 533      36.906  45.001  42.777  1.00  0.80           O  
ATOM   4328  CB  ARG A 533      35.966  47.378  44.944  1.00  0.80           C  
ATOM   4329  CG  ARG A 533      37.499  47.407  45.112  1.00  0.80           C  
ATOM   4330  CD  ARG A 533      37.990  47.971  46.464  1.00  0.80           C  
ATOM   4331  NE  ARG A 533      37.300  47.319  47.638  1.00  0.80           N  
ATOM   4332  CZ  ARG A 533      37.385  46.008  47.951  1.00  0.80           C  
ATOM   4333  NH1 ARG A 533      38.141  45.208  47.241  1.00  0.80           N  
ATOM   4334  NH2 ARG A 533      36.672  45.499  48.952  1.00  0.80           N  
ATOM   4335  N   ASP A 534      35.436  44.307  44.317  1.00  0.89           N  
ATOM   4336  CA  ASP A 534      35.857  42.920  44.314  1.00  0.89           C  
ATOM   4337  C   ASP A 534      35.557  42.190  42.990  1.00  0.89           C  
ATOM   4338  O   ASP A 534      36.395  41.450  42.485  1.00  0.89           O  
ATOM   4339  CB  ASP A 534      35.341  42.198  45.595  1.00  0.89           C  
ATOM   4340  CG  ASP A 534      36.016  42.798  46.824  1.00  0.89           C  
ATOM   4341  OD1 ASP A 534      37.277  42.813  46.839  1.00  0.89           O  
ATOM   4342  OD2 ASP A 534      35.347  43.316  47.760  1.00  0.89           O  
ATOM   4343  N   VAL A 535      34.393  42.425  42.334  1.00  0.91           N  
ATOM   4344  CA  VAL A 535      34.094  41.890  41.001  1.00  0.91           C  
ATOM   4345  C   VAL A 535      35.054  42.396  39.929  1.00  0.91           C  
ATOM   4346  O   VAL A 535      35.565  41.631  39.109  1.00  0.91           O  
ATOM   4347  CB  VAL A 535      32.654  42.210  40.588  1.00  0.91           C  
ATOM   4348  CG1 VAL A 535      32.366  41.870  39.106  1.00  0.91           C  
ATOM   4349  CG2 VAL A 535      31.677  41.412  41.475  1.00  0.91           C  
ATOM   4350  N   ALA A 536      35.361  43.712  39.934  1.00  0.90           N  
ATOM   4351  CA  ALA A 536      36.333  44.302  39.036  1.00  0.90           C  
ATOM   4352  C   ALA A 536      37.747  43.770  39.247  1.00  0.90           C  
ATOM   4353  O   ALA A 536      38.491  43.518  38.297  1.00  0.90           O  
ATOM   4354  CB  ALA A 536      36.316  45.834  39.200  1.00  0.90           C  
ATOM   4355  N   LYS A 537      38.141  43.561  40.517  1.00  0.86           N  
ATOM   4356  CA  LYS A 537      39.419  42.998  40.894  1.00  0.86           C  
ATOM   4357  C   LYS A 537      39.648  41.580  40.405  1.00  0.86           C  
ATOM   4358  O   LYS A 537      40.694  41.296  39.826  1.00  0.86           O  
ATOM   4359  CB  LYS A 537      39.552  43.039  42.425  1.00  0.86           C  
ATOM   4360  CG  LYS A 537      40.906  42.559  42.950  1.00  0.86           C  
ATOM   4361  CD  LYS A 537      40.963  42.635  44.478  1.00  0.86           C  
ATOM   4362  CE  LYS A 537      42.294  42.118  45.018  1.00  0.86           C  
ATOM   4363  NZ  LYS A 537      42.296  42.141  46.491  1.00  0.86           N  
ATOM   4364  N   VAL A 538      38.648  40.680  40.542  1.00  0.91           N  
ATOM   4365  CA  VAL A 538      38.717  39.319  40.017  1.00  0.91           C  
ATOM   4366  C   VAL A 538      38.937  39.329  38.519  1.00  0.91           C  
ATOM   4367  O   VAL A 538      39.726  38.570  37.958  1.00  0.91           O  
ATOM   4368  CB  VAL A 538      37.421  38.556  40.281  1.00  0.91           C  
ATOM   4369  CG1 VAL A 538      37.401  37.204  39.534  1.00  0.91           C  
ATOM   4370  CG2 VAL A 538      37.278  38.300  41.790  1.00  0.91           C  
ATOM   4371  N   LYS A 539      38.240  40.237  37.811  1.00  0.90           N  
ATOM   4372  CA  LYS A 539      38.401  40.389  36.388  1.00  0.90           C  
ATOM   4373  C   LYS A 539      39.798  40.821  35.983  1.00  0.90           C  
ATOM   4374  O   LYS A 539      40.397  40.242  35.078  1.00  0.90           O  
ATOM   4375  CB  LYS A 539      37.342  41.369  35.846  1.00  0.90           C  
ATOM   4376  CG  LYS A 539      36.968  41.109  34.386  1.00  0.90           C  
ATOM   4377  CD  LYS A 539      36.194  39.793  34.226  1.00  0.90           C  
ATOM   4378  CE  LYS A 539      35.882  39.529  32.764  1.00  0.90           C  
ATOM   4379  NZ  LYS A 539      35.373  38.162  32.548  1.00  0.90           N  
ATOM   4380  N   GLN A 540      40.379  41.801  36.699  1.00  0.87           N  
ATOM   4381  CA  GLN A 540      41.745  42.237  36.508  1.00  0.87           C  
ATOM   4382  C   GLN A 540      42.763  41.130  36.799  1.00  0.87           C  
ATOM   4383  O   GLN A 540      43.675  40.899  36.027  1.00  0.87           O  
ATOM   4384  CB  GLN A 540      42.007  43.515  37.345  1.00  0.87           C  
ATOM   4385  CG  GLN A 540      43.261  44.338  36.963  1.00  0.87           C  
ATOM   4386  CD  GLN A 540      43.167  44.881  35.537  1.00  0.87           C  
ATOM   4387  OE1 GLN A 540      43.500  44.221  34.564  1.00  0.87           O  
ATOM   4388  NE2 GLN A 540      42.686  46.144  35.415  1.00  0.87           N  
ATOM   4389  N   GLU A 541      42.564  40.352  37.895  1.00  0.85           N  
ATOM   4390  CA  GLU A 541      43.364  39.173  38.200  1.00  0.85           C  
ATOM   4391  C   GLU A 541      43.326  38.117  37.110  1.00  0.85           C  
ATOM   4392  O   GLU A 541      44.363  37.607  36.682  1.00  0.85           O  
ATOM   4393  CB  GLU A 541      42.901  38.541  39.534  1.00  0.85           C  
ATOM   4394  CG  GLU A 541      43.355  39.358  40.765  1.00  0.85           C  
ATOM   4395  CD  GLU A 541      42.750  38.860  42.074  1.00  0.85           C  
ATOM   4396  OE1 GLU A 541      42.298  37.692  42.135  1.00  0.85           O  
ATOM   4397  OE2 GLU A 541      42.756  39.667  43.041  1.00  0.85           O  
ATOM   4398  N   ASN A 542      42.132  37.811  36.568  1.00  0.91           N  
ATOM   4399  CA  ASN A 542      41.982  36.908  35.442  1.00  0.91           C  
ATOM   4400  C   ASN A 542      42.664  37.400  34.173  1.00  0.91           C  
ATOM   4401  O   ASN A 542      43.291  36.618  33.463  1.00  0.91           O  
ATOM   4402  CB  ASN A 542      40.498  36.612  35.142  1.00  0.91           C  
ATOM   4403  CG  ASN A 542      39.912  35.721  36.231  1.00  0.91           C  
ATOM   4404  OD1 ASN A 542      40.601  34.937  36.885  1.00  0.91           O  
ATOM   4405  ND2 ASN A 542      38.572  35.799  36.387  1.00  0.91           N  
ATOM   4406  N   LYS A 543      42.594  38.711  33.864  1.00  0.89           N  
ATOM   4407  CA  LYS A 543      43.313  39.295  32.746  1.00  0.89           C  
ATOM   4408  C   LYS A 543      44.814  39.161  32.846  1.00  0.89           C  
ATOM   4409  O   LYS A 543      45.469  38.737  31.894  1.00  0.89           O  
ATOM   4410  CB  LYS A 543      43.012  40.796  32.630  1.00  0.89           C  
ATOM   4411  CG  LYS A 543      41.608  41.088  32.116  1.00  0.89           C  
ATOM   4412  CD  LYS A 543      41.429  42.596  31.977  1.00  0.89           C  
ATOM   4413  CE  LYS A 543      40.193  42.947  31.190  1.00  0.89           C  
ATOM   4414  NZ  LYS A 543      40.195  44.372  30.851  1.00  0.89           N  
ATOM   4415  N   LEU A 544      45.386  39.469  34.025  1.00  0.87           N  
ATOM   4416  CA  LEU A 544      46.794  39.288  34.317  1.00  0.87           C  
ATOM   4417  C   LEU A 544      47.214  37.831  34.234  1.00  0.87           C  
ATOM   4418  O   LEU A 544      48.243  37.495  33.654  1.00  0.87           O  
ATOM   4419  CB  LEU A 544      47.125  39.811  35.735  1.00  0.87           C  
ATOM   4420  CG  LEU A 544      47.030  41.340  35.903  1.00  0.87           C  
ATOM   4421  CD1 LEU A 544      47.058  41.710  37.393  1.00  0.87           C  
ATOM   4422  CD2 LEU A 544      48.172  42.060  35.175  1.00  0.87           C  
ATOM   4423  N   LYS A 545      46.395  36.914  34.784  1.00  0.84           N  
ATOM   4424  CA  LYS A 545      46.641  35.489  34.712  1.00  0.84           C  
ATOM   4425  C   LYS A 545      46.625  34.938  33.289  1.00  0.84           C  
ATOM   4426  O   LYS A 545      47.507  34.177  32.894  1.00  0.84           O  
ATOM   4427  CB  LYS A 545      45.608  34.735  35.587  1.00  0.84           C  
ATOM   4428  CG  LYS A 545      45.863  33.224  35.729  1.00  0.84           C  
ATOM   4429  CD  LYS A 545      44.765  32.534  36.557  1.00  0.84           C  
ATOM   4430  CE  LYS A 545      44.965  31.020  36.771  1.00  0.84           C  
ATOM   4431  NZ  LYS A 545      46.129  30.720  37.649  1.00  0.84           N  
ATOM   4432  N   PHE A 546      45.631  35.336  32.468  1.00  0.89           N  
ATOM   4433  CA  PHE A 546      45.522  34.964  31.075  1.00  0.89           C  
ATOM   4434  C   PHE A 546      46.662  35.518  30.232  1.00  0.89           C  
ATOM   4435  O   PHE A 546      47.247  34.822  29.433  1.00  0.89           O  
ATOM   4436  CB  PHE A 546      44.148  35.407  30.517  1.00  0.89           C  
ATOM   4437  CG  PHE A 546      43.902  34.832  29.154  1.00  0.89           C  
ATOM   4438  CD1 PHE A 546      43.789  33.444  28.987  1.00  0.89           C  
ATOM   4439  CD2 PHE A 546      43.841  35.661  28.028  1.00  0.89           C  
ATOM   4440  CE1 PHE A 546      43.657  32.888  27.710  1.00  0.89           C  
ATOM   4441  CE2 PHE A 546      43.682  35.104  26.757  1.00  0.89           C  
ATOM   4442  CZ  PHE A 546      43.609  33.720  26.590  1.00  0.89           C  
ATOM   4443  N   ALA A 547      47.024  36.799  30.470  1.00  0.88           N  
ATOM   4444  CA  ALA A 547      48.147  37.456  29.848  1.00  0.88           C  
ATOM   4445  C   ALA A 547      49.450  36.750  30.131  1.00  0.88           C  
ATOM   4446  O   ALA A 547      50.232  36.472  29.221  1.00  0.88           O  
ATOM   4447  CB  ALA A 547      48.224  38.875  30.429  1.00  0.88           C  
ATOM   4448  N   ALA A 548      49.663  36.369  31.408  1.00  0.85           N  
ATOM   4449  CA  ALA A 548      50.798  35.592  31.816  1.00  0.85           C  
ATOM   4450  C   ALA A 548      50.857  34.240  31.137  1.00  0.85           C  
ATOM   4451  O   ALA A 548      51.886  33.914  30.565  1.00  0.85           O  
ATOM   4452  CB  ALA A 548      50.796  35.425  33.347  1.00  0.85           C  
ATOM   4453  N   TYR A 549      49.740  33.469  31.095  1.00  0.82           N  
ATOM   4454  CA  TYR A 549      49.653  32.182  30.417  1.00  0.82           C  
ATOM   4455  C   TYR A 549      49.988  32.289  28.940  1.00  0.82           C  
ATOM   4456  O   TYR A 549      50.764  31.492  28.410  1.00  0.82           O  
ATOM   4457  CB  TYR A 549      48.227  31.579  30.636  1.00  0.82           C  
ATOM   4458  CG  TYR A 549      47.891  30.405  29.737  1.00  0.82           C  
ATOM   4459  CD1 TYR A 549      47.234  30.647  28.519  1.00  0.82           C  
ATOM   4460  CD2 TYR A 549      48.254  29.086  30.056  1.00  0.82           C  
ATOM   4461  CE1 TYR A 549      46.963  29.599  27.631  1.00  0.82           C  
ATOM   4462  CE2 TYR A 549      47.988  28.037  29.160  1.00  0.82           C  
ATOM   4463  CZ  TYR A 549      47.349  28.291  27.941  1.00  0.82           C  
ATOM   4464  OH  TYR A 549      47.134  27.233  27.025  1.00  0.82           O  
ATOM   4465  N   LEU A 550      49.428  33.305  28.274  1.00  0.79           N  
ATOM   4466  CA  LEU A 550      49.609  33.582  26.877  1.00  0.79           C  
ATOM   4467  C   LEU A 550      51.039  33.880  26.497  1.00  0.79           C  
ATOM   4468  O   LEU A 550      51.510  33.377  25.484  1.00  0.79           O  
ATOM   4469  CB  LEU A 550      48.682  34.748  26.493  1.00  0.79           C  
ATOM   4470  CG  LEU A 550      47.607  34.478  25.437  1.00  0.79           C  
ATOM   4471  CD1 LEU A 550      46.792  33.236  25.772  1.00  0.79           C  
ATOM   4472  CD2 LEU A 550      46.652  35.680  25.378  1.00  0.79           C  
ATOM   4473  N   GLU A 551      51.785  34.670  27.300  1.00  0.74           N  
ATOM   4474  CA  GLU A 551      53.158  34.975  26.931  1.00  0.74           C  
ATOM   4475  C   GLU A 551      54.185  33.962  27.438  1.00  0.74           C  
ATOM   4476  O   GLU A 551      55.343  33.970  27.030  1.00  0.74           O  
ATOM   4477  CB  GLU A 551      53.546  36.425  27.292  1.00  0.74           C  
ATOM   4478  CG  GLU A 551      54.776  36.908  26.480  1.00  0.74           C  
ATOM   4479  CD  GLU A 551      54.977  38.417  26.415  1.00  0.74           C  
ATOM   4480  OE1 GLU A 551      55.925  38.821  25.680  1.00  0.74           O  
ATOM   4481  OE2 GLU A 551      54.184  39.183  27.013  1.00  0.74           O  
ATOM   4482  N   ARG A 552      53.790  33.000  28.304  1.00  0.74           N  
ATOM   4483  CA  ARG A 552      54.708  31.953  28.723  1.00  0.74           C  
ATOM   4484  C   ARG A 552      54.527  30.623  27.995  1.00  0.74           C  
ATOM   4485  O   ARG A 552      55.396  29.763  28.083  1.00  0.74           O  
ATOM   4486  CB  ARG A 552      54.585  31.675  30.244  1.00  0.74           C  
ATOM   4487  CG  ARG A 552      53.226  31.076  30.643  1.00  0.74           C  
ATOM   4488  CD  ARG A 552      53.147  30.430  32.027  1.00  0.74           C  
ATOM   4489  NE  ARG A 552      53.879  29.124  31.949  1.00  0.74           N  
ATOM   4490  CZ  ARG A 552      53.419  28.089  31.238  1.00  0.74           C  
ATOM   4491  NH1 ARG A 552      52.205  28.130  30.711  1.00  0.74           N  
ATOM   4492  NH2 ARG A 552      54.157  27.009  30.988  1.00  0.74           N  
ATOM   4493  N   GLU A 553      53.392  30.414  27.285  1.00  0.73           N  
ATOM   4494  CA  GLU A 553      53.123  29.178  26.559  1.00  0.73           C  
ATOM   4495  C   GLU A 553      53.121  29.430  25.049  1.00  0.73           C  
ATOM   4496  O   GLU A 553      53.156  28.517  24.237  1.00  0.73           O  
ATOM   4497  CB  GLU A 553      51.738  28.614  26.997  1.00  0.73           C  
ATOM   4498  CG  GLU A 553      51.525  27.087  26.784  1.00  0.73           C  
ATOM   4499  CD  GLU A 553      52.436  26.183  27.622  1.00  0.73           C  
ATOM   4500  OE1 GLU A 553      52.412  26.340  28.876  1.00  0.73           O  
ATOM   4501  OE2 GLU A 553      53.144  25.316  27.057  1.00  0.73           O  
ATOM   4502  N   TYR A 554      53.121  30.719  24.645  1.00  0.78           N  
ATOM   4503  CA  TYR A 554      53.094  31.178  23.268  1.00  0.78           C  
ATOM   4504  C   TYR A 554      53.787  32.537  23.278  1.00  0.78           C  
ATOM   4505  O   TYR A 554      54.245  32.992  24.314  1.00  0.78           O  
ATOM   4506  CB  TYR A 554      51.658  31.417  22.719  1.00  0.78           C  
ATOM   4507  CG  TYR A 554      50.774  30.207  22.818  1.00  0.78           C  
ATOM   4508  CD1 TYR A 554      50.897  29.141  21.912  1.00  0.78           C  
ATOM   4509  CD2 TYR A 554      49.772  30.151  23.803  1.00  0.78           C  
ATOM   4510  CE1 TYR A 554      50.034  28.037  21.990  1.00  0.78           C  
ATOM   4511  CE2 TYR A 554      48.913  29.048  23.883  1.00  0.78           C  
ATOM   4512  CZ  TYR A 554      49.047  27.991  22.977  1.00  0.78           C  
ATOM   4513  OH  TYR A 554      48.162  26.901  23.075  1.00  0.78           O  
ATOM   4514  N   LYS A 555      53.902  33.248  22.129  1.00  0.64           N  
ATOM   4515  CA  LYS A 555      54.328  34.642  22.172  1.00  0.64           C  
ATOM   4516  C   LYS A 555      53.082  35.515  22.220  1.00  0.64           C  
ATOM   4517  O   LYS A 555      52.192  35.383  21.382  1.00  0.64           O  
ATOM   4518  CB  LYS A 555      55.197  35.060  20.947  1.00  0.64           C  
ATOM   4519  CG  LYS A 555      56.235  36.181  21.196  1.00  0.64           C  
ATOM   4520  CD  LYS A 555      55.739  37.408  21.973  1.00  0.64           C  
ATOM   4521  CE  LYS A 555      56.820  38.450  22.252  1.00  0.64           C  
ATOM   4522  NZ  LYS A 555      56.331  39.446  23.211  1.00  0.64           N  
ATOM   4523  N   VAL A 556      52.990  36.450  23.180  1.00  0.73           N  
ATOM   4524  CA  VAL A 556      51.884  37.378  23.239  1.00  0.73           C  
ATOM   4525  C   VAL A 556      52.370  38.802  23.424  1.00  0.73           C  
ATOM   4526  O   VAL A 556      53.573  39.066  23.449  1.00  0.73           O  
ATOM   4527  CB  VAL A 556      50.837  36.863  24.222  1.00  0.73           C  
ATOM   4528  CG1 VAL A 556      50.537  37.782  25.422  1.00  0.73           C  
ATOM   4529  CG2 VAL A 556      49.595  36.569  23.367  1.00  0.73           C  
ATOM   4530  N   HIS A 557      51.474  39.802  23.459  1.00  0.73           N  
ATOM   4531  CA  HIS A 557      51.836  41.089  24.013  1.00  0.73           C  
ATOM   4532  C   HIS A 557      50.589  41.580  24.703  1.00  0.73           C  
ATOM   4533  O   HIS A 557      49.492  41.361  24.215  1.00  0.73           O  
ATOM   4534  CB  HIS A 557      52.323  42.126  22.964  1.00  0.73           C  
ATOM   4535  CG  HIS A 557      53.072  43.262  23.600  1.00  0.73           C  
ATOM   4536  ND1 HIS A 557      54.346  43.007  24.062  1.00  0.73           N  
ATOM   4537  CD2 HIS A 557      52.676  44.506  23.974  1.00  0.73           C  
ATOM   4538  CE1 HIS A 557      54.699  44.093  24.720  1.00  0.73           C  
ATOM   4539  NE2 HIS A 557      53.725  45.035  24.696  1.00  0.73           N  
ATOM   4540  N   ILE A 558      50.725  42.236  25.873  1.00  0.82           N  
ATOM   4541  CA  ILE A 558      49.560  42.673  26.619  1.00  0.82           C  
ATOM   4542  C   ILE A 558      49.669  44.073  27.164  1.00  0.82           C  
ATOM   4543  O   ILE A 558      50.712  44.609  27.470  1.00  0.82           O  
ATOM   4544  CB  ILE A 558      49.150  41.789  27.794  1.00  0.82           C  
ATOM   4545  CG1 ILE A 558      50.216  41.653  28.915  1.00  0.82           C  
ATOM   4546  CG2 ILE A 558      48.646  40.427  27.292  1.00  0.82           C  
ATOM   4547  CD1 ILE A 558      51.413  40.745  28.605  1.00  0.82           C  
ATOM   4548  N   ASN A 559      48.469  44.662  27.337  1.00  0.85           N  
ATOM   4549  CA  ASN A 559      48.260  45.788  28.201  1.00  0.85           C  
ATOM   4550  C   ASN A 559      47.004  45.389  28.952  1.00  0.85           C  
ATOM   4551  O   ASN A 559      45.931  45.641  28.426  1.00  0.85           O  
ATOM   4552  CB  ASN A 559      48.044  47.051  27.322  1.00  0.85           C  
ATOM   4553  CG  ASN A 559      47.381  48.214  28.066  1.00  0.85           C  
ATOM   4554  OD1 ASN A 559      47.417  48.342  29.268  1.00  0.85           O  
ATOM   4555  ND2 ASN A 559      46.655  49.045  27.267  1.00  0.85           N  
ATOM   4556  N   PRO A 560      47.040  44.761  30.128  1.00  0.89           N  
ATOM   4557  CA  PRO A 560      45.856  44.215  30.788  1.00  0.89           C  
ATOM   4558  C   PRO A 560      44.794  45.242  31.122  1.00  0.89           C  
ATOM   4559  O   PRO A 560      43.641  44.905  31.337  1.00  0.89           O  
ATOM   4560  CB  PRO A 560      46.387  43.480  32.027  1.00  0.89           C  
ATOM   4561  CG  PRO A 560      47.799  44.036  32.219  1.00  0.89           C  
ATOM   4562  CD  PRO A 560      48.260  44.366  30.811  1.00  0.89           C  
ATOM   4563  N   ASN A 561      45.157  46.528  31.149  1.00  0.87           N  
ATOM   4564  CA  ASN A 561      44.214  47.601  31.309  1.00  0.87           C  
ATOM   4565  C   ASN A 561      43.308  47.777  30.091  1.00  0.87           C  
ATOM   4566  O   ASN A 561      42.221  48.353  30.211  1.00  0.87           O  
ATOM   4567  CB  ASN A 561      44.953  48.910  31.676  1.00  0.87           C  
ATOM   4568  CG  ASN A 561      45.809  48.661  32.914  1.00  0.87           C  
ATOM   4569  OD1 ASN A 561      46.846  48.004  32.877  1.00  0.87           O  
ATOM   4570  ND2 ASN A 561      45.358  49.183  34.077  1.00  0.87           N  
ATOM   4571  N   SER A 562      43.685  47.249  28.906  1.00  0.94           N  
ATOM   4572  CA  SER A 562      42.848  47.208  27.718  1.00  0.94           C  
ATOM   4573  C   SER A 562      41.552  46.435  27.864  1.00  0.94           C  
ATOM   4574  O   SER A 562      41.424  45.511  28.665  1.00  0.94           O  
ATOM   4575  CB  SER A 562      43.580  46.716  26.435  1.00  0.94           C  
ATOM   4576  OG  SER A 562      43.797  45.303  26.416  1.00  0.94           O  
ATOM   4577  N   LEU A 563      40.533  46.818  27.069  1.00  0.96           N  
ATOM   4578  CA  LEU A 563      39.315  46.053  26.916  1.00  0.96           C  
ATOM   4579  C   LEU A 563      39.611  44.746  26.192  1.00  0.96           C  
ATOM   4580  O   LEU A 563      40.106  44.734  25.064  1.00  0.96           O  
ATOM   4581  CB  LEU A 563      38.248  46.911  26.185  1.00  0.96           C  
ATOM   4582  CG  LEU A 563      36.794  46.388  26.175  1.00  0.96           C  
ATOM   4583  CD1 LEU A 563      35.839  47.532  25.799  1.00  0.96           C  
ATOM   4584  CD2 LEU A 563      36.570  45.234  25.190  1.00  0.96           C  
ATOM   4585  N   PHE A 564      39.331  43.600  26.839  1.00  0.96           N  
ATOM   4586  CA  PHE A 564      39.560  42.285  26.276  1.00  0.96           C  
ATOM   4587  C   PHE A 564      38.324  41.881  25.506  1.00  0.96           C  
ATOM   4588  O   PHE A 564      37.304  41.487  26.071  1.00  0.96           O  
ATOM   4589  CB  PHE A 564      39.891  41.202  27.346  1.00  0.96           C  
ATOM   4590  CG  PHE A 564      41.345  41.168  27.769  1.00  0.96           C  
ATOM   4591  CD1 PHE A 564      42.227  42.255  27.617  1.00  0.96           C  
ATOM   4592  CD2 PHE A 564      41.844  39.986  28.347  1.00  0.96           C  
ATOM   4593  CE1 PHE A 564      43.566  42.158  28.015  1.00  0.96           C  
ATOM   4594  CE2 PHE A 564      43.185  39.880  28.739  1.00  0.96           C  
ATOM   4595  CZ  PHE A 564      44.049  40.968  28.569  1.00  0.96           C  
ATOM   4596  N   ASP A 565      38.416  42.002  24.174  1.00  0.98           N  
ATOM   4597  CA  ASP A 565      37.349  41.796  23.228  1.00  0.98           C  
ATOM   4598  C   ASP A 565      37.542  40.426  22.607  1.00  0.98           C  
ATOM   4599  O   ASP A 565      38.558  40.151  21.980  1.00  0.98           O  
ATOM   4600  CB  ASP A 565      37.456  42.937  22.191  1.00  0.98           C  
ATOM   4601  CG  ASP A 565      36.371  42.902  21.137  1.00  0.98           C  
ATOM   4602  OD1 ASP A 565      35.496  42.012  21.202  1.00  0.98           O  
ATOM   4603  OD2 ASP A 565      36.404  43.825  20.273  1.00  0.98           O  
ATOM   4604  N   ILE A 566      36.604  39.490  22.861  1.00  0.98           N  
ATOM   4605  CA  ILE A 566      36.891  38.089  22.625  1.00  0.98           C  
ATOM   4606  C   ILE A 566      35.781  37.372  21.887  1.00  0.98           C  
ATOM   4607  O   ILE A 566      34.642  37.251  22.331  1.00  0.98           O  
ATOM   4608  CB  ILE A 566      37.264  37.363  23.915  1.00  0.98           C  
ATOM   4609  CG1 ILE A 566      38.495  38.074  24.552  1.00  0.98           C  
ATOM   4610  CG2 ILE A 566      37.545  35.869  23.622  1.00  0.98           C  
ATOM   4611  CD1 ILE A 566      39.196  37.336  25.690  1.00  0.98           C  
ATOM   4612  N   GLN A 567      36.150  36.797  20.722  1.00  0.96           N  
ATOM   4613  CA  GLN A 567      35.290  35.913  19.980  1.00  0.96           C  
ATOM   4614  C   GLN A 567      35.932  34.542  19.896  1.00  0.96           C  
ATOM   4615  O   GLN A 567      36.864  34.310  19.130  1.00  0.96           O  
ATOM   4616  CB  GLN A 567      35.045  36.444  18.551  1.00  0.96           C  
ATOM   4617  CG  GLN A 567      33.877  35.699  17.872  1.00  0.96           C  
ATOM   4618  CD  GLN A 567      33.544  36.155  16.450  1.00  0.96           C  
ATOM   4619  OE1 GLN A 567      32.716  35.560  15.801  1.00  0.96           O  
ATOM   4620  NE2 GLN A 567      34.242  37.209  15.949  1.00  0.96           N  
ATOM   4621  N   VAL A 568      35.422  33.569  20.678  1.00  0.98           N  
ATOM   4622  CA  VAL A 568      35.910  32.202  20.629  1.00  0.98           C  
ATOM   4623  C   VAL A 568      34.768  31.231  20.399  1.00  0.98           C  
ATOM   4624  O   VAL A 568      33.741  31.250  21.082  1.00  0.98           O  
ATOM   4625  CB  VAL A 568      36.750  31.763  21.823  1.00  0.98           C  
ATOM   4626  CG1 VAL A 568      38.113  32.481  21.797  1.00  0.98           C  
ATOM   4627  CG2 VAL A 568      36.030  32.030  23.156  1.00  0.98           C  
ATOM   4628  N   LYS A 569      34.938  30.358  19.384  1.00  0.91           N  
ATOM   4629  CA  LYS A 569      33.922  29.493  18.816  1.00  0.91           C  
ATOM   4630  C   LYS A 569      34.467  28.986  17.497  1.00  0.91           C  
ATOM   4631  O   LYS A 569      35.429  29.532  16.971  1.00  0.91           O  
ATOM   4632  CB  LYS A 569      32.540  30.182  18.577  1.00  0.91           C  
ATOM   4633  CG  LYS A 569      32.588  31.497  17.771  1.00  0.91           C  
ATOM   4634  CD  LYS A 569      31.234  32.234  17.697  1.00  0.91           C  
ATOM   4635  CE  LYS A 569      30.772  32.861  19.016  1.00  0.91           C  
ATOM   4636  NZ  LYS A 569      29.296  32.970  19.047  1.00  0.91           N  
ATOM   4637  N   ARG A 570      33.913  27.889  16.930  1.00  0.89           N  
ATOM   4638  CA  ARG A 570      34.322  27.398  15.619  1.00  0.89           C  
ATOM   4639  C   ARG A 570      34.167  28.433  14.507  1.00  0.89           C  
ATOM   4640  O   ARG A 570      33.281  29.286  14.542  1.00  0.89           O  
ATOM   4641  CB  ARG A 570      33.554  26.106  15.231  1.00  0.89           C  
ATOM   4642  CG  ARG A 570      33.910  24.870  16.088  1.00  0.89           C  
ATOM   4643  CD  ARG A 570      35.334  24.331  15.903  1.00  0.89           C  
ATOM   4644  NE  ARG A 570      35.487  23.842  14.494  1.00  0.89           N  
ATOM   4645  CZ  ARG A 570      35.367  22.558  14.116  1.00  0.89           C  
ATOM   4646  NH1 ARG A 570      35.114  21.603  14.997  1.00  0.89           N  
ATOM   4647  NH2 ARG A 570      35.515  22.238  12.833  1.00  0.89           N  
ATOM   4648  N   ILE A 571      35.065  28.405  13.505  1.00  0.96           N  
ATOM   4649  CA  ILE A 571      35.076  29.412  12.458  1.00  0.96           C  
ATOM   4650  C   ILE A 571      34.018  29.108  11.414  1.00  0.96           C  
ATOM   4651  O   ILE A 571      34.016  28.049  10.789  1.00  0.96           O  
ATOM   4652  CB  ILE A 571      36.434  29.557  11.790  1.00  0.96           C  
ATOM   4653  CG1 ILE A 571      37.583  29.689  12.819  1.00  0.96           C  
ATOM   4654  CG2 ILE A 571      36.431  30.753  10.808  1.00  0.96           C  
ATOM   4655  CD1 ILE A 571      37.518  30.918  13.734  1.00  0.96           C  
ATOM   4656  N   HIS A 572      33.074  30.043  11.224  1.00  0.93           N  
ATOM   4657  CA  HIS A 572      31.956  29.854  10.331  1.00  0.93           C  
ATOM   4658  C   HIS A 572      31.523  31.188   9.791  1.00  0.93           C  
ATOM   4659  O   HIS A 572      31.478  32.182  10.511  1.00  0.93           O  
ATOM   4660  CB  HIS A 572      30.718  29.303  11.076  1.00  0.93           C  
ATOM   4661  CG  HIS A 572      30.624  27.826  11.115  1.00  0.93           C  
ATOM   4662  ND1 HIS A 572      30.138  27.155  10.010  1.00  0.93           N  
ATOM   4663  CD2 HIS A 572      30.869  26.966  12.132  1.00  0.93           C  
ATOM   4664  CE1 HIS A 572      30.104  25.886  10.379  1.00  0.93           C  
ATOM   4665  NE2 HIS A 572      30.533  25.725  11.655  1.00  0.93           N  
ATOM   4666  N   GLU A 573      31.088  31.228   8.520  1.00  0.94           N  
ATOM   4667  CA  GLU A 573      30.497  32.406   7.920  1.00  0.94           C  
ATOM   4668  C   GLU A 573      29.243  32.889   8.644  1.00  0.94           C  
ATOM   4669  O   GLU A 573      29.066  34.081   8.870  1.00  0.94           O  
ATOM   4670  CB  GLU A 573      30.182  32.120   6.443  1.00  0.94           C  
ATOM   4671  CG  GLU A 573      31.436  31.804   5.598  1.00  0.94           C  
ATOM   4672  CD  GLU A 573      31.050  31.405   4.178  1.00  0.94           C  
ATOM   4673  OE1 GLU A 573      30.245  32.138   3.554  1.00  0.94           O  
ATOM   4674  OE2 GLU A 573      31.562  30.357   3.707  1.00  0.94           O  
ATOM   4675  N   TYR A 574      28.379  31.952   9.105  1.00  0.91           N  
ATOM   4676  CA  TYR A 574      27.203  32.262   9.907  1.00  0.91           C  
ATOM   4677  C   TYR A 574      27.480  32.939  11.241  1.00  0.91           C  
ATOM   4678  O   TYR A 574      26.728  33.808  11.678  1.00  0.91           O  
ATOM   4679  CB  TYR A 574      26.257  31.027  10.067  1.00  0.91           C  
ATOM   4680  CG  TYR A 574      26.490  30.088  11.235  1.00  0.91           C  
ATOM   4681  CD1 TYR A 574      25.976  30.404  12.507  1.00  0.91           C  
ATOM   4682  CD2 TYR A 574      27.108  28.840  11.056  1.00  0.91           C  
ATOM   4683  CE1 TYR A 574      26.046  29.487  13.562  1.00  0.91           C  
ATOM   4684  CE2 TYR A 574      27.166  27.912  12.109  1.00  0.91           C  
ATOM   4685  CZ  TYR A 574      26.620  28.232  13.357  1.00  0.91           C  
ATOM   4686  OH  TYR A 574      26.646  27.313  14.428  1.00  0.91           O  
ATOM   4687  N   LYS A 575      28.577  32.541  11.921  1.00  0.91           N  
ATOM   4688  CA  LYS A 575      28.991  33.103  13.191  1.00  0.91           C  
ATOM   4689  C   LYS A 575      29.684  34.446  13.009  1.00  0.91           C  
ATOM   4690  O   LYS A 575      29.775  35.229  13.948  1.00  0.91           O  
ATOM   4691  CB  LYS A 575      29.929  32.117  13.934  1.00  0.91           C  
ATOM   4692  CG  LYS A 575      29.207  30.844  14.418  1.00  0.91           C  
ATOM   4693  CD  LYS A 575      30.161  29.793  15.012  1.00  0.91           C  
ATOM   4694  CE  LYS A 575      29.530  28.446  15.392  1.00  0.91           C  
ATOM   4695  NZ  LYS A 575      28.469  28.603  16.394  1.00  0.91           N  
ATOM   4696  N   ARG A 576      30.131  34.742  11.769  1.00  0.93           N  
ATOM   4697  CA  ARG A 576      30.598  36.039  11.325  1.00  0.93           C  
ATOM   4698  C   ARG A 576      31.883  36.561  11.955  1.00  0.93           C  
ATOM   4699  O   ARG A 576      31.981  37.736  12.301  1.00  0.93           O  
ATOM   4700  CB  ARG A 576      29.512  37.139  11.419  1.00  0.93           C  
ATOM   4701  CG  ARG A 576      28.263  36.943  10.540  1.00  0.93           C  
ATOM   4702  CD  ARG A 576      27.091  37.723  11.127  1.00  0.93           C  
ATOM   4703  NE  ARG A 576      26.328  38.477  10.085  1.00  0.93           N  
ATOM   4704  CZ  ARG A 576      25.398  39.349  10.469  1.00  0.93           C  
ATOM   4705  NH1 ARG A 576      25.169  39.611  11.754  1.00  0.93           N  
ATOM   4706  NH2 ARG A 576      24.646  40.017   9.602  1.00  0.93           N  
ATOM   4707  N   GLN A 577      32.969  35.754  12.019  1.00  0.96           N  
ATOM   4708  CA  GLN A 577      34.283  36.261  12.405  1.00  0.96           C  
ATOM   4709  C   GLN A 577      34.749  37.403  11.495  1.00  0.96           C  
ATOM   4710  O   GLN A 577      35.385  38.354  11.935  1.00  0.96           O  
ATOM   4711  CB  GLN A 577      35.346  35.134  12.481  1.00  0.96           C  
ATOM   4712  CG  GLN A 577      35.208  34.172  13.693  1.00  0.96           C  
ATOM   4713  CD  GLN A 577      34.182  33.050  13.499  1.00  0.96           C  
ATOM   4714  OE1 GLN A 577      33.636  32.820  12.422  1.00  0.96           O  
ATOM   4715  NE2 GLN A 577      33.956  32.268  14.582  1.00  0.96           N  
ATOM   4716  N   LEU A 578      34.333  37.372  10.211  1.00  0.98           N  
ATOM   4717  CA  LEU A 578      34.487  38.457   9.258  1.00  0.98           C  
ATOM   4718  C   LEU A 578      33.856  39.785   9.660  1.00  0.98           C  
ATOM   4719  O   LEU A 578      34.453  40.830   9.429  1.00  0.98           O  
ATOM   4720  CB  LEU A 578      33.930  38.056   7.872  1.00  0.98           C  
ATOM   4721  CG  LEU A 578      34.787  37.000   7.154  1.00  0.98           C  
ATOM   4722  CD1 LEU A 578      34.071  36.438   5.921  1.00  0.98           C  
ATOM   4723  CD2 LEU A 578      36.148  37.579   6.740  1.00  0.98           C  
ATOM   4724  N   LEU A 579      32.658  39.810  10.291  1.00  0.99           N  
ATOM   4725  CA  LEU A 579      32.052  41.050  10.764  1.00  0.99           C  
ATOM   4726  C   LEU A 579      32.909  41.722  11.835  1.00  0.99           C  
ATOM   4727  O   LEU A 579      33.171  42.924  11.788  1.00  0.99           O  
ATOM   4728  CB  LEU A 579      30.598  40.798  11.249  1.00  0.99           C  
ATOM   4729  CG  LEU A 579      29.824  42.024  11.779  1.00  0.99           C  
ATOM   4730  CD1 LEU A 579      29.690  43.149  10.740  1.00  0.99           C  
ATOM   4731  CD2 LEU A 579      28.425  41.620  12.272  1.00  0.99           C  
ATOM   4732  N   ASN A 580      33.453  40.920  12.777  1.00  0.98           N  
ATOM   4733  CA  ASN A 580      34.425  41.349  13.763  1.00  0.98           C  
ATOM   4734  C   ASN A 580      35.705  41.854  13.118  1.00  0.98           C  
ATOM   4735  O   ASN A 580      36.178  42.924  13.474  1.00  0.98           O  
ATOM   4736  CB  ASN A 580      34.690  40.179  14.738  1.00  0.98           C  
ATOM   4737  CG  ASN A 580      35.483  40.466  16.020  1.00  0.98           C  
ATOM   4738  OD1 ASN A 580      35.853  39.498  16.686  1.00  0.98           O  
ATOM   4739  ND2 ASN A 580      35.750  41.741  16.368  1.00  0.98           N  
ATOM   4740  N   CYS A 581      36.240  41.146  12.099  1.00  0.99           N  
ATOM   4741  CA  CYS A 581      37.400  41.594  11.342  1.00  0.99           C  
ATOM   4742  C   CYS A 581      37.195  42.930  10.653  1.00  0.99           C  
ATOM   4743  O   CYS A 581      38.084  43.776  10.682  1.00  0.99           O  
ATOM   4744  CB  CYS A 581      37.859  40.569  10.273  1.00  0.99           C  
ATOM   4745  SG  CYS A 581      38.449  39.015  11.022  1.00  0.99           S  
ATOM   4746  N   LEU A 582      36.006  43.188  10.061  1.00  0.98           N  
ATOM   4747  CA  LEU A 582      35.705  44.491   9.484  1.00  0.98           C  
ATOM   4748  C   LEU A 582      35.776  45.610  10.518  1.00  0.98           C  
ATOM   4749  O   LEU A 582      36.419  46.628  10.287  1.00  0.98           O  
ATOM   4750  CB  LEU A 582      34.321  44.542   8.776  1.00  0.98           C  
ATOM   4751  CG  LEU A 582      34.157  43.646   7.527  1.00  0.98           C  
ATOM   4752  CD1 LEU A 582      32.773  43.871   6.899  1.00  0.98           C  
ATOM   4753  CD2 LEU A 582      35.238  43.885   6.463  1.00  0.98           C  
ATOM   4754  N   HIS A 583      35.197  45.410  11.726  1.00  0.97           N  
ATOM   4755  CA  HIS A 583      35.292  46.379  12.815  1.00  0.97           C  
ATOM   4756  C   HIS A 583      36.711  46.648  13.281  1.00  0.97           C  
ATOM   4757  O   HIS A 583      37.081  47.799  13.512  1.00  0.97           O  
ATOM   4758  CB  HIS A 583      34.436  45.987  14.044  1.00  0.97           C  
ATOM   4759  CG  HIS A 583      34.657  46.827  15.275  1.00  0.97           C  
ATOM   4760  ND1 HIS A 583      35.178  46.224  16.400  1.00  0.97           N  
ATOM   4761  CD2 HIS A 583      34.516  48.161  15.484  1.00  0.97           C  
ATOM   4762  CE1 HIS A 583      35.344  47.194  17.274  1.00  0.97           C  
ATOM   4763  NE2 HIS A 583      34.964  48.394  16.767  1.00  0.97           N  
ATOM   4764  N   VAL A 584      37.552  45.602  13.391  1.00  0.98           N  
ATOM   4765  CA  VAL A 584      38.955  45.737  13.749  1.00  0.98           C  
ATOM   4766  C   VAL A 584      39.717  46.630  12.779  1.00  0.98           C  
ATOM   4767  O   VAL A 584      40.448  47.538  13.179  1.00  0.98           O  
ATOM   4768  CB  VAL A 584      39.614  44.363  13.789  1.00  0.98           C  
ATOM   4769  CG1 VAL A 584      41.130  44.471  14.016  1.00  0.98           C  
ATOM   4770  CG2 VAL A 584      39.015  43.543  14.943  1.00  0.98           C  
ATOM   4771  N   ILE A 585      39.521  46.429  11.460  1.00  0.95           N  
ATOM   4772  CA  ILE A 585      40.132  47.255  10.431  1.00  0.95           C  
ATOM   4773  C   ILE A 585      39.603  48.687  10.459  1.00  0.95           C  
ATOM   4774  O   ILE A 585      40.374  49.645  10.404  1.00  0.95           O  
ATOM   4775  CB  ILE A 585      39.995  46.635   9.048  1.00  0.95           C  
ATOM   4776  CG1 ILE A 585      40.615  45.216   9.024  1.00  0.95           C  
ATOM   4777  CG2 ILE A 585      40.689  47.539   8.006  1.00  0.95           C  
ATOM   4778  CD1 ILE A 585      40.308  44.432   7.742  1.00  0.95           C  
ATOM   4779  N   THR A 586      38.274  48.873  10.629  1.00  0.94           N  
ATOM   4780  CA  THR A 586      37.636  50.185  10.770  1.00  0.94           C  
ATOM   4781  C   THR A 586      38.192  50.973  11.939  1.00  0.94           C  
ATOM   4782  O   THR A 586      38.489  52.162  11.837  1.00  0.94           O  
ATOM   4783  CB  THR A 586      36.124  50.081  10.961  1.00  0.94           C  
ATOM   4784  OG1 THR A 586      35.563  49.395   9.858  1.00  0.94           O  
ATOM   4785  CG2 THR A 586      35.429  51.447  11.031  1.00  0.94           C  
ATOM   4786  N   LEU A 587      38.390  50.308  13.096  1.00  0.93           N  
ATOM   4787  CA  LEU A 587      38.999  50.887  14.276  1.00  0.93           C  
ATOM   4788  C   LEU A 587      40.459  51.276  14.079  1.00  0.93           C  
ATOM   4789  O   LEU A 587      40.870  52.371  14.452  1.00  0.93           O  
ATOM   4790  CB  LEU A 587      38.811  49.927  15.475  1.00  0.93           C  
ATOM   4791  CG  LEU A 587      39.127  50.511  16.869  1.00  0.93           C  
ATOM   4792  CD1 LEU A 587      38.341  51.805  17.140  1.00  0.93           C  
ATOM   4793  CD2 LEU A 587      38.810  49.469  17.956  1.00  0.93           C  
ATOM   4794  N   TYR A 588      41.259  50.416  13.408  1.00  0.94           N  
ATOM   4795  CA  TYR A 588      42.633  50.693  13.014  1.00  0.94           C  
ATOM   4796  C   TYR A 588      42.732  51.921  12.116  1.00  0.94           C  
ATOM   4797  O   TYR A 588      43.542  52.820  12.346  1.00  0.94           O  
ATOM   4798  CB  TYR A 588      43.194  49.420  12.299  1.00  0.94           C  
ATOM   4799  CG  TYR A 588      44.527  49.598  11.619  1.00  0.94           C  
ATOM   4800  CD1 TYR A 588      45.709  49.650  12.372  1.00  0.94           C  
ATOM   4801  CD2 TYR A 588      44.607  49.733  10.220  1.00  0.94           C  
ATOM   4802  CE1 TYR A 588      46.946  49.853  11.742  1.00  0.94           C  
ATOM   4803  CE2 TYR A 588      45.841  49.928   9.591  1.00  0.94           C  
ATOM   4804  CZ  TYR A 588      46.999  49.975  10.360  1.00  0.94           C  
ATOM   4805  OH  TYR A 588      48.245  50.133   9.722  1.00  0.94           O  
ATOM   4806  N   ASN A 589      41.858  52.020  11.094  1.00  0.92           N  
ATOM   4807  CA  ASN A 589      41.797  53.186  10.235  1.00  0.92           C  
ATOM   4808  C   ASN A 589      41.401  54.455  10.982  1.00  0.92           C  
ATOM   4809  O   ASN A 589      41.986  55.510  10.755  1.00  0.92           O  
ATOM   4810  CB  ASN A 589      40.858  52.961   9.023  1.00  0.92           C  
ATOM   4811  CG  ASN A 589      41.306  51.815   8.113  1.00  0.92           C  
ATOM   4812  OD1 ASN A 589      40.479  51.107   7.549  1.00  0.92           O  
ATOM   4813  ND2 ASN A 589      42.634  51.644   7.913  1.00  0.92           N  
ATOM   4814  N   ARG A 590      40.434  54.372  11.919  1.00  0.86           N  
ATOM   4815  CA  ARG A 590      40.032  55.482  12.769  1.00  0.86           C  
ATOM   4816  C   ARG A 590      41.153  56.017  13.667  1.00  0.86           C  
ATOM   4817  O   ARG A 590      41.358  57.227  13.744  1.00  0.86           O  
ATOM   4818  CB  ARG A 590      38.776  55.104  13.617  1.00  0.86           C  
ATOM   4819  CG  ARG A 590      37.460  55.767  13.142  1.00  0.86           C  
ATOM   4820  CD  ARG A 590      36.394  54.852  12.505  1.00  0.86           C  
ATOM   4821  NE  ARG A 590      35.639  54.179  13.601  1.00  0.86           N  
ATOM   4822  CZ  ARG A 590      34.314  54.274  13.736  1.00  0.86           C  
ATOM   4823  NH1 ARG A 590      33.472  54.596  12.763  1.00  0.86           N  
ATOM   4824  NH2 ARG A 590      33.819  54.058  14.948  1.00  0.86           N  
ATOM   4825  N   ILE A 591      41.938  55.128  14.321  1.00  0.88           N  
ATOM   4826  CA  ILE A 591      43.080  55.496  15.161  1.00  0.88           C  
ATOM   4827  C   ILE A 591      44.170  56.212  14.377  1.00  0.88           C  
ATOM   4828  O   ILE A 591      44.747  57.200  14.827  1.00  0.88           O  
ATOM   4829  CB  ILE A 591      43.656  54.279  15.899  1.00  0.88           C  
ATOM   4830  CG1 ILE A 591      42.610  53.711  16.892  1.00  0.88           C  
ATOM   4831  CG2 ILE A 591      44.961  54.651  16.648  1.00  0.88           C  
ATOM   4832  CD1 ILE A 591      43.014  52.377  17.535  1.00  0.88           C  
ATOM   4833  N   LYS A 592      44.462  55.730  13.153  1.00  0.85           N  
ATOM   4834  CA  LYS A 592      45.364  56.385  12.230  1.00  0.85           C  
ATOM   4835  C   LYS A 592      44.893  57.748  11.748  1.00  0.85           C  
ATOM   4836  O   LYS A 592      45.692  58.667  11.611  1.00  0.85           O  
ATOM   4837  CB  LYS A 592      45.629  55.471  11.012  1.00  0.85           C  
ATOM   4838  CG  LYS A 592      46.768  54.473  11.253  1.00  0.85           C  
ATOM   4839  CD  LYS A 592      47.185  53.777   9.951  1.00  0.85           C  
ATOM   4840  CE  LYS A 592      48.574  53.141   9.998  1.00  0.85           C  
ATOM   4841  NZ  LYS A 592      49.664  54.114  10.228  1.00  0.85           N  
ATOM   4842  N   ARG A 593      43.585  57.895  11.452  1.00  0.81           N  
ATOM   4843  CA  ARG A 593      43.006  59.117  10.927  1.00  0.81           C  
ATOM   4844  C   ARG A 593      43.072  60.298  11.886  1.00  0.81           C  
ATOM   4845  O   ARG A 593      43.424  61.414  11.509  1.00  0.81           O  
ATOM   4846  CB  ARG A 593      41.518  58.861  10.568  1.00  0.81           C  
ATOM   4847  CG  ARG A 593      41.023  59.571   9.293  1.00  0.81           C  
ATOM   4848  CD  ARG A 593      39.492  59.703   9.171  1.00  0.81           C  
ATOM   4849  NE  ARG A 593      38.793  58.454   9.639  1.00  0.81           N  
ATOM   4850  CZ  ARG A 593      38.711  57.286   8.988  1.00  0.81           C  
ATOM   4851  NH1 ARG A 593      39.367  57.045   7.859  1.00  0.81           N  
ATOM   4852  NH2 ARG A 593      37.945  56.324   9.474  1.00  0.81           N  
ATOM   4853  N   GLU A 594      42.732  60.051  13.166  1.00  0.78           N  
ATOM   4854  CA  GLU A 594      42.696  61.052  14.210  1.00  0.78           C  
ATOM   4855  C   GLU A 594      43.744  60.713  15.280  1.00  0.78           C  
ATOM   4856  O   GLU A 594      43.353  60.296  16.374  1.00  0.78           O  
ATOM   4857  CB  GLU A 594      41.285  61.121  14.887  1.00  0.78           C  
ATOM   4858  CG  GLU A 594      40.063  61.368  13.950  1.00  0.78           C  
ATOM   4859  CD  GLU A 594      38.724  61.397  14.676  1.00  0.78           C  
ATOM   4860  OE1 GLU A 594      38.269  62.458  15.184  1.00  0.78           O  
ATOM   4861  OE2 GLU A 594      38.091  60.307  14.776  1.00  0.78           O  
ATOM   4862  N   PRO A 595      45.073  60.844  15.106  1.00  0.79           N  
ATOM   4863  CA  PRO A 595      46.052  60.298  16.047  1.00  0.79           C  
ATOM   4864  C   PRO A 595      45.985  60.963  17.400  1.00  0.79           C  
ATOM   4865  O   PRO A 595      46.302  60.322  18.398  1.00  0.79           O  
ATOM   4866  CB  PRO A 595      47.414  60.516  15.366  1.00  0.79           C  
ATOM   4867  CG  PRO A 595      47.167  61.681  14.402  1.00  0.79           C  
ATOM   4868  CD  PRO A 595      45.731  61.424  13.934  1.00  0.79           C  
ATOM   4869  N   ASN A 596      45.542  62.232  17.429  1.00  0.68           N  
ATOM   4870  CA  ASN A 596      45.397  63.052  18.607  1.00  0.68           C  
ATOM   4871  C   ASN A 596      44.010  62.929  19.229  1.00  0.68           C  
ATOM   4872  O   ASN A 596      43.547  63.826  19.923  1.00  0.68           O  
ATOM   4873  CB  ASN A 596      45.683  64.529  18.236  1.00  0.68           C  
ATOM   4874  CG  ASN A 596      47.189  64.725  18.155  1.00  0.68           C  
ATOM   4875  OD1 ASN A 596      47.904  64.636  19.148  1.00  0.68           O  
ATOM   4876  ND2 ASN A 596      47.705  65.009  16.938  1.00  0.68           N  
ATOM   4877  N   LYS A 597      43.312  61.797  19.014  1.00  0.77           N  
ATOM   4878  CA  LYS A 597      42.053  61.519  19.664  1.00  0.77           C  
ATOM   4879  C   LYS A 597      42.205  60.352  20.618  1.00  0.77           C  
ATOM   4880  O   LYS A 597      42.939  59.390  20.382  1.00  0.77           O  
ATOM   4881  CB  LYS A 597      40.978  61.187  18.619  1.00  0.77           C  
ATOM   4882  CG  LYS A 597      39.550  60.952  19.143  1.00  0.77           C  
ATOM   4883  CD  LYS A 597      38.660  60.819  17.909  1.00  0.77           C  
ATOM   4884  CE  LYS A 597      37.143  60.864  18.071  1.00  0.77           C  
ATOM   4885  NZ  LYS A 597      36.547  60.919  16.728  1.00  0.77           N  
ATOM   4886  N   PHE A 598      41.513  60.437  21.774  1.00  0.84           N  
ATOM   4887  CA  PHE A 598      41.462  59.360  22.733  1.00  0.84           C  
ATOM   4888  C   PHE A 598      40.595  58.196  22.267  1.00  0.84           C  
ATOM   4889  O   PHE A 598      39.395  58.321  22.027  1.00  0.84           O  
ATOM   4890  CB  PHE A 598      40.976  59.851  24.123  1.00  0.84           C  
ATOM   4891  CG  PHE A 598      41.141  58.761  25.157  1.00  0.84           C  
ATOM   4892  CD1 PHE A 598      42.414  58.457  25.661  1.00  0.84           C  
ATOM   4893  CD2 PHE A 598      40.048  57.969  25.551  1.00  0.84           C  
ATOM   4894  CE1 PHE A 598      42.598  57.373  26.528  1.00  0.84           C  
ATOM   4895  CE2 PHE A 598      40.228  56.882  26.416  1.00  0.84           C  
ATOM   4896  CZ  PHE A 598      41.507  56.579  26.898  1.00  0.84           C  
ATOM   4897  N   PHE A 599      41.221  57.011  22.211  1.00  0.88           N  
ATOM   4898  CA  PHE A 599      40.574  55.769  21.886  1.00  0.88           C  
ATOM   4899  C   PHE A 599      40.773  54.840  23.057  1.00  0.88           C  
ATOM   4900  O   PHE A 599      41.848  54.780  23.647  1.00  0.88           O  
ATOM   4901  CB  PHE A 599      41.190  55.100  20.634  1.00  0.88           C  
ATOM   4902  CG  PHE A 599      40.888  55.908  19.405  1.00  0.88           C  
ATOM   4903  CD1 PHE A 599      39.669  55.724  18.734  1.00  0.88           C  
ATOM   4904  CD2 PHE A 599      41.810  56.833  18.886  1.00  0.88           C  
ATOM   4905  CE1 PHE A 599      39.362  56.468  17.589  1.00  0.88           C  
ATOM   4906  CE2 PHE A 599      41.494  57.598  17.758  1.00  0.88           C  
ATOM   4907  CZ  PHE A 599      40.268  57.420  17.112  1.00  0.88           C  
ATOM   4908  N   VAL A 600      39.717  54.100  23.436  1.00  0.93           N  
ATOM   4909  CA  VAL A 600      39.778  53.122  24.506  1.00  0.93           C  
ATOM   4910  C   VAL A 600      40.706  51.973  24.118  1.00  0.93           C  
ATOM   4911  O   VAL A 600      40.433  51.342  23.094  1.00  0.93           O  
ATOM   4912  CB  VAL A 600      38.380  52.606  24.830  1.00  0.93           C  
ATOM   4913  CG1 VAL A 600      38.416  51.391  25.780  1.00  0.93           C  
ATOM   4914  CG2 VAL A 600      37.581  53.762  25.461  1.00  0.93           C  
ATOM   4915  N   PRO A 601      41.800  51.670  24.834  1.00  0.95           N  
ATOM   4916  CA  PRO A 601      42.694  50.571  24.497  1.00  0.95           C  
ATOM   4917  C   PRO A 601      41.978  49.240  24.424  1.00  0.95           C  
ATOM   4918  O   PRO A 601      41.229  48.901  25.341  1.00  0.95           O  
ATOM   4919  CB  PRO A 601      43.791  50.616  25.573  1.00  0.95           C  
ATOM   4920  CG  PRO A 601      43.114  51.294  26.765  1.00  0.95           C  
ATOM   4921  CD  PRO A 601      42.199  52.314  26.088  1.00  0.95           C  
ATOM   4922  N   ARG A 602      42.177  48.473  23.340  1.00  0.90           N  
ATOM   4923  CA  ARG A 602      41.432  47.253  23.129  1.00  0.90           C  
ATOM   4924  C   ARG A 602      42.294  46.123  22.584  1.00  0.90           C  
ATOM   4925  O   ARG A 602      43.052  46.273  21.632  1.00  0.90           O  
ATOM   4926  CB  ARG A 602      40.252  47.539  22.174  1.00  0.90           C  
ATOM   4927  CG  ARG A 602      39.196  46.423  22.146  1.00  0.90           C  
ATOM   4928  CD  ARG A 602      38.111  46.592  21.079  1.00  0.90           C  
ATOM   4929  NE  ARG A 602      37.061  47.555  21.553  1.00  0.90           N  
ATOM   4930  CZ  ARG A 602      35.755  47.369  21.298  1.00  0.90           C  
ATOM   4931  NH1 ARG A 602      35.295  46.278  20.707  1.00  0.90           N  
ATOM   4932  NH2 ARG A 602      34.875  48.321  21.607  1.00  0.90           N  
ATOM   4933  N   THR A 603      42.171  44.925  23.183  1.00  0.95           N  
ATOM   4934  CA  THR A 603      42.831  43.720  22.697  1.00  0.95           C  
ATOM   4935  C   THR A 603      41.754  42.844  22.118  1.00  0.95           C  
ATOM   4936  O   THR A 603      40.911  42.324  22.843  1.00  0.95           O  
ATOM   4937  CB  THR A 603      43.540  42.904  23.770  1.00  0.95           C  
ATOM   4938  OG1 THR A 603      44.583  43.656  24.371  1.00  0.95           O  
ATOM   4939  CG2 THR A 603      44.234  41.679  23.154  1.00  0.95           C  
ATOM   4940  N   VAL A 604      41.751  42.663  20.787  1.00  0.97           N  
ATOM   4941  CA  VAL A 604      40.771  41.854  20.089  1.00  0.97           C  
ATOM   4942  C   VAL A 604      41.346  40.474  19.866  1.00  0.97           C  
ATOM   4943  O   VAL A 604      42.394  40.298  19.241  1.00  0.97           O  
ATOM   4944  CB  VAL A 604      40.344  42.445  18.752  1.00  0.97           C  
ATOM   4945  CG1 VAL A 604      39.294  41.530  18.081  1.00  0.97           C  
ATOM   4946  CG2 VAL A 604      39.741  43.843  18.993  1.00  0.97           C  
ATOM   4947  N   MET A 605      40.675  39.446  20.398  1.00  0.93           N  
ATOM   4948  CA  MET A 605      41.120  38.083  20.308  1.00  0.93           C  
ATOM   4949  C   MET A 605      40.072  37.250  19.614  1.00  0.93           C  
ATOM   4950  O   MET A 605      38.923  37.152  20.045  1.00  0.93           O  
ATOM   4951  CB  MET A 605      41.406  37.465  21.690  1.00  0.93           C  
ATOM   4952  CG  MET A 605      42.432  38.249  22.519  1.00  0.93           C  
ATOM   4953  SD  MET A 605      42.771  37.453  24.099  1.00  0.93           S  
ATOM   4954  CE  MET A 605      42.600  38.929  25.127  1.00  0.93           C  
ATOM   4955  N   ILE A 606      40.459  36.607  18.506  1.00  0.96           N  
ATOM   4956  CA  ILE A 606      39.572  35.750  17.744  1.00  0.96           C  
ATOM   4957  C   ILE A 606      40.186  34.371  17.776  1.00  0.96           C  
ATOM   4958  O   ILE A 606      41.371  34.201  17.517  1.00  0.96           O  
ATOM   4959  CB  ILE A 606      39.370  36.249  16.315  1.00  0.96           C  
ATOM   4960  CG1 ILE A 606      38.751  37.670  16.353  1.00  0.96           C  
ATOM   4961  CG2 ILE A 606      38.487  35.263  15.513  1.00  0.96           C  
ATOM   4962  CD1 ILE A 606      38.595  38.333  14.980  1.00  0.96           C  
ATOM   4963  N   GLY A 607      39.426  33.328  18.148  1.00  0.98           N  
ATOM   4964  CA  GLY A 607      39.996  31.989  18.240  1.00  0.98           C  
ATOM   4965  C   GLY A 607      39.015  30.920  17.882  1.00  0.98           C  
ATOM   4966  O   GLY A 607      37.835  30.985  18.205  1.00  0.98           O  
ATOM   4967  N   GLY A 608      39.488  29.857  17.211  1.00  0.98           N  
ATOM   4968  CA  GLY A 608      38.567  28.842  16.739  1.00  0.98           C  
ATOM   4969  C   GLY A 608      39.168  27.957  15.697  1.00  0.98           C  
ATOM   4970  O   GLY A 608      40.122  28.298  15.013  1.00  0.98           O  
ATOM   4971  N   LYS A 609      38.594  26.760  15.529  1.00  0.93           N  
ATOM   4972  CA  LYS A 609      39.027  25.833  14.506  1.00  0.93           C  
ATOM   4973  C   LYS A 609      38.107  25.859  13.302  1.00  0.93           C  
ATOM   4974  O   LYS A 609      36.891  26.044  13.413  1.00  0.93           O  
ATOM   4975  CB  LYS A 609      39.137  24.399  15.069  1.00  0.93           C  
ATOM   4976  CG  LYS A 609      40.280  24.278  16.083  1.00  0.93           C  
ATOM   4977  CD  LYS A 609      40.302  22.940  16.835  1.00  0.93           C  
ATOM   4978  CE  LYS A 609      41.444  22.927  17.847  1.00  0.93           C  
ATOM   4979  NZ  LYS A 609      41.504  21.680  18.633  1.00  0.93           N  
ATOM   4980  N   ALA A 610      38.685  25.655  12.109  1.00  0.94           N  
ATOM   4981  CA  ALA A 610      37.976  25.520  10.862  1.00  0.94           C  
ATOM   4982  C   ALA A 610      38.015  24.060  10.462  1.00  0.94           C  
ATOM   4983  O   ALA A 610      38.975  23.349  10.748  1.00  0.94           O  
ATOM   4984  CB  ALA A 610      38.679  26.363   9.784  1.00  0.94           C  
ATOM   4985  N   ALA A 611      36.955  23.527   9.821  1.00  0.90           N  
ATOM   4986  CA  ALA A 611      37.027  22.180   9.284  1.00  0.90           C  
ATOM   4987  C   ALA A 611      38.072  22.090   8.156  1.00  0.90           C  
ATOM   4988  O   ALA A 611      38.189  23.068   7.415  1.00  0.90           O  
ATOM   4989  CB  ALA A 611      35.636  21.689   8.834  1.00  0.90           C  
ATOM   4990  N   PRO A 612      38.852  21.018   7.958  1.00  0.88           N  
ATOM   4991  CA  PRO A 612      39.952  20.997   7.001  1.00  0.88           C  
ATOM   4992  C   PRO A 612      39.551  21.322   5.580  1.00  0.88           C  
ATOM   4993  O   PRO A 612      40.322  21.982   4.887  1.00  0.88           O  
ATOM   4994  CB  PRO A 612      40.553  19.595   7.142  1.00  0.88           C  
ATOM   4995  CG  PRO A 612      40.366  19.312   8.631  1.00  0.88           C  
ATOM   4996  CD  PRO A 612      38.991  19.924   8.911  1.00  0.88           C  
ATOM   4997  N   GLY A 613      38.351  20.879   5.142  1.00  0.84           N  
ATOM   4998  CA  GLY A 613      37.810  21.190   3.821  1.00  0.84           C  
ATOM   4999  C   GLY A 613      37.104  22.522   3.691  1.00  0.84           C  
ATOM   5000  O   GLY A 613      36.689  22.905   2.602  1.00  0.84           O  
ATOM   5001  N   TYR A 614      36.933  23.287   4.787  1.00  0.89           N  
ATOM   5002  CA  TYR A 614      36.199  24.539   4.770  1.00  0.89           C  
ATOM   5003  C   TYR A 614      37.149  25.671   4.429  1.00  0.89           C  
ATOM   5004  O   TYR A 614      37.703  26.351   5.293  1.00  0.89           O  
ATOM   5005  CB  TYR A 614      35.524  24.757   6.152  1.00  0.89           C  
ATOM   5006  CG  TYR A 614      34.440  25.814   6.260  1.00  0.89           C  
ATOM   5007  CD1 TYR A 614      34.004  26.671   5.226  1.00  0.89           C  
ATOM   5008  CD2 TYR A 614      33.808  25.916   7.509  1.00  0.89           C  
ATOM   5009  CE1 TYR A 614      32.951  27.583   5.446  1.00  0.89           C  
ATOM   5010  CE2 TYR A 614      32.760  26.815   7.725  1.00  0.89           C  
ATOM   5011  CZ  TYR A 614      32.318  27.645   6.697  1.00  0.89           C  
ATOM   5012  OH  TYR A 614      31.226  28.509   6.954  1.00  0.89           O  
ATOM   5013  N   HIS A 615      37.330  25.906   3.114  1.00  0.89           N  
ATOM   5014  CA  HIS A 615      38.257  26.884   2.576  1.00  0.89           C  
ATOM   5015  C   HIS A 615      38.025  28.294   3.090  1.00  0.89           C  
ATOM   5016  O   HIS A 615      38.946  28.946   3.565  1.00  0.89           O  
ATOM   5017  CB  HIS A 615      38.170  26.878   1.031  1.00  0.89           C  
ATOM   5018  CG  HIS A 615      39.008  27.915   0.358  1.00  0.89           C  
ATOM   5019  ND1 HIS A 615      40.369  27.919   0.570  1.00  0.89           N  
ATOM   5020  CD2 HIS A 615      38.644  28.949  -0.443  1.00  0.89           C  
ATOM   5021  CE1 HIS A 615      40.811  28.962  -0.112  1.00  0.89           C  
ATOM   5022  NE2 HIS A 615      39.808  29.617  -0.742  1.00  0.89           N  
ATOM   5023  N   MET A 616      36.764  28.781   3.096  1.00  0.92           N  
ATOM   5024  CA  MET A 616      36.466  30.123   3.558  1.00  0.92           C  
ATOM   5025  C   MET A 616      36.833  30.353   5.015  1.00  0.92           C  
ATOM   5026  O   MET A 616      37.460  31.348   5.363  1.00  0.92           O  
ATOM   5027  CB  MET A 616      34.979  30.453   3.316  1.00  0.92           C  
ATOM   5028  CG  MET A 616      34.606  31.925   3.584  1.00  0.92           C  
ATOM   5029  SD  MET A 616      35.595  33.150   2.674  1.00  0.92           S  
ATOM   5030  CE  MET A 616      34.890  32.784   1.046  1.00  0.92           C  
ATOM   5031  N   ALA A 617      36.537  29.388   5.903  1.00  0.96           N  
ATOM   5032  CA  ALA A 617      36.938  29.443   7.287  1.00  0.96           C  
ATOM   5033  C   ALA A 617      38.451  29.473   7.498  1.00  0.96           C  
ATOM   5034  O   ALA A 617      38.954  30.222   8.335  1.00  0.96           O  
ATOM   5035  CB  ALA A 617      36.291  28.266   8.024  1.00  0.96           C  
ATOM   5036  N   LYS A 618      39.235  28.706   6.708  1.00  0.91           N  
ATOM   5037  CA  LYS A 618      40.685  28.825   6.702  1.00  0.91           C  
ATOM   5038  C   LYS A 618      41.179  30.193   6.258  1.00  0.91           C  
ATOM   5039  O   LYS A 618      42.087  30.761   6.863  1.00  0.91           O  
ATOM   5040  CB  LYS A 618      41.362  27.740   5.831  1.00  0.91           C  
ATOM   5041  CG  LYS A 618      41.206  26.334   6.423  1.00  0.91           C  
ATOM   5042  CD  LYS A 618      42.208  25.306   5.868  1.00  0.91           C  
ATOM   5043  CE  LYS A 618      42.292  24.093   6.797  1.00  0.91           C  
ATOM   5044  NZ  LYS A 618      43.358  23.153   6.425  1.00  0.91           N  
ATOM   5045  N   MET A 619      40.555  30.781   5.215  1.00  0.93           N  
ATOM   5046  CA  MET A 619      40.849  32.132   4.778  1.00  0.93           C  
ATOM   5047  C   MET A 619      40.567  33.173   5.855  1.00  0.93           C  
ATOM   5048  O   MET A 619      41.343  34.103   6.049  1.00  0.93           O  
ATOM   5049  CB  MET A 619      40.098  32.500   3.472  1.00  0.93           C  
ATOM   5050  CG  MET A 619      40.466  31.637   2.245  1.00  0.93           C  
ATOM   5051  SD  MET A 619      42.245  31.447   1.918  1.00  0.93           S  
ATOM   5052  CE  MET A 619      42.596  33.192   1.593  1.00  0.93           C  
ATOM   5053  N   ILE A 620      39.465  33.016   6.617  1.00  0.96           N  
ATOM   5054  CA  ILE A 620      39.125  33.859   7.759  1.00  0.96           C  
ATOM   5055  C   ILE A 620      40.171  33.800   8.872  1.00  0.96           C  
ATOM   5056  O   ILE A 620      40.581  34.834   9.395  1.00  0.96           O  
ATOM   5057  CB  ILE A 620      37.734  33.530   8.303  1.00  0.96           C  
ATOM   5058  CG1 ILE A 620      36.647  33.811   7.238  1.00  0.96           C  
ATOM   5059  CG2 ILE A 620      37.435  34.362   9.571  1.00  0.96           C  
ATOM   5060  CD1 ILE A 620      35.254  33.265   7.591  1.00  0.96           C  
ATOM   5061  N   ILE A 621      40.691  32.600   9.225  1.00  0.96           N  
ATOM   5062  CA  ILE A 621      41.798  32.447  10.174  1.00  0.96           C  
ATOM   5063  C   ILE A 621      43.044  33.176   9.696  1.00  0.96           C  
ATOM   5064  O   ILE A 621      43.704  33.899  10.445  1.00  0.96           O  
ATOM   5065  CB  ILE A 621      42.138  30.971  10.410  1.00  0.96           C  
ATOM   5066  CG1 ILE A 621      40.958  30.283  11.132  1.00  0.96           C  
ATOM   5067  CG2 ILE A 621      43.451  30.823  11.224  1.00  0.96           C  
ATOM   5068  CD1 ILE A 621      41.108  28.763  11.261  1.00  0.96           C  
ATOM   5069  N   ARG A 622      43.356  33.039   8.392  1.00  0.90           N  
ATOM   5070  CA  ARG A 622      44.460  33.726   7.759  1.00  0.90           C  
ATOM   5071  C   ARG A 622      44.332  35.241   7.765  1.00  0.90           C  
ATOM   5072  O   ARG A 622      45.319  35.968   7.898  1.00  0.90           O  
ATOM   5073  CB  ARG A 622      44.683  33.205   6.317  1.00  0.90           C  
ATOM   5074  CG  ARG A 622      45.955  33.758   5.638  1.00  0.90           C  
ATOM   5075  CD  ARG A 622      47.228  33.419   6.419  1.00  0.90           C  
ATOM   5076  NE  ARG A 622      48.386  34.117   5.790  1.00  0.90           N  
ATOM   5077  CZ  ARG A 622      48.967  35.206   6.316  1.00  0.90           C  
ATOM   5078  NH1 ARG A 622      48.463  35.850   7.366  1.00  0.90           N  
ATOM   5079  NH2 ARG A 622      50.100  35.662   5.785  1.00  0.90           N  
ATOM   5080  N   LEU A 623      43.099  35.753   7.628  1.00  0.94           N  
ATOM   5081  CA  LEU A 623      42.775  37.156   7.735  1.00  0.94           C  
ATOM   5082  C   LEU A 623      43.077  37.736   9.120  1.00  0.94           C  
ATOM   5083  O   LEU A 623      43.670  38.798   9.242  1.00  0.94           O  
ATOM   5084  CB  LEU A 623      41.284  37.368   7.361  1.00  0.94           C  
ATOM   5085  CG  LEU A 623      40.922  38.678   6.618  1.00  0.94           C  
ATOM   5086  CD1 LEU A 623      39.503  39.125   6.999  1.00  0.94           C  
ATOM   5087  CD2 LEU A 623      41.906  39.834   6.832  1.00  0.94           C  
ATOM   5088  N   VAL A 624      42.725  37.020  10.216  1.00  0.95           N  
ATOM   5089  CA  VAL A 624      42.982  37.492  11.579  1.00  0.95           C  
ATOM   5090  C   VAL A 624      44.461  37.688  11.859  1.00  0.95           C  
ATOM   5091  O   VAL A 624      44.885  38.712  12.396  1.00  0.95           O  
ATOM   5092  CB  VAL A 624      42.425  36.543  12.641  1.00  0.95           C  
ATOM   5093  CG1 VAL A 624      42.678  37.089  14.066  1.00  0.95           C  
ATOM   5094  CG2 VAL A 624      40.908  36.381  12.446  1.00  0.95           C  
ATOM   5095  N   THR A 625      45.297  36.717  11.447  1.00  0.93           N  
ATOM   5096  CA  THR A 625      46.744  36.806  11.567  1.00  0.93           C  
ATOM   5097  C   THR A 625      47.328  37.917  10.718  1.00  0.93           C  
ATOM   5098  O   THR A 625      48.126  38.708  11.200  1.00  0.93           O  
ATOM   5099  CB  THR A 625      47.435  35.481  11.268  1.00  0.93           C  
ATOM   5100  OG1 THR A 625      47.013  34.918  10.030  1.00  0.93           O  
ATOM   5101  CG2 THR A 625      47.060  34.469  12.361  1.00  0.93           C  
ATOM   5102  N   ALA A 626      46.868  38.064   9.460  1.00  0.94           N  
ATOM   5103  CA  ALA A 626      47.281  39.118   8.557  1.00  0.94           C  
ATOM   5104  C   ALA A 626      46.971  40.531   9.037  1.00  0.94           C  
ATOM   5105  O   ALA A 626      47.780  41.447   8.907  1.00  0.94           O  
ATOM   5106  CB  ALA A 626      46.598  38.874   7.205  1.00  0.94           C  
ATOM   5107  N   ILE A 627      45.783  40.743   9.643  1.00  0.95           N  
ATOM   5108  CA  ILE A 627      45.466  41.984  10.333  1.00  0.95           C  
ATOM   5109  C   ILE A 627      46.395  42.199  11.513  1.00  0.95           C  
ATOM   5110  O   ILE A 627      46.942  43.284  11.684  1.00  0.95           O  
ATOM   5111  CB  ILE A 627      44.011  42.019  10.791  1.00  0.95           C  
ATOM   5112  CG1 ILE A 627      43.056  42.013   9.579  1.00  0.95           C  
ATOM   5113  CG2 ILE A 627      43.732  43.266  11.660  1.00  0.95           C  
ATOM   5114  CD1 ILE A 627      41.601  41.734   9.980  1.00  0.95           C  
ATOM   5115  N   GLY A 628      46.635  41.146  12.329  1.00  0.92           N  
ATOM   5116  CA  GLY A 628      47.618  41.134  13.409  1.00  0.92           C  
ATOM   5117  C   GLY A 628      48.980  41.632  13.030  1.00  0.92           C  
ATOM   5118  O   GLY A 628      49.478  42.571  13.640  1.00  0.92           O  
ATOM   5119  N   ASP A 629      49.580  41.048  11.977  1.00  0.89           N  
ATOM   5120  CA  ASP A 629      50.894  41.380  11.463  1.00  0.89           C  
ATOM   5121  C   ASP A 629      51.032  42.872  11.115  1.00  0.89           C  
ATOM   5122  O   ASP A 629      52.072  43.493  11.311  1.00  0.89           O  
ATOM   5123  CB  ASP A 629      51.211  40.494  10.215  1.00  0.89           C  
ATOM   5124  CG  ASP A 629      51.191  38.993  10.504  1.00  0.89           C  
ATOM   5125  OD1 ASP A 629      51.435  38.598  11.673  1.00  0.89           O  
ATOM   5126  OD2 ASP A 629      50.944  38.217   9.535  1.00  0.89           O  
ATOM   5127  N   VAL A 630      49.955  43.503  10.600  1.00  0.92           N  
ATOM   5128  CA  VAL A 630      49.938  44.935  10.337  1.00  0.92           C  
ATOM   5129  C   VAL A 630      49.647  45.788  11.576  1.00  0.92           C  
ATOM   5130  O   VAL A 630      50.361  46.733  11.886  1.00  0.92           O  
ATOM   5131  CB  VAL A 630      48.917  45.254   9.249  1.00  0.92           C  
ATOM   5132  CG1 VAL A 630      48.726  46.776   9.062  1.00  0.92           C  
ATOM   5133  CG2 VAL A 630      49.393  44.634   7.919  1.00  0.92           C  
ATOM   5134  N   VAL A 631      48.566  45.476  12.327  1.00  0.91           N  
ATOM   5135  CA  VAL A 631      48.114  46.262  13.471  1.00  0.91           C  
ATOM   5136  C   VAL A 631      49.063  46.237  14.648  1.00  0.91           C  
ATOM   5137  O   VAL A 631      49.320  47.259  15.288  1.00  0.91           O  
ATOM   5138  CB  VAL A 631      46.732  45.820  13.945  1.00  0.91           C  
ATOM   5139  CG1 VAL A 631      46.278  46.631  15.179  1.00  0.91           C  
ATOM   5140  CG2 VAL A 631      45.713  46.037  12.810  1.00  0.91           C  
ATOM   5141  N   ASN A 632      49.635  45.067  14.980  1.00  0.87           N  
ATOM   5142  CA  ASN A 632      50.391  44.894  16.204  1.00  0.87           C  
ATOM   5143  C   ASN A 632      51.751  45.570  16.149  1.00  0.87           C  
ATOM   5144  O   ASN A 632      52.394  45.782  17.176  1.00  0.87           O  
ATOM   5145  CB  ASN A 632      50.589  43.392  16.503  1.00  0.87           C  
ATOM   5146  CG  ASN A 632      49.236  42.737  16.747  1.00  0.87           C  
ATOM   5147  OD1 ASN A 632      48.235  43.365  17.097  1.00  0.87           O  
ATOM   5148  ND2 ASN A 632      49.197  41.395  16.602  1.00  0.87           N  
ATOM   5149  N   HIS A 633      52.196  45.933  14.935  1.00  0.86           N  
ATOM   5150  CA  HIS A 633      53.484  46.532  14.705  1.00  0.86           C  
ATOM   5151  C   HIS A 633      53.420  47.954  14.158  1.00  0.86           C  
ATOM   5152  O   HIS A 633      54.459  48.520  13.828  1.00  0.86           O  
ATOM   5153  CB  HIS A 633      54.284  45.637  13.735  1.00  0.86           C  
ATOM   5154  CG  HIS A 633      54.548  44.271  14.306  1.00  0.86           C  
ATOM   5155  ND1 HIS A 633      53.640  43.249  14.109  1.00  0.86           N  
ATOM   5156  CD2 HIS A 633      55.604  43.818  15.029  1.00  0.86           C  
ATOM   5157  CE1 HIS A 633      54.159  42.197  14.697  1.00  0.86           C  
ATOM   5158  NE2 HIS A 633      55.348  42.485  15.280  1.00  0.86           N  
ATOM   5159  N   ASP A 634      52.232  48.607  14.082  1.00  0.88           N  
ATOM   5160  CA  ASP A 634      52.157  49.998  13.664  1.00  0.88           C  
ATOM   5161  C   ASP A 634      52.442  50.932  14.860  1.00  0.88           C  
ATOM   5162  O   ASP A 634      51.780  50.848  15.902  1.00  0.88           O  
ATOM   5163  CB  ASP A 634      50.807  50.353  12.982  1.00  0.88           C  
ATOM   5164  CG  ASP A 634      50.814  51.750  12.383  1.00  0.88           C  
ATOM   5165  OD1 ASP A 634      50.642  52.721  13.161  1.00  0.88           O  
ATOM   5166  OD2 ASP A 634      50.989  51.923  11.149  1.00  0.88           O  
ATOM   5167  N   PRO A 635      53.406  51.846  14.773  1.00  0.89           N  
ATOM   5168  CA  PRO A 635      53.779  52.699  15.889  1.00  0.89           C  
ATOM   5169  C   PRO A 635      52.780  53.805  16.141  1.00  0.89           C  
ATOM   5170  O   PRO A 635      52.785  54.356  17.238  1.00  0.89           O  
ATOM   5171  CB  PRO A 635      55.147  53.265  15.472  1.00  0.89           C  
ATOM   5172  CG  PRO A 635      55.123  53.224  13.943  1.00  0.89           C  
ATOM   5173  CD  PRO A 635      54.358  51.938  13.670  1.00  0.89           C  
ATOM   5174  N   ALA A 636      51.917  54.171  15.175  1.00  0.89           N  
ATOM   5175  CA  ALA A 636      50.905  55.177  15.398  1.00  0.89           C  
ATOM   5176  C   ALA A 636      49.756  54.616  16.237  1.00  0.89           C  
ATOM   5177  O   ALA A 636      49.116  55.307  17.028  1.00  0.89           O  
ATOM   5178  CB  ALA A 636      50.435  55.747  14.042  1.00  0.89           C  
ATOM   5179  N   VAL A 637      49.498  53.302  16.095  1.00  0.89           N  
ATOM   5180  CA  VAL A 637      48.557  52.552  16.901  1.00  0.89           C  
ATOM   5181  C   VAL A 637      49.035  52.291  18.325  1.00  0.89           C  
ATOM   5182  O   VAL A 637      48.254  52.328  19.272  1.00  0.89           O  
ATOM   5183  CB  VAL A 637      48.188  51.258  16.205  1.00  0.89           C  
ATOM   5184  CG1 VAL A 637      47.158  50.463  17.026  1.00  0.89           C  
ATOM   5185  CG2 VAL A 637      47.577  51.608  14.835  1.00  0.89           C  
ATOM   5186  N   GLY A 638      50.343  52.027  18.542  1.00  0.87           N  
ATOM   5187  CA  GLY A 638      50.873  51.676  19.862  1.00  0.87           C  
ATOM   5188  C   GLY A 638      50.228  50.434  20.423  1.00  0.87           C  
ATOM   5189  O   GLY A 638      50.095  49.436  19.728  1.00  0.87           O  
ATOM   5190  N   ASP A 639      49.797  50.464  21.692  1.00  0.86           N  
ATOM   5191  CA  ASP A 639      49.091  49.389  22.366  1.00  0.86           C  
ATOM   5192  C   ASP A 639      47.618  49.747  22.550  1.00  0.86           C  
ATOM   5193  O   ASP A 639      46.871  49.082  23.269  1.00  0.86           O  
ATOM   5194  CB  ASP A 639      49.761  49.053  23.726  1.00  0.86           C  
ATOM   5195  CG  ASP A 639      50.260  50.322  24.394  1.00  0.86           C  
ATOM   5196  OD1 ASP A 639      49.468  51.297  24.469  1.00  0.86           O  
ATOM   5197  OD2 ASP A 639      51.461  50.347  24.747  1.00  0.86           O  
ATOM   5198  N   ARG A 640      47.143  50.785  21.822  1.00  0.87           N  
ATOM   5199  CA  ARG A 640      45.752  51.194  21.795  1.00  0.87           C  
ATOM   5200  C   ARG A 640      44.888  50.154  21.082  1.00  0.87           C  
ATOM   5201  O   ARG A 640      43.695  50.041  21.334  1.00  0.87           O  
ATOM   5202  CB  ARG A 640      45.562  52.577  21.097  1.00  0.87           C  
ATOM   5203  CG  ARG A 640      46.305  53.758  21.768  1.00  0.87           C  
ATOM   5204  CD  ARG A 640      46.890  54.827  20.819  1.00  0.87           C  
ATOM   5205  NE  ARG A 640      45.830  55.758  20.306  1.00  0.87           N  
ATOM   5206  CZ  ARG A 640      46.118  56.744  19.434  1.00  0.87           C  
ATOM   5207  NH1 ARG A 640      47.238  56.720  18.719  1.00  0.87           N  
ATOM   5208  NH2 ARG A 640      45.301  57.784  19.281  1.00  0.87           N  
ATOM   5209  N   LEU A 641      45.489  49.331  20.198  1.00  0.93           N  
ATOM   5210  CA  LEU A 641      44.816  48.203  19.593  1.00  0.93           C  
ATOM   5211  C   LEU A 641      45.789  47.039  19.439  1.00  0.93           C  
ATOM   5212  O   LEU A 641      46.960  47.203  19.092  1.00  0.93           O  
ATOM   5213  CB  LEU A 641      44.221  48.610  18.224  1.00  0.93           C  
ATOM   5214  CG  LEU A 641      43.393  47.561  17.453  1.00  0.93           C  
ATOM   5215  CD1 LEU A 641      42.150  47.099  18.224  1.00  0.93           C  
ATOM   5216  CD2 LEU A 641      42.958  48.164  16.107  1.00  0.93           C  
ATOM   5217  N   ARG A 642      45.329  45.808  19.715  1.00  0.88           N  
ATOM   5218  CA  ARG A 642      46.093  44.598  19.491  1.00  0.88           C  
ATOM   5219  C   ARG A 642      45.138  43.565  18.942  1.00  0.88           C  
ATOM   5220  O   ARG A 642      44.008  43.448  19.410  1.00  0.88           O  
ATOM   5221  CB  ARG A 642      46.754  44.046  20.793  1.00  0.88           C  
ATOM   5222  CG  ARG A 642      48.142  44.639  21.121  1.00  0.88           C  
ATOM   5223  CD  ARG A 642      49.223  44.186  20.132  1.00  0.88           C  
ATOM   5224  NE  ARG A 642      50.499  44.918  20.416  1.00  0.88           N  
ATOM   5225  CZ  ARG A 642      50.733  46.151  19.950  1.00  0.88           C  
ATOM   5226  NH1 ARG A 642      49.800  46.851  19.316  1.00  0.88           N  
ATOM   5227  NH2 ARG A 642      51.934  46.703  20.102  1.00  0.88           N  
ATOM   5228  N   VAL A 643      45.562  42.807  17.914  1.00  0.93           N  
ATOM   5229  CA  VAL A 643      44.730  41.797  17.279  1.00  0.93           C  
ATOM   5230  C   VAL A 643      45.454  40.472  17.339  1.00  0.93           C  
ATOM   5231  O   VAL A 643      46.555  40.314  16.811  1.00  0.93           O  
ATOM   5232  CB  VAL A 643      44.412  42.103  15.820  1.00  0.93           C  
ATOM   5233  CG1 VAL A 643      43.350  41.118  15.278  1.00  0.93           C  
ATOM   5234  CG2 VAL A 643      43.903  43.550  15.712  1.00  0.93           C  
ATOM   5235  N   ILE A 644      44.859  39.481  18.018  1.00  0.91           N  
ATOM   5236  CA  ILE A 644      45.486  38.194  18.249  1.00  0.91           C  
ATOM   5237  C   ILE A 644      44.579  37.083  17.756  1.00  0.91           C  
ATOM   5238  O   ILE A 644      43.377  37.071  18.003  1.00  0.91           O  
ATOM   5239  CB  ILE A 644      45.776  37.989  19.735  1.00  0.91           C  
ATOM   5240  CG1 ILE A 644      46.765  39.049  20.286  1.00  0.91           C  
ATOM   5241  CG2 ILE A 644      46.283  36.560  20.030  1.00  0.91           C  
ATOM   5242  CD1 ILE A 644      48.162  39.019  19.646  1.00  0.91           C  
ATOM   5243  N   PHE A 645      45.148  36.084  17.049  1.00  0.92           N  
ATOM   5244  CA  PHE A 645      44.448  34.843  16.790  1.00  0.92           C  
ATOM   5245  C   PHE A 645      44.810  33.870  17.905  1.00  0.92           C  
ATOM   5246  O   PHE A 645      45.985  33.610  18.154  1.00  0.92           O  
ATOM   5247  CB  PHE A 645      44.809  34.252  15.402  1.00  0.92           C  
ATOM   5248  CG  PHE A 645      43.958  33.045  15.101  1.00  0.92           C  
ATOM   5249  CD1 PHE A 645      42.616  33.199  14.724  1.00  0.92           C  
ATOM   5250  CD2 PHE A 645      44.474  31.749  15.263  1.00  0.92           C  
ATOM   5251  CE1 PHE A 645      41.796  32.082  14.528  1.00  0.92           C  
ATOM   5252  CE2 PHE A 645      43.663  30.628  15.054  1.00  0.92           C  
ATOM   5253  CZ  PHE A 645      42.324  30.799  14.692  1.00  0.92           C  
ATOM   5254  N   LEU A 646      43.816  33.321  18.626  1.00  0.92           N  
ATOM   5255  CA  LEU A 646      44.095  32.408  19.718  1.00  0.92           C  
ATOM   5256  C   LEU A 646      44.187  30.978  19.212  1.00  0.92           C  
ATOM   5257  O   LEU A 646      43.179  30.332  18.925  1.00  0.92           O  
ATOM   5258  CB  LEU A 646      43.047  32.475  20.857  1.00  0.92           C  
ATOM   5259  CG  LEU A 646      42.961  33.828  21.590  1.00  0.92           C  
ATOM   5260  CD1 LEU A 646      41.860  33.779  22.658  1.00  0.92           C  
ATOM   5261  CD2 LEU A 646      44.285  34.221  22.263  1.00  0.92           C  
ATOM   5262  N   GLU A 647      45.431  30.464  19.097  1.00  0.90           N  
ATOM   5263  CA  GLU A 647      45.736  29.123  18.632  1.00  0.90           C  
ATOM   5264  C   GLU A 647      45.116  27.991  19.450  1.00  0.90           C  
ATOM   5265  O   GLU A 647      45.148  27.966  20.681  1.00  0.90           O  
ATOM   5266  CB  GLU A 647      47.271  28.892  18.569  1.00  0.90           C  
ATOM   5267  CG  GLU A 647      47.681  27.588  17.832  1.00  0.90           C  
ATOM   5268  CD  GLU A 647      49.188  27.362  17.721  1.00  0.90           C  
ATOM   5269  OE1 GLU A 647      49.862  28.192  17.063  1.00  0.90           O  
ATOM   5270  OE2 GLU A 647      49.663  26.307  18.217  1.00  0.90           O  
ATOM   5271  N   ASN A 648      44.538  26.994  18.745  1.00  0.93           N  
ATOM   5272  CA  ASN A 648      44.088  25.735  19.300  1.00  0.93           C  
ATOM   5273  C   ASN A 648      43.013  25.848  20.365  1.00  0.93           C  
ATOM   5274  O   ASN A 648      43.108  25.236  21.430  1.00  0.93           O  
ATOM   5275  CB  ASN A 648      45.297  24.887  19.776  1.00  0.93           C  
ATOM   5276  CG  ASN A 648      44.966  23.408  19.886  1.00  0.93           C  
ATOM   5277  OD1 ASN A 648      44.076  22.879  19.219  1.00  0.93           O  
ATOM   5278  ND2 ASN A 648      45.703  22.707  20.775  1.00  0.93           N  
ATOM   5279  N   TYR A 649      41.941  26.612  20.072  1.00  0.94           N  
ATOM   5280  CA  TYR A 649      40.778  26.730  20.930  1.00  0.94           C  
ATOM   5281  C   TYR A 649      40.116  25.377  21.225  1.00  0.94           C  
ATOM   5282  O   TYR A 649      39.865  24.558  20.341  1.00  0.94           O  
ATOM   5283  CB  TYR A 649      39.779  27.762  20.334  1.00  0.94           C  
ATOM   5284  CG  TYR A 649      38.596  28.005  21.238  1.00  0.94           C  
ATOM   5285  CD1 TYR A 649      38.782  28.577  22.507  1.00  0.94           C  
ATOM   5286  CD2 TYR A 649      37.300  27.628  20.847  1.00  0.94           C  
ATOM   5287  CE1 TYR A 649      37.695  28.754  23.374  1.00  0.94           C  
ATOM   5288  CE2 TYR A 649      36.209  27.822  21.708  1.00  0.94           C  
ATOM   5289  CZ  TYR A 649      36.406  28.383  22.974  1.00  0.94           C  
ATOM   5290  OH  TYR A 649      35.294  28.638  23.805  1.00  0.94           O  
ATOM   5291  N   ARG A 650      39.871  25.127  22.523  1.00  0.91           N  
ATOM   5292  CA  ARG A 650      39.468  23.854  23.060  1.00  0.91           C  
ATOM   5293  C   ARG A 650      38.916  24.131  24.446  1.00  0.91           C  
ATOM   5294  O   ARG A 650      38.966  25.271  24.908  1.00  0.91           O  
ATOM   5295  CB  ARG A 650      40.649  22.850  23.124  1.00  0.91           C  
ATOM   5296  CG  ARG A 650      41.688  23.170  24.217  1.00  0.91           C  
ATOM   5297  CD  ARG A 650      43.010  22.404  24.085  1.00  0.91           C  
ATOM   5298  NE  ARG A 650      44.037  23.360  23.571  1.00  0.91           N  
ATOM   5299  CZ  ARG A 650      44.630  24.273  24.352  1.00  0.91           C  
ATOM   5300  NH1 ARG A 650      44.460  24.298  25.665  1.00  0.91           N  
ATOM   5301  NH2 ARG A 650      45.374  25.216  23.774  1.00  0.91           N  
ATOM   5302  N   VAL A 651      38.380  23.113  25.149  1.00  0.96           N  
ATOM   5303  CA  VAL A 651      37.739  23.268  26.451  1.00  0.96           C  
ATOM   5304  C   VAL A 651      38.652  23.845  27.525  1.00  0.96           C  
ATOM   5305  O   VAL A 651      38.287  24.811  28.188  1.00  0.96           O  
ATOM   5306  CB  VAL A 651      37.149  21.939  26.913  1.00  0.96           C  
ATOM   5307  CG1 VAL A 651      36.479  22.050  28.297  1.00  0.96           C  
ATOM   5308  CG2 VAL A 651      36.104  21.483  25.881  1.00  0.96           C  
ATOM   5309  N   SER A 652      39.895  23.336  27.661  1.00  0.95           N  
ATOM   5310  CA  SER A 652      40.887  23.854  28.586  1.00  0.95           C  
ATOM   5311  C   SER A 652      41.354  25.265  28.315  1.00  0.95           C  
ATOM   5312  O   SER A 652      41.717  25.997  29.232  1.00  0.95           O  
ATOM   5313  CB  SER A 652      42.125  22.941  28.697  1.00  0.95           C  
ATOM   5314  OG  SER A 652      42.869  22.792  27.477  1.00  0.95           O  
ATOM   5315  N   LEU A 653      41.379  25.691  27.036  1.00  0.94           N  
ATOM   5316  CA  LEU A 653      41.639  27.079  26.696  1.00  0.94           C  
ATOM   5317  C   LEU A 653      40.465  27.977  27.034  1.00  0.94           C  
ATOM   5318  O   LEU A 653      40.640  29.069  27.569  1.00  0.94           O  
ATOM   5319  CB  LEU A 653      42.056  27.283  25.218  1.00  0.94           C  
ATOM   5320  CG  LEU A 653      42.648  28.679  24.900  1.00  0.94           C  
ATOM   5321  CD1 LEU A 653      43.944  28.945  25.682  1.00  0.94           C  
ATOM   5322  CD2 LEU A 653      42.937  28.828  23.399  1.00  0.94           C  
ATOM   5323  N   ALA A 654      39.225  27.508  26.779  1.00  0.98           N  
ATOM   5324  CA  ALA A 654      37.998  28.203  27.105  1.00  0.98           C  
ATOM   5325  C   ALA A 654      37.869  28.494  28.593  1.00  0.98           C  
ATOM   5326  O   ALA A 654      37.482  29.588  28.996  1.00  0.98           O  
ATOM   5327  CB  ALA A 654      36.802  27.381  26.598  1.00  0.98           C  
ATOM   5328  N   GLU A 655      38.286  27.530  29.435  1.00  0.94           N  
ATOM   5329  CA  GLU A 655      38.378  27.676  30.874  1.00  0.94           C  
ATOM   5330  C   GLU A 655      39.390  28.731  31.323  1.00  0.94           C  
ATOM   5331  O   GLU A 655      39.336  29.218  32.445  1.00  0.94           O  
ATOM   5332  CB  GLU A 655      38.740  26.314  31.518  1.00  0.94           C  
ATOM   5333  CG  GLU A 655      37.621  25.243  31.415  1.00  0.94           C  
ATOM   5334  CD  GLU A 655      38.078  23.861  31.884  1.00  0.94           C  
ATOM   5335  OE1 GLU A 655      38.980  23.758  32.745  1.00  0.94           O  
ATOM   5336  OE2 GLU A 655      37.509  22.850  31.387  1.00  0.94           O  
ATOM   5337  N   LYS A 656      40.344  29.146  30.466  1.00  0.92           N  
ATOM   5338  CA  LYS A 656      41.270  30.206  30.817  1.00  0.92           C  
ATOM   5339  C   LYS A 656      40.907  31.547  30.198  1.00  0.92           C  
ATOM   5340  O   LYS A 656      41.017  32.586  30.845  1.00  0.92           O  
ATOM   5341  CB  LYS A 656      42.711  29.838  30.398  1.00  0.92           C  
ATOM   5342  CG  LYS A 656      43.188  28.522  31.023  1.00  0.92           C  
ATOM   5343  CD  LYS A 656      44.621  28.157  30.609  1.00  0.92           C  
ATOM   5344  CE  LYS A 656      44.990  26.703  30.929  1.00  0.92           C  
ATOM   5345  NZ  LYS A 656      44.790  26.470  32.366  1.00  0.92           N  
ATOM   5346  N   VAL A 657      40.464  31.574  28.923  1.00  0.96           N  
ATOM   5347  CA  VAL A 657      40.178  32.816  28.223  1.00  0.96           C  
ATOM   5348  C   VAL A 657      38.871  33.496  28.597  1.00  0.96           C  
ATOM   5349  O   VAL A 657      38.806  34.712  28.768  1.00  0.96           O  
ATOM   5350  CB  VAL A 657      40.323  32.661  26.715  1.00  0.96           C  
ATOM   5351  CG1 VAL A 657      39.246  31.776  26.077  1.00  0.96           C  
ATOM   5352  CG2 VAL A 657      40.312  34.048  26.064  1.00  0.96           C  
ATOM   5353  N   ILE A 658      37.776  32.731  28.768  1.00  0.97           N  
ATOM   5354  CA  ILE A 658      36.464  33.269  29.104  1.00  0.97           C  
ATOM   5355  C   ILE A 658      36.414  34.011  30.448  1.00  0.97           C  
ATOM   5356  O   ILE A 658      35.819  35.095  30.497  1.00  0.97           O  
ATOM   5357  CB  ILE A 658      35.394  32.188  28.968  1.00  0.97           C  
ATOM   5358  CG1 ILE A 658      35.323  31.725  27.491  1.00  0.97           C  
ATOM   5359  CG2 ILE A 658      34.027  32.722  29.433  1.00  0.97           C  
ATOM   5360  CD1 ILE A 658      34.382  30.540  27.254  1.00  0.97           C  
ATOM   5361  N   PRO A 659      37.032  33.578  31.554  1.00  0.99           N  
ATOM   5362  CA  PRO A 659      37.123  34.362  32.781  1.00  0.99           C  
ATOM   5363  C   PRO A 659      37.792  35.708  32.626  1.00  0.99           C  
ATOM   5364  O   PRO A 659      37.504  36.605  33.411  1.00  0.99           O  
ATOM   5365  CB  PRO A 659      37.835  33.441  33.778  1.00  0.99           C  
ATOM   5366  CG  PRO A 659      37.414  32.056  33.294  1.00  0.99           C  
ATOM   5367  CD  PRO A 659      37.483  32.206  31.785  1.00  0.99           C  
ATOM   5368  N   ALA A 660      38.664  35.888  31.618  1.00  0.97           N  
ATOM   5369  CA  ALA A 660      39.422  37.099  31.430  1.00  0.97           C  
ATOM   5370  C   ALA A 660      38.807  38.076  30.439  1.00  0.97           C  
ATOM   5371  O   ALA A 660      39.286  39.189  30.268  1.00  0.97           O  
ATOM   5372  CB  ALA A 660      40.806  36.682  30.911  1.00  0.97           C  
ATOM   5373  N   ALA A 661      37.697  37.717  29.779  1.00  0.99           N  
ATOM   5374  CA  ALA A 661      37.124  38.559  28.755  1.00  0.99           C  
ATOM   5375  C   ALA A 661      36.188  39.661  29.220  1.00  0.99           C  
ATOM   5376  O   ALA A 661      35.246  39.387  29.964  1.00  0.99           O  
ATOM   5377  CB  ALA A 661      36.288  37.649  27.873  1.00  0.99           C  
ATOM   5378  N   ASP A 662      36.383  40.920  28.775  1.00  0.98           N  
ATOM   5379  CA  ASP A 662      35.445  41.995  29.045  1.00  0.98           C  
ATOM   5380  C   ASP A 662      34.235  41.948  28.136  1.00  0.98           C  
ATOM   5381  O   ASP A 662      33.105  42.121  28.581  1.00  0.98           O  
ATOM   5382  CB  ASP A 662      36.047  43.393  28.838  1.00  0.98           C  
ATOM   5383  CG  ASP A 662      37.181  43.600  29.785  1.00  0.98           C  
ATOM   5384  OD1 ASP A 662      37.066  43.371  31.011  1.00  0.98           O  
ATOM   5385  OD2 ASP A 662      38.238  44.015  29.251  1.00  0.98           O  
ATOM   5386  N   LEU A 663      34.458  41.723  26.826  1.00  0.99           N  
ATOM   5387  CA  LEU A 663      33.409  41.759  25.833  1.00  0.99           C  
ATOM   5388  C   LEU A 663      33.288  40.422  25.138  1.00  0.99           C  
ATOM   5389  O   LEU A 663      34.266  39.785  24.753  1.00  0.99           O  
ATOM   5390  CB  LEU A 663      33.652  42.873  24.794  1.00  0.99           C  
ATOM   5391  CG  LEU A 663      32.527  43.100  23.766  1.00  0.99           C  
ATOM   5392  CD1 LEU A 663      31.252  43.638  24.433  1.00  0.99           C  
ATOM   5393  CD2 LEU A 663      33.007  44.062  22.670  1.00  0.99           C  
ATOM   5394  N   SER A 664      32.035  39.964  25.007  1.00  0.99           N  
ATOM   5395  CA  SER A 664      31.667  38.692  24.435  1.00  0.99           C  
ATOM   5396  C   SER A 664      31.027  38.909  23.092  1.00  0.99           C  
ATOM   5397  O   SER A 664      29.933  39.467  22.994  1.00  0.99           O  
ATOM   5398  CB  SER A 664      30.626  38.004  25.348  1.00  0.99           C  
ATOM   5399  OG  SER A 664      30.177  36.736  24.867  1.00  0.99           O  
ATOM   5400  N   GLU A 665      31.697  38.444  22.029  1.00  0.96           N  
ATOM   5401  CA  GLU A 665      31.227  38.584  20.673  1.00  0.96           C  
ATOM   5402  C   GLU A 665      30.325  37.437  20.254  1.00  0.96           C  
ATOM   5403  O   GLU A 665      30.742  36.294  20.042  1.00  0.96           O  
ATOM   5404  CB  GLU A 665      32.440  38.648  19.728  1.00  0.96           C  
ATOM   5405  CG  GLU A 665      33.180  40.004  19.761  1.00  0.96           C  
ATOM   5406  CD  GLU A 665      32.335  41.155  19.229  1.00  0.96           C  
ATOM   5407  OE1 GLU A 665      31.366  40.892  18.471  1.00  0.96           O  
ATOM   5408  OE2 GLU A 665      32.630  42.319  19.591  1.00  0.96           O  
ATOM   5409  N   GLN A 666      29.017  37.729  20.118  1.00  0.96           N  
ATOM   5410  CA  GLN A 666      27.992  36.750  19.824  1.00  0.96           C  
ATOM   5411  C   GLN A 666      27.155  37.260  18.661  1.00  0.96           C  
ATOM   5412  O   GLN A 666      25.955  37.474  18.753  1.00  0.96           O  
ATOM   5413  CB  GLN A 666      27.123  36.446  21.074  1.00  0.96           C  
ATOM   5414  CG  GLN A 666      27.945  36.083  22.339  1.00  0.96           C  
ATOM   5415  CD  GLN A 666      28.833  34.853  22.144  1.00  0.96           C  
ATOM   5416  OE1 GLN A 666      28.511  33.904  21.420  1.00  0.96           O  
ATOM   5417  NE2 GLN A 666      30.000  34.835  22.821  1.00  0.96           N  
ATOM   5418  N   ILE A 667      27.832  37.489  17.521  1.00  0.98           N  
ATOM   5419  CA  ILE A 667      27.369  38.314  16.418  1.00  0.98           C  
ATOM   5420  C   ILE A 667      26.809  37.618  15.189  1.00  0.98           C  
ATOM   5421  O   ILE A 667      26.732  38.208  14.103  1.00  0.98           O  
ATOM   5422  CB  ILE A 667      28.510  39.207  15.974  1.00  0.98           C  
ATOM   5423  CG1 ILE A 667      29.743  38.403  15.501  1.00  0.98           C  
ATOM   5424  CG2 ILE A 667      28.878  40.085  17.174  1.00  0.98           C  
ATOM   5425  CD1 ILE A 667      30.907  39.295  15.065  1.00  0.98           C  
ATOM   5426  N   SER A 668      26.363  36.358  15.330  1.00  0.97           N  
ATOM   5427  CA  SER A 668      25.709  35.552  14.316  1.00  0.97           C  
ATOM   5428  C   SER A 668      24.515  36.186  13.644  1.00  0.97           C  
ATOM   5429  O   SER A 668      23.816  37.020  14.199  1.00  0.97           O  
ATOM   5430  CB  SER A 668      25.264  34.184  14.874  1.00  0.97           C  
ATOM   5431  OG  SER A 668      24.437  34.302  16.043  1.00  0.97           O  
ATOM   5432  N   THR A 669      24.269  35.834  12.366  1.00  0.96           N  
ATOM   5433  CA  THR A 669      23.117  36.356  11.629  1.00  0.96           C  
ATOM   5434  C   THR A 669      21.802  35.914  12.229  1.00  0.96           C  
ATOM   5435  O   THR A 669      21.584  34.727  12.426  1.00  0.96           O  
ATOM   5436  CB  THR A 669      23.084  35.942  10.172  1.00  0.96           C  
ATOM   5437  OG1 THR A 669      24.372  36.067   9.591  1.00  0.96           O  
ATOM   5438  CG2 THR A 669      22.137  36.832   9.360  1.00  0.96           C  
ATOM   5439  N   ALA A 670      20.870  36.847  12.516  1.00  0.95           N  
ATOM   5440  CA  ALA A 670      19.620  36.532  13.180  1.00  0.95           C  
ATOM   5441  C   ALA A 670      18.830  35.380  12.560  1.00  0.95           C  
ATOM   5442  O   ALA A 670      18.340  35.459  11.433  1.00  0.95           O  
ATOM   5443  CB  ALA A 670      18.746  37.796  13.287  1.00  0.95           C  
ATOM   5444  N   GLY A 671      18.721  34.265  13.313  1.00  0.92           N  
ATOM   5445  CA  GLY A 671      18.109  33.030  12.866  1.00  0.92           C  
ATOM   5446  C   GLY A 671      19.076  31.934  12.466  1.00  0.92           C  
ATOM   5447  O   GLY A 671      18.630  30.893  11.995  1.00  0.92           O  
ATOM   5448  N   THR A 672      20.414  32.108  12.617  1.00  0.92           N  
ATOM   5449  CA  THR A 672      21.374  31.077  12.215  1.00  0.92           C  
ATOM   5450  C   THR A 672      22.053  30.336  13.355  1.00  0.92           C  
ATOM   5451  O   THR A 672      22.349  29.150  13.213  1.00  0.92           O  
ATOM   5452  CB  THR A 672      22.487  31.571  11.284  1.00  0.92           C  
ATOM   5453  OG1 THR A 672      23.357  32.510  11.904  1.00  0.92           O  
ATOM   5454  CG2 THR A 672      21.885  32.243  10.042  1.00  0.92           C  
ATOM   5455  N   GLU A 673      22.306  30.956  14.526  1.00  0.91           N  
ATOM   5456  CA  GLU A 673      22.872  30.235  15.656  1.00  0.91           C  
ATOM   5457  C   GLU A 673      21.709  29.703  16.477  1.00  0.91           C  
ATOM   5458  O   GLU A 673      20.947  30.444  17.089  1.00  0.91           O  
ATOM   5459  CB  GLU A 673      23.815  31.146  16.498  1.00  0.91           C  
ATOM   5460  CG  GLU A 673      24.576  30.547  17.724  1.00  0.91           C  
ATOM   5461  CD  GLU A 673      25.980  29.984  17.509  1.00  0.91           C  
ATOM   5462  OE1 GLU A 673      26.157  28.747  17.691  1.00  0.91           O  
ATOM   5463  OE2 GLU A 673      26.960  30.737  17.230  1.00  0.91           O  
ATOM   5464  N   ALA A 674      21.528  28.362  16.523  1.00  0.95           N  
ATOM   5465  CA  ALA A 674      20.385  27.720  17.154  1.00  0.95           C  
ATOM   5466  C   ALA A 674      20.271  28.003  18.645  1.00  0.95           C  
ATOM   5467  O   ALA A 674      19.195  27.937  19.231  1.00  0.95           O  
ATOM   5468  CB  ALA A 674      20.469  26.200  16.950  1.00  0.95           C  
ATOM   5469  N   SER A 675      21.404  28.343  19.287  1.00  0.95           N  
ATOM   5470  CA  SER A 675      21.417  28.722  20.686  1.00  0.95           C  
ATOM   5471  C   SER A 675      22.732  29.349  21.089  1.00  0.95           C  
ATOM   5472  O   SER A 675      22.793  30.460  21.578  1.00  0.95           O  
ATOM   5473  CB  SER A 675      21.170  27.504  21.600  1.00  0.95           C  
ATOM   5474  OG  SER A 675      21.096  27.832  22.986  1.00  0.95           O  
ATOM   5475  N   GLY A 676      23.844  28.616  20.843  1.00  0.96           N  
ATOM   5476  CA  GLY A 676      25.135  28.960  21.412  1.00  0.96           C  
ATOM   5477  C   GLY A 676      25.245  28.489  22.845  1.00  0.96           C  
ATOM   5478  O   GLY A 676      24.260  28.330  23.557  1.00  0.96           O  
ATOM   5479  N   THR A 677      26.474  28.230  23.319  1.00  0.96           N  
ATOM   5480  CA  THR A 677      26.693  27.956  24.738  1.00  0.96           C  
ATOM   5481  C   THR A 677      27.877  28.732  25.261  1.00  0.96           C  
ATOM   5482  O   THR A 677      28.056  28.882  26.464  1.00  0.96           O  
ATOM   5483  CB  THR A 677      26.907  26.483  25.093  1.00  0.96           C  
ATOM   5484  OG1 THR A 677      27.944  25.869  24.332  1.00  0.96           O  
ATOM   5485  CG2 THR A 677      25.616  25.690  24.841  1.00  0.96           C  
ATOM   5486  N   GLY A 678      28.729  29.302  24.372  1.00  0.99           N  
ATOM   5487  CA  GLY A 678      29.833  30.163  24.787  1.00  0.99           C  
ATOM   5488  C   GLY A 678      29.341  31.442  25.374  1.00  0.99           C  
ATOM   5489  O   GLY A 678      29.866  31.918  26.371  1.00  0.99           O  
ATOM   5490  N   ASN A 679      28.247  31.971  24.814  1.00  0.97           N  
ATOM   5491  CA  ASN A 679      27.586  33.185  25.222  1.00  0.97           C  
ATOM   5492  C   ASN A 679      27.190  33.175  26.694  1.00  0.97           C  
ATOM   5493  O   ASN A 679      27.470  34.117  27.433  1.00  0.97           O  
ATOM   5494  CB  ASN A 679      26.359  33.446  24.291  1.00  0.97           C  
ATOM   5495  CG  ASN A 679      25.401  32.258  24.130  1.00  0.97           C  
ATOM   5496  OD1 ASN A 679      25.609  31.163  24.639  1.00  0.97           O  
ATOM   5497  ND2 ASN A 679      24.336  32.488  23.330  1.00  0.97           N  
ATOM   5498  N   MET A 680      26.614  32.052  27.154  1.00  0.97           N  
ATOM   5499  CA  MET A 680      26.297  31.786  28.537  1.00  0.97           C  
ATOM   5500  C   MET A 680      27.521  31.798  29.439  1.00  0.97           C  
ATOM   5501  O   MET A 680      27.509  32.402  30.509  1.00  0.97           O  
ATOM   5502  CB  MET A 680      25.611  30.404  28.649  1.00  0.97           C  
ATOM   5503  CG  MET A 680      24.340  30.269  27.791  1.00  0.97           C  
ATOM   5504  SD  MET A 680      23.714  28.572  27.675  1.00  0.97           S  
ATOM   5505  CE  MET A 680      22.469  29.037  26.443  1.00  0.97           C  
ATOM   5506  N   LYS A 681      28.636  31.167  29.006  1.00  0.96           N  
ATOM   5507  CA  LYS A 681      29.870  31.098  29.774  1.00  0.96           C  
ATOM   5508  C   LYS A 681      30.476  32.464  30.013  1.00  0.96           C  
ATOM   5509  O   LYS A 681      30.908  32.787  31.117  1.00  0.96           O  
ATOM   5510  CB  LYS A 681      30.932  30.213  29.077  1.00  0.96           C  
ATOM   5511  CG  LYS A 681      30.490  28.773  28.799  1.00  0.96           C  
ATOM   5512  CD  LYS A 681      31.439  28.082  27.811  1.00  0.96           C  
ATOM   5513  CE  LYS A 681      30.850  26.821  27.178  1.00  0.96           C  
ATOM   5514  NZ  LYS A 681      31.769  26.308  26.139  1.00  0.96           N  
ATOM   5515  N   PHE A 682      30.485  33.316  28.973  1.00  0.98           N  
ATOM   5516  CA  PHE A 682      30.953  34.685  29.044  1.00  0.98           C  
ATOM   5517  C   PHE A 682      30.165  35.537  30.026  1.00  0.98           C  
ATOM   5518  O   PHE A 682      30.741  36.231  30.862  1.00  0.98           O  
ATOM   5519  CB  PHE A 682      30.831  35.328  27.647  1.00  0.98           C  
ATOM   5520  CG  PHE A 682      32.029  35.052  26.779  1.00  0.98           C  
ATOM   5521  CD1 PHE A 682      33.189  35.828  26.919  1.00  0.98           C  
ATOM   5522  CD2 PHE A 682      31.985  34.106  25.742  1.00  0.98           C  
ATOM   5523  CE1 PHE A 682      34.280  35.624  26.070  1.00  0.98           C  
ATOM   5524  CE2 PHE A 682      33.088  33.878  24.912  1.00  0.98           C  
ATOM   5525  CZ  PHE A 682      34.238  34.644  25.085  1.00  0.98           C  
ATOM   5526  N   MET A 683      28.821  35.452  29.977  1.00  0.97           N  
ATOM   5527  CA  MET A 683      27.929  36.145  30.888  1.00  0.97           C  
ATOM   5528  C   MET A 683      28.106  35.721  32.341  1.00  0.97           C  
ATOM   5529  O   MET A 683      28.191  36.549  33.245  1.00  0.97           O  
ATOM   5530  CB  MET A 683      26.468  35.899  30.442  1.00  0.97           C  
ATOM   5531  CG  MET A 683      25.405  36.557  31.342  1.00  0.97           C  
ATOM   5532  SD  MET A 683      23.722  36.551  30.662  1.00  0.97           S  
ATOM   5533  CE  MET A 683      23.558  34.748  30.634  1.00  0.97           C  
ATOM   5534  N   LEU A 684      28.234  34.400  32.594  1.00  0.98           N  
ATOM   5535  CA  LEU A 684      28.454  33.828  33.912  1.00  0.98           C  
ATOM   5536  C   LEU A 684      29.750  34.323  34.548  1.00  0.98           C  
ATOM   5537  O   LEU A 684      29.847  34.584  35.739  1.00  0.98           O  
ATOM   5538  CB  LEU A 684      28.486  32.278  33.806  1.00  0.98           C  
ATOM   5539  CG  LEU A 684      27.757  31.475  34.909  1.00  0.98           C  
ATOM   5540  CD1 LEU A 684      28.318  30.041  34.953  1.00  0.98           C  
ATOM   5541  CD2 LEU A 684      27.843  32.113  36.302  1.00  0.98           C  
ATOM   5542  N   ASN A 685      30.788  34.493  33.708  1.00  0.97           N  
ATOM   5543  CA  ASN A 685      32.122  34.854  34.120  1.00  0.97           C  
ATOM   5544  C   ASN A 685      32.403  36.345  34.044  1.00  0.97           C  
ATOM   5545  O   ASN A 685      33.549  36.789  34.116  1.00  0.97           O  
ATOM   5546  CB  ASN A 685      33.123  34.102  33.229  1.00  0.97           C  
ATOM   5547  CG  ASN A 685      33.220  32.691  33.778  1.00  0.97           C  
ATOM   5548  OD1 ASN A 685      33.926  32.477  34.760  1.00  0.97           O  
ATOM   5549  ND2 ASN A 685      32.470  31.746  33.187  1.00  0.97           N  
ATOM   5550  N   GLY A 686      31.361  37.182  33.920  1.00  0.98           N  
ATOM   5551  CA  GLY A 686      31.511  38.616  34.078  1.00  0.98           C  
ATOM   5552  C   GLY A 686      31.994  39.357  32.873  1.00  0.98           C  
ATOM   5553  O   GLY A 686      32.701  40.348  33.000  1.00  0.98           O  
ATOM   5554  N   ALA A 687      31.638  38.892  31.670  1.00  1.00           N  
ATOM   5555  CA  ALA A 687      31.787  39.674  30.466  1.00  1.00           C  
ATOM   5556  C   ALA A 687      30.455  40.305  30.103  1.00  1.00           C  
ATOM   5557  O   ALA A 687      29.391  39.778  30.419  1.00  1.00           O  
ATOM   5558  CB  ALA A 687      32.238  38.778  29.300  1.00  1.00           C  
ATOM   5559  N   LEU A 688      30.487  41.457  29.413  1.00  0.98           N  
ATOM   5560  CA  LEU A 688      29.307  42.041  28.809  1.00  0.98           C  
ATOM   5561  C   LEU A 688      29.199  41.514  27.388  1.00  0.98           C  
ATOM   5562  O   LEU A 688      30.190  41.136  26.771  1.00  0.98           O  
ATOM   5563  CB  LEU A 688      29.353  43.591  28.819  1.00  0.98           C  
ATOM   5564  CG  LEU A 688      29.410  44.200  30.237  1.00  0.98           C  
ATOM   5565  CD1 LEU A 688      29.471  45.730  30.212  1.00  0.98           C  
ATOM   5566  CD2 LEU A 688      28.203  43.774  31.078  1.00  0.98           C  
ATOM   5567  N   THR A 689      27.984  41.455  26.815  1.00  0.99           N  
ATOM   5568  CA  THR A 689      27.787  40.796  25.526  1.00  0.99           C  
ATOM   5569  C   THR A 689      27.356  41.766  24.459  1.00  0.99           C  
ATOM   5570  O   THR A 689      26.382  42.499  24.617  1.00  0.99           O  
ATOM   5571  CB  THR A 689      26.740  39.695  25.588  1.00  0.99           C  
ATOM   5572  OG1 THR A 689      27.185  38.656  26.446  1.00  0.99           O  
ATOM   5573  CG2 THR A 689      26.482  39.037  24.223  1.00  0.99           C  
ATOM   5574  N   ILE A 690      28.065  41.757  23.313  1.00  0.98           N  
ATOM   5575  CA  ILE A 690      27.631  42.416  22.098  1.00  0.98           C  
ATOM   5576  C   ILE A 690      27.144  41.322  21.180  1.00  0.98           C  
ATOM   5577  O   ILE A 690      27.760  40.269  20.997  1.00  0.98           O  
ATOM   5578  CB  ILE A 690      28.695  43.299  21.447  1.00  0.98           C  
ATOM   5579  CG1 ILE A 690      28.150  44.050  20.210  1.00  0.98           C  
ATOM   5580  CG2 ILE A 690      29.929  42.459  21.087  1.00  0.98           C  
ATOM   5581  CD1 ILE A 690      29.069  45.182  19.738  1.00  0.98           C  
ATOM   5582  N   GLY A 691      25.936  41.485  20.631  1.00  0.99           N  
ATOM   5583  CA  GLY A 691      25.359  40.381  19.907  1.00  0.99           C  
ATOM   5584  C   GLY A 691      24.085  40.759  19.247  1.00  0.99           C  
ATOM   5585  O   GLY A 691      23.488  41.800  19.501  1.00  0.99           O  
ATOM   5586  N   THR A 692      23.629  39.881  18.362  1.00  0.97           N  
ATOM   5587  CA  THR A 692      22.372  39.987  17.662  1.00  0.97           C  
ATOM   5588  C   THR A 692      21.294  39.302  18.473  1.00  0.97           C  
ATOM   5589  O   THR A 692      21.566  38.510  19.374  1.00  0.97           O  
ATOM   5590  CB  THR A 692      22.464  39.285  16.319  1.00  0.97           C  
ATOM   5591  OG1 THR A 692      23.029  37.992  16.515  1.00  0.97           O  
ATOM   5592  CG2 THR A 692      23.410  40.077  15.405  1.00  0.97           C  
ATOM   5593  N   MET A 693      20.009  39.581  18.171  1.00  0.93           N  
ATOM   5594  CA  MET A 693      18.907  38.822  18.739  1.00  0.93           C  
ATOM   5595  C   MET A 693      18.754  37.470  18.051  1.00  0.93           C  
ATOM   5596  O   MET A 693      17.831  37.250  17.272  1.00  0.93           O  
ATOM   5597  CB  MET A 693      17.569  39.596  18.670  1.00  0.93           C  
ATOM   5598  CG  MET A 693      17.508  40.798  19.627  1.00  0.93           C  
ATOM   5599  SD  MET A 693      17.452  40.315  21.380  1.00  0.93           S  
ATOM   5600  CE  MET A 693      15.883  41.150  21.743  1.00  0.93           C  
ATOM   5601  N   ASP A 694      19.678  36.542  18.350  1.00  0.93           N  
ATOM   5602  CA  ASP A 694      19.760  35.237  17.751  1.00  0.93           C  
ATOM   5603  C   ASP A 694      19.915  34.222  18.876  1.00  0.93           C  
ATOM   5604  O   ASP A 694      20.265  34.580  19.990  1.00  0.93           O  
ATOM   5605  CB  ASP A 694      20.973  35.243  16.786  1.00  0.93           C  
ATOM   5606  CG  ASP A 694      20.999  34.018  15.900  1.00  0.93           C  
ATOM   5607  OD1 ASP A 694      19.911  33.445  15.659  1.00  0.93           O  
ATOM   5608  OD2 ASP A 694      22.084  33.631  15.419  1.00  0.93           O  
ATOM   5609  N   GLY A 695      19.610  32.928  18.602  1.00  0.95           N  
ATOM   5610  CA  GLY A 695      19.677  31.824  19.567  1.00  0.95           C  
ATOM   5611  C   GLY A 695      19.313  32.120  21.005  1.00  0.95           C  
ATOM   5612  O   GLY A 695      18.229  32.612  21.324  1.00  0.95           O  
ATOM   5613  N   ALA A 696      20.229  31.827  21.941  1.00  0.95           N  
ATOM   5614  CA  ALA A 696      19.991  32.052  23.344  1.00  0.95           C  
ATOM   5615  C   ALA A 696      20.289  33.480  23.769  1.00  0.95           C  
ATOM   5616  O   ALA A 696      19.924  33.883  24.871  1.00  0.95           O  
ATOM   5617  CB  ALA A 696      20.844  31.083  24.172  1.00  0.95           C  
ATOM   5618  N   ASN A 697      20.894  34.315  22.888  1.00  0.95           N  
ATOM   5619  CA  ASN A 697      21.186  35.716  23.166  1.00  0.95           C  
ATOM   5620  C   ASN A 697      19.921  36.485  23.512  1.00  0.95           C  
ATOM   5621  O   ASN A 697      19.929  37.343  24.387  1.00  0.95           O  
ATOM   5622  CB  ASN A 697      21.834  36.481  21.982  1.00  0.95           C  
ATOM   5623  CG  ASN A 697      23.135  35.862  21.489  1.00  0.95           C  
ATOM   5624  OD1 ASN A 697      23.817  35.082  22.160  1.00  0.95           O  
ATOM   5625  ND2 ASN A 697      23.518  36.278  20.258  1.00  0.95           N  
ATOM   5626  N   VAL A 698      18.793  36.148  22.847  1.00  0.95           N  
ATOM   5627  CA  VAL A 698      17.480  36.720  23.104  1.00  0.95           C  
ATOM   5628  C   VAL A 698      17.022  36.512  24.537  1.00  0.95           C  
ATOM   5629  O   VAL A 698      16.607  37.437  25.230  1.00  0.95           O  
ATOM   5630  CB  VAL A 698      16.436  36.074  22.193  1.00  0.95           C  
ATOM   5631  CG1 VAL A 698      15.056  36.745  22.376  1.00  0.95           C  
ATOM   5632  CG2 VAL A 698      16.889  36.194  20.728  1.00  0.95           C  
ATOM   5633  N   GLU A 699      17.139  35.270  25.037  1.00  0.94           N  
ATOM   5634  CA  GLU A 699      16.825  34.921  26.402  1.00  0.94           C  
ATOM   5635  C   GLU A 699      17.795  35.520  27.403  1.00  0.94           C  
ATOM   5636  O   GLU A 699      17.399  35.953  28.477  1.00  0.94           O  
ATOM   5637  CB  GLU A 699      16.731  33.388  26.539  1.00  0.94           C  
ATOM   5638  CG  GLU A 699      15.528  32.838  25.739  1.00  0.94           C  
ATOM   5639  CD  GLU A 699      15.460  31.325  25.732  1.00  0.94           C  
ATOM   5640  OE1 GLU A 699      15.010  30.752  26.764  1.00  0.94           O  
ATOM   5641  OE2 GLU A 699      15.819  30.713  24.697  1.00  0.94           O  
ATOM   5642  N   MET A 700      19.101  35.583  27.083  1.00  0.95           N  
ATOM   5643  CA  MET A 700      20.083  36.247  27.922  1.00  0.95           C  
ATOM   5644  C   MET A 700      19.821  37.741  28.075  1.00  0.95           C  
ATOM   5645  O   MET A 700      19.884  38.285  29.176  1.00  0.95           O  
ATOM   5646  CB  MET A 700      21.500  36.018  27.362  1.00  0.95           C  
ATOM   5647  CG  MET A 700      21.954  34.547  27.361  1.00  0.95           C  
ATOM   5648  SD  MET A 700      23.366  34.235  26.271  1.00  0.95           S  
ATOM   5649  CE  MET A 700      24.586  35.317  27.064  1.00  0.95           C  
ATOM   5650  N   ALA A 701      19.458  38.427  26.973  1.00  0.95           N  
ATOM   5651  CA  ALA A 701      19.021  39.804  26.998  1.00  0.95           C  
ATOM   5652  C   ALA A 701      17.741  40.014  27.806  1.00  0.95           C  
ATOM   5653  O   ALA A 701      17.644  40.946  28.595  1.00  0.95           O  
ATOM   5654  CB  ALA A 701      18.864  40.308  25.550  1.00  0.95           C  
ATOM   5655  N   GLU A 702      16.745  39.113  27.678  1.00  0.92           N  
ATOM   5656  CA  GLU A 702      15.526  39.124  28.472  1.00  0.92           C  
ATOM   5657  C   GLU A 702      15.764  38.963  29.968  1.00  0.92           C  
ATOM   5658  O   GLU A 702      15.240  39.734  30.770  1.00  0.92           O  
ATOM   5659  CB  GLU A 702      14.603  37.995  27.947  1.00  0.92           C  
ATOM   5660  CG  GLU A 702      13.282  37.755  28.720  1.00  0.92           C  
ATOM   5661  CD  GLU A 702      12.428  36.740  27.989  1.00  0.92           C  
ATOM   5662  OE1 GLU A 702      11.941  37.061  26.876  1.00  0.92           O  
ATOM   5663  OE2 GLU A 702      12.290  35.571  28.441  1.00  0.92           O  
ATOM   5664  N   GLU A 703      16.614  37.999  30.386  1.00  0.93           N  
ATOM   5665  CA  GLU A 703      16.955  37.806  31.785  1.00  0.93           C  
ATOM   5666  C   GLU A 703      17.707  38.977  32.407  1.00  0.93           C  
ATOM   5667  O   GLU A 703      17.399  39.414  33.517  1.00  0.93           O  
ATOM   5668  CB  GLU A 703      17.813  36.530  31.977  1.00  0.93           C  
ATOM   5669  CG  GLU A 703      17.083  35.192  31.695  1.00  0.93           C  
ATOM   5670  CD  GLU A 703      15.948  34.855  32.657  1.00  0.93           C  
ATOM   5671  OE1 GLU A 703      15.962  35.297  33.839  1.00  0.93           O  
ATOM   5672  OE2 GLU A 703      15.056  34.087  32.205  1.00  0.93           O  
ATOM   5673  N   ALA A 704      18.724  39.531  31.710  1.00  0.95           N  
ATOM   5674  CA  ALA A 704      19.541  40.596  32.254  1.00  0.95           C  
ATOM   5675  C   ALA A 704      18.970  41.988  32.074  1.00  0.95           C  
ATOM   5676  O   ALA A 704      19.388  42.927  32.746  1.00  0.95           O  
ATOM   5677  CB  ALA A 704      20.930  40.557  31.587  1.00  0.95           C  
ATOM   5678  N   GLY A 705      17.990  42.143  31.171  1.00  0.94           N  
ATOM   5679  CA  GLY A 705      17.485  43.433  30.734  1.00  0.94           C  
ATOM   5680  C   GLY A 705      18.248  43.907  29.523  1.00  0.94           C  
ATOM   5681  O   GLY A 705      19.468  43.771  29.431  1.00  0.94           O  
ATOM   5682  N   GLU A 706      17.540  44.500  28.541  1.00  0.89           N  
ATOM   5683  CA  GLU A 706      18.106  44.898  27.264  1.00  0.89           C  
ATOM   5684  C   GLU A 706      18.981  46.145  27.386  1.00  0.89           C  
ATOM   5685  O   GLU A 706      19.888  46.381  26.588  1.00  0.89           O  
ATOM   5686  CB  GLU A 706      16.991  45.058  26.188  1.00  0.89           C  
ATOM   5687  CG  GLU A 706      17.387  44.487  24.791  1.00  0.89           C  
ATOM   5688  CD  GLU A 706      16.259  44.406  23.751  1.00  0.89           C  
ATOM   5689  OE1 GLU A 706      15.166  43.895  24.099  1.00  0.89           O  
ATOM   5690  OE2 GLU A 706      16.504  44.790  22.570  1.00  0.89           O  
ATOM   5691  N   GLU A 707      18.789  46.945  28.460  1.00  0.89           N  
ATOM   5692  CA  GLU A 707      19.698  48.007  28.873  1.00  0.89           C  
ATOM   5693  C   GLU A 707      21.063  47.485  29.274  1.00  0.89           C  
ATOM   5694  O   GLU A 707      22.081  48.132  29.055  1.00  0.89           O  
ATOM   5695  CB  GLU A 707      19.158  48.910  30.023  1.00  0.89           C  
ATOM   5696  CG  GLU A 707      17.666  48.715  30.374  1.00  0.89           C  
ATOM   5697  CD  GLU A 707      17.430  47.406  31.123  1.00  0.89           C  
ATOM   5698  OE1 GLU A 707      17.945  47.239  32.257  1.00  0.89           O  
ATOM   5699  OE2 GLU A 707      16.770  46.531  30.506  1.00  0.89           O  
ATOM   5700  N   ASN A 708      21.106  46.270  29.851  1.00  0.92           N  
ATOM   5701  CA  ASN A 708      22.312  45.659  30.349  1.00  0.92           C  
ATOM   5702  C   ASN A 708      22.980  44.794  29.288  1.00  0.92           C  
ATOM   5703  O   ASN A 708      23.843  43.982  29.595  1.00  0.92           O  
ATOM   5704  CB  ASN A 708      22.022  44.829  31.623  1.00  0.92           C  
ATOM   5705  CG  ASN A 708      21.439  45.796  32.648  1.00  0.92           C  
ATOM   5706  OD1 ASN A 708      22.113  46.736  33.071  1.00  0.92           O  
ATOM   5707  ND2 ASN A 708      20.164  45.588  33.042  1.00  0.92           N  
ATOM   5708  N   PHE A 709      22.635  45.008  27.997  1.00  0.94           N  
ATOM   5709  CA  PHE A 709      23.160  44.266  26.873  1.00  0.94           C  
ATOM   5710  C   PHE A 709      23.524  45.213  25.739  1.00  0.94           C  
ATOM   5711  O   PHE A 709      23.026  46.330  25.624  1.00  0.94           O  
ATOM   5712  CB  PHE A 709      22.071  43.282  26.355  1.00  0.94           C  
ATOM   5713  CG  PHE A 709      22.493  41.846  26.476  1.00  0.94           C  
ATOM   5714  CD1 PHE A 709      22.664  41.262  27.738  1.00  0.94           C  
ATOM   5715  CD2 PHE A 709      22.681  41.051  25.335  1.00  0.94           C  
ATOM   5716  CE1 PHE A 709      23.021  39.917  27.867  1.00  0.94           C  
ATOM   5717  CE2 PHE A 709      23.029  39.701  25.450  1.00  0.94           C  
ATOM   5718  CZ  PHE A 709      23.209  39.141  26.719  1.00  0.94           C  
ATOM   5719  N   PHE A 710      24.413  44.762  24.833  1.00  0.95           N  
ATOM   5720  CA  PHE A 710      24.770  45.505  23.639  1.00  0.95           C  
ATOM   5721  C   PHE A 710      24.178  44.812  22.422  1.00  0.95           C  
ATOM   5722  O   PHE A 710      24.867  44.306  21.540  1.00  0.95           O  
ATOM   5723  CB  PHE A 710      26.303  45.669  23.510  1.00  0.95           C  
ATOM   5724  CG  PHE A 710      26.845  46.551  24.592  1.00  0.95           C  
ATOM   5725  CD1 PHE A 710      26.646  47.941  24.542  1.00  0.95           C  
ATOM   5726  CD2 PHE A 710      27.615  46.007  25.632  1.00  0.95           C  
ATOM   5727  CE1 PHE A 710      27.204  48.775  25.518  1.00  0.95           C  
ATOM   5728  CE2 PHE A 710      28.181  46.840  26.603  1.00  0.95           C  
ATOM   5729  CZ  PHE A 710      27.970  48.223  26.549  1.00  0.95           C  
ATOM   5730  N   ILE A 711      22.833  44.767  22.367  1.00  0.95           N  
ATOM   5731  CA  ILE A 711      22.089  44.309  21.205  1.00  0.95           C  
ATOM   5732  C   ILE A 711      22.250  45.235  20.003  1.00  0.95           C  
ATOM   5733  O   ILE A 711      22.179  46.455  20.128  1.00  0.95           O  
ATOM   5734  CB  ILE A 711      20.610  44.090  21.525  1.00  0.95           C  
ATOM   5735  CG1 ILE A 711      20.407  42.972  22.578  1.00  0.95           C  
ATOM   5736  CG2 ILE A 711      19.789  43.767  20.258  1.00  0.95           C  
ATOM   5737  CD1 ILE A 711      20.884  41.582  22.132  1.00  0.95           C  
ATOM   5738  N   PHE A 712      22.434  44.649  18.803  1.00  0.95           N  
ATOM   5739  CA  PHE A 712      22.519  45.381  17.556  1.00  0.95           C  
ATOM   5740  C   PHE A 712      21.928  44.549  16.430  1.00  0.95           C  
ATOM   5741  O   PHE A 712      21.568  43.385  16.605  1.00  0.95           O  
ATOM   5742  CB  PHE A 712      23.975  45.823  17.206  1.00  0.95           C  
ATOM   5743  CG  PHE A 712      24.868  44.693  16.759  1.00  0.95           C  
ATOM   5744  CD1 PHE A 712      25.458  43.833  17.692  1.00  0.95           C  
ATOM   5745  CD2 PHE A 712      25.065  44.450  15.388  1.00  0.95           C  
ATOM   5746  CE1 PHE A 712      26.218  42.738  17.266  1.00  0.95           C  
ATOM   5747  CE2 PHE A 712      25.818  43.352  14.961  1.00  0.95           C  
ATOM   5748  CZ  PHE A 712      26.394  42.494  15.900  1.00  0.95           C  
ATOM   5749  N   GLY A 713      21.845  45.165  15.238  1.00  0.98           N  
ATOM   5750  CA  GLY A 713      21.605  44.494  13.973  1.00  0.98           C  
ATOM   5751  C   GLY A 713      20.210  44.032  13.693  1.00  0.98           C  
ATOM   5752  O   GLY A 713      19.258  44.215  14.454  1.00  0.98           O  
ATOM   5753  N   MET A 714      20.075  43.406  12.518  1.00  0.93           N  
ATOM   5754  CA  MET A 714      18.848  42.855  11.992  1.00  0.93           C  
ATOM   5755  C   MET A 714      18.184  41.839  12.909  1.00  0.93           C  
ATOM   5756  O   MET A 714      18.832  41.024  13.565  1.00  0.93           O  
ATOM   5757  CB  MET A 714      19.125  42.145  10.645  1.00  0.93           C  
ATOM   5758  CG  MET A 714      19.631  43.066   9.521  1.00  0.93           C  
ATOM   5759  SD  MET A 714      19.958  42.163   7.975  1.00  0.93           S  
ATOM   5760  CE  MET A 714      18.274  42.387   7.364  1.00  0.93           C  
ATOM   5761  N   ARG A 715      16.841  41.863  12.977  1.00  0.87           N  
ATOM   5762  CA  ARG A 715      16.073  40.822  13.623  1.00  0.87           C  
ATOM   5763  C   ARG A 715      15.761  39.747  12.588  1.00  0.87           C  
ATOM   5764  O   ARG A 715      16.064  39.893  11.403  1.00  0.87           O  
ATOM   5765  CB  ARG A 715      14.791  41.403  14.270  1.00  0.87           C  
ATOM   5766  CG  ARG A 715      15.022  42.532  15.308  1.00  0.87           C  
ATOM   5767  CD  ARG A 715      15.772  42.077  16.563  1.00  0.87           C  
ATOM   5768  NE  ARG A 715      15.828  43.198  17.567  1.00  0.87           N  
ATOM   5769  CZ  ARG A 715      16.871  44.023  17.739  1.00  0.87           C  
ATOM   5770  NH1 ARG A 715      17.903  44.040  16.903  1.00  0.87           N  
ATOM   5771  NH2 ARG A 715      16.889  44.843  18.791  1.00  0.87           N  
ATOM   5772  N   VAL A 716      15.163  38.608  12.996  1.00  0.87           N  
ATOM   5773  CA  VAL A 716      14.862  37.482  12.109  1.00  0.87           C  
ATOM   5774  C   VAL A 716      13.923  37.919  10.992  1.00  0.87           C  
ATOM   5775  O   VAL A 716      14.093  37.599   9.814  1.00  0.87           O  
ATOM   5776  CB  VAL A 716      14.247  36.320  12.894  1.00  0.87           C  
ATOM   5777  CG1 VAL A 716      13.743  35.191  11.965  1.00  0.87           C  
ATOM   5778  CG2 VAL A 716      15.301  35.755  13.864  1.00  0.87           C  
ATOM   5779  N   GLU A 717      12.940  38.757  11.358  1.00  0.80           N  
ATOM   5780  CA  GLU A 717      11.967  39.383  10.503  1.00  0.80           C  
ATOM   5781  C   GLU A 717      12.591  40.232   9.413  1.00  0.80           C  
ATOM   5782  O   GLU A 717      12.134  40.251   8.270  1.00  0.80           O  
ATOM   5783  CB  GLU A 717      11.037  40.305  11.342  1.00  0.80           C  
ATOM   5784  CG  GLU A 717      10.519  39.692  12.674  1.00  0.80           C  
ATOM   5785  CD  GLU A 717      11.469  39.859  13.868  1.00  0.80           C  
ATOM   5786  OE1 GLU A 717      12.433  39.056  13.977  1.00  0.80           O  
ATOM   5787  OE2 GLU A 717      11.246  40.788  14.678  1.00  0.80           O  
ATOM   5788  N   ASP A 718      13.646  40.990   9.752  1.00  0.87           N  
ATOM   5789  CA  ASP A 718      14.367  41.827   8.820  1.00  0.87           C  
ATOM   5790  C   ASP A 718      15.155  41.006   7.814  1.00  0.87           C  
ATOM   5791  O   ASP A 718      15.167  41.307   6.619  1.00  0.87           O  
ATOM   5792  CB  ASP A 718      15.271  42.831   9.564  1.00  0.87           C  
ATOM   5793  CG  ASP A 718      14.440  43.569  10.595  1.00  0.87           C  
ATOM   5794  OD1 ASP A 718      13.305  44.004  10.250  1.00  0.87           O  
ATOM   5795  OD2 ASP A 718      14.928  43.644  11.751  1.00  0.87           O  
ATOM   5796  N   VAL A 719      15.808  39.912   8.271  1.00  0.89           N  
ATOM   5797  CA  VAL A 719      16.566  39.006   7.422  1.00  0.89           C  
ATOM   5798  C   VAL A 719      15.690  38.387   6.344  1.00  0.89           C  
ATOM   5799  O   VAL A 719      16.037  38.418   5.172  1.00  0.89           O  
ATOM   5800  CB  VAL A 719      17.257  37.925   8.250  1.00  0.89           C  
ATOM   5801  CG1 VAL A 719      18.001  36.911   7.358  1.00  0.89           C  
ATOM   5802  CG2 VAL A 719      18.282  38.575   9.200  1.00  0.89           C  
ATOM   5803  N   ASP A 720      14.482  37.912   6.725  1.00  0.82           N  
ATOM   5804  CA  ASP A 720      13.489  37.377   5.817  1.00  0.82           C  
ATOM   5805  C   ASP A 720      12.985  38.402   4.796  1.00  0.82           C  
ATOM   5806  O   ASP A 720      12.907  38.117   3.602  1.00  0.82           O  
ATOM   5807  CB  ASP A 720      12.338  36.802   6.674  1.00  0.82           C  
ATOM   5808  CG  ASP A 720      11.357  36.005   5.835  1.00  0.82           C  
ATOM   5809  OD1 ASP A 720      11.711  34.890   5.384  1.00  0.82           O  
ATOM   5810  OD2 ASP A 720      10.231  36.527   5.627  1.00  0.82           O  
ATOM   5811  N   LYS A 721      12.709  39.665   5.212  1.00  0.81           N  
ATOM   5812  CA  LYS A 721      12.317  40.723   4.285  1.00  0.81           C  
ATOM   5813  C   LYS A 721      13.362  40.960   3.205  1.00  0.81           C  
ATOM   5814  O   LYS A 721      13.056  41.156   2.032  1.00  0.81           O  
ATOM   5815  CB  LYS A 721      12.103  42.084   5.003  1.00  0.81           C  
ATOM   5816  CG  LYS A 721      10.838  42.176   5.864  1.00  0.81           C  
ATOM   5817  CD  LYS A 721      10.740  43.556   6.539  1.00  0.81           C  
ATOM   5818  CE  LYS A 721       9.576  43.698   7.523  1.00  0.81           C  
ATOM   5819  NZ  LYS A 721       9.811  42.845   8.710  1.00  0.81           N  
ATOM   5820  N   LEU A 722      14.643  40.931   3.612  1.00  0.85           N  
ATOM   5821  CA  LEU A 722      15.773  41.051   2.727  1.00  0.85           C  
ATOM   5822  C   LEU A 722      15.941  39.849   1.809  1.00  0.85           C  
ATOM   5823  O   LEU A 722      16.182  40.011   0.617  1.00  0.85           O  
ATOM   5824  CB  LEU A 722      17.029  41.361   3.574  1.00  0.85           C  
ATOM   5825  CG  LEU A 722      18.089  42.277   2.924  1.00  0.85           C  
ATOM   5826  CD1 LEU A 722      17.480  43.613   2.461  1.00  0.85           C  
ATOM   5827  CD2 LEU A 722      19.216  42.540   3.937  1.00  0.85           C  
ATOM   5828  N   ASP A 723      15.771  38.613   2.316  1.00  0.82           N  
ATOM   5829  CA  ASP A 723      15.799  37.408   1.509  1.00  0.82           C  
ATOM   5830  C   ASP A 723      14.676  37.290   0.478  1.00  0.82           C  
ATOM   5831  O   ASP A 723      14.932  36.913  -0.662  1.00  0.82           O  
ATOM   5832  CB  ASP A 723      15.881  36.151   2.401  1.00  0.82           C  
ATOM   5833  CG  ASP A 723      17.293  36.009   2.884  1.00  0.82           C  
ATOM   5834  OD1 ASP A 723      18.242  35.950   2.053  1.00  0.82           O  
ATOM   5835  OD2 ASP A 723      17.528  35.994   4.117  1.00  0.82           O  
ATOM   5836  N   GLN A 724      13.417  37.652   0.808  1.00  0.78           N  
ATOM   5837  CA  GLN A 724      12.330  37.675  -0.161  1.00  0.78           C  
ATOM   5838  C   GLN A 724      12.539  38.654  -1.320  1.00  0.78           C  
ATOM   5839  O   GLN A 724      12.246  38.346  -2.468  1.00  0.78           O  
ATOM   5840  CB  GLN A 724      10.976  37.958   0.533  1.00  0.78           C  
ATOM   5841  CG  GLN A 724      10.507  36.794   1.441  1.00  0.78           C  
ATOM   5842  CD  GLN A 724       9.079  37.016   1.940  1.00  0.78           C  
ATOM   5843  OE1 GLN A 724       8.170  37.319   1.163  1.00  0.78           O  
ATOM   5844  NE2 GLN A 724       8.848  36.847   3.259  1.00  0.78           N  
ATOM   5845  N   ARG A 725      13.070  39.867  -1.046  1.00  0.73           N  
ATOM   5846  CA  ARG A 725      13.439  40.816  -2.089  1.00  0.73           C  
ATOM   5847  C   ARG A 725      14.689  40.417  -2.858  1.00  0.73           C  
ATOM   5848  O   ARG A 725      14.843  40.718  -4.040  1.00  0.73           O  
ATOM   5849  CB  ARG A 725      13.673  42.222  -1.480  1.00  0.73           C  
ATOM   5850  CG  ARG A 725      14.216  43.275  -2.471  1.00  0.73           C  
ATOM   5851  CD  ARG A 725      14.421  44.638  -1.825  1.00  0.73           C  
ATOM   5852  NE  ARG A 725      15.133  45.512  -2.816  1.00  0.73           N  
ATOM   5853  CZ  ARG A 725      16.459  45.659  -2.878  1.00  0.73           C  
ATOM   5854  NH1 ARG A 725      17.316  44.901  -2.202  1.00  0.73           N  
ATOM   5855  NH2 ARG A 725      16.966  46.630  -3.627  1.00  0.73           N  
ATOM   5856  N   GLY A 726      15.637  39.760  -2.170  1.00  0.86           N  
ATOM   5857  CA  GLY A 726      16.976  39.517  -2.667  1.00  0.86           C  
ATOM   5858  C   GLY A 726      17.963  40.431  -1.991  1.00  0.86           C  
ATOM   5859  O   GLY A 726      17.852  41.659  -2.016  1.00  0.86           O  
ATOM   5860  N   TYR A 727      18.990  39.827  -1.363  1.00  0.87           N  
ATOM   5861  CA  TYR A 727      20.091  40.538  -0.745  1.00  0.87           C  
ATOM   5862  C   TYR A 727      21.089  41.021  -1.785  1.00  0.87           C  
ATOM   5863  O   TYR A 727      21.609  40.247  -2.580  1.00  0.87           O  
ATOM   5864  CB  TYR A 727      20.826  39.623   0.281  1.00  0.87           C  
ATOM   5865  CG  TYR A 727      22.050  40.258   0.920  1.00  0.87           C  
ATOM   5866  CD1 TYR A 727      21.954  41.412   1.715  1.00  0.87           C  
ATOM   5867  CD2 TYR A 727      23.322  39.703   0.703  1.00  0.87           C  
ATOM   5868  CE1 TYR A 727      23.097  41.981   2.301  1.00  0.87           C  
ATOM   5869  CE2 TYR A 727      24.462  40.263   1.293  1.00  0.87           C  
ATOM   5870  CZ  TYR A 727      24.350  41.397   2.099  1.00  0.87           C  
ATOM   5871  OH  TYR A 727      25.499  41.923   2.727  1.00  0.87           O  
ATOM   5872  N   ASN A 728      21.410  42.327  -1.762  1.00  0.88           N  
ATOM   5873  CA  ASN A 728      22.450  42.869  -2.594  1.00  0.88           C  
ATOM   5874  C   ASN A 728      23.415  43.636  -1.709  1.00  0.88           C  
ATOM   5875  O   ASN A 728      23.095  44.673  -1.127  1.00  0.88           O  
ATOM   5876  CB  ASN A 728      21.778  43.754  -3.659  1.00  0.88           C  
ATOM   5877  CG  ASN A 728      22.750  44.305  -4.684  1.00  0.88           C  
ATOM   5878  OD1 ASN A 728      23.948  44.032  -4.673  1.00  0.88           O  
ATOM   5879  ND2 ASN A 728      22.195  45.136  -5.596  1.00  0.88           N  
ATOM   5880  N   ALA A 729      24.654  43.134  -1.581  1.00  0.93           N  
ATOM   5881  CA  ALA A 729      25.643  43.714  -0.706  1.00  0.93           C  
ATOM   5882  C   ALA A 729      26.153  45.052  -1.222  1.00  0.93           C  
ATOM   5883  O   ALA A 729      26.534  45.941  -0.457  1.00  0.93           O  
ATOM   5884  CB  ALA A 729      26.795  42.722  -0.522  1.00  0.93           C  
ATOM   5885  N   GLN A 730      26.085  45.245  -2.552  1.00  0.86           N  
ATOM   5886  CA  GLN A 730      26.497  46.437  -3.255  1.00  0.86           C  
ATOM   5887  C   GLN A 730      25.762  47.692  -2.792  1.00  0.86           C  
ATOM   5888  O   GLN A 730      26.342  48.762  -2.681  1.00  0.86           O  
ATOM   5889  CB  GLN A 730      26.306  46.209  -4.770  1.00  0.86           C  
ATOM   5890  CG  GLN A 730      27.011  47.236  -5.685  1.00  0.86           C  
ATOM   5891  CD  GLN A 730      28.535  47.097  -5.631  1.00  0.86           C  
ATOM   5892  OE1 GLN A 730      29.094  46.018  -5.788  1.00  0.86           O  
ATOM   5893  NE2 GLN A 730      29.244  48.228  -5.410  1.00  0.86           N  
ATOM   5894  N   GLU A 731      24.465  47.569  -2.431  1.00  0.85           N  
ATOM   5895  CA  GLU A 731      23.634  48.667  -1.965  1.00  0.85           C  
ATOM   5896  C   GLU A 731      24.193  49.357  -0.718  1.00  0.85           C  
ATOM   5897  O   GLU A 731      24.252  50.582  -0.630  1.00  0.85           O  
ATOM   5898  CB  GLU A 731      22.184  48.148  -1.728  1.00  0.85           C  
ATOM   5899  CG  GLU A 731      21.618  47.454  -2.997  1.00  0.85           C  
ATOM   5900  CD  GLU A 731      20.228  46.813  -2.931  1.00  0.85           C  
ATOM   5901  OE1 GLU A 731      19.818  46.167  -1.933  1.00  0.85           O  
ATOM   5902  OE2 GLU A 731      19.561  46.850  -4.000  1.00  0.85           O  
ATOM   5903  N   TYR A 732      24.679  48.567   0.262  1.00  0.89           N  
ATOM   5904  CA  TYR A 732      25.407  49.039   1.428  1.00  0.89           C  
ATOM   5905  C   TYR A 732      26.786  49.582   1.076  1.00  0.89           C  
ATOM   5906  O   TYR A 732      27.205  50.635   1.551  1.00  0.89           O  
ATOM   5907  CB  TYR A 732      25.584  47.902   2.472  1.00  0.89           C  
ATOM   5908  CG  TYR A 732      24.272  47.225   2.739  1.00  0.89           C  
ATOM   5909  CD1 TYR A 732      23.363  47.758   3.665  1.00  0.89           C  
ATOM   5910  CD2 TYR A 732      23.905  46.087   2.004  1.00  0.89           C  
ATOM   5911  CE1 TYR A 732      22.088  47.191   3.814  1.00  0.89           C  
ATOM   5912  CE2 TYR A 732      22.632  45.526   2.144  1.00  0.89           C  
ATOM   5913  CZ  TYR A 732      21.721  46.089   3.039  1.00  0.89           C  
ATOM   5914  OH  TYR A 732      20.422  45.564   3.107  1.00  0.89           O  
ATOM   5915  N   TYR A 733      27.530  48.890   0.184  1.00  0.88           N  
ATOM   5916  CA  TYR A 733      28.872  49.265  -0.243  1.00  0.88           C  
ATOM   5917  C   TYR A 733      28.893  50.656  -0.860  1.00  0.88           C  
ATOM   5918  O   TYR A 733      29.708  51.514  -0.517  1.00  0.88           O  
ATOM   5919  CB  TYR A 733      29.380  48.223  -1.279  1.00  0.88           C  
ATOM   5920  CG  TYR A 733      30.842  48.368  -1.612  1.00  0.88           C  
ATOM   5921  CD1 TYR A 733      31.798  47.788  -0.774  1.00  0.88           C  
ATOM   5922  CD2 TYR A 733      31.273  49.037  -2.772  1.00  0.88           C  
ATOM   5923  CE1 TYR A 733      33.159  47.875  -1.087  1.00  0.88           C  
ATOM   5924  CE2 TYR A 733      32.643  49.131  -3.079  1.00  0.88           C  
ATOM   5925  CZ  TYR A 733      33.595  48.572  -2.220  1.00  0.88           C  
ATOM   5926  OH  TYR A 733      34.983  48.670  -2.478  1.00  0.88           O  
ATOM   5927  N   ASP A 734      27.913  50.950  -1.723  1.00  0.88           N  
ATOM   5928  CA  ASP A 734      27.790  52.205  -2.421  1.00  0.88           C  
ATOM   5929  C   ASP A 734      27.375  53.357  -1.515  1.00  0.88           C  
ATOM   5930  O   ASP A 734      27.445  54.526  -1.900  1.00  0.88           O  
ATOM   5931  CB  ASP A 734      26.752  52.061  -3.548  1.00  0.88           C  
ATOM   5932  CG  ASP A 734      27.235  51.127  -4.645  1.00  0.88           C  
ATOM   5933  OD1 ASP A 734      28.420  50.708  -4.622  1.00  0.88           O  
ATOM   5934  OD2 ASP A 734      26.409  50.858  -5.550  1.00  0.88           O  
ATOM   5935  N   ARG A 735      26.923  53.080  -0.276  1.00  0.83           N  
ATOM   5936  CA  ARG A 735      26.529  54.119   0.651  1.00  0.83           C  
ATOM   5937  C   ARG A 735      27.398  54.263   1.885  1.00  0.83           C  
ATOM   5938  O   ARG A 735      27.288  55.274   2.567  1.00  0.83           O  
ATOM   5939  CB  ARG A 735      25.053  53.919   1.061  1.00  0.83           C  
ATOM   5940  CG  ARG A 735      24.078  54.111  -0.120  1.00  0.83           C  
ATOM   5941  CD  ARG A 735      24.095  55.532  -0.700  1.00  0.83           C  
ATOM   5942  NE  ARG A 735      23.241  55.537  -1.927  1.00  0.83           N  
ATOM   5943  CZ  ARG A 735      23.697  55.238  -3.152  1.00  0.83           C  
ATOM   5944  NH1 ARG A 735      24.975  54.966  -3.391  1.00  0.83           N  
ATOM   5945  NH2 ARG A 735      22.842  55.220  -4.172  1.00  0.83           N  
ATOM   5946  N   ILE A 736      28.337  53.337   2.176  1.00  0.91           N  
ATOM   5947  CA  ILE A 736      29.147  53.450   3.388  1.00  0.91           C  
ATOM   5948  C   ILE A 736      30.627  53.675   3.044  1.00  0.91           C  
ATOM   5949  O   ILE A 736      31.322  52.720   2.684  1.00  0.91           O  
ATOM   5950  CB  ILE A 736      29.026  52.197   4.251  1.00  0.91           C  
ATOM   5951  CG1 ILE A 736      27.548  51.837   4.541  1.00  0.91           C  
ATOM   5952  CG2 ILE A 736      29.769  52.410   5.591  1.00  0.91           C  
ATOM   5953  CD1 ILE A 736      27.355  50.388   5.005  1.00  0.91           C  
ATOM   5954  N   PRO A 737      31.205  54.882   3.158  1.00  0.92           N  
ATOM   5955  CA  PRO A 737      32.588  55.121   2.742  1.00  0.92           C  
ATOM   5956  C   PRO A 737      33.624  54.397   3.568  1.00  0.92           C  
ATOM   5957  O   PRO A 737      34.618  53.941   3.008  1.00  0.92           O  
ATOM   5958  CB  PRO A 737      32.762  56.645   2.840  1.00  0.92           C  
ATOM   5959  CG  PRO A 737      31.358  57.181   2.567  1.00  0.92           C  
ATOM   5960  CD  PRO A 737      30.451  56.137   3.225  1.00  0.92           C  
ATOM   5961  N   GLU A 738      33.419  54.269   4.896  1.00  0.88           N  
ATOM   5962  CA  GLU A 738      34.319  53.521   5.754  1.00  0.88           C  
ATOM   5963  C   GLU A 738      34.390  52.047   5.388  1.00  0.88           C  
ATOM   5964  O   GLU A 738      35.461  51.450   5.370  1.00  0.88           O  
ATOM   5965  CB  GLU A 738      33.955  53.674   7.250  1.00  0.88           C  
ATOM   5966  CG  GLU A 738      34.162  55.103   7.801  1.00  0.88           C  
ATOM   5967  CD  GLU A 738      34.495  55.132   9.289  1.00  0.88           C  
ATOM   5968  OE1 GLU A 738      33.854  54.428  10.112  1.00  0.88           O  
ATOM   5969  OE2 GLU A 738      35.439  55.884   9.639  1.00  0.88           O  
ATOM   5970  N   LEU A 739      33.247  51.426   5.031  1.00  0.92           N  
ATOM   5971  CA  LEU A 739      33.211  50.050   4.574  1.00  0.92           C  
ATOM   5972  C   LEU A 739      33.980  49.836   3.285  1.00  0.92           C  
ATOM   5973  O   LEU A 739      34.759  48.894   3.176  1.00  0.92           O  
ATOM   5974  CB  LEU A 739      31.753  49.575   4.396  1.00  0.92           C  
ATOM   5975  CG  LEU A 739      31.565  48.124   3.909  1.00  0.92           C  
ATOM   5976  CD1 LEU A 739      32.229  47.105   4.845  1.00  0.92           C  
ATOM   5977  CD2 LEU A 739      30.067  47.819   3.784  1.00  0.92           C  
ATOM   5978  N   ARG A 740      33.848  50.740   2.291  1.00  0.85           N  
ATOM   5979  CA  ARG A 740      34.645  50.653   1.080  1.00  0.85           C  
ATOM   5980  C   ARG A 740      36.141  50.728   1.348  1.00  0.85           C  
ATOM   5981  O   ARG A 740      36.907  49.907   0.855  1.00  0.85           O  
ATOM   5982  CB  ARG A 740      34.242  51.743   0.071  1.00  0.85           C  
ATOM   5983  CG  ARG A 740      32.794  51.610  -0.423  1.00  0.85           C  
ATOM   5984  CD  ARG A 740      32.537  52.332  -1.751  1.00  0.85           C  
ATOM   5985  NE  ARG A 740      32.714  53.800  -1.530  1.00  0.85           N  
ATOM   5986  CZ  ARG A 740      31.735  54.615  -1.114  1.00  0.85           C  
ATOM   5987  NH1 ARG A 740      30.540  54.148  -0.779  1.00  0.85           N  
ATOM   5988  NH2 ARG A 740      31.964  55.925  -1.041  1.00  0.85           N  
ATOM   5989  N   GLN A 741      36.572  51.640   2.247  1.00  0.86           N  
ATOM   5990  CA  GLN A 741      37.950  51.756   2.697  1.00  0.86           C  
ATOM   5991  C   GLN A 741      38.506  50.457   3.297  1.00  0.86           C  
ATOM   5992  O   GLN A 741      39.627  50.047   3.025  1.00  0.86           O  
ATOM   5993  CB  GLN A 741      38.065  52.931   3.715  1.00  0.86           C  
ATOM   5994  CG  GLN A 741      39.474  53.121   4.332  1.00  0.86           C  
ATOM   5995  CD  GLN A 741      39.646  54.420   5.130  1.00  0.86           C  
ATOM   5996  OE1 GLN A 741      39.061  54.709   6.181  1.00  0.86           O  
ATOM   5997  NE2 GLN A 741      40.561  55.279   4.624  1.00  0.86           N  
ATOM   5998  N   VAL A 742      37.706  49.741   4.113  1.00  0.92           N  
ATOM   5999  CA  VAL A 742      38.079  48.430   4.624  1.00  0.92           C  
ATOM   6000  C   VAL A 742      38.190  47.354   3.551  1.00  0.92           C  
ATOM   6001  O   VAL A 742      39.189  46.637   3.469  1.00  0.92           O  
ATOM   6002  CB  VAL A 742      37.118  47.982   5.710  1.00  0.92           C  
ATOM   6003  CG1 VAL A 742      37.482  46.567   6.198  1.00  0.92           C  
ATOM   6004  CG2 VAL A 742      37.200  48.966   6.892  1.00  0.92           C  
ATOM   6005  N   ILE A 743      37.186  47.235   2.664  1.00  0.89           N  
ATOM   6006  CA  ILE A 743      37.167  46.241   1.599  1.00  0.89           C  
ATOM   6007  C   ILE A 743      38.261  46.462   0.567  1.00  0.89           C  
ATOM   6008  O   ILE A 743      38.927  45.522   0.135  1.00  0.89           O  
ATOM   6009  CB  ILE A 743      35.804  46.196   0.933  1.00  0.89           C  
ATOM   6010  CG1 ILE A 743      34.678  45.853   1.944  1.00  0.89           C  
ATOM   6011  CG2 ILE A 743      35.773  45.210  -0.257  1.00  0.89           C  
ATOM   6012  CD1 ILE A 743      34.827  44.504   2.659  1.00  0.89           C  
ATOM   6013  N   GLU A 744      38.517  47.723   0.174  1.00  0.86           N  
ATOM   6014  CA  GLU A 744      39.585  48.094  -0.732  1.00  0.86           C  
ATOM   6015  C   GLU A 744      40.964  47.757  -0.192  1.00  0.86           C  
ATOM   6016  O   GLU A 744      41.798  47.261  -0.938  1.00  0.86           O  
ATOM   6017  CB  GLU A 744      39.422  49.562  -1.197  1.00  0.86           C  
ATOM   6018  CG  GLU A 744      38.289  49.653  -2.261  1.00  0.86           C  
ATOM   6019  CD  GLU A 744      37.621  51.016  -2.450  1.00  0.86           C  
ATOM   6020  OE1 GLU A 744      38.338  52.040  -2.550  1.00  0.86           O  
ATOM   6021  OE2 GLU A 744      36.358  51.017  -2.543  1.00  0.86           O  
ATOM   6022  N   GLN A 745      41.230  47.914   1.124  1.00  0.88           N  
ATOM   6023  CA  GLN A 745      42.448  47.402   1.745  1.00  0.88           C  
ATOM   6024  C   GLN A 745      42.611  45.883   1.657  1.00  0.88           C  
ATOM   6025  O   GLN A 745      43.702  45.383   1.393  1.00  0.88           O  
ATOM   6026  CB  GLN A 745      42.522  47.803   3.238  1.00  0.88           C  
ATOM   6027  CG  GLN A 745      42.768  49.309   3.477  1.00  0.88           C  
ATOM   6028  CD  GLN A 745      42.602  49.671   4.950  1.00  0.88           C  
ATOM   6029  OE1 GLN A 745      43.516  50.125   5.640  1.00  0.88           O  
ATOM   6030  NE2 GLN A 745      41.370  49.477   5.458  1.00  0.88           N  
ATOM   6031  N   LEU A 746      41.527  45.103   1.872  1.00  0.90           N  
ATOM   6032  CA  LEU A 746      41.544  43.656   1.703  1.00  0.90           C  
ATOM   6033  C   LEU A 746      41.804  43.236   0.265  1.00  0.90           C  
ATOM   6034  O   LEU A 746      42.590  42.335  -0.005  1.00  0.90           O  
ATOM   6035  CB  LEU A 746      40.200  43.021   2.148  1.00  0.90           C  
ATOM   6036  CG  LEU A 746      39.853  43.213   3.636  1.00  0.90           C  
ATOM   6037  CD1 LEU A 746      38.417  42.743   3.916  1.00  0.90           C  
ATOM   6038  CD2 LEU A 746      40.831  42.456   4.538  1.00  0.90           C  
ATOM   6039  N   SER A 747      41.128  43.916  -0.678  1.00  0.87           N  
ATOM   6040  CA  SER A 747      41.211  43.701  -2.112  1.00  0.87           C  
ATOM   6041  C   SER A 747      42.532  44.105  -2.749  1.00  0.87           C  
ATOM   6042  O   SER A 747      43.020  43.457  -3.662  1.00  0.87           O  
ATOM   6043  CB  SER A 747      40.057  44.450  -2.817  1.00  0.87           C  
ATOM   6044  OG  SER A 747      39.858  43.992  -4.154  1.00  0.87           O  
ATOM   6045  N   SER A 748      43.163  45.207  -2.286  1.00  0.88           N  
ATOM   6046  CA  SER A 748      44.374  45.723  -2.911  1.00  0.88           C  
ATOM   6047  C   SER A 748      45.654  45.156  -2.327  1.00  0.88           C  
ATOM   6048  O   SER A 748      46.747  45.453  -2.804  1.00  0.88           O  
ATOM   6049  CB  SER A 748      44.450  47.271  -2.779  1.00  0.88           C  
ATOM   6050  OG  SER A 748      44.593  47.708  -1.421  1.00  0.88           O  
ATOM   6051  N   GLY A 749      45.555  44.304  -1.286  1.00  0.90           N  
ATOM   6052  CA  GLY A 749      46.718  43.653  -0.701  1.00  0.90           C  
ATOM   6053  C   GLY A 749      47.400  44.395   0.412  1.00  0.90           C  
ATOM   6054  O   GLY A 749      48.552  44.122   0.733  1.00  0.90           O  
ATOM   6055  N   PHE A 750      46.714  45.335   1.087  1.00  0.91           N  
ATOM   6056  CA  PHE A 750      47.258  46.051   2.232  1.00  0.91           C  
ATOM   6057  C   PHE A 750      47.608  45.109   3.384  1.00  0.91           C  
ATOM   6058  O   PHE A 750      48.652  45.221   4.020  1.00  0.91           O  
ATOM   6059  CB  PHE A 750      46.236  47.126   2.684  1.00  0.91           C  
ATOM   6060  CG  PHE A 750      46.728  47.945   3.843  1.00  0.91           C  
ATOM   6061  CD1 PHE A 750      47.809  48.825   3.695  1.00  0.91           C  
ATOM   6062  CD2 PHE A 750      46.143  47.791   5.108  1.00  0.91           C  
ATOM   6063  CE1 PHE A 750      48.300  49.538   4.796  1.00  0.91           C  
ATOM   6064  CE2 PHE A 750      46.632  48.496   6.211  1.00  0.91           C  
ATOM   6065  CZ  PHE A 750      47.713  49.372   6.057  1.00  0.91           C  
ATOM   6066  N   PHE A 751      46.750  44.101   3.628  1.00  0.90           N  
ATOM   6067  CA  PHE A 751      46.979  43.117   4.668  1.00  0.90           C  
ATOM   6068  C   PHE A 751      47.727  41.905   4.134  1.00  0.90           C  
ATOM   6069  O   PHE A 751      47.870  40.890   4.806  1.00  0.90           O  
ATOM   6070  CB  PHE A 751      45.641  42.666   5.301  1.00  0.90           C  
ATOM   6071  CG  PHE A 751      45.078  43.792   6.117  1.00  0.90           C  
ATOM   6072  CD1 PHE A 751      45.694  44.142   7.327  1.00  0.90           C  
ATOM   6073  CD2 PHE A 751      43.962  44.525   5.684  1.00  0.90           C  
ATOM   6074  CE1 PHE A 751      45.215  45.212   8.091  1.00  0.90           C  
ATOM   6075  CE2 PHE A 751      43.479  45.596   6.445  1.00  0.90           C  
ATOM   6076  CZ  PHE A 751      44.112  45.946   7.645  1.00  0.90           C  
ATOM   6077  N   SER A 752      48.273  41.981   2.913  1.00  0.88           N  
ATOM   6078  CA  SER A 752      49.008  40.877   2.330  1.00  0.88           C  
ATOM   6079  C   SER A 752      50.006  41.343   1.280  1.00  0.88           C  
ATOM   6080  O   SER A 752      49.893  40.912   0.134  1.00  0.88           O  
ATOM   6081  CB  SER A 752      48.051  39.818   1.695  1.00  0.88           C  
ATOM   6082  OG  SER A 752      46.995  40.403   0.924  1.00  0.88           O  
ATOM   6083  N   PRO A 753      51.035  42.163   1.564  1.00  0.90           N  
ATOM   6084  CA  PRO A 753      51.861  42.800   0.531  1.00  0.90           C  
ATOM   6085  C   PRO A 753      52.579  41.830  -0.387  1.00  0.90           C  
ATOM   6086  O   PRO A 753      52.829  42.144  -1.543  1.00  0.90           O  
ATOM   6087  CB  PRO A 753      52.872  43.650   1.326  1.00  0.90           C  
ATOM   6088  CG  PRO A 753      52.137  43.980   2.625  1.00  0.90           C  
ATOM   6089  CD  PRO A 753      51.328  42.714   2.894  1.00  0.90           C  
ATOM   6090  N   LYS A 754      52.939  40.639   0.128  1.00  0.80           N  
ATOM   6091  CA  LYS A 754      53.608  39.608  -0.637  1.00  0.80           C  
ATOM   6092  C   LYS A 754      52.684  38.888  -1.607  1.00  0.80           C  
ATOM   6093  O   LYS A 754      53.128  38.265  -2.566  1.00  0.80           O  
ATOM   6094  CB  LYS A 754      54.159  38.534   0.329  1.00  0.80           C  
ATOM   6095  CG  LYS A 754      55.201  39.058   1.326  1.00  0.80           C  
ATOM   6096  CD  LYS A 754      55.881  37.899   2.075  1.00  0.80           C  
ATOM   6097  CE  LYS A 754      57.006  38.368   3.002  1.00  0.80           C  
ATOM   6098  NZ  LYS A 754      57.745  37.208   3.553  1.00  0.80           N  
ATOM   6099  N   GLN A 755      51.364  38.947  -1.359  1.00  0.83           N  
ATOM   6100  CA  GLN A 755      50.367  38.207  -2.100  1.00  0.83           C  
ATOM   6101  C   GLN A 755      49.129  39.089  -2.237  1.00  0.83           C  
ATOM   6102  O   GLN A 755      48.171  38.872  -1.488  1.00  0.83           O  
ATOM   6103  CB  GLN A 755      49.956  36.908  -1.341  1.00  0.83           C  
ATOM   6104  CG  GLN A 755      51.078  35.856  -1.186  1.00  0.83           C  
ATOM   6105  CD  GLN A 755      50.668  34.737  -0.229  1.00  0.83           C  
ATOM   6106  OE1 GLN A 755      50.770  34.855   0.994  1.00  0.83           O  
ATOM   6107  NE2 GLN A 755      50.198  33.603  -0.795  1.00  0.83           N  
ATOM   6108  N   PRO A 756      49.065  40.092  -3.123  1.00  0.90           N  
ATOM   6109  CA  PRO A 756      47.979  41.069  -3.138  1.00  0.90           C  
ATOM   6110  C   PRO A 756      46.593  40.468  -3.241  1.00  0.90           C  
ATOM   6111  O   PRO A 756      45.695  40.896  -2.533  1.00  0.90           O  
ATOM   6112  CB  PRO A 756      48.320  42.000  -4.307  1.00  0.90           C  
ATOM   6113  CG  PRO A 756      49.849  41.989  -4.317  1.00  0.90           C  
ATOM   6114  CD  PRO A 756      50.191  40.542  -3.950  1.00  0.90           C  
ATOM   6115  N   ASP A 757      46.441  39.404  -4.048  1.00  0.88           N  
ATOM   6116  CA  ASP A 757      45.167  38.785  -4.310  1.00  0.88           C  
ATOM   6117  C   ASP A 757      44.772  37.759  -3.243  1.00  0.88           C  
ATOM   6118  O   ASP A 757      43.793  37.031  -3.402  1.00  0.88           O  
ATOM   6119  CB  ASP A 757      45.253  38.013  -5.656  1.00  0.88           C  
ATOM   6120  CG  ASP A 757      45.460  38.895  -6.879  1.00  0.88           C  
ATOM   6121  OD1 ASP A 757      45.259  38.343  -7.993  1.00  0.88           O  
ATOM   6122  OD2 ASP A 757      45.823  40.086  -6.739  1.00  0.88           O  
ATOM   6123  N   LEU A 758      45.494  37.678  -2.098  1.00  0.89           N  
ATOM   6124  CA  LEU A 758      45.302  36.643  -1.088  1.00  0.89           C  
ATOM   6125  C   LEU A 758      43.884  36.537  -0.552  1.00  0.89           C  
ATOM   6126  O   LEU A 758      43.359  35.447  -0.357  1.00  0.89           O  
ATOM   6127  CB  LEU A 758      46.254  36.852   0.120  1.00  0.89           C  
ATOM   6128  CG  LEU A 758      46.220  35.747   1.200  1.00  0.89           C  
ATOM   6129  CD1 LEU A 758      46.626  34.378   0.640  1.00  0.89           C  
ATOM   6130  CD2 LEU A 758      47.144  36.095   2.375  1.00  0.89           C  
ATOM   6131  N   PHE A 759      43.207  37.674  -0.329  1.00  0.90           N  
ATOM   6132  CA  PHE A 759      41.881  37.676   0.250  1.00  0.90           C  
ATOM   6133  C   PHE A 759      40.789  37.884  -0.783  1.00  0.90           C  
ATOM   6134  O   PHE A 759      39.674  38.281  -0.444  1.00  0.90           O  
ATOM   6135  CB  PHE A 759      41.787  38.734   1.376  1.00  0.90           C  
ATOM   6136  CG  PHE A 759      42.736  38.378   2.493  1.00  0.90           C  
ATOM   6137  CD1 PHE A 759      42.716  37.099   3.083  1.00  0.90           C  
ATOM   6138  CD2 PHE A 759      43.675  39.317   2.953  1.00  0.90           C  
ATOM   6139  CE1 PHE A 759      43.628  36.756   4.084  1.00  0.90           C  
ATOM   6140  CE2 PHE A 759      44.591  38.976   3.957  1.00  0.90           C  
ATOM   6141  CZ  PHE A 759      44.572  37.691   4.514  1.00  0.90           C  
ATOM   6142  N   LYS A 760      41.051  37.575  -2.074  1.00  0.86           N  
ATOM   6143  CA  LYS A 760      40.097  37.746  -3.158  1.00  0.86           C  
ATOM   6144  C   LYS A 760      38.795  36.991  -2.953  1.00  0.86           C  
ATOM   6145  O   LYS A 760      37.713  37.546  -3.139  1.00  0.86           O  
ATOM   6146  CB  LYS A 760      40.720  37.281  -4.494  1.00  0.86           C  
ATOM   6147  CG  LYS A 760      39.799  37.476  -5.708  1.00  0.86           C  
ATOM   6148  CD  LYS A 760      40.400  36.927  -7.007  1.00  0.86           C  
ATOM   6149  CE  LYS A 760      39.408  37.040  -8.165  1.00  0.86           C  
ATOM   6150  NZ  LYS A 760      40.008  36.506  -9.403  1.00  0.86           N  
ATOM   6151  N   ASP A 761      38.868  35.723  -2.504  1.00  0.90           N  
ATOM   6152  CA  ASP A 761      37.717  34.890  -2.228  1.00  0.90           C  
ATOM   6153  C   ASP A 761      36.806  35.492  -1.163  1.00  0.90           C  
ATOM   6154  O   ASP A 761      35.585  35.537  -1.316  1.00  0.90           O  
ATOM   6155  CB  ASP A 761      38.184  33.494  -1.749  1.00  0.90           C  
ATOM   6156  CG  ASP A 761      39.086  32.802  -2.762  1.00  0.90           C  
ATOM   6157  OD1 ASP A 761      39.155  33.247  -3.934  1.00  0.90           O  
ATOM   6158  OD2 ASP A 761      39.733  31.812  -2.336  1.00  0.90           O  
ATOM   6159  N   ILE A 762      37.400  36.036  -0.075  1.00  0.92           N  
ATOM   6160  CA  ILE A 762      36.678  36.726   0.985  1.00  0.92           C  
ATOM   6161  C   ILE A 762      35.963  37.957   0.454  1.00  0.92           C  
ATOM   6162  O   ILE A 762      34.775  38.149   0.695  1.00  0.92           O  
ATOM   6163  CB  ILE A 762      37.602  37.124   2.142  1.00  0.92           C  
ATOM   6164  CG1 ILE A 762      38.142  35.859   2.852  1.00  0.92           C  
ATOM   6165  CG2 ILE A 762      36.862  38.040   3.151  1.00  0.92           C  
ATOM   6166  CD1 ILE A 762      39.116  36.162   3.998  1.00  0.92           C  
ATOM   6167  N   VAL A 763      36.654  38.802  -0.340  1.00  0.91           N  
ATOM   6168  CA  VAL A 763      36.046  39.985  -0.932  1.00  0.91           C  
ATOM   6169  C   VAL A 763      34.944  39.630  -1.914  1.00  0.91           C  
ATOM   6170  O   VAL A 763      33.844  40.171  -1.859  1.00  0.91           O  
ATOM   6171  CB  VAL A 763      37.081  40.866  -1.623  1.00  0.91           C  
ATOM   6172  CG1 VAL A 763      36.410  42.110  -2.244  1.00  0.91           C  
ATOM   6173  CG2 VAL A 763      38.137  41.323  -0.595  1.00  0.91           C  
ATOM   6174  N   ASN A 764      35.178  38.659  -2.819  1.00  0.88           N  
ATOM   6175  CA  ASN A 764      34.176  38.210  -3.769  1.00  0.88           C  
ATOM   6176  C   ASN A 764      32.947  37.590  -3.116  1.00  0.88           C  
ATOM   6177  O   ASN A 764      31.832  37.843  -3.568  1.00  0.88           O  
ATOM   6178  CB  ASN A 764      34.787  37.279  -4.857  1.00  0.88           C  
ATOM   6179  CG  ASN A 764      35.692  38.005  -5.862  1.00  0.88           C  
ATOM   6180  OD1 ASN A 764      36.432  37.387  -6.627  1.00  0.88           O  
ATOM   6181  ND2 ASN A 764      35.615  39.354  -5.928  1.00  0.88           N  
ATOM   6182  N   MET A 765      33.095  36.809  -2.027  1.00  0.90           N  
ATOM   6183  CA  MET A 765      31.959  36.354  -1.241  1.00  0.90           C  
ATOM   6184  C   MET A 765      31.189  37.492  -0.586  1.00  0.90           C  
ATOM   6185  O   MET A 765      29.985  37.616  -0.797  1.00  0.90           O  
ATOM   6186  CB  MET A 765      32.434  35.326  -0.182  1.00  0.90           C  
ATOM   6187  CG  MET A 765      31.335  34.699   0.710  1.00  0.90           C  
ATOM   6188  SD  MET A 765      30.779  35.694   2.131  1.00  0.90           S  
ATOM   6189  CE  MET A 765      32.307  35.563   3.089  1.00  0.90           C  
ATOM   6190  N   LEU A 766      31.865  38.414   0.138  1.00  0.93           N  
ATOM   6191  CA  LEU A 766      31.199  39.503   0.844  1.00  0.93           C  
ATOM   6192  C   LEU A 766      30.416  40.423  -0.081  1.00  0.93           C  
ATOM   6193  O   LEU A 766      29.286  40.810   0.199  1.00  0.93           O  
ATOM   6194  CB  LEU A 766      32.215  40.358   1.640  1.00  0.93           C  
ATOM   6195  CG  LEU A 766      32.867  39.655   2.849  1.00  0.93           C  
ATOM   6196  CD1 LEU A 766      34.014  40.520   3.398  1.00  0.93           C  
ATOM   6197  CD2 LEU A 766      31.849  39.370   3.964  1.00  0.93           C  
ATOM   6198  N   MET A 767      31.016  40.768  -1.234  1.00  0.88           N  
ATOM   6199  CA  MET A 767      30.388  41.552  -2.272  1.00  0.88           C  
ATOM   6200  C   MET A 767      29.258  40.854  -3.028  1.00  0.88           C  
ATOM   6201  O   MET A 767      28.249  41.474  -3.330  1.00  0.88           O  
ATOM   6202  CB  MET A 767      31.449  42.021  -3.293  1.00  0.88           C  
ATOM   6203  CG  MET A 767      32.554  42.918  -2.695  1.00  0.88           C  
ATOM   6204  SD  MET A 767      32.005  44.538  -2.102  1.00  0.88           S  
ATOM   6205  CE  MET A 767      31.737  45.293  -3.725  1.00  0.88           C  
ATOM   6206  N   HIS A 768      29.407  39.549  -3.377  1.00  0.87           N  
ATOM   6207  CA  HIS A 768      28.515  38.958  -4.366  1.00  0.87           C  
ATOM   6208  C   HIS A 768      27.756  37.696  -3.974  1.00  0.87           C  
ATOM   6209  O   HIS A 768      26.883  37.263  -4.718  1.00  0.87           O  
ATOM   6210  CB  HIS A 768      29.313  38.579  -5.632  1.00  0.87           C  
ATOM   6211  CG  HIS A 768      30.169  39.687  -6.153  1.00  0.87           C  
ATOM   6212  ND1 HIS A 768      29.590  40.885  -6.506  1.00  0.87           N  
ATOM   6213  CD2 HIS A 768      31.512  39.738  -6.347  1.00  0.87           C  
ATOM   6214  CE1 HIS A 768      30.583  41.650  -6.902  1.00  0.87           C  
ATOM   6215  NE2 HIS A 768      31.774  41.004  -6.829  1.00  0.87           N  
ATOM   6216  N   HIS A 769      28.027  37.042  -2.824  1.00  0.87           N  
ATOM   6217  CA  HIS A 769      27.314  35.808  -2.519  1.00  0.87           C  
ATOM   6218  C   HIS A 769      27.217  35.501  -1.039  1.00  0.87           C  
ATOM   6219  O   HIS A 769      26.887  34.401  -0.635  1.00  0.87           O  
ATOM   6220  CB  HIS A 769      27.833  34.578  -3.320  1.00  0.87           C  
ATOM   6221  CG  HIS A 769      29.303  34.307  -3.291  1.00  0.87           C  
ATOM   6222  ND1 HIS A 769      29.816  33.462  -2.335  1.00  0.87           N  
ATOM   6223  CD2 HIS A 769      30.256  34.606  -4.213  1.00  0.87           C  
ATOM   6224  CE1 HIS A 769      31.066  33.258  -2.684  1.00  0.87           C  
ATOM   6225  NE2 HIS A 769      31.388  33.926  -3.817  1.00  0.87           N  
ATOM   6226  N   ASP A 770      27.414  36.530  -0.191  1.00  0.94           N  
ATOM   6227  CA  ASP A 770      27.222  36.463   1.234  1.00  0.94           C  
ATOM   6228  C   ASP A 770      25.800  36.053   1.637  1.00  0.94           C  
ATOM   6229  O   ASP A 770      24.821  36.792   1.490  1.00  0.94           O  
ATOM   6230  CB  ASP A 770      27.660  37.827   1.832  1.00  0.94           C  
ATOM   6231  CG  ASP A 770      27.589  37.904   3.343  1.00  0.94           C  
ATOM   6232  OD1 ASP A 770      27.306  36.876   4.010  1.00  0.94           O  
ATOM   6233  OD2 ASP A 770      27.720  39.045   3.857  1.00  0.94           O  
ATOM   6234  N   ARG A 771      25.662  34.828   2.185  1.00  0.85           N  
ATOM   6235  CA  ARG A 771      24.399  34.308   2.664  1.00  0.85           C  
ATOM   6236  C   ARG A 771      24.025  34.892   4.020  1.00  0.85           C  
ATOM   6237  O   ARG A 771      22.861  34.881   4.423  1.00  0.85           O  
ATOM   6238  CB  ARG A 771      24.448  32.758   2.802  1.00  0.85           C  
ATOM   6239  CG  ARG A 771      24.707  32.008   1.475  1.00  0.85           C  
ATOM   6240  CD  ARG A 771      24.332  30.509   1.486  1.00  0.85           C  
ATOM   6241  NE  ARG A 771      25.241  29.816   2.463  1.00  0.85           N  
ATOM   6242  CZ  ARG A 771      24.949  28.803   3.298  1.00  0.85           C  
ATOM   6243  NH1 ARG A 771      23.753  28.237   3.413  1.00  0.85           N  
ATOM   6244  NH2 ARG A 771      25.923  28.318   4.060  1.00  0.85           N  
ATOM   6245  N   PHE A 772      25.016  35.431   4.756  1.00  0.93           N  
ATOM   6246  CA  PHE A 772      24.901  35.734   6.162  1.00  0.93           C  
ATOM   6247  C   PHE A 772      24.889  37.232   6.406  1.00  0.93           C  
ATOM   6248  O   PHE A 772      24.682  37.714   7.511  1.00  0.93           O  
ATOM   6249  CB  PHE A 772      26.078  35.052   6.899  1.00  0.93           C  
ATOM   6250  CG  PHE A 772      25.868  33.568   6.782  1.00  0.93           C  
ATOM   6251  CD1 PHE A 772      24.740  32.982   7.379  1.00  0.93           C  
ATOM   6252  CD2 PHE A 772      26.731  32.760   6.027  1.00  0.93           C  
ATOM   6253  CE1 PHE A 772      24.472  31.619   7.217  1.00  0.93           C  
ATOM   6254  CE2 PHE A 772      26.483  31.388   5.887  1.00  0.93           C  
ATOM   6255  CZ  PHE A 772      25.347  30.818   6.475  1.00  0.93           C  
ATOM   6256  N   LYS A 773      25.036  38.009   5.320  1.00  0.93           N  
ATOM   6257  CA  LYS A 773      24.705  39.413   5.244  1.00  0.93           C  
ATOM   6258  C   LYS A 773      25.515  40.300   6.180  1.00  0.93           C  
ATOM   6259  O   LYS A 773      24.978  41.037   7.008  1.00  0.93           O  
ATOM   6260  CB  LYS A 773      23.180  39.645   5.405  1.00  0.93           C  
ATOM   6261  CG  LYS A 773      22.290  38.752   4.513  1.00  0.93           C  
ATOM   6262  CD  LYS A 773      20.816  38.845   4.951  1.00  0.93           C  
ATOM   6263  CE  LYS A 773      19.779  38.142   4.064  1.00  0.93           C  
ATOM   6264  NZ  LYS A 773      19.983  36.684   4.028  1.00  0.93           N  
ATOM   6265  N   VAL A 774      26.854  40.234   6.091  1.00  0.99           N  
ATOM   6266  CA  VAL A 774      27.796  40.979   6.913  1.00  0.99           C  
ATOM   6267  C   VAL A 774      27.649  42.481   6.749  1.00  0.99           C  
ATOM   6268  O   VAL A 774      27.623  43.232   7.723  1.00  0.99           O  
ATOM   6269  CB  VAL A 774      29.228  40.558   6.587  1.00  0.99           C  
ATOM   6270  CG1 VAL A 774      30.254  41.389   7.383  1.00  0.99           C  
ATOM   6271  CG2 VAL A 774      29.393  39.065   6.933  1.00  0.99           C  
ATOM   6272  N   PHE A 775      27.509  42.970   5.502  1.00  0.96           N  
ATOM   6273  CA  PHE A 775      27.385  44.388   5.213  1.00  0.96           C  
ATOM   6274  C   PHE A 775      26.111  45.013   5.751  1.00  0.96           C  
ATOM   6275  O   PHE A 775      26.115  46.166   6.172  1.00  0.96           O  
ATOM   6276  CB  PHE A 775      27.477  44.681   3.699  1.00  0.96           C  
ATOM   6277  CG  PHE A 775      28.827  44.427   3.072  1.00  0.96           C  
ATOM   6278  CD1 PHE A 775      29.957  43.910   3.740  1.00  0.96           C  
ATOM   6279  CD2 PHE A 775      28.964  44.785   1.724  1.00  0.96           C  
ATOM   6280  CE1 PHE A 775      31.171  43.735   3.064  1.00  0.96           C  
ATOM   6281  CE2 PHE A 775      30.174  44.620   1.047  1.00  0.96           C  
ATOM   6282  CZ  PHE A 775      31.281  44.090   1.715  1.00  0.96           C  
ATOM   6283  N   ALA A 776      24.997  44.254   5.777  1.00  0.97           N  
ATOM   6284  CA  ALA A 776      23.728  44.705   6.311  1.00  0.97           C  
ATOM   6285  C   ALA A 776      23.782  45.104   7.784  1.00  0.97           C  
ATOM   6286  O   ALA A 776      23.214  46.114   8.182  1.00  0.97           O  
ATOM   6287  CB  ALA A 776      22.659  43.620   6.091  1.00  0.97           C  
ATOM   6288  N   ASP A 777      24.534  44.350   8.614  1.00  0.96           N  
ATOM   6289  CA  ASP A 777      24.695  44.694  10.012  1.00  0.96           C  
ATOM   6290  C   ASP A 777      25.927  45.552  10.273  1.00  0.96           C  
ATOM   6291  O   ASP A 777      26.174  45.929  11.418  1.00  0.96           O  
ATOM   6292  CB  ASP A 777      24.843  43.416  10.874  1.00  0.96           C  
ATOM   6293  CG  ASP A 777      23.499  42.781  11.143  1.00  0.96           C  
ATOM   6294  OD1 ASP A 777      22.456  43.462  11.079  1.00  0.96           O  
ATOM   6295  OD2 ASP A 777      23.497  41.564  11.462  1.00  0.96           O  
ATOM   6296  N   TYR A 778      26.735  45.913   9.246  1.00  0.96           N  
ATOM   6297  CA  TYR A 778      27.997  46.607   9.455  1.00  0.96           C  
ATOM   6298  C   TYR A 778      27.838  47.932  10.195  1.00  0.96           C  
ATOM   6299  O   TYR A 778      28.474  48.137  11.220  1.00  0.96           O  
ATOM   6300  CB  TYR A 778      28.755  46.803   8.099  1.00  0.96           C  
ATOM   6301  CG  TYR A 778      29.983  47.688   8.198  1.00  0.96           C  
ATOM   6302  CD1 TYR A 778      31.237  47.187   8.587  1.00  0.96           C  
ATOM   6303  CD2 TYR A 778      29.851  49.069   7.972  1.00  0.96           C  
ATOM   6304  CE1 TYR A 778      32.331  48.056   8.759  1.00  0.96           C  
ATOM   6305  CE2 TYR A 778      30.931  49.937   8.162  1.00  0.96           C  
ATOM   6306  CZ  TYR A 778      32.167  49.432   8.554  1.00  0.96           C  
ATOM   6307  OH  TYR A 778      33.214  50.344   8.779  1.00  0.96           O  
ATOM   6308  N   GLU A 779      26.952  48.844   9.742  1.00  0.90           N  
ATOM   6309  CA  GLU A 779      26.833  50.149  10.376  1.00  0.90           C  
ATOM   6310  C   GLU A 779      26.388  50.104  11.823  1.00  0.90           C  
ATOM   6311  O   GLU A 779      26.968  50.758  12.688  1.00  0.90           O  
ATOM   6312  CB  GLU A 779      25.838  51.044   9.616  1.00  0.90           C  
ATOM   6313  CG  GLU A 779      26.483  51.829   8.459  1.00  0.90           C  
ATOM   6314  CD  GLU A 779      25.477  52.857   7.961  1.00  0.90           C  
ATOM   6315  OE1 GLU A 779      24.615  52.480   7.133  1.00  0.90           O  
ATOM   6316  OE2 GLU A 779      25.524  54.007   8.476  1.00  0.90           O  
ATOM   6317  N   ASP A 780      25.355  49.298  12.117  1.00  0.93           N  
ATOM   6318  CA  ASP A 780      24.812  49.150  13.443  1.00  0.93           C  
ATOM   6319  C   ASP A 780      25.810  48.489  14.393  1.00  0.93           C  
ATOM   6320  O   ASP A 780      25.987  48.906  15.536  1.00  0.93           O  
ATOM   6321  CB  ASP A 780      23.463  48.409  13.339  1.00  0.93           C  
ATOM   6322  CG  ASP A 780      22.595  48.784  14.523  1.00  0.93           C  
ATOM   6323  OD1 ASP A 780      22.344  50.004  14.697  1.00  0.93           O  
ATOM   6324  OD2 ASP A 780      22.185  47.852  15.259  1.00  0.93           O  
ATOM   6325  N   TYR A 781      26.568  47.483  13.901  1.00  0.95           N  
ATOM   6326  CA  TYR A 781      27.664  46.875  14.633  1.00  0.95           C  
ATOM   6327  C   TYR A 781      28.765  47.863  15.010  1.00  0.95           C  
ATOM   6328  O   TYR A 781      29.206  47.891  16.157  1.00  0.95           O  
ATOM   6329  CB  TYR A 781      28.257  45.717  13.785  1.00  0.95           C  
ATOM   6330  CG  TYR A 781      29.353  44.954  14.484  1.00  0.95           C  
ATOM   6331  CD1 TYR A 781      29.178  44.433  15.779  1.00  0.95           C  
ATOM   6332  CD2 TYR A 781      30.583  44.765  13.839  1.00  0.95           C  
ATOM   6333  CE1 TYR A 781      30.212  43.722  16.408  1.00  0.95           C  
ATOM   6334  CE2 TYR A 781      31.615  44.064  14.468  1.00  0.95           C  
ATOM   6335  CZ  TYR A 781      31.428  43.553  15.746  1.00  0.95           C  
ATOM   6336  OH  TYR A 781      32.481  42.866  16.354  1.00  0.95           O  
ATOM   6337  N   ILE A 782      29.210  48.740  14.079  1.00  0.92           N  
ATOM   6338  CA  ILE A 782      30.208  49.758  14.396  1.00  0.92           C  
ATOM   6339  C   ILE A 782      29.709  50.724  15.470  1.00  0.92           C  
ATOM   6340  O   ILE A 782      30.404  50.971  16.454  1.00  0.92           O  
ATOM   6341  CB  ILE A 782      30.677  50.527  13.158  1.00  0.92           C  
ATOM   6342  CG1 ILE A 782      31.290  49.612  12.066  1.00  0.92           C  
ATOM   6343  CG2 ILE A 782      31.698  51.625  13.530  1.00  0.92           C  
ATOM   6344  CD1 ILE A 782      32.484  48.751  12.489  1.00  0.92           C  
ATOM   6345  N   LYS A 783      28.456  51.215  15.354  1.00  0.87           N  
ATOM   6346  CA  LYS A 783      27.841  52.105  16.331  1.00  0.87           C  
ATOM   6347  C   LYS A 783      27.687  51.473  17.708  1.00  0.87           C  
ATOM   6348  O   LYS A 783      27.940  52.082  18.748  1.00  0.87           O  
ATOM   6349  CB  LYS A 783      26.451  52.576  15.838  1.00  0.87           C  
ATOM   6350  CG  LYS A 783      26.520  53.467  14.588  1.00  0.87           C  
ATOM   6351  CD  LYS A 783      25.125  53.907  14.110  1.00  0.87           C  
ATOM   6352  CE  LYS A 783      25.149  54.594  12.739  1.00  0.87           C  
ATOM   6353  NZ  LYS A 783      23.786  55.018  12.345  1.00  0.87           N  
ATOM   6354  N   CYS A 784      27.287  50.189  17.751  1.00  0.92           N  
ATOM   6355  CA  CYS A 784      27.198  49.425  18.975  1.00  0.92           C  
ATOM   6356  C   CYS A 784      28.544  49.254  19.657  1.00  0.92           C  
ATOM   6357  O   CYS A 784      28.670  49.408  20.868  1.00  0.92           O  
ATOM   6358  CB  CYS A 784      26.551  48.055  18.697  1.00  0.92           C  
ATOM   6359  SG  CYS A 784      25.982  47.245  20.227  1.00  0.92           S  
ATOM   6360  N   GLN A 785      29.608  48.999  18.876  1.00  0.91           N  
ATOM   6361  CA  GLN A 785      30.965  48.957  19.373  1.00  0.91           C  
ATOM   6362  C   GLN A 785      31.450  50.272  19.972  1.00  0.91           C  
ATOM   6363  O   GLN A 785      32.152  50.280  20.980  1.00  0.91           O  
ATOM   6364  CB  GLN A 785      31.938  48.479  18.276  1.00  0.91           C  
ATOM   6365  CG  GLN A 785      31.852  46.964  17.978  1.00  0.91           C  
ATOM   6366  CD  GLN A 785      32.474  46.107  19.085  1.00  0.91           C  
ATOM   6367  OE1 GLN A 785      32.664  46.541  20.227  1.00  0.91           O  
ATOM   6368  NE2 GLN A 785      32.839  44.866  18.709  1.00  0.91           N  
ATOM   6369  N   GLU A 786      31.063  51.428  19.386  1.00  0.86           N  
ATOM   6370  CA  GLU A 786      31.320  52.736  19.968  1.00  0.86           C  
ATOM   6371  C   GLU A 786      30.661  52.903  21.329  1.00  0.86           C  
ATOM   6372  O   GLU A 786      31.285  53.367  22.285  1.00  0.86           O  
ATOM   6373  CB  GLU A 786      30.891  53.873  19.008  1.00  0.86           C  
ATOM   6374  CG  GLU A 786      31.686  53.846  17.680  1.00  0.86           C  
ATOM   6375  CD  GLU A 786      31.200  54.882  16.667  1.00  0.86           C  
ATOM   6376  OE1 GLU A 786      29.982  54.937  16.381  1.00  0.86           O  
ATOM   6377  OE2 GLU A 786      32.084  55.588  16.105  1.00  0.86           O  
ATOM   6378  N   LYS A 787      29.402  52.435  21.464  1.00  0.85           N  
ATOM   6379  CA  LYS A 787      28.671  52.401  22.716  1.00  0.85           C  
ATOM   6380  C   LYS A 787      29.335  51.529  23.784  1.00  0.85           C  
ATOM   6381  O   LYS A 787      29.406  51.910  24.951  1.00  0.85           O  
ATOM   6382  CB  LYS A 787      27.203  51.969  22.467  1.00  0.85           C  
ATOM   6383  CG  LYS A 787      26.258  52.219  23.653  1.00  0.85           C  
ATOM   6384  CD  LYS A 787      24.836  51.688  23.398  1.00  0.85           C  
ATOM   6385  CE  LYS A 787      23.930  51.842  24.627  1.00  0.85           C  
ATOM   6386  NZ  LYS A 787      22.538  51.423  24.338  1.00  0.85           N  
ATOM   6387  N   VAL A 788      29.889  50.354  23.400  1.00  0.92           N  
ATOM   6388  CA  VAL A 788      30.686  49.511  24.289  1.00  0.92           C  
ATOM   6389  C   VAL A 788      31.910  50.229  24.834  1.00  0.92           C  
ATOM   6390  O   VAL A 788      32.166  50.256  26.040  1.00  0.92           O  
ATOM   6391  CB  VAL A 788      31.168  48.239  23.589  1.00  0.92           C  
ATOM   6392  CG1 VAL A 788      32.054  47.403  24.532  1.00  0.92           C  
ATOM   6393  CG2 VAL A 788      29.977  47.360  23.180  1.00  0.92           C  
ATOM   6394  N   SER A 789      32.684  50.891  23.955  1.00  0.91           N  
ATOM   6395  CA  SER A 789      33.855  51.658  24.351  1.00  0.91           C  
ATOM   6396  C   SER A 789      33.514  52.828  25.255  1.00  0.91           C  
ATOM   6397  O   SER A 789      34.238  53.129  26.199  1.00  0.91           O  
ATOM   6398  CB  SER A 789      34.633  52.187  23.127  1.00  0.91           C  
ATOM   6399  OG  SER A 789      35.170  51.107  22.352  1.00  0.91           O  
ATOM   6400  N   ALA A 790      32.384  53.517  25.002  1.00  0.89           N  
ATOM   6401  CA  ALA A 790      31.880  54.587  25.835  1.00  0.89           C  
ATOM   6402  C   ALA A 790      31.544  54.165  27.263  1.00  0.89           C  
ATOM   6403  O   ALA A 790      31.925  54.847  28.211  1.00  0.89           O  
ATOM   6404  CB  ALA A 790      30.656  55.218  25.148  1.00  0.89           C  
ATOM   6405  N   LEU A 791      30.880  53.005  27.464  1.00  0.88           N  
ATOM   6406  CA  LEU A 791      30.643  52.467  28.796  1.00  0.88           C  
ATOM   6407  C   LEU A 791      31.920  52.073  29.522  1.00  0.88           C  
ATOM   6408  O   LEU A 791      32.053  52.282  30.724  1.00  0.88           O  
ATOM   6409  CB  LEU A 791      29.666  51.272  28.772  1.00  0.88           C  
ATOM   6410  CG  LEU A 791      29.298  50.708  30.165  1.00  0.88           C  
ATOM   6411  CD1 LEU A 791      28.530  51.717  31.031  1.00  0.88           C  
ATOM   6412  CD2 LEU A 791      28.465  49.436  30.015  1.00  0.88           C  
ATOM   6413  N   TYR A 792      32.924  51.528  28.802  1.00  0.90           N  
ATOM   6414  CA  TYR A 792      34.186  51.095  29.387  1.00  0.90           C  
ATOM   6415  C   TYR A 792      35.007  52.261  29.943  1.00  0.90           C  
ATOM   6416  O   TYR A 792      35.854  52.098  30.816  1.00  0.90           O  
ATOM   6417  CB  TYR A 792      34.987  50.291  28.327  1.00  0.90           C  
ATOM   6418  CG  TYR A 792      36.091  49.456  28.939  1.00  0.90           C  
ATOM   6419  CD1 TYR A 792      35.823  48.190  29.487  1.00  0.90           C  
ATOM   6420  CD2 TYR A 792      37.415  49.923  28.956  1.00  0.90           C  
ATOM   6421  CE1 TYR A 792      36.846  47.428  30.075  1.00  0.90           C  
ATOM   6422  CE2 TYR A 792      38.440  49.164  29.538  1.00  0.90           C  
ATOM   6423  CZ  TYR A 792      38.155  47.923  30.114  1.00  0.90           C  
ATOM   6424  OH  TYR A 792      39.198  47.187  30.722  1.00  0.90           O  
ATOM   6425  N   LYS A 793      34.716  53.503  29.503  1.00  0.84           N  
ATOM   6426  CA  LYS A 793      35.286  54.699  30.094  1.00  0.84           C  
ATOM   6427  C   LYS A 793      34.745  55.008  31.487  1.00  0.84           C  
ATOM   6428  O   LYS A 793      35.298  55.841  32.199  1.00  0.84           O  
ATOM   6429  CB  LYS A 793      35.030  55.940  29.214  1.00  0.84           C  
ATOM   6430  CG  LYS A 793      35.666  55.861  27.823  1.00  0.84           C  
ATOM   6431  CD  LYS A 793      35.393  57.151  27.038  1.00  0.84           C  
ATOM   6432  CE  LYS A 793      35.996  57.146  25.635  1.00  0.84           C  
ATOM   6433  NZ  LYS A 793      35.811  58.471  25.005  1.00  0.84           N  
ATOM   6434  N   ASN A 794      33.655  54.339  31.922  1.00  0.83           N  
ATOM   6435  CA  ASN A 794      33.146  54.427  33.273  1.00  0.83           C  
ATOM   6436  C   ASN A 794      33.304  53.056  33.940  1.00  0.83           C  
ATOM   6437  O   ASN A 794      32.400  52.221  33.841  1.00  0.83           O  
ATOM   6438  CB  ASN A 794      31.652  54.848  33.195  1.00  0.83           C  
ATOM   6439  CG  ASN A 794      31.080  55.265  34.546  1.00  0.83           C  
ATOM   6440  OD1 ASN A 794      31.418  54.742  35.608  1.00  0.83           O  
ATOM   6441  ND2 ASN A 794      30.144  56.244  34.497  1.00  0.83           N  
ATOM   6442  N   PRO A 795      34.396  52.768  34.662  1.00  0.86           N  
ATOM   6443  CA  PRO A 795      34.634  51.433  35.199  1.00  0.86           C  
ATOM   6444  C   PRO A 795      33.616  51.016  36.227  1.00  0.86           C  
ATOM   6445  O   PRO A 795      33.336  49.828  36.360  1.00  0.86           O  
ATOM   6446  CB  PRO A 795      36.036  51.525  35.822  1.00  0.86           C  
ATOM   6447  CG  PRO A 795      36.751  52.535  34.928  1.00  0.86           C  
ATOM   6448  CD  PRO A 795      35.645  53.536  34.595  1.00  0.86           C  
ATOM   6449  N   ARG A 796      33.060  51.977  36.991  1.00  0.81           N  
ATOM   6450  CA  ARG A 796      32.033  51.679  37.958  1.00  0.81           C  
ATOM   6451  C   ARG A 796      30.759  51.176  37.308  1.00  0.81           C  
ATOM   6452  O   ARG A 796      30.284  50.092  37.638  1.00  0.81           O  
ATOM   6453  CB  ARG A 796      31.712  52.943  38.783  1.00  0.81           C  
ATOM   6454  CG  ARG A 796      30.607  52.719  39.826  1.00  0.81           C  
ATOM   6455  CD  ARG A 796      30.211  53.997  40.552  1.00  0.81           C  
ATOM   6456  NE  ARG A 796      29.096  53.622  41.468  1.00  0.81           N  
ATOM   6457  CZ  ARG A 796      29.306  53.106  42.684  1.00  0.81           C  
ATOM   6458  NH1 ARG A 796      30.520  52.782  43.090  1.00  0.81           N  
ATOM   6459  NH2 ARG A 796      28.308  52.999  43.543  1.00  0.81           N  
ATOM   6460  N   GLU A 797      30.213  51.917  36.322  1.00  0.85           N  
ATOM   6461  CA  GLU A 797      28.982  51.527  35.662  1.00  0.85           C  
ATOM   6462  C   GLU A 797      29.140  50.304  34.773  1.00  0.85           C  
ATOM   6463  O   GLU A 797      28.228  49.481  34.693  1.00  0.85           O  
ATOM   6464  CB  GLU A 797      28.294  52.712  34.940  1.00  0.85           C  
ATOM   6465  CG  GLU A 797      27.791  53.830  35.894  1.00  0.85           C  
ATOM   6466  CD  GLU A 797      26.970  53.250  37.010  1.00  0.85           C  
ATOM   6467  OE1 GLU A 797      25.817  52.860  36.713  1.00  0.85           O  
ATOM   6468  OE2 GLU A 797      27.435  53.137  38.178  1.00  0.85           O  
ATOM   6469  N   TRP A 798      30.324  50.093  34.143  1.00  0.89           N  
ATOM   6470  CA  TRP A 798      30.638  48.843  33.460  1.00  0.89           C  
ATOM   6471  C   TRP A 798      30.541  47.647  34.403  1.00  0.89           C  
ATOM   6472  O   TRP A 798      29.835  46.684  34.132  1.00  0.89           O  
ATOM   6473  CB  TRP A 798      32.063  48.896  32.822  1.00  0.89           C  
ATOM   6474  CG  TRP A 798      32.533  47.627  32.105  1.00  0.89           C  
ATOM   6475  CD1 TRP A 798      33.052  46.479  32.645  1.00  0.89           C  
ATOM   6476  CD2 TRP A 798      32.468  47.386  30.685  1.00  0.89           C  
ATOM   6477  NE1 TRP A 798      33.283  45.530  31.667  1.00  0.89           N  
ATOM   6478  CE2 TRP A 798      32.926  46.085  30.458  1.00  0.89           C  
ATOM   6479  CE3 TRP A 798      32.047  48.196  29.632  1.00  0.89           C  
ATOM   6480  CZ2 TRP A 798      32.957  45.538  29.180  1.00  0.89           C  
ATOM   6481  CZ3 TRP A 798      32.096  47.657  28.339  1.00  0.89           C  
ATOM   6482  CH2 TRP A 798      32.541  46.349  28.113  1.00  0.89           C  
ATOM   6483  N   THR A 799      31.189  47.712  35.582  1.00  0.91           N  
ATOM   6484  CA  THR A 799      31.100  46.654  36.585  1.00  0.91           C  
ATOM   6485  C   THR A 799      29.711  46.477  37.176  1.00  0.91           C  
ATOM   6486  O   THR A 799      29.261  45.355  37.394  1.00  0.91           O  
ATOM   6487  CB  THR A 799      32.124  46.796  37.688  1.00  0.91           C  
ATOM   6488  OG1 THR A 799      33.424  46.737  37.122  1.00  0.91           O  
ATOM   6489  CG2 THR A 799      32.043  45.620  38.667  1.00  0.91           C  
ATOM   6490  N   ARG A 800      28.941  47.560  37.423  1.00  0.87           N  
ATOM   6491  CA  ARG A 800      27.555  47.433  37.854  1.00  0.87           C  
ATOM   6492  C   ARG A 800      26.692  46.713  36.825  1.00  0.87           C  
ATOM   6493  O   ARG A 800      25.876  45.858  37.161  1.00  0.87           O  
ATOM   6494  CB  ARG A 800      26.887  48.787  38.204  1.00  0.87           C  
ATOM   6495  CG  ARG A 800      27.568  49.563  39.351  1.00  0.87           C  
ATOM   6496  CD  ARG A 800      26.627  50.412  40.223  1.00  0.87           C  
ATOM   6497  NE  ARG A 800      25.857  51.309  39.312  1.00  0.87           N  
ATOM   6498  CZ  ARG A 800      24.532  51.495  39.331  1.00  0.87           C  
ATOM   6499  NH1 ARG A 800      23.723  50.983  40.231  1.00  0.87           N  
ATOM   6500  NH2 ARG A 800      24.003  52.265  38.385  1.00  0.87           N  
ATOM   6501  N   MET A 801      26.893  47.006  35.525  1.00  0.92           N  
ATOM   6502  CA  MET A 801      26.264  46.295  34.429  1.00  0.92           C  
ATOM   6503  C   MET A 801      26.680  44.828  34.357  1.00  0.92           C  
ATOM   6504  O   MET A 801      25.861  43.944  34.104  1.00  0.92           O  
ATOM   6505  CB  MET A 801      26.500  47.045  33.098  1.00  0.92           C  
ATOM   6506  CG  MET A 801      25.535  46.638  31.970  1.00  0.92           C  
ATOM   6507  SD  MET A 801      25.500  47.821  30.590  1.00  0.92           S  
ATOM   6508  CE  MET A 801      25.939  46.660  29.272  1.00  0.92           C  
ATOM   6509  N   VAL A 802      27.966  44.519  34.646  1.00  0.95           N  
ATOM   6510  CA  VAL A 802      28.462  43.155  34.794  1.00  0.95           C  
ATOM   6511  C   VAL A 802      27.738  42.395  35.902  1.00  0.95           C  
ATOM   6512  O   VAL A 802      27.282  41.274  35.698  1.00  0.95           O  
ATOM   6513  CB  VAL A 802      29.972  43.117  35.036  1.00  0.95           C  
ATOM   6514  CG1 VAL A 802      30.442  41.704  35.421  1.00  0.95           C  
ATOM   6515  CG2 VAL A 802      30.718  43.541  33.758  1.00  0.95           C  
ATOM   6516  N   ILE A 803      27.533  43.018  37.083  1.00  0.93           N  
ATOM   6517  CA  ILE A 803      26.779  42.443  38.196  1.00  0.93           C  
ATOM   6518  C   ILE A 803      25.345  42.113  37.808  1.00  0.93           C  
ATOM   6519  O   ILE A 803      24.836  41.033  38.110  1.00  0.93           O  
ATOM   6520  CB  ILE A 803      26.803  43.358  39.425  1.00  0.93           C  
ATOM   6521  CG1 ILE A 803      28.251  43.499  39.952  1.00  0.93           C  
ATOM   6522  CG2 ILE A 803      25.877  42.816  40.543  1.00  0.93           C  
ATOM   6523  CD1 ILE A 803      28.437  44.665  40.931  1.00  0.93           C  
ATOM   6524  N   ARG A 804      24.676  43.012  37.056  1.00  0.89           N  
ATOM   6525  CA  ARG A 804      23.351  42.782  36.509  1.00  0.89           C  
ATOM   6526  C   ARG A 804      23.275  41.596  35.547  1.00  0.89           C  
ATOM   6527  O   ARG A 804      22.261  40.920  35.495  1.00  0.89           O  
ATOM   6528  CB  ARG A 804      22.779  44.069  35.860  1.00  0.89           C  
ATOM   6529  CG  ARG A 804      22.584  45.223  36.870  1.00  0.89           C  
ATOM   6530  CD  ARG A 804      21.979  46.488  36.239  1.00  0.89           C  
ATOM   6531  NE  ARG A 804      22.013  47.635  37.216  1.00  0.89           N  
ATOM   6532  CZ  ARG A 804      21.217  47.777  38.286  1.00  0.89           C  
ATOM   6533  NH1 ARG A 804      20.319  46.855  38.613  1.00  0.89           N  
ATOM   6534  NH2 ARG A 804      21.352  48.858  39.055  1.00  0.89           N  
ATOM   6535  N   ASN A 805      24.356  41.321  34.778  1.00  0.95           N  
ATOM   6536  CA  ASN A 805      24.473  40.138  33.937  1.00  0.95           C  
ATOM   6537  C   ASN A 805      24.760  38.846  34.700  1.00  0.95           C  
ATOM   6538  O   ASN A 805      24.142  37.815  34.449  1.00  0.95           O  
ATOM   6539  CB  ASN A 805      25.590  40.335  32.879  1.00  0.95           C  
ATOM   6540  CG  ASN A 805      25.077  41.089  31.658  1.00  0.95           C  
ATOM   6541  OD1 ASN A 805      24.811  40.493  30.615  1.00  0.95           O  
ATOM   6542  ND2 ASN A 805      24.950  42.428  31.767  1.00  0.95           N  
ATOM   6543  N   ILE A 806      25.704  38.850  35.666  1.00  0.96           N  
ATOM   6544  CA  ILE A 806      26.059  37.657  36.436  1.00  0.96           C  
ATOM   6545  C   ILE A 806      24.888  37.155  37.260  1.00  0.96           C  
ATOM   6546  O   ILE A 806      24.600  35.965  37.318  1.00  0.96           O  
ATOM   6547  CB  ILE A 806      27.260  37.892  37.353  1.00  0.96           C  
ATOM   6548  CG1 ILE A 806      28.518  38.193  36.506  1.00  0.96           C  
ATOM   6549  CG2 ILE A 806      27.530  36.660  38.259  1.00  0.96           C  
ATOM   6550  CD1 ILE A 806      29.698  38.709  37.339  1.00  0.96           C  
ATOM   6551  N   ALA A 807      24.145  38.081  37.890  1.00  0.95           N  
ATOM   6552  CA  ALA A 807      23.070  37.764  38.798  1.00  0.95           C  
ATOM   6553  C   ALA A 807      21.830  37.193  38.116  1.00  0.95           C  
ATOM   6554  O   ALA A 807      20.968  36.582  38.740  1.00  0.95           O  
ATOM   6555  CB  ALA A 807      22.703  39.057  39.534  1.00  0.95           C  
ATOM   6556  N   THR A 808      21.710  37.360  36.792  1.00  0.94           N  
ATOM   6557  CA  THR A 808      20.573  36.891  36.021  1.00  0.94           C  
ATOM   6558  C   THR A 808      20.951  35.732  35.131  1.00  0.94           C  
ATOM   6559  O   THR A 808      20.183  35.292  34.283  1.00  0.94           O  
ATOM   6560  CB  THR A 808      19.993  37.988  35.159  1.00  0.94           C  
ATOM   6561  OG1 THR A 808      21.005  38.568  34.349  1.00  0.94           O  
ATOM   6562  CG2 THR A 808      19.438  39.082  36.083  1.00  0.94           C  
ATOM   6563  N   SER A 809      22.143  35.138  35.336  1.00  0.96           N  
ATOM   6564  CA  SER A 809      22.610  34.070  34.471  1.00  0.96           C  
ATOM   6565  C   SER A 809      22.098  32.710  34.911  1.00  0.96           C  
ATOM   6566  O   SER A 809      22.307  31.710  34.227  1.00  0.96           O  
ATOM   6567  CB  SER A 809      24.160  34.036  34.398  1.00  0.96           C  
ATOM   6568  OG  SER A 809      24.759  33.615  35.622  1.00  0.96           O  
ATOM   6569  N   GLY A 810      21.367  32.673  36.051  1.00  0.95           N  
ATOM   6570  CA  GLY A 810      20.789  31.495  36.698  1.00  0.95           C  
ATOM   6571  C   GLY A 810      20.115  30.504  35.800  1.00  0.95           C  
ATOM   6572  O   GLY A 810      20.447  29.319  35.787  1.00  0.95           O  
ATOM   6573  N   LYS A 811      19.213  31.010  34.937  1.00  0.92           N  
ATOM   6574  CA  LYS A 811      18.470  30.252  33.958  1.00  0.92           C  
ATOM   6575  C   LYS A 811      19.345  29.399  33.054  1.00  0.92           C  
ATOM   6576  O   LYS A 811      18.945  28.347  32.573  1.00  0.92           O  
ATOM   6577  CB  LYS A 811      17.651  31.218  33.067  1.00  0.92           C  
ATOM   6578  CG  LYS A 811      16.955  30.543  31.875  1.00  0.92           C  
ATOM   6579  CD  LYS A 811      16.040  31.503  31.123  1.00  0.92           C  
ATOM   6580  CE  LYS A 811      15.438  30.872  29.878  1.00  0.92           C  
ATOM   6581  NZ  LYS A 811      14.562  31.819  29.170  1.00  0.92           N  
ATOM   6582  N   PHE A 812      20.593  29.820  32.801  1.00  0.96           N  
ATOM   6583  CA  PHE A 812      21.454  29.179  31.837  1.00  0.96           C  
ATOM   6584  C   PHE A 812      22.344  28.125  32.462  1.00  0.96           C  
ATOM   6585  O   PHE A 812      23.289  27.648  31.841  1.00  0.96           O  
ATOM   6586  CB  PHE A 812      22.294  30.225  31.077  1.00  0.96           C  
ATOM   6587  CG  PHE A 812      21.340  31.190  30.431  1.00  0.96           C  
ATOM   6588  CD1 PHE A 812      20.609  30.824  29.288  1.00  0.96           C  
ATOM   6589  CD2 PHE A 812      21.068  32.422  31.041  1.00  0.96           C  
ATOM   6590  CE1 PHE A 812      19.613  31.666  28.777  1.00  0.96           C  
ATOM   6591  CE2 PHE A 812      20.076  33.266  30.537  1.00  0.96           C  
ATOM   6592  CZ  PHE A 812      19.338  32.881  29.414  1.00  0.96           C  
ATOM   6593  N   SER A 813      22.054  27.673  33.696  1.00  0.97           N  
ATOM   6594  CA  SER A 813      22.579  26.403  34.177  1.00  0.97           C  
ATOM   6595  C   SER A 813      22.055  25.221  33.374  1.00  0.97           C  
ATOM   6596  O   SER A 813      20.868  25.140  33.056  1.00  0.97           O  
ATOM   6597  CB  SER A 813      22.229  26.142  35.662  1.00  0.97           C  
ATOM   6598  OG  SER A 813      22.794  24.905  36.113  1.00  0.97           O  
ATOM   6599  N   SER A 814      22.911  24.219  33.079  1.00  0.97           N  
ATOM   6600  CA  SER A 814      22.462  22.967  32.492  1.00  0.97           C  
ATOM   6601  C   SER A 814      21.688  22.110  33.465  1.00  0.97           C  
ATOM   6602  O   SER A 814      20.987  21.196  33.043  1.00  0.97           O  
ATOM   6603  CB  SER A 814      23.539  22.138  31.739  1.00  0.97           C  
ATOM   6604  OG  SER A 814      24.695  21.846  32.523  1.00  0.97           O  
ATOM   6605  N   ASP A 815      21.715  22.413  34.782  1.00  0.96           N  
ATOM   6606  CA  ASP A 815      20.834  21.766  35.733  1.00  0.96           C  
ATOM   6607  C   ASP A 815      19.377  22.103  35.451  1.00  0.96           C  
ATOM   6608  O   ASP A 815      18.515  21.229  35.407  1.00  0.96           O  
ATOM   6609  CB  ASP A 815      21.198  22.128  37.188  1.00  0.96           C  
ATOM   6610  CG  ASP A 815      22.681  21.912  37.398  1.00  0.96           C  
ATOM   6611  OD1 ASP A 815      23.241  20.874  36.950  1.00  0.96           O  
ATOM   6612  OD2 ASP A 815      23.327  22.816  37.993  1.00  0.96           O  
ATOM   6613  N   ARG A 816      19.075  23.389  35.157  1.00  0.90           N  
ATOM   6614  CA  ARG A 816      17.744  23.820  34.769  1.00  0.90           C  
ATOM   6615  C   ARG A 816      17.310  23.140  33.483  1.00  0.90           C  
ATOM   6616  O   ARG A 816      16.198  22.623  33.378  1.00  0.90           O  
ATOM   6617  CB  ARG A 816      17.693  25.369  34.630  1.00  0.90           C  
ATOM   6618  CG  ARG A 816      16.305  25.994  34.325  1.00  0.90           C  
ATOM   6619  CD  ARG A 816      15.825  25.942  32.859  1.00  0.90           C  
ATOM   6620  NE  ARG A 816      16.816  26.691  32.031  1.00  0.90           N  
ATOM   6621  CZ  ARG A 816      17.168  26.404  30.784  1.00  0.90           C  
ATOM   6622  NH1 ARG A 816      16.469  25.583  30.026  1.00  0.90           N  
ATOM   6623  NH2 ARG A 816      18.276  26.949  30.279  1.00  0.90           N  
ATOM   6624  N   THR A 817      18.207  23.081  32.482  1.00  0.96           N  
ATOM   6625  CA  THR A 817      17.956  22.436  31.200  1.00  0.96           C  
ATOM   6626  C   THR A 817      17.637  20.962  31.328  1.00  0.96           C  
ATOM   6627  O   THR A 817      16.627  20.482  30.818  1.00  0.96           O  
ATOM   6628  CB  THR A 817      19.155  22.597  30.280  1.00  0.96           C  
ATOM   6629  OG1 THR A 817      19.501  23.970  30.214  1.00  0.96           O  
ATOM   6630  CG2 THR A 817      18.845  22.137  28.853  1.00  0.96           C  
ATOM   6631  N   ILE A 818      18.458  20.209  32.083  1.00  0.96           N  
ATOM   6632  CA  ILE A 818      18.242  18.798  32.365  1.00  0.96           C  
ATOM   6633  C   ILE A 818      16.995  18.536  33.182  1.00  0.96           C  
ATOM   6634  O   ILE A 818      16.275  17.573  32.927  1.00  0.96           O  
ATOM   6635  CB  ILE A 818      19.476  18.172  32.994  1.00  0.96           C  
ATOM   6636  CG1 ILE A 818      20.614  18.056  31.947  1.00  0.96           C  
ATOM   6637  CG2 ILE A 818      19.186  16.790  33.620  1.00  0.96           C  
ATOM   6638  CD1 ILE A 818      20.286  17.189  30.725  1.00  0.96           C  
ATOM   6639  N   ALA A 819      16.660  19.404  34.158  1.00  0.95           N  
ATOM   6640  CA  ALA A 819      15.435  19.291  34.920  1.00  0.95           C  
ATOM   6641  C   ALA A 819      14.187  19.337  34.044  1.00  0.95           C  
ATOM   6642  O   ALA A 819      13.247  18.566  34.233  1.00  0.95           O  
ATOM   6643  CB  ALA A 819      15.385  20.397  35.993  1.00  0.95           C  
ATOM   6644  N   GLN A 820      14.177  20.218  33.028  1.00  0.92           N  
ATOM   6645  CA  GLN A 820      13.151  20.236  32.009  1.00  0.92           C  
ATOM   6646  C   GLN A 820      13.146  19.001  31.107  1.00  0.92           C  
ATOM   6647  O   GLN A 820      12.094  18.422  30.857  1.00  0.92           O  
ATOM   6648  CB  GLN A 820      13.257  21.537  31.189  1.00  0.92           C  
ATOM   6649  CG  GLN A 820      13.061  22.791  32.069  1.00  0.92           C  
ATOM   6650  CD  GLN A 820      13.064  24.065  31.229  1.00  0.92           C  
ATOM   6651  OE1 GLN A 820      14.082  24.468  30.671  1.00  0.92           O  
ATOM   6652  NE2 GLN A 820      11.902  24.757  31.173  1.00  0.92           N  
ATOM   6653  N   TYR A 821      14.314  18.511  30.615  1.00  0.95           N  
ATOM   6654  CA  TYR A 821      14.387  17.280  29.819  1.00  0.95           C  
ATOM   6655  C   TYR A 821      13.846  16.084  30.600  1.00  0.95           C  
ATOM   6656  O   TYR A 821      13.072  15.273  30.092  1.00  0.95           O  
ATOM   6657  CB  TYR A 821      15.847  16.925  29.388  1.00  0.95           C  
ATOM   6658  CG  TYR A 821      16.317  17.527  28.080  1.00  0.95           C  
ATOM   6659  CD1 TYR A 821      16.097  16.860  26.860  1.00  0.95           C  
ATOM   6660  CD2 TYR A 821      17.096  18.693  28.061  1.00  0.95           C  
ATOM   6661  CE1 TYR A 821      16.612  17.367  25.654  1.00  0.95           C  
ATOM   6662  CE2 TYR A 821      17.610  19.206  26.860  1.00  0.95           C  
ATOM   6663  CZ  TYR A 821      17.375  18.537  25.657  1.00  0.95           C  
ATOM   6664  OH  TYR A 821      17.936  19.038  24.462  1.00  0.95           O  
ATOM   6665  N   ALA A 822      14.217  15.989  31.890  1.00  0.95           N  
ATOM   6666  CA  ALA A 822      13.775  14.965  32.801  1.00  0.95           C  
ATOM   6667  C   ALA A 822      12.273  14.926  33.013  1.00  0.95           C  
ATOM   6668  O   ALA A 822      11.643  13.888  32.824  1.00  0.95           O  
ATOM   6669  CB  ALA A 822      14.491  15.191  34.148  1.00  0.95           C  
ATOM   6670  N   ARG A 823      11.664  16.077  33.344  1.00  0.86           N  
ATOM   6671  CA  ARG A 823      10.240  16.176  33.583  1.00  0.86           C  
ATOM   6672  C   ARG A 823       9.381  16.148  32.322  1.00  0.86           C  
ATOM   6673  O   ARG A 823       8.381  15.441  32.261  1.00  0.86           O  
ATOM   6674  CB  ARG A 823       9.954  17.459  34.394  1.00  0.86           C  
ATOM   6675  CG  ARG A 823      10.467  17.358  35.847  1.00  0.86           C  
ATOM   6676  CD  ARG A 823      10.560  18.710  36.559  1.00  0.86           C  
ATOM   6677  NE  ARG A 823      10.961  18.449  37.977  1.00  0.86           N  
ATOM   6678  CZ  ARG A 823      11.600  19.305  38.781  1.00  0.86           C  
ATOM   6679  NH1 ARG A 823      12.001  20.500  38.352  1.00  0.86           N  
ATOM   6680  NH2 ARG A 823      11.859  18.972  40.038  1.00  0.86           N  
ATOM   6681  N   GLU A 824       9.752  16.903  31.265  1.00  0.90           N  
ATOM   6682  CA  GLU A 824       8.878  17.124  30.125  1.00  0.90           C  
ATOM   6683  C   GLU A 824       9.128  16.159  28.965  1.00  0.90           C  
ATOM   6684  O   GLU A 824       8.346  16.109  28.015  1.00  0.90           O  
ATOM   6685  CB  GLU A 824       9.099  18.564  29.590  1.00  0.90           C  
ATOM   6686  CG  GLU A 824       8.711  19.700  30.575  1.00  0.90           C  
ATOM   6687  CD  GLU A 824       9.418  21.014  30.249  1.00  0.90           C  
ATOM   6688  OE1 GLU A 824       9.371  21.457  29.070  1.00  0.90           O  
ATOM   6689  OE2 GLU A 824      10.079  21.575  31.161  1.00  0.90           O  
ATOM   6690  N   ILE A 825      10.208  15.345  28.998  1.00  0.94           N  
ATOM   6691  CA  ILE A 825      10.466  14.366  27.942  1.00  0.94           C  
ATOM   6692  C   ILE A 825      10.679  12.980  28.514  1.00  0.94           C  
ATOM   6693  O   ILE A 825      10.057  12.011  28.078  1.00  0.94           O  
ATOM   6694  CB  ILE A 825      11.683  14.725  27.076  1.00  0.94           C  
ATOM   6695  CG1 ILE A 825      11.425  16.046  26.316  1.00  0.94           C  
ATOM   6696  CG2 ILE A 825      11.993  13.595  26.062  1.00  0.94           C  
ATOM   6697  CD1 ILE A 825      12.635  16.568  25.534  1.00  0.94           C  
ATOM   6698  N   TRP A 826      11.588  12.828  29.498  1.00  0.91           N  
ATOM   6699  CA  TRP A 826      11.977  11.512  29.970  1.00  0.91           C  
ATOM   6700  C   TRP A 826      11.006  10.898  30.971  1.00  0.91           C  
ATOM   6701  O   TRP A 826      10.895   9.673  31.058  1.00  0.91           O  
ATOM   6702  CB  TRP A 826      13.427  11.549  30.535  1.00  0.91           C  
ATOM   6703  CG  TRP A 826      14.475  11.970  29.517  1.00  0.91           C  
ATOM   6704  CD1 TRP A 826      14.450  11.782  28.162  1.00  0.91           C  
ATOM   6705  CD2 TRP A 826      15.704  12.712  29.758  1.00  0.91           C  
ATOM   6706  NE1 TRP A 826      15.540  12.363  27.535  1.00  0.91           N  
ATOM   6707  CE2 TRP A 826      16.310  12.929  28.545  1.00  0.91           C  
ATOM   6708  CE3 TRP A 826      16.267  13.188  30.955  1.00  0.91           C  
ATOM   6709  CZ2 TRP A 826      17.514  13.634  28.420  1.00  0.91           C  
ATOM   6710  CZ3 TRP A 826      17.477  13.899  30.852  1.00  0.91           C  
ATOM   6711  CH2 TRP A 826      18.085  14.122  29.614  1.00  0.91           C  
ATOM   6712  N   GLY A 827      10.237  11.710  31.723  1.00  0.93           N  
ATOM   6713  CA  GLY A 827       9.277  11.207  32.702  1.00  0.93           C  
ATOM   6714  C   GLY A 827       9.919  10.787  33.996  1.00  0.93           C  
ATOM   6715  O   GLY A 827       9.448   9.871  34.664  1.00  0.93           O  
ATOM   6716  N   VAL A 828      11.032  11.439  34.373  1.00  0.92           N  
ATOM   6717  CA  VAL A 828      11.732  11.173  35.616  1.00  0.92           C  
ATOM   6718  C   VAL A 828      11.836  12.464  36.401  1.00  0.92           C  
ATOM   6719  O   VAL A 828      11.865  13.556  35.841  1.00  0.92           O  
ATOM   6720  CB  VAL A 828      13.128  10.571  35.435  1.00  0.92           C  
ATOM   6721  CG1 VAL A 828      13.034   9.277  34.609  1.00  0.92           C  
ATOM   6722  CG2 VAL A 828      14.093  11.544  34.738  1.00  0.92           C  
ATOM   6723  N   GLU A 829      11.899  12.374  37.740  1.00  0.86           N  
ATOM   6724  CA  GLU A 829      12.017  13.541  38.591  1.00  0.86           C  
ATOM   6725  C   GLU A 829      13.472  13.746  39.019  1.00  0.86           C  
ATOM   6726  O   GLU A 829      14.082  12.794  39.513  1.00  0.86           O  
ATOM   6727  CB  GLU A 829      11.089  13.384  39.815  1.00  0.86           C  
ATOM   6728  CG  GLU A 829      11.061  14.562  40.829  1.00  0.86           C  
ATOM   6729  CD  GLU A 829      10.662  15.926  40.278  1.00  0.86           C  
ATOM   6730  OE1 GLU A 829      10.363  16.090  39.068  1.00  0.86           O  
ATOM   6731  OE2 GLU A 829      10.716  16.899  41.073  1.00  0.86           O  
ATOM   6732  N   PRO A 830      14.108  14.906  38.823  1.00  0.93           N  
ATOM   6733  CA  PRO A 830      15.386  15.260  39.440  1.00  0.93           C  
ATOM   6734  C   PRO A 830      15.493  15.028  40.944  1.00  0.93           C  
ATOM   6735  O   PRO A 830      14.507  15.149  41.660  1.00  0.93           O  
ATOM   6736  CB  PRO A 830      15.570  16.749  39.080  1.00  0.93           C  
ATOM   6737  CG  PRO A 830      14.730  16.936  37.816  1.00  0.93           C  
ATOM   6738  CD  PRO A 830      13.538  16.036  38.098  1.00  0.93           C  
ATOM   6739  N   SER A 831      16.696  14.733  41.464  1.00  0.88           N  
ATOM   6740  CA  SER A 831      16.881  14.500  42.885  1.00  0.88           C  
ATOM   6741  C   SER A 831      18.176  15.141  43.342  1.00  0.88           C  
ATOM   6742  O   SER A 831      19.172  15.166  42.636  1.00  0.88           O  
ATOM   6743  CB  SER A 831      16.935  12.990  43.205  1.00  0.88           C  
ATOM   6744  OG  SER A 831      17.013  12.750  44.618  1.00  0.88           O  
ATOM   6745  N   ARG A 832      18.185  15.715  44.560  1.00  0.80           N  
ATOM   6746  CA  ARG A 832      19.385  16.299  45.137  1.00  0.80           C  
ATOM   6747  C   ARG A 832      19.760  15.583  46.418  1.00  0.80           C  
ATOM   6748  O   ARG A 832      20.673  15.989  47.136  1.00  0.80           O  
ATOM   6749  CB  ARG A 832      19.172  17.809  45.430  1.00  0.80           C  
ATOM   6750  CG  ARG A 832      19.414  18.738  44.217  1.00  0.80           C  
ATOM   6751  CD  ARG A 832      20.842  19.309  44.097  1.00  0.80           C  
ATOM   6752  NE  ARG A 832      21.806  18.222  43.692  1.00  0.80           N  
ATOM   6753  CZ  ARG A 832      23.099  18.183  44.039  1.00  0.80           C  
ATOM   6754  NH1 ARG A 832      23.691  19.155  44.723  1.00  0.80           N  
ATOM   6755  NH2 ARG A 832      23.855  17.157  43.678  1.00  0.80           N  
ATOM   6756  N   GLN A 833      19.075  14.465  46.740  1.00  0.79           N  
ATOM   6757  CA  GLN A 833      19.467  13.643  47.867  1.00  0.79           C  
ATOM   6758  C   GLN A 833      20.743  12.878  47.559  1.00  0.79           C  
ATOM   6759  O   GLN A 833      21.092  12.652  46.407  1.00  0.79           O  
ATOM   6760  CB  GLN A 833      18.330  12.731  48.385  1.00  0.79           C  
ATOM   6761  CG  GLN A 833      18.061  11.472  47.524  1.00  0.79           C  
ATOM   6762  CD  GLN A 833      16.716  10.781  47.778  1.00  0.79           C  
ATOM   6763  OE1 GLN A 833      16.461   9.703  47.247  1.00  0.79           O  
ATOM   6764  NE2 GLN A 833      15.823  11.397  48.584  1.00  0.79           N  
ATOM   6765  N   ARG A 834      21.508  12.511  48.599  1.00  0.77           N  
ATOM   6766  CA  ARG A 834      22.854  12.019  48.414  1.00  0.77           C  
ATOM   6767  C   ARG A 834      22.972  10.578  48.849  1.00  0.77           C  
ATOM   6768  O   ARG A 834      22.354  10.154  49.820  1.00  0.77           O  
ATOM   6769  CB  ARG A 834      23.867  12.860  49.217  1.00  0.77           C  
ATOM   6770  CG  ARG A 834      23.958  14.334  48.779  1.00  0.77           C  
ATOM   6771  CD  ARG A 834      23.093  15.326  49.552  1.00  0.77           C  
ATOM   6772  NE  ARG A 834      23.552  15.384  50.977  1.00  0.77           N  
ATOM   6773  CZ  ARG A 834      24.651  16.023  51.415  1.00  0.77           C  
ATOM   6774  NH1 ARG A 834      25.488  16.623  50.581  1.00  0.77           N  
ATOM   6775  NH2 ARG A 834      24.901  16.061  52.722  1.00  0.77           N  
ATOM   6776  N   LEU A 835      23.785   9.789  48.117  1.00  0.78           N  
ATOM   6777  CA  LEU A 835      24.117   8.427  48.496  1.00  0.78           C  
ATOM   6778  C   LEU A 835      25.110   8.455  49.659  1.00  0.78           C  
ATOM   6779  O   LEU A 835      25.861   9.430  49.759  1.00  0.78           O  
ATOM   6780  CB  LEU A 835      24.679   7.618  47.294  1.00  0.78           C  
ATOM   6781  CG  LEU A 835      23.781   7.627  46.035  1.00  0.78           C  
ATOM   6782  CD1 LEU A 835      24.458   6.863  44.887  1.00  0.78           C  
ATOM   6783  CD2 LEU A 835      22.384   7.037  46.297  1.00  0.78           C  
ATOM   6784  N   PRO A 836      25.168   7.496  50.581  1.00  0.75           N  
ATOM   6785  CA  PRO A 836      26.217   7.449  51.597  1.00  0.75           C  
ATOM   6786  C   PRO A 836      27.617   7.219  51.028  1.00  0.75           C  
ATOM   6787  O   PRO A 836      27.776   7.005  49.824  1.00  0.75           O  
ATOM   6788  CB  PRO A 836      25.763   6.293  52.499  1.00  0.75           C  
ATOM   6789  CG  PRO A 836      25.090   5.321  51.530  1.00  0.75           C  
ATOM   6790  CD  PRO A 836      24.370   6.264  50.563  1.00  0.75           C  
ATOM   6791  N   ALA A 837      28.642   7.279  51.895  1.00  0.62           N  
ATOM   6792  CA  ALA A 837      30.019   6.991  51.579  1.00  0.62           C  
ATOM   6793  C   ALA A 837      30.618   6.175  52.766  1.00  0.62           C  
ATOM   6794  O   ALA A 837      30.261   6.516  53.928  1.00  0.62           O  
ATOM   6795  CB  ALA A 837      30.760   8.326  51.312  1.00  0.62           C  
ATOM   6796  OXT ALA A 837      31.371   5.173  52.549  1.00  0.62           O  
TER    6797      ALA A 837                                                      
ATOM   6798  N   ARG B   3      61.347  23.620  61.243  1.00  0.67           N  
ATOM   6799  CA  ARG B   3      61.895  24.459  60.124  1.00  0.67           C  
ATOM   6800  C   ARG B   3      61.082  24.175  58.888  1.00  0.67           C  
ATOM   6801  O   ARG B   3      60.740  23.006  58.719  1.00  0.67           O  
ATOM   6802  CB  ARG B   3      63.380  24.047  59.898  1.00  0.67           C  
ATOM   6803  CG  ARG B   3      64.071  24.690  58.672  1.00  0.67           C  
ATOM   6804  CD  ARG B   3      65.481  24.148  58.361  1.00  0.67           C  
ATOM   6805  NE  ARG B   3      65.426  22.648  58.205  1.00  0.67           N  
ATOM   6806  CZ  ARG B   3      65.041  22.000  57.093  1.00  0.67           C  
ATOM   6807  NH1 ARG B   3      64.575  22.649  56.034  1.00  0.67           N  
ATOM   6808  NH2 ARG B   3      65.129  20.671  57.042  1.00  0.67           N  
ATOM   6809  N   PRO B   4      60.732  25.096  58.004  1.00  0.80           N  
ATOM   6810  CA  PRO B   4      60.185  24.739  56.713  1.00  0.80           C  
ATOM   6811  C   PRO B   4      61.032  23.819  55.876  1.00  0.80           C  
ATOM   6812  O   PRO B   4      62.205  24.157  55.591  1.00  0.80           O  
ATOM   6813  CB  PRO B   4      59.923  26.072  56.009  1.00  0.80           C  
ATOM   6814  CG  PRO B   4      59.694  27.028  57.180  1.00  0.80           C  
ATOM   6815  CD  PRO B   4      60.698  26.543  58.225  1.00  0.80           C  
ATOM   6816  N   LEU B   5      60.515  22.674  55.457  1.00  0.61           N  
ATOM   6817  CA  LEU B   5      61.180  21.807  54.509  1.00  0.61           C  
ATOM   6818  C   LEU B   5      60.981  22.330  53.095  1.00  0.61           C  
ATOM   6819  O   LEU B   5      59.922  22.823  52.727  1.00  0.61           O  
ATOM   6820  CB  LEU B   5      60.666  20.350  54.605  1.00  0.61           C  
ATOM   6821  CG  LEU B   5      61.291  19.459  55.706  1.00  0.61           C  
ATOM   6822  CD1 LEU B   5      61.295  20.101  57.102  1.00  0.61           C  
ATOM   6823  CD2 LEU B   5      60.536  18.120  55.787  1.00  0.61           C  
ATOM   6824  N   SER B   6      62.028  22.214  52.260  1.00  0.67           N  
ATOM   6825  CA  SER B   6      61.960  22.502  50.842  1.00  0.67           C  
ATOM   6826  C   SER B   6      61.408  21.299  50.121  1.00  0.67           C  
ATOM   6827  O   SER B   6      61.300  20.210  50.687  1.00  0.67           O  
ATOM   6828  CB  SER B   6      63.344  22.872  50.238  1.00  0.67           C  
ATOM   6829  OG  SER B   6      64.337  21.873  50.515  1.00  0.67           O  
ATOM   6830  N   ASP B   7      61.037  21.456  48.839  1.00  0.72           N  
ATOM   6831  CA  ASP B   7      60.429  20.410  48.050  1.00  0.72           C  
ATOM   6832  C   ASP B   7      61.295  19.172  47.880  1.00  0.72           C  
ATOM   6833  O   ASP B   7      60.795  18.058  47.883  1.00  0.72           O  
ATOM   6834  CB  ASP B   7      59.975  20.968  46.693  1.00  0.72           C  
ATOM   6835  CG  ASP B   7      59.031  22.127  46.971  1.00  0.72           C  
ATOM   6836  OD1 ASP B   7      58.011  21.912  47.679  1.00  0.72           O  
ATOM   6837  OD2 ASP B   7      59.383  23.256  46.556  1.00  0.72           O  
ATOM   6838  N   GLN B   8      62.640  19.325  47.806  1.00  0.69           N  
ATOM   6839  CA  GLN B   8      63.543  18.190  47.814  1.00  0.69           C  
ATOM   6840  C   GLN B   8      63.395  17.308  49.043  1.00  0.69           C  
ATOM   6841  O   GLN B   8      63.473  16.089  48.943  1.00  0.69           O  
ATOM   6842  CB  GLN B   8      65.041  18.578  47.667  1.00  0.69           C  
ATOM   6843  CG  GLN B   8      65.696  19.315  48.866  1.00  0.69           C  
ATOM   6844  CD  GLN B   8      67.220  19.180  48.800  1.00  0.69           C  
ATOM   6845  OE1 GLN B   8      67.740  18.093  48.609  1.00  0.69           O  
ATOM   6846  NE2 GLN B   8      67.960  20.298  49.001  1.00  0.69           N  
ATOM   6847  N   GLU B   9      63.165  17.911  50.230  1.00  0.70           N  
ATOM   6848  CA  GLU B   9      63.107  17.179  51.474  1.00  0.70           C  
ATOM   6849  C   GLU B   9      61.739  16.613  51.742  1.00  0.70           C  
ATOM   6850  O   GLU B   9      61.574  15.509  52.257  1.00  0.70           O  
ATOM   6851  CB  GLU B   9      63.625  18.062  52.636  1.00  0.70           C  
ATOM   6852  CG  GLU B   9      64.038  17.319  53.950  1.00  0.70           C  
ATOM   6853  CD  GLU B   9      65.257  16.445  53.814  1.00  0.70           C  
ATOM   6854  OE1 GLU B   9      65.951  16.083  54.815  1.00  0.70           O  
ATOM   6855  OE2 GLU B   9      65.569  16.138  52.631  1.00  0.70           O  
ATOM   6856  N   LYS B  10      60.686  17.319  51.310  1.00  0.69           N  
ATOM   6857  CA  LYS B  10      59.346  16.781  51.320  1.00  0.69           C  
ATOM   6858  C   LYS B  10      59.182  15.559  50.421  1.00  0.69           C  
ATOM   6859  O   LYS B  10      58.568  14.568  50.816  1.00  0.69           O  
ATOM   6860  CB  LYS B  10      58.358  17.864  50.891  1.00  0.69           C  
ATOM   6861  CG  LYS B  10      58.262  19.059  51.846  1.00  0.69           C  
ATOM   6862  CD  LYS B  10      57.301  20.077  51.229  1.00  0.69           C  
ATOM   6863  CE  LYS B  10      56.955  21.296  52.075  1.00  0.69           C  
ATOM   6864  NZ  LYS B  10      56.085  22.161  51.255  1.00  0.69           N  
ATOM   6865  N   ARG B  11      59.797  15.569  49.215  1.00  0.65           N  
ATOM   6866  CA  ARG B  11      59.746  14.459  48.287  1.00  0.65           C  
ATOM   6867  C   ARG B  11      60.479  13.214  48.779  1.00  0.65           C  
ATOM   6868  O   ARG B  11      60.325  12.144  48.212  1.00  0.65           O  
ATOM   6869  CB  ARG B  11      60.286  14.839  46.881  1.00  0.65           C  
ATOM   6870  CG  ARG B  11      59.379  15.835  46.124  1.00  0.65           C  
ATOM   6871  CD  ARG B  11      59.842  16.153  44.697  1.00  0.65           C  
ATOM   6872  NE  ARG B  11      59.113  17.383  44.236  1.00  0.65           N  
ATOM   6873  CZ  ARG B  11      59.169  17.926  43.011  1.00  0.65           C  
ATOM   6874  NH1 ARG B  11      59.761  17.317  41.990  1.00  0.65           N  
ATOM   6875  NH2 ARG B  11      58.585  19.106  42.812  1.00  0.65           N  
ATOM   6876  N   LYS B  12      61.266  13.281  49.882  1.00  0.72           N  
ATOM   6877  CA  LYS B  12      61.888  12.111  50.495  1.00  0.72           C  
ATOM   6878  C   LYS B  12      60.850  11.127  51.021  1.00  0.72           C  
ATOM   6879  O   LYS B  12      61.085   9.918  51.051  1.00  0.72           O  
ATOM   6880  CB  LYS B  12      62.857  12.490  51.642  1.00  0.72           C  
ATOM   6881  CG  LYS B  12      63.953  13.507  51.266  1.00  0.72           C  
ATOM   6882  CD  LYS B  12      65.036  13.009  50.293  1.00  0.72           C  
ATOM   6883  CE  LYS B  12      66.048  14.085  49.842  1.00  0.72           C  
ATOM   6884  NZ  LYS B  12      66.754  14.700  50.979  1.00  0.72           N  
ATOM   6885  N   GLN B  13      59.639  11.642  51.355  1.00  0.64           N  
ATOM   6886  CA  GLN B  13      58.473  10.866  51.735  1.00  0.64           C  
ATOM   6887  C   GLN B  13      57.904  10.054  50.578  1.00  0.64           C  
ATOM   6888  O   GLN B  13      57.122   9.132  50.774  1.00  0.64           O  
ATOM   6889  CB  GLN B  13      57.321  11.771  52.249  1.00  0.64           C  
ATOM   6890  CG  GLN B  13      57.632  12.551  53.547  1.00  0.64           C  
ATOM   6891  CD  GLN B  13      56.553  13.609  53.815  1.00  0.64           C  
ATOM   6892  OE1 GLN B  13      55.508  13.402  54.425  1.00  0.64           O  
ATOM   6893  NE2 GLN B  13      56.817  14.826  53.280  1.00  0.64           N  
ATOM   6894  N   ILE B  14      58.306  10.342  49.323  1.00  0.61           N  
ATOM   6895  CA  ILE B  14      58.021   9.493  48.179  1.00  0.61           C  
ATOM   6896  C   ILE B  14      58.957   8.277  48.249  1.00  0.61           C  
ATOM   6897  O   ILE B  14      59.989   8.206  47.579  1.00  0.61           O  
ATOM   6898  CB  ILE B  14      58.094  10.261  46.855  1.00  0.61           C  
ATOM   6899  CG1 ILE B  14      57.186  11.518  46.941  1.00  0.61           C  
ATOM   6900  CG2 ILE B  14      57.671   9.357  45.672  1.00  0.61           C  
ATOM   6901  CD1 ILE B  14      57.313  12.480  45.755  1.00  0.61           C  
ATOM   6902  N   SER B  15      58.604   7.334  49.163  1.00  0.71           N  
ATOM   6903  CA  SER B  15      59.301   6.120  49.616  1.00  0.71           C  
ATOM   6904  C   SER B  15      58.694   4.866  49.013  1.00  0.71           C  
ATOM   6905  O   SER B  15      57.511   4.837  48.721  1.00  0.71           O  
ATOM   6906  CB  SER B  15      60.869   6.190  49.559  1.00  0.71           C  
ATOM   6907  OG  SER B  15      61.608   5.256  50.333  1.00  0.71           O  
ATOM   6908  N   VAL B  16      59.468   3.777  48.849  1.00  0.77           N  
ATOM   6909  CA  VAL B  16      58.943   2.482  48.406  1.00  0.77           C  
ATOM   6910  C   VAL B  16      58.479   1.705  49.633  1.00  0.77           C  
ATOM   6911  O   VAL B  16      59.279   1.042  50.314  1.00  0.77           O  
ATOM   6912  CB  VAL B  16      59.976   1.643  47.639  1.00  0.77           C  
ATOM   6913  CG1 VAL B  16      59.460   0.232  47.256  1.00  0.77           C  
ATOM   6914  CG2 VAL B  16      60.408   2.373  46.356  1.00  0.77           C  
ATOM   6915  N   ARG B  17      57.176   1.771  49.972  1.00  0.56           N  
ATOM   6916  CA  ARG B  17      56.628   1.137  51.164  1.00  0.56           C  
ATOM   6917  C   ARG B  17      55.206   0.642  51.011  1.00  0.56           C  
ATOM   6918  O   ARG B  17      54.565   0.793  49.978  1.00  0.56           O  
ATOM   6919  CB  ARG B  17      56.727   2.049  52.418  1.00  0.56           C  
ATOM   6920  CG  ARG B  17      58.096   2.029  53.137  1.00  0.56           C  
ATOM   6921  CD  ARG B  17      58.497   0.698  53.821  1.00  0.56           C  
ATOM   6922  NE  ARG B  17      59.024  -0.241  52.773  1.00  0.56           N  
ATOM   6923  CZ  ARG B  17      59.267  -1.555  52.933  1.00  0.56           C  
ATOM   6924  NH1 ARG B  17      59.188  -2.157  54.109  1.00  0.56           N  
ATOM   6925  NH2 ARG B  17      59.610  -2.292  51.875  1.00  0.56           N  
ATOM   6926  N   GLY B  18      54.695  -0.066  52.049  1.00  0.61           N  
ATOM   6927  CA  GLY B  18      53.395  -0.712  51.986  1.00  0.61           C  
ATOM   6928  C   GLY B  18      53.543  -2.046  51.331  1.00  0.61           C  
ATOM   6929  O   GLY B  18      53.856  -3.028  51.965  1.00  0.61           O  
ATOM   6930  N   LEU B  19      53.354  -2.065  49.992  1.00  0.48           N  
ATOM   6931  CA  LEU B  19      53.225  -3.262  49.199  1.00  0.48           C  
ATOM   6932  C   LEU B  19      54.362  -4.238  49.348  1.00  0.48           C  
ATOM   6933  O   LEU B  19      54.142  -5.422  49.502  1.00  0.48           O  
ATOM   6934  CB  LEU B  19      52.927  -2.938  47.724  1.00  0.48           C  
ATOM   6935  CG  LEU B  19      51.426  -2.775  47.377  1.00  0.48           C  
ATOM   6936  CD1 LEU B  19      50.653  -4.090  47.614  1.00  0.48           C  
ATOM   6937  CD2 LEU B  19      50.758  -1.602  48.079  1.00  0.48           C  
ATOM   6938  N   ALA B  20      55.614  -3.753  49.403  1.00  0.54           N  
ATOM   6939  CA  ALA B  20      56.770  -4.616  49.370  1.00  0.54           C  
ATOM   6940  C   ALA B  20      57.186  -5.177  50.726  1.00  0.54           C  
ATOM   6941  O   ALA B  20      58.206  -5.846  50.828  1.00  0.54           O  
ATOM   6942  CB  ALA B  20      57.930  -3.764  48.826  1.00  0.54           C  
ATOM   6943  N   GLY B  21      56.390  -4.926  51.785  1.00  0.57           N  
ATOM   6944  CA  GLY B  21      56.688  -5.348  53.145  1.00  0.57           C  
ATOM   6945  C   GLY B  21      55.518  -6.068  53.765  1.00  0.57           C  
ATOM   6946  O   GLY B  21      55.293  -5.988  54.955  1.00  0.57           O  
ATOM   6947  N   VAL B  22      54.757  -6.808  52.925  1.00  0.64           N  
ATOM   6948  CA  VAL B  22      53.645  -7.633  53.421  1.00  0.64           C  
ATOM   6949  C   VAL B  22      53.472  -8.857  52.507  1.00  0.64           C  
ATOM   6950  O   VAL B  22      53.588  -8.848  51.394  1.00  0.64           O  
ATOM   6951  CB  VAL B  22      52.283  -6.934  53.378  1.00  0.64           C  
ATOM   6952  CG1 VAL B  22      52.132  -5.974  54.567  1.00  0.64           C  
ATOM   6953  CG2 VAL B  22      52.085  -6.185  52.047  1.00  0.64           C  
ATOM   6954  N   GLU B  23      53.174 -10.039  53.177  1.00  0.66           N  
ATOM   6955  CA  GLU B  23      52.991 -11.251  52.373  1.00  0.66           C  
ATOM   6956  C   GLU B  23      51.948 -12.099  53.090  1.00  0.66           C  
ATOM   6957  O   GLU B  23      51.794 -13.295  52.898  1.00  0.66           O  
ATOM   6958  CB  GLU B  23      54.327 -12.014  52.163  1.00  0.66           C  
ATOM   6959  CG  GLU B  23      55.159 -12.361  53.422  1.00  0.66           C  
ATOM   6960  CD  GLU B  23      56.514 -12.977  53.048  1.00  0.66           C  
ATOM   6961  OE1 GLU B  23      56.871 -12.966  51.839  1.00  0.66           O  
ATOM   6962  OE2 GLU B  23      57.211 -13.441  53.985  1.00  0.66           O  
ATOM   6963  N   ASN B  24      51.156 -11.421  53.942  1.00  0.75           N  
ATOM   6964  CA  ASN B  24      50.171 -12.017  54.813  1.00  0.75           C  
ATOM   6965  C   ASN B  24      48.886 -12.403  54.089  1.00  0.75           C  
ATOM   6966  O   ASN B  24      48.395 -11.655  53.254  1.00  0.75           O  
ATOM   6967  CB  ASN B  24      49.846 -10.988  55.931  1.00  0.75           C  
ATOM   6968  CG  ASN B  24      49.677 -11.670  57.277  1.00  0.75           C  
ATOM   6969  OD1 ASN B  24      50.638 -12.077  57.903  1.00  0.75           O  
ATOM   6970  ND2 ASN B  24      48.420 -11.821  57.749  1.00  0.75           N  
ATOM   6971  N   VAL B  25      48.247 -13.541  54.456  1.00  0.77           N  
ATOM   6972  CA  VAL B  25      46.979 -14.005  53.882  1.00  0.77           C  
ATOM   6973  C   VAL B  25      45.882 -12.964  54.041  1.00  0.77           C  
ATOM   6974  O   VAL B  25      45.117 -12.663  53.129  1.00  0.77           O  
ATOM   6975  CB  VAL B  25      46.520 -15.312  54.539  1.00  0.77           C  
ATOM   6976  CG1 VAL B  25      45.106 -15.716  54.066  1.00  0.77           C  
ATOM   6977  CG2 VAL B  25      47.498 -16.455  54.196  1.00  0.77           C  
ATOM   6978  N   THR B  26      45.834 -12.328  55.225  1.00  0.76           N  
ATOM   6979  CA  THR B  26      44.926 -11.234  55.527  1.00  0.76           C  
ATOM   6980  C   THR B  26      45.144  -9.995  54.668  1.00  0.76           C  
ATOM   6981  O   THR B  26      44.186  -9.320  54.296  1.00  0.76           O  
ATOM   6982  CB  THR B  26      44.928 -10.838  57.003  1.00  0.76           C  
ATOM   6983  OG1 THR B  26      46.146 -10.216  57.387  1.00  0.76           O  
ATOM   6984  CG2 THR B  26      44.785 -12.090  57.877  1.00  0.76           C  
ATOM   6985  N   GLU B  27      46.404  -9.647  54.349  1.00  0.75           N  
ATOM   6986  CA  GLU B  27      46.748  -8.535  53.477  1.00  0.75           C  
ATOM   6987  C   GLU B  27      46.577  -8.836  52.001  1.00  0.75           C  
ATOM   6988  O   GLU B  27      46.166  -7.985  51.217  1.00  0.75           O  
ATOM   6989  CB  GLU B  27      48.191  -8.052  53.725  1.00  0.75           C  
ATOM   6990  CG  GLU B  27      48.397  -7.442  55.135  1.00  0.75           C  
ATOM   6991  CD  GLU B  27      47.334  -6.410  55.488  1.00  0.75           C  
ATOM   6992  OE1 GLU B  27      46.662  -6.607  56.538  1.00  0.75           O  
ATOM   6993  OE2 GLU B  27      47.091  -5.479  54.685  1.00  0.75           O  
ATOM   6994  N   LEU B  28      46.864 -10.077  51.563  1.00  0.82           N  
ATOM   6995  CA  LEU B  28      46.622 -10.531  50.206  1.00  0.82           C  
ATOM   6996  C   LEU B  28      45.145 -10.482  49.874  1.00  0.82           C  
ATOM   6997  O   LEU B  28      44.761 -10.026  48.800  1.00  0.82           O  
ATOM   6998  CB  LEU B  28      47.163 -11.960  49.985  1.00  0.82           C  
ATOM   6999  CG  LEU B  28      48.702 -12.072  49.984  1.00  0.82           C  
ATOM   7000  CD1 LEU B  28      49.109 -13.548  50.035  1.00  0.82           C  
ATOM   7001  CD2 LEU B  28      49.333 -11.419  48.745  1.00  0.82           C  
ATOM   7002  N   LYS B  29      44.277 -10.868  50.838  1.00  0.82           N  
ATOM   7003  CA  LYS B  29      42.845 -10.660  50.755  1.00  0.82           C  
ATOM   7004  C   LYS B  29      42.445  -9.206  50.539  1.00  0.82           C  
ATOM   7005  O   LYS B  29      41.693  -8.908  49.619  1.00  0.82           O  
ATOM   7006  CB  LYS B  29      42.160 -11.115  52.066  1.00  0.82           C  
ATOM   7007  CG  LYS B  29      41.896 -12.620  52.170  1.00  0.82           C  
ATOM   7008  CD  LYS B  29      41.302 -12.980  53.544  1.00  0.82           C  
ATOM   7009  CE  LYS B  29      40.045 -13.844  53.441  1.00  0.82           C  
ATOM   7010  NZ  LYS B  29      39.545 -14.193  54.786  1.00  0.82           N  
ATOM   7011  N   LYS B  30      42.970  -8.256  51.350  1.00  0.79           N  
ATOM   7012  CA  LYS B  30      42.637  -6.847  51.202  1.00  0.79           C  
ATOM   7013  C   LYS B  30      43.068  -6.276  49.864  1.00  0.79           C  
ATOM   7014  O   LYS B  30      42.323  -5.562  49.204  1.00  0.79           O  
ATOM   7015  CB  LYS B  30      43.287  -5.958  52.288  1.00  0.79           C  
ATOM   7016  CG  LYS B  30      42.814  -6.209  53.723  1.00  0.79           C  
ATOM   7017  CD  LYS B  30      43.594  -5.298  54.685  1.00  0.79           C  
ATOM   7018  CE  LYS B  30      43.455  -5.643  56.166  1.00  0.79           C  
ATOM   7019  NZ  LYS B  30      44.123  -6.916  56.442  1.00  0.79           N  
ATOM   7020  N   ASN B  31      44.293  -6.602  49.414  1.00  0.81           N  
ATOM   7021  CA  ASN B  31      44.797  -6.183  48.125  1.00  0.81           C  
ATOM   7022  C   ASN B  31      44.042  -6.805  46.949  1.00  0.81           C  
ATOM   7023  O   ASN B  31      43.739  -6.116  45.983  1.00  0.81           O  
ATOM   7024  CB  ASN B  31      46.325  -6.392  48.041  1.00  0.81           C  
ATOM   7025  CG  ASN B  31      47.015  -5.371  48.948  1.00  0.81           C  
ATOM   7026  OD1 ASN B  31      46.981  -4.165  48.681  1.00  0.81           O  
ATOM   7027  ND2 ASN B  31      47.652  -5.830  50.046  1.00  0.81           N  
ATOM   7028  N   PHE B  32      43.651  -8.101  47.032  1.00  0.87           N  
ATOM   7029  CA  PHE B  32      42.799  -8.750  46.046  1.00  0.87           C  
ATOM   7030  C   PHE B  32      41.456  -8.051  45.933  1.00  0.87           C  
ATOM   7031  O   PHE B  32      40.973  -7.750  44.839  1.00  0.87           O  
ATOM   7032  CB  PHE B  32      42.623 -10.244  46.461  1.00  0.87           C  
ATOM   7033  CG  PHE B  32      41.796 -11.040  45.492  1.00  0.87           C  
ATOM   7034  CD1 PHE B  32      40.393 -10.949  45.513  1.00  0.87           C  
ATOM   7035  CD2 PHE B  32      42.408 -11.888  44.559  1.00  0.87           C  
ATOM   7036  CE1 PHE B  32      39.619 -11.654  44.589  1.00  0.87           C  
ATOM   7037  CE2 PHE B  32      41.633 -12.604  43.640  1.00  0.87           C  
ATOM   7038  CZ  PHE B  32      40.243 -12.472  43.644  1.00  0.87           C  
ATOM   7039  N   ASN B  33      40.851  -7.738  47.091  1.00  0.85           N  
ATOM   7040  CA  ASN B  33      39.600  -7.035  47.202  1.00  0.85           C  
ATOM   7041  C   ASN B  33      39.692  -5.629  46.609  1.00  0.85           C  
ATOM   7042  O   ASN B  33      38.902  -5.234  45.770  1.00  0.85           O  
ATOM   7043  CB  ASN B  33      39.230  -7.020  48.709  1.00  0.85           C  
ATOM   7044  CG  ASN B  33      37.801  -6.586  48.998  1.00  0.85           C  
ATOM   7045  OD1 ASN B  33      37.555  -5.788  49.890  1.00  0.85           O  
ATOM   7046  ND2 ASN B  33      36.825  -7.144  48.249  1.00  0.85           N  
ATOM   7047  N   ARG B  34      40.757  -4.887  46.971  1.00  0.80           N  
ATOM   7048  CA  ARG B  34      41.046  -3.569  46.446  1.00  0.80           C  
ATOM   7049  C   ARG B  34      41.265  -3.551  44.946  1.00  0.80           C  
ATOM   7050  O   ARG B  34      40.738  -2.694  44.238  1.00  0.80           O  
ATOM   7051  CB  ARG B  34      42.296  -3.005  47.165  1.00  0.80           C  
ATOM   7052  CG  ARG B  34      42.803  -1.635  46.670  1.00  0.80           C  
ATOM   7053  CD  ARG B  34      44.027  -1.098  47.444  1.00  0.80           C  
ATOM   7054  NE  ARG B  34      45.224  -2.011  47.306  1.00  0.80           N  
ATOM   7055  CZ  ARG B  34      45.969  -2.181  46.199  1.00  0.80           C  
ATOM   7056  NH1 ARG B  34      45.649  -1.641  45.039  1.00  0.80           N  
ATOM   7057  NH2 ARG B  34      47.061  -2.939  46.278  1.00  0.80           N  
ATOM   7058  N   HIS B  35      42.029  -4.507  44.395  1.00  0.84           N  
ATOM   7059  CA  HIS B  35      42.214  -4.608  42.963  1.00  0.84           C  
ATOM   7060  C   HIS B  35      40.938  -4.970  42.208  1.00  0.84           C  
ATOM   7061  O   HIS B  35      40.656  -4.401  41.155  1.00  0.84           O  
ATOM   7062  CB  HIS B  35      43.375  -5.559  42.592  1.00  0.84           C  
ATOM   7063  CG  HIS B  35      44.742  -4.972  42.869  1.00  0.84           C  
ATOM   7064  ND1 HIS B  35      45.139  -3.838  42.163  1.00  0.84           N  
ATOM   7065  CD2 HIS B  35      45.754  -5.404  43.647  1.00  0.84           C  
ATOM   7066  CE1 HIS B  35      46.382  -3.629  42.526  1.00  0.84           C  
ATOM   7067  NE2 HIS B  35      46.819  -4.540  43.434  1.00  0.84           N  
ATOM   7068  N   LEU B  36      40.107  -5.897  42.733  1.00  0.88           N  
ATOM   7069  CA  LEU B  36      38.863  -6.296  42.101  1.00  0.88           C  
ATOM   7070  C   LEU B  36      37.893  -5.133  41.957  1.00  0.88           C  
ATOM   7071  O   LEU B  36      37.348  -4.878  40.881  1.00  0.88           O  
ATOM   7072  CB  LEU B  36      38.238  -7.459  42.922  1.00  0.88           C  
ATOM   7073  CG  LEU B  36      37.015  -8.194  42.314  1.00  0.88           C  
ATOM   7074  CD1 LEU B  36      35.702  -7.419  42.499  1.00  0.88           C  
ATOM   7075  CD2 LEU B  36      37.211  -8.569  40.836  1.00  0.88           C  
ATOM   7076  N   HIS B  37      37.687  -4.345  43.025  1.00  0.83           N  
ATOM   7077  CA  HIS B  37      36.821  -3.192  42.929  1.00  0.83           C  
ATOM   7078  C   HIS B  37      37.453  -1.980  42.270  1.00  0.83           C  
ATOM   7079  O   HIS B  37      36.888  -1.403  41.348  1.00  0.83           O  
ATOM   7080  CB  HIS B  37      36.248  -2.803  44.304  1.00  0.83           C  
ATOM   7081  CG  HIS B  37      35.405  -3.896  44.887  1.00  0.83           C  
ATOM   7082  ND1 HIS B  37      35.976  -4.815  45.740  1.00  0.83           N  
ATOM   7083  CD2 HIS B  37      34.107  -4.209  44.677  1.00  0.83           C  
ATOM   7084  CE1 HIS B  37      35.023  -5.658  46.033  1.00  0.83           C  
ATOM   7085  NE2 HIS B  37      33.859  -5.346  45.418  1.00  0.83           N  
ATOM   7086  N   PHE B  38      38.651  -1.545  42.697  1.00  0.86           N  
ATOM   7087  CA  PHE B  38      39.139  -0.224  42.313  1.00  0.86           C  
ATOM   7088  C   PHE B  38      39.924  -0.222  41.007  1.00  0.86           C  
ATOM   7089  O   PHE B  38      39.699   0.604  40.122  1.00  0.86           O  
ATOM   7090  CB  PHE B  38      39.900   0.465  43.483  1.00  0.86           C  
ATOM   7091  CG  PHE B  38      38.970   0.566  44.664  1.00  0.86           C  
ATOM   7092  CD1 PHE B  38      37.968   1.541  44.692  1.00  0.86           C  
ATOM   7093  CD2 PHE B  38      38.998  -0.364  45.711  1.00  0.86           C  
ATOM   7094  CE1 PHE B  38      36.971   1.519  45.670  1.00  0.86           C  
ATOM   7095  CE2 PHE B  38      37.990  -0.418  46.668  1.00  0.86           C  
ATOM   7096  CZ  PHE B  38      36.953   0.514  46.638  1.00  0.86           C  
ATOM   7097  N   THR B  39      40.849  -1.185  40.832  1.00  0.84           N  
ATOM   7098  CA  THR B  39      41.635  -1.363  39.614  1.00  0.84           C  
ATOM   7099  C   THR B  39      40.819  -1.884  38.446  1.00  0.84           C  
ATOM   7100  O   THR B  39      40.887  -1.362  37.331  1.00  0.84           O  
ATOM   7101  CB  THR B  39      42.806  -2.307  39.834  1.00  0.84           C  
ATOM   7102  OG1 THR B  39      43.629  -1.793  40.870  1.00  0.84           O  
ATOM   7103  CG2 THR B  39      43.693  -2.438  38.591  1.00  0.84           C  
ATOM   7104  N   LEU B  40      39.996  -2.928  38.680  1.00  0.84           N  
ATOM   7105  CA  LEU B  40      39.202  -3.563  37.645  1.00  0.84           C  
ATOM   7106  C   LEU B  40      37.855  -2.898  37.405  1.00  0.84           C  
ATOM   7107  O   LEU B  40      37.259  -3.095  36.343  1.00  0.84           O  
ATOM   7108  CB  LEU B  40      38.944  -5.046  37.989  1.00  0.84           C  
ATOM   7109  CG  LEU B  40      40.026  -6.044  37.543  1.00  0.84           C  
ATOM   7110  CD1 LEU B  40      41.452  -5.684  37.981  1.00  0.84           C  
ATOM   7111  CD2 LEU B  40      39.652  -7.417  38.100  1.00  0.84           C  
ATOM   7112  N   VAL B  41      37.348  -2.076  38.350  1.00  0.83           N  
ATOM   7113  CA  VAL B  41      36.051  -1.413  38.253  1.00  0.83           C  
ATOM   7114  C   VAL B  41      34.916  -2.432  38.161  1.00  0.83           C  
ATOM   7115  O   VAL B  41      34.135  -2.463  37.211  1.00  0.83           O  
ATOM   7116  CB  VAL B  41      35.988  -0.329  37.174  1.00  0.83           C  
ATOM   7117  CG1 VAL B  41      34.771   0.589  37.381  1.00  0.83           C  
ATOM   7118  CG2 VAL B  41      37.258   0.540  37.236  1.00  0.83           C  
ATOM   7119  N   LYS B  42      34.874  -3.343  39.153  1.00  0.81           N  
ATOM   7120  CA  LYS B  42      34.008  -4.506  39.222  1.00  0.81           C  
ATOM   7121  C   LYS B  42      33.530  -4.709  40.652  1.00  0.81           C  
ATOM   7122  O   LYS B  42      33.891  -3.982  41.568  1.00  0.81           O  
ATOM   7123  CB  LYS B  42      34.757  -5.811  38.829  1.00  0.81           C  
ATOM   7124  CG  LYS B  42      35.220  -5.913  37.372  1.00  0.81           C  
ATOM   7125  CD  LYS B  42      34.068  -6.067  36.376  1.00  0.81           C  
ATOM   7126  CE  LYS B  42      34.588  -6.366  34.972  1.00  0.81           C  
ATOM   7127  NZ  LYS B  42      33.479  -6.665  34.066  1.00  0.81           N  
ATOM   7128  N   ASP B  43      32.682  -5.726  40.867  1.00  0.81           N  
ATOM   7129  CA  ASP B  43      32.235  -6.152  42.168  1.00  0.81           C  
ATOM   7130  C   ASP B  43      31.904  -7.628  42.058  1.00  0.81           C  
ATOM   7131  O   ASP B  43      32.025  -8.217  40.985  1.00  0.81           O  
ATOM   7132  CB  ASP B  43      31.034  -5.306  42.677  1.00  0.81           C  
ATOM   7133  CG  ASP B  43      29.816  -5.335  41.761  1.00  0.81           C  
ATOM   7134  OD1 ASP B  43      29.628  -6.331  41.017  1.00  0.81           O  
ATOM   7135  OD2 ASP B  43      29.026  -4.365  41.856  1.00  0.81           O  
ATOM   7136  N   ARG B  44      31.460  -8.283  43.151  1.00  0.75           N  
ATOM   7137  CA  ARG B  44      31.100  -9.687  43.084  1.00  0.75           C  
ATOM   7138  C   ARG B  44      29.805  -9.973  42.344  1.00  0.75           C  
ATOM   7139  O   ARG B  44      29.497 -11.127  42.060  1.00  0.75           O  
ATOM   7140  CB  ARG B  44      31.013 -10.333  44.485  1.00  0.75           C  
ATOM   7141  CG  ARG B  44      29.807  -9.911  45.348  1.00  0.75           C  
ATOM   7142  CD  ARG B  44      29.778 -10.661  46.679  1.00  0.75           C  
ATOM   7143  NE  ARG B  44      28.536 -10.249  47.411  1.00  0.75           N  
ATOM   7144  CZ  ARG B  44      28.486  -9.178  48.213  1.00  0.75           C  
ATOM   7145  NH1 ARG B  44      29.532  -8.382  48.369  1.00  0.75           N  
ATOM   7146  NH2 ARG B  44      27.363  -8.898  48.872  1.00  0.75           N  
ATOM   7147  N   ASN B  45      28.996  -8.939  42.039  1.00  0.78           N  
ATOM   7148  CA  ASN B  45      27.757  -9.091  41.317  1.00  0.78           C  
ATOM   7149  C   ASN B  45      27.999  -9.387  39.843  1.00  0.78           C  
ATOM   7150  O   ASN B  45      27.257 -10.150  39.222  1.00  0.78           O  
ATOM   7151  CB  ASN B  45      26.868  -7.837  41.509  1.00  0.78           C  
ATOM   7152  CG  ASN B  45      26.553  -7.616  42.985  1.00  0.78           C  
ATOM   7153  OD1 ASN B  45      26.837  -6.597  43.607  1.00  0.78           O  
ATOM   7154  ND2 ASN B  45      25.916  -8.630  43.617  1.00  0.78           N  
ATOM   7155  N   VAL B  46      29.062  -8.799  39.250  1.00  0.80           N  
ATOM   7156  CA  VAL B  46      29.394  -9.028  37.852  1.00  0.80           C  
ATOM   7157  C   VAL B  46      30.721  -9.744  37.586  1.00  0.80           C  
ATOM   7158  O   VAL B  46      30.962 -10.213  36.470  1.00  0.80           O  
ATOM   7159  CB  VAL B  46      29.312  -7.701  37.098  1.00  0.80           C  
ATOM   7160  CG1 VAL B  46      30.428  -6.744  37.559  1.00  0.80           C  
ATOM   7161  CG2 VAL B  46      29.329  -7.901  35.567  1.00  0.80           C  
ATOM   7162  N   ALA B  47      31.608  -9.893  38.589  1.00  0.86           N  
ATOM   7163  CA  ALA B  47      32.921 -10.495  38.414  1.00  0.86           C  
ATOM   7164  C   ALA B  47      32.959 -11.940  37.917  1.00  0.86           C  
ATOM   7165  O   ALA B  47      32.360 -12.858  38.479  1.00  0.86           O  
ATOM   7166  CB  ALA B  47      33.705 -10.444  39.734  1.00  0.86           C  
ATOM   7167  N   THR B  48      33.724 -12.160  36.833  1.00  0.84           N  
ATOM   7168  CA  THR B  48      33.926 -13.439  36.177  1.00  0.84           C  
ATOM   7169  C   THR B  48      35.156 -14.136  36.730  1.00  0.84           C  
ATOM   7170  O   THR B  48      35.944 -13.490  37.420  1.00  0.84           O  
ATOM   7171  CB  THR B  48      34.017 -13.312  34.639  1.00  0.84           C  
ATOM   7172  OG1 THR B  48      35.156 -12.626  34.153  1.00  0.84           O  
ATOM   7173  CG2 THR B  48      32.850 -12.499  34.098  1.00  0.84           C  
ATOM   7174  N   PRO B  49      35.424 -15.424  36.469  1.00  0.88           N  
ATOM   7175  CA  PRO B  49      36.710 -16.042  36.802  1.00  0.88           C  
ATOM   7176  C   PRO B  49      37.896 -15.297  36.221  1.00  0.88           C  
ATOM   7177  O   PRO B  49      38.966 -15.278  36.818  1.00  0.88           O  
ATOM   7178  CB  PRO B  49      36.589 -17.479  36.269  1.00  0.88           C  
ATOM   7179  CG  PRO B  49      35.086 -17.766  36.342  1.00  0.88           C  
ATOM   7180  CD  PRO B  49      34.460 -16.417  35.984  1.00  0.88           C  
ATOM   7181  N   ARG B  50      37.718 -14.636  35.060  1.00  0.83           N  
ATOM   7182  CA  ARG B  50      38.728 -13.790  34.475  1.00  0.83           C  
ATOM   7183  C   ARG B  50      39.028 -12.549  35.297  1.00  0.83           C  
ATOM   7184  O   ARG B  50      40.191 -12.193  35.490  1.00  0.83           O  
ATOM   7185  CB  ARG B  50      38.348 -13.439  33.020  1.00  0.83           C  
ATOM   7186  CG  ARG B  50      39.446 -12.666  32.270  1.00  0.83           C  
ATOM   7187  CD  ARG B  50      39.062 -12.231  30.849  1.00  0.83           C  
ATOM   7188  NE  ARG B  50      38.714 -13.435  30.023  1.00  0.83           N  
ATOM   7189  CZ  ARG B  50      39.594 -14.314  29.518  1.00  0.83           C  
ATOM   7190  NH1 ARG B  50      40.901 -14.194  29.710  1.00  0.83           N  
ATOM   7191  NH2 ARG B  50      39.142 -15.334  28.788  1.00  0.83           N  
ATOM   7192  N   ASP B  51      37.994 -11.889  35.849  1.00  0.89           N  
ATOM   7193  CA  ASP B  51      38.145 -10.758  36.743  1.00  0.89           C  
ATOM   7194  C   ASP B  51      38.885 -11.126  38.021  1.00  0.89           C  
ATOM   7195  O   ASP B  51      39.789 -10.434  38.480  1.00  0.89           O  
ATOM   7196  CB  ASP B  51      36.765 -10.165  37.103  1.00  0.89           C  
ATOM   7197  CG  ASP B  51      36.100  -9.675  35.835  1.00  0.89           C  
ATOM   7198  OD1 ASP B  51      36.757  -8.909  35.093  1.00  0.89           O  
ATOM   7199  OD2 ASP B  51      34.930 -10.067  35.572  1.00  0.89           O  
ATOM   7200  N   TYR B  52      38.553 -12.284  38.609  1.00  0.88           N  
ATOM   7201  CA  TYR B  52      39.256 -12.811  39.758  1.00  0.88           C  
ATOM   7202  C   TYR B  52      40.714 -13.167  39.474  1.00  0.88           C  
ATOM   7203  O   TYR B  52      41.592 -12.902  40.294  1.00  0.88           O  
ATOM   7204  CB  TYR B  52      38.477 -14.001  40.363  1.00  0.88           C  
ATOM   7205  CG  TYR B  52      37.136 -13.569  40.915  1.00  0.88           C  
ATOM   7206  CD1 TYR B  52      37.003 -12.431  41.733  1.00  0.88           C  
ATOM   7207  CD2 TYR B  52      35.984 -14.329  40.642  1.00  0.88           C  
ATOM   7208  CE1 TYR B  52      35.757 -12.067  42.260  1.00  0.88           C  
ATOM   7209  CE2 TYR B  52      34.738 -13.971  41.177  1.00  0.88           C  
ATOM   7210  CZ  TYR B  52      34.629 -12.847  41.997  1.00  0.88           C  
ATOM   7211  OH  TYR B  52      33.373 -12.495  42.538  1.00  0.88           O  
ATOM   7212  N   TYR B  53      41.027 -13.719  38.277  1.00  0.91           N  
ATOM   7213  CA  TYR B  53      42.397 -13.909  37.824  1.00  0.91           C  
ATOM   7214  C   TYR B  53      43.156 -12.581  37.773  1.00  0.91           C  
ATOM   7215  O   TYR B  53      44.259 -12.474  38.300  1.00  0.91           O  
ATOM   7216  CB  TYR B  53      42.418 -14.660  36.443  1.00  0.91           C  
ATOM   7217  CG  TYR B  53      43.695 -14.429  35.665  1.00  0.91           C  
ATOM   7218  CD1 TYR B  53      44.906 -14.948  36.143  1.00  0.91           C  
ATOM   7219  CD2 TYR B  53      43.721 -13.502  34.607  1.00  0.91           C  
ATOM   7220  CE1 TYR B  53      46.125 -14.510  35.611  1.00  0.91           C  
ATOM   7221  CE2 TYR B  53      44.942 -13.074  34.064  1.00  0.91           C  
ATOM   7222  CZ  TYR B  53      46.142 -13.561  34.589  1.00  0.91           C  
ATOM   7223  OH  TYR B  53      47.381 -13.061  34.151  1.00  0.91           O  
ATOM   7224  N   PHE B  54      42.562 -11.529  37.182  1.00  0.91           N  
ATOM   7225  CA  PHE B  54      43.177 -10.216  37.111  1.00  0.91           C  
ATOM   7226  C   PHE B  54      43.388  -9.574  38.472  1.00  0.91           C  
ATOM   7227  O   PHE B  54      44.433  -8.979  38.732  1.00  0.91           O  
ATOM   7228  CB  PHE B  54      42.358  -9.268  36.206  1.00  0.91           C  
ATOM   7229  CG  PHE B  54      42.607  -9.526  34.749  1.00  0.91           C  
ATOM   7230  CD1 PHE B  54      43.909  -9.475  34.221  1.00  0.91           C  
ATOM   7231  CD2 PHE B  54      41.531  -9.746  33.875  1.00  0.91           C  
ATOM   7232  CE1 PHE B  54      44.128  -9.665  32.853  1.00  0.91           C  
ATOM   7233  CE2 PHE B  54      41.752  -9.926  32.504  1.00  0.91           C  
ATOM   7234  CZ  PHE B  54      43.053  -9.895  31.994  1.00  0.91           C  
ATOM   7235  N   ALA B  55      42.424  -9.715  39.400  1.00  0.92           N  
ATOM   7236  CA  ALA B  55      42.569  -9.272  40.768  1.00  0.92           C  
ATOM   7237  C   ALA B  55      43.738  -9.943  41.491  1.00  0.92           C  
ATOM   7238  O   ALA B  55      44.527  -9.287  42.167  1.00  0.92           O  
ATOM   7239  CB  ALA B  55      41.247  -9.531  41.515  1.00  0.92           C  
ATOM   7240  N   LEU B  56      43.915 -11.271  41.314  1.00  0.91           N  
ATOM   7241  CA  LEU B  56      45.073 -11.991  41.812  1.00  0.91           C  
ATOM   7242  C   LEU B  56      46.368 -11.579  41.141  1.00  0.91           C  
ATOM   7243  O   LEU B  56      47.383 -11.370  41.805  1.00  0.91           O  
ATOM   7244  CB  LEU B  56      44.882 -13.517  41.664  1.00  0.91           C  
ATOM   7245  CG  LEU B  56      45.974 -14.389  42.319  1.00  0.91           C  
ATOM   7246  CD1 LEU B  56      46.127 -14.113  43.825  1.00  0.91           C  
ATOM   7247  CD2 LEU B  56      45.653 -15.873  42.105  1.00  0.91           C  
ATOM   7248  N   ALA B  57      46.351 -11.405  39.803  1.00  0.95           N  
ATOM   7249  CA  ALA B  57      47.505 -10.992  39.040  1.00  0.95           C  
ATOM   7250  C   ALA B  57      48.042  -9.641  39.484  1.00  0.95           C  
ATOM   7251  O   ALA B  57      49.231  -9.503  39.749  1.00  0.95           O  
ATOM   7252  CB  ALA B  57      47.168 -10.960  37.534  1.00  0.95           C  
ATOM   7253  N   HIS B  58      47.162  -8.636  39.668  1.00  0.87           N  
ATOM   7254  CA  HIS B  58      47.534  -7.337  40.203  1.00  0.87           C  
ATOM   7255  C   HIS B  58      48.060  -7.389  41.636  1.00  0.87           C  
ATOM   7256  O   HIS B  58      49.079  -6.775  41.945  1.00  0.87           O  
ATOM   7257  CB  HIS B  58      46.366  -6.339  40.090  1.00  0.87           C  
ATOM   7258  CG  HIS B  58      46.123  -5.840  38.693  1.00  0.87           C  
ATOM   7259  ND1 HIS B  58      47.003  -4.939  38.121  1.00  0.87           N  
ATOM   7260  CD2 HIS B  58      45.104  -6.100  37.834  1.00  0.87           C  
ATOM   7261  CE1 HIS B  58      46.502  -4.670  36.935  1.00  0.87           C  
ATOM   7262  NE2 HIS B  58      45.352  -5.348  36.706  1.00  0.87           N  
ATOM   7263  N   THR B  59      47.439  -8.176  42.541  1.00  0.87           N  
ATOM   7264  CA  THR B  59      47.933  -8.382  43.908  1.00  0.87           C  
ATOM   7265  C   THR B  59      49.326  -8.961  43.977  1.00  0.87           C  
ATOM   7266  O   THR B  59      50.184  -8.478  44.712  1.00  0.87           O  
ATOM   7267  CB  THR B  59      47.030  -9.330  44.678  1.00  0.87           C  
ATOM   7268  OG1 THR B  59      45.760  -8.731  44.811  1.00  0.87           O  
ATOM   7269  CG2 THR B  59      47.506  -9.596  46.112  1.00  0.87           C  
ATOM   7270  N   VAL B  60      49.610 -10.007  43.178  1.00  0.89           N  
ATOM   7271  CA  VAL B  60      50.947 -10.561  43.043  1.00  0.89           C  
ATOM   7272  C   VAL B  60      51.901  -9.560  42.385  1.00  0.89           C  
ATOM   7273  O   VAL B  60      53.069  -9.435  42.761  1.00  0.89           O  
ATOM   7274  CB  VAL B  60      50.923 -11.893  42.298  1.00  0.89           C  
ATOM   7275  CG1 VAL B  60      52.347 -12.458  42.165  1.00  0.89           C  
ATOM   7276  CG2 VAL B  60      50.059 -12.921  43.059  1.00  0.89           C  
ATOM   7277  N   ARG B  61      51.417  -8.786  41.392  1.00  0.84           N  
ATOM   7278  CA  ARG B  61      52.192  -7.786  40.689  1.00  0.84           C  
ATOM   7279  C   ARG B  61      52.757  -6.683  41.562  1.00  0.84           C  
ATOM   7280  O   ARG B  61      53.904  -6.301  41.374  1.00  0.84           O  
ATOM   7281  CB  ARG B  61      51.407  -7.121  39.545  1.00  0.84           C  
ATOM   7282  CG  ARG B  61      52.317  -6.584  38.430  1.00  0.84           C  
ATOM   7283  CD  ARG B  61      51.626  -5.566  37.534  1.00  0.84           C  
ATOM   7284  NE  ARG B  61      51.738  -4.199  38.136  1.00  0.84           N  
ATOM   7285  CZ  ARG B  61      51.271  -3.124  37.486  1.00  0.84           C  
ATOM   7286  NH1 ARG B  61      50.623  -3.252  36.334  1.00  0.84           N  
ATOM   7287  NH2 ARG B  61      51.471  -1.906  37.979  1.00  0.84           N  
ATOM   7288  N   ASP B  62      52.002  -6.168  42.559  1.00  0.84           N  
ATOM   7289  CA  ASP B  62      52.487  -5.158  43.493  1.00  0.84           C  
ATOM   7290  C   ASP B  62      53.739  -5.637  44.223  1.00  0.84           C  
ATOM   7291  O   ASP B  62      54.742  -4.926  44.317  1.00  0.84           O  
ATOM   7292  CB  ASP B  62      51.431  -4.803  44.573  1.00  0.84           C  
ATOM   7293  CG  ASP B  62      50.272  -3.987  44.017  1.00  0.84           C  
ATOM   7294  OD1 ASP B  62      50.393  -3.502  42.855  1.00  0.84           O  
ATOM   7295  OD2 ASP B  62      49.211  -3.809  44.696  1.00  0.84           O  
ATOM   7296  N   HIS B  63      53.723  -6.912  44.682  1.00  0.82           N  
ATOM   7297  CA  HIS B  63      54.859  -7.563  45.307  1.00  0.82           C  
ATOM   7298  C   HIS B  63      56.054  -7.634  44.386  1.00  0.82           C  
ATOM   7299  O   HIS B  63      57.162  -7.302  44.760  1.00  0.82           O  
ATOM   7300  CB  HIS B  63      54.518  -9.000  45.767  1.00  0.82           C  
ATOM   7301  CG  HIS B  63      53.575  -8.991  46.906  1.00  0.82           C  
ATOM   7302  ND1 HIS B  63      54.053  -8.408  48.052  1.00  0.82           N  
ATOM   7303  CD2 HIS B  63      52.243  -9.201  46.992  1.00  0.82           C  
ATOM   7304  CE1 HIS B  63      52.994  -8.258  48.807  1.00  0.82           C  
ATOM   7305  NE2 HIS B  63      51.861  -8.719  48.224  1.00  0.82           N  
ATOM   7306  N   LEU B  64      55.804  -8.021  43.116  1.00  0.85           N  
ATOM   7307  CA  LEU B  64      56.789  -8.076  42.060  1.00  0.85           C  
ATOM   7308  C   LEU B  64      57.423  -6.718  41.772  1.00  0.85           C  
ATOM   7309  O   LEU B  64      58.644  -6.579  41.733  1.00  0.85           O  
ATOM   7310  CB  LEU B  64      56.064  -8.599  40.791  1.00  0.85           C  
ATOM   7311  CG  LEU B  64      56.782  -9.670  39.954  1.00  0.85           C  
ATOM   7312  CD1 LEU B  64      56.093  -9.777  38.580  1.00  0.85           C  
ATOM   7313  CD2 LEU B  64      58.280  -9.426  39.798  1.00  0.85           C  
ATOM   7314  N   VAL B  65      56.591  -5.665  41.638  1.00  0.82           N  
ATOM   7315  CA  VAL B  65      57.009  -4.293  41.391  1.00  0.82           C  
ATOM   7316  C   VAL B  65      57.865  -3.731  42.515  1.00  0.82           C  
ATOM   7317  O   VAL B  65      58.879  -3.077  42.276  1.00  0.82           O  
ATOM   7318  CB  VAL B  65      55.818  -3.378  41.113  1.00  0.82           C  
ATOM   7319  CG1 VAL B  65      56.262  -1.907  40.986  1.00  0.82           C  
ATOM   7320  CG2 VAL B  65      55.134  -3.806  39.798  1.00  0.82           C  
ATOM   7321  N   GLY B  66      57.526  -4.000  43.792  1.00  0.81           N  
ATOM   7322  CA  GLY B  66      58.325  -3.507  44.912  1.00  0.81           C  
ATOM   7323  C   GLY B  66      59.710  -4.085  45.010  1.00  0.81           C  
ATOM   7324  O   GLY B  66      60.659  -3.411  45.407  1.00  0.81           O  
ATOM   7325  N   ARG B  67      59.862  -5.359  44.612  1.00  0.79           N  
ATOM   7326  CA  ARG B  67      61.153  -5.995  44.450  1.00  0.79           C  
ATOM   7327  C   ARG B  67      61.903  -5.446  43.242  1.00  0.79           C  
ATOM   7328  O   ARG B  67      63.112  -5.244  43.303  1.00  0.79           O  
ATOM   7329  CB  ARG B  67      61.022  -7.522  44.278  1.00  0.79           C  
ATOM   7330  CG  ARG B  67      60.181  -8.303  45.307  1.00  0.79           C  
ATOM   7331  CD  ARG B  67      60.827  -8.545  46.672  1.00  0.79           C  
ATOM   7332  NE  ARG B  67      60.275  -9.818  47.264  1.00  0.79           N  
ATOM   7333  CZ  ARG B  67      59.030 -10.015  47.726  1.00  0.79           C  
ATOM   7334  NH1 ARG B  67      58.076  -9.100  47.600  1.00  0.79           N  
ATOM   7335  NH2 ARG B  67      58.736 -11.171  48.325  1.00  0.79           N  
ATOM   7336  N   TRP B  68      61.190  -5.158  42.125  1.00  0.87           N  
ATOM   7337  CA  TRP B  68      61.744  -4.593  40.905  1.00  0.87           C  
ATOM   7338  C   TRP B  68      62.359  -3.227  41.118  1.00  0.87           C  
ATOM   7339  O   TRP B  68      63.506  -2.994  40.739  1.00  0.87           O  
ATOM   7340  CB  TRP B  68      60.661  -4.520  39.788  1.00  0.87           C  
ATOM   7341  CG  TRP B  68      61.167  -4.116  38.412  1.00  0.87           C  
ATOM   7342  CD1 TRP B  68      61.716  -4.901  37.440  1.00  0.87           C  
ATOM   7343  CD2 TRP B  68      61.214  -2.768  37.906  1.00  0.87           C  
ATOM   7344  NE1 TRP B  68      62.074  -4.140  36.351  1.00  0.87           N  
ATOM   7345  CE2 TRP B  68      61.773  -2.830  36.620  1.00  0.87           C  
ATOM   7346  CE3 TRP B  68      60.836  -1.550  38.465  1.00  0.87           C  
ATOM   7347  CZ2 TRP B  68      61.959  -1.681  35.861  1.00  0.87           C  
ATOM   7348  CZ3 TRP B  68      61.086  -0.381  37.730  1.00  0.87           C  
ATOM   7349  CH2 TRP B  68      61.630  -0.445  36.441  1.00  0.87           C  
ATOM   7350  N   ILE B  69      61.646  -2.307  41.802  1.00  0.85           N  
ATOM   7351  CA  ILE B  69      62.135  -0.968  42.091  1.00  0.85           C  
ATOM   7352  C   ILE B  69      63.406  -1.015  42.928  1.00  0.85           C  
ATOM   7353  O   ILE B  69      64.401  -0.393  42.607  1.00  0.85           O  
ATOM   7354  CB  ILE B  69      61.066  -0.104  42.760  1.00  0.85           C  
ATOM   7355  CG1 ILE B  69      59.851   0.092  41.821  1.00  0.85           C  
ATOM   7356  CG2 ILE B  69      61.654   1.274  43.136  1.00  0.85           C  
ATOM   7357  CD1 ILE B  69      58.638   0.721  42.512  1.00  0.85           C  
ATOM   7358  N   ARG B  70      63.439  -1.843  43.996  1.00  0.80           N  
ATOM   7359  CA  ARG B  70      64.645  -2.020  44.783  1.00  0.80           C  
ATOM   7360  C   ARG B  70      65.787  -2.674  44.021  1.00  0.80           C  
ATOM   7361  O   ARG B  70      66.935  -2.253  44.140  1.00  0.80           O  
ATOM   7362  CB  ARG B  70      64.343  -2.792  46.090  1.00  0.80           C  
ATOM   7363  CG  ARG B  70      63.478  -2.011  47.109  1.00  0.80           C  
ATOM   7364  CD  ARG B  70      64.030  -0.614  47.437  1.00  0.80           C  
ATOM   7365  NE  ARG B  70      63.332  -0.095  48.659  1.00  0.80           N  
ATOM   7366  CZ  ARG B  70      63.368   1.192  49.032  1.00  0.80           C  
ATOM   7367  NH1 ARG B  70      63.906   2.135  48.269  1.00  0.80           N  
ATOM   7368  NH2 ARG B  70      62.809   1.558  50.187  1.00  0.80           N  
ATOM   7369  N   THR B  71      65.497  -3.685  43.180  1.00  0.87           N  
ATOM   7370  CA  THR B  71      66.495  -4.309  42.311  1.00  0.87           C  
ATOM   7371  C   THR B  71      67.124  -3.318  41.347  1.00  0.87           C  
ATOM   7372  O   THR B  71      68.343  -3.205  41.228  1.00  0.87           O  
ATOM   7373  CB  THR B  71      65.931  -5.431  41.473  1.00  0.87           C  
ATOM   7374  OG1 THR B  71      65.314  -6.402  42.304  1.00  0.87           O  
ATOM   7375  CG2 THR B  71      67.041  -6.099  40.659  1.00  0.87           C  
ATOM   7376  N   GLN B  72      66.294  -2.507  40.663  1.00  0.84           N  
ATOM   7377  CA  GLN B  72      66.782  -1.491  39.759  1.00  0.84           C  
ATOM   7378  C   GLN B  72      67.538  -0.360  40.449  1.00  0.84           C  
ATOM   7379  O   GLN B  72      68.588   0.053  39.971  1.00  0.84           O  
ATOM   7380  CB  GLN B  72      65.667  -0.942  38.840  1.00  0.84           C  
ATOM   7381  CG  GLN B  72      65.004  -1.998  37.914  1.00  0.84           C  
ATOM   7382  CD  GLN B  72      65.991  -2.816  37.072  1.00  0.84           C  
ATOM   7383  OE1 GLN B  72      66.784  -2.306  36.269  1.00  0.84           O  
ATOM   7384  NE2 GLN B  72      65.931  -4.158  37.242  1.00  0.84           N  
ATOM   7385  N   GLN B  73      67.068   0.125  41.624  1.00  0.80           N  
ATOM   7386  CA  GLN B  73      67.760   1.114  42.437  1.00  0.80           C  
ATOM   7387  C   GLN B  73      69.136   0.640  42.883  1.00  0.80           C  
ATOM   7388  O   GLN B  73      70.118   1.370  42.789  1.00  0.80           O  
ATOM   7389  CB  GLN B  73      66.918   1.475  43.689  1.00  0.80           C  
ATOM   7390  CG  GLN B  73      65.697   2.368  43.376  1.00  0.80           C  
ATOM   7391  CD  GLN B  73      64.842   2.631  44.617  1.00  0.80           C  
ATOM   7392  OE1 GLN B  73      64.976   2.042  45.699  1.00  0.80           O  
ATOM   7393  NE2 GLN B  73      63.880   3.566  44.457  1.00  0.80           N  
ATOM   7394  N   HIS B  74      69.242  -0.640  43.299  1.00  0.81           N  
ATOM   7395  CA  HIS B  74      70.492  -1.294  43.657  1.00  0.81           C  
ATOM   7396  C   HIS B  74      71.518  -1.302  42.524  1.00  0.81           C  
ATOM   7397  O   HIS B  74      72.709  -1.078  42.722  1.00  0.81           O  
ATOM   7398  CB  HIS B  74      70.193  -2.748  44.094  1.00  0.81           C  
ATOM   7399  CG  HIS B  74      71.382  -3.559  44.490  1.00  0.81           C  
ATOM   7400  ND1 HIS B  74      72.029  -3.271  45.670  1.00  0.81           N  
ATOM   7401  CD2 HIS B  74      71.979  -4.608  43.868  1.00  0.81           C  
ATOM   7402  CE1 HIS B  74      73.004  -4.145  45.750  1.00  0.81           C  
ATOM   7403  NE2 HIS B  74      73.025  -4.980  44.683  1.00  0.81           N  
ATOM   7404  N   TYR B  75      71.090  -1.525  41.265  1.00  0.85           N  
ATOM   7405  CA  TYR B  75      71.978  -1.456  40.114  1.00  0.85           C  
ATOM   7406  C   TYR B  75      72.497  -0.058  39.805  1.00  0.85           C  
ATOM   7407  O   TYR B  75      73.601   0.108  39.295  1.00  0.85           O  
ATOM   7408  CB  TYR B  75      71.316  -2.048  38.842  1.00  0.85           C  
ATOM   7409  CG  TYR B  75      70.961  -3.509  38.973  1.00  0.85           C  
ATOM   7410  CD1 TYR B  75      71.656  -4.392  39.822  1.00  0.85           C  
ATOM   7411  CD2 TYR B  75      69.901  -4.019  38.201  1.00  0.85           C  
ATOM   7412  CE1 TYR B  75      71.269  -5.733  39.929  1.00  0.85           C  
ATOM   7413  CE2 TYR B  75      69.525  -5.366  38.296  1.00  0.85           C  
ATOM   7414  CZ  TYR B  75      70.202  -6.215  39.174  1.00  0.85           C  
ATOM   7415  OH  TYR B  75      69.818  -7.560  39.298  1.00  0.85           O  
ATOM   7416  N   TYR B  76      71.721   1.004  40.079  1.00  0.82           N  
ATOM   7417  CA  TYR B  76      72.240   2.362  40.040  1.00  0.82           C  
ATOM   7418  C   TYR B  76      73.167   2.657  41.212  1.00  0.82           C  
ATOM   7419  O   TYR B  76      74.154   3.365  41.045  1.00  0.82           O  
ATOM   7420  CB  TYR B  76      71.121   3.424  39.913  1.00  0.82           C  
ATOM   7421  CG  TYR B  76      70.600   3.444  38.495  1.00  0.82           C  
ATOM   7422  CD1 TYR B  76      69.509   2.649  38.104  1.00  0.82           C  
ATOM   7423  CD2 TYR B  76      71.207   4.267  37.529  1.00  0.82           C  
ATOM   7424  CE1 TYR B  76      69.036   2.673  36.783  1.00  0.82           C  
ATOM   7425  CE2 TYR B  76      70.728   4.303  36.211  1.00  0.82           C  
ATOM   7426  CZ  TYR B  76      69.630   3.519  35.845  1.00  0.82           C  
ATOM   7427  OH  TYR B  76      69.086   3.644  34.551  1.00  0.82           O  
ATOM   7428  N   GLU B  77      72.902   2.099  42.416  1.00  0.77           N  
ATOM   7429  CA  GLU B  77      73.780   2.236  43.571  1.00  0.77           C  
ATOM   7430  C   GLU B  77      75.157   1.626  43.348  1.00  0.77           C  
ATOM   7431  O   GLU B  77      76.184   2.208  43.693  1.00  0.77           O  
ATOM   7432  CB  GLU B  77      73.162   1.594  44.846  1.00  0.77           C  
ATOM   7433  CG  GLU B  77      73.978   1.897  46.136  1.00  0.77           C  
ATOM   7434  CD  GLU B  77      73.633   1.030  47.345  1.00  0.77           C  
ATOM   7435  OE1 GLU B  77      72.441   0.944  47.713  1.00  0.77           O  
ATOM   7436  OE2 GLU B  77      74.600   0.456  47.926  1.00  0.77           O  
ATOM   7437  N   LYS B  78      75.213   0.420  42.748  1.00  0.81           N  
ATOM   7438  CA  LYS B  78      76.464  -0.303  42.636  1.00  0.81           C  
ATOM   7439  C   LYS B  78      77.130  -0.227  41.280  1.00  0.81           C  
ATOM   7440  O   LYS B  78      78.287  -0.622  41.152  1.00  0.81           O  
ATOM   7441  CB  LYS B  78      76.221  -1.805  42.929  1.00  0.81           C  
ATOM   7442  CG  LYS B  78      75.686  -2.092  44.339  1.00  0.81           C  
ATOM   7443  CD  LYS B  78      76.617  -1.577  45.447  1.00  0.81           C  
ATOM   7444  CE  LYS B  78      76.088  -1.901  46.841  1.00  0.81           C  
ATOM   7445  NZ  LYS B  78      76.792  -1.084  47.854  1.00  0.81           N  
ATOM   7446  N   ASP B  79      76.427   0.260  40.238  1.00  0.87           N  
ATOM   7447  CA  ASP B  79      76.902   0.286  38.859  1.00  0.87           C  
ATOM   7448  C   ASP B  79      77.573  -1.025  38.366  1.00  0.87           C  
ATOM   7449  O   ASP B  79      78.713  -1.018  37.889  1.00  0.87           O  
ATOM   7450  CB  ASP B  79      77.741   1.577  38.673  1.00  0.87           C  
ATOM   7451  CG  ASP B  79      78.286   1.796  37.280  1.00  0.87           C  
ATOM   7452  OD1 ASP B  79      77.541   2.074  36.302  1.00  0.87           O  
ATOM   7453  OD2 ASP B  79      79.537   1.711  37.144  1.00  0.87           O  
ATOM   7454  N   PRO B  80      76.942  -2.195  38.474  1.00  0.93           N  
ATOM   7455  CA  PRO B  80      77.513  -3.430  37.970  1.00  0.93           C  
ATOM   7456  C   PRO B  80      77.512  -3.466  36.459  1.00  0.93           C  
ATOM   7457  O   PRO B  80      76.823  -2.682  35.806  1.00  0.93           O  
ATOM   7458  CB  PRO B  80      76.569  -4.498  38.530  1.00  0.93           C  
ATOM   7459  CG  PRO B  80      75.202  -3.813  38.471  1.00  0.93           C  
ATOM   7460  CD  PRO B  80      75.526  -2.358  38.803  1.00  0.93           C  
ATOM   7461  N   LYS B  81      78.288  -4.393  35.870  1.00  0.91           N  
ATOM   7462  CA  LYS B  81      78.241  -4.619  34.445  1.00  0.91           C  
ATOM   7463  C   LYS B  81      76.880  -5.135  34.002  1.00  0.91           C  
ATOM   7464  O   LYS B  81      76.381  -6.145  34.491  1.00  0.91           O  
ATOM   7465  CB  LYS B  81      79.378  -5.564  33.994  1.00  0.91           C  
ATOM   7466  CG  LYS B  81      79.403  -5.815  32.481  1.00  0.91           C  
ATOM   7467  CD  LYS B  81      80.697  -6.489  32.004  1.00  0.91           C  
ATOM   7468  CE  LYS B  81      80.719  -6.613  30.480  1.00  0.91           C  
ATOM   7469  NZ  LYS B  81      82.004  -7.156  30.000  1.00  0.91           N  
ATOM   7470  N   ARG B  82      76.233  -4.404  33.075  1.00  0.91           N  
ATOM   7471  CA  ARG B  82      74.886  -4.689  32.652  1.00  0.91           C  
ATOM   7472  C   ARG B  82      74.861  -5.555  31.414  1.00  0.91           C  
ATOM   7473  O   ARG B  82      75.592  -5.346  30.448  1.00  0.91           O  
ATOM   7474  CB  ARG B  82      74.097  -3.389  32.400  1.00  0.91           C  
ATOM   7475  CG  ARG B  82      73.788  -2.625  33.703  1.00  0.91           C  
ATOM   7476  CD  ARG B  82      72.952  -1.370  33.442  1.00  0.91           C  
ATOM   7477  NE  ARG B  82      72.235  -0.941  34.686  1.00  0.91           N  
ATOM   7478  CZ  ARG B  82      72.727  -0.059  35.576  1.00  0.91           C  
ATOM   7479  NH1 ARG B  82      73.997   0.315  35.549  1.00  0.91           N  
ATOM   7480  NH2 ARG B  82      71.917   0.460  36.496  1.00  0.91           N  
ATOM   7481  N   ILE B  83      73.995  -6.577  31.430  1.00  0.97           N  
ATOM   7482  CA  ILE B  83      73.982  -7.605  30.410  1.00  0.97           C  
ATOM   7483  C   ILE B  83      72.704  -7.501  29.629  1.00  0.97           C  
ATOM   7484  O   ILE B  83      71.601  -7.609  30.158  1.00  0.97           O  
ATOM   7485  CB  ILE B  83      74.108  -8.999  31.001  1.00  0.97           C  
ATOM   7486  CG1 ILE B  83      75.447  -9.110  31.760  1.00  0.97           C  
ATOM   7487  CG2 ILE B  83      74.022 -10.065  29.877  1.00  0.97           C  
ATOM   7488  CD1 ILE B  83      75.498 -10.306  32.704  1.00  0.97           C  
ATOM   7489  N   TYR B  84      72.830  -7.287  28.317  1.00  0.97           N  
ATOM   7490  CA  TYR B  84      71.710  -7.049  27.451  1.00  0.97           C  
ATOM   7491  C   TYR B  84      71.581  -8.211  26.498  1.00  0.97           C  
ATOM   7492  O   TYR B  84      72.397  -8.427  25.603  1.00  0.97           O  
ATOM   7493  CB  TYR B  84      71.912  -5.728  26.675  1.00  0.97           C  
ATOM   7494  CG  TYR B  84      71.930  -4.573  27.644  1.00  0.97           C  
ATOM   7495  CD1 TYR B  84      70.720  -4.050  28.105  1.00  0.97           C  
ATOM   7496  CD2 TYR B  84      73.125  -3.992  28.095  1.00  0.97           C  
ATOM   7497  CE1 TYR B  84      70.688  -2.944  28.967  1.00  0.97           C  
ATOM   7498  CE2 TYR B  84      73.104  -2.878  28.954  1.00  0.97           C  
ATOM   7499  CZ  TYR B  84      71.879  -2.333  29.362  1.00  0.97           C  
ATOM   7500  OH  TYR B  84      71.831  -1.123  30.095  1.00  0.97           O  
ATOM   7501  N   TYR B  85      70.516  -9.009  26.682  1.00  0.98           N  
ATOM   7502  CA  TYR B  85      70.227 -10.145  25.843  1.00  0.98           C  
ATOM   7503  C   TYR B  85      69.275  -9.673  24.765  1.00  0.98           C  
ATOM   7504  O   TYR B  85      68.096  -9.409  25.014  1.00  0.98           O  
ATOM   7505  CB  TYR B  85      69.608 -11.291  26.685  1.00  0.98           C  
ATOM   7506  CG  TYR B  85      69.716 -12.609  25.966  1.00  0.98           C  
ATOM   7507  CD1 TYR B  85      70.909 -13.343  26.048  1.00  0.98           C  
ATOM   7508  CD2 TYR B  85      68.652 -13.125  25.207  1.00  0.98           C  
ATOM   7509  CE1 TYR B  85      71.037 -14.571  25.388  1.00  0.98           C  
ATOM   7510  CE2 TYR B  85      68.782 -14.356  24.542  1.00  0.98           C  
ATOM   7511  CZ  TYR B  85      69.978 -15.078  24.635  1.00  0.98           C  
ATOM   7512  OH  TYR B  85      70.141 -16.340  24.026  1.00  0.98           O  
ATOM   7513  N   LEU B  86      69.782  -9.526  23.530  1.00  0.98           N  
ATOM   7514  CA  LEU B  86      68.999  -9.030  22.422  1.00  0.98           C  
ATOM   7515  C   LEU B  86      68.441 -10.213  21.671  1.00  0.98           C  
ATOM   7516  O   LEU B  86      69.162 -11.110  21.233  1.00  0.98           O  
ATOM   7517  CB  LEU B  86      69.813  -8.137  21.449  1.00  0.98           C  
ATOM   7518  CG  LEU B  86      69.880  -6.642  21.829  1.00  0.98           C  
ATOM   7519  CD1 LEU B  86      70.499  -6.425  23.217  1.00  0.98           C  
ATOM   7520  CD2 LEU B  86      70.654  -5.853  20.757  1.00  0.98           C  
ATOM   7521  N   SER B  87      67.113 -10.241  21.505  1.00  0.98           N  
ATOM   7522  CA  SER B  87      66.448 -11.348  20.854  1.00  0.98           C  
ATOM   7523  C   SER B  87      65.232 -10.814  20.150  1.00  0.98           C  
ATOM   7524  O   SER B  87      64.602  -9.857  20.586  1.00  0.98           O  
ATOM   7525  CB  SER B  87      65.997 -12.438  21.865  1.00  0.98           C  
ATOM   7526  OG  SER B  87      65.410 -13.585  21.238  1.00  0.98           O  
ATOM   7527  N   LEU B  88      64.842 -11.451  19.035  1.00  0.97           N  
ATOM   7528  CA  LEU B  88      63.633 -11.108  18.318  1.00  0.97           C  
ATOM   7529  C   LEU B  88      62.499 -11.976  18.833  1.00  0.97           C  
ATOM   7530  O   LEU B  88      61.367 -11.868  18.370  1.00  0.97           O  
ATOM   7531  CB  LEU B  88      63.817 -11.351  16.796  1.00  0.97           C  
ATOM   7532  CG  LEU B  88      64.394 -10.159  15.994  1.00  0.97           C  
ATOM   7533  CD1 LEU B  88      63.367  -9.025  15.853  1.00  0.97           C  
ATOM   7534  CD2 LEU B  88      65.728  -9.625  16.540  1.00  0.97           C  
ATOM   7535  N   GLU B  89      62.777 -12.838  19.829  1.00  0.95           N  
ATOM   7536  CA  GLU B  89      61.801 -13.732  20.399  1.00  0.95           C  
ATOM   7537  C   GLU B  89      61.990 -13.915  21.897  1.00  0.95           C  
ATOM   7538  O   GLU B  89      63.098 -14.099  22.401  1.00  0.95           O  
ATOM   7539  CB  GLU B  89      61.896 -15.135  19.771  1.00  0.95           C  
ATOM   7540  CG  GLU B  89      61.516 -15.195  18.278  1.00  0.95           C  
ATOM   7541  CD  GLU B  89      61.546 -16.620  17.753  1.00  0.95           C  
ATOM   7542  OE1 GLU B  89      61.479 -17.576  18.574  1.00  0.95           O  
ATOM   7543  OE2 GLU B  89      61.564 -16.778  16.509  1.00  0.95           O  
ATOM   7544  N   PHE B  90      60.875 -13.902  22.643  1.00  0.96           N  
ATOM   7545  CA  PHE B  90      60.831 -14.171  24.065  1.00  0.96           C  
ATOM   7546  C   PHE B  90      59.598 -15.009  24.354  1.00  0.96           C  
ATOM   7547  O   PHE B  90      58.493 -14.504  24.537  1.00  0.96           O  
ATOM   7548  CB  PHE B  90      60.758 -12.858  24.891  1.00  0.96           C  
ATOM   7549  CG  PHE B  90      62.128 -12.270  25.055  1.00  0.96           C  
ATOM   7550  CD1 PHE B  90      62.995 -12.802  26.021  1.00  0.96           C  
ATOM   7551  CD2 PHE B  90      62.573 -11.209  24.249  1.00  0.96           C  
ATOM   7552  CE1 PHE B  90      64.299 -12.309  26.156  1.00  0.96           C  
ATOM   7553  CE2 PHE B  90      63.873 -10.708  24.391  1.00  0.96           C  
ATOM   7554  CZ  PHE B  90      64.743 -11.268  25.335  1.00  0.96           C  
ATOM   7555  N   TYR B  91      59.755 -16.345  24.419  1.00  0.94           N  
ATOM   7556  CA  TYR B  91      58.649 -17.282  24.529  1.00  0.94           C  
ATOM   7557  C   TYR B  91      58.342 -17.565  25.993  1.00  0.94           C  
ATOM   7558  O   TYR B  91      58.555 -18.660  26.521  1.00  0.94           O  
ATOM   7559  CB  TYR B  91      59.017 -18.578  23.759  1.00  0.94           C  
ATOM   7560  CG  TYR B  91      57.894 -19.398  23.180  1.00  0.94           C  
ATOM   7561  CD1 TYR B  91      56.527 -19.114  23.346  1.00  0.94           C  
ATOM   7562  CD2 TYR B  91      58.260 -20.494  22.381  1.00  0.94           C  
ATOM   7563  CE1 TYR B  91      55.554 -19.897  22.701  1.00  0.94           C  
ATOM   7564  CE2 TYR B  91      57.294 -21.269  21.731  1.00  0.94           C  
ATOM   7565  CZ  TYR B  91      55.942 -20.962  21.885  1.00  0.94           C  
ATOM   7566  OH  TYR B  91      54.980 -21.733  21.208  1.00  0.94           O  
ATOM   7567  N   MET B  92      57.880 -16.524  26.706  1.00  0.94           N  
ATOM   7568  CA  MET B  92      57.730 -16.499  28.143  1.00  0.94           C  
ATOM   7569  C   MET B  92      56.709 -17.464  28.719  1.00  0.94           C  
ATOM   7570  O   MET B  92      56.970 -18.114  29.725  1.00  0.94           O  
ATOM   7571  CB  MET B  92      57.385 -15.077  28.616  1.00  0.94           C  
ATOM   7572  CG  MET B  92      58.428 -14.017  28.219  1.00  0.94           C  
ATOM   7573  SD  MET B  92      60.106 -14.330  28.852  1.00  0.94           S  
ATOM   7574  CE  MET B  92      59.824 -13.754  30.550  1.00  0.94           C  
ATOM   7575  N   GLY B  93      55.533 -17.594  28.063  1.00  0.97           N  
ATOM   7576  CA  GLY B  93      54.445 -18.418  28.582  1.00  0.97           C  
ATOM   7577  C   GLY B  93      53.585 -17.660  29.558  1.00  0.97           C  
ATOM   7578  O   GLY B  93      53.416 -16.451  29.437  1.00  0.97           O  
ATOM   7579  N   ARG B  94      52.989 -18.369  30.533  1.00  0.91           N  
ATOM   7580  CA  ARG B  94      52.244 -17.770  31.632  1.00  0.91           C  
ATOM   7581  C   ARG B  94      53.145 -17.201  32.738  1.00  0.91           C  
ATOM   7582  O   ARG B  94      54.233 -17.726  33.006  1.00  0.91           O  
ATOM   7583  CB  ARG B  94      51.307 -18.816  32.276  1.00  0.91           C  
ATOM   7584  CG  ARG B  94      50.143 -19.283  31.380  1.00  0.91           C  
ATOM   7585  CD  ARG B  94      49.324 -20.352  32.101  1.00  0.91           C  
ATOM   7586  NE  ARG B  94      48.131 -20.688  31.273  1.00  0.91           N  
ATOM   7587  CZ  ARG B  94      47.439 -21.810  31.435  1.00  0.91           C  
ATOM   7588  NH1 ARG B  94      47.859 -22.698  32.322  1.00  0.91           N  
ATOM   7589  NH2 ARG B  94      46.289 -22.022  30.803  1.00  0.91           N  
ATOM   7590  N   THR B  95      52.709 -16.138  33.445  1.00  0.96           N  
ATOM   7591  CA  THR B  95      53.520 -15.465  34.451  1.00  0.96           C  
ATOM   7592  C   THR B  95      53.010 -15.655  35.879  1.00  0.96           C  
ATOM   7593  O   THR B  95      53.795 -15.637  36.812  1.00  0.96           O  
ATOM   7594  CB  THR B  95      53.572 -13.963  34.193  1.00  0.96           C  
ATOM   7595  OG1 THR B  95      54.204 -13.681  32.955  1.00  0.96           O  
ATOM   7596  CG2 THR B  95      54.357 -13.176  35.253  1.00  0.96           C  
ATOM   7597  N   LEU B  96      51.686 -15.876  36.119  1.00  0.94           N  
ATOM   7598  CA  LEU B  96      51.131 -15.813  37.476  1.00  0.94           C  
ATOM   7599  C   LEU B  96      51.758 -16.793  38.468  1.00  0.94           C  
ATOM   7600  O   LEU B  96      52.336 -16.386  39.478  1.00  0.94           O  
ATOM   7601  CB  LEU B  96      49.587 -16.041  37.450  1.00  0.94           C  
ATOM   7602  CG  LEU B  96      48.713 -15.260  38.470  1.00  0.94           C  
ATOM   7603  CD1 LEU B  96      47.383 -15.990  38.725  1.00  0.94           C  
ATOM   7604  CD2 LEU B  96      49.377 -14.972  39.824  1.00  0.94           C  
ATOM   7605  N   GLN B  97      51.756 -18.108  38.151  1.00  0.92           N  
ATOM   7606  CA  GLN B  97      52.362 -19.126  38.995  1.00  0.92           C  
ATOM   7607  C   GLN B  97      53.869 -18.968  39.131  1.00  0.92           C  
ATOM   7608  O   GLN B  97      54.440 -19.092  40.210  1.00  0.92           O  
ATOM   7609  CB  GLN B  97      52.039 -20.561  38.517  1.00  0.92           C  
ATOM   7610  CG  GLN B  97      52.599 -21.622  39.492  1.00  0.92           C  
ATOM   7611  CD  GLN B  97      52.232 -23.058  39.122  1.00  0.92           C  
ATOM   7612  OE1 GLN B  97      52.206 -23.442  37.951  1.00  0.92           O  
ATOM   7613  NE2 GLN B  97      52.022 -23.890  40.167  1.00  0.92           N  
ATOM   7614  N   ASN B  98      54.570 -18.632  38.025  1.00  0.94           N  
ATOM   7615  CA  ASN B  98      56.012 -18.461  38.024  1.00  0.94           C  
ATOM   7616  C   ASN B  98      56.439 -17.346  38.968  1.00  0.94           C  
ATOM   7617  O   ASN B  98      57.367 -17.509  39.759  1.00  0.94           O  
ATOM   7618  CB  ASN B  98      56.511 -18.234  36.570  1.00  0.94           C  
ATOM   7619  CG  ASN B  98      58.031 -18.151  36.431  1.00  0.94           C  
ATOM   7620  OD1 ASN B  98      58.558 -17.126  36.026  1.00  0.94           O  
ATOM   7621  ND2 ASN B  98      58.748 -19.262  36.726  1.00  0.94           N  
ATOM   7622  N   THR B  99      55.712 -16.216  38.963  1.00  0.95           N  
ATOM   7623  CA  THR B  99      55.910 -15.143  39.928  1.00  0.95           C  
ATOM   7624  C   THR B  99      55.634 -15.567  41.356  1.00  0.95           C  
ATOM   7625  O   THR B  99      56.424 -15.305  42.262  1.00  0.95           O  
ATOM   7626  CB  THR B  99      55.050 -13.930  39.632  1.00  0.95           C  
ATOM   7627  OG1 THR B  99      55.393 -13.387  38.370  1.00  0.95           O  
ATOM   7628  CG2 THR B  99      55.350 -12.821  40.639  1.00  0.95           C  
ATOM   7629  N   MET B 100      54.518 -16.279  41.611  1.00  0.89           N  
ATOM   7630  CA  MET B 100      54.208 -16.753  42.945  1.00  0.89           C  
ATOM   7631  C   MET B 100      55.234 -17.730  43.513  1.00  0.89           C  
ATOM   7632  O   MET B 100      55.652 -17.573  44.659  1.00  0.89           O  
ATOM   7633  CB  MET B 100      52.788 -17.355  43.025  1.00  0.89           C  
ATOM   7634  CG  MET B 100      51.671 -16.307  42.844  1.00  0.89           C  
ATOM   7635  SD  MET B 100      49.994 -16.907  43.189  1.00  0.89           S  
ATOM   7636  CE  MET B 100      50.006 -18.244  41.968  1.00  0.89           C  
ATOM   7637  N   VAL B 101      55.722 -18.729  42.743  1.00  0.92           N  
ATOM   7638  CA  VAL B 101      56.772 -19.620  43.225  1.00  0.92           C  
ATOM   7639  C   VAL B 101      58.102 -18.932  43.424  1.00  0.92           C  
ATOM   7640  O   VAL B 101      58.782 -19.185  44.418  1.00  0.92           O  
ATOM   7641  CB  VAL B 101      56.992 -20.907  42.439  1.00  0.92           C  
ATOM   7642  CG1 VAL B 101      55.638 -21.597  42.250  1.00  0.92           C  
ATOM   7643  CG2 VAL B 101      57.691 -20.675  41.087  1.00  0.92           C  
ATOM   7644  N   ASN B 102      58.506 -18.019  42.513  1.00  0.93           N  
ATOM   7645  CA  ASN B 102      59.746 -17.279  42.634  1.00  0.93           C  
ATOM   7646  C   ASN B 102      59.781 -16.374  43.861  1.00  0.93           C  
ATOM   7647  O   ASN B 102      60.816 -16.269  44.517  1.00  0.93           O  
ATOM   7648  CB  ASN B 102      60.091 -16.498  41.338  1.00  0.93           C  
ATOM   7649  CG  ASN B 102      60.742 -17.439  40.323  1.00  0.93           C  
ATOM   7650  OD1 ASN B 102      61.617 -18.229  40.670  1.00  0.93           O  
ATOM   7651  ND2 ASN B 102      60.339 -17.347  39.040  1.00  0.93           N  
ATOM   7652  N   LEU B 103      58.646 -15.744  44.237  1.00  0.88           N  
ATOM   7653  CA  LEU B 103      58.603 -14.839  45.373  1.00  0.88           C  
ATOM   7654  C   LEU B 103      58.109 -15.484  46.675  1.00  0.88           C  
ATOM   7655  O   LEU B 103      58.063 -14.813  47.699  1.00  0.88           O  
ATOM   7656  CB  LEU B 103      57.688 -13.624  45.058  1.00  0.88           C  
ATOM   7657  CG  LEU B 103      58.066 -12.796  43.805  1.00  0.88           C  
ATOM   7658  CD1 LEU B 103      57.233 -11.505  43.765  1.00  0.88           C  
ATOM   7659  CD2 LEU B 103      59.561 -12.444  43.720  1.00  0.88           C  
ATOM   7660  N   ALA B 104      57.747 -16.789  46.658  1.00  0.86           N  
ATOM   7661  CA  ALA B 104      57.278 -17.583  47.796  1.00  0.86           C  
ATOM   7662  C   ALA B 104      55.827 -17.339  48.202  1.00  0.86           C  
ATOM   7663  O   ALA B 104      55.394 -17.684  49.297  1.00  0.86           O  
ATOM   7664  CB  ALA B 104      58.203 -17.555  49.037  1.00  0.86           C  
ATOM   7665  N   LEU B 105      55.002 -16.813  47.283  1.00  0.84           N  
ATOM   7666  CA  LEU B 105      53.670 -16.353  47.612  1.00  0.84           C  
ATOM   7667  C   LEU B 105      52.589 -17.390  47.352  1.00  0.84           C  
ATOM   7668  O   LEU B 105      51.444 -17.199  47.743  1.00  0.84           O  
ATOM   7669  CB  LEU B 105      53.329 -15.105  46.763  1.00  0.84           C  
ATOM   7670  CG  LEU B 105      54.176 -13.857  47.083  1.00  0.84           C  
ATOM   7671  CD1 LEU B 105      53.934 -12.763  46.031  1.00  0.84           C  
ATOM   7672  CD2 LEU B 105      53.863 -13.320  48.489  1.00  0.84           C  
ATOM   7673  N   GLU B 106      52.915 -18.535  46.721  1.00  0.83           N  
ATOM   7674  CA  GLU B 106      51.945 -19.520  46.258  1.00  0.83           C  
ATOM   7675  C   GLU B 106      51.039 -20.103  47.341  1.00  0.83           C  
ATOM   7676  O   GLU B 106      49.820 -20.046  47.228  1.00  0.83           O  
ATOM   7677  CB  GLU B 106      52.739 -20.621  45.521  1.00  0.83           C  
ATOM   7678  CG  GLU B 106      51.905 -21.711  44.806  1.00  0.83           C  
ATOM   7679  CD  GLU B 106      52.819 -22.664  44.036  1.00  0.83           C  
ATOM   7680  OE1 GLU B 106      53.773 -23.184  44.673  1.00  0.83           O  
ATOM   7681  OE2 GLU B 106      52.609 -22.841  42.808  1.00  0.83           O  
ATOM   7682  N   ASN B 107      51.599 -20.568  48.480  1.00  0.81           N  
ATOM   7683  CA  ASN B 107      50.812 -21.047  49.612  1.00  0.81           C  
ATOM   7684  C   ASN B 107      49.928 -19.968  50.240  1.00  0.81           C  
ATOM   7685  O   ASN B 107      48.768 -20.193  50.573  1.00  0.81           O  
ATOM   7686  CB  ASN B 107      51.737 -21.617  50.719  1.00  0.81           C  
ATOM   7687  CG  ASN B 107      52.561 -22.774  50.168  1.00  0.81           C  
ATOM   7688  OD1 ASN B 107      52.042 -23.766  49.668  1.00  0.81           O  
ATOM   7689  ND2 ASN B 107      53.906 -22.661  50.269  1.00  0.81           N  
ATOM   7690  N   ALA B 108      50.464 -18.741  50.415  1.00  0.84           N  
ATOM   7691  CA  ALA B 108      49.726 -17.633  50.980  1.00  0.84           C  
ATOM   7692  C   ALA B 108      48.596 -17.143  50.083  1.00  0.84           C  
ATOM   7693  O   ALA B 108      47.492 -16.859  50.542  1.00  0.84           O  
ATOM   7694  CB  ALA B 108      50.705 -16.493  51.315  1.00  0.84           C  
ATOM   7695  N   CYS B 109      48.846 -17.060  48.762  1.00  0.87           N  
ATOM   7696  CA  CYS B 109      47.842 -16.737  47.770  1.00  0.87           C  
ATOM   7697  C   CYS B 109      46.744 -17.772  47.660  1.00  0.87           C  
ATOM   7698  O   CYS B 109      45.577 -17.400  47.583  1.00  0.87           O  
ATOM   7699  CB  CYS B 109      48.477 -16.502  46.383  1.00  0.87           C  
ATOM   7700  SG  CYS B 109      49.387 -14.919  46.335  1.00  0.87           S  
ATOM   7701  N   ASP B 110      47.087 -19.078  47.688  1.00  0.85           N  
ATOM   7702  CA  ASP B 110      46.139 -20.173  47.634  1.00  0.85           C  
ATOM   7703  C   ASP B 110      45.159 -20.152  48.807  1.00  0.85           C  
ATOM   7704  O   ASP B 110      43.943 -20.206  48.645  1.00  0.85           O  
ATOM   7705  CB  ASP B 110      46.956 -21.490  47.603  1.00  0.85           C  
ATOM   7706  CG  ASP B 110      46.068 -22.693  47.350  1.00  0.85           C  
ATOM   7707  OD1 ASP B 110      45.269 -22.631  46.382  1.00  0.85           O  
ATOM   7708  OD2 ASP B 110      46.188 -23.672  48.126  1.00  0.85           O  
ATOM   7709  N   GLU B 111      45.677 -19.959  50.035  1.00  0.81           N  
ATOM   7710  CA  GLU B 111      44.862 -19.792  51.224  1.00  0.81           C  
ATOM   7711  C   GLU B 111      43.983 -18.544  51.164  1.00  0.81           C  
ATOM   7712  O   GLU B 111      42.795 -18.553  51.494  1.00  0.81           O  
ATOM   7713  CB  GLU B 111      45.802 -19.784  52.450  1.00  0.81           C  
ATOM   7714  CG  GLU B 111      45.122 -19.726  53.840  1.00  0.81           C  
ATOM   7715  CD  GLU B 111      44.128 -20.861  54.071  1.00  0.81           C  
ATOM   7716  OE1 GLU B 111      44.539 -22.043  54.007  1.00  0.81           O  
ATOM   7717  OE2 GLU B 111      42.945 -20.539  54.367  1.00  0.81           O  
ATOM   7718  N   ALA B 112      44.531 -17.416  50.665  1.00  0.87           N  
ATOM   7719  CA  ALA B 112      43.768 -16.200  50.478  1.00  0.87           C  
ATOM   7720  C   ALA B 112      42.606 -16.332  49.493  1.00  0.87           C  
ATOM   7721  O   ALA B 112      41.490 -15.899  49.783  1.00  0.87           O  
ATOM   7722  CB  ALA B 112      44.711 -15.051  50.064  1.00  0.87           C  
ATOM   7723  N   THR B 113      42.816 -16.972  48.325  1.00  0.86           N  
ATOM   7724  CA  THR B 113      41.755 -17.266  47.367  1.00  0.86           C  
ATOM   7725  C   THR B 113      40.757 -18.282  47.890  1.00  0.86           C  
ATOM   7726  O   THR B 113      39.546 -18.094  47.756  1.00  0.86           O  
ATOM   7727  CB  THR B 113      42.259 -17.720  46.004  1.00  0.86           C  
ATOM   7728  OG1 THR B 113      43.159 -18.802  46.133  1.00  0.86           O  
ATOM   7729  CG2 THR B 113      43.038 -16.574  45.347  1.00  0.86           C  
ATOM   7730  N   TYR B 114      41.223 -19.355  48.566  1.00  0.85           N  
ATOM   7731  CA  TYR B 114      40.390 -20.386  49.163  1.00  0.85           C  
ATOM   7732  C   TYR B 114      39.418 -19.823  50.199  1.00  0.85           C  
ATOM   7733  O   TYR B 114      38.241 -20.199  50.259  1.00  0.85           O  
ATOM   7734  CB  TYR B 114      41.283 -21.497  49.797  1.00  0.85           C  
ATOM   7735  CG  TYR B 114      40.454 -22.552  50.483  1.00  0.85           C  
ATOM   7736  CD1 TYR B 114      39.601 -23.368  49.728  1.00  0.85           C  
ATOM   7737  CD2 TYR B 114      40.394 -22.607  51.885  1.00  0.85           C  
ATOM   7738  CE1 TYR B 114      38.661 -24.190  50.363  1.00  0.85           C  
ATOM   7739  CE2 TYR B 114      39.456 -23.431  52.524  1.00  0.85           C  
ATOM   7740  CZ  TYR B 114      38.577 -24.204  51.760  1.00  0.85           C  
ATOM   7741  OH  TYR B 114      37.526 -24.900  52.386  1.00  0.85           O  
ATOM   7742  N   GLN B 115      39.879 -18.869  51.027  1.00  0.81           N  
ATOM   7743  CA  GLN B 115      39.047 -18.195  52.000  1.00  0.81           C  
ATOM   7744  C   GLN B 115      38.065 -17.211  51.381  1.00  0.81           C  
ATOM   7745  O   GLN B 115      37.113 -16.810  52.044  1.00  0.81           O  
ATOM   7746  CB  GLN B 115      39.908 -17.422  53.017  1.00  0.81           C  
ATOM   7747  CG  GLN B 115      40.608 -18.315  54.056  1.00  0.81           C  
ATOM   7748  CD  GLN B 115      41.448 -17.475  55.020  1.00  0.81           C  
ATOM   7749  OE1 GLN B 115      41.152 -16.307  55.304  1.00  0.81           O  
ATOM   7750  NE2 GLN B 115      42.521 -18.094  55.548  1.00  0.81           N  
ATOM   7751  N   LEU B 116      38.251 -16.812  50.106  1.00  0.84           N  
ATOM   7752  CA  LEU B 116      37.317 -15.966  49.380  1.00  0.84           C  
ATOM   7753  C   LEU B 116      36.418 -16.783  48.463  1.00  0.84           C  
ATOM   7754  O   LEU B 116      35.582 -16.234  47.755  1.00  0.84           O  
ATOM   7755  CB  LEU B 116      38.047 -14.918  48.503  1.00  0.84           C  
ATOM   7756  CG  LEU B 116      38.819 -13.839  49.286  1.00  0.84           C  
ATOM   7757  CD1 LEU B 116      39.637 -12.978  48.312  1.00  0.84           C  
ATOM   7758  CD2 LEU B 116      37.877 -12.942  50.105  1.00  0.84           C  
ATOM   7759  N   GLY B 117      36.532 -18.129  48.470  1.00  0.83           N  
ATOM   7760  CA  GLY B 117      35.659 -19.004  47.691  1.00  0.83           C  
ATOM   7761  C   GLY B 117      36.006 -19.057  46.237  1.00  0.83           C  
ATOM   7762  O   GLY B 117      35.139 -19.109  45.361  1.00  0.83           O  
ATOM   7763  N   LEU B 118      37.310 -19.007  45.950  1.00  0.84           N  
ATOM   7764  CA  LEU B 118      37.864 -19.022  44.622  1.00  0.84           C  
ATOM   7765  C   LEU B 118      38.936 -20.094  44.576  1.00  0.84           C  
ATOM   7766  O   LEU B 118      39.748 -20.198  45.489  1.00  0.84           O  
ATOM   7767  CB  LEU B 118      38.524 -17.655  44.322  1.00  0.84           C  
ATOM   7768  CG  LEU B 118      37.551 -16.462  44.338  1.00  0.84           C  
ATOM   7769  CD1 LEU B 118      38.331 -15.145  44.285  1.00  0.84           C  
ATOM   7770  CD2 LEU B 118      36.563 -16.543  43.169  1.00  0.84           C  
ATOM   7771  N   ASP B 119      38.985 -20.920  43.513  1.00  0.85           N  
ATOM   7772  CA  ASP B 119      40.082 -21.841  43.292  1.00  0.85           C  
ATOM   7773  C   ASP B 119      41.224 -21.110  42.598  1.00  0.85           C  
ATOM   7774  O   ASP B 119      41.024 -20.457  41.576  1.00  0.85           O  
ATOM   7775  CB  ASP B 119      39.584 -23.026  42.420  1.00  0.85           C  
ATOM   7776  CG  ASP B 119      40.724 -23.932  41.976  1.00  0.85           C  
ATOM   7777  OD1 ASP B 119      41.728 -24.034  42.723  1.00  0.85           O  
ATOM   7778  OD2 ASP B 119      40.652 -24.430  40.829  1.00  0.85           O  
ATOM   7779  N   MET B 120      42.465 -21.200  43.116  1.00  0.85           N  
ATOM   7780  CA  MET B 120      43.608 -20.618  42.453  1.00  0.85           C  
ATOM   7781  C   MET B 120      43.979 -21.309  41.146  1.00  0.85           C  
ATOM   7782  O   MET B 120      44.314 -20.638  40.180  1.00  0.85           O  
ATOM   7783  CB  MET B 120      44.823 -20.518  43.387  1.00  0.85           C  
ATOM   7784  CG  MET B 120      45.944 -19.628  42.823  1.00  0.85           C  
ATOM   7785  SD  MET B 120      47.120 -19.078  44.088  1.00  0.85           S  
ATOM   7786  CE  MET B 120      48.045 -20.639  44.119  1.00  0.85           C  
ATOM   7787  N   GLU B 121      43.870 -22.659  41.076  1.00  0.82           N  
ATOM   7788  CA  GLU B 121      44.205 -23.427  39.885  1.00  0.82           C  
ATOM   7789  C   GLU B 121      43.316 -23.036  38.702  1.00  0.82           C  
ATOM   7790  O   GLU B 121      43.789 -22.829  37.579  1.00  0.82           O  
ATOM   7791  CB  GLU B 121      44.094 -24.960  40.135  1.00  0.82           C  
ATOM   7792  CG  GLU B 121      45.200 -25.587  41.029  1.00  0.82           C  
ATOM   7793  CD  GLU B 121      45.237 -27.124  40.970  1.00  0.82           C  
ATOM   7794  OE1 GLU B 121      45.448 -27.702  39.858  1.00  0.82           O  
ATOM   7795  OE2 GLU B 121      45.092 -27.770  42.040  1.00  0.82           O  
ATOM   7796  N   GLU B 122      41.999 -22.841  38.940  1.00  0.83           N  
ATOM   7797  CA  GLU B 122      41.059 -22.301  37.970  1.00  0.83           C  
ATOM   7798  C   GLU B 122      41.442 -20.919  37.457  1.00  0.83           C  
ATOM   7799  O   GLU B 122      41.435 -20.661  36.253  1.00  0.83           O  
ATOM   7800  CB  GLU B 122      39.643 -22.213  38.600  1.00  0.83           C  
ATOM   7801  CG  GLU B 122      38.490 -21.824  37.634  1.00  0.83           C  
ATOM   7802  CD  GLU B 122      37.215 -21.418  38.381  1.00  0.83           C  
ATOM   7803  OE1 GLU B 122      36.687 -22.236  39.174  1.00  0.83           O  
ATOM   7804  OE2 GLU B 122      36.745 -20.268  38.163  1.00  0.83           O  
ATOM   7805  N   LEU B 123      41.850 -19.993  38.355  1.00  0.89           N  
ATOM   7806  CA  LEU B 123      42.286 -18.662  37.968  1.00  0.89           C  
ATOM   7807  C   LEU B 123      43.542 -18.664  37.103  1.00  0.89           C  
ATOM   7808  O   LEU B 123      43.633 -17.929  36.127  1.00  0.89           O  
ATOM   7809  CB  LEU B 123      42.519 -17.727  39.183  1.00  0.89           C  
ATOM   7810  CG  LEU B 123      41.296 -17.510  40.103  1.00  0.89           C  
ATOM   7811  CD1 LEU B 123      41.618 -16.499  41.217  1.00  0.89           C  
ATOM   7812  CD2 LEU B 123      40.025 -17.098  39.346  1.00  0.89           C  
ATOM   7813  N   GLU B 124      44.540 -19.512  37.418  1.00  0.89           N  
ATOM   7814  CA  GLU B 124      45.766 -19.649  36.648  1.00  0.89           C  
ATOM   7815  C   GLU B 124      45.552 -20.121  35.218  1.00  0.89           C  
ATOM   7816  O   GLU B 124      46.226 -19.673  34.291  1.00  0.89           O  
ATOM   7817  CB  GLU B 124      46.764 -20.576  37.370  1.00  0.89           C  
ATOM   7818  CG  GLU B 124      47.243 -19.985  38.716  1.00  0.89           C  
ATOM   7819  CD  GLU B 124      48.153 -20.936  39.482  1.00  0.89           C  
ATOM   7820  OE1 GLU B 124      47.868 -22.156  39.502  1.00  0.89           O  
ATOM   7821  OE2 GLU B 124      49.143 -20.421  40.059  1.00  0.89           O  
ATOM   7822  N   GLU B 125      44.569 -21.013  34.975  1.00  0.86           N  
ATOM   7823  CA  GLU B 125      44.258 -21.461  33.629  1.00  0.86           C  
ATOM   7824  C   GLU B 125      43.649 -20.411  32.721  1.00  0.86           C  
ATOM   7825  O   GLU B 125      43.734 -20.522  31.499  1.00  0.86           O  
ATOM   7826  CB  GLU B 125      43.357 -22.711  33.631  1.00  0.86           C  
ATOM   7827  CG  GLU B 125      44.117 -24.007  33.997  1.00  0.86           C  
ATOM   7828  CD  GLU B 125      45.299 -24.288  33.107  1.00  0.86           C  
ATOM   7829  OE1 GLU B 125      45.204 -24.253  31.855  1.00  0.86           O  
ATOM   7830  OE2 GLU B 125      46.406 -24.563  33.637  1.00  0.86           O  
ATOM   7831  N   ILE B 126      43.082 -19.332  33.290  1.00  0.89           N  
ATOM   7832  CA  ILE B 126      42.620 -18.173  32.544  1.00  0.89           C  
ATOM   7833  C   ILE B 126      43.748 -17.470  31.786  1.00  0.89           C  
ATOM   7834  O   ILE B 126      43.534 -16.940  30.694  1.00  0.89           O  
ATOM   7835  CB  ILE B 126      41.922 -17.177  33.469  1.00  0.89           C  
ATOM   7836  CG1 ILE B 126      40.685 -17.784  34.185  1.00  0.89           C  
ATOM   7837  CG2 ILE B 126      41.538 -15.873  32.738  1.00  0.89           C  
ATOM   7838  CD1 ILE B 126      39.547 -18.243  33.261  1.00  0.89           C  
ATOM   7839  N   GLU B 127      44.973 -17.416  32.356  1.00  0.90           N  
ATOM   7840  CA  GLU B 127      46.097 -16.718  31.753  1.00  0.90           C  
ATOM   7841  C   GLU B 127      46.561 -17.268  30.397  1.00  0.90           C  
ATOM   7842  O   GLU B 127      46.838 -18.455  30.227  1.00  0.90           O  
ATOM   7843  CB  GLU B 127      47.282 -16.646  32.743  1.00  0.90           C  
ATOM   7844  CG  GLU B 127      48.465 -15.765  32.269  1.00  0.90           C  
ATOM   7845  CD  GLU B 127      49.544 -15.593  33.329  1.00  0.90           C  
ATOM   7846  OE1 GLU B 127      49.745 -16.491  34.181  1.00  0.90           O  
ATOM   7847  OE2 GLU B 127      50.273 -14.568  33.260  1.00  0.90           O  
ATOM   7848  N   GLU B 128      46.663 -16.384  29.382  1.00  0.89           N  
ATOM   7849  CA  GLU B 128      47.152 -16.722  28.057  1.00  0.89           C  
ATOM   7850  C   GLU B 128      48.676 -16.718  28.002  1.00  0.89           C  
ATOM   7851  O   GLU B 128      49.349 -15.999  28.729  1.00  0.89           O  
ATOM   7852  CB  GLU B 128      46.544 -15.772  26.984  1.00  0.89           C  
ATOM   7853  CG  GLU B 128      45.036 -16.080  26.755  1.00  0.89           C  
ATOM   7854  CD  GLU B 128      44.277 -15.174  25.778  1.00  0.89           C  
ATOM   7855  OE1 GLU B 128      44.657 -15.112  24.585  1.00  0.89           O  
ATOM   7856  OE2 GLU B 128      43.242 -14.591  26.219  1.00  0.89           O  
ATOM   7857  N   ASP B 129      49.275 -17.571  27.141  1.00  0.93           N  
ATOM   7858  CA  ASP B 129      50.704 -17.575  26.899  1.00  0.93           C  
ATOM   7859  C   ASP B 129      51.212 -16.281  26.292  1.00  0.93           C  
ATOM   7860  O   ASP B 129      50.746 -15.833  25.271  1.00  0.93           O  
ATOM   7861  CB  ASP B 129      51.108 -18.663  25.869  1.00  0.93           C  
ATOM   7862  CG  ASP B 129      50.902 -20.032  26.437  1.00  0.93           C  
ATOM   7863  OD1 ASP B 129      49.720 -20.391  26.662  1.00  0.93           O  
ATOM   7864  OD2 ASP B 129      51.893 -20.788  26.629  1.00  0.93           O  
ATOM   7865  N   ALA B 130      52.285 -15.690  26.876  1.00  0.96           N  
ATOM   7866  CA  ALA B 130      53.022 -14.670  26.162  1.00  0.96           C  
ATOM   7867  C   ALA B 130      53.866 -15.330  25.067  1.00  0.96           C  
ATOM   7868  O   ALA B 130      55.042 -15.629  25.240  1.00  0.96           O  
ATOM   7869  CB  ALA B 130      53.870 -13.831  27.143  1.00  0.96           C  
ATOM   7870  N   GLY B 131      53.221 -15.630  23.910  1.00  0.87           N  
ATOM   7871  CA  GLY B 131      53.757 -16.456  22.834  1.00  0.87           C  
ATOM   7872  C   GLY B 131      54.590 -15.732  21.822  1.00  0.87           C  
ATOM   7873  O   GLY B 131      54.471 -15.946  20.622  1.00  0.87           O  
ATOM   7874  N   LEU B 132      55.509 -14.866  22.275  1.00  0.93           N  
ATOM   7875  CA  LEU B 132      56.325 -14.047  21.401  1.00  0.93           C  
ATOM   7876  C   LEU B 132      57.567 -14.791  20.937  1.00  0.93           C  
ATOM   7877  O   LEU B 132      58.671 -14.256  20.942  1.00  0.93           O  
ATOM   7878  CB  LEU B 132      56.729 -12.728  22.103  1.00  0.93           C  
ATOM   7879  CG  LEU B 132      55.560 -11.968  22.762  1.00  0.93           C  
ATOM   7880  CD1 LEU B 132      56.042 -10.596  23.249  1.00  0.93           C  
ATOM   7881  CD2 LEU B 132      54.350 -11.785  21.834  1.00  0.93           C  
ATOM   7882  N   GLY B 133      57.412 -16.067  20.530  1.00  0.95           N  
ATOM   7883  CA  GLY B 133      58.520 -16.881  20.068  1.00  0.95           C  
ATOM   7884  C   GLY B 133      58.069 -18.063  19.258  1.00  0.95           C  
ATOM   7885  O   GLY B 133      56.989 -18.602  19.440  1.00  0.95           O  
ATOM   7886  N   ASN B 134      58.928 -18.489  18.314  1.00  0.87           N  
ATOM   7887  CA  ASN B 134      58.676 -19.593  17.419  1.00  0.87           C  
ATOM   7888  C   ASN B 134      58.877 -20.945  18.063  1.00  0.87           C  
ATOM   7889  O   ASN B 134      58.094 -21.872  17.837  1.00  0.87           O  
ATOM   7890  CB  ASN B 134      59.603 -19.486  16.184  1.00  0.87           C  
ATOM   7891  CG  ASN B 134      58.922 -18.595  15.161  1.00  0.87           C  
ATOM   7892  OD1 ASN B 134      57.951 -19.030  14.536  1.00  0.87           O  
ATOM   7893  ND2 ASN B 134      59.410 -17.358  14.990  1.00  0.87           N  
ATOM   7894  N   GLY B 135      59.947 -21.095  18.859  1.00  0.94           N  
ATOM   7895  CA  GLY B 135      60.308 -22.400  19.374  1.00  0.94           C  
ATOM   7896  C   GLY B 135      61.457 -22.359  20.337  1.00  0.94           C  
ATOM   7897  O   GLY B 135      61.453 -21.638  21.333  1.00  0.94           O  
ATOM   7898  N   GLY B 136      62.484 -23.194  20.074  1.00  0.94           N  
ATOM   7899  CA  GLY B 136      63.675 -23.351  20.911  1.00  0.94           C  
ATOM   7900  C   GLY B 136      64.398 -22.081  21.262  1.00  0.94           C  
ATOM   7901  O   GLY B 136      64.676 -21.829  22.430  1.00  0.94           O  
ATOM   7902  N   LEU B 137      64.693 -21.251  20.245  1.00  0.93           N  
ATOM   7903  CA  LEU B 137      65.426 -20.004  20.342  1.00  0.93           C  
ATOM   7904  C   LEU B 137      64.751 -18.992  21.257  1.00  0.93           C  
ATOM   7905  O   LEU B 137      65.369 -18.423  22.157  1.00  0.93           O  
ATOM   7906  CB  LEU B 137      65.554 -19.477  18.888  1.00  0.93           C  
ATOM   7907  CG  LEU B 137      66.239 -18.115  18.654  1.00  0.93           C  
ATOM   7908  CD1 LEU B 137      66.839 -18.095  17.241  1.00  0.93           C  
ATOM   7909  CD2 LEU B 137      65.257 -16.936  18.774  1.00  0.93           C  
ATOM   7910  N   GLY B 138      63.425 -18.785  21.096  1.00  0.96           N  
ATOM   7911  CA  GLY B 138      62.672 -17.887  21.960  1.00  0.96           C  
ATOM   7912  C   GLY B 138      62.447 -18.405  23.348  1.00  0.96           C  
ATOM   7913  O   GLY B 138      62.375 -17.643  24.311  1.00  0.96           O  
ATOM   7914  N   ARG B 139      62.302 -19.733  23.510  1.00  0.91           N  
ATOM   7915  CA  ARG B 139      62.147 -20.328  24.820  1.00  0.91           C  
ATOM   7916  C   ARG B 139      63.431 -20.338  25.614  1.00  0.91           C  
ATOM   7917  O   ARG B 139      63.419 -20.199  26.837  1.00  0.91           O  
ATOM   7918  CB  ARG B 139      61.530 -21.744  24.731  1.00  0.91           C  
ATOM   7919  CG  ARG B 139      61.192 -22.374  26.100  1.00  0.91           C  
ATOM   7920  CD  ARG B 139      60.222 -21.517  26.932  1.00  0.91           C  
ATOM   7921  NE  ARG B 139      60.886 -21.168  28.218  1.00  0.91           N  
ATOM   7922  CZ  ARG B 139      60.299 -20.451  29.195  1.00  0.91           C  
ATOM   7923  NH1 ARG B 139      59.095 -19.955  29.026  1.00  0.91           N  
ATOM   7924  NH2 ARG B 139      60.987 -20.212  30.310  1.00  0.91           N  
ATOM   7925  N   LEU B 140      64.579 -20.462  24.927  1.00  0.96           N  
ATOM   7926  CA  LEU B 140      65.889 -20.339  25.524  1.00  0.96           C  
ATOM   7927  C   LEU B 140      66.095 -18.976  26.154  1.00  0.96           C  
ATOM   7928  O   LEU B 140      66.504 -18.871  27.308  1.00  0.96           O  
ATOM   7929  CB  LEU B 140      66.974 -20.585  24.454  1.00  0.96           C  
ATOM   7930  CG  LEU B 140      68.402 -20.701  25.006  1.00  0.96           C  
ATOM   7931  CD1 LEU B 140      68.552 -21.984  25.837  1.00  0.96           C  
ATOM   7932  CD2 LEU B 140      69.414 -20.675  23.850  1.00  0.96           C  
ATOM   7933  N   ALA B 141      65.696 -17.903  25.441  1.00  0.99           N  
ATOM   7934  CA  ALA B 141      65.744 -16.547  25.934  1.00  0.99           C  
ATOM   7935  C   ALA B 141      64.916 -16.351  27.199  1.00  0.99           C  
ATOM   7936  O   ALA B 141      65.368 -15.771  28.182  1.00  0.99           O  
ATOM   7937  CB  ALA B 141      65.251 -15.617  24.809  1.00  0.99           C  
ATOM   7938  N   ALA B 142      63.696 -16.915  27.231  1.00  0.99           N  
ATOM   7939  CA  ALA B 142      62.853 -16.949  28.402  1.00  0.99           C  
ATOM   7940  C   ALA B 142      63.408 -17.748  29.581  1.00  0.99           C  
ATOM   7941  O   ALA B 142      63.267 -17.350  30.736  1.00  0.99           O  
ATOM   7942  CB  ALA B 142      61.481 -17.493  27.984  1.00  0.99           C  
ATOM   7943  N   CYS B 143      64.052 -18.914  29.349  1.00  0.98           N  
ATOM   7944  CA  CYS B 143      64.760 -19.633  30.401  1.00  0.98           C  
ATOM   7945  C   CYS B 143      65.924 -18.829  30.956  1.00  0.98           C  
ATOM   7946  O   CYS B 143      66.121 -18.724  32.151  1.00  0.98           O  
ATOM   7947  CB  CYS B 143      65.267 -21.015  29.921  1.00  0.98           C  
ATOM   7948  SG  CYS B 143      63.888 -22.165  29.576  1.00  0.98           S  
ATOM   7949  N   PHE B 144      66.683 -18.186  30.043  1.00  0.98           N  
ATOM   7950  CA  PHE B 144      67.828 -17.367  30.364  1.00  0.98           C  
ATOM   7951  C   PHE B 144      67.480 -16.177  31.243  1.00  0.98           C  
ATOM   7952  O   PHE B 144      68.213 -15.875  32.173  1.00  0.98           O  
ATOM   7953  CB  PHE B 144      68.560 -16.904  29.069  1.00  0.98           C  
ATOM   7954  CG  PHE B 144      69.446 -17.951  28.414  1.00  0.98           C  
ATOM   7955  CD1 PHE B 144      69.507 -19.306  28.797  1.00  0.98           C  
ATOM   7956  CD2 PHE B 144      70.293 -17.523  27.378  1.00  0.98           C  
ATOM   7957  CE1 PHE B 144      70.393 -20.192  28.169  1.00  0.98           C  
ATOM   7958  CE2 PHE B 144      71.180 -18.403  26.745  1.00  0.98           C  
ATOM   7959  CZ  PHE B 144      71.230 -19.742  27.143  1.00  0.98           C  
ATOM   7960  N   LEU B 145      66.337 -15.489  31.016  1.00  0.98           N  
ATOM   7961  CA  LEU B 145      65.923 -14.392  31.880  1.00  0.98           C  
ATOM   7962  C   LEU B 145      65.678 -14.820  33.336  1.00  0.98           C  
ATOM   7963  O   LEU B 145      66.142 -14.152  34.262  1.00  0.98           O  
ATOM   7964  CB  LEU B 145      64.671 -13.629  31.355  1.00  0.98           C  
ATOM   7965  CG  LEU B 145      64.727 -13.011  29.939  1.00  0.98           C  
ATOM   7966  CD1 LEU B 145      63.506 -12.102  29.725  1.00  0.98           C  
ATOM   7967  CD2 LEU B 145      66.007 -12.207  29.672  1.00  0.98           C  
ATOM   7968  N   ASP B 146      65.000 -15.973  33.563  1.00  0.98           N  
ATOM   7969  CA  ASP B 146      64.769 -16.585  34.870  1.00  0.98           C  
ATOM   7970  C   ASP B 146      66.090 -16.923  35.569  1.00  0.98           C  
ATOM   7971  O   ASP B 146      66.336 -16.554  36.719  1.00  0.98           O  
ATOM   7972  CB  ASP B 146      63.887 -17.855  34.605  1.00  0.98           C  
ATOM   7973  CG  ASP B 146      63.560 -18.767  35.781  1.00  0.98           C  
ATOM   7974  OD1 ASP B 146      64.514 -19.310  36.398  1.00  0.98           O  
ATOM   7975  OD2 ASP B 146      62.362 -19.087  36.000  1.00  0.98           O  
ATOM   7976  N   SER B 147      67.012 -17.582  34.843  1.00  0.99           N  
ATOM   7977  CA  SER B 147      68.344 -17.916  35.335  1.00  0.99           C  
ATOM   7978  C   SER B 147      69.226 -16.734  35.652  1.00  0.99           C  
ATOM   7979  O   SER B 147      69.894 -16.714  36.681  1.00  0.99           O  
ATOM   7980  CB  SER B 147      69.136 -18.774  34.353  1.00  0.99           C  
ATOM   7981  OG  SER B 147      68.586 -20.095  34.354  1.00  0.99           O  
ATOM   7982  N   MET B 148      69.273 -15.695  34.794  1.00  0.97           N  
ATOM   7983  CA  MET B 148      70.064 -14.505  35.055  1.00  0.97           C  
ATOM   7984  C   MET B 148      69.598 -13.744  36.285  1.00  0.97           C  
ATOM   7985  O   MET B 148      70.418 -13.313  37.093  1.00  0.97           O  
ATOM   7986  CB  MET B 148      70.128 -13.559  33.830  1.00  0.97           C  
ATOM   7987  CG  MET B 148      70.904 -14.143  32.630  1.00  0.97           C  
ATOM   7988  SD  MET B 148      71.161 -13.014  31.226  1.00  0.97           S  
ATOM   7989  CE  MET B 148      69.431 -12.853  30.706  1.00  0.97           C  
ATOM   7990  N   ALA B 149      68.271 -13.615  36.486  1.00  0.99           N  
ATOM   7991  CA  ALA B 149      67.711 -13.055  37.696  1.00  0.99           C  
ATOM   7992  C   ALA B 149      67.978 -13.899  38.941  1.00  0.99           C  
ATOM   7993  O   ALA B 149      68.337 -13.383  39.995  1.00  0.99           O  
ATOM   7994  CB  ALA B 149      66.208 -12.806  37.475  1.00  0.99           C  
ATOM   7995  N   THR B 150      67.856 -15.240  38.836  1.00  0.96           N  
ATOM   7996  CA  THR B 150      68.189 -16.214  39.879  1.00  0.96           C  
ATOM   7997  C   THR B 150      69.647 -16.177  40.289  1.00  0.96           C  
ATOM   7998  O   THR B 150      70.000 -16.376  41.453  1.00  0.96           O  
ATOM   7999  CB  THR B 150      67.821 -17.631  39.449  1.00  0.96           C  
ATOM   8000  OG1 THR B 150      66.412 -17.803  39.490  1.00  0.96           O  
ATOM   8001  CG2 THR B 150      68.398 -18.714  40.367  1.00  0.96           C  
ATOM   8002  N   LEU B 151      70.547 -15.917  39.334  1.00  0.95           N  
ATOM   8003  CA  LEU B 151      71.961 -15.790  39.594  1.00  0.95           C  
ATOM   8004  C   LEU B 151      72.379 -14.350  39.822  1.00  0.95           C  
ATOM   8005  O   LEU B 151      73.567 -14.030  39.768  1.00  0.95           O  
ATOM   8006  CB  LEU B 151      72.787 -16.393  38.438  1.00  0.95           C  
ATOM   8007  CG  LEU B 151      72.589 -17.909  38.238  1.00  0.95           C  
ATOM   8008  CD1 LEU B 151      73.561 -18.420  37.169  1.00  0.95           C  
ATOM   8009  CD2 LEU B 151      72.780 -18.715  39.534  1.00  0.95           C  
ATOM   8010  N   GLY B 152      71.425 -13.439  40.110  1.00  0.96           N  
ATOM   8011  CA  GLY B 152      71.730 -12.105  40.612  1.00  0.96           C  
ATOM   8012  C   GLY B 152      72.446 -11.192  39.661  1.00  0.96           C  
ATOM   8013  O   GLY B 152      73.097 -10.235  40.072  1.00  0.96           O  
ATOM   8014  N   LEU B 153      72.351 -11.464  38.351  1.00  0.95           N  
ATOM   8015  CA  LEU B 153      73.004 -10.664  37.347  1.00  0.95           C  
ATOM   8016  C   LEU B 153      72.181  -9.422  37.044  1.00  0.95           C  
ATOM   8017  O   LEU B 153      70.950  -9.428  37.069  1.00  0.95           O  
ATOM   8018  CB  LEU B 153      73.230 -11.468  36.041  1.00  0.95           C  
ATOM   8019  CG  LEU B 153      74.038 -12.779  36.192  1.00  0.95           C  
ATOM   8020  CD1 LEU B 153      74.260 -13.416  34.812  1.00  0.95           C  
ATOM   8021  CD2 LEU B 153      75.395 -12.569  36.881  1.00  0.95           C  
ATOM   8022  N   ALA B 154      72.851  -8.297  36.713  1.00  0.97           N  
ATOM   8023  CA  ALA B 154      72.194  -7.093  36.255  1.00  0.97           C  
ATOM   8024  C   ALA B 154      71.817  -7.220  34.791  1.00  0.97           C  
ATOM   8025  O   ALA B 154      72.329  -6.533  33.909  1.00  0.97           O  
ATOM   8026  CB  ALA B 154      73.078  -5.858  36.504  1.00  0.97           C  
ATOM   8027  N   ALA B 155      70.908  -8.166  34.515  1.00  0.98           N  
ATOM   8028  CA  ALA B 155      70.550  -8.550  33.186  1.00  0.98           C  
ATOM   8029  C   ALA B 155      69.233  -7.964  32.725  1.00  0.98           C  
ATOM   8030  O   ALA B 155      68.353  -7.575  33.494  1.00  0.98           O  
ATOM   8031  CB  ALA B 155      70.506 -10.077  33.084  1.00  0.98           C  
ATOM   8032  N   TYR B 156      69.101  -7.883  31.396  1.00  0.96           N  
ATOM   8033  CA  TYR B 156      67.977  -7.284  30.733  1.00  0.96           C  
ATOM   8034  C   TYR B 156      67.688  -8.084  29.474  1.00  0.96           C  
ATOM   8035  O   TYR B 156      68.599  -8.497  28.758  1.00  0.96           O  
ATOM   8036  CB  TYR B 156      68.298  -5.840  30.252  1.00  0.96           C  
ATOM   8037  CG  TYR B 156      68.588  -4.832  31.345  1.00  0.96           C  
ATOM   8038  CD1 TYR B 156      69.834  -4.797  31.997  1.00  0.96           C  
ATOM   8039  CD2 TYR B 156      67.643  -3.842  31.669  1.00  0.96           C  
ATOM   8040  CE1 TYR B 156      70.094  -3.858  33.009  1.00  0.96           C  
ATOM   8041  CE2 TYR B 156      67.898  -2.907  32.684  1.00  0.96           C  
ATOM   8042  CZ  TYR B 156      69.113  -2.923  33.373  1.00  0.96           C  
ATOM   8043  OH  TYR B 156      69.306  -2.012  34.447  1.00  0.96           O  
ATOM   8044  N   GLY B 157      66.398  -8.302  29.148  1.00  0.99           N  
ATOM   8045  CA  GLY B 157      66.016  -8.860  27.852  1.00  0.99           C  
ATOM   8046  C   GLY B 157      65.428  -7.786  26.996  1.00  0.99           C  
ATOM   8047  O   GLY B 157      64.527  -7.084  27.435  1.00  0.99           O  
ATOM   8048  N   TYR B 158      65.910  -7.626  25.754  1.00  0.97           N  
ATOM   8049  CA  TYR B 158      65.423  -6.600  24.852  1.00  0.97           C  
ATOM   8050  C   TYR B 158      64.931  -7.215  23.554  1.00  0.97           C  
ATOM   8051  O   TYR B 158      65.649  -7.947  22.871  1.00  0.97           O  
ATOM   8052  CB  TYR B 158      66.512  -5.553  24.517  1.00  0.97           C  
ATOM   8053  CG  TYR B 158      66.604  -4.456  25.542  1.00  0.97           C  
ATOM   8054  CD1 TYR B 158      67.218  -4.659  26.784  1.00  0.97           C  
ATOM   8055  CD2 TYR B 158      66.139  -3.170  25.231  1.00  0.97           C  
ATOM   8056  CE1 TYR B 158      67.376  -3.591  27.677  1.00  0.97           C  
ATOM   8057  CE2 TYR B 158      66.339  -2.092  26.102  1.00  0.97           C  
ATOM   8058  CZ  TYR B 158      66.942  -2.318  27.341  1.00  0.97           C  
ATOM   8059  OH  TYR B 158      67.122  -1.292  28.278  1.00  0.97           O  
ATOM   8060  N   GLY B 159      63.661  -6.928  23.198  1.00  0.99           N  
ATOM   8061  CA  GLY B 159      63.010  -7.506  22.033  1.00  0.99           C  
ATOM   8062  C   GLY B 159      61.887  -6.650  21.515  1.00  0.99           C  
ATOM   8063  O   GLY B 159      61.780  -5.461  21.805  1.00  0.99           O  
ATOM   8064  N   ILE B 160      60.982  -7.257  20.730  1.00  0.97           N  
ATOM   8065  CA  ILE B 160      59.835  -6.573  20.156  1.00  0.97           C  
ATOM   8066  C   ILE B 160      58.580  -7.036  20.853  1.00  0.97           C  
ATOM   8067  O   ILE B 160      58.349  -8.221  21.078  1.00  0.97           O  
ATOM   8068  CB  ILE B 160      59.678  -6.809  18.656  1.00  0.97           C  
ATOM   8069  CG1 ILE B 160      60.911  -6.248  17.927  1.00  0.97           C  
ATOM   8070  CG2 ILE B 160      58.388  -6.143  18.113  1.00  0.97           C  
ATOM   8071  CD1 ILE B 160      60.867  -6.469  16.420  1.00  0.97           C  
ATOM   8072  N   ARG B 161      57.709  -6.074  21.211  1.00  0.91           N  
ATOM   8073  CA  ARG B 161      56.398  -6.370  21.730  1.00  0.91           C  
ATOM   8074  C   ARG B 161      55.454  -6.576  20.575  1.00  0.91           C  
ATOM   8075  O   ARG B 161      54.763  -5.660  20.138  1.00  0.91           O  
ATOM   8076  CB  ARG B 161      55.868  -5.216  22.605  1.00  0.91           C  
ATOM   8077  CG  ARG B 161      54.488  -5.503  23.230  1.00  0.91           C  
ATOM   8078  CD  ARG B 161      54.067  -4.373  24.163  1.00  0.91           C  
ATOM   8079  NE  ARG B 161      52.696  -4.622  24.686  1.00  0.91           N  
ATOM   8080  CZ  ARG B 161      51.579  -4.171  24.101  1.00  0.91           C  
ATOM   8081  NH1 ARG B 161      51.555  -3.840  22.812  1.00  0.91           N  
ATOM   8082  NH2 ARG B 161      50.472  -4.068  24.827  1.00  0.91           N  
ATOM   8083  N   TYR B 162      55.427  -7.808  20.031  1.00  0.92           N  
ATOM   8084  CA  TYR B 162      54.502  -8.141  18.975  1.00  0.92           C  
ATOM   8085  C   TYR B 162      53.078  -8.073  19.480  1.00  0.92           C  
ATOM   8086  O   TYR B 162      52.754  -8.594  20.543  1.00  0.92           O  
ATOM   8087  CB  TYR B 162      54.734  -9.534  18.341  1.00  0.92           C  
ATOM   8088  CG  TYR B 162      56.153  -9.723  17.893  1.00  0.92           C  
ATOM   8089  CD1 TYR B 162      56.635  -9.102  16.728  1.00  0.92           C  
ATOM   8090  CD2 TYR B 162      57.011 -10.566  18.617  1.00  0.92           C  
ATOM   8091  CE1 TYR B 162      57.945  -9.338  16.287  1.00  0.92           C  
ATOM   8092  CE2 TYR B 162      58.322 -10.794  18.181  1.00  0.92           C  
ATOM   8093  CZ  TYR B 162      58.781 -10.191  17.006  1.00  0.92           C  
ATOM   8094  OH  TYR B 162      60.072 -10.473  16.521  1.00  0.92           O  
ATOM   8095  N   GLU B 163      52.187  -7.410  18.731  1.00  0.87           N  
ATOM   8096  CA  GLU B 163      50.775  -7.376  19.037  1.00  0.87           C  
ATOM   8097  C   GLU B 163      50.145  -8.747  18.861  1.00  0.87           C  
ATOM   8098  O   GLU B 163      49.313  -9.183  19.647  1.00  0.87           O  
ATOM   8099  CB  GLU B 163      50.104  -6.283  18.184  1.00  0.87           C  
ATOM   8100  CG  GLU B 163      48.625  -6.009  18.536  1.00  0.87           C  
ATOM   8101  CD  GLU B 163      48.109  -4.705  17.938  1.00  0.87           C  
ATOM   8102  OE1 GLU B 163      46.879  -4.480  17.991  1.00  0.87           O  
ATOM   8103  OE2 GLU B 163      48.926  -3.908  17.396  1.00  0.87           O  
ATOM   8104  N   PHE B 164      50.621  -9.477  17.836  1.00  0.89           N  
ATOM   8105  CA  PHE B 164      50.256 -10.846  17.565  1.00  0.89           C  
ATOM   8106  C   PHE B 164      51.491 -11.735  17.619  1.00  0.89           C  
ATOM   8107  O   PHE B 164      52.469 -11.522  16.896  1.00  0.89           O  
ATOM   8108  CB  PHE B 164      49.583 -10.971  16.173  1.00  0.89           C  
ATOM   8109  CG  PHE B 164      48.383 -10.063  16.117  1.00  0.89           C  
ATOM   8110  CD1 PHE B 164      47.175 -10.449  16.709  1.00  0.89           C  
ATOM   8111  CD2 PHE B 164      48.475  -8.773  15.567  1.00  0.89           C  
ATOM   8112  CE1 PHE B 164      46.105  -9.552  16.812  1.00  0.89           C  
ATOM   8113  CE2 PHE B 164      47.396  -7.888  15.620  1.00  0.89           C  
ATOM   8114  CZ  PHE B 164      46.221  -8.266  16.274  1.00  0.89           C  
ATOM   8115  N   GLY B 165      51.492 -12.756  18.503  1.00  0.93           N  
ATOM   8116  CA  GLY B 165      52.617 -13.668  18.676  1.00  0.93           C  
ATOM   8117  C   GLY B 165      52.671 -14.759  17.637  1.00  0.93           C  
ATOM   8118  O   GLY B 165      52.302 -14.584  16.477  1.00  0.93           O  
ATOM   8119  N   ILE B 166      53.163 -15.955  18.014  1.00  0.87           N  
ATOM   8120  CA  ILE B 166      53.006 -17.131  17.168  1.00  0.87           C  
ATOM   8121  C   ILE B 166      51.538 -17.504  17.035  1.00  0.87           C  
ATOM   8122  O   ILE B 166      50.811 -17.561  18.020  1.00  0.87           O  
ATOM   8123  CB  ILE B 166      53.826 -18.337  17.642  1.00  0.87           C  
ATOM   8124  CG1 ILE B 166      53.824 -19.507  16.628  1.00  0.87           C  
ATOM   8125  CG2 ILE B 166      53.332 -18.832  19.021  1.00  0.87           C  
ATOM   8126  CD1 ILE B 166      54.525 -19.179  15.306  1.00  0.87           C  
ATOM   8127  N   PHE B 167      51.037 -17.785  15.814  1.00  0.89           N  
ATOM   8128  CA  PHE B 167      49.627 -18.054  15.594  1.00  0.89           C  
ATOM   8129  C   PHE B 167      49.050 -19.176  16.458  1.00  0.89           C  
ATOM   8130  O   PHE B 167      49.703 -20.174  16.756  1.00  0.89           O  
ATOM   8131  CB  PHE B 167      49.332 -18.307  14.086  1.00  0.89           C  
ATOM   8132  CG  PHE B 167      49.995 -19.568  13.586  1.00  0.89           C  
ATOM   8133  CD1 PHE B 167      49.359 -20.814  13.738  1.00  0.89           C  
ATOM   8134  CD2 PHE B 167      51.268 -19.525  12.998  1.00  0.89           C  
ATOM   8135  CE1 PHE B 167      49.996 -21.995  13.348  1.00  0.89           C  
ATOM   8136  CE2 PHE B 167      51.908 -20.706  12.604  1.00  0.89           C  
ATOM   8137  CZ  PHE B 167      51.277 -21.939  12.795  1.00  0.89           C  
ATOM   8138  N   ASN B 168      47.780 -19.046  16.879  1.00  0.88           N  
ATOM   8139  CA  ASN B 168      47.061 -20.128  17.504  1.00  0.88           C  
ATOM   8140  C   ASN B 168      46.669 -21.107  16.419  1.00  0.88           C  
ATOM   8141  O   ASN B 168      45.956 -20.789  15.479  1.00  0.88           O  
ATOM   8142  CB  ASN B 168      45.822 -19.638  18.292  1.00  0.88           C  
ATOM   8143  CG  ASN B 168      46.318 -19.149  19.652  1.00  0.88           C  
ATOM   8144  OD1 ASN B 168      46.837 -19.957  20.417  1.00  0.88           O  
ATOM   8145  ND2 ASN B 168      46.156 -17.839  19.942  1.00  0.88           N  
ATOM   8146  N   GLN B 169      47.188 -22.336  16.505  1.00  0.88           N  
ATOM   8147  CA  GLN B 169      46.915 -23.362  15.530  1.00  0.88           C  
ATOM   8148  C   GLN B 169      45.585 -24.002  15.821  1.00  0.88           C  
ATOM   8149  O   GLN B 169      45.314 -24.390  16.949  1.00  0.88           O  
ATOM   8150  CB  GLN B 169      48.026 -24.427  15.583  1.00  0.88           C  
ATOM   8151  CG  GLN B 169      47.846 -25.651  14.658  1.00  0.88           C  
ATOM   8152  CD  GLN B 169      48.918 -26.686  14.993  1.00  0.88           C  
ATOM   8153  OE1 GLN B 169      48.979 -27.185  16.113  1.00  0.88           O  
ATOM   8154  NE2 GLN B 169      49.811 -26.988  14.025  1.00  0.88           N  
ATOM   8155  N   LYS B 170      44.736 -24.109  14.796  1.00  0.85           N  
ATOM   8156  CA  LYS B 170      43.500 -24.840  14.850  1.00  0.85           C  
ATOM   8157  C   LYS B 170      43.649 -25.982  13.882  1.00  0.85           C  
ATOM   8158  O   LYS B 170      44.398 -25.896  12.907  1.00  0.85           O  
ATOM   8159  CB  LYS B 170      42.302 -23.969  14.401  1.00  0.85           C  
ATOM   8160  CG  LYS B 170      42.008 -22.783  15.329  1.00  0.85           C  
ATOM   8161  CD  LYS B 170      41.600 -23.224  16.747  1.00  0.85           C  
ATOM   8162  CE  LYS B 170      40.866 -22.157  17.561  1.00  0.85           C  
ATOM   8163  NZ  LYS B 170      41.692 -20.962  17.630  1.00  0.85           N  
ATOM   8164  N   ILE B 171      42.948 -27.095  14.130  1.00  0.89           N  
ATOM   8165  CA  ILE B 171      42.949 -28.211  13.209  1.00  0.89           C  
ATOM   8166  C   ILE B 171      41.550 -28.403  12.653  1.00  0.89           C  
ATOM   8167  O   ILE B 171      40.573 -28.615  13.368  1.00  0.89           O  
ATOM   8168  CB  ILE B 171      43.471 -29.489  13.862  1.00  0.89           C  
ATOM   8169  CG1 ILE B 171      44.962 -29.363  14.276  1.00  0.89           C  
ATOM   8170  CG2 ILE B 171      43.278 -30.703  12.928  1.00  0.89           C  
ATOM   8171  CD1 ILE B 171      45.955 -29.272  13.109  1.00  0.89           C  
ATOM   8172  N   SER B 172      41.400 -28.344  11.314  1.00  0.89           N  
ATOM   8173  CA  SER B 172      40.120 -28.631  10.681  1.00  0.89           C  
ATOM   8174  C   SER B 172      40.341 -29.503   9.472  1.00  0.89           C  
ATOM   8175  O   SER B 172      41.241 -29.290   8.662  1.00  0.89           O  
ATOM   8176  CB  SER B 172      39.248 -27.385  10.333  1.00  0.89           C  
ATOM   8177  OG  SER B 172      39.653 -26.720   9.136  1.00  0.89           O  
ATOM   8178  N   GLY B 173      39.582 -30.617   9.364  1.00  0.93           N  
ATOM   8179  CA  GLY B 173      39.762 -31.565   8.263  1.00  0.93           C  
ATOM   8180  C   GLY B 173      41.079 -32.298   8.322  1.00  0.93           C  
ATOM   8181  O   GLY B 173      41.528 -32.877   7.340  1.00  0.93           O  
ATOM   8182  N   GLY B 174      41.744 -32.240   9.491  1.00  0.93           N  
ATOM   8183  CA  GLY B 174      43.088 -32.730   9.718  1.00  0.93           C  
ATOM   8184  C   GLY B 174      44.201 -31.779   9.345  1.00  0.93           C  
ATOM   8185  O   GLY B 174      45.367 -32.109   9.530  1.00  0.93           O  
ATOM   8186  N   TRP B 175      43.888 -30.577   8.825  1.00  0.88           N  
ATOM   8187  CA  TRP B 175      44.873 -29.612   8.368  1.00  0.88           C  
ATOM   8188  C   TRP B 175      45.173 -28.537   9.398  1.00  0.88           C  
ATOM   8189  O   TRP B 175      44.295 -28.111  10.139  1.00  0.88           O  
ATOM   8190  CB  TRP B 175      44.359 -28.859   7.113  1.00  0.88           C  
ATOM   8191  CG  TRP B 175      44.085 -29.731   5.927  1.00  0.88           C  
ATOM   8192  CD1 TRP B 175      42.921 -30.321   5.521  1.00  0.88           C  
ATOM   8193  CD2 TRP B 175      45.058 -30.125   4.921  1.00  0.88           C  
ATOM   8194  NE1 TRP B 175      43.078 -31.051   4.341  1.00  0.88           N  
ATOM   8195  CE2 TRP B 175      44.430 -30.885   3.998  1.00  0.88           C  
ATOM   8196  CE3 TRP B 175      46.427 -29.800   4.836  1.00  0.88           C  
ATOM   8197  CZ2 TRP B 175      45.092 -31.420   2.876  1.00  0.88           C  
ATOM   8198  CZ3 TRP B 175      47.119 -30.337   3.734  1.00  0.88           C  
ATOM   8199  CH2 TRP B 175      46.474 -31.124   2.780  1.00  0.88           C  
ATOM   8200  N   GLN B 176      46.434 -28.029   9.439  1.00  0.87           N  
ATOM   8201  CA  GLN B 176      46.741 -26.798  10.159  1.00  0.87           C  
ATOM   8202  C   GLN B 176      46.011 -25.617   9.562  1.00  0.87           C  
ATOM   8203  O   GLN B 176      46.215 -25.265   8.403  1.00  0.87           O  
ATOM   8204  CB  GLN B 176      48.256 -26.433  10.210  1.00  0.87           C  
ATOM   8205  CG  GLN B 176      48.548 -24.966  10.650  1.00  0.87           C  
ATOM   8206  CD  GLN B 176      50.040 -24.722  10.851  1.00  0.87           C  
ATOM   8207  OE1 GLN B 176      50.695 -25.427  11.616  1.00  0.87           O  
ATOM   8208  NE2 GLN B 176      50.588 -23.687  10.168  1.00  0.87           N  
ATOM   8209  N   MET B 177      45.185 -24.967  10.396  1.00  0.82           N  
ATOM   8210  CA  MET B 177      44.560 -23.714  10.085  1.00  0.82           C  
ATOM   8211  C   MET B 177      45.139 -22.732  11.076  1.00  0.82           C  
ATOM   8212  O   MET B 177      44.936 -22.836  12.282  1.00  0.82           O  
ATOM   8213  CB  MET B 177      43.022 -23.779  10.276  1.00  0.82           C  
ATOM   8214  CG  MET B 177      42.343 -24.901   9.475  1.00  0.82           C  
ATOM   8215  SD  MET B 177      42.421 -24.688   7.673  1.00  0.82           S  
ATOM   8216  CE  MET B 177      40.883 -23.729   7.578  1.00  0.82           C  
ATOM   8217  N   GLU B 178      45.941 -21.767  10.614  1.00  0.81           N  
ATOM   8218  CA  GLU B 178      46.440 -20.722  11.480  1.00  0.81           C  
ATOM   8219  C   GLU B 178      45.350 -19.731  11.931  1.00  0.81           C  
ATOM   8220  O   GLU B 178      44.438 -19.386  11.188  1.00  0.81           O  
ATOM   8221  CB  GLU B 178      47.699 -20.028  10.880  1.00  0.81           C  
ATOM   8222  CG  GLU B 178      47.754 -19.889   9.339  1.00  0.81           C  
ATOM   8223  CD  GLU B 178      48.148 -21.179   8.646  1.00  0.81           C  
ATOM   8224  OE1 GLU B 178      49.305 -21.660   8.780  1.00  0.81           O  
ATOM   8225  OE2 GLU B 178      47.300 -21.751   7.919  1.00  0.81           O  
ATOM   8226  N   GLU B 179      45.437 -19.204  13.179  1.00  0.80           N  
ATOM   8227  CA  GLU B 179      44.528 -18.182  13.684  1.00  0.80           C  
ATOM   8228  C   GLU B 179      45.331 -17.200  14.520  1.00  0.80           C  
ATOM   8229  O   GLU B 179      46.209 -17.575  15.278  1.00  0.80           O  
ATOM   8230  CB  GLU B 179      43.437 -18.816  14.576  1.00  0.80           C  
ATOM   8231  CG  GLU B 179      42.213 -17.926  14.909  1.00  0.80           C  
ATOM   8232  CD  GLU B 179      41.395 -18.629  15.948  1.00  0.80           C  
ATOM   8233  OE1 GLU B 179      41.307 -18.207  17.131  1.00  0.80           O  
ATOM   8234  OE2 GLU B 179      40.940 -19.744  15.581  1.00  0.80           O  
ATOM   8235  N   ALA B 180      45.109 -15.881  14.372  1.00  0.85           N  
ATOM   8236  CA  ALA B 180      45.944 -14.866  14.994  1.00  0.85           C  
ATOM   8237  C   ALA B 180      45.963 -14.896  16.516  1.00  0.85           C  
ATOM   8238  O   ALA B 180      44.944 -15.085  17.172  1.00  0.85           O  
ATOM   8239  CB  ALA B 180      45.565 -13.444  14.527  1.00  0.85           C  
ATOM   8240  N   ASP B 181      47.153 -14.702  17.109  1.00  0.87           N  
ATOM   8241  CA  ASP B 181      47.339 -14.752  18.534  1.00  0.87           C  
ATOM   8242  C   ASP B 181      47.117 -13.384  19.165  1.00  0.87           C  
ATOM   8243  O   ASP B 181      48.031 -12.623  19.402  1.00  0.87           O  
ATOM   8244  CB  ASP B 181      48.750 -15.319  18.773  1.00  0.87           C  
ATOM   8245  CG  ASP B 181      49.081 -15.440  20.245  1.00  0.87           C  
ATOM   8246  OD1 ASP B 181      48.287 -16.113  20.949  1.00  0.87           O  
ATOM   8247  OD2 ASP B 181      50.105 -14.842  20.660  1.00  0.87           O  
ATOM   8248  N   ASP B 182      45.835 -13.048  19.431  1.00  0.84           N  
ATOM   8249  CA  ASP B 182      45.416 -11.812  20.056  1.00  0.84           C  
ATOM   8250  C   ASP B 182      45.577 -11.898  21.573  1.00  0.84           C  
ATOM   8251  O   ASP B 182      44.627 -11.807  22.349  1.00  0.84           O  
ATOM   8252  CB  ASP B 182      43.964 -11.555  19.583  1.00  0.84           C  
ATOM   8253  CG  ASP B 182      43.419 -10.191  19.957  1.00  0.84           C  
ATOM   8254  OD1 ASP B 182      44.212  -9.237  20.121  1.00  0.84           O  
ATOM   8255  OD2 ASP B 182      42.165 -10.107  20.038  1.00  0.84           O  
ATOM   8256  N   TRP B 183      46.835 -12.069  22.020  1.00  0.86           N  
ATOM   8257  CA  TRP B 183      47.203 -12.356  23.393  1.00  0.86           C  
ATOM   8258  C   TRP B 183      47.020 -11.150  24.303  1.00  0.86           C  
ATOM   8259  O   TRP B 183      46.994 -11.239  25.528  1.00  0.86           O  
ATOM   8260  CB  TRP B 183      48.682 -12.848  23.449  1.00  0.86           C  
ATOM   8261  CG  TRP B 183      49.753 -11.820  23.112  1.00  0.86           C  
ATOM   8262  CD1 TRP B 183      50.100 -11.305  21.896  1.00  0.86           C  
ATOM   8263  CD2 TRP B 183      50.609 -11.155  24.066  1.00  0.86           C  
ATOM   8264  NE1 TRP B 183      51.078 -10.338  22.026  1.00  0.86           N  
ATOM   8265  CE2 TRP B 183      51.394 -10.248  23.364  1.00  0.86           C  
ATOM   8266  CE3 TRP B 183      50.729 -11.299  25.450  1.00  0.86           C  
ATOM   8267  CZ2 TRP B 183      52.321  -9.424  23.999  1.00  0.86           C  
ATOM   8268  CZ3 TRP B 183      51.672 -10.489  26.101  1.00  0.86           C  
ATOM   8269  CH2 TRP B 183      52.451  -9.563  25.393  1.00  0.86           C  
ATOM   8270  N   LEU B 184      46.866  -9.964  23.690  1.00  0.87           N  
ATOM   8271  CA  LEU B 184      46.666  -8.717  24.380  1.00  0.87           C  
ATOM   8272  C   LEU B 184      45.200  -8.345  24.471  1.00  0.87           C  
ATOM   8273  O   LEU B 184      44.873  -7.266  24.968  1.00  0.87           O  
ATOM   8274  CB  LEU B 184      47.399  -7.590  23.623  1.00  0.87           C  
ATOM   8275  CG  LEU B 184      48.930  -7.705  23.670  1.00  0.87           C  
ATOM   8276  CD1 LEU B 184      49.548  -6.714  22.680  1.00  0.87           C  
ATOM   8277  CD2 LEU B 184      49.468  -7.463  25.088  1.00  0.87           C  
ATOM   8278  N   ARG B 185      44.264  -9.224  24.044  1.00  0.78           N  
ATOM   8279  CA  ARG B 185      42.848  -8.904  23.954  1.00  0.78           C  
ATOM   8280  C   ARG B 185      42.228  -8.436  25.255  1.00  0.78           C  
ATOM   8281  O   ARG B 185      41.481  -7.463  25.298  1.00  0.78           O  
ATOM   8282  CB  ARG B 185      42.052 -10.144  23.500  1.00  0.78           C  
ATOM   8283  CG  ARG B 185      40.588  -9.853  23.099  1.00  0.78           C  
ATOM   8284  CD  ARG B 185      39.707 -11.100  23.025  1.00  0.78           C  
ATOM   8285  NE  ARG B 185      40.401 -12.057  22.120  1.00  0.78           N  
ATOM   8286  CZ  ARG B 185      40.052 -13.339  21.958  1.00  0.78           C  
ATOM   8287  NH1 ARG B 185      38.923 -13.816  22.482  1.00  0.78           N  
ATOM   8288  NH2 ARG B 185      40.858 -14.158  21.291  1.00  0.78           N  
ATOM   8289  N   TYR B 186      42.566  -9.106  26.372  1.00  0.83           N  
ATOM   8290  CA  TYR B 186      42.027  -8.772  27.672  1.00  0.83           C  
ATOM   8291  C   TYR B 186      42.990  -7.890  28.450  1.00  0.83           C  
ATOM   8292  O   TYR B 186      42.817  -7.640  29.641  1.00  0.83           O  
ATOM   8293  CB  TYR B 186      41.700 -10.051  28.476  1.00  0.83           C  
ATOM   8294  CG  TYR B 186      40.673 -10.879  27.749  1.00  0.83           C  
ATOM   8295  CD1 TYR B 186      39.326 -10.479  27.710  1.00  0.83           C  
ATOM   8296  CD2 TYR B 186      41.044 -12.065  27.094  1.00  0.83           C  
ATOM   8297  CE1 TYR B 186      38.369 -11.251  27.036  1.00  0.83           C  
ATOM   8298  CE2 TYR B 186      40.089 -12.843  26.428  1.00  0.83           C  
ATOM   8299  CZ  TYR B 186      38.751 -12.438  26.402  1.00  0.83           C  
ATOM   8300  OH  TYR B 186      37.799 -13.231  25.732  1.00  0.83           O  
ATOM   8301  N   GLY B 187      44.027  -7.370  27.763  1.00  0.87           N  
ATOM   8302  CA  GLY B 187      45.146  -6.662  28.354  1.00  0.87           C  
ATOM   8303  C   GLY B 187      46.154  -7.569  29.011  1.00  0.87           C  
ATOM   8304  O   GLY B 187      45.904  -8.730  29.323  1.00  0.87           O  
ATOM   8305  N   ASN B 188      47.353  -7.023  29.260  1.00  0.89           N  
ATOM   8306  CA  ASN B 188      48.454  -7.729  29.876  1.00  0.89           C  
ATOM   8307  C   ASN B 188      48.746  -6.991  31.183  1.00  0.89           C  
ATOM   8308  O   ASN B 188      49.088  -5.811  31.128  1.00  0.89           O  
ATOM   8309  CB  ASN B 188      49.672  -7.704  28.911  1.00  0.89           C  
ATOM   8310  CG  ASN B 188      50.937  -8.349  29.471  1.00  0.89           C  
ATOM   8311  OD1 ASN B 188      50.960  -8.955  30.543  1.00  0.89           O  
ATOM   8312  ND2 ASN B 188      52.055  -8.190  28.726  1.00  0.89           N  
ATOM   8313  N   PRO B 189      48.623  -7.584  32.371  1.00  0.92           N  
ATOM   8314  CA  PRO B 189      48.722  -6.839  33.616  1.00  0.92           C  
ATOM   8315  C   PRO B 189      50.164  -6.711  34.025  1.00  0.92           C  
ATOM   8316  O   PRO B 189      50.480  -5.845  34.838  1.00  0.92           O  
ATOM   8317  CB  PRO B 189      47.942  -7.693  34.632  1.00  0.92           C  
ATOM   8318  CG  PRO B 189      48.034  -9.119  34.078  1.00  0.92           C  
ATOM   8319  CD  PRO B 189      48.023  -8.902  32.567  1.00  0.92           C  
ATOM   8320  N   TRP B 190      51.029  -7.601  33.510  1.00  0.89           N  
ATOM   8321  CA  TRP B 190      52.412  -7.716  33.900  1.00  0.89           C  
ATOM   8322  C   TRP B 190      53.323  -6.716  33.231  1.00  0.89           C  
ATOM   8323  O   TRP B 190      54.391  -6.411  33.755  1.00  0.89           O  
ATOM   8324  CB  TRP B 190      52.938  -9.125  33.531  1.00  0.89           C  
ATOM   8325  CG  TRP B 190      52.067 -10.239  33.981  1.00  0.89           C  
ATOM   8326  CD1 TRP B 190      51.266 -11.068  33.245  1.00  0.89           C  
ATOM   8327  CD2 TRP B 190      51.831 -10.701  35.357  1.00  0.89           C  
ATOM   8328  NE1 TRP B 190      50.555 -12.001  34.016  1.00  0.89           N  
ATOM   8329  CE2 TRP B 190      50.970 -11.677  35.339  1.00  0.89           C  
ATOM   8330  CE3 TRP B 190      52.446 -10.209  36.546  1.00  0.89           C  
ATOM   8331  CZ2 TRP B 190      50.506 -12.358  36.504  1.00  0.89           C  
ATOM   8332  CZ3 TRP B 190      52.017 -10.849  37.735  1.00  0.89           C  
ATOM   8333  CH2 TRP B 190      51.079 -11.874  37.719  1.00  0.89           C  
ATOM   8334  N   GLU B 191      52.930  -6.177  32.064  1.00  0.90           N  
ATOM   8335  CA  GLU B 191      53.707  -5.166  31.387  1.00  0.90           C  
ATOM   8336  C   GLU B 191      53.366  -3.776  31.888  1.00  0.90           C  
ATOM   8337  O   GLU B 191      52.253  -3.472  32.308  1.00  0.90           O  
ATOM   8338  CB  GLU B 191      53.487  -5.197  29.855  1.00  0.90           C  
ATOM   8339  CG  GLU B 191      52.052  -4.808  29.416  1.00  0.90           C  
ATOM   8340  CD  GLU B 191      51.789  -4.961  27.928  1.00  0.90           C  
ATOM   8341  OE1 GLU B 191      52.581  -5.640  27.225  1.00  0.90           O  
ATOM   8342  OE2 GLU B 191      50.772  -4.411  27.428  1.00  0.90           O  
ATOM   8343  N   LYS B 192      54.346  -2.861  31.832  1.00  0.83           N  
ATOM   8344  CA  LYS B 192      54.099  -1.459  32.032  1.00  0.83           C  
ATOM   8345  C   LYS B 192      54.603  -0.660  30.848  1.00  0.83           C  
ATOM   8346  O   LYS B 192      55.801  -0.515  30.615  1.00  0.83           O  
ATOM   8347  CB  LYS B 192      54.745  -0.939  33.340  1.00  0.83           C  
ATOM   8348  CG  LYS B 192      54.430   0.535  33.644  1.00  0.83           C  
ATOM   8349  CD  LYS B 192      52.934   0.776  33.901  1.00  0.83           C  
ATOM   8350  CE  LYS B 192      52.570   2.252  34.075  1.00  0.83           C  
ATOM   8351  NZ  LYS B 192      52.761   3.015  32.821  1.00  0.83           N  
ATOM   8352  N   ALA B 193      53.662  -0.070  30.083  1.00  0.89           N  
ATOM   8353  CA  ALA B 193      53.941   0.884  29.033  1.00  0.89           C  
ATOM   8354  C   ALA B 193      54.699   2.118  29.512  1.00  0.89           C  
ATOM   8355  O   ALA B 193      54.349   2.705  30.542  1.00  0.89           O  
ATOM   8356  CB  ALA B 193      52.598   1.364  28.448  1.00  0.89           C  
ATOM   8357  N   ARG B 194      55.736   2.541  28.759  1.00  0.82           N  
ATOM   8358  CA  ARG B 194      56.478   3.756  29.024  1.00  0.82           C  
ATOM   8359  C   ARG B 194      56.357   4.742  27.867  1.00  0.82           C  
ATOM   8360  O   ARG B 194      57.311   4.925  27.104  1.00  0.82           O  
ATOM   8361  CB  ARG B 194      57.978   3.461  29.248  1.00  0.82           C  
ATOM   8362  CG  ARG B 194      58.293   2.398  30.316  1.00  0.82           C  
ATOM   8363  CD  ARG B 194      57.692   2.718  31.682  1.00  0.82           C  
ATOM   8364  NE  ARG B 194      58.317   1.782  32.644  1.00  0.82           N  
ATOM   8365  CZ  ARG B 194      58.247   1.875  33.970  1.00  0.82           C  
ATOM   8366  NH1 ARG B 194      57.474   2.761  34.577  1.00  0.82           N  
ATOM   8367  NH2 ARG B 194      59.005   1.067  34.698  1.00  0.82           N  
ATOM   8368  N   PRO B 195      55.229   5.411  27.668  1.00  0.83           N  
ATOM   8369  CA  PRO B 195      55.069   6.381  26.591  1.00  0.83           C  
ATOM   8370  C   PRO B 195      55.932   7.624  26.743  1.00  0.83           C  
ATOM   8371  O   PRO B 195      55.992   8.416  25.799  1.00  0.83           O  
ATOM   8372  CB  PRO B 195      53.576   6.715  26.669  1.00  0.83           C  
ATOM   8373  CG  PRO B 195      53.224   6.553  28.148  1.00  0.83           C  
ATOM   8374  CD  PRO B 195      54.059   5.355  28.549  1.00  0.83           C  
ATOM   8375  N   GLU B 196      56.612   7.837  27.882  1.00  0.80           N  
ATOM   8376  CA  GLU B 196      57.496   8.947  28.121  1.00  0.80           C  
ATOM   8377  C   GLU B 196      58.918   8.685  27.655  1.00  0.80           C  
ATOM   8378  O   GLU B 196      59.730   9.600  27.574  1.00  0.80           O  
ATOM   8379  CB  GLU B 196      57.518   9.300  29.637  1.00  0.80           C  
ATOM   8380  CG  GLU B 196      58.214   8.286  30.598  1.00  0.80           C  
ATOM   8381  CD  GLU B 196      57.478   6.972  30.883  1.00  0.80           C  
ATOM   8382  OE1 GLU B 196      58.027   6.190  31.709  1.00  0.80           O  
ATOM   8383  OE2 GLU B 196      56.385   6.698  30.334  1.00  0.80           O  
ATOM   8384  N   PHE B 197      59.253   7.421  27.313  1.00  0.85           N  
ATOM   8385  CA  PHE B 197      60.598   7.044  26.913  1.00  0.85           C  
ATOM   8386  C   PHE B 197      60.662   6.572  25.470  1.00  0.85           C  
ATOM   8387  O   PHE B 197      61.458   5.702  25.119  1.00  0.85           O  
ATOM   8388  CB  PHE B 197      61.196   5.940  27.836  1.00  0.85           C  
ATOM   8389  CG  PHE B 197      61.421   6.409  29.252  1.00  0.85           C  
ATOM   8390  CD1 PHE B 197      61.974   7.671  29.542  1.00  0.85           C  
ATOM   8391  CD2 PHE B 197      61.115   5.550  30.321  1.00  0.85           C  
ATOM   8392  CE1 PHE B 197      62.172   8.079  30.867  1.00  0.85           C  
ATOM   8393  CE2 PHE B 197      61.323   5.949  31.647  1.00  0.85           C  
ATOM   8394  CZ  PHE B 197      61.841   7.221  31.920  1.00  0.85           C  
ATOM   8395  N   THR B 198      59.806   7.110  24.581  1.00  0.85           N  
ATOM   8396  CA  THR B 198      59.873   6.817  23.155  1.00  0.85           C  
ATOM   8397  C   THR B 198      61.155   7.289  22.479  1.00  0.85           C  
ATOM   8398  O   THR B 198      61.664   8.375  22.746  1.00  0.85           O  
ATOM   8399  CB  THR B 198      58.676   7.326  22.360  1.00  0.85           C  
ATOM   8400  OG1 THR B 198      58.543   8.738  22.441  1.00  0.85           O  
ATOM   8401  CG2 THR B 198      57.387   6.735  22.942  1.00  0.85           C  
ATOM   8402  N   LEU B 199      61.722   6.463  21.575  1.00  0.90           N  
ATOM   8403  CA  LEU B 199      62.983   6.759  20.912  1.00  0.90           C  
ATOM   8404  C   LEU B 199      62.824   6.750  19.396  1.00  0.90           C  
ATOM   8405  O   LEU B 199      62.077   5.919  18.875  1.00  0.90           O  
ATOM   8406  CB  LEU B 199      64.072   5.728  21.298  1.00  0.90           C  
ATOM   8407  CG  LEU B 199      64.479   5.769  22.786  1.00  0.90           C  
ATOM   8408  CD1 LEU B 199      65.410   4.598  23.118  1.00  0.90           C  
ATOM   8409  CD2 LEU B 199      65.161   7.098  23.155  1.00  0.90           C  
ATOM   8410  N   PRO B 200      63.457   7.629  18.621  1.00  0.91           N  
ATOM   8411  CA  PRO B 200      63.338   7.617  17.171  1.00  0.91           C  
ATOM   8412  C   PRO B 200      64.160   6.519  16.515  1.00  0.91           C  
ATOM   8413  O   PRO B 200      65.308   6.277  16.886  1.00  0.91           O  
ATOM   8414  CB  PRO B 200      63.848   9.012  16.767  1.00  0.91           C  
ATOM   8415  CG  PRO B 200      64.902   9.342  17.830  1.00  0.91           C  
ATOM   8416  CD  PRO B 200      64.320   8.713  19.099  1.00  0.91           C  
ATOM   8417  N   VAL B 201      63.587   5.854  15.498  1.00  0.93           N  
ATOM   8418  CA  VAL B 201      64.270   4.884  14.668  1.00  0.93           C  
ATOM   8419  C   VAL B 201      64.189   5.375  13.236  1.00  0.93           C  
ATOM   8420  O   VAL B 201      63.119   5.696  12.728  1.00  0.93           O  
ATOM   8421  CB  VAL B 201      63.655   3.491  14.756  1.00  0.93           C  
ATOM   8422  CG1 VAL B 201      64.437   2.495  13.874  1.00  0.93           C  
ATOM   8423  CG2 VAL B 201      63.675   3.028  16.228  1.00  0.93           C  
ATOM   8424  N   HIS B 202      65.348   5.462  12.557  1.00  0.90           N  
ATOM   8425  CA  HIS B 202      65.458   5.987  11.207  1.00  0.90           C  
ATOM   8426  C   HIS B 202      65.488   4.916  10.129  1.00  0.90           C  
ATOM   8427  O   HIS B 202      66.108   3.875  10.279  1.00  0.90           O  
ATOM   8428  CB  HIS B 202      66.757   6.804  11.050  1.00  0.90           C  
ATOM   8429  CG  HIS B 202      66.796   7.978  11.963  1.00  0.90           C  
ATOM   8430  ND1 HIS B 202      66.029   9.082  11.667  1.00  0.90           N  
ATOM   8431  CD2 HIS B 202      67.414   8.136  13.160  1.00  0.90           C  
ATOM   8432  CE1 HIS B 202      66.186   9.895  12.693  1.00  0.90           C  
ATOM   8433  NE2 HIS B 202      67.017   9.370  13.628  1.00  0.90           N  
ATOM   8434  N   PHE B 203      64.836   5.179   8.983  1.00  0.90           N  
ATOM   8435  CA  PHE B 203      64.821   4.279   7.846  1.00  0.90           C  
ATOM   8436  C   PHE B 203      64.976   5.071   6.554  1.00  0.90           C  
ATOM   8437  O   PHE B 203      64.650   6.250   6.482  1.00  0.90           O  
ATOM   8438  CB  PHE B 203      63.475   3.504   7.769  1.00  0.90           C  
ATOM   8439  CG  PHE B 203      63.309   2.508   8.885  1.00  0.90           C  
ATOM   8440  CD1 PHE B 203      64.016   1.297   8.855  1.00  0.90           C  
ATOM   8441  CD2 PHE B 203      62.407   2.736   9.939  1.00  0.90           C  
ATOM   8442  CE1 PHE B 203      63.814   0.324   9.839  1.00  0.90           C  
ATOM   8443  CE2 PHE B 203      62.202   1.764  10.928  1.00  0.90           C  
ATOM   8444  CZ  PHE B 203      62.910   0.557  10.881  1.00  0.90           C  
ATOM   8445  N   TYR B 204      65.451   4.418   5.474  1.00  0.90           N  
ATOM   8446  CA  TYR B 204      65.664   5.013   4.161  1.00  0.90           C  
ATOM   8447  C   TYR B 204      66.592   6.221   4.151  1.00  0.90           C  
ATOM   8448  O   TYR B 204      67.655   6.189   4.766  1.00  0.90           O  
ATOM   8449  CB  TYR B 204      64.330   5.337   3.440  1.00  0.90           C  
ATOM   8450  CG  TYR B 204      63.370   4.178   3.497  1.00  0.90           C  
ATOM   8451  CD1 TYR B 204      63.508   3.044   2.682  1.00  0.90           C  
ATOM   8452  CD2 TYR B 204      62.280   4.240   4.369  1.00  0.90           C  
ATOM   8453  CE1 TYR B 204      62.534   2.022   2.703  1.00  0.90           C  
ATOM   8454  CE2 TYR B 204      61.323   3.222   4.402  1.00  0.90           C  
ATOM   8455  CZ  TYR B 204      61.407   2.139   3.536  1.00  0.90           C  
ATOM   8456  OH  TYR B 204      60.272   1.308   3.467  1.00  0.90           O  
ATOM   8457  N   GLY B 205      66.245   7.313   3.431  1.00  0.91           N  
ATOM   8458  CA  GLY B 205      67.133   8.451   3.212  1.00  0.91           C  
ATOM   8459  C   GLY B 205      68.439   8.116   2.550  1.00  0.91           C  
ATOM   8460  O   GLY B 205      68.559   7.139   1.813  1.00  0.91           O  
ATOM   8461  N   HIS B 206      69.468   8.938   2.784  1.00  0.87           N  
ATOM   8462  CA  HIS B 206      70.757   8.721   2.170  1.00  0.87           C  
ATOM   8463  C   HIS B 206      71.853   9.345   3.009  1.00  0.87           C  
ATOM   8464  O   HIS B 206      71.609   9.983   4.027  1.00  0.87           O  
ATOM   8465  CB  HIS B 206      70.826   9.230   0.707  1.00  0.87           C  
ATOM   8466  CG  HIS B 206      70.830  10.718   0.572  1.00  0.87           C  
ATOM   8467  ND1 HIS B 206      69.678  11.420   0.837  1.00  0.87           N  
ATOM   8468  CD2 HIS B 206      71.850  11.565   0.289  1.00  0.87           C  
ATOM   8469  CE1 HIS B 206      70.012  12.694   0.713  1.00  0.87           C  
ATOM   8470  NE2 HIS B 206      71.319  12.830   0.380  1.00  0.87           N  
ATOM   8471  N   VAL B 207      73.127   9.120   2.630  1.00  0.90           N  
ATOM   8472  CA  VAL B 207      74.250   9.576   3.434  1.00  0.90           C  
ATOM   8473  C   VAL B 207      75.026  10.659   2.728  1.00  0.90           C  
ATOM   8474  O   VAL B 207      75.580  10.454   1.660  1.00  0.90           O  
ATOM   8475  CB  VAL B 207      75.235   8.463   3.749  1.00  0.90           C  
ATOM   8476  CG1 VAL B 207      76.402   8.979   4.624  1.00  0.90           C  
ATOM   8477  CG2 VAL B 207      74.495   7.337   4.486  1.00  0.90           C  
ATOM   8478  N   GLU B 208      75.116  11.826   3.390  1.00  0.85           N  
ATOM   8479  CA  GLU B 208      75.928  12.936   2.961  1.00  0.85           C  
ATOM   8480  C   GLU B 208      77.217  12.899   3.751  1.00  0.85           C  
ATOM   8481  O   GLU B 208      77.225  12.916   4.982  1.00  0.85           O  
ATOM   8482  CB  GLU B 208      75.207  14.276   3.240  1.00  0.85           C  
ATOM   8483  CG  GLU B 208      73.945  14.490   2.371  1.00  0.85           C  
ATOM   8484  CD  GLU B 208      74.236  14.727   0.891  1.00  0.85           C  
ATOM   8485  OE1 GLU B 208      75.422  14.908   0.515  1.00  0.85           O  
ATOM   8486  OE2 GLU B 208      73.239  14.730   0.123  1.00  0.85           O  
ATOM   8487  N   HIS B 209      78.365  12.822   3.062  1.00  0.83           N  
ATOM   8488  CA  HIS B 209      79.651  12.777   3.732  1.00  0.83           C  
ATOM   8489  C   HIS B 209      80.194  14.182   3.855  1.00  0.83           C  
ATOM   8490  O   HIS B 209      80.485  14.834   2.858  1.00  0.83           O  
ATOM   8491  CB  HIS B 209      80.675  11.914   2.965  1.00  0.83           C  
ATOM   8492  CG  HIS B 209      80.315  10.462   2.947  1.00  0.83           C  
ATOM   8493  ND1 HIS B 209      80.333   9.740   4.127  1.00  0.83           N  
ATOM   8494  CD2 HIS B 209      79.968   9.657   1.909  1.00  0.83           C  
ATOM   8495  CE1 HIS B 209      79.997   8.516   3.784  1.00  0.83           C  
ATOM   8496  NE2 HIS B 209      79.766   8.407   2.453  1.00  0.83           N  
ATOM   8497  N   THR B 210      80.340  14.696   5.096  1.00  0.86           N  
ATOM   8498  CA  THR B 210      80.700  16.088   5.310  1.00  0.86           C  
ATOM   8499  C   THR B 210      81.889  16.217   6.231  1.00  0.86           C  
ATOM   8500  O   THR B 210      82.272  15.312   6.955  1.00  0.86           O  
ATOM   8501  CB  THR B 210      79.560  16.955   5.870  1.00  0.86           C  
ATOM   8502  OG1 THR B 210      79.330  16.801   7.269  1.00  0.86           O  
ATOM   8503  CG2 THR B 210      78.233  16.608   5.182  1.00  0.86           C  
ATOM   8504  N   SER B 211      82.492  17.430   6.248  1.00  0.83           N  
ATOM   8505  CA  SER B 211      83.626  17.778   7.095  1.00  0.83           C  
ATOM   8506  C   SER B 211      83.337  17.789   8.584  1.00  0.83           C  
ATOM   8507  O   SER B 211      84.191  18.117   9.401  1.00  0.83           O  
ATOM   8508  CB  SER B 211      84.195  19.169   6.726  1.00  0.83           C  
ATOM   8509  OG  SER B 211      84.429  19.233   5.319  1.00  0.83           O  
ATOM   8510  N   GLN B 212      82.111  17.414   8.989  1.00  0.75           N  
ATOM   8511  CA  GLN B 212      81.726  17.286  10.367  1.00  0.75           C  
ATOM   8512  C   GLN B 212      81.035  15.949  10.603  1.00  0.75           C  
ATOM   8513  O   GLN B 212      80.272  15.767  11.558  1.00  0.75           O  
ATOM   8514  CB  GLN B 212      80.908  18.512  10.859  1.00  0.75           C  
ATOM   8515  CG  GLN B 212      79.896  19.138   9.860  1.00  0.75           C  
ATOM   8516  CD  GLN B 212      80.488  20.039   8.763  1.00  0.75           C  
ATOM   8517  OE1 GLN B 212      79.919  20.171   7.688  1.00  0.75           O  
ATOM   8518  NE2 GLN B 212      81.652  20.668   9.038  1.00  0.75           N  
ATOM   8519  N   GLY B 213      81.348  14.952   9.748  1.00  0.87           N  
ATOM   8520  CA  GLY B 213      80.934  13.563   9.898  1.00  0.87           C  
ATOM   8521  C   GLY B 213      80.016  13.102   8.813  1.00  0.87           C  
ATOM   8522  O   GLY B 213      79.540  13.879   7.992  1.00  0.87           O  
ATOM   8523  N   ALA B 214      79.711  11.794   8.795  1.00  0.92           N  
ATOM   8524  CA  ALA B 214      78.720  11.270   7.890  1.00  0.92           C  
ATOM   8525  C   ALA B 214      77.330  11.596   8.411  1.00  0.92           C  
ATOM   8526  O   ALA B 214      77.014  11.418   9.590  1.00  0.92           O  
ATOM   8527  CB  ALA B 214      78.895   9.755   7.687  1.00  0.92           C  
ATOM   8528  N   LYS B 215      76.466  12.145   7.546  1.00  0.86           N  
ATOM   8529  CA  LYS B 215      75.147  12.569   7.944  1.00  0.86           C  
ATOM   8530  C   LYS B 215      74.121  11.749   7.214  1.00  0.86           C  
ATOM   8531  O   LYS B 215      74.007  11.787   5.994  1.00  0.86           O  
ATOM   8532  CB  LYS B 215      74.900  14.072   7.657  1.00  0.86           C  
ATOM   8533  CG  LYS B 215      75.925  15.023   8.302  1.00  0.86           C  
ATOM   8534  CD  LYS B 215      76.001  14.911   9.834  1.00  0.86           C  
ATOM   8535  CE  LYS B 215      77.182  15.695  10.406  1.00  0.86           C  
ATOM   8536  NZ  LYS B 215      77.349  15.412  11.847  1.00  0.86           N  
ATOM   8537  N   TRP B 216      73.329  10.970   7.971  1.00  0.83           N  
ATOM   8538  CA  TRP B 216      72.230  10.215   7.423  1.00  0.83           C  
ATOM   8539  C   TRP B 216      71.020  11.137   7.431  1.00  0.83           C  
ATOM   8540  O   TRP B 216      70.540  11.534   8.488  1.00  0.83           O  
ATOM   8541  CB  TRP B 216      72.006   8.931   8.270  1.00  0.83           C  
ATOM   8542  CG  TRP B 216      71.057   7.887   7.724  1.00  0.83           C  
ATOM   8543  CD1 TRP B 216      70.551   7.737   6.466  1.00  0.83           C  
ATOM   8544  CD2 TRP B 216      70.520   6.777   8.481  1.00  0.83           C  
ATOM   8545  NE1 TRP B 216      69.741   6.624   6.384  1.00  0.83           N  
ATOM   8546  CE2 TRP B 216      69.716   6.040   7.634  1.00  0.83           C  
ATOM   8547  CE3 TRP B 216      70.704   6.402   9.818  1.00  0.83           C  
ATOM   8548  CZ2 TRP B 216      69.006   4.917   8.064  1.00  0.83           C  
ATOM   8549  CZ3 TRP B 216      70.013   5.265  10.266  1.00  0.83           C  
ATOM   8550  CH2 TRP B 216      69.175   4.538   9.411  1.00  0.83           C  
ATOM   8551  N   VAL B 217      70.559  11.543   6.235  1.00  0.89           N  
ATOM   8552  CA  VAL B 217      69.560  12.578   6.068  1.00  0.89           C  
ATOM   8553  C   VAL B 217      68.398  12.042   5.270  1.00  0.89           C  
ATOM   8554  O   VAL B 217      68.449  10.936   4.738  1.00  0.89           O  
ATOM   8555  CB  VAL B 217      70.096  13.829   5.382  1.00  0.89           C  
ATOM   8556  CG1 VAL B 217      71.135  14.520   6.284  1.00  0.89           C  
ATOM   8557  CG2 VAL B 217      70.725  13.485   4.018  1.00  0.89           C  
ATOM   8558  N   ASP B 218      67.290  12.814   5.237  1.00  0.86           N  
ATOM   8559  CA  ASP B 218      66.060  12.534   4.524  1.00  0.86           C  
ATOM   8560  C   ASP B 218      65.438  11.177   4.856  1.00  0.86           C  
ATOM   8561  O   ASP B 218      64.878  10.463   4.030  1.00  0.86           O  
ATOM   8562  CB  ASP B 218      66.254  12.816   3.017  1.00  0.86           C  
ATOM   8563  CG  ASP B 218      66.766  14.241   2.820  1.00  0.86           C  
ATOM   8564  OD1 ASP B 218      66.474  15.108   3.689  1.00  0.86           O  
ATOM   8565  OD2 ASP B 218      67.470  14.473   1.807  1.00  0.86           O  
ATOM   8566  N   THR B 219      65.523  10.816   6.151  1.00  0.87           N  
ATOM   8567  CA  THR B 219      65.048   9.567   6.706  1.00  0.87           C  
ATOM   8568  C   THR B 219      63.569   9.555   7.036  1.00  0.87           C  
ATOM   8569  O   THR B 219      62.935  10.546   7.379  1.00  0.87           O  
ATOM   8570  CB  THR B 219      65.810   9.135   7.958  1.00  0.87           C  
ATOM   8571  OG1 THR B 219      65.768  10.123   8.983  1.00  0.87           O  
ATOM   8572  CG2 THR B 219      67.285   8.939   7.590  1.00  0.87           C  
ATOM   8573  N   GLN B 220      62.972   8.352   6.969  1.00  0.80           N  
ATOM   8574  CA  GLN B 220      61.659   8.086   7.511  1.00  0.80           C  
ATOM   8575  C   GLN B 220      61.842   7.713   8.967  1.00  0.80           C  
ATOM   8576  O   GLN B 220      62.633   6.836   9.289  1.00  0.80           O  
ATOM   8577  CB  GLN B 220      60.994   6.881   6.801  1.00  0.80           C  
ATOM   8578  CG  GLN B 220      59.637   6.434   7.400  1.00  0.80           C  
ATOM   8579  CD  GLN B 220      59.231   5.062   6.868  1.00  0.80           C  
ATOM   8580  OE1 GLN B 220      58.807   4.895   5.725  1.00  0.80           O  
ATOM   8581  NE2 GLN B 220      59.375   4.016   7.715  1.00  0.80           N  
ATOM   8582  N   VAL B 221      61.103   8.356   9.885  1.00  0.86           N  
ATOM   8583  CA  VAL B 221      61.188   8.042  11.299  1.00  0.86           C  
ATOM   8584  C   VAL B 221      59.998   7.192  11.721  1.00  0.86           C  
ATOM   8585  O   VAL B 221      58.869   7.409  11.326  1.00  0.86           O  
ATOM   8586  CB  VAL B 221      61.284   9.305  12.146  1.00  0.86           C  
ATOM   8587  CG1 VAL B 221      61.265   8.979  13.655  1.00  0.86           C  
ATOM   8588  CG2 VAL B 221      62.597  10.034  11.795  1.00  0.86           C  
ATOM   8589  N   VAL B 222      60.255   6.162  12.552  1.00  0.90           N  
ATOM   8590  CA  VAL B 222      59.235   5.419  13.273  1.00  0.90           C  
ATOM   8591  C   VAL B 222      59.668   5.523  14.719  1.00  0.90           C  
ATOM   8592  O   VAL B 222      60.859   5.513  15.012  1.00  0.90           O  
ATOM   8593  CB  VAL B 222      59.138   3.956  12.834  1.00  0.90           C  
ATOM   8594  CG1 VAL B 222      58.114   3.185  13.693  1.00  0.90           C  
ATOM   8595  CG2 VAL B 222      58.696   3.910  11.357  1.00  0.90           C  
ATOM   8596  N   LEU B 223      58.739   5.690  15.677  1.00  0.88           N  
ATOM   8597  CA  LEU B 223      59.123   5.788  17.071  1.00  0.88           C  
ATOM   8598  C   LEU B 223      59.027   4.444  17.760  1.00  0.88           C  
ATOM   8599  O   LEU B 223      58.147   3.635  17.479  1.00  0.88           O  
ATOM   8600  CB  LEU B 223      58.264   6.803  17.856  1.00  0.88           C  
ATOM   8601  CG  LEU B 223      58.343   8.256  17.351  1.00  0.88           C  
ATOM   8602  CD1 LEU B 223      57.464   9.153  18.233  1.00  0.88           C  
ATOM   8603  CD2 LEU B 223      59.782   8.789  17.340  1.00  0.88           C  
ATOM   8604  N   ALA B 224      59.945   4.176  18.703  1.00  0.93           N  
ATOM   8605  CA  ALA B 224      59.956   2.959  19.474  1.00  0.93           C  
ATOM   8606  C   ALA B 224      59.570   3.232  20.912  1.00  0.93           C  
ATOM   8607  O   ALA B 224      60.256   3.943  21.639  1.00  0.93           O  
ATOM   8608  CB  ALA B 224      61.349   2.309  19.415  1.00  0.93           C  
ATOM   8609  N   MET B 225      58.437   2.659  21.356  1.00  0.91           N  
ATOM   8610  CA  MET B 225      57.911   2.835  22.693  1.00  0.91           C  
ATOM   8611  C   MET B 225      58.181   1.607  23.556  1.00  0.91           C  
ATOM   8612  O   MET B 225      57.724   0.523  23.185  1.00  0.91           O  
ATOM   8613  CB  MET B 225      56.387   3.084  22.610  1.00  0.91           C  
ATOM   8614  CG  MET B 225      55.705   3.268  23.977  1.00  0.91           C  
ATOM   8615  SD  MET B 225      54.026   3.938  23.856  1.00  0.91           S  
ATOM   8616  CE  MET B 225      53.451   3.187  25.399  1.00  0.91           C  
ATOM   8617  N   PRO B 226      58.909   1.663  24.669  1.00  0.96           N  
ATOM   8618  CA  PRO B 226      59.205   0.479  25.451  1.00  0.96           C  
ATOM   8619  C   PRO B 226      58.109   0.117  26.424  1.00  0.96           C  
ATOM   8620  O   PRO B 226      57.423   0.974  26.975  1.00  0.96           O  
ATOM   8621  CB  PRO B 226      60.490   0.831  26.199  1.00  0.96           C  
ATOM   8622  CG  PRO B 226      60.463   2.353  26.354  1.00  0.96           C  
ATOM   8623  CD  PRO B 226      59.582   2.851  25.199  1.00  0.96           C  
ATOM   8624  N   TYR B 227      57.947  -1.196  26.636  1.00  0.94           N  
ATOM   8625  CA  TYR B 227      57.087  -1.758  27.644  1.00  0.94           C  
ATOM   8626  C   TYR B 227      57.987  -2.591  28.545  1.00  0.94           C  
ATOM   8627  O   TYR B 227      58.735  -3.446  28.070  1.00  0.94           O  
ATOM   8628  CB  TYR B 227      55.994  -2.666  27.011  1.00  0.94           C  
ATOM   8629  CG  TYR B 227      54.867  -1.892  26.356  1.00  0.94           C  
ATOM   8630  CD1 TYR B 227      55.063  -1.115  25.197  1.00  0.94           C  
ATOM   8631  CD2 TYR B 227      53.559  -2.019  26.854  1.00  0.94           C  
ATOM   8632  CE1 TYR B 227      53.985  -0.475  24.570  1.00  0.94           C  
ATOM   8633  CE2 TYR B 227      52.477  -1.393  26.218  1.00  0.94           C  
ATOM   8634  CZ  TYR B 227      52.692  -0.624  25.071  1.00  0.94           C  
ATOM   8635  OH  TYR B 227      51.610  -0.018  24.400  1.00  0.94           O  
ATOM   8636  N   ASP B 228      57.941  -2.330  29.867  1.00  0.93           N  
ATOM   8637  CA  ASP B 228      58.732  -3.028  30.861  1.00  0.93           C  
ATOM   8638  C   ASP B 228      57.921  -4.156  31.501  1.00  0.93           C  
ATOM   8639  O   ASP B 228      56.843  -3.929  32.042  1.00  0.93           O  
ATOM   8640  CB  ASP B 228      59.127  -2.073  32.027  1.00  0.93           C  
ATOM   8641  CG  ASP B 228      60.130  -0.993  31.682  1.00  0.93           C  
ATOM   8642  OD1 ASP B 228      60.739  -0.994  30.589  1.00  0.93           O  
ATOM   8643  OD2 ASP B 228      60.306  -0.085  32.545  1.00  0.93           O  
ATOM   8644  N   THR B 229      58.447  -5.393  31.504  1.00  0.95           N  
ATOM   8645  CA  THR B 229      57.841  -6.527  32.204  1.00  0.95           C  
ATOM   8646  C   THR B 229      58.815  -7.014  33.268  1.00  0.95           C  
ATOM   8647  O   THR B 229      59.964  -7.308  32.920  1.00  0.95           O  
ATOM   8648  CB  THR B 229      57.530  -7.710  31.297  1.00  0.95           C  
ATOM   8649  OG1 THR B 229      56.509  -7.357  30.376  1.00  0.95           O  
ATOM   8650  CG2 THR B 229      57.002  -8.924  32.081  1.00  0.95           C  
ATOM   8651  N   PRO B 230      58.471  -7.138  34.554  1.00  0.96           N  
ATOM   8652  CA  PRO B 230      59.401  -7.621  35.569  1.00  0.96           C  
ATOM   8653  C   PRO B 230      59.700  -9.112  35.469  1.00  0.96           C  
ATOM   8654  O   PRO B 230      58.794  -9.906  35.227  1.00  0.96           O  
ATOM   8655  CB  PRO B 230      58.694  -7.306  36.904  1.00  0.96           C  
ATOM   8656  CG  PRO B 230      57.647  -6.244  36.574  1.00  0.96           C  
ATOM   8657  CD  PRO B 230      57.242  -6.614  35.152  1.00  0.96           C  
ATOM   8658  N   VAL B 231      60.967  -9.511  35.678  1.00  0.98           N  
ATOM   8659  CA  VAL B 231      61.402 -10.901  35.640  1.00  0.98           C  
ATOM   8660  C   VAL B 231      61.952 -11.315  37.008  1.00  0.98           C  
ATOM   8661  O   VAL B 231      63.046 -10.869  37.365  1.00  0.98           O  
ATOM   8662  CB  VAL B 231      62.516 -11.087  34.619  1.00  0.98           C  
ATOM   8663  CG1 VAL B 231      63.051 -12.536  34.646  1.00  0.98           C  
ATOM   8664  CG2 VAL B 231      61.991 -10.721  33.214  1.00  0.98           C  
ATOM   8665  N   PRO B 232      61.298 -12.136  37.820  1.00  0.98           N  
ATOM   8666  CA  PRO B 232      61.784 -12.478  39.151  1.00  0.98           C  
ATOM   8667  C   PRO B 232      62.735 -13.660  39.176  1.00  0.98           C  
ATOM   8668  O   PRO B 232      62.502 -14.666  38.519  1.00  0.98           O  
ATOM   8669  CB  PRO B 232      60.497 -12.842  39.895  1.00  0.98           C  
ATOM   8670  CG  PRO B 232      59.626 -13.494  38.814  1.00  0.98           C  
ATOM   8671  CD  PRO B 232      59.977 -12.703  37.551  1.00  0.98           C  
ATOM   8672  N   GLY B 233      63.813 -13.573  39.981  1.00  0.98           N  
ATOM   8673  CA  GLY B 233      64.685 -14.714  40.233  1.00  0.98           C  
ATOM   8674  C   GLY B 233      64.240 -15.494  41.443  1.00  0.98           C  
ATOM   8675  O   GLY B 233      63.559 -14.979  42.325  1.00  0.98           O  
ATOM   8676  N   TYR B 234      64.662 -16.767  41.549  1.00  0.93           N  
ATOM   8677  CA  TYR B 234      64.229 -17.660  42.609  1.00  0.93           C  
ATOM   8678  C   TYR B 234      64.669 -17.284  44.028  1.00  0.93           C  
ATOM   8679  O   TYR B 234      65.822 -17.475  44.430  1.00  0.93           O  
ATOM   8680  CB  TYR B 234      64.630 -19.126  42.281  1.00  0.93           C  
ATOM   8681  CG  TYR B 234      63.957 -20.119  43.205  1.00  0.93           C  
ATOM   8682  CD1 TYR B 234      62.573 -20.326  43.118  1.00  0.93           C  
ATOM   8683  CD2 TYR B 234      64.681 -20.819  44.187  1.00  0.93           C  
ATOM   8684  CE1 TYR B 234      61.919 -21.198  43.996  1.00  0.93           C  
ATOM   8685  CE2 TYR B 234      64.031 -21.701  45.067  1.00  0.93           C  
ATOM   8686  CZ  TYR B 234      62.646 -21.884  44.972  1.00  0.93           C  
ATOM   8687  OH  TYR B 234      61.957 -22.750  45.843  1.00  0.93           O  
ATOM   8688  N   ARG B 235      63.707 -16.769  44.829  1.00  0.85           N  
ATOM   8689  CA  ARG B 235      63.786 -16.529  46.264  1.00  0.85           C  
ATOM   8690  C   ARG B 235      64.906 -15.591  46.690  1.00  0.85           C  
ATOM   8691  O   ARG B 235      65.443 -15.688  47.793  1.00  0.85           O  
ATOM   8692  CB  ARG B 235      63.832 -17.851  47.076  1.00  0.85           C  
ATOM   8693  CG  ARG B 235      62.691 -18.840  46.751  1.00  0.85           C  
ATOM   8694  CD  ARG B 235      61.295 -18.375  47.180  1.00  0.85           C  
ATOM   8695  NE  ARG B 235      60.274 -19.347  46.670  1.00  0.85           N  
ATOM   8696  CZ  ARG B 235      59.944 -20.520  47.227  1.00  0.85           C  
ATOM   8697  NH1 ARG B 235      60.525 -20.964  48.334  1.00  0.85           N  
ATOM   8698  NH2 ARG B 235      59.012 -21.274  46.645  1.00  0.85           N  
ATOM   8699  N   ASN B 236      65.270 -14.643  45.804  1.00  0.87           N  
ATOM   8700  CA  ASN B 236      66.388 -13.747  46.041  1.00  0.87           C  
ATOM   8701  C   ASN B 236      66.062 -12.284  46.025  1.00  0.87           C  
ATOM   8702  O   ASN B 236      66.926 -11.441  46.243  1.00  0.87           O  
ATOM   8703  CB  ASN B 236      67.588 -14.066  45.107  1.00  0.87           C  
ATOM   8704  CG  ASN B 236      67.313 -14.052  43.603  1.00  0.87           C  
ATOM   8705  OD1 ASN B 236      68.142 -14.546  42.847  1.00  0.87           O  
ATOM   8706  ND2 ASN B 236      66.165 -13.524  43.132  1.00  0.87           N  
ATOM   8707  N   ASN B 237      64.789 -11.958  45.760  1.00  0.85           N  
ATOM   8708  CA  ASN B 237      64.281 -10.602  45.726  1.00  0.85           C  
ATOM   8709  C   ASN B 237      64.855  -9.746  44.594  1.00  0.85           C  
ATOM   8710  O   ASN B 237      64.513  -8.586  44.458  1.00  0.85           O  
ATOM   8711  CB  ASN B 237      64.397  -9.913  47.111  1.00  0.85           C  
ATOM   8712  CG  ASN B 237      63.624 -10.722  48.145  1.00  0.85           C  
ATOM   8713  OD1 ASN B 237      62.528 -11.228  47.881  1.00  0.85           O  
ATOM   8714  ND2 ASN B 237      64.201 -10.868  49.353  1.00  0.85           N  
ATOM   8715  N   VAL B 238      65.684 -10.359  43.720  1.00  0.92           N  
ATOM   8716  CA  VAL B 238      66.174  -9.815  42.475  1.00  0.92           C  
ATOM   8717  C   VAL B 238      65.110  -9.932  41.410  1.00  0.92           C  
ATOM   8718  O   VAL B 238      64.690 -11.019  41.037  1.00  0.92           O  
ATOM   8719  CB  VAL B 238      67.404 -10.568  41.965  1.00  0.92           C  
ATOM   8720  CG1 VAL B 238      67.882  -9.971  40.627  1.00  0.92           C  
ATOM   8721  CG2 VAL B 238      68.531 -10.501  43.011  1.00  0.92           C  
ATOM   8722  N   VAL B 239      64.652  -8.785  40.883  1.00  0.95           N  
ATOM   8723  CA  VAL B 239      63.720  -8.764  39.777  1.00  0.95           C  
ATOM   8724  C   VAL B 239      64.283  -7.911  38.647  1.00  0.95           C  
ATOM   8725  O   VAL B 239      64.512  -6.711  38.768  1.00  0.95           O  
ATOM   8726  CB  VAL B 239      62.359  -8.281  40.225  1.00  0.95           C  
ATOM   8727  CG1 VAL B 239      61.346  -8.313  39.073  1.00  0.95           C  
ATOM   8728  CG2 VAL B 239      61.874  -9.175  41.386  1.00  0.95           C  
ATOM   8729  N   ASN B 240      64.551  -8.547  37.488  1.00  0.96           N  
ATOM   8730  CA  ASN B 240      65.151  -7.927  36.319  1.00  0.96           C  
ATOM   8731  C   ASN B 240      64.079  -7.367  35.390  1.00  0.96           C  
ATOM   8732  O   ASN B 240      62.890  -7.434  35.672  1.00  0.96           O  
ATOM   8733  CB  ASN B 240      66.056  -8.909  35.532  1.00  0.96           C  
ATOM   8734  CG  ASN B 240      67.321  -9.366  36.264  1.00  0.96           C  
ATOM   8735  OD1 ASN B 240      67.945 -10.331  35.839  1.00  0.96           O  
ATOM   8736  ND2 ASN B 240      67.738  -8.679  37.354  1.00  0.96           N  
ATOM   8737  N   THR B 241      64.495  -6.777  34.248  1.00  0.97           N  
ATOM   8738  CA  THR B 241      63.577  -6.117  33.321  1.00  0.97           C  
ATOM   8739  C   THR B 241      63.600  -6.782  31.964  1.00  0.97           C  
ATOM   8740  O   THR B 241      64.635  -6.897  31.323  1.00  0.97           O  
ATOM   8741  CB  THR B 241      63.951  -4.665  33.057  1.00  0.97           C  
ATOM   8742  OG1 THR B 241      64.068  -3.976  34.289  1.00  0.97           O  
ATOM   8743  CG2 THR B 241      62.868  -3.936  32.247  1.00  0.97           C  
ATOM   8744  N   MET B 242      62.422  -7.201  31.457  1.00  0.95           N  
ATOM   8745  CA  MET B 242      62.270  -7.522  30.053  1.00  0.95           C  
ATOM   8746  C   MET B 242      61.701  -6.274  29.403  1.00  0.95           C  
ATOM   8747  O   MET B 242      60.690  -5.739  29.843  1.00  0.95           O  
ATOM   8748  CB  MET B 242      61.362  -8.757  29.814  1.00  0.95           C  
ATOM   8749  CG  MET B 242      61.179  -9.106  28.322  1.00  0.95           C  
ATOM   8750  SD  MET B 242      60.269 -10.646  28.000  1.00  0.95           S  
ATOM   8751  CE  MET B 242      58.637 -10.034  28.502  1.00  0.95           C  
ATOM   8752  N   ARG B 243      62.384  -5.748  28.373  1.00  0.92           N  
ATOM   8753  CA  ARG B 243      62.051  -4.507  27.715  1.00  0.92           C  
ATOM   8754  C   ARG B 243      61.645  -4.820  26.291  1.00  0.92           C  
ATOM   8755  O   ARG B 243      62.446  -5.276  25.482  1.00  0.92           O  
ATOM   8756  CB  ARG B 243      63.301  -3.592  27.664  1.00  0.92           C  
ATOM   8757  CG  ARG B 243      63.054  -2.134  27.223  1.00  0.92           C  
ATOM   8758  CD  ARG B 243      62.643  -1.224  28.382  1.00  0.92           C  
ATOM   8759  NE  ARG B 243      63.362   0.099  28.280  1.00  0.92           N  
ATOM   8760  CZ  ARG B 243      63.036   1.158  29.025  1.00  0.92           C  
ATOM   8761  NH1 ARG B 243      62.044   1.136  29.901  1.00  0.92           N  
ATOM   8762  NH2 ARG B 243      63.732   2.287  28.932  1.00  0.92           N  
ATOM   8763  N   LEU B 244      60.373  -4.588  25.933  1.00  0.97           N  
ATOM   8764  CA  LEU B 244      59.911  -4.930  24.603  1.00  0.97           C  
ATOM   8765  C   LEU B 244      59.383  -3.702  23.887  1.00  0.97           C  
ATOM   8766  O   LEU B 244      58.517  -2.988  24.380  1.00  0.97           O  
ATOM   8767  CB  LEU B 244      58.824  -6.021  24.638  1.00  0.97           C  
ATOM   8768  CG  LEU B 244      59.201  -7.343  25.332  1.00  0.97           C  
ATOM   8769  CD1 LEU B 244      58.028  -8.319  25.187  1.00  0.97           C  
ATOM   8770  CD2 LEU B 244      60.467  -7.998  24.758  1.00  0.97           C  
ATOM   8771  N   TRP B 245      59.917  -3.419  22.680  1.00  0.94           N  
ATOM   8772  CA  TRP B 245      59.592  -2.213  21.942  1.00  0.94           C  
ATOM   8773  C   TRP B 245      58.341  -2.334  21.079  1.00  0.94           C  
ATOM   8774  O   TRP B 245      58.070  -3.356  20.453  1.00  0.94           O  
ATOM   8775  CB  TRP B 245      60.766  -1.767  21.032  1.00  0.94           C  
ATOM   8776  CG  TRP B 245      62.075  -1.569  21.736  1.00  0.94           C  
ATOM   8777  CD1 TRP B 245      63.147  -2.411  21.814  1.00  0.94           C  
ATOM   8778  CD2 TRP B 245      62.503  -0.395  22.490  1.00  0.94           C  
ATOM   8779  NE1 TRP B 245      64.209  -1.880  22.549  1.00  0.94           N  
ATOM   8780  CE2 TRP B 245      63.732  -0.618  22.966  1.00  0.94           C  
ATOM   8781  CE3 TRP B 245      61.813   0.824  22.696  1.00  0.94           C  
ATOM   8782  CZ2 TRP B 245      64.440   0.318  23.754  1.00  0.94           C  
ATOM   8783  CZ3 TRP B 245      62.514   1.801  23.433  1.00  0.94           C  
ATOM   8784  CH2 TRP B 245      63.771   1.549  23.970  1.00  0.94           C  
ATOM   8785  N   SER B 246      57.548  -1.250  21.026  1.00  0.94           N  
ATOM   8786  CA  SER B 246      56.300  -1.165  20.282  1.00  0.94           C  
ATOM   8787  C   SER B 246      56.376   0.025  19.356  1.00  0.94           C  
ATOM   8788  O   SER B 246      56.654   1.144  19.787  1.00  0.94           O  
ATOM   8789  CB  SER B 246      55.113  -1.001  21.268  1.00  0.94           C  
ATOM   8790  OG  SER B 246      53.822  -1.093  20.659  1.00  0.94           O  
ATOM   8791  N   ALA B 247      56.202  -0.192  18.040  1.00  0.91           N  
ATOM   8792  CA  ALA B 247      56.252   0.846  17.037  1.00  0.91           C  
ATOM   8793  C   ALA B 247      55.101   1.837  17.149  1.00  0.91           C  
ATOM   8794  O   ALA B 247      53.963   1.455  17.401  1.00  0.91           O  
ATOM   8795  CB  ALA B 247      56.366   0.230  15.629  1.00  0.91           C  
ATOM   8796  N   LYS B 248      55.408   3.142  16.984  1.00  0.82           N  
ATOM   8797  CA  LYS B 248      54.439   4.222  17.023  1.00  0.82           C  
ATOM   8798  C   LYS B 248      54.715   5.225  15.925  1.00  0.82           C  
ATOM   8799  O   LYS B 248      55.859   5.479  15.541  1.00  0.82           O  
ATOM   8800  CB  LYS B 248      54.421   5.003  18.370  1.00  0.82           C  
ATOM   8801  CG  LYS B 248      54.228   4.121  19.614  1.00  0.82           C  
ATOM   8802  CD  LYS B 248      52.857   3.428  19.620  1.00  0.82           C  
ATOM   8803  CE  LYS B 248      52.758   2.247  20.577  1.00  0.82           C  
ATOM   8804  NZ  LYS B 248      51.526   1.490  20.276  1.00  0.82           N  
ATOM   8805  N   ALA B 249      53.647   5.830  15.373  1.00  0.80           N  
ATOM   8806  CA  ALA B 249      53.771   6.931  14.442  1.00  0.80           C  
ATOM   8807  C   ALA B 249      54.398   8.205  15.044  1.00  0.80           C  
ATOM   8808  O   ALA B 249      54.019   8.593  16.151  1.00  0.80           O  
ATOM   8809  CB  ALA B 249      52.396   7.283  13.868  1.00  0.80           C  
ATOM   8810  N   PRO B 250      55.332   8.905  14.393  1.00  0.79           N  
ATOM   8811  CA  PRO B 250      55.900  10.150  14.905  1.00  0.79           C  
ATOM   8812  C   PRO B 250      54.914  11.288  15.029  1.00  0.79           C  
ATOM   8813  O   PRO B 250      53.931  11.330  14.295  1.00  0.79           O  
ATOM   8814  CB  PRO B 250      57.005  10.519  13.903  1.00  0.79           C  
ATOM   8815  CG  PRO B 250      57.365   9.193  13.249  1.00  0.79           C  
ATOM   8816  CD  PRO B 250      56.044   8.434  13.211  1.00  0.79           C  
ATOM   8817  N   ASN B 251      55.200  12.252  15.932  1.00  0.66           N  
ATOM   8818  CA  ASN B 251      54.392  13.438  16.150  1.00  0.66           C  
ATOM   8819  C   ASN B 251      54.280  14.301  14.891  1.00  0.66           C  
ATOM   8820  O   ASN B 251      53.221  14.798  14.549  1.00  0.66           O  
ATOM   8821  CB  ASN B 251      54.935  14.287  17.334  1.00  0.66           C  
ATOM   8822  CG  ASN B 251      54.825  13.518  18.650  1.00  0.66           C  
ATOM   8823  OD1 ASN B 251      54.019  12.613  18.831  1.00  0.66           O  
ATOM   8824  ND2 ASN B 251      55.669  13.885  19.645  1.00  0.66           N  
ATOM   8825  N   ASP B 252      55.384  14.461  14.123  1.00  0.70           N  
ATOM   8826  CA  ASP B 252      55.369  15.253  12.905  1.00  0.70           C  
ATOM   8827  C   ASP B 252      54.641  14.593  11.739  1.00  0.70           C  
ATOM   8828  O   ASP B 252      54.145  15.263  10.840  1.00  0.70           O  
ATOM   8829  CB  ASP B 252      56.806  15.543  12.435  1.00  0.70           C  
ATOM   8830  CG  ASP B 252      57.427  16.550  13.358  1.00  0.70           C  
ATOM   8831  OD1 ASP B 252      56.954  17.717  13.303  1.00  0.70           O  
ATOM   8832  OD2 ASP B 252      58.373  16.176  14.097  1.00  0.70           O  
ATOM   8833  N   PHE B 253      54.506  13.253  11.779  1.00  0.63           N  
ATOM   8834  CA  PHE B 253      53.739  12.462  10.839  1.00  0.63           C  
ATOM   8835  C   PHE B 253      52.350  12.195  11.415  1.00  0.63           C  
ATOM   8836  O   PHE B 253      51.709  11.178  11.215  1.00  0.63           O  
ATOM   8837  CB  PHE B 253      54.421  11.106  10.521  1.00  0.63           C  
ATOM   8838  CG  PHE B 253      55.728  11.205   9.763  1.00  0.63           C  
ATOM   8839  CD1 PHE B 253      56.074  12.280   8.923  1.00  0.63           C  
ATOM   8840  CD2 PHE B 253      56.599  10.106   9.815  1.00  0.63           C  
ATOM   8841  CE1 PHE B 253      57.273  12.269   8.193  1.00  0.63           C  
ATOM   8842  CE2 PHE B 253      57.792  10.082   9.086  1.00  0.63           C  
ATOM   8843  CZ  PHE B 253      58.134  11.169   8.277  1.00  0.63           C  
ATOM   8844  N   ASN B 254      51.821  13.143  12.212  1.00  0.61           N  
ATOM   8845  CA  ASN B 254      50.436  13.120  12.605  1.00  0.61           C  
ATOM   8846  C   ASN B 254      49.506  13.354  11.432  1.00  0.61           C  
ATOM   8847  O   ASN B 254      48.483  12.683  11.328  1.00  0.61           O  
ATOM   8848  CB  ASN B 254      50.170  14.185  13.693  1.00  0.61           C  
ATOM   8849  CG  ASN B 254      50.601  13.692  15.073  1.00  0.61           C  
ATOM   8850  OD1 ASN B 254      51.241  12.676  15.250  1.00  0.61           O  
ATOM   8851  ND2 ASN B 254      50.125  14.392  16.133  1.00  0.61           N  
ATOM   8852  N   LEU B 255      49.839  14.299  10.538  1.00  0.63           N  
ATOM   8853  CA  LEU B 255      48.923  14.748   9.513  1.00  0.63           C  
ATOM   8854  C   LEU B 255      49.619  15.423   8.328  1.00  0.63           C  
ATOM   8855  O   LEU B 255      48.993  15.821   7.374  1.00  0.63           O  
ATOM   8856  CB  LEU B 255      47.946  15.819  10.069  1.00  0.63           C  
ATOM   8857  CG  LEU B 255      46.823  15.409  11.035  1.00  0.63           C  
ATOM   8858  CD1 LEU B 255      45.861  16.554  11.314  1.00  0.63           C  
ATOM   8859  CD2 LEU B 255      45.941  14.266  10.579  1.00  0.63           C  
ATOM   8860  N   LYS B 256      50.961  15.548   8.298  1.00  0.61           N  
ATOM   8861  CA  LYS B 256      51.593  16.310   7.227  1.00  0.61           C  
ATOM   8862  C   LYS B 256      51.799  15.474   5.988  1.00  0.61           C  
ATOM   8863  O   LYS B 256      52.193  15.983   4.941  1.00  0.61           O  
ATOM   8864  CB  LYS B 256      52.951  16.880   7.692  1.00  0.61           C  
ATOM   8865  CG  LYS B 256      52.792  18.005   8.729  1.00  0.61           C  
ATOM   8866  CD  LYS B 256      54.145  18.426   9.323  1.00  0.61           C  
ATOM   8867  CE  LYS B 256      54.056  19.486  10.425  1.00  0.61           C  
ATOM   8868  NZ  LYS B 256      55.389  19.648  11.054  1.00  0.61           N  
ATOM   8869  N   ASP B 257      51.446  14.185   6.076  1.00  0.55           N  
ATOM   8870  CA  ASP B 257      51.579  13.236   5.015  1.00  0.55           C  
ATOM   8871  C   ASP B 257      50.334  13.224   4.115  1.00  0.55           C  
ATOM   8872  O   ASP B 257      50.252  12.443   3.178  1.00  0.55           O  
ATOM   8873  CB  ASP B 257      51.798  11.844   5.668  1.00  0.55           C  
ATOM   8874  CG  ASP B 257      52.981  11.855   6.630  1.00  0.55           C  
ATOM   8875  OD1 ASP B 257      53.984  12.566   6.374  1.00  0.55           O  
ATOM   8876  OD2 ASP B 257      52.848  11.187   7.686  1.00  0.55           O  
ATOM   8877  N   PHE B 258      49.330  14.119   4.354  1.00  0.59           N  
ATOM   8878  CA  PHE B 258      48.106  14.159   3.575  1.00  0.59           C  
ATOM   8879  C   PHE B 258      47.860  15.433   2.794  1.00  0.59           C  
ATOM   8880  O   PHE B 258      48.279  16.522   3.159  1.00  0.59           O  
ATOM   8881  CB  PHE B 258      46.882  13.828   4.459  1.00  0.59           C  
ATOM   8882  CG  PHE B 258      46.276  14.915   5.340  1.00  0.59           C  
ATOM   8883  CD1 PHE B 258      45.436  15.851   4.740  1.00  0.59           C  
ATOM   8884  CD2 PHE B 258      46.393  14.992   6.739  1.00  0.59           C  
ATOM   8885  CE1 PHE B 258      44.868  16.909   5.429  1.00  0.59           C  
ATOM   8886  CE2 PHE B 258      45.761  16.028   7.439  1.00  0.59           C  
ATOM   8887  CZ  PHE B 258      45.075  17.029   6.780  1.00  0.59           C  
ATOM   8888  N   ASN B 259      47.073  15.326   1.699  1.00  0.41           N  
ATOM   8889  CA  ASN B 259      46.630  16.475   0.914  1.00  0.41           C  
ATOM   8890  C   ASN B 259      45.368  17.052   1.545  1.00  0.41           C  
ATOM   8891  O   ASN B 259      44.450  16.253   1.674  1.00  0.41           O  
ATOM   8892  CB  ASN B 259      46.090  16.022  -0.485  1.00  0.41           C  
ATOM   8893  CG  ASN B 259      47.140  15.491  -1.448  1.00  0.41           C  
ATOM   8894  OD1 ASN B 259      48.331  15.759  -1.355  1.00  0.41           O  
ATOM   8895  ND2 ASN B 259      46.659  14.729  -2.464  1.00  0.41           N  
ATOM   8896  N   VAL B 260      45.216  18.366   1.900  1.00  0.39           N  
ATOM   8897  CA  VAL B 260      44.078  19.016   2.590  1.00  0.39           C  
ATOM   8898  C   VAL B 260      42.689  18.337   2.583  1.00  0.39           C  
ATOM   8899  O   VAL B 260      42.077  18.168   3.638  1.00  0.39           O  
ATOM   8900  CB  VAL B 260      43.955  20.495   2.206  1.00  0.39           C  
ATOM   8901  CG1 VAL B 260      42.810  21.206   2.962  1.00  0.39           C  
ATOM   8902  CG2 VAL B 260      45.259  21.246   2.556  1.00  0.39           C  
ATOM   8903  N   GLY B 261      42.145  17.877   1.426  1.00  0.38           N  
ATOM   8904  CA  GLY B 261      40.854  17.186   1.393  1.00  0.38           C  
ATOM   8905  C   GLY B 261      40.865  15.755   1.897  1.00  0.38           C  
ATOM   8906  O   GLY B 261      39.852  15.101   1.979  1.00  0.38           O  
ATOM   8907  N   GLY B 262      42.058  15.234   2.241  1.00  0.54           N  
ATOM   8908  CA  GLY B 262      42.277  13.881   2.696  1.00  0.54           C  
ATOM   8909  C   GLY B 262      42.596  13.727   4.153  1.00  0.54           C  
ATOM   8910  O   GLY B 262      43.216  12.744   4.524  1.00  0.54           O  
ATOM   8911  N   TYR B 263      42.188  14.692   5.014  1.00  0.44           N  
ATOM   8912  CA  TYR B 263      42.509  14.738   6.440  1.00  0.44           C  
ATOM   8913  C   TYR B 263      42.308  13.420   7.170  1.00  0.44           C  
ATOM   8914  O   TYR B 263      43.183  12.951   7.892  1.00  0.44           O  
ATOM   8915  CB  TYR B 263      41.701  15.897   7.117  1.00  0.44           C  
ATOM   8916  CG  TYR B 263      41.631  15.803   8.625  1.00  0.44           C  
ATOM   8917  CD1 TYR B 263      42.676  16.202   9.463  1.00  0.44           C  
ATOM   8918  CD2 TYR B 263      40.502  15.212   9.205  1.00  0.44           C  
ATOM   8919  CE1 TYR B 263      42.541  16.089  10.858  1.00  0.44           C  
ATOM   8920  CE2 TYR B 263      40.409  15.021  10.584  1.00  0.44           C  
ATOM   8921  CZ  TYR B 263      41.415  15.488  11.415  1.00  0.44           C  
ATOM   8922  OH  TYR B 263      41.265  15.314  12.804  1.00  0.44           O  
ATOM   8923  N   ILE B 264      41.143  12.786   6.957  1.00  0.58           N  
ATOM   8924  CA  ILE B 264      40.784  11.524   7.577  1.00  0.58           C  
ATOM   8925  C   ILE B 264      41.736  10.400   7.216  1.00  0.58           C  
ATOM   8926  O   ILE B 264      42.166   9.659   8.091  1.00  0.58           O  
ATOM   8927  CB  ILE B 264      39.343  11.154   7.230  1.00  0.58           C  
ATOM   8928  CG1 ILE B 264      38.355  12.251   7.706  1.00  0.58           C  
ATOM   8929  CG2 ILE B 264      38.948   9.779   7.815  1.00  0.58           C  
ATOM   8930  CD1 ILE B 264      38.288  12.430   9.229  1.00  0.58           C  
ATOM   8931  N   GLN B 265      42.145  10.276   5.934  1.00  0.56           N  
ATOM   8932  CA  GLN B 265      42.975   9.185   5.448  1.00  0.56           C  
ATOM   8933  C   GLN B 265      44.316   9.147   6.139  1.00  0.56           C  
ATOM   8934  O   GLN B 265      44.781   8.110   6.580  1.00  0.56           O  
ATOM   8935  CB  GLN B 265      43.127   9.265   3.907  1.00  0.56           C  
ATOM   8936  CG  GLN B 265      43.830   8.051   3.248  1.00  0.56           C  
ATOM   8937  CD  GLN B 265      43.131   6.729   3.578  1.00  0.56           C  
ATOM   8938  OE1 GLN B 265      41.942   6.552   3.320  1.00  0.56           O  
ATOM   8939  NE2 GLN B 265      43.878   5.777   4.183  1.00  0.56           N  
ATOM   8940  N   ALA B 266      44.910  10.324   6.375  1.00  0.61           N  
ATOM   8941  CA  ALA B 266      46.141  10.422   7.093  1.00  0.61           C  
ATOM   8942  C   ALA B 266      46.120   9.884   8.511  1.00  0.61           C  
ATOM   8943  O   ALA B 266      47.066   9.290   8.991  1.00  0.61           O  
ATOM   8944  CB  ALA B 266      46.518  11.881   7.145  1.00  0.61           C  
ATOM   8945  N   VAL B 267      45.007  10.097   9.232  1.00  0.58           N  
ATOM   8946  CA  VAL B 267      44.817   9.624  10.582  1.00  0.58           C  
ATOM   8947  C   VAL B 267      44.704   8.102  10.647  1.00  0.58           C  
ATOM   8948  O   VAL B 267      45.202   7.456  11.554  1.00  0.58           O  
ATOM   8949  CB  VAL B 267      43.632  10.311  11.232  1.00  0.58           C  
ATOM   8950  CG1 VAL B 267      43.544   9.910  12.705  1.00  0.58           C  
ATOM   8951  CG2 VAL B 267      43.793  11.836  11.138  1.00  0.58           C  
ATOM   8952  N   LEU B 268      44.055   7.500   9.621  1.00  0.57           N  
ATOM   8953  CA  LEU B 268      44.055   6.074   9.373  1.00  0.57           C  
ATOM   8954  C   LEU B 268      45.449   5.540   8.995  1.00  0.57           C  
ATOM   8955  O   LEU B 268      45.905   4.531   9.535  1.00  0.57           O  
ATOM   8956  CB  LEU B 268      43.002   5.746   8.278  1.00  0.57           C  
ATOM   8957  CG  LEU B 268      41.600   6.391   8.460  1.00  0.57           C  
ATOM   8958  CD1 LEU B 268      40.602   5.863   7.415  1.00  0.57           C  
ATOM   8959  CD2 LEU B 268      41.008   6.253   9.873  1.00  0.57           C  
ATOM   8960  N   ASP B 269      46.176   6.253   8.106  1.00  0.60           N  
ATOM   8961  CA  ASP B 269      47.520   5.938   7.646  1.00  0.60           C  
ATOM   8962  C   ASP B 269      48.613   6.052   8.700  1.00  0.60           C  
ATOM   8963  O   ASP B 269      49.617   5.345   8.612  1.00  0.60           O  
ATOM   8964  CB  ASP B 269      47.940   6.806   6.435  1.00  0.60           C  
ATOM   8965  CG  ASP B 269      47.095   6.519   5.206  1.00  0.60           C  
ATOM   8966  OD1 ASP B 269      46.460   5.435   5.137  1.00  0.60           O  
ATOM   8967  OD2 ASP B 269      47.077   7.388   4.299  1.00  0.60           O  
ATOM   8968  N   ARG B 270      48.456   6.879   9.764  1.00  0.58           N  
ATOM   8969  CA  ARG B 270      49.380   6.928  10.896  1.00  0.58           C  
ATOM   8970  C   ARG B 270      49.722   5.547  11.448  1.00  0.58           C  
ATOM   8971  O   ARG B 270      50.878   5.195  11.649  1.00  0.58           O  
ATOM   8972  CB  ARG B 270      48.769   7.686  12.107  1.00  0.58           C  
ATOM   8973  CG  ARG B 270      48.827   9.222  12.061  1.00  0.58           C  
ATOM   8974  CD  ARG B 270      48.187   9.906  13.285  1.00  0.58           C  
ATOM   8975  NE  ARG B 270      48.722   9.359  14.575  1.00  0.58           N  
ATOM   8976  CZ  ARG B 270      49.931   9.613  15.111  1.00  0.58           C  
ATOM   8977  NH1 ARG B 270      50.916  10.128  14.406  1.00  0.58           N  
ATOM   8978  NH2 ARG B 270      50.132   9.317  16.398  1.00  0.58           N  
ATOM   8979  N   ASN B 271      48.679   4.706  11.629  1.00  0.70           N  
ATOM   8980  CA  ASN B 271      48.777   3.348  12.112  1.00  0.70           C  
ATOM   8981  C   ASN B 271      49.694   2.485  11.242  1.00  0.70           C  
ATOM   8982  O   ASN B 271      50.284   1.532  11.728  1.00  0.70           O  
ATOM   8983  CB  ASN B 271      47.356   2.721  12.256  1.00  0.70           C  
ATOM   8984  CG  ASN B 271      47.424   1.204  12.413  1.00  0.70           C  
ATOM   8985  OD1 ASN B 271      47.528   0.653  13.502  1.00  0.70           O  
ATOM   8986  ND2 ASN B 271      47.482   0.499  11.247  1.00  0.70           N  
ATOM   8987  N   LEU B 272      49.816   2.751   9.925  1.00  0.70           N  
ATOM   8988  CA  LEU B 272      50.602   1.912   9.036  1.00  0.70           C  
ATOM   8989  C   LEU B 272      52.079   1.863   9.418  1.00  0.70           C  
ATOM   8990  O   LEU B 272      52.758   0.855   9.211  1.00  0.70           O  
ATOM   8991  CB  LEU B 272      50.451   2.359   7.566  1.00  0.70           C  
ATOM   8992  CG  LEU B 272      49.045   2.169   6.955  1.00  0.70           C  
ATOM   8993  CD1 LEU B 272      48.966   2.885   5.598  1.00  0.70           C  
ATOM   8994  CD2 LEU B 272      48.694   0.684   6.770  1.00  0.70           C  
ATOM   8995  N   ALA B 273      52.590   2.932  10.064  1.00  0.75           N  
ATOM   8996  CA  ALA B 273      53.918   2.996  10.628  1.00  0.75           C  
ATOM   8997  C   ALA B 273      54.130   2.023  11.791  1.00  0.75           C  
ATOM   8998  O   ALA B 273      55.249   1.604  12.074  1.00  0.75           O  
ATOM   8999  CB  ALA B 273      54.162   4.442  11.099  1.00  0.75           C  
ATOM   9000  N   GLU B 274      53.039   1.583  12.453  1.00  0.82           N  
ATOM   9001  CA  GLU B 274      53.088   0.699  13.598  1.00  0.82           C  
ATOM   9002  C   GLU B 274      53.043  -0.769  13.202  1.00  0.82           C  
ATOM   9003  O   GLU B 274      53.144  -1.674  14.029  1.00  0.82           O  
ATOM   9004  CB  GLU B 274      51.901   0.964  14.547  1.00  0.82           C  
ATOM   9005  CG  GLU B 274      51.682   2.463  14.848  1.00  0.82           C  
ATOM   9006  CD  GLU B 274      50.818   2.678  16.086  1.00  0.82           C  
ATOM   9007  OE1 GLU B 274      49.874   1.881  16.314  1.00  0.82           O  
ATOM   9008  OE2 GLU B 274      51.122   3.646  16.833  1.00  0.82           O  
ATOM   9009  N   ASN B 275      52.979  -1.066  11.886  1.00  0.82           N  
ATOM   9010  CA  ASN B 275      52.938  -2.426  11.379  1.00  0.82           C  
ATOM   9011  C   ASN B 275      54.239  -3.190  11.579  1.00  0.82           C  
ATOM   9012  O   ASN B 275      54.274  -4.415  11.489  1.00  0.82           O  
ATOM   9013  CB  ASN B 275      52.512  -2.454   9.893  1.00  0.82           C  
ATOM   9014  CG  ASN B 275      51.010  -2.207   9.764  1.00  0.82           C  
ATOM   9015  OD1 ASN B 275      50.221  -2.377  10.689  1.00  0.82           O  
ATOM   9016  ND2 ASN B 275      50.590  -1.831   8.530  1.00  0.82           N  
ATOM   9017  N   ILE B 276      55.329  -2.481  11.924  1.00  0.89           N  
ATOM   9018  CA  ILE B 276      56.614  -3.054  12.289  1.00  0.89           C  
ATOM   9019  C   ILE B 276      56.529  -3.982  13.497  1.00  0.89           C  
ATOM   9020  O   ILE B 276      57.062  -5.087  13.469  1.00  0.89           O  
ATOM   9021  CB  ILE B 276      57.651  -1.949  12.471  1.00  0.89           C  
ATOM   9022  CG1 ILE B 276      57.893  -1.254  11.104  1.00  0.89           C  
ATOM   9023  CG2 ILE B 276      58.972  -2.519  13.041  1.00  0.89           C  
ATOM   9024  CD1 ILE B 276      58.764   0.004  11.192  1.00  0.89           C  
ATOM   9025  N   SER B 277      55.803  -3.608  14.573  1.00  0.91           N  
ATOM   9026  CA  SER B 277      55.652  -4.456  15.746  1.00  0.91           C  
ATOM   9027  C   SER B 277      54.317  -5.167  15.803  1.00  0.91           C  
ATOM   9028  O   SER B 277      53.906  -5.635  16.859  1.00  0.91           O  
ATOM   9029  CB  SER B 277      55.872  -3.700  17.091  1.00  0.91           C  
ATOM   9030  OG  SER B 277      54.943  -2.652  17.332  1.00  0.91           O  
ATOM   9031  N   ARG B 278      53.576  -5.283  14.687  1.00  0.83           N  
ATOM   9032  CA  ARG B 278      52.323  -6.013  14.675  1.00  0.83           C  
ATOM   9033  C   ARG B 278      52.432  -7.520  14.872  1.00  0.83           C  
ATOM   9034  O   ARG B 278      51.694  -8.086  15.648  1.00  0.83           O  
ATOM   9035  CB  ARG B 278      51.568  -5.782  13.354  1.00  0.83           C  
ATOM   9036  CG  ARG B 278      50.745  -4.489  13.328  1.00  0.83           C  
ATOM   9037  CD  ARG B 278      49.360  -4.657  13.945  1.00  0.83           C  
ATOM   9038  NE  ARG B 278      49.033  -3.476  14.783  1.00  0.83           N  
ATOM   9039  CZ  ARG B 278      48.886  -2.198  14.431  1.00  0.83           C  
ATOM   9040  NH1 ARG B 278      49.073  -1.720  13.209  1.00  0.83           N  
ATOM   9041  NH2 ARG B 278      48.534  -1.347  15.391  1.00  0.83           N  
ATOM   9042  N   VAL B 279      53.357  -8.218  14.170  1.00  0.88           N  
ATOM   9043  CA  VAL B 279      53.307  -9.676  14.176  1.00  0.88           C  
ATOM   9044  C   VAL B 279      54.667 -10.338  14.085  1.00  0.88           C  
ATOM   9045  O   VAL B 279      55.546  -9.945  13.336  1.00  0.88           O  
ATOM   9046  CB  VAL B 279      52.375 -10.201  13.091  1.00  0.88           C  
ATOM   9047  CG1 VAL B 279      52.822  -9.758  11.685  1.00  0.88           C  
ATOM   9048  CG2 VAL B 279      52.203 -11.733  13.179  1.00  0.88           C  
ATOM   9049  N   LEU B 280      54.860 -11.399  14.908  1.00  0.91           N  
ATOM   9050  CA  LEU B 280      56.012 -12.271  14.836  1.00  0.91           C  
ATOM   9051  C   LEU B 280      56.057 -13.036  13.529  1.00  0.91           C  
ATOM   9052  O   LEU B 280      55.087 -13.662  13.104  1.00  0.91           O  
ATOM   9053  CB  LEU B 280      55.974 -13.263  16.022  1.00  0.91           C  
ATOM   9054  CG  LEU B 280      57.027 -14.392  16.023  1.00  0.91           C  
ATOM   9055  CD1 LEU B 280      58.469 -13.870  16.114  1.00  0.91           C  
ATOM   9056  CD2 LEU B 280      56.745 -15.338  17.194  1.00  0.91           C  
ATOM   9057  N   TYR B 281      57.216 -13.018  12.840  1.00  0.88           N  
ATOM   9058  CA  TYR B 281      57.412 -13.863  11.686  1.00  0.88           C  
ATOM   9059  C   TYR B 281      57.441 -15.338  12.110  1.00  0.88           C  
ATOM   9060  O   TYR B 281      58.261 -15.685  12.959  1.00  0.88           O  
ATOM   9061  CB  TYR B 281      58.718 -13.509  10.927  1.00  0.88           C  
ATOM   9062  CG  TYR B 281      58.424 -12.514   9.838  1.00  0.88           C  
ATOM   9063  CD1 TYR B 281      58.267 -11.145  10.108  1.00  0.88           C  
ATOM   9064  CD2 TYR B 281      58.243 -12.965   8.523  1.00  0.88           C  
ATOM   9065  CE1 TYR B 281      57.933 -10.248   9.081  1.00  0.88           C  
ATOM   9066  CE2 TYR B 281      57.910 -12.077   7.494  1.00  0.88           C  
ATOM   9067  CZ  TYR B 281      57.750 -10.717   7.775  1.00  0.88           C  
ATOM   9068  OH  TYR B 281      57.399  -9.832   6.739  1.00  0.88           O  
ATOM   9069  N   PRO B 282      56.643 -16.251  11.563  1.00  0.90           N  
ATOM   9070  CA  PRO B 282      56.381 -17.546  12.194  1.00  0.90           C  
ATOM   9071  C   PRO B 282      57.340 -18.587  11.652  1.00  0.90           C  
ATOM   9072  O   PRO B 282      57.004 -19.769  11.561  1.00  0.90           O  
ATOM   9073  CB  PRO B 282      54.957 -17.867  11.714  1.00  0.90           C  
ATOM   9074  CG  PRO B 282      54.899 -17.214  10.334  1.00  0.90           C  
ATOM   9075  CD  PRO B 282      55.627 -15.910  10.574  1.00  0.90           C  
ATOM   9076  N   ASN B 283      58.577 -18.171  11.353  1.00  0.86           N  
ATOM   9077  CA  ASN B 283      59.593 -19.023  10.794  1.00  0.86           C  
ATOM   9078  C   ASN B 283      60.524 -19.552  11.873  1.00  0.86           C  
ATOM   9079  O   ASN B 283      61.137 -18.801  12.615  1.00  0.86           O  
ATOM   9080  CB  ASN B 283      60.417 -18.248   9.751  1.00  0.86           C  
ATOM   9081  CG  ASN B 283      59.492 -17.845   8.612  1.00  0.86           C  
ATOM   9082  OD1 ASN B 283      58.716 -18.651   8.090  1.00  0.86           O  
ATOM   9083  ND2 ASN B 283      59.596 -16.557   8.224  1.00  0.86           N  
ATOM   9084  N   ASP B 284      60.661 -20.892  11.950  1.00  0.85           N  
ATOM   9085  CA  ASP B 284      61.539 -21.574  12.875  1.00  0.85           C  
ATOM   9086  C   ASP B 284      62.598 -22.222  12.010  1.00  0.85           C  
ATOM   9087  O   ASP B 284      62.272 -22.943  11.069  1.00  0.85           O  
ATOM   9088  CB  ASP B 284      60.733 -22.633  13.677  1.00  0.85           C  
ATOM   9089  CG  ASP B 284      61.572 -23.399  14.682  1.00  0.85           C  
ATOM   9090  OD1 ASP B 284      61.568 -23.047  15.887  1.00  0.85           O  
ATOM   9091  OD2 ASP B 284      62.208 -24.393  14.246  1.00  0.85           O  
ATOM   9092  N   ASN B 285      63.892 -21.926  12.269  1.00  0.79           N  
ATOM   9093  CA  ASN B 285      65.015 -22.437  11.496  1.00  0.79           C  
ATOM   9094  C   ASN B 285      64.890 -22.197   9.990  1.00  0.79           C  
ATOM   9095  O   ASN B 285      65.223 -23.050   9.179  1.00  0.79           O  
ATOM   9096  CB  ASN B 285      65.242 -23.947  11.768  1.00  0.79           C  
ATOM   9097  CG  ASN B 285      65.790 -24.155  13.169  1.00  0.79           C  
ATOM   9098  OD1 ASN B 285      66.995 -24.094  13.393  1.00  0.79           O  
ATOM   9099  ND2 ASN B 285      64.908 -24.437  14.153  1.00  0.79           N  
ATOM   9100  N   PHE B 286      64.402 -21.007   9.591  1.00  0.83           N  
ATOM   9101  CA  PHE B 286      64.240 -20.683   8.194  1.00  0.83           C  
ATOM   9102  C   PHE B 286      64.403 -19.183   8.002  1.00  0.83           C  
ATOM   9103  O   PHE B 286      63.820 -18.384   8.734  1.00  0.83           O  
ATOM   9104  CB  PHE B 286      62.840 -21.150   7.710  1.00  0.83           C  
ATOM   9105  CG  PHE B 286      62.668 -20.964   6.230  1.00  0.83           C  
ATOM   9106  CD1 PHE B 286      63.363 -21.786   5.329  1.00  0.83           C  
ATOM   9107  CD2 PHE B 286      61.846 -19.941   5.729  1.00  0.83           C  
ATOM   9108  CE1 PHE B 286      63.251 -21.578   3.948  1.00  0.83           C  
ATOM   9109  CE2 PHE B 286      61.736 -19.729   4.350  1.00  0.83           C  
ATOM   9110  CZ  PHE B 286      62.446 -20.542   3.459  1.00  0.83           C  
ATOM   9111  N   PHE B 287      65.192 -18.767   6.994  1.00  0.85           N  
ATOM   9112  CA  PHE B 287      65.404 -17.377   6.651  1.00  0.85           C  
ATOM   9113  C   PHE B 287      64.426 -16.963   5.561  1.00  0.85           C  
ATOM   9114  O   PHE B 287      64.484 -17.427   4.426  1.00  0.85           O  
ATOM   9115  CB  PHE B 287      66.878 -17.156   6.189  1.00  0.85           C  
ATOM   9116  CG  PHE B 287      67.162 -15.758   5.686  1.00  0.85           C  
ATOM   9117  CD1 PHE B 287      66.911 -14.633   6.487  1.00  0.85           C  
ATOM   9118  CD2 PHE B 287      67.668 -15.561   4.389  1.00  0.85           C  
ATOM   9119  CE1 PHE B 287      67.157 -13.344   6.004  1.00  0.85           C  
ATOM   9120  CE2 PHE B 287      67.913 -14.270   3.901  1.00  0.85           C  
ATOM   9121  CZ  PHE B 287      67.651 -13.159   4.709  1.00  0.85           C  
ATOM   9122  N   GLU B 288      63.514 -16.025   5.880  1.00  0.78           N  
ATOM   9123  CA  GLU B 288      62.620 -15.460   4.892  1.00  0.78           C  
ATOM   9124  C   GLU B 288      63.014 -14.013   4.733  1.00  0.78           C  
ATOM   9125  O   GLU B 288      62.891 -13.194   5.638  1.00  0.78           O  
ATOM   9126  CB  GLU B 288      61.140 -15.555   5.326  1.00  0.78           C  
ATOM   9127  CG  GLU B 288      60.088 -15.091   4.283  1.00  0.78           C  
ATOM   9128  CD  GLU B 288      58.734 -14.788   4.924  1.00  0.78           C  
ATOM   9129  OE1 GLU B 288      58.539 -15.101   6.123  1.00  0.78           O  
ATOM   9130  OE2 GLU B 288      57.864 -14.186   4.231  1.00  0.78           O  
ATOM   9131  N   GLY B 289      63.532 -13.660   3.543  1.00  0.88           N  
ATOM   9132  CA  GLY B 289      64.174 -12.369   3.331  1.00  0.88           C  
ATOM   9133  C   GLY B 289      63.237 -11.239   3.008  1.00  0.88           C  
ATOM   9134  O   GLY B 289      63.363 -10.592   1.973  1.00  0.88           O  
ATOM   9135  N   LYS B 290      62.272 -10.945   3.893  1.00  0.85           N  
ATOM   9136  CA  LYS B 290      61.349  -9.839   3.711  1.00  0.85           C  
ATOM   9137  C   LYS B 290      61.834  -8.546   4.353  1.00  0.85           C  
ATOM   9138  O   LYS B 290      62.400  -8.537   5.442  1.00  0.85           O  
ATOM   9139  CB  LYS B 290      59.941 -10.159   4.278  1.00  0.85           C  
ATOM   9140  CG  LYS B 290      59.260 -11.397   3.676  1.00  0.85           C  
ATOM   9141  CD  LYS B 290      59.159 -11.386   2.144  1.00  0.85           C  
ATOM   9142  CE  LYS B 290      58.659 -12.692   1.511  1.00  0.85           C  
ATOM   9143  NZ  LYS B 290      57.339 -13.089   2.027  1.00  0.85           N  
ATOM   9144  N   GLU B 291      61.563  -7.388   3.704  1.00  0.86           N  
ATOM   9145  CA  GLU B 291      61.904  -6.069   4.221  1.00  0.86           C  
ATOM   9146  C   GLU B 291      61.290  -5.768   5.578  1.00  0.86           C  
ATOM   9147  O   GLU B 291      61.936  -5.196   6.450  1.00  0.86           O  
ATOM   9148  CB  GLU B 291      61.459  -4.949   3.249  1.00  0.86           C  
ATOM   9149  CG  GLU B 291      62.000  -3.549   3.635  1.00  0.86           C  
ATOM   9150  CD  GLU B 291      61.253  -2.406   2.952  1.00  0.86           C  
ATOM   9151  OE1 GLU B 291      60.056  -2.198   3.291  1.00  0.86           O  
ATOM   9152  OE2 GLU B 291      61.881  -1.681   2.150  1.00  0.86           O  
ATOM   9153  N   LEU B 292      60.026  -6.180   5.818  1.00  0.89           N  
ATOM   9154  CA  LEU B 292      59.357  -5.970   7.089  1.00  0.89           C  
ATOM   9155  C   LEU B 292      60.106  -6.627   8.245  1.00  0.89           C  
ATOM   9156  O   LEU B 292      60.342  -6.003   9.274  1.00  0.89           O  
ATOM   9157  CB  LEU B 292      57.894  -6.485   7.030  1.00  0.89           C  
ATOM   9158  CG  LEU B 292      56.821  -5.669   7.795  1.00  0.89           C  
ATOM   9159  CD1 LEU B 292      55.653  -6.585   8.202  1.00  0.89           C  
ATOM   9160  CD2 LEU B 292      57.331  -4.930   9.041  1.00  0.89           C  
ATOM   9161  N   ARG B 293      60.588  -7.872   8.063  1.00  0.87           N  
ATOM   9162  CA  ARG B 293      61.434  -8.557   9.019  1.00  0.87           C  
ATOM   9163  C   ARG B 293      62.747  -7.826   9.290  1.00  0.87           C  
ATOM   9164  O   ARG B 293      63.127  -7.629  10.436  1.00  0.87           O  
ATOM   9165  CB  ARG B 293      61.707  -9.997   8.526  1.00  0.87           C  
ATOM   9166  CG  ARG B 293      62.668 -10.800   9.421  1.00  0.87           C  
ATOM   9167  CD  ARG B 293      62.202 -10.939  10.873  1.00  0.87           C  
ATOM   9168  NE  ARG B 293      63.301 -11.673  11.537  1.00  0.87           N  
ATOM   9169  CZ  ARG B 293      63.247 -12.436  12.628  1.00  0.87           C  
ATOM   9170  NH1 ARG B 293      62.146 -12.557  13.361  1.00  0.87           N  
ATOM   9171  NH2 ARG B 293      64.375 -13.053  12.961  1.00  0.87           N  
ATOM   9172  N   LEU B 294      63.424  -7.327   8.238  1.00  0.94           N  
ATOM   9173  CA  LEU B 294      64.616  -6.510   8.376  1.00  0.94           C  
ATOM   9174  C   LEU B 294      64.361  -5.204   9.126  1.00  0.94           C  
ATOM   9175  O   LEU B 294      65.155  -4.763   9.959  1.00  0.94           O  
ATOM   9176  CB  LEU B 294      65.178  -6.222   6.971  1.00  0.94           C  
ATOM   9177  CG  LEU B 294      66.486  -5.416   6.917  1.00  0.94           C  
ATOM   9178  CD1 LEU B 294      67.648  -6.148   7.604  1.00  0.94           C  
ATOM   9179  CD2 LEU B 294      66.822  -5.142   5.447  1.00  0.94           C  
ATOM   9180  N   LYS B 295      63.197  -4.556   8.891  1.00  0.92           N  
ATOM   9181  CA  LYS B 295      62.764  -3.414   9.678  1.00  0.92           C  
ATOM   9182  C   LYS B 295      62.569  -3.737  11.137  1.00  0.92           C  
ATOM   9183  O   LYS B 295      62.951  -2.940  11.986  1.00  0.92           O  
ATOM   9184  CB  LYS B 295      61.442  -2.775   9.197  1.00  0.92           C  
ATOM   9185  CG  LYS B 295      61.566  -2.085   7.846  1.00  0.92           C  
ATOM   9186  CD  LYS B 295      60.254  -1.428   7.389  1.00  0.92           C  
ATOM   9187  CE  LYS B 295      60.451  -0.911   5.969  1.00  0.92           C  
ATOM   9188  NZ  LYS B 295      59.218  -0.629   5.216  1.00  0.92           N  
ATOM   9189  N   GLN B 296      61.994  -4.911  11.471  1.00  0.93           N  
ATOM   9190  CA  GLN B 296      61.835  -5.358  12.842  1.00  0.93           C  
ATOM   9191  C   GLN B 296      63.170  -5.479  13.547  1.00  0.93           C  
ATOM   9192  O   GLN B 296      63.360  -4.994  14.658  1.00  0.93           O  
ATOM   9193  CB  GLN B 296      61.134  -6.742  12.912  1.00  0.93           C  
ATOM   9194  CG  GLN B 296      59.680  -6.720  12.406  1.00  0.93           C  
ATOM   9195  CD  GLN B 296      58.942  -8.039  12.646  1.00  0.93           C  
ATOM   9196  OE1 GLN B 296      59.504  -9.134  12.569  1.00  0.93           O  
ATOM   9197  NE2 GLN B 296      57.621  -7.924  12.920  1.00  0.93           N  
ATOM   9198  N   GLU B 297      64.148  -6.087  12.866  1.00  0.95           N  
ATOM   9199  CA  GLU B 297      65.485  -6.279  13.360  1.00  0.95           C  
ATOM   9200  C   GLU B 297      66.243  -4.983  13.579  1.00  0.95           C  
ATOM   9201  O   GLU B 297      66.848  -4.774  14.626  1.00  0.95           O  
ATOM   9202  CB  GLU B 297      66.191  -7.252  12.413  1.00  0.95           C  
ATOM   9203  CG  GLU B 297      65.530  -8.652  12.489  1.00  0.95           C  
ATOM   9204  CD  GLU B 297      66.053  -9.626  11.443  1.00  0.95           C  
ATOM   9205  OE1 GLU B 297      66.660  -9.169  10.445  1.00  0.95           O  
ATOM   9206  OE2 GLU B 297      65.743 -10.839  11.603  1.00  0.95           O  
ATOM   9207  N   TYR B 298      66.173  -4.020  12.637  1.00  0.96           N  
ATOM   9208  CA  TYR B 298      66.727  -2.699  12.868  1.00  0.96           C  
ATOM   9209  C   TYR B 298      65.993  -1.927  13.968  1.00  0.96           C  
ATOM   9210  O   TYR B 298      66.612  -1.265  14.799  1.00  0.96           O  
ATOM   9211  CB  TYR B 298      66.798  -1.888  11.548  1.00  0.96           C  
ATOM   9212  CG  TYR B 298      67.556  -0.608  11.775  1.00  0.96           C  
ATOM   9213  CD1 TYR B 298      68.907  -0.654  12.147  1.00  0.96           C  
ATOM   9214  CD2 TYR B 298      66.897   0.632  11.763  1.00  0.96           C  
ATOM   9215  CE1 TYR B 298      69.578   0.515  12.523  1.00  0.96           C  
ATOM   9216  CE2 TYR B 298      67.574   1.800  12.132  1.00  0.96           C  
ATOM   9217  CZ  TYR B 298      68.916   1.744  12.497  1.00  0.96           C  
ATOM   9218  OH  TYR B 298      69.573   2.928  12.871  1.00  0.96           O  
ATOM   9219  N   PHE B 299      64.650  -2.024  14.021  1.00  0.95           N  
ATOM   9220  CA  PHE B 299      63.818  -1.365  15.008  1.00  0.95           C  
ATOM   9221  C   PHE B 299      64.171  -1.753  16.440  1.00  0.95           C  
ATOM   9222  O   PHE B 299      64.386  -0.888  17.289  1.00  0.95           O  
ATOM   9223  CB  PHE B 299      62.332  -1.677  14.657  1.00  0.95           C  
ATOM   9224  CG  PHE B 299      61.337  -1.122  15.624  1.00  0.95           C  
ATOM   9225  CD1 PHE B 299      60.967   0.228  15.574  1.00  0.95           C  
ATOM   9226  CD2 PHE B 299      60.773  -1.959  16.600  1.00  0.95           C  
ATOM   9227  CE1 PHE B 299      60.073   0.747  16.517  1.00  0.95           C  
ATOM   9228  CE2 PHE B 299      59.885  -1.443  17.547  1.00  0.95           C  
ATOM   9229  CZ  PHE B 299      59.556  -0.086  17.516  1.00  0.95           C  
ATOM   9230  N   VAL B 300      64.315  -3.063  16.731  1.00  0.98           N  
ATOM   9231  CA  VAL B 300      64.760  -3.509  18.039  1.00  0.98           C  
ATOM   9232  C   VAL B 300      66.187  -3.092  18.346  1.00  0.98           C  
ATOM   9233  O   VAL B 300      66.489  -2.660  19.451  1.00  0.98           O  
ATOM   9234  CB  VAL B 300      64.554  -5.005  18.261  1.00  0.98           C  
ATOM   9235  CG1 VAL B 300      65.312  -5.842  17.220  1.00  0.98           C  
ATOM   9236  CG2 VAL B 300      64.980  -5.428  19.681  1.00  0.98           C  
ATOM   9237  N   VAL B 301      67.110  -3.187  17.371  1.00  0.98           N  
ATOM   9238  CA  VAL B 301      68.494  -2.800  17.555  1.00  0.98           C  
ATOM   9239  C   VAL B 301      68.694  -1.317  17.854  1.00  0.98           C  
ATOM   9240  O   VAL B 301      69.347  -0.961  18.835  1.00  0.98           O  
ATOM   9241  CB  VAL B 301      69.272  -3.223  16.318  1.00  0.98           C  
ATOM   9242  CG1 VAL B 301      70.617  -2.492  16.203  1.00  0.98           C  
ATOM   9243  CG2 VAL B 301      69.494  -4.749  16.381  1.00  0.98           C  
ATOM   9244  N   ALA B 302      68.107  -0.407  17.052  1.00  0.98           N  
ATOM   9245  CA  ALA B 302      68.304   1.020  17.193  1.00  0.98           C  
ATOM   9246  C   ALA B 302      67.739   1.590  18.482  1.00  0.98           C  
ATOM   9247  O   ALA B 302      68.354   2.405  19.157  1.00  0.98           O  
ATOM   9248  CB  ALA B 302      67.668   1.726  15.987  1.00  0.98           C  
ATOM   9249  N   ALA B 303      66.527   1.151  18.868  1.00  0.97           N  
ATOM   9250  CA  ALA B 303      65.919   1.551  20.112  1.00  0.97           C  
ATOM   9251  C   ALA B 303      66.671   1.031  21.334  1.00  0.97           C  
ATOM   9252  O   ALA B 303      66.973   1.770  22.273  1.00  0.97           O  
ATOM   9253  CB  ALA B 303      64.468   1.058  20.077  1.00  0.97           C  
ATOM   9254  N   THR B 304      67.063  -0.258  21.312  1.00  0.97           N  
ATOM   9255  CA  THR B 304      67.828  -0.896  22.374  1.00  0.97           C  
ATOM   9256  C   THR B 304      69.178  -0.260  22.611  1.00  0.97           C  
ATOM   9257  O   THR B 304      69.518   0.081  23.734  1.00  0.97           O  
ATOM   9258  CB  THR B 304      68.053  -2.369  22.078  1.00  0.97           C  
ATOM   9259  OG1 THR B 304      66.824  -3.074  22.114  1.00  0.97           O  
ATOM   9260  CG2 THR B 304      68.959  -3.043  23.109  1.00  0.97           C  
ATOM   9261  N   LEU B 305      69.982  -0.029  21.555  1.00  0.97           N  
ATOM   9262  CA  LEU B 305      71.311   0.542  21.694  1.00  0.97           C  
ATOM   9263  C   LEU B 305      71.277   1.974  22.220  1.00  0.97           C  
ATOM   9264  O   LEU B 305      72.084   2.347  23.072  1.00  0.97           O  
ATOM   9265  CB  LEU B 305      72.114   0.391  20.379  1.00  0.97           C  
ATOM   9266  CG  LEU B 305      72.910  -0.936  20.260  1.00  0.97           C  
ATOM   9267  CD1 LEU B 305      72.060  -2.212  20.395  1.00  0.97           C  
ATOM   9268  CD2 LEU B 305      73.657  -0.978  18.923  1.00  0.97           C  
ATOM   9269  N   GLN B 306      70.290   2.795  21.795  1.00  0.92           N  
ATOM   9270  CA  GLN B 306      70.054   4.101  22.389  1.00  0.92           C  
ATOM   9271  C   GLN B 306      69.728   4.043  23.892  1.00  0.92           C  
ATOM   9272  O   GLN B 306      70.316   4.778  24.685  1.00  0.92           O  
ATOM   9273  CB  GLN B 306      68.906   4.838  21.649  1.00  0.92           C  
ATOM   9274  CG  GLN B 306      69.241   5.306  20.214  1.00  0.92           C  
ATOM   9275  CD  GLN B 306      68.021   5.947  19.542  1.00  0.92           C  
ATOM   9276  OE1 GLN B 306      67.787   7.151  19.631  1.00  0.92           O  
ATOM   9277  NE2 GLN B 306      67.222   5.117  18.835  1.00  0.92           N  
ATOM   9278  N   ASP B 307      68.827   3.131  24.337  1.00  0.93           N  
ATOM   9279  CA  ASP B 307      68.482   2.927  25.741  1.00  0.93           C  
ATOM   9280  C   ASP B 307      69.674   2.415  26.566  1.00  0.93           C  
ATOM   9281  O   ASP B 307      69.900   2.866  27.692  1.00  0.93           O  
ATOM   9282  CB  ASP B 307      67.210   2.022  25.819  1.00  0.93           C  
ATOM   9283  CG  ASP B 307      66.400   2.043  27.109  1.00  0.93           C  
ATOM   9284  OD1 ASP B 307      65.906   3.112  27.541  1.00  0.93           O  
ATOM   9285  OD2 ASP B 307      66.149   0.955  27.695  1.00  0.93           O  
ATOM   9286  N   ILE B 308      70.504   1.502  26.003  1.00  0.95           N  
ATOM   9287  CA  ILE B 308      71.753   1.038  26.609  1.00  0.95           C  
ATOM   9288  C   ILE B 308      72.753   2.162  26.841  1.00  0.95           C  
ATOM   9289  O   ILE B 308      73.263   2.326  27.948  1.00  0.95           O  
ATOM   9290  CB  ILE B 308      72.439  -0.045  25.761  1.00  0.95           C  
ATOM   9291  CG1 ILE B 308      71.586  -1.334  25.727  1.00  0.95           C  
ATOM   9292  CG2 ILE B 308      73.859  -0.369  26.295  1.00  0.95           C  
ATOM   9293  CD1 ILE B 308      72.145  -2.424  24.802  1.00  0.95           C  
ATOM   9294  N   ILE B 309      73.034   2.992  25.811  1.00  0.91           N  
ATOM   9295  CA  ILE B 309      73.968   4.109  25.904  1.00  0.91           C  
ATOM   9296  C   ILE B 309      73.465   5.187  26.845  1.00  0.91           C  
ATOM   9297  O   ILE B 309      74.209   5.703  27.676  1.00  0.91           O  
ATOM   9298  CB  ILE B 309      74.325   4.669  24.528  1.00  0.91           C  
ATOM   9299  CG1 ILE B 309      75.146   3.612  23.745  1.00  0.91           C  
ATOM   9300  CG2 ILE B 309      75.119   5.994  24.654  1.00  0.91           C  
ATOM   9301  CD1 ILE B 309      75.359   3.959  22.268  1.00  0.91           C  
ATOM   9302  N   ARG B 310      72.161   5.520  26.796  1.00  0.81           N  
ATOM   9303  CA  ARG B 310      71.550   6.454  27.722  1.00  0.81           C  
ATOM   9304  C   ARG B 310      71.656   5.996  29.172  1.00  0.81           C  
ATOM   9305  O   ARG B 310      72.000   6.774  30.055  1.00  0.81           O  
ATOM   9306  CB  ARG B 310      70.057   6.607  27.361  1.00  0.81           C  
ATOM   9307  CG  ARG B 310      69.273   7.643  28.195  1.00  0.81           C  
ATOM   9308  CD  ARG B 310      67.842   7.196  28.520  1.00  0.81           C  
ATOM   9309  NE  ARG B 310      67.943   6.063  29.493  1.00  0.81           N  
ATOM   9310  CZ  ARG B 310      67.032   5.104  29.645  1.00  0.81           C  
ATOM   9311  NH1 ARG B 310      65.824   5.174  29.121  1.00  0.81           N  
ATOM   9312  NH2 ARG B 310      67.347   3.981  30.267  1.00  0.81           N  
ATOM   9313  N   ARG B 311      71.387   4.698  29.441  1.00  0.83           N  
ATOM   9314  CA  ARG B 311      71.560   4.091  30.749  1.00  0.83           C  
ATOM   9315  C   ARG B 311      72.999   4.048  31.221  1.00  0.83           C  
ATOM   9316  O   ARG B 311      73.276   4.229  32.401  1.00  0.83           O  
ATOM   9317  CB  ARG B 311      70.948   2.668  30.796  1.00  0.83           C  
ATOM   9318  CG  ARG B 311      70.971   2.045  32.213  1.00  0.83           C  
ATOM   9319  CD  ARG B 311      70.153   0.765  32.450  1.00  0.83           C  
ATOM   9320  NE  ARG B 311      68.723   1.015  32.078  1.00  0.83           N  
ATOM   9321  CZ  ARG B 311      68.179   0.572  30.938  1.00  0.83           C  
ATOM   9322  NH1 ARG B 311      68.918  -0.009  30.002  1.00  0.83           N  
ATOM   9323  NH2 ARG B 311      66.876   0.734  30.705  1.00  0.83           N  
ATOM   9324  N   PHE B 312      73.960   3.805  30.306  1.00  0.85           N  
ATOM   9325  CA  PHE B 312      75.372   3.884  30.613  1.00  0.85           C  
ATOM   9326  C   PHE B 312      75.757   5.286  31.068  1.00  0.85           C  
ATOM   9327  O   PHE B 312      76.377   5.423  32.120  1.00  0.85           O  
ATOM   9328  CB  PHE B 312      76.181   3.435  29.359  1.00  0.85           C  
ATOM   9329  CG  PHE B 312      77.673   3.603  29.478  1.00  0.85           C  
ATOM   9330  CD1 PHE B 312      78.451   2.692  30.207  1.00  0.85           C  
ATOM   9331  CD2 PHE B 312      78.307   4.675  28.826  1.00  0.85           C  
ATOM   9332  CE1 PHE B 312      79.844   2.834  30.259  1.00  0.85           C  
ATOM   9333  CE2 PHE B 312      79.701   4.809  28.863  1.00  0.85           C  
ATOM   9334  CZ  PHE B 312      80.472   3.882  29.573  1.00  0.85           C  
ATOM   9335  N   LYS B 313      75.350   6.340  30.327  1.00  0.76           N  
ATOM   9336  CA  LYS B 313      75.692   7.717  30.631  1.00  0.76           C  
ATOM   9337  C   LYS B 313      75.147   8.246  31.960  1.00  0.76           C  
ATOM   9338  O   LYS B 313      75.874   8.898  32.712  1.00  0.76           O  
ATOM   9339  CB  LYS B 313      75.284   8.684  29.485  1.00  0.76           C  
ATOM   9340  CG  LYS B 313      76.059   8.490  28.168  1.00  0.76           C  
ATOM   9341  CD  LYS B 313      75.853   9.631  27.152  1.00  0.76           C  
ATOM   9342  CE  LYS B 313      76.692   9.415  25.881  1.00  0.76           C  
ATOM   9343  NZ  LYS B 313      76.584  10.548  24.946  1.00  0.76           N  
ATOM   9344  N   SER B 314      73.868   7.977  32.307  1.00  0.76           N  
ATOM   9345  CA  SER B 314      73.258   8.434  33.556  1.00  0.76           C  
ATOM   9346  C   SER B 314      73.497   7.498  34.728  1.00  0.76           C  
ATOM   9347  O   SER B 314      72.593   7.013  35.390  1.00  0.76           O  
ATOM   9348  CB  SER B 314      71.739   8.725  33.433  1.00  0.76           C  
ATOM   9349  OG  SER B 314      71.006   7.620  32.893  1.00  0.76           O  
ATOM   9350  N   SER B 315      74.778   7.231  35.030  1.00  0.73           N  
ATOM   9351  CA  SER B 315      75.175   6.254  36.027  1.00  0.73           C  
ATOM   9352  C   SER B 315      75.013   6.613  37.492  1.00  0.73           C  
ATOM   9353  O   SER B 315      74.956   5.725  38.338  1.00  0.73           O  
ATOM   9354  CB  SER B 315      76.653   5.850  35.833  1.00  0.73           C  
ATOM   9355  OG  SER B 315      77.545   6.968  35.903  1.00  0.73           O  
ATOM   9356  N   LYS B 316      74.959   7.904  37.861  1.00  0.57           N  
ATOM   9357  CA  LYS B 316      74.912   8.303  39.257  1.00  0.57           C  
ATOM   9358  C   LYS B 316      73.562   8.071  39.927  1.00  0.57           C  
ATOM   9359  O   LYS B 316      72.528   8.540  39.467  1.00  0.57           O  
ATOM   9360  CB  LYS B 316      75.305   9.794  39.412  1.00  0.57           C  
ATOM   9361  CG  LYS B 316      75.332  10.297  40.868  1.00  0.57           C  
ATOM   9362  CD  LYS B 316      75.862  11.734  41.010  1.00  0.57           C  
ATOM   9363  CE  LYS B 316      75.874  12.186  42.476  1.00  0.57           C  
ATOM   9364  NZ  LYS B 316      76.427  13.553  42.619  1.00  0.57           N  
ATOM   9365  N   PHE B 317      73.537   7.371  41.086  1.00  0.50           N  
ATOM   9366  CA  PHE B 317      72.325   7.190  41.869  1.00  0.50           C  
ATOM   9367  C   PHE B 317      71.639   8.504  42.243  1.00  0.50           C  
ATOM   9368  O   PHE B 317      72.243   9.433  42.776  1.00  0.50           O  
ATOM   9369  CB  PHE B 317      72.618   6.357  43.151  1.00  0.50           C  
ATOM   9370  CG  PHE B 317      71.365   5.991  43.920  1.00  0.50           C  
ATOM   9371  CD1 PHE B 317      70.761   6.909  44.802  1.00  0.50           C  
ATOM   9372  CD2 PHE B 317      70.780   4.727  43.769  1.00  0.50           C  
ATOM   9373  CE1 PHE B 317      69.586   6.578  45.490  1.00  0.50           C  
ATOM   9374  CE2 PHE B 317      69.616   4.388  44.465  1.00  0.50           C  
ATOM   9375  CZ  PHE B 317      69.010   5.315  45.319  1.00  0.50           C  
ATOM   9376  N   GLY B 318      70.321   8.584  41.961  1.00  0.65           N  
ATOM   9377  CA  GLY B 318      69.495   9.732  42.304  1.00  0.65           C  
ATOM   9378  C   GLY B 318      69.630  10.897  41.376  1.00  0.65           C  
ATOM   9379  O   GLY B 318      69.022  11.936  41.603  1.00  0.65           O  
ATOM   9380  N   CYS B 319      70.424  10.757  40.307  1.00  0.67           N  
ATOM   9381  CA  CYS B 319      70.709  11.831  39.392  1.00  0.67           C  
ATOM   9382  C   CYS B 319      70.519  11.312  37.985  1.00  0.67           C  
ATOM   9383  O   CYS B 319      70.907  10.194  37.670  1.00  0.67           O  
ATOM   9384  CB  CYS B 319      72.168  12.287  39.607  1.00  0.67           C  
ATOM   9385  SG  CYS B 319      72.724  13.577  38.450  1.00  0.67           S  
ATOM   9386  N   ARG B 320      69.896  12.097  37.086  1.00  0.56           N  
ATOM   9387  CA  ARG B 320      69.651  11.609  35.741  1.00  0.56           C  
ATOM   9388  C   ARG B 320      70.511  12.293  34.708  1.00  0.56           C  
ATOM   9389  O   ARG B 320      70.381  12.018  33.518  1.00  0.56           O  
ATOM   9390  CB  ARG B 320      68.162  11.731  35.356  1.00  0.56           C  
ATOM   9391  CG  ARG B 320      67.273  10.766  36.161  1.00  0.56           C  
ATOM   9392  CD  ARG B 320      65.859  10.614  35.600  1.00  0.56           C  
ATOM   9393  NE  ARG B 320      65.178  11.935  35.760  1.00  0.56           N  
ATOM   9394  CZ  ARG B 320      63.996  12.261  35.228  1.00  0.56           C  
ATOM   9395  NH1 ARG B 320      63.289  11.402  34.503  1.00  0.56           N  
ATOM   9396  NH2 ARG B 320      63.508  13.484  35.429  1.00  0.56           N  
ATOM   9397  N   ASP B 321      71.426  13.180  35.142  1.00  0.60           N  
ATOM   9398  CA  ASP B 321      72.340  13.868  34.264  1.00  0.60           C  
ATOM   9399  C   ASP B 321      73.279  12.904  33.535  1.00  0.60           C  
ATOM   9400  O   ASP B 321      73.696  11.908  34.135  1.00  0.60           O  
ATOM   9401  CB  ASP B 321      73.196  14.902  35.026  1.00  0.60           C  
ATOM   9402  CG  ASP B 321      72.319  15.934  35.710  1.00  0.60           C  
ATOM   9403  OD1 ASP B 321      71.254  16.284  35.142  1.00  0.60           O  
ATOM   9404  OD2 ASP B 321      72.714  16.371  36.820  1.00  0.60           O  
ATOM   9405  N   PRO B 322      73.667  13.120  32.279  1.00  0.64           N  
ATOM   9406  CA  PRO B 322      74.598  12.227  31.593  1.00  0.64           C  
ATOM   9407  C   PRO B 322      76.037  12.455  32.036  1.00  0.64           C  
ATOM   9408  O   PRO B 322      76.863  12.901  31.252  1.00  0.64           O  
ATOM   9409  CB  PRO B 322      74.390  12.565  30.097  1.00  0.64           C  
ATOM   9410  CG  PRO B 322      72.976  13.141  30.038  1.00  0.64           C  
ATOM   9411  CD  PRO B 322      72.896  13.929  31.337  1.00  0.64           C  
ATOM   9412  N   VAL B 323      76.346  12.131  33.307  1.00  0.66           N  
ATOM   9413  CA  VAL B 323      77.616  12.366  33.967  1.00  0.66           C  
ATOM   9414  C   VAL B 323      78.788  11.639  33.334  1.00  0.66           C  
ATOM   9415  O   VAL B 323      79.902  12.148  33.253  1.00  0.66           O  
ATOM   9416  CB  VAL B 323      77.561  12.070  35.470  1.00  0.66           C  
ATOM   9417  CG1 VAL B 323      76.530  13.013  36.122  1.00  0.66           C  
ATOM   9418  CG2 VAL B 323      77.217  10.595  35.776  1.00  0.66           C  
ATOM   9419  N   ARG B 324      78.560  10.406  32.861  1.00  0.57           N  
ATOM   9420  CA  ARG B 324      79.571   9.569  32.266  1.00  0.57           C  
ATOM   9421  C   ARG B 324      79.548   9.692  30.750  1.00  0.57           C  
ATOM   9422  O   ARG B 324      78.857   8.970  30.036  1.00  0.57           O  
ATOM   9423  CB  ARG B 324      79.281   8.135  32.730  1.00  0.57           C  
ATOM   9424  CG  ARG B 324      80.160   6.996  32.186  1.00  0.57           C  
ATOM   9425  CD  ARG B 324      79.424   5.675  32.422  1.00  0.57           C  
ATOM   9426  NE  ARG B 324      80.060   4.920  33.530  1.00  0.57           N  
ATOM   9427  CZ  ARG B 324      79.454   3.935  34.207  1.00  0.57           C  
ATOM   9428  NH1 ARG B 324      78.217   3.526  33.962  1.00  0.57           N  
ATOM   9429  NH2 ARG B 324      80.112   3.382  35.212  1.00  0.57           N  
ATOM   9430  N   THR B 325      80.353  10.619  30.211  1.00  0.70           N  
ATOM   9431  CA  THR B 325      80.434  10.882  28.779  1.00  0.70           C  
ATOM   9432  C   THR B 325      81.581  10.131  28.136  1.00  0.70           C  
ATOM   9433  O   THR B 325      81.691  10.056  26.916  1.00  0.70           O  
ATOM   9434  CB  THR B 325      80.638  12.368  28.520  1.00  0.70           C  
ATOM   9435  OG1 THR B 325      81.680  12.887  29.338  1.00  0.70           O  
ATOM   9436  CG2 THR B 325      79.351  13.110  28.907  1.00  0.70           C  
ATOM   9437  N   ASN B 326      82.447   9.509  28.958  1.00  0.71           N  
ATOM   9438  CA  ASN B 326      83.579   8.734  28.508  1.00  0.71           C  
ATOM   9439  C   ASN B 326      83.210   7.262  28.344  1.00  0.71           C  
ATOM   9440  O   ASN B 326      82.608   6.635  29.215  1.00  0.71           O  
ATOM   9441  CB  ASN B 326      84.768   8.910  29.495  1.00  0.71           C  
ATOM   9442  CG  ASN B 326      86.020   8.221  28.963  1.00  0.71           C  
ATOM   9443  OD1 ASN B 326      86.203   8.170  27.750  1.00  0.71           O  
ATOM   9444  ND2 ASN B 326      86.846   7.650  29.870  1.00  0.71           N  
ATOM   9445  N   PHE B 327      83.617   6.681  27.201  1.00  0.83           N  
ATOM   9446  CA  PHE B 327      83.256   5.341  26.791  1.00  0.83           C  
ATOM   9447  C   PHE B 327      84.351   4.321  27.025  1.00  0.83           C  
ATOM   9448  O   PHE B 327      84.175   3.150  26.695  1.00  0.83           O  
ATOM   9449  CB  PHE B 327      82.957   5.309  25.278  1.00  0.83           C  
ATOM   9450  CG  PHE B 327      81.568   5.783  24.986  1.00  0.83           C  
ATOM   9451  CD1 PHE B 327      80.505   4.866  24.974  1.00  0.83           C  
ATOM   9452  CD2 PHE B 327      81.316   7.122  24.659  1.00  0.83           C  
ATOM   9453  CE1 PHE B 327      79.209   5.276  24.647  1.00  0.83           C  
ATOM   9454  CE2 PHE B 327      80.021   7.538  24.330  1.00  0.83           C  
ATOM   9455  CZ  PHE B 327      78.966   6.616  24.325  1.00  0.83           C  
ATOM   9456  N   ASP B 328      85.497   4.691  27.626  1.00  0.80           N  
ATOM   9457  CA  ASP B 328      86.595   3.770  27.865  1.00  0.80           C  
ATOM   9458  C   ASP B 328      86.169   2.560  28.717  1.00  0.80           C  
ATOM   9459  O   ASP B 328      86.566   1.428  28.461  1.00  0.80           O  
ATOM   9460  CB  ASP B 328      87.777   4.533  28.508  1.00  0.80           C  
ATOM   9461  CG  ASP B 328      88.291   5.695  27.666  1.00  0.80           C  
ATOM   9462  OD1 ASP B 328      88.083   5.743  26.431  1.00  0.80           O  
ATOM   9463  OD2 ASP B 328      88.901   6.593  28.291  1.00  0.80           O  
ATOM   9464  N   ALA B 329      85.261   2.782  29.697  1.00  0.85           N  
ATOM   9465  CA  ALA B 329      84.695   1.735  30.522  1.00  0.85           C  
ATOM   9466  C   ALA B 329      83.389   1.141  29.983  1.00  0.85           C  
ATOM   9467  O   ALA B 329      82.695   0.415  30.691  1.00  0.85           O  
ATOM   9468  CB  ALA B 329      84.421   2.315  31.926  1.00  0.85           C  
ATOM   9469  N   PHE B 330      82.995   1.410  28.718  1.00  0.90           N  
ATOM   9470  CA  PHE B 330      81.795   0.830  28.120  1.00  0.90           C  
ATOM   9471  C   PHE B 330      81.824  -0.692  28.026  1.00  0.90           C  
ATOM   9472  O   PHE B 330      80.843  -1.300  28.458  1.00  0.90           O  
ATOM   9473  CB  PHE B 330      81.465   1.513  26.762  1.00  0.90           C  
ATOM   9474  CG  PHE B 330      80.102   1.182  26.205  1.00  0.90           C  
ATOM   9475  CD1 PHE B 330      78.984   1.961  26.538  1.00  0.90           C  
ATOM   9476  CD2 PHE B 330      79.935   0.138  25.285  1.00  0.90           C  
ATOM   9477  CE1 PHE B 330      77.726   1.708  25.977  1.00  0.90           C  
ATOM   9478  CE2 PHE B 330      78.681  -0.125  24.717  1.00  0.90           C  
ATOM   9479  CZ  PHE B 330      77.574   0.657  25.066  1.00  0.90           C  
ATOM   9480  N   PRO B 331      82.873  -1.394  27.596  1.00  0.95           N  
ATOM   9481  CA  PRO B 331      82.824  -2.847  27.516  1.00  0.95           C  
ATOM   9482  C   PRO B 331      82.881  -3.509  28.870  1.00  0.95           C  
ATOM   9483  O   PRO B 331      82.665  -4.713  28.956  1.00  0.95           O  
ATOM   9484  CB  PRO B 331      84.052  -3.217  26.675  1.00  0.95           C  
ATOM   9485  CG  PRO B 331      84.322  -1.955  25.859  1.00  0.95           C  
ATOM   9486  CD  PRO B 331      84.028  -0.862  26.872  1.00  0.95           C  
ATOM   9487  N   ASP B 332      83.173  -2.755  29.942  1.00  0.90           N  
ATOM   9488  CA  ASP B 332      83.261  -3.282  31.282  1.00  0.90           C  
ATOM   9489  C   ASP B 332      82.003  -2.940  32.065  1.00  0.90           C  
ATOM   9490  O   ASP B 332      81.826  -3.355  33.210  1.00  0.90           O  
ATOM   9491  CB  ASP B 332      84.531  -2.723  31.956  1.00  0.90           C  
ATOM   9492  CG  ASP B 332      85.707  -3.108  31.071  1.00  0.90           C  
ATOM   9493  OD1 ASP B 332      85.931  -4.333  30.899  1.00  0.90           O  
ATOM   9494  OD2 ASP B 332      86.346  -2.189  30.492  1.00  0.90           O  
ATOM   9495  N   LYS B 333      81.056  -2.207  31.437  1.00  0.90           N  
ATOM   9496  CA  LYS B 333      79.776  -1.890  32.037  1.00  0.90           C  
ATOM   9497  C   LYS B 333      78.605  -2.335  31.181  1.00  0.90           C  
ATOM   9498  O   LYS B 333      77.458  -2.286  31.621  1.00  0.90           O  
ATOM   9499  CB  LYS B 333      79.656  -0.371  32.289  1.00  0.90           C  
ATOM   9500  CG  LYS B 333      80.691   0.163  33.292  1.00  0.90           C  
ATOM   9501  CD  LYS B 333      80.513  -0.427  34.699  1.00  0.90           C  
ATOM   9502  CE  LYS B 333      81.611   0.007  35.668  1.00  0.90           C  
ATOM   9503  NZ  LYS B 333      81.222  -0.355  37.039  1.00  0.90           N  
ATOM   9504  N   VAL B 334      78.871  -2.829  29.958  1.00  0.95           N  
ATOM   9505  CA  VAL B 334      77.852  -3.264  29.021  1.00  0.95           C  
ATOM   9506  C   VAL B 334      78.300  -4.553  28.344  1.00  0.95           C  
ATOM   9507  O   VAL B 334      79.424  -4.686  27.886  1.00  0.95           O  
ATOM   9508  CB  VAL B 334      77.597  -2.214  27.937  1.00  0.95           C  
ATOM   9509  CG1 VAL B 334      76.502  -2.668  26.949  1.00  0.95           C  
ATOM   9510  CG2 VAL B 334      77.208  -0.869  28.589  1.00  0.95           C  
ATOM   9511  N   ALA B 335      77.403  -5.560  28.275  1.00  0.98           N  
ATOM   9512  CA  ALA B 335      77.556  -6.714  27.411  1.00  0.98           C  
ATOM   9513  C   ALA B 335      76.322  -6.814  26.534  1.00  0.98           C  
ATOM   9514  O   ALA B 335      75.202  -6.679  27.017  1.00  0.98           O  
ATOM   9515  CB  ALA B 335      77.700  -8.038  28.197  1.00  0.98           C  
ATOM   9516  N   ILE B 336      76.494  -7.052  25.221  1.00  0.97           N  
ATOM   9517  CA  ILE B 336      75.380  -7.264  24.309  1.00  0.97           C  
ATOM   9518  C   ILE B 336      75.501  -8.666  23.743  1.00  0.97           C  
ATOM   9519  O   ILE B 336      76.414  -8.991  22.990  1.00  0.97           O  
ATOM   9520  CB  ILE B 336      75.326  -6.229  23.178  1.00  0.97           C  
ATOM   9521  CG1 ILE B 336      75.105  -4.813  23.759  1.00  0.97           C  
ATOM   9522  CG2 ILE B 336      74.193  -6.560  22.182  1.00  0.97           C  
ATOM   9523  CD1 ILE B 336      75.131  -3.694  22.708  1.00  0.97           C  
ATOM   9524  N   GLN B 337      74.552  -9.553  24.093  1.00  0.97           N  
ATOM   9525  CA  GLN B 337      74.537 -10.909  23.590  1.00  0.97           C  
ATOM   9526  C   GLN B 337      73.530 -11.003  22.462  1.00  0.97           C  
ATOM   9527  O   GLN B 337      72.339 -10.744  22.639  1.00  0.97           O  
ATOM   9528  CB  GLN B 337      74.161 -11.925  24.698  1.00  0.97           C  
ATOM   9529  CG  GLN B 337      74.358 -13.413  24.301  1.00  0.97           C  
ATOM   9530  CD  GLN B 337      75.836 -13.764  24.121  1.00  0.97           C  
ATOM   9531  OE1 GLN B 337      76.686 -13.370  24.922  1.00  0.97           O  
ATOM   9532  NE2 GLN B 337      76.157 -14.549  23.072  1.00  0.97           N  
ATOM   9533  N   LEU B 338      73.998 -11.372  21.257  1.00  0.98           N  
ATOM   9534  CA  LEU B 338      73.160 -11.525  20.089  1.00  0.98           C  
ATOM   9535  C   LEU B 338      72.596 -12.932  20.055  1.00  0.98           C  
ATOM   9536  O   LEU B 338      73.312 -13.911  19.841  1.00  0.98           O  
ATOM   9537  CB  LEU B 338      73.942 -11.297  18.760  1.00  0.98           C  
ATOM   9538  CG  LEU B 338      74.245  -9.835  18.337  1.00  0.98           C  
ATOM   9539  CD1 LEU B 338      73.818  -8.765  19.351  1.00  0.98           C  
ATOM   9540  CD2 LEU B 338      75.736  -9.666  17.999  1.00  0.98           C  
ATOM   9541  N   ASN B 339      71.266 -13.059  20.252  1.00  0.96           N  
ATOM   9542  CA  ASN B 339      70.572 -14.314  20.075  1.00  0.96           C  
ATOM   9543  C   ASN B 339      70.340 -14.539  18.582  1.00  0.96           C  
ATOM   9544  O   ASN B 339      69.482 -13.902  17.973  1.00  0.96           O  
ATOM   9545  CB  ASN B 339      69.238 -14.282  20.878  1.00  0.96           C  
ATOM   9546  CG  ASN B 339      68.663 -15.670  21.137  1.00  0.96           C  
ATOM   9547  OD1 ASN B 339      69.404 -16.612  21.392  1.00  0.96           O  
ATOM   9548  ND2 ASN B 339      67.314 -15.791  21.166  1.00  0.96           N  
ATOM   9549  N   ASP B 340      71.131 -15.449  17.973  1.00  0.95           N  
ATOM   9550  CA  ASP B 340      71.199 -15.672  16.538  1.00  0.95           C  
ATOM   9551  C   ASP B 340      71.674 -14.455  15.737  1.00  0.95           C  
ATOM   9552  O   ASP B 340      72.217 -13.494  16.287  1.00  0.95           O  
ATOM   9553  CB  ASP B 340      69.874 -16.288  16.014  1.00  0.95           C  
ATOM   9554  CG  ASP B 340      70.142 -17.358  14.970  1.00  0.95           C  
ATOM   9555  OD1 ASP B 340      70.652 -16.985  13.887  1.00  0.95           O  
ATOM   9556  OD2 ASP B 340      69.894 -18.555  15.256  1.00  0.95           O  
ATOM   9557  N   THR B 341      71.512 -14.456  14.394  1.00  0.95           N  
ATOM   9558  CA  THR B 341      71.946 -13.297  13.579  1.00  0.95           C  
ATOM   9559  C   THR B 341      70.917 -12.216  13.454  1.00  0.95           C  
ATOM   9560  O   THR B 341      71.195 -11.156  12.910  1.00  0.95           O  
ATOM   9561  CB  THR B 341      72.535 -13.531  12.248  1.00  0.95           C  
ATOM   9562  OG1 THR B 341      71.518 -14.153  11.382  1.00  0.95           O  
ATOM   9563  CG2 THR B 341      73.728 -14.417  12.386  1.00  0.95           C  
ATOM   9564  N   HIS B 342      69.719 -12.449  14.001  1.00  0.95           N  
ATOM   9565  CA  HIS B 342      68.597 -11.535  13.935  1.00  0.95           C  
ATOM   9566  C   HIS B 342      68.871 -10.161  14.550  1.00  0.95           C  
ATOM   9567  O   HIS B 342      68.378  -9.174  14.014  1.00  0.95           O  
ATOM   9568  CB  HIS B 342      67.321 -12.151  14.557  1.00  0.95           C  
ATOM   9569  CG  HIS B 342      67.063 -13.599  14.255  1.00  0.95           C  
ATOM   9570  ND1 HIS B 342      66.197 -14.295  15.085  1.00  0.95           N  
ATOM   9571  CD2 HIS B 342      67.579 -14.430  13.315  1.00  0.95           C  
ATOM   9572  CE1 HIS B 342      66.228 -15.541  14.639  1.00  0.95           C  
ATOM   9573  NE2 HIS B 342      67.045 -15.673  13.568  1.00  0.95           N  
ATOM   9574  N   PRO B 343      69.655  -9.966  15.623  1.00  0.99           N  
ATOM   9575  CA  PRO B 343      69.967  -8.614  16.074  1.00  0.99           C  
ATOM   9576  C   PRO B 343      71.393  -8.275  15.703  1.00  0.99           C  
ATOM   9577  O   PRO B 343      72.008  -7.428  16.352  1.00  0.99           O  
ATOM   9578  CB  PRO B 343      69.794  -8.719  17.592  1.00  0.99           C  
ATOM   9579  CG  PRO B 343      70.301 -10.122  17.910  1.00  0.99           C  
ATOM   9580  CD  PRO B 343      69.792 -10.935  16.721  1.00  0.99           C  
ATOM   9581  N   SER B 344      71.927  -8.851  14.605  1.00  0.98           N  
ATOM   9582  CA  SER B 344      73.288  -8.627  14.122  1.00  0.98           C  
ATOM   9583  C   SER B 344      73.609  -7.185  13.796  1.00  0.98           C  
ATOM   9584  O   SER B 344      74.717  -6.725  14.011  1.00  0.98           O  
ATOM   9585  CB  SER B 344      73.702  -9.500  12.916  1.00  0.98           C  
ATOM   9586  OG  SER B 344      72.843  -9.320  11.779  1.00  0.98           O  
ATOM   9587  N   LEU B 345      72.597  -6.421  13.322  1.00  0.97           N  
ATOM   9588  CA  LEU B 345      72.705  -5.006  13.032  1.00  0.97           C  
ATOM   9589  C   LEU B 345      73.140  -4.135  14.206  1.00  0.97           C  
ATOM   9590  O   LEU B 345      73.527  -2.988  14.015  1.00  0.97           O  
ATOM   9591  CB  LEU B 345      71.369  -4.469  12.464  1.00  0.97           C  
ATOM   9592  CG  LEU B 345      71.034  -4.994  11.052  1.00  0.97           C  
ATOM   9593  CD1 LEU B 345      69.640  -4.513  10.625  1.00  0.97           C  
ATOM   9594  CD2 LEU B 345      72.072  -4.545  10.007  1.00  0.97           C  
ATOM   9595  N   ALA B 346      73.177  -4.686  15.440  1.00  0.99           N  
ATOM   9596  CA  ALA B 346      73.763  -4.061  16.604  1.00  0.99           C  
ATOM   9597  C   ALA B 346      75.234  -3.718  16.415  1.00  0.99           C  
ATOM   9598  O   ALA B 346      75.695  -2.669  16.856  1.00  0.99           O  
ATOM   9599  CB  ALA B 346      73.576  -4.973  17.834  1.00  0.99           C  
ATOM   9600  N   ILE B 347      76.006  -4.569  15.716  1.00  0.97           N  
ATOM   9601  CA  ILE B 347      77.402  -4.308  15.389  1.00  0.97           C  
ATOM   9602  C   ILE B 347      77.616  -3.083  14.490  1.00  0.97           C  
ATOM   9603  O   ILE B 347      78.407  -2.218  14.877  1.00  0.97           O  
ATOM   9604  CB  ILE B 347      78.044  -5.568  14.812  1.00  0.97           C  
ATOM   9605  CG1 ILE B 347      78.041  -6.688  15.878  1.00  0.97           C  
ATOM   9606  CG2 ILE B 347      79.484  -5.293  14.322  1.00  0.97           C  
ATOM   9607  CD1 ILE B 347      78.389  -8.064  15.313  1.00  0.97           C  
ATOM   9608  N   PRO B 348      76.946  -2.864  13.348  1.00  0.99           N  
ATOM   9609  CA  PRO B 348      77.136  -1.633  12.598  1.00  0.99           C  
ATOM   9610  C   PRO B 348      76.378  -0.468  13.206  1.00  0.99           C  
ATOM   9611  O   PRO B 348      76.822   0.661  13.019  1.00  0.99           O  
ATOM   9612  CB  PRO B 348      76.686  -1.980  11.168  1.00  0.99           C  
ATOM   9613  CG  PRO B 348      75.696  -3.127  11.357  1.00  0.99           C  
ATOM   9614  CD  PRO B 348      76.325  -3.898  12.517  1.00  0.99           C  
ATOM   9615  N   GLU B 349      75.255  -0.673  13.923  1.00  0.95           N  
ATOM   9616  CA  GLU B 349      74.560   0.399  14.619  1.00  0.95           C  
ATOM   9617  C   GLU B 349      75.362   0.987  15.768  1.00  0.95           C  
ATOM   9618  O   GLU B 349      75.452   2.200  15.928  1.00  0.95           O  
ATOM   9619  CB  GLU B 349      73.163  -0.067  15.094  1.00  0.95           C  
ATOM   9620  CG  GLU B 349      72.338   0.958  15.929  1.00  0.95           C  
ATOM   9621  CD  GLU B 349      72.008   2.261  15.212  1.00  0.95           C  
ATOM   9622  OE1 GLU B 349      72.370   2.409  14.018  1.00  0.95           O  
ATOM   9623  OE2 GLU B 349      71.405   3.178  15.830  1.00  0.95           O  
ATOM   9624  N   LEU B 350      76.041   0.147  16.576  1.00  0.96           N  
ATOM   9625  CA  LEU B 350      76.917   0.621  17.632  1.00  0.96           C  
ATOM   9626  C   LEU B 350      78.078   1.420  17.076  1.00  0.96           C  
ATOM   9627  O   LEU B 350      78.393   2.506  17.556  1.00  0.96           O  
ATOM   9628  CB  LEU B 350      77.395  -0.559  18.507  1.00  0.96           C  
ATOM   9629  CG  LEU B 350      78.259  -0.188  19.728  1.00  0.96           C  
ATOM   9630  CD1 LEU B 350      77.597   0.872  20.626  1.00  0.96           C  
ATOM   9631  CD2 LEU B 350      78.559  -1.453  20.545  1.00  0.96           C  
ATOM   9632  N   MET B 351      78.675   0.950  15.964  1.00  0.93           N  
ATOM   9633  CA  MET B 351      79.659   1.717  15.227  1.00  0.93           C  
ATOM   9634  C   MET B 351      79.138   3.034  14.684  1.00  0.93           C  
ATOM   9635  O   MET B 351      79.805   4.058  14.811  1.00  0.93           O  
ATOM   9636  CB  MET B 351      80.246   0.876  14.070  1.00  0.93           C  
ATOM   9637  CG  MET B 351      81.225  -0.200  14.559  1.00  0.93           C  
ATOM   9638  SD  MET B 351      82.618   0.505  15.488  1.00  0.93           S  
ATOM   9639  CE  MET B 351      83.511   1.215  14.080  1.00  0.93           C  
ATOM   9640  N   ARG B 352      77.916   3.059  14.118  1.00  0.91           N  
ATOM   9641  CA  ARG B 352      77.283   4.278  13.652  1.00  0.91           C  
ATOM   9642  C   ARG B 352      77.071   5.303  14.761  1.00  0.91           C  
ATOM   9643  O   ARG B 352      77.380   6.484  14.610  1.00  0.91           O  
ATOM   9644  CB  ARG B 352      75.908   3.950  13.021  1.00  0.91           C  
ATOM   9645  CG  ARG B 352      75.268   5.137  12.278  1.00  0.91           C  
ATOM   9646  CD  ARG B 352      73.856   4.836  11.766  1.00  0.91           C  
ATOM   9647  NE  ARG B 352      72.930   4.732  12.931  1.00  0.91           N  
ATOM   9648  CZ  ARG B 352      72.289   5.740  13.525  1.00  0.91           C  
ATOM   9649  NH1 ARG B 352      72.490   7.010  13.171  1.00  0.91           N  
ATOM   9650  NH2 ARG B 352      71.431   5.475  14.504  1.00  0.91           N  
ATOM   9651  N   ILE B 353      76.570   4.869  15.937  1.00  0.93           N  
ATOM   9652  CA  ILE B 353      76.384   5.747  17.082  1.00  0.93           C  
ATOM   9653  C   ILE B 353      77.706   6.288  17.612  1.00  0.93           C  
ATOM   9654  O   ILE B 353      77.859   7.491  17.822  1.00  0.93           O  
ATOM   9655  CB  ILE B 353      75.588   5.079  18.206  1.00  0.93           C  
ATOM   9656  CG1 ILE B 353      74.166   4.699  17.721  1.00  0.93           C  
ATOM   9657  CG2 ILE B 353      75.501   6.040  19.416  1.00  0.93           C  
ATOM   9658  CD1 ILE B 353      73.382   3.815  18.705  1.00  0.93           C  
ATOM   9659  N   LEU B 354      78.728   5.430  17.798  1.00  0.90           N  
ATOM   9660  CA  LEU B 354      80.013   5.874  18.304  1.00  0.90           C  
ATOM   9661  C   LEU B 354      80.770   6.794  17.345  1.00  0.90           C  
ATOM   9662  O   LEU B 354      81.272   7.839  17.751  1.00  0.90           O  
ATOM   9663  CB  LEU B 354      80.905   4.666  18.699  1.00  0.90           C  
ATOM   9664  CG  LEU B 354      80.338   3.763  19.824  1.00  0.90           C  
ATOM   9665  CD1 LEU B 354      81.249   2.544  20.066  1.00  0.90           C  
ATOM   9666  CD2 LEU B 354      80.124   4.528  21.138  1.00  0.90           C  
ATOM   9667  N   VAL B 355      80.847   6.445  16.041  1.00  0.91           N  
ATOM   9668  CA  VAL B 355      81.616   7.200  15.060  1.00  0.91           C  
ATOM   9669  C   VAL B 355      80.907   8.451  14.580  1.00  0.91           C  
ATOM   9670  O   VAL B 355      81.469   9.548  14.594  1.00  0.91           O  
ATOM   9671  CB  VAL B 355      81.994   6.323  13.863  1.00  0.91           C  
ATOM   9672  CG1 VAL B 355      82.699   7.118  12.739  1.00  0.91           C  
ATOM   9673  CG2 VAL B 355      82.933   5.210  14.370  1.00  0.91           C  
ATOM   9674  N   ASP B 356      79.634   8.360  14.152  1.00  0.91           N  
ATOM   9675  CA  ASP B 356      78.954   9.506  13.586  1.00  0.91           C  
ATOM   9676  C   ASP B 356      78.428  10.455  14.659  1.00  0.91           C  
ATOM   9677  O   ASP B 356      78.621  11.669  14.575  1.00  0.91           O  
ATOM   9678  CB  ASP B 356      77.847   9.061  12.602  1.00  0.91           C  
ATOM   9679  CG  ASP B 356      78.466   8.304  11.438  1.00  0.91           C  
ATOM   9680  OD1 ASP B 356      79.492   8.783  10.887  1.00  0.91           O  
ATOM   9681  OD2 ASP B 356      77.925   7.236  11.042  1.00  0.91           O  
ATOM   9682  N   LEU B 357      77.786   9.919  15.718  1.00  0.88           N  
ATOM   9683  CA  LEU B 357      77.144  10.728  16.739  1.00  0.88           C  
ATOM   9684  C   LEU B 357      78.065  11.143  17.884  1.00  0.88           C  
ATOM   9685  O   LEU B 357      78.161  12.327  18.190  1.00  0.88           O  
ATOM   9686  CB  LEU B 357      75.855  10.040  17.253  1.00  0.88           C  
ATOM   9687  CG  LEU B 357      74.903   9.587  16.118  1.00  0.88           C  
ATOM   9688  CD1 LEU B 357      73.678   8.868  16.695  1.00  0.88           C  
ATOM   9689  CD2 LEU B 357      74.438  10.750  15.222  1.00  0.88           C  
ATOM   9690  N   GLU B 358      78.825  10.213  18.506  1.00  0.82           N  
ATOM   9691  CA  GLU B 358      79.670  10.549  19.655  1.00  0.82           C  
ATOM   9692  C   GLU B 358      81.077  10.978  19.231  1.00  0.82           C  
ATOM   9693  O   GLU B 358      81.900  11.381  20.050  1.00  0.82           O  
ATOM   9694  CB  GLU B 358      79.805   9.337  20.615  1.00  0.82           C  
ATOM   9695  CG  GLU B 358      78.461   8.784  21.177  1.00  0.82           C  
ATOM   9696  CD  GLU B 358      77.737   9.564  22.269  1.00  0.82           C  
ATOM   9697  OE1 GLU B 358      78.335  10.390  23.002  1.00  0.82           O  
ATOM   9698  OE2 GLU B 358      76.531   9.272  22.503  1.00  0.82           O  
ATOM   9699  N   ARG B 359      81.378  10.917  17.914  1.00  0.81           N  
ATOM   9700  CA  ARG B 359      82.586  11.449  17.292  1.00  0.81           C  
ATOM   9701  C   ARG B 359      83.861  10.709  17.652  1.00  0.81           C  
ATOM   9702  O   ARG B 359      84.965  11.241  17.552  1.00  0.81           O  
ATOM   9703  CB  ARG B 359      82.769  12.975  17.532  1.00  0.81           C  
ATOM   9704  CG  ARG B 359      81.571  13.860  17.126  1.00  0.81           C  
ATOM   9705  CD  ARG B 359      81.548  14.308  15.657  1.00  0.81           C  
ATOM   9706  NE  ARG B 359      81.305  13.116  14.778  1.00  0.81           N  
ATOM   9707  CZ  ARG B 359      81.894  12.886  13.597  1.00  0.81           C  
ATOM   9708  NH1 ARG B 359      82.617  13.821  12.994  1.00  0.81           N  
ATOM   9709  NH2 ARG B 359      81.750  11.709  13.004  1.00  0.81           N  
ATOM   9710  N   MET B 360      83.732   9.434  18.045  1.00  0.82           N  
ATOM   9711  CA  MET B 360      84.845   8.549  18.292  1.00  0.82           C  
ATOM   9712  C   MET B 360      85.543   8.157  17.000  1.00  0.82           C  
ATOM   9713  O   MET B 360      84.918   8.046  15.945  1.00  0.82           O  
ATOM   9714  CB  MET B 360      84.314   7.301  19.033  1.00  0.82           C  
ATOM   9715  CG  MET B 360      85.360   6.476  19.802  1.00  0.82           C  
ATOM   9716  SD  MET B 360      84.634   5.123  20.781  1.00  0.82           S  
ATOM   9717  CE  MET B 360      83.596   6.093  21.910  1.00  0.82           C  
ATOM   9718  N   ASP B 361      86.871   7.932  17.027  1.00  0.85           N  
ATOM   9719  CA  ASP B 361      87.572   7.357  15.905  1.00  0.85           C  
ATOM   9720  C   ASP B 361      87.118   5.925  15.630  1.00  0.85           C  
ATOM   9721  O   ASP B 361      86.593   5.229  16.504  1.00  0.85           O  
ATOM   9722  CB  ASP B 361      89.101   7.478  16.096  1.00  0.85           C  
ATOM   9723  CG  ASP B 361      89.537   6.618  17.257  1.00  0.85           C  
ATOM   9724  OD1 ASP B 361      89.576   7.130  18.405  1.00  0.85           O  
ATOM   9725  OD2 ASP B 361      89.774   5.408  17.008  1.00  0.85           O  
ATOM   9726  N   TRP B 362      87.276   5.455  14.380  1.00  0.85           N  
ATOM   9727  CA  TRP B 362      86.813   4.138  14.006  1.00  0.85           C  
ATOM   9728  C   TRP B 362      87.495   3.018  14.779  1.00  0.85           C  
ATOM   9729  O   TRP B 362      86.840   2.077  15.222  1.00  0.85           O  
ATOM   9730  CB  TRP B 362      87.016   3.903  12.482  1.00  0.85           C  
ATOM   9731  CG  TRP B 362      86.604   2.524  11.980  1.00  0.85           C  
ATOM   9732  CD1 TRP B 362      87.282   1.343  12.121  1.00  0.85           C  
ATOM   9733  CD2 TRP B 362      85.354   2.178  11.357  1.00  0.85           C  
ATOM   9734  NE1 TRP B 362      86.556   0.290  11.621  1.00  0.85           N  
ATOM   9735  CE2 TRP B 362      85.366   0.793  11.155  1.00  0.85           C  
ATOM   9736  CE3 TRP B 362      84.256   2.958  10.993  1.00  0.85           C  
ATOM   9737  CZ2 TRP B 362      84.291   0.135  10.584  1.00  0.85           C  
ATOM   9738  CZ3 TRP B 362      83.164   2.295  10.410  1.00  0.85           C  
ATOM   9739  CH2 TRP B 362      83.186   0.909  10.205  1.00  0.85           C  
ATOM   9740  N   ASP B 363      88.824   3.079  14.943  1.00  0.86           N  
ATOM   9741  CA  ASP B 363      89.588   1.984  15.489  1.00  0.86           C  
ATOM   9742  C   ASP B 363      89.304   1.811  16.986  1.00  0.86           C  
ATOM   9743  O   ASP B 363      89.075   0.696  17.466  1.00  0.86           O  
ATOM   9744  CB  ASP B 363      91.083   2.164  15.118  1.00  0.86           C  
ATOM   9745  CG  ASP B 363      91.290   2.216  13.604  1.00  0.86           C  
ATOM   9746  OD1 ASP B 363      90.514   1.577  12.843  1.00  0.86           O  
ATOM   9747  OD2 ASP B 363      92.234   2.912  13.164  1.00  0.86           O  
ATOM   9748  N   LYS B 364      89.207   2.917  17.756  1.00  0.83           N  
ATOM   9749  CA  LYS B 364      88.750   2.914  19.135  1.00  0.83           C  
ATOM   9750  C   LYS B 364      87.306   2.452  19.279  1.00  0.83           C  
ATOM   9751  O   LYS B 364      86.972   1.662  20.163  1.00  0.83           O  
ATOM   9752  CB  LYS B 364      88.925   4.309  19.796  1.00  0.83           C  
ATOM   9753  CG  LYS B 364      88.574   4.351  21.294  1.00  0.83           C  
ATOM   9754  CD  LYS B 364      88.794   5.722  21.970  1.00  0.83           C  
ATOM   9755  CE  LYS B 364      88.348   5.681  23.442  1.00  0.83           C  
ATOM   9756  NZ  LYS B 364      88.605   6.927  24.206  1.00  0.83           N  
ATOM   9757  N   ALA B 365      86.400   2.903  18.388  1.00  0.91           N  
ATOM   9758  CA  ALA B 365      85.024   2.457  18.366  1.00  0.91           C  
ATOM   9759  C   ALA B 365      84.870   0.972  18.068  1.00  0.91           C  
ATOM   9760  O   ALA B 365      84.042   0.283  18.653  1.00  0.91           O  
ATOM   9761  CB  ALA B 365      84.218   3.299  17.362  1.00  0.91           C  
ATOM   9762  N   TRP B 366      85.688   0.433  17.146  1.00  0.88           N  
ATOM   9763  CA  TRP B 366      85.717  -0.972  16.813  1.00  0.88           C  
ATOM   9764  C   TRP B 366      86.170  -1.855  17.968  1.00  0.88           C  
ATOM   9765  O   TRP B 366      85.552  -2.886  18.221  1.00  0.88           O  
ATOM   9766  CB  TRP B 366      86.531  -1.197  15.513  1.00  0.88           C  
ATOM   9767  CG  TRP B 366      86.457  -2.595  14.940  1.00  0.88           C  
ATOM   9768  CD1 TRP B 366      87.459  -3.509  14.790  1.00  0.88           C  
ATOM   9769  CD2 TRP B 366      85.261  -3.261  14.470  1.00  0.88           C  
ATOM   9770  NE1 TRP B 366      86.982  -4.698  14.259  1.00  0.88           N  
ATOM   9771  CE2 TRP B 366      85.619  -4.532  14.064  1.00  0.88           C  
ATOM   9772  CE3 TRP B 366      83.940  -2.814  14.398  1.00  0.88           C  
ATOM   9773  CZ2 TRP B 366      84.679  -5.436  13.559  1.00  0.88           C  
ATOM   9774  CZ3 TRP B 366      82.979  -3.716  13.919  1.00  0.88           C  
ATOM   9775  CH2 TRP B 366      83.341  -4.998  13.501  1.00  0.88           C  
ATOM   9776  N   ASP B 367      87.197  -1.451  18.753  1.00  0.89           N  
ATOM   9777  CA  ASP B 367      87.585  -2.156  19.972  1.00  0.89           C  
ATOM   9778  C   ASP B 367      86.428  -2.223  20.979  1.00  0.89           C  
ATOM   9779  O   ASP B 367      86.091  -3.286  21.504  1.00  0.89           O  
ATOM   9780  CB  ASP B 367      88.850  -1.474  20.581  1.00  0.89           C  
ATOM   9781  CG  ASP B 367      89.189  -1.968  21.981  1.00  0.89           C  
ATOM   9782  OD1 ASP B 367      89.264  -3.196  22.230  1.00  0.89           O  
ATOM   9783  OD2 ASP B 367      89.271  -1.102  22.888  1.00  0.89           O  
ATOM   9784  N   VAL B 368      85.735  -1.089  21.207  1.00  0.92           N  
ATOM   9785  CA  VAL B 368      84.569  -1.031  22.073  1.00  0.92           C  
ATOM   9786  C   VAL B 368      83.421  -1.911  21.581  1.00  0.92           C  
ATOM   9787  O   VAL B 368      82.788  -2.631  22.345  1.00  0.92           O  
ATOM   9788  CB  VAL B 368      84.095   0.409  22.251  1.00  0.92           C  
ATOM   9789  CG1 VAL B 368      82.759   0.480  23.020  1.00  0.92           C  
ATOM   9790  CG2 VAL B 368      85.165   1.210  23.022  1.00  0.92           C  
ATOM   9791  N   THR B 369      83.132  -1.895  20.266  1.00  0.94           N  
ATOM   9792  CA  THR B 369      82.115  -2.750  19.664  1.00  0.94           C  
ATOM   9793  C   THR B 369      82.409  -4.229  19.779  1.00  0.94           C  
ATOM   9794  O   THR B 369      81.548  -5.002  20.191  1.00  0.94           O  
ATOM   9795  CB  THR B 369      81.906  -2.397  18.201  1.00  0.94           C  
ATOM   9796  OG1 THR B 369      81.312  -1.112  18.112  1.00  0.94           O  
ATOM   9797  CG2 THR B 369      80.943  -3.358  17.491  1.00  0.94           C  
ATOM   9798  N   VAL B 370      83.649  -4.661  19.469  1.00  0.94           N  
ATOM   9799  CA  VAL B 370      84.046  -6.058  19.557  1.00  0.94           C  
ATOM   9800  C   VAL B 370      84.045  -6.575  20.985  1.00  0.94           C  
ATOM   9801  O   VAL B 370      83.586  -7.683  21.232  1.00  0.94           O  
ATOM   9802  CB  VAL B 370      85.388  -6.318  18.874  1.00  0.94           C  
ATOM   9803  CG1 VAL B 370      85.812  -7.798  19.003  1.00  0.94           C  
ATOM   9804  CG2 VAL B 370      85.277  -5.979  17.372  1.00  0.94           C  
ATOM   9805  N   ARG B 371      84.525  -5.793  21.977  1.00  0.90           N  
ATOM   9806  CA  ARG B 371      84.511  -6.225  23.366  1.00  0.90           C  
ATOM   9807  C   ARG B 371      83.132  -6.175  24.035  1.00  0.90           C  
ATOM   9808  O   ARG B 371      82.908  -6.817  25.058  1.00  0.90           O  
ATOM   9809  CB  ARG B 371      85.502  -5.379  24.212  1.00  0.90           C  
ATOM   9810  CG  ARG B 371      86.995  -5.688  23.970  1.00  0.90           C  
ATOM   9811  CD  ARG B 371      87.947  -5.067  25.010  1.00  0.90           C  
ATOM   9812  NE  ARG B 371      88.088  -3.602  24.729  1.00  0.90           N  
ATOM   9813  CZ  ARG B 371      88.003  -2.619  25.637  1.00  0.90           C  
ATOM   9814  NH1 ARG B 371      87.688  -2.845  26.913  1.00  0.90           N  
ATOM   9815  NH2 ARG B 371      88.241  -1.367  25.265  1.00  0.90           N  
ATOM   9816  N   THR B 372      82.173  -5.394  23.494  1.00  0.96           N  
ATOM   9817  CA  THR B 372      80.793  -5.386  23.986  1.00  0.96           C  
ATOM   9818  C   THR B 372      79.978  -6.573  23.485  1.00  0.96           C  
ATOM   9819  O   THR B 372      79.183  -7.161  24.224  1.00  0.96           O  
ATOM   9820  CB  THR B 372      80.032  -4.110  23.613  1.00  0.96           C  
ATOM   9821  OG1 THR B 372      80.643  -2.950  24.149  1.00  0.96           O  
ATOM   9822  CG2 THR B 372      78.615  -4.103  24.195  1.00  0.96           C  
ATOM   9823  N   CYS B 373      80.118  -6.935  22.195  1.00  0.97           N  
ATOM   9824  CA  CYS B 373      79.220  -7.861  21.528  1.00  0.97           C  
ATOM   9825  C   CYS B 373      79.674  -9.311  21.522  1.00  0.97           C  
ATOM   9826  O   CYS B 373      80.837  -9.644  21.312  1.00  0.97           O  
ATOM   9827  CB  CYS B 373      78.955  -7.427  20.067  1.00  0.97           C  
ATOM   9828  SG  CYS B 373      78.084  -5.820  20.003  1.00  0.97           S  
ATOM   9829  N   ALA B 374      78.716 -10.235  21.715  1.00  0.99           N  
ATOM   9830  CA  ALA B 374      78.961 -11.653  21.588  1.00  0.99           C  
ATOM   9831  C   ALA B 374      77.819 -12.312  20.831  1.00  0.99           C  
ATOM   9832  O   ALA B 374      76.678 -11.867  20.891  1.00  0.99           O  
ATOM   9833  CB  ALA B 374      79.152 -12.300  22.969  1.00  0.99           C  
ATOM   9834  N   TYR B 375      78.111 -13.387  20.067  1.00  0.97           N  
ATOM   9835  CA  TYR B 375      77.163 -14.012  19.154  1.00  0.97           C  
ATOM   9836  C   TYR B 375      76.901 -15.484  19.463  1.00  0.97           C  
ATOM   9837  O   TYR B 375      77.808 -16.305  19.569  1.00  0.97           O  
ATOM   9838  CB  TYR B 375      77.687 -13.823  17.696  1.00  0.97           C  
ATOM   9839  CG  TYR B 375      77.105 -14.728  16.622  1.00  0.97           C  
ATOM   9840  CD1 TYR B 375      75.720 -14.879  16.425  1.00  0.97           C  
ATOM   9841  CD2 TYR B 375      77.982 -15.405  15.757  1.00  0.97           C  
ATOM   9842  CE1 TYR B 375      75.233 -15.731  15.421  1.00  0.97           C  
ATOM   9843  CE2 TYR B 375      77.497 -16.226  14.732  1.00  0.97           C  
ATOM   9844  CZ  TYR B 375      76.122 -16.402  14.576  1.00  0.97           C  
ATOM   9845  OH  TYR B 375      75.648 -17.254  13.560  1.00  0.97           O  
ATOM   9846  N   THR B 376      75.603 -15.849  19.543  1.00  0.98           N  
ATOM   9847  CA  THR B 376      75.170 -17.226  19.749  1.00  0.98           C  
ATOM   9848  C   THR B 376      74.591 -17.795  18.473  1.00  0.98           C  
ATOM   9849  O   THR B 376      73.603 -17.287  17.951  1.00  0.98           O  
ATOM   9850  CB  THR B 376      74.087 -17.360  20.811  1.00  0.98           C  
ATOM   9851  OG1 THR B 376      74.549 -16.827  22.043  1.00  0.98           O  
ATOM   9852  CG2 THR B 376      73.736 -18.836  21.051  1.00  0.98           C  
ATOM   9853  N   ASN B 377      75.178 -18.886  17.939  1.00  0.94           N  
ATOM   9854  CA  ASN B 377      74.677 -19.571  16.758  1.00  0.94           C  
ATOM   9855  C   ASN B 377      73.828 -20.776  17.154  1.00  0.94           C  
ATOM   9856  O   ASN B 377      74.253 -21.635  17.921  1.00  0.94           O  
ATOM   9857  CB  ASN B 377      75.855 -20.013  15.841  1.00  0.94           C  
ATOM   9858  CG  ASN B 377      75.397 -20.883  14.671  1.00  0.94           C  
ATOM   9859  OD1 ASN B 377      75.236 -22.089  14.823  1.00  0.94           O  
ATOM   9860  ND2 ASN B 377      75.112 -20.270  13.507  1.00  0.94           N  
ATOM   9861  N   HIS B 378      72.617 -20.879  16.559  1.00  0.92           N  
ATOM   9862  CA  HIS B 378      71.674 -21.922  16.899  1.00  0.92           C  
ATOM   9863  C   HIS B 378      71.423 -22.923  15.781  1.00  0.92           C  
ATOM   9864  O   HIS B 378      70.536 -23.760  15.910  1.00  0.92           O  
ATOM   9865  CB  HIS B 378      70.305 -21.292  17.226  1.00  0.92           C  
ATOM   9866  CG  HIS B 378      70.378 -20.296  18.333  1.00  0.92           C  
ATOM   9867  ND1 HIS B 378      70.103 -20.678  19.637  1.00  0.92           N  
ATOM   9868  CD2 HIS B 378      70.665 -18.979  18.279  1.00  0.92           C  
ATOM   9869  CE1 HIS B 378      70.223 -19.575  20.339  1.00  0.92           C  
ATOM   9870  NE2 HIS B 378      70.565 -18.513  19.570  1.00  0.92           N  
ATOM   9871  N   THR B 379      72.167 -22.888  14.654  1.00  0.89           N  
ATOM   9872  CA  THR B 379      71.885 -23.803  13.547  1.00  0.89           C  
ATOM   9873  C   THR B 379      72.997 -23.784  12.515  1.00  0.89           C  
ATOM   9874  O   THR B 379      73.664 -22.779  12.303  1.00  0.89           O  
ATOM   9875  CB  THR B 379      70.540 -23.545  12.853  1.00  0.89           C  
ATOM   9876  OG1 THR B 379      70.274 -24.435  11.768  1.00  0.89           O  
ATOM   9877  CG2 THR B 379      70.454 -22.105  12.334  1.00  0.89           C  
ATOM   9878  N   VAL B 380      73.202 -24.932  11.825  1.00  0.87           N  
ATOM   9879  CA  VAL B 380      74.168 -25.061  10.747  1.00  0.87           C  
ATOM   9880  C   VAL B 380      73.480 -25.203   9.401  1.00  0.87           C  
ATOM   9881  O   VAL B 380      74.130 -25.342   8.367  1.00  0.87           O  
ATOM   9882  CB  VAL B 380      75.094 -26.267  10.927  1.00  0.87           C  
ATOM   9883  CG1 VAL B 380      75.813 -26.171  12.283  1.00  0.87           C  
ATOM   9884  CG2 VAL B 380      74.327 -27.603  10.835  1.00  0.87           C  
ATOM   9885  N   LEU B 381      72.132 -25.187   9.373  1.00  0.83           N  
ATOM   9886  CA  LEU B 381      71.369 -25.469   8.171  1.00  0.83           C  
ATOM   9887  C   LEU B 381      71.355 -24.281   7.198  1.00  0.83           C  
ATOM   9888  O   LEU B 381      70.982 -23.186   7.620  1.00  0.83           O  
ATOM   9889  CB  LEU B 381      69.913 -25.880   8.505  1.00  0.83           C  
ATOM   9890  CG  LEU B 381      69.764 -27.185   9.323  1.00  0.83           C  
ATOM   9891  CD1 LEU B 381      68.277 -27.453   9.609  1.00  0.83           C  
ATOM   9892  CD2 LEU B 381      70.367 -28.399   8.594  1.00  0.83           C  
ATOM   9893  N   PRO B 382      71.727 -24.392   5.912  1.00  0.86           N  
ATOM   9894  CA  PRO B 382      71.918 -23.246   5.022  1.00  0.86           C  
ATOM   9895  C   PRO B 382      70.708 -22.364   4.817  1.00  0.86           C  
ATOM   9896  O   PRO B 382      70.868 -21.162   4.610  1.00  0.86           O  
ATOM   9897  CB  PRO B 382      72.346 -23.875   3.687  1.00  0.86           C  
ATOM   9898  CG  PRO B 382      73.073 -25.149   4.111  1.00  0.86           C  
ATOM   9899  CD  PRO B 382      72.258 -25.617   5.317  1.00  0.86           C  
ATOM   9900  N   GLU B 383      69.489 -22.927   4.852  1.00  0.83           N  
ATOM   9901  CA  GLU B 383      68.265 -22.191   4.673  1.00  0.83           C  
ATOM   9902  C   GLU B 383      67.874 -21.355   5.880  1.00  0.83           C  
ATOM   9903  O   GLU B 383      66.994 -20.503   5.789  1.00  0.83           O  
ATOM   9904  CB  GLU B 383      67.103 -23.150   4.308  1.00  0.83           C  
ATOM   9905  CG  GLU B 383      66.750 -24.239   5.364  1.00  0.83           C  
ATOM   9906  CD  GLU B 383      67.585 -25.520   5.288  1.00  0.83           C  
ATOM   9907  OE1 GLU B 383      68.614 -25.591   4.561  1.00  0.83           O  
ATOM   9908  OE2 GLU B 383      67.167 -26.541   5.898  1.00  0.83           O  
ATOM   9909  N   ALA B 384      68.520 -21.562   7.046  1.00  0.88           N  
ATOM   9910  CA  ALA B 384      68.193 -20.856   8.260  1.00  0.88           C  
ATOM   9911  C   ALA B 384      69.101 -19.669   8.527  1.00  0.88           C  
ATOM   9912  O   ALA B 384      68.862 -18.889   9.444  1.00  0.88           O  
ATOM   9913  CB  ALA B 384      68.348 -21.843   9.427  1.00  0.88           C  
ATOM   9914  N   LEU B 385      70.157 -19.489   7.716  1.00  0.89           N  
ATOM   9915  CA  LEU B 385      71.178 -18.485   7.951  1.00  0.89           C  
ATOM   9916  C   LEU B 385      70.874 -17.219   7.185  1.00  0.89           C  
ATOM   9917  O   LEU B 385      70.628 -17.230   5.979  1.00  0.89           O  
ATOM   9918  CB  LEU B 385      72.564 -18.995   7.481  1.00  0.89           C  
ATOM   9919  CG  LEU B 385      73.356 -19.858   8.491  1.00  0.89           C  
ATOM   9920  CD1 LEU B 385      72.484 -20.685   9.449  1.00  0.89           C  
ATOM   9921  CD2 LEU B 385      74.318 -20.774   7.721  1.00  0.89           C  
ATOM   9922  N   GLU B 386      70.905 -16.068   7.879  1.00  0.89           N  
ATOM   9923  CA  GLU B 386      70.581 -14.800   7.281  1.00  0.89           C  
ATOM   9924  C   GLU B 386      71.602 -14.226   6.327  1.00  0.89           C  
ATOM   9925  O   GLU B 386      72.785 -14.034   6.617  1.00  0.89           O  
ATOM   9926  CB  GLU B 386      70.238 -13.767   8.345  1.00  0.89           C  
ATOM   9927  CG  GLU B 386      69.160 -14.315   9.295  1.00  0.89           C  
ATOM   9928  CD  GLU B 386      68.629 -13.248  10.231  1.00  0.89           C  
ATOM   9929  OE1 GLU B 386      69.452 -12.642  10.955  1.00  0.89           O  
ATOM   9930  OE2 GLU B 386      67.389 -13.115  10.312  1.00  0.89           O  
ATOM   9931  N   ARG B 387      71.112 -13.930   5.114  1.00  0.85           N  
ATOM   9932  CA  ARG B 387      71.916 -13.462   4.020  1.00  0.85           C  
ATOM   9933  C   ARG B 387      71.109 -12.426   3.268  1.00  0.85           C  
ATOM   9934  O   ARG B 387      70.500 -12.692   2.227  1.00  0.85           O  
ATOM   9935  CB  ARG B 387      72.315 -14.608   3.062  1.00  0.85           C  
ATOM   9936  CG  ARG B 387      72.986 -15.816   3.743  1.00  0.85           C  
ATOM   9937  CD  ARG B 387      73.505 -16.859   2.755  1.00  0.85           C  
ATOM   9938  NE  ARG B 387      72.313 -17.374   2.011  1.00  0.85           N  
ATOM   9939  CZ  ARG B 387      72.316 -17.671   0.708  1.00  0.85           C  
ATOM   9940  NH1 ARG B 387      73.433 -17.751   0.006  1.00  0.85           N  
ATOM   9941  NH2 ARG B 387      71.162 -17.938   0.100  1.00  0.85           N  
ATOM   9942  N   TRP B 388      71.055 -11.203   3.825  1.00  0.89           N  
ATOM   9943  CA  TRP B 388      70.265 -10.116   3.287  1.00  0.89           C  
ATOM   9944  C   TRP B 388      70.829  -9.580   1.973  1.00  0.89           C  
ATOM   9945  O   TRP B 388      72.007  -9.221   1.944  1.00  0.89           O  
ATOM   9946  CB  TRP B 388      70.127  -8.940   4.285  1.00  0.89           C  
ATOM   9947  CG  TRP B 388      69.352  -9.291   5.539  1.00  0.89           C  
ATOM   9948  CD1 TRP B 388      69.813  -9.494   6.806  1.00  0.89           C  
ATOM   9949  CD2 TRP B 388      67.927  -9.453   5.607  1.00  0.89           C  
ATOM   9950  NE1 TRP B 388      68.781  -9.844   7.646  1.00  0.89           N  
ATOM   9951  CE2 TRP B 388      67.614  -9.807   6.934  1.00  0.89           C  
ATOM   9952  CE3 TRP B 388      66.933  -9.308   4.650  1.00  0.89           C  
ATOM   9953  CZ2 TRP B 388      66.306 -10.032   7.328  1.00  0.89           C  
ATOM   9954  CZ3 TRP B 388      65.608  -9.520   5.050  1.00  0.89           C  
ATOM   9955  CH2 TRP B 388      65.298  -9.897   6.364  1.00  0.89           C  
ATOM   9956  N   PRO B 389      70.091  -9.517   0.861  1.00  0.94           N  
ATOM   9957  CA  PRO B 389      70.568  -8.926  -0.383  1.00  0.94           C  
ATOM   9958  C   PRO B 389      70.980  -7.470  -0.237  1.00  0.94           C  
ATOM   9959  O   PRO B 389      70.316  -6.710   0.467  1.00  0.94           O  
ATOM   9960  CB  PRO B 389      69.411  -9.139  -1.366  1.00  0.94           C  
ATOM   9961  CG  PRO B 389      68.163  -9.228  -0.489  1.00  0.94           C  
ATOM   9962  CD  PRO B 389      68.691  -9.930   0.759  1.00  0.94           C  
ATOM   9963  N   VAL B 390      72.091  -7.058  -0.880  1.00  0.91           N  
ATOM   9964  CA  VAL B 390      72.657  -5.729  -0.698  1.00  0.91           C  
ATOM   9965  C   VAL B 390      71.755  -4.588  -1.114  1.00  0.91           C  
ATOM   9966  O   VAL B 390      71.707  -3.573  -0.433  1.00  0.91           O  
ATOM   9967  CB  VAL B 390      74.028  -5.525  -1.324  1.00  0.91           C  
ATOM   9968  CG1 VAL B 390      75.038  -6.487  -0.676  1.00  0.91           C  
ATOM   9969  CG2 VAL B 390      73.992  -5.712  -2.851  1.00  0.91           C  
ATOM   9970  N   HIS B 391      70.975  -4.734  -2.208  1.00  0.86           N  
ATOM   9971  CA  HIS B 391      70.063  -3.710  -2.681  1.00  0.86           C  
ATOM   9972  C   HIS B 391      68.993  -3.357  -1.660  1.00  0.86           C  
ATOM   9973  O   HIS B 391      68.581  -2.209  -1.522  1.00  0.86           O  
ATOM   9974  CB  HIS B 391      69.383  -4.148  -4.002  1.00  0.86           C  
ATOM   9975  CG  HIS B 391      68.516  -5.373  -3.907  1.00  0.86           C  
ATOM   9976  ND1 HIS B 391      69.085  -6.627  -4.016  1.00  0.86           N  
ATOM   9977  CD2 HIS B 391      67.167  -5.478  -3.780  1.00  0.86           C  
ATOM   9978  CE1 HIS B 391      68.070  -7.468  -3.968  1.00  0.86           C  
ATOM   9979  NE2 HIS B 391      66.887  -6.827  -3.819  1.00  0.86           N  
ATOM   9980  N   LEU B 392      68.514  -4.360  -0.898  1.00  0.90           N  
ATOM   9981  CA  LEU B 392      67.572  -4.155   0.180  1.00  0.90           C  
ATOM   9982  C   LEU B 392      68.159  -3.368   1.343  1.00  0.90           C  
ATOM   9983  O   LEU B 392      67.566  -2.408   1.832  1.00  0.90           O  
ATOM   9984  CB  LEU B 392      67.060  -5.535   0.642  1.00  0.90           C  
ATOM   9985  CG  LEU B 392      65.924  -5.518   1.678  1.00  0.90           C  
ATOM   9986  CD1 LEU B 392      64.716  -4.723   1.170  1.00  0.90           C  
ATOM   9987  CD2 LEU B 392      65.505  -6.956   2.021  1.00  0.90           C  
ATOM   9988  N   LEU B 393      69.388  -3.719   1.774  1.00  0.92           N  
ATOM   9989  CA  LEU B 393      70.109  -2.981   2.794  1.00  0.92           C  
ATOM   9990  C   LEU B 393      70.453  -1.568   2.354  1.00  0.92           C  
ATOM   9991  O   LEU B 393      70.328  -0.631   3.135  1.00  0.92           O  
ATOM   9992  CB  LEU B 393      71.402  -3.716   3.215  1.00  0.92           C  
ATOM   9993  CG  LEU B 393      71.180  -5.005   4.032  1.00  0.92           C  
ATOM   9994  CD1 LEU B 393      72.493  -5.789   4.127  1.00  0.92           C  
ATOM   9995  CD2 LEU B 393      70.673  -4.708   5.452  1.00  0.92           C  
ATOM   9996  N   GLU B 394      70.864  -1.382   1.088  1.00  0.87           N  
ATOM   9997  CA  GLU B 394      71.187  -0.106   0.485  1.00  0.87           C  
ATOM   9998  C   GLU B 394      70.036   0.876   0.457  1.00  0.87           C  
ATOM   9999  O   GLU B 394      70.171   2.018   0.886  1.00  0.87           O  
ATOM  10000  CB  GLU B 394      71.674  -0.387  -0.950  1.00  0.87           C  
ATOM  10001  CG  GLU B 394      72.126   0.837  -1.776  1.00  0.87           C  
ATOM  10002  CD  GLU B 394      73.149   0.416  -2.829  1.00  0.87           C  
ATOM  10003  OE1 GLU B 394      72.949  -0.651  -3.469  1.00  0.87           O  
ATOM  10004  OE2 GLU B 394      74.165   1.144  -2.969  1.00  0.87           O  
ATOM  10005  N   THR B 395      68.844   0.436   0.018  1.00  0.91           N  
ATOM  10006  CA  THR B 395      67.636   1.245   0.100  1.00  0.91           C  
ATOM  10007  C   THR B 395      67.169   1.527   1.523  1.00  0.91           C  
ATOM  10008  O   THR B 395      66.854   2.662   1.869  1.00  0.91           O  
ATOM  10009  CB  THR B 395      66.491   0.586  -0.655  1.00  0.91           C  
ATOM  10010  OG1 THR B 395      66.825   0.470  -2.029  1.00  0.91           O  
ATOM  10011  CG2 THR B 395      65.207   1.422  -0.599  1.00  0.91           C  
ATOM  10012  N   LEU B 396      67.095   0.503   2.402  1.00  0.91           N  
ATOM  10013  CA  LEU B 396      66.535   0.659   3.735  1.00  0.91           C  
ATOM  10014  C   LEU B 396      67.456   1.315   4.756  1.00  0.91           C  
ATOM  10015  O   LEU B 396      67.022   2.096   5.593  1.00  0.91           O  
ATOM  10016  CB  LEU B 396      66.061  -0.702   4.293  1.00  0.91           C  
ATOM  10017  CG  LEU B 396      65.274  -0.626   5.622  1.00  0.91           C  
ATOM  10018  CD1 LEU B 396      63.968   0.164   5.464  1.00  0.91           C  
ATOM  10019  CD2 LEU B 396      64.991  -2.035   6.152  1.00  0.91           C  
ATOM  10020  N   LEU B 397      68.760   0.989   4.718  1.00  0.93           N  
ATOM  10021  CA  LEU B 397      69.718   1.394   5.731  1.00  0.93           C  
ATOM  10022  C   LEU B 397      71.061   1.758   5.086  1.00  0.93           C  
ATOM  10023  O   LEU B 397      72.064   1.079   5.343  1.00  0.93           O  
ATOM  10024  CB  LEU B 397      69.968   0.243   6.742  1.00  0.93           C  
ATOM  10025  CG  LEU B 397      68.733  -0.281   7.505  1.00  0.93           C  
ATOM  10026  CD1 LEU B 397      69.127  -1.508   8.338  1.00  0.93           C  
ATOM  10027  CD2 LEU B 397      68.118   0.785   8.425  1.00  0.93           C  
ATOM  10028  N   PRO B 398      71.172   2.795   4.244  1.00  0.93           N  
ATOM  10029  CA  PRO B 398      72.337   3.029   3.389  1.00  0.93           C  
ATOM  10030  C   PRO B 398      73.623   3.226   4.166  1.00  0.93           C  
ATOM  10031  O   PRO B 398      74.680   2.772   3.750  1.00  0.93           O  
ATOM  10032  CB  PRO B 398      71.972   4.295   2.590  1.00  0.93           C  
ATOM  10033  CG  PRO B 398      70.897   4.982   3.437  1.00  0.93           C  
ATOM  10034  CD  PRO B 398      70.129   3.798   4.017  1.00  0.93           C  
ATOM  10035  N   ARG B 399      73.546   3.915   5.317  1.00  0.89           N  
ATOM  10036  CA  ARG B 399      74.655   4.147   6.211  1.00  0.89           C  
ATOM  10037  C   ARG B 399      75.224   2.875   6.804  1.00  0.89           C  
ATOM  10038  O   ARG B 399      76.437   2.679   6.813  1.00  0.89           O  
ATOM  10039  CB  ARG B 399      74.155   5.072   7.337  1.00  0.89           C  
ATOM  10040  CG  ARG B 399      75.137   5.361   8.490  1.00  0.89           C  
ATOM  10041  CD  ARG B 399      76.249   6.403   8.273  1.00  0.89           C  
ATOM  10042  NE  ARG B 399      77.358   5.858   7.414  1.00  0.89           N  
ATOM  10043  CZ  ARG B 399      78.664   6.014   7.682  1.00  0.89           C  
ATOM  10044  NH1 ARG B 399      79.136   6.423   8.846  1.00  0.89           N  
ATOM  10045  NH2 ARG B 399      79.537   5.772   6.704  1.00  0.89           N  
ATOM  10046  N   HIS B 400      74.360   1.954   7.271  1.00  0.93           N  
ATOM  10047  CA  HIS B 400      74.759   0.672   7.808  1.00  0.93           C  
ATOM  10048  C   HIS B 400      75.456  -0.189   6.788  1.00  0.93           C  
ATOM  10049  O   HIS B 400      76.433  -0.847   7.107  1.00  0.93           O  
ATOM  10050  CB  HIS B 400      73.572  -0.100   8.409  1.00  0.93           C  
ATOM  10051  CG  HIS B 400      73.005   0.629   9.581  1.00  0.93           C  
ATOM  10052  ND1 HIS B 400      72.143   1.692   9.388  1.00  0.93           N  
ATOM  10053  CD2 HIS B 400      73.267   0.462  10.902  1.00  0.93           C  
ATOM  10054  CE1 HIS B 400      71.885   2.140  10.601  1.00  0.93           C  
ATOM  10055  NE2 HIS B 400      72.549   1.437  11.544  1.00  0.93           N  
ATOM  10056  N   LEU B 401      75.006  -0.167   5.517  1.00  0.93           N  
ATOM  10057  CA  LEU B 401      75.675  -0.854   4.429  1.00  0.93           C  
ATOM  10058  C   LEU B 401      77.089  -0.321   4.191  1.00  0.93           C  
ATOM  10059  O   LEU B 401      78.043  -1.083   4.045  1.00  0.93           O  
ATOM  10060  CB  LEU B 401      74.819  -0.749   3.142  1.00  0.93           C  
ATOM  10061  CG  LEU B 401      74.864  -1.938   2.145  1.00  0.93           C  
ATOM  10062  CD1 LEU B 401      74.843  -1.406   0.704  1.00  0.93           C  
ATOM  10063  CD2 LEU B 401      76.039  -2.913   2.322  1.00  0.93           C  
ATOM  10064  N   GLN B 402      77.284   1.017   4.238  1.00  0.90           N  
ATOM  10065  CA  GLN B 402      78.614   1.614   4.166  1.00  0.90           C  
ATOM  10066  C   GLN B 402      79.532   1.159   5.299  1.00  0.90           C  
ATOM  10067  O   GLN B 402      80.694   0.823   5.084  1.00  0.90           O  
ATOM  10068  CB  GLN B 402      78.582   3.164   4.201  1.00  0.90           C  
ATOM  10069  CG  GLN B 402      77.812   3.835   3.042  1.00  0.90           C  
ATOM  10070  CD  GLN B 402      77.844   5.352   3.205  1.00  0.90           C  
ATOM  10071  OE1 GLN B 402      78.213   5.871   4.266  1.00  0.90           O  
ATOM  10072  NE2 GLN B 402      77.455   6.093   2.142  1.00  0.90           N  
ATOM  10073  N   ILE B 403      79.002   1.106   6.537  1.00  0.94           N  
ATOM  10074  CA  ILE B 403      79.693   0.597   7.713  1.00  0.94           C  
ATOM  10075  C   ILE B 403      80.022  -0.887   7.580  1.00  0.94           C  
ATOM  10076  O   ILE B 403      81.136  -1.308   7.865  1.00  0.94           O  
ATOM  10077  CB  ILE B 403      78.890   0.915   8.974  1.00  0.94           C  
ATOM  10078  CG1 ILE B 403      78.827   2.452   9.167  1.00  0.94           C  
ATOM  10079  CG2 ILE B 403      79.481   0.245  10.237  1.00  0.94           C  
ATOM  10080  CD1 ILE B 403      77.914   2.884  10.315  1.00  0.94           C  
ATOM  10081  N   ILE B 404      79.086  -1.719   7.074  1.00  0.94           N  
ATOM  10082  CA  ILE B 404      79.310  -3.131   6.784  1.00  0.94           C  
ATOM  10083  C   ILE B 404      80.414  -3.337   5.749  1.00  0.94           C  
ATOM  10084  O   ILE B 404      81.285  -4.188   5.925  1.00  0.94           O  
ATOM  10085  CB  ILE B 404      78.011  -3.813   6.341  1.00  0.94           C  
ATOM  10086  CG1 ILE B 404      77.008  -3.912   7.520  1.00  0.94           C  
ATOM  10087  CG2 ILE B 404      78.280  -5.226   5.774  1.00  0.94           C  
ATOM  10088  CD1 ILE B 404      75.568  -4.198   7.067  1.00  0.94           C  
ATOM  10089  N   TYR B 405      80.443  -2.534   4.662  1.00  0.92           N  
ATOM  10090  CA  TYR B 405      81.516  -2.564   3.678  1.00  0.92           C  
ATOM  10091  C   TYR B 405      82.891  -2.194   4.247  1.00  0.92           C  
ATOM  10092  O   TYR B 405      83.869  -2.895   3.980  1.00  0.92           O  
ATOM  10093  CB  TYR B 405      81.193  -1.666   2.442  1.00  0.92           C  
ATOM  10094  CG  TYR B 405      80.175  -2.236   1.464  1.00  0.92           C  
ATOM  10095  CD1 TYR B 405      80.183  -3.585   1.054  1.00  0.92           C  
ATOM  10096  CD2 TYR B 405      79.262  -1.365   0.839  1.00  0.92           C  
ATOM  10097  CE1 TYR B 405      79.300  -4.045   0.061  1.00  0.92           C  
ATOM  10098  CE2 TYR B 405      78.380  -1.823  -0.153  1.00  0.92           C  
ATOM  10099  CZ  TYR B 405      78.396  -3.165  -0.539  1.00  0.92           C  
ATOM  10100  OH  TYR B 405      77.514  -3.626  -1.543  1.00  0.92           O  
ATOM  10101  N   GLU B 406      83.006  -1.137   5.086  1.00  0.89           N  
ATOM  10102  CA  GLU B 406      84.235  -0.799   5.802  1.00  0.89           C  
ATOM  10103  C   GLU B 406      84.664  -1.906   6.760  1.00  0.89           C  
ATOM  10104  O   GLU B 406      85.803  -2.350   6.743  1.00  0.89           O  
ATOM  10105  CB  GLU B 406      84.077   0.553   6.539  1.00  0.89           C  
ATOM  10106  CG  GLU B 406      85.194   0.974   7.536  1.00  0.89           C  
ATOM  10107  CD  GLU B 406      86.544   1.413   6.979  1.00  0.89           C  
ATOM  10108  OE1 GLU B 406      87.268   0.595   6.356  1.00  0.89           O  
ATOM  10109  OE2 GLU B 406      86.980   2.555   7.305  1.00  0.89           O  
ATOM  10110  N   ILE B 407      83.727  -2.480   7.556  1.00  0.93           N  
ATOM  10111  CA  ILE B 407      84.026  -3.612   8.432  1.00  0.93           C  
ATOM  10112  C   ILE B 407      84.568  -4.790   7.637  1.00  0.93           C  
ATOM  10113  O   ILE B 407      85.572  -5.398   8.012  1.00  0.93           O  
ATOM  10114  CB  ILE B 407      82.805  -4.067   9.242  1.00  0.93           C  
ATOM  10115  CG1 ILE B 407      82.373  -2.998  10.274  1.00  0.93           C  
ATOM  10116  CG2 ILE B 407      83.100  -5.399   9.978  1.00  0.93           C  
ATOM  10117  CD1 ILE B 407      81.005  -3.288  10.908  1.00  0.93           C  
ATOM  10118  N   ASN B 408      83.955  -5.102   6.476  1.00  0.91           N  
ATOM  10119  CA  ASN B 408      84.432  -6.137   5.587  1.00  0.91           C  
ATOM  10120  C   ASN B 408      85.839  -5.872   5.058  1.00  0.91           C  
ATOM  10121  O   ASN B 408      86.684  -6.755   5.092  1.00  0.91           O  
ATOM  10122  CB  ASN B 408      83.436  -6.316   4.412  1.00  0.91           C  
ATOM  10123  CG  ASN B 408      83.788  -7.557   3.602  1.00  0.91           C  
ATOM  10124  OD1 ASN B 408      84.010  -8.629   4.154  1.00  0.91           O  
ATOM  10125  ND2 ASN B 408      83.852  -7.426   2.259  1.00  0.91           N  
ATOM  10126  N   GLN B 409      86.149  -4.641   4.602  1.00  0.86           N  
ATOM  10127  CA  GLN B 409      87.482  -4.291   4.147  1.00  0.86           C  
ATOM  10128  C   GLN B 409      88.528  -4.401   5.247  1.00  0.86           C  
ATOM  10129  O   GLN B 409      89.590  -4.996   5.061  1.00  0.86           O  
ATOM  10130  CB  GLN B 409      87.477  -2.857   3.565  1.00  0.86           C  
ATOM  10131  CG  GLN B 409      88.847  -2.407   3.003  1.00  0.86           C  
ATOM  10132  CD  GLN B 409      88.796  -0.992   2.424  1.00  0.86           C  
ATOM  10133  OE1 GLN B 409      88.380  -0.777   1.290  1.00  0.86           O  
ATOM  10134  NE2 GLN B 409      89.262   0.004   3.216  1.00  0.86           N  
ATOM  10135  N   ARG B 410      88.235  -3.888   6.462  1.00  0.84           N  
ATOM  10136  CA  ARG B 410      89.131  -4.012   7.596  1.00  0.84           C  
ATOM  10137  C   ARG B 410      89.390  -5.469   7.974  1.00  0.84           C  
ATOM  10138  O   ARG B 410      90.524  -5.867   8.241  1.00  0.84           O  
ATOM  10139  CB  ARG B 410      88.605  -3.250   8.847  1.00  0.84           C  
ATOM  10140  CG  ARG B 410      88.361  -1.727   8.691  1.00  0.84           C  
ATOM  10141  CD  ARG B 410      89.550  -0.910   8.169  1.00  0.84           C  
ATOM  10142  NE  ARG B 410      89.179   0.531   8.231  1.00  0.84           N  
ATOM  10143  CZ  ARG B 410      89.356   1.340   9.284  1.00  0.84           C  
ATOM  10144  NH1 ARG B 410      90.083   0.941  10.326  1.00  0.84           N  
ATOM  10145  NH2 ARG B 410      88.786   2.537   9.294  1.00  0.84           N  
ATOM  10146  N   PHE B 411      88.333  -6.304   7.972  1.00  0.90           N  
ATOM  10147  CA  PHE B 411      88.420  -7.724   8.224  1.00  0.90           C  
ATOM  10148  C   PHE B 411      89.188  -8.497   7.150  1.00  0.90           C  
ATOM  10149  O   PHE B 411      90.090  -9.269   7.463  1.00  0.90           O  
ATOM  10150  CB  PHE B 411      86.978  -8.264   8.409  1.00  0.90           C  
ATOM  10151  CG  PHE B 411      86.958  -9.694   8.861  1.00  0.90           C  
ATOM  10152  CD1 PHE B 411      87.405 -10.050  10.143  1.00  0.90           C  
ATOM  10153  CD2 PHE B 411      86.511 -10.696   7.988  1.00  0.90           C  
ATOM  10154  CE1 PHE B 411      87.433 -11.393  10.537  1.00  0.90           C  
ATOM  10155  CE2 PHE B 411      86.543 -12.039   8.377  1.00  0.90           C  
ATOM  10156  CZ  PHE B 411      87.016 -12.389   9.646  1.00  0.90           C  
ATOM  10157  N   LEU B 412      88.910  -8.264   5.854  1.00  0.88           N  
ATOM  10158  CA  LEU B 412      89.584  -8.918   4.744  1.00  0.88           C  
ATOM  10159  C   LEU B 412      91.073  -8.621   4.671  1.00  0.88           C  
ATOM  10160  O   LEU B 412      91.880  -9.503   4.389  1.00  0.88           O  
ATOM  10161  CB  LEU B 412      88.857  -8.601   3.414  1.00  0.88           C  
ATOM  10162  CG  LEU B 412      88.082  -9.775   2.767  1.00  0.88           C  
ATOM  10163  CD1 LEU B 412      87.356 -10.687   3.773  1.00  0.88           C  
ATOM  10164  CD2 LEU B 412      87.066  -9.223   1.756  1.00  0.88           C  
ATOM  10165  N   ASN B 413      91.490  -7.381   4.998  1.00  0.85           N  
ATOM  10166  CA  ASN B 413      92.899  -7.032   5.126  1.00  0.85           C  
ATOM  10167  C   ASN B 413      93.607  -7.858   6.199  1.00  0.85           C  
ATOM  10168  O   ASN B 413      94.731  -8.317   6.015  1.00  0.85           O  
ATOM  10169  CB  ASN B 413      93.088  -5.528   5.454  1.00  0.85           C  
ATOM  10170  CG  ASN B 413      92.636  -4.660   4.282  1.00  0.85           C  
ATOM  10171  OD1 ASN B 413      92.750  -5.014   3.118  1.00  0.85           O  
ATOM  10172  ND2 ASN B 413      92.135  -3.439   4.602  1.00  0.85           N  
ATOM  10173  N   ARG B 414      92.945  -8.108   7.347  1.00  0.81           N  
ATOM  10174  CA  ARG B 414      93.447  -9.015   8.363  1.00  0.81           C  
ATOM  10175  C   ARG B 414      93.528 -10.469   7.901  1.00  0.81           C  
ATOM  10176  O   ARG B 414      94.496 -11.162   8.200  1.00  0.81           O  
ATOM  10177  CB  ARG B 414      92.597  -8.938   9.647  1.00  0.81           C  
ATOM  10178  CG  ARG B 414      92.665  -7.581  10.382  1.00  0.81           C  
ATOM  10179  CD  ARG B 414      91.605  -7.435  11.482  1.00  0.81           C  
ATOM  10180  NE  ARG B 414      91.808  -8.608  12.391  1.00  0.81           N  
ATOM  10181  CZ  ARG B 414      90.850  -9.362  12.934  1.00  0.81           C  
ATOM  10182  NH1 ARG B 414      89.571  -9.008  12.961  1.00  0.81           N  
ATOM  10183  NH2 ARG B 414      91.183 -10.507  13.516  1.00  0.81           N  
ATOM  10184  N   VAL B 415      92.523 -10.964   7.140  1.00  0.88           N  
ATOM  10185  CA  VAL B 415      92.547 -12.297   6.540  1.00  0.88           C  
ATOM  10186  C   VAL B 415      93.707 -12.454   5.568  1.00  0.88           C  
ATOM  10187  O   VAL B 415      94.430 -13.447   5.594  1.00  0.88           O  
ATOM  10188  CB  VAL B 415      91.244 -12.629   5.808  1.00  0.88           C  
ATOM  10189  CG1 VAL B 415      91.317 -14.028   5.156  1.00  0.88           C  
ATOM  10190  CG2 VAL B 415      90.055 -12.609   6.788  1.00  0.88           C  
ATOM  10191  N   ALA B 416      93.936 -11.436   4.717  1.00  0.89           N  
ATOM  10192  CA  ALA B 416      95.040 -11.367   3.789  1.00  0.89           C  
ATOM  10193  C   ALA B 416      96.402 -11.337   4.466  1.00  0.89           C  
ATOM  10194  O   ALA B 416      97.344 -11.981   4.014  1.00  0.89           O  
ATOM  10195  CB  ALA B 416      94.856 -10.127   2.891  1.00  0.89           C  
ATOM  10196  N   ALA B 417      96.534 -10.596   5.583  1.00  0.88           N  
ATOM  10197  CA  ALA B 417      97.733 -10.573   6.391  1.00  0.88           C  
ATOM  10198  C   ALA B 417      98.063 -11.903   7.060  1.00  0.88           C  
ATOM  10199  O   ALA B 417      99.208 -12.345   7.063  1.00  0.88           O  
ATOM  10200  CB  ALA B 417      97.576  -9.478   7.462  1.00  0.88           C  
ATOM  10201  N   ALA B 418      97.053 -12.578   7.642  1.00  0.88           N  
ATOM  10202  CA  ALA B 418      97.221 -13.879   8.248  1.00  0.88           C  
ATOM  10203  C   ALA B 418      97.502 -14.999   7.253  1.00  0.88           C  
ATOM  10204  O   ALA B 418      98.329 -15.874   7.501  1.00  0.88           O  
ATOM  10205  CB  ALA B 418      95.970 -14.209   9.078  1.00  0.88           C  
ATOM  10206  N   PHE B 419      96.816 -14.993   6.094  1.00  0.87           N  
ATOM  10207  CA  PHE B 419      96.953 -16.031   5.089  1.00  0.87           C  
ATOM  10208  C   PHE B 419      97.406 -15.447   3.745  1.00  0.87           C  
ATOM  10209  O   PHE B 419      96.618 -15.428   2.792  1.00  0.87           O  
ATOM  10210  CB  PHE B 419      95.613 -16.787   4.894  1.00  0.87           C  
ATOM  10211  CG  PHE B 419      95.134 -17.405   6.186  1.00  0.87           C  
ATOM  10212  CD1 PHE B 419      94.324 -16.669   7.071  1.00  0.87           C  
ATOM  10213  CD2 PHE B 419      95.457 -18.732   6.516  1.00  0.87           C  
ATOM  10214  CE1 PHE B 419      93.874 -17.232   8.271  1.00  0.87           C  
ATOM  10215  CE2 PHE B 419      95.005 -19.300   7.716  1.00  0.87           C  
ATOM  10216  CZ  PHE B 419      94.221 -18.547   8.598  1.00  0.87           C  
ATOM  10217  N   PRO B 420      98.635 -14.939   3.603  1.00  0.89           N  
ATOM  10218  CA  PRO B 420      99.107 -14.299   2.380  1.00  0.89           C  
ATOM  10219  C   PRO B 420      99.015 -15.183   1.145  1.00  0.89           C  
ATOM  10220  O   PRO B 420      99.579 -16.271   1.109  1.00  0.89           O  
ATOM  10221  CB  PRO B 420     100.546 -13.867   2.712  1.00  0.89           C  
ATOM  10222  CG  PRO B 420     100.989 -14.855   3.793  1.00  0.89           C  
ATOM  10223  CD  PRO B 420      99.707 -15.043   4.597  1.00  0.89           C  
ATOM  10224  N   GLY B 421      98.313 -14.702   0.098  1.00  0.88           N  
ATOM  10225  CA  GLY B 421      98.137 -15.424  -1.157  1.00  0.88           C  
ATOM  10226  C   GLY B 421      96.981 -16.397  -1.217  1.00  0.88           C  
ATOM  10227  O   GLY B 421      96.741 -16.982  -2.271  1.00  0.88           O  
ATOM  10228  N   ASP B 422      96.194 -16.579  -0.133  1.00  0.88           N  
ATOM  10229  CA  ASP B 422      95.037 -17.462  -0.135  1.00  0.88           C  
ATOM  10230  C   ASP B 422      93.816 -16.766  -0.758  1.00  0.88           C  
ATOM  10231  O   ASP B 422      92.955 -16.194  -0.091  1.00  0.88           O  
ATOM  10232  CB  ASP B 422      94.789 -18.007   1.299  1.00  0.88           C  
ATOM  10233  CG  ASP B 422      93.846 -19.203   1.355  1.00  0.88           C  
ATOM  10234  OD1 ASP B 422      93.091 -19.435   0.372  1.00  0.88           O  
ATOM  10235  OD2 ASP B 422      93.802 -19.863   2.431  1.00  0.88           O  
ATOM  10236  N   VAL B 423      93.746 -16.796  -2.107  1.00  0.83           N  
ATOM  10237  CA  VAL B 423      92.738 -16.135  -2.924  1.00  0.83           C  
ATOM  10238  C   VAL B 423      91.303 -16.582  -2.645  1.00  0.83           C  
ATOM  10239  O   VAL B 423      90.403 -15.758  -2.506  1.00  0.83           O  
ATOM  10240  CB  VAL B 423      93.056 -16.321  -4.411  1.00  0.83           C  
ATOM  10241  CG1 VAL B 423      91.975 -15.681  -5.310  1.00  0.83           C  
ATOM  10242  CG2 VAL B 423      94.425 -15.688  -4.744  1.00  0.83           C  
ATOM  10243  N   ASP B 424      91.039 -17.905  -2.523  1.00  0.87           N  
ATOM  10244  CA  ASP B 424      89.707 -18.406  -2.237  1.00  0.87           C  
ATOM  10245  C   ASP B 424      89.257 -18.040  -0.825  1.00  0.87           C  
ATOM  10246  O   ASP B 424      88.089 -17.764  -0.577  1.00  0.87           O  
ATOM  10247  CB  ASP B 424      89.622 -19.930  -2.501  1.00  0.87           C  
ATOM  10248  CG  ASP B 424      88.176 -20.374  -2.499  1.00  0.87           C  
ATOM  10249  OD1 ASP B 424      87.423 -19.953  -3.411  1.00  0.87           O  
ATOM  10250  OD2 ASP B 424      87.751 -21.102  -1.565  1.00  0.87           O  
ATOM  10251  N   ARG B 425      90.176 -17.985   0.150  1.00  0.85           N  
ATOM  10252  CA  ARG B 425      89.847 -17.609   1.506  1.00  0.85           C  
ATOM  10253  C   ARG B 425      89.285 -16.209   1.670  1.00  0.85           C  
ATOM  10254  O   ARG B 425      88.359 -15.996   2.451  1.00  0.85           O  
ATOM  10255  CB  ARG B 425      91.096 -17.772   2.359  1.00  0.85           C  
ATOM  10256  CG  ARG B 425      90.844 -17.745   3.865  1.00  0.85           C  
ATOM  10257  CD  ARG B 425      92.129 -17.997   4.637  1.00  0.85           C  
ATOM  10258  NE  ARG B 425      91.720 -18.520   5.964  1.00  0.85           N  
ATOM  10259  CZ  ARG B 425      91.798 -19.810   6.301  1.00  0.85           C  
ATOM  10260  NH1 ARG B 425      92.379 -20.730   5.543  1.00  0.85           N  
ATOM  10261  NH2 ARG B 425      91.288 -20.185   7.467  1.00  0.85           N  
ATOM  10262  N   LEU B 426      89.782 -15.220   0.893  1.00  0.87           N  
ATOM  10263  CA  LEU B 426      89.152 -13.907   0.827  1.00  0.87           C  
ATOM  10264  C   LEU B 426      87.703 -13.982   0.340  1.00  0.87           C  
ATOM  10265  O   LEU B 426      86.826 -13.308   0.870  1.00  0.87           O  
ATOM  10266  CB  LEU B 426      89.904 -12.887  -0.082  1.00  0.87           C  
ATOM  10267  CG  LEU B 426      91.210 -12.237   0.453  1.00  0.87           C  
ATOM  10268  CD1 LEU B 426      91.288 -12.141   1.983  1.00  0.87           C  
ATOM  10269  CD2 LEU B 426      92.478 -12.901  -0.107  1.00  0.87           C  
ATOM  10270  N   ARG B 427      87.410 -14.832  -0.667  1.00  0.83           N  
ATOM  10271  CA  ARG B 427      86.055 -15.090  -1.124  1.00  0.83           C  
ATOM  10272  C   ARG B 427      85.173 -15.769  -0.076  1.00  0.83           C  
ATOM  10273  O   ARG B 427      84.023 -15.387   0.111  1.00  0.83           O  
ATOM  10274  CB  ARG B 427      86.094 -15.950  -2.414  1.00  0.83           C  
ATOM  10275  CG  ARG B 427      84.734 -16.203  -3.102  1.00  0.83           C  
ATOM  10276  CD  ARG B 427      84.800 -17.274  -4.202  1.00  0.83           C  
ATOM  10277  NE  ARG B 427      85.176 -18.581  -3.573  1.00  0.83           N  
ATOM  10278  CZ  ARG B 427      84.376 -19.440  -2.932  1.00  0.83           C  
ATOM  10279  NH1 ARG B 427      83.079 -19.213  -2.768  1.00  0.83           N  
ATOM  10280  NH2 ARG B 427      84.922 -20.555  -2.447  1.00  0.83           N  
ATOM  10281  N   ARG B 428      85.683 -16.795   0.637  1.00  0.85           N  
ATOM  10282  CA  ARG B 428      84.939 -17.506   1.665  1.00  0.85           C  
ATOM  10283  C   ARG B 428      84.630 -16.714   2.928  1.00  0.85           C  
ATOM  10284  O   ARG B 428      83.547 -16.848   3.496  1.00  0.85           O  
ATOM  10285  CB  ARG B 428      85.649 -18.813   2.081  1.00  0.85           C  
ATOM  10286  CG  ARG B 428      85.881 -19.797   0.923  1.00  0.85           C  
ATOM  10287  CD  ARG B 428      86.251 -21.225   1.362  1.00  0.85           C  
ATOM  10288  NE  ARG B 428      87.400 -21.196   2.326  1.00  0.85           N  
ATOM  10289  CZ  ARG B 428      88.693 -21.301   1.986  1.00  0.85           C  
ATOM  10290  NH1 ARG B 428      89.083 -21.428   0.730  1.00  0.85           N  
ATOM  10291  NH2 ARG B 428      89.631 -21.287   2.932  1.00  0.85           N  
ATOM  10292  N   MET B 429      85.577 -15.885   3.411  1.00  0.91           N  
ATOM  10293  CA  MET B 429      85.419 -15.183   4.673  1.00  0.91           C  
ATOM  10294  C   MET B 429      84.876 -13.776   4.521  1.00  0.91           C  
ATOM  10295  O   MET B 429      84.707 -13.057   5.504  1.00  0.91           O  
ATOM  10296  CB  MET B 429      86.782 -15.060   5.389  1.00  0.91           C  
ATOM  10297  CG  MET B 429      87.418 -16.419   5.703  1.00  0.91           C  
ATOM  10298  SD  MET B 429      88.952 -16.297   6.678  1.00  0.91           S  
ATOM  10299  CE  MET B 429      88.160 -15.848   8.240  1.00  0.91           C  
ATOM  10300  N   SER B 430      84.597 -13.336   3.281  1.00  0.92           N  
ATOM  10301  CA  SER B 430      83.972 -12.047   3.023  1.00  0.92           C  
ATOM  10302  C   SER B 430      82.588 -11.929   3.621  1.00  0.92           C  
ATOM  10303  O   SER B 430      81.765 -12.832   3.534  1.00  0.92           O  
ATOM  10304  CB  SER B 430      83.876 -11.750   1.504  1.00  0.92           C  
ATOM  10305  OG  SER B 430      83.347 -10.456   1.183  1.00  0.92           O  
ATOM  10306  N   LEU B 431      82.266 -10.752   4.193  1.00  0.93           N  
ATOM  10307  CA  LEU B 431      80.936 -10.467   4.689  1.00  0.93           C  
ATOM  10308  C   LEU B 431      79.984 -10.278   3.526  1.00  0.93           C  
ATOM  10309  O   LEU B 431      78.771 -10.386   3.669  1.00  0.93           O  
ATOM  10310  CB  LEU B 431      80.851  -9.168   5.539  1.00  0.93           C  
ATOM  10311  CG  LEU B 431      81.843  -9.013   6.713  1.00  0.93           C  
ATOM  10312  CD1 LEU B 431      81.321  -7.928   7.670  1.00  0.93           C  
ATOM  10313  CD2 LEU B 431      82.115 -10.325   7.457  1.00  0.93           C  
ATOM  10314  N   VAL B 432      80.540  -9.993   2.338  1.00  0.93           N  
ATOM  10315  CA  VAL B 432      79.813  -9.832   1.103  1.00  0.93           C  
ATOM  10316  C   VAL B 432      79.833 -11.139   0.312  1.00  0.93           C  
ATOM  10317  O   VAL B 432      80.889 -11.627  -0.088  1.00  0.93           O  
ATOM  10318  CB  VAL B 432      80.422  -8.718   0.261  1.00  0.93           C  
ATOM  10319  CG1 VAL B 432      79.570  -8.490  -0.997  1.00  0.93           C  
ATOM  10320  CG2 VAL B 432      80.505  -7.415   1.084  1.00  0.93           C  
ATOM  10321  N   GLU B 433      78.647 -11.728   0.062  1.00  0.86           N  
ATOM  10322  CA  GLU B 433      78.484 -12.950  -0.703  1.00  0.86           C  
ATOM  10323  C   GLU B 433      78.068 -12.626  -2.127  1.00  0.86           C  
ATOM  10324  O   GLU B 433      77.055 -11.978  -2.367  1.00  0.86           O  
ATOM  10325  CB  GLU B 433      77.389 -13.869  -0.089  1.00  0.86           C  
ATOM  10326  CG  GLU B 433      77.114 -15.183  -0.875  1.00  0.86           C  
ATOM  10327  CD  GLU B 433      75.820 -15.881  -0.484  1.00  0.86           C  
ATOM  10328  OE1 GLU B 433      75.788 -16.574   0.568  1.00  0.86           O  
ATOM  10329  OE2 GLU B 433      74.809 -15.779  -1.233  1.00  0.86           O  
ATOM  10330  N   GLU B 434      78.855 -13.110  -3.108  1.00  0.80           N  
ATOM  10331  CA  GLU B 434      78.519 -13.018  -4.515  1.00  0.80           C  
ATOM  10332  C   GLU B 434      77.753 -14.259  -4.958  1.00  0.80           C  
ATOM  10333  O   GLU B 434      77.799 -15.312  -4.332  1.00  0.80           O  
ATOM  10334  CB  GLU B 434      79.776 -12.887  -5.409  1.00  0.80           C  
ATOM  10335  CG  GLU B 434      80.749 -11.739  -5.027  1.00  0.80           C  
ATOM  10336  CD  GLU B 434      80.152 -10.332  -5.052  1.00  0.80           C  
ATOM  10337  OE1 GLU B 434      79.443  -9.961  -6.022  1.00  0.80           O  
ATOM  10338  OE2 GLU B 434      80.449  -9.577  -4.089  1.00  0.80           O  
ATOM  10339  N   GLY B 435      77.036 -14.179  -6.097  1.00  0.79           N  
ATOM  10340  CA  GLY B 435      76.272 -15.313  -6.586  1.00  0.79           C  
ATOM  10341  C   GLY B 435      75.179 -14.853  -7.503  1.00  0.79           C  
ATOM  10342  O   GLY B 435      75.339 -13.897  -8.251  1.00  0.79           O  
ATOM  10343  N   ALA B 436      74.007 -15.523  -7.463  1.00  0.72           N  
ATOM  10344  CA  ALA B 436      72.824 -15.103  -8.193  1.00  0.72           C  
ATOM  10345  C   ALA B 436      72.291 -13.752  -7.727  1.00  0.72           C  
ATOM  10346  O   ALA B 436      71.789 -12.948  -8.506  1.00  0.72           O  
ATOM  10347  CB  ALA B 436      71.717 -16.171  -8.046  1.00  0.72           C  
ATOM  10348  N   VAL B 437      72.391 -13.492  -6.412  1.00  0.83           N  
ATOM  10349  CA  VAL B 437      71.993 -12.237  -5.808  1.00  0.83           C  
ATOM  10350  C   VAL B 437      73.097 -11.894  -4.844  1.00  0.83           C  
ATOM  10351  O   VAL B 437      73.470 -12.735  -4.035  1.00  0.83           O  
ATOM  10352  CB  VAL B 437      70.698 -12.333  -4.998  1.00  0.83           C  
ATOM  10353  CG1 VAL B 437      70.285 -10.942  -4.474  1.00  0.83           C  
ATOM  10354  CG2 VAL B 437      69.567 -12.928  -5.858  1.00  0.83           C  
ATOM  10355  N   LYS B 438      73.650 -10.667  -4.913  1.00  0.86           N  
ATOM  10356  CA  LYS B 438      74.680 -10.211  -4.003  1.00  0.86           C  
ATOM  10357  C   LYS B 438      74.125  -9.913  -2.612  1.00  0.86           C  
ATOM  10358  O   LYS B 438      73.127  -9.208  -2.463  1.00  0.86           O  
ATOM  10359  CB  LYS B 438      75.382  -8.970  -4.593  1.00  0.86           C  
ATOM  10360  CG  LYS B 438      76.646  -8.528  -3.850  1.00  0.86           C  
ATOM  10361  CD  LYS B 438      77.276  -7.302  -4.525  1.00  0.86           C  
ATOM  10362  CE  LYS B 438      78.562  -6.873  -3.827  1.00  0.86           C  
ATOM  10363  NZ  LYS B 438      79.186  -5.727  -4.510  1.00  0.86           N  
ATOM  10364  N   ARG B 439      74.747 -10.468  -1.553  1.00  0.88           N  
ATOM  10365  CA  ARG B 439      74.201 -10.444  -0.207  1.00  0.88           C  
ATOM  10366  C   ARG B 439      75.235 -10.110   0.846  1.00  0.88           C  
ATOM  10367  O   ARG B 439      76.437 -10.167   0.623  1.00  0.88           O  
ATOM  10368  CB  ARG B 439      73.609 -11.821   0.193  1.00  0.88           C  
ATOM  10369  CG  ARG B 439      72.543 -12.364  -0.771  1.00  0.88           C  
ATOM  10370  CD  ARG B 439      72.206 -13.824  -0.497  1.00  0.88           C  
ATOM  10371  NE  ARG B 439      71.272 -14.288  -1.561  1.00  0.88           N  
ATOM  10372  CZ  ARG B 439      69.942 -14.182  -1.478  1.00  0.88           C  
ATOM  10373  NH1 ARG B 439      69.345 -13.656  -0.410  1.00  0.88           N  
ATOM  10374  NH2 ARG B 439      69.194 -14.627  -2.487  1.00  0.88           N  
ATOM  10375  N   ILE B 440      74.767  -9.772   2.061  1.00  0.94           N  
ATOM  10376  CA  ILE B 440      75.614  -9.667   3.236  1.00  0.94           C  
ATOM  10377  C   ILE B 440      75.359 -10.879   4.110  1.00  0.94           C  
ATOM  10378  O   ILE B 440      74.222 -11.171   4.475  1.00  0.94           O  
ATOM  10379  CB  ILE B 440      75.368  -8.400   4.050  1.00  0.94           C  
ATOM  10380  CG1 ILE B 440      75.577  -7.123   3.199  1.00  0.94           C  
ATOM  10381  CG2 ILE B 440      76.275  -8.383   5.304  1.00  0.94           C  
ATOM  10382  CD1 ILE B 440      76.980  -6.971   2.599  1.00  0.94           C  
ATOM  10383  N   ASN B 441      76.420 -11.629   4.468  1.00  0.94           N  
ATOM  10384  CA  ASN B 441      76.337 -12.769   5.354  1.00  0.94           C  
ATOM  10385  C   ASN B 441      76.378 -12.288   6.797  1.00  0.94           C  
ATOM  10386  O   ASN B 441      77.393 -11.802   7.300  1.00  0.94           O  
ATOM  10387  CB  ASN B 441      77.495 -13.761   5.058  1.00  0.94           C  
ATOM  10388  CG  ASN B 441      77.342 -15.082   5.808  1.00  0.94           C  
ATOM  10389  OD1 ASN B 441      77.195 -15.131   7.029  1.00  0.94           O  
ATOM  10390  ND2 ASN B 441      77.376 -16.202   5.050  1.00  0.94           N  
ATOM  10391  N   MET B 442      75.248 -12.424   7.517  1.00  0.95           N  
ATOM  10392  CA  MET B 442      75.131 -11.831   8.829  1.00  0.95           C  
ATOM  10393  C   MET B 442      75.822 -12.636   9.911  1.00  0.95           C  
ATOM  10394  O   MET B 442      76.224 -12.106  10.944  1.00  0.95           O  
ATOM  10395  CB  MET B 442      73.653 -11.622   9.203  1.00  0.95           C  
ATOM  10396  CG  MET B 442      72.824 -10.860   8.151  1.00  0.95           C  
ATOM  10397  SD  MET B 442      73.569  -9.335   7.465  1.00  0.95           S  
ATOM  10398  CE  MET B 442      72.948  -8.107   8.647  1.00  0.95           C  
ATOM  10399  N   ALA B 443      76.046 -13.944   9.674  1.00  0.97           N  
ATOM  10400  CA  ALA B 443      76.832 -14.776  10.557  1.00  0.97           C  
ATOM  10401  C   ALA B 443      78.285 -14.356  10.545  1.00  0.97           C  
ATOM  10402  O   ALA B 443      78.918 -14.210  11.586  1.00  0.97           O  
ATOM  10403  CB  ALA B 443      76.681 -16.257  10.166  1.00  0.97           C  
ATOM  10404  N   HIS B 444      78.821 -14.079   9.343  1.00  0.94           N  
ATOM  10405  CA  HIS B 444      80.156 -13.547   9.164  1.00  0.94           C  
ATOM  10406  C   HIS B 444      80.327 -12.167   9.788  1.00  0.94           C  
ATOM  10407  O   HIS B 444      81.332 -11.904  10.450  1.00  0.94           O  
ATOM  10408  CB  HIS B 444      80.539 -13.516   7.671  1.00  0.94           C  
ATOM  10409  CG  HIS B 444      80.556 -14.857   7.000  1.00  0.94           C  
ATOM  10410  ND1 HIS B 444      80.913 -14.881   5.674  1.00  0.94           N  
ATOM  10411  CD2 HIS B 444      80.367 -16.124   7.453  1.00  0.94           C  
ATOM  10412  CE1 HIS B 444      80.950 -16.150   5.335  1.00  0.94           C  
ATOM  10413  NE2 HIS B 444      80.622 -16.952   6.377  1.00  0.94           N  
ATOM  10414  N   LEU B 445      79.323 -11.265   9.648  1.00  0.96           N  
ATOM  10415  CA  LEU B 445      79.304  -9.964  10.310  1.00  0.96           C  
ATOM  10416  C   LEU B 445      79.360 -10.091  11.824  1.00  0.96           C  
ATOM  10417  O   LEU B 445      80.152  -9.427  12.497  1.00  0.96           O  
ATOM  10418  CB  LEU B 445      78.035  -9.166   9.897  1.00  0.96           C  
ATOM  10419  CG  LEU B 445      77.785  -7.822  10.626  1.00  0.96           C  
ATOM  10420  CD1 LEU B 445      78.929  -6.812  10.440  1.00  0.96           C  
ATOM  10421  CD2 LEU B 445      76.461  -7.204  10.148  1.00  0.96           C  
ATOM  10422  N   CYS B 446      78.565 -11.019  12.392  1.00  0.98           N  
ATOM  10423  CA  CYS B 446      78.605 -11.347  13.801  1.00  0.98           C  
ATOM  10424  C   CYS B 446      79.937 -11.885  14.289  1.00  0.98           C  
ATOM  10425  O   CYS B 446      80.391 -11.524  15.367  1.00  0.98           O  
ATOM  10426  CB  CYS B 446      77.511 -12.362  14.180  1.00  0.98           C  
ATOM  10427  SG  CYS B 446      75.877 -11.609  14.402  1.00  0.98           S  
ATOM  10428  N   ILE B 447      80.607 -12.767  13.524  1.00  0.96           N  
ATOM  10429  CA  ILE B 447      81.925 -13.278  13.880  1.00  0.96           C  
ATOM  10430  C   ILE B 447      82.981 -12.190  13.879  1.00  0.96           C  
ATOM  10431  O   ILE B 447      83.791 -12.084  14.802  1.00  0.96           O  
ATOM  10432  CB  ILE B 447      82.367 -14.425  12.978  1.00  0.96           C  
ATOM  10433  CG1 ILE B 447      81.428 -15.640  13.157  1.00  0.96           C  
ATOM  10434  CG2 ILE B 447      83.825 -14.832  13.302  1.00  0.96           C  
ATOM  10435  CD1 ILE B 447      81.654 -16.742  12.121  1.00  0.96           C  
ATOM  10436  N   ALA B 448      82.979 -11.319  12.852  1.00  0.96           N  
ATOM  10437  CA  ALA B 448      83.916 -10.228  12.735  1.00  0.96           C  
ATOM  10438  C   ALA B 448      83.812  -9.214  13.868  1.00  0.96           C  
ATOM  10439  O   ALA B 448      84.823  -8.784  14.421  1.00  0.96           O  
ATOM  10440  CB  ALA B 448      83.686  -9.519  11.388  1.00  0.96           C  
ATOM  10441  N   GLY B 449      82.572  -8.841  14.251  1.00  0.97           N  
ATOM  10442  CA  GLY B 449      82.323  -7.808  15.249  1.00  0.97           C  
ATOM  10443  C   GLY B 449      82.053  -8.240  16.667  1.00  0.97           C  
ATOM  10444  O   GLY B 449      81.630  -7.416  17.465  1.00  0.97           O  
ATOM  10445  N   SER B 450      82.272  -9.520  17.020  1.00  0.97           N  
ATOM  10446  CA  SER B 450      82.056 -10.030  18.375  1.00  0.97           C  
ATOM  10447  C   SER B 450      83.323 -10.620  18.960  1.00  0.97           C  
ATOM  10448  O   SER B 450      84.101 -11.242  18.240  1.00  0.97           O  
ATOM  10449  CB  SER B 450      81.048 -11.202  18.391  1.00  0.97           C  
ATOM  10450  OG  SER B 450      79.714 -10.755  18.155  1.00  0.97           O  
ATOM  10451  N   HIS B 451      83.577 -10.489  20.286  1.00  0.95           N  
ATOM  10452  CA  HIS B 451      84.742 -11.101  20.920  1.00  0.95           C  
ATOM  10453  C   HIS B 451      84.559 -12.576  21.212  1.00  0.95           C  
ATOM  10454  O   HIS B 451      85.522 -13.290  21.459  1.00  0.95           O  
ATOM  10455  CB  HIS B 451      85.164 -10.427  22.254  1.00  0.95           C  
ATOM  10456  CG  HIS B 451      84.220 -10.608  23.408  1.00  0.95           C  
ATOM  10457  ND1 HIS B 451      83.098  -9.823  23.469  1.00  0.95           N  
ATOM  10458  CD2 HIS B 451      84.276 -11.427  24.492  1.00  0.95           C  
ATOM  10459  CE1 HIS B 451      82.486 -10.161  24.581  1.00  0.95           C  
ATOM  10460  NE2 HIS B 451      83.157 -11.134  25.246  1.00  0.95           N  
ATOM  10461  N   ALA B 452      83.307 -13.062  21.177  1.00  0.97           N  
ATOM  10462  CA  ALA B 452      82.999 -14.444  21.438  1.00  0.97           C  
ATOM  10463  C   ALA B 452      81.898 -14.911  20.513  1.00  0.97           C  
ATOM  10464  O   ALA B 452      80.906 -14.230  20.276  1.00  0.97           O  
ATOM  10465  CB  ALA B 452      82.536 -14.646  22.892  1.00  0.97           C  
ATOM  10466  N   VAL B 453      82.082 -16.122  19.963  1.00  0.97           N  
ATOM  10467  CA  VAL B 453      81.106 -16.778  19.124  1.00  0.97           C  
ATOM  10468  C   VAL B 453      80.883 -18.131  19.738  1.00  0.97           C  
ATOM  10469  O   VAL B 453      81.813 -18.917  19.896  1.00  0.97           O  
ATOM  10470  CB  VAL B 453      81.582 -16.971  17.689  1.00  0.97           C  
ATOM  10471  CG1 VAL B 453      80.510 -17.730  16.873  1.00  0.97           C  
ATOM  10472  CG2 VAL B 453      81.864 -15.593  17.061  1.00  0.97           C  
ATOM  10473  N   ASN B 454      79.638 -18.457  20.123  1.00  0.96           N  
ATOM  10474  CA  ASN B 454      79.384 -19.744  20.732  1.00  0.96           C  
ATOM  10475  C   ASN B 454      78.326 -20.561  20.026  1.00  0.96           C  
ATOM  10476  O   ASN B 454      77.293 -20.085  19.599  1.00  0.96           O  
ATOM  10477  CB  ASN B 454      79.127 -19.677  22.255  1.00  0.96           C  
ATOM  10478  CG  ASN B 454      77.811 -19.005  22.622  1.00  0.96           C  
ATOM  10479  OD1 ASN B 454      77.747 -17.801  22.851  1.00  0.96           O  
ATOM  10480  ND2 ASN B 454      76.747 -19.828  22.751  1.00  0.96           N  
ATOM  10481  N   GLY B 455      78.603 -21.881  19.938  1.00  0.97           N  
ATOM  10482  CA  GLY B 455      77.568 -22.858  19.647  1.00  0.97           C  
ATOM  10483  C   GLY B 455      76.858 -23.222  20.929  1.00  0.97           C  
ATOM  10484  O   GLY B 455      77.235 -22.780  22.015  1.00  0.97           O  
ATOM  10485  N   VAL B 456      75.804 -24.045  20.823  1.00  0.96           N  
ATOM  10486  CA  VAL B 456      74.735 -24.147  21.794  1.00  0.96           C  
ATOM  10487  C   VAL B 456      74.529 -25.593  22.297  1.00  0.96           C  
ATOM  10488  O   VAL B 456      73.632 -25.903  23.084  1.00  0.96           O  
ATOM  10489  CB  VAL B 456      73.543 -23.493  21.089  1.00  0.96           C  
ATOM  10490  CG1 VAL B 456      72.641 -24.523  20.398  1.00  0.96           C  
ATOM  10491  CG2 VAL B 456      72.790 -22.535  22.020  1.00  0.96           C  
ATOM  10492  N   ALA B 457      75.437 -26.508  21.880  1.00  0.96           N  
ATOM  10493  CA  ALA B 457      75.647 -27.840  22.429  1.00  0.96           C  
ATOM  10494  C   ALA B 457      77.026 -28.267  21.964  1.00  0.96           C  
ATOM  10495  O   ALA B 457      77.539 -27.715  20.990  1.00  0.96           O  
ATOM  10496  CB  ALA B 457      74.613 -28.894  21.986  1.00  0.96           C  
ATOM  10497  N   ARG B 458      77.682 -29.223  22.655  1.00  0.88           N  
ATOM  10498  CA  ARG B 458      79.075 -29.575  22.410  1.00  0.88           C  
ATOM  10499  C   ARG B 458      79.355 -30.062  20.993  1.00  0.88           C  
ATOM  10500  O   ARG B 458      80.301 -29.620  20.343  1.00  0.88           O  
ATOM  10501  CB  ARG B 458      79.541 -30.616  23.466  1.00  0.88           C  
ATOM  10502  CG  ARG B 458      81.028 -31.035  23.382  1.00  0.88           C  
ATOM  10503  CD  ARG B 458      81.553 -31.799  24.609  1.00  0.88           C  
ATOM  10504  NE  ARG B 458      80.832 -33.103  24.604  1.00  0.88           N  
ATOM  10505  CZ  ARG B 458      80.544 -33.863  25.666  1.00  0.88           C  
ATOM  10506  NH1 ARG B 458      80.924 -33.608  26.904  1.00  0.88           N  
ATOM  10507  NH2 ARG B 458      79.843 -34.970  25.445  1.00  0.88           N  
ATOM  10508  N   ILE B 459      78.499 -30.946  20.442  1.00  0.90           N  
ATOM  10509  CA  ILE B 459      78.633 -31.460  19.092  1.00  0.90           C  
ATOM  10510  C   ILE B 459      78.473 -30.380  18.026  1.00  0.90           C  
ATOM  10511  O   ILE B 459      79.245 -30.292  17.095  1.00  0.90           O  
ATOM  10512  CB  ILE B 459      77.720 -32.655  18.871  1.00  0.90           C  
ATOM  10513  CG1 ILE B 459      78.055 -33.387  17.555  1.00  0.90           C  
ATOM  10514  CG2 ILE B 459      76.241 -32.228  18.941  1.00  0.90           C  
ATOM  10515  CD1 ILE B 459      77.356 -34.744  17.441  1.00  0.90           C  
ATOM  10516  N   HIS B 460      77.481 -29.478  18.205  1.00  0.90           N  
ATOM  10517  CA  HIS B 460      77.234 -28.334  17.348  1.00  0.90           C  
ATOM  10518  C   HIS B 460      78.372 -27.328  17.332  1.00  0.90           C  
ATOM  10519  O   HIS B 460      78.812 -26.909  16.263  1.00  0.90           O  
ATOM  10520  CB  HIS B 460      75.898 -27.690  17.769  1.00  0.90           C  
ATOM  10521  CG  HIS B 460      75.558 -26.398  17.109  1.00  0.90           C  
ATOM  10522  ND1 HIS B 460      75.452 -26.361  15.742  1.00  0.90           N  
ATOM  10523  CD2 HIS B 460      75.352 -25.163  17.626  1.00  0.90           C  
ATOM  10524  CE1 HIS B 460      75.191 -25.102  15.452  1.00  0.90           C  
ATOM  10525  NE2 HIS B 460      75.121 -24.335  16.559  1.00  0.90           N  
ATOM  10526  N   SER B 461      78.967 -26.957  18.487  1.00  0.93           N  
ATOM  10527  CA  SER B 461      80.151 -26.099  18.493  1.00  0.93           C  
ATOM  10528  C   SER B 461      81.339 -26.704  17.756  1.00  0.93           C  
ATOM  10529  O   SER B 461      82.032 -26.041  16.998  1.00  0.93           O  
ATOM  10530  CB  SER B 461      80.633 -25.743  19.922  1.00  0.93           C  
ATOM  10531  OG  SER B 461      79.698 -24.922  20.624  1.00  0.93           O  
ATOM  10532  N   GLU B 462      81.572 -28.020  17.940  1.00  0.86           N  
ATOM  10533  CA  GLU B 462      82.580 -28.744  17.194  1.00  0.86           C  
ATOM  10534  C   GLU B 462      82.313 -28.826  15.701  1.00  0.86           C  
ATOM  10535  O   GLU B 462      83.256 -28.738  14.912  1.00  0.86           O  
ATOM  10536  CB  GLU B 462      82.811 -30.148  17.791  1.00  0.86           C  
ATOM  10537  CG  GLU B 462      83.588 -30.120  19.133  1.00  0.86           C  
ATOM  10538  CD  GLU B 462      84.861 -29.285  19.097  1.00  0.86           C  
ATOM  10539  OE1 GLU B 462      85.766 -29.583  18.267  1.00  0.86           O  
ATOM  10540  OE2 GLU B 462      84.958 -28.295  19.868  1.00  0.86           O  
ATOM  10541  N   ILE B 463      81.043 -28.977  15.270  1.00  0.84           N  
ATOM  10542  CA  ILE B 463      80.637 -28.869  13.877  1.00  0.84           C  
ATOM  10543  C   ILE B 463      80.912 -27.477  13.315  1.00  0.84           C  
ATOM  10544  O   ILE B 463      81.500 -27.354  12.252  1.00  0.84           O  
ATOM  10545  CB  ILE B 463      79.177 -29.275  13.664  1.00  0.84           C  
ATOM  10546  CG1 ILE B 463      78.989 -30.785  13.956  1.00  0.84           C  
ATOM  10547  CG2 ILE B 463      78.728 -28.970  12.215  1.00  0.84           C  
ATOM  10548  CD1 ILE B 463      77.518 -31.206  14.079  1.00  0.84           C  
ATOM  10549  N   LEU B 464      80.578 -26.385  14.047  1.00  0.89           N  
ATOM  10550  CA  LEU B 464      80.821 -25.016  13.603  1.00  0.89           C  
ATOM  10551  C   LEU B 464      82.286 -24.743  13.314  1.00  0.89           C  
ATOM  10552  O   LEU B 464      82.634 -24.187  12.273  1.00  0.89           O  
ATOM  10553  CB  LEU B 464      80.372 -23.980  14.671  1.00  0.89           C  
ATOM  10554  CG  LEU B 464      78.854 -23.827  14.882  1.00  0.89           C  
ATOM  10555  CD1 LEU B 464      78.577 -22.852  16.040  1.00  0.89           C  
ATOM  10556  CD2 LEU B 464      78.152 -23.352  13.606  1.00  0.89           C  
ATOM  10557  N   LYS B 465      83.183 -25.200  14.208  1.00  0.86           N  
ATOM  10558  CA  LYS B 465      84.618 -25.060  14.069  1.00  0.86           C  
ATOM  10559  C   LYS B 465      85.212 -25.898  12.941  1.00  0.86           C  
ATOM  10560  O   LYS B 465      86.337 -25.648  12.519  1.00  0.86           O  
ATOM  10561  CB  LYS B 465      85.310 -25.492  15.386  1.00  0.86           C  
ATOM  10562  CG  LYS B 465      85.134 -24.517  16.565  1.00  0.86           C  
ATOM  10563  CD  LYS B 465      85.410 -25.181  17.930  1.00  0.86           C  
ATOM  10564  CE  LYS B 465      86.738 -25.943  18.004  1.00  0.86           C  
ATOM  10565  NZ  LYS B 465      86.886 -26.621  19.303  1.00  0.86           N  
ATOM  10566  N   LYS B 466      84.491 -26.923  12.437  1.00  0.79           N  
ATOM  10567  CA  LYS B 466      85.013 -27.806  11.411  1.00  0.79           C  
ATOM  10568  C   LYS B 466      84.339 -27.633  10.058  1.00  0.79           C  
ATOM  10569  O   LYS B 466      84.893 -28.065   9.048  1.00  0.79           O  
ATOM  10570  CB  LYS B 466      84.895 -29.285  11.849  1.00  0.79           C  
ATOM  10571  CG  LYS B 466      85.799 -29.637  13.041  1.00  0.79           C  
ATOM  10572  CD  LYS B 466      85.664 -31.115  13.446  1.00  0.79           C  
ATOM  10573  CE  LYS B 466      86.442 -31.486  14.716  1.00  0.79           C  
ATOM  10574  NZ  LYS B 466      85.891 -30.719  15.849  1.00  0.79           N  
ATOM  10575  N   THR B 467      83.161 -26.979   9.975  1.00  0.84           N  
ATOM  10576  CA  THR B 467      82.467 -26.767   8.709  1.00  0.84           C  
ATOM  10577  C   THR B 467      82.314 -25.286   8.377  1.00  0.84           C  
ATOM  10578  O   THR B 467      83.217 -24.648   7.849  1.00  0.84           O  
ATOM  10579  CB  THR B 467      81.109 -27.490   8.621  1.00  0.84           C  
ATOM  10580  OG1 THR B 467      80.179 -27.089   9.625  1.00  0.84           O  
ATOM  10581  CG2 THR B 467      81.296 -29.002   8.798  1.00  0.84           C  
ATOM  10582  N   ILE B 468      81.147 -24.684   8.666  1.00  0.82           N  
ATOM  10583  CA  ILE B 468      80.761 -23.355   8.221  1.00  0.82           C  
ATOM  10584  C   ILE B 468      81.596 -22.212   8.759  1.00  0.82           C  
ATOM  10585  O   ILE B 468      81.786 -21.210   8.081  1.00  0.82           O  
ATOM  10586  CB  ILE B 468      79.284 -23.051   8.431  1.00  0.82           C  
ATOM  10587  CG1 ILE B 468      78.827 -23.244   9.896  1.00  0.82           C  
ATOM  10588  CG2 ILE B 468      78.492 -23.955   7.465  1.00  0.82           C  
ATOM  10589  CD1 ILE B 468      77.377 -22.802  10.126  1.00  0.82           C  
ATOM  10590  N   PHE B 469      82.119 -22.317   9.997  1.00  0.90           N  
ATOM  10591  CA  PHE B 469      82.914 -21.258  10.585  1.00  0.90           C  
ATOM  10592  C   PHE B 469      84.370 -21.683  10.710  1.00  0.90           C  
ATOM  10593  O   PHE B 469      85.143 -21.067  11.445  1.00  0.90           O  
ATOM  10594  CB  PHE B 469      82.350 -20.833  11.971  1.00  0.90           C  
ATOM  10595  CG  PHE B 469      80.948 -20.252  11.931  1.00  0.90           C  
ATOM  10596  CD1 PHE B 469      80.336 -19.734  10.770  1.00  0.90           C  
ATOM  10597  CD2 PHE B 469      80.229 -20.189  13.136  1.00  0.90           C  
ATOM  10598  CE1 PHE B 469      79.032 -19.222  10.807  1.00  0.90           C  
ATOM  10599  CE2 PHE B 469      78.926 -19.679  13.179  1.00  0.90           C  
ATOM  10600  CZ  PHE B 469      78.322 -19.209  12.010  1.00  0.90           C  
ATOM  10601  N   LYS B 470      84.810 -22.720   9.961  1.00  0.89           N  
ATOM  10602  CA  LYS B 470      86.163 -23.248  10.013  1.00  0.89           C  
ATOM  10603  C   LYS B 470      87.240 -22.238   9.657  1.00  0.89           C  
ATOM  10604  O   LYS B 470      88.230 -22.095  10.354  1.00  0.89           O  
ATOM  10605  CB  LYS B 470      86.311 -24.464   9.069  1.00  0.89           C  
ATOM  10606  CG  LYS B 470      87.667 -25.186   9.161  1.00  0.89           C  
ATOM  10607  CD  LYS B 470      87.801 -26.294   8.109  1.00  0.89           C  
ATOM  10608  CE  LYS B 470      89.101 -27.099   8.223  1.00  0.89           C  
ATOM  10609  NZ  LYS B 470      90.285 -26.287   7.874  1.00  0.89           N  
ATOM  10610  N   ASP B 471      87.042 -21.455   8.571  1.00  0.93           N  
ATOM  10611  CA  ASP B 471      88.006 -20.455   8.170  1.00  0.93           C  
ATOM  10612  C   ASP B 471      88.210 -19.377   9.221  1.00  0.93           C  
ATOM  10613  O   ASP B 471      89.328 -18.918   9.472  1.00  0.93           O  
ATOM  10614  CB  ASP B 471      87.565 -19.772   6.862  1.00  0.93           C  
ATOM  10615  CG  ASP B 471      87.722 -20.694   5.681  1.00  0.93           C  
ATOM  10616  OD1 ASP B 471      88.861 -21.173   5.459  1.00  0.93           O  
ATOM  10617  OD2 ASP B 471      86.741 -20.899   4.925  1.00  0.93           O  
ATOM  10618  N   PHE B 472      87.101 -18.972   9.859  1.00  0.94           N  
ATOM  10619  CA  PHE B 472      87.060 -18.020  10.941  1.00  0.94           C  
ATOM  10620  C   PHE B 472      87.737 -18.524  12.199  1.00  0.94           C  
ATOM  10621  O   PHE B 472      88.491 -17.797  12.838  1.00  0.94           O  
ATOM  10622  CB  PHE B 472      85.600 -17.641  11.263  1.00  0.94           C  
ATOM  10623  CG  PHE B 472      84.943 -16.951  10.098  1.00  0.94           C  
ATOM  10624  CD1 PHE B 472      84.278 -17.690   9.103  1.00  0.94           C  
ATOM  10625  CD2 PHE B 472      84.972 -15.551   9.992  1.00  0.94           C  
ATOM  10626  CE1 PHE B 472      83.675 -17.045   8.018  1.00  0.94           C  
ATOM  10627  CE2 PHE B 472      84.356 -14.902   8.914  1.00  0.94           C  
ATOM  10628  CZ  PHE B 472      83.717 -15.650   7.923  1.00  0.94           C  
ATOM  10629  N   TYR B 473      87.517 -19.805  12.562  1.00  0.93           N  
ATOM  10630  CA  TYR B 473      88.169 -20.456  13.683  1.00  0.93           C  
ATOM  10631  C   TYR B 473      89.680 -20.484  13.514  1.00  0.93           C  
ATOM  10632  O   TYR B 473      90.422 -20.218  14.449  1.00  0.93           O  
ATOM  10633  CB  TYR B 473      87.566 -21.882  13.867  1.00  0.93           C  
ATOM  10634  CG  TYR B 473      88.303 -22.722  14.880  1.00  0.93           C  
ATOM  10635  CD1 TYR B 473      88.285 -22.381  16.239  1.00  0.93           C  
ATOM  10636  CD2 TYR B 473      89.064 -23.829  14.465  1.00  0.93           C  
ATOM  10637  CE1 TYR B 473      89.020 -23.127  17.171  1.00  0.93           C  
ATOM  10638  CE2 TYR B 473      89.805 -24.572  15.394  1.00  0.93           C  
ATOM  10639  CZ  TYR B 473      89.789 -24.215  16.744  1.00  0.93           C  
ATOM  10640  OH  TYR B 473      90.534 -24.968  17.673  1.00  0.93           O  
ATOM  10641  N   GLU B 474      90.178 -20.762  12.303  1.00  0.89           N  
ATOM  10642  CA  GLU B 474      91.595 -20.683  12.020  1.00  0.89           C  
ATOM  10643  C   GLU B 474      92.189 -19.278  12.151  1.00  0.89           C  
ATOM  10644  O   GLU B 474      93.296 -19.111  12.654  1.00  0.89           O  
ATOM  10645  CB  GLU B 474      91.868 -21.277  10.630  1.00  0.89           C  
ATOM  10646  CG  GLU B 474      91.475 -22.770  10.553  1.00  0.89           C  
ATOM  10647  CD  GLU B 474      91.678 -23.408   9.189  1.00  0.89           C  
ATOM  10648  OE1 GLU B 474      91.636 -22.703   8.146  1.00  0.89           O  
ATOM  10649  OE2 GLU B 474      91.774 -24.666   9.164  1.00  0.89           O  
ATOM  10650  N   LEU B 475      91.472 -18.218  11.714  1.00  0.91           N  
ATOM  10651  CA  LEU B 475      91.898 -16.843  11.935  1.00  0.91           C  
ATOM  10652  C   LEU B 475      91.868 -16.395  13.397  1.00  0.91           C  
ATOM  10653  O   LEU B 475      92.791 -15.748  13.890  1.00  0.91           O  
ATOM  10654  CB  LEU B 475      91.014 -15.879  11.106  1.00  0.91           C  
ATOM  10655  CG  LEU B 475      91.453 -14.397  11.118  1.00  0.91           C  
ATOM  10656  CD1 LEU B 475      92.734 -14.164  10.311  1.00  0.91           C  
ATOM  10657  CD2 LEU B 475      90.328 -13.505  10.583  1.00  0.91           C  
ATOM  10658  N   GLU B 476      90.786 -16.720  14.131  1.00  0.91           N  
ATOM  10659  CA  GLU B 476      90.560 -16.207  15.470  1.00  0.91           C  
ATOM  10660  C   GLU B 476      90.088 -17.307  16.418  1.00  0.91           C  
ATOM  10661  O   GLU B 476      88.940 -17.270  16.868  1.00  0.91           O  
ATOM  10662  CB  GLU B 476      89.516 -15.050  15.458  1.00  0.91           C  
ATOM  10663  CG  GLU B 476      89.973 -13.804  14.652  1.00  0.91           C  
ATOM  10664  CD  GLU B 476      88.924 -12.711  14.518  1.00  0.91           C  
ATOM  10665  OE1 GLU B 476      87.789 -12.965  14.049  1.00  0.91           O  
ATOM  10666  OE2 GLU B 476      89.222 -11.541  14.888  1.00  0.91           O  
ATOM  10667  N   PRO B 477      90.914 -18.300  16.785  1.00  0.95           N  
ATOM  10668  CA  PRO B 477      90.473 -19.499  17.503  1.00  0.95           C  
ATOM  10669  C   PRO B 477      89.930 -19.210  18.880  1.00  0.95           C  
ATOM  10670  O   PRO B 477      89.085 -19.949  19.375  1.00  0.95           O  
ATOM  10671  CB  PRO B 477      91.724 -20.396  17.545  1.00  0.95           C  
ATOM  10672  CG  PRO B 477      92.901 -19.430  17.372  1.00  0.95           C  
ATOM  10673  CD  PRO B 477      92.329 -18.392  16.410  1.00  0.95           C  
ATOM  10674  N   HIS B 478      90.416 -18.135  19.510  1.00  0.91           N  
ATOM  10675  CA  HIS B 478      90.055 -17.681  20.833  1.00  0.91           C  
ATOM  10676  C   HIS B 478      88.594 -17.288  20.998  1.00  0.91           C  
ATOM  10677  O   HIS B 478      88.019 -17.442  22.073  1.00  0.91           O  
ATOM  10678  CB  HIS B 478      90.994 -16.515  21.207  1.00  0.91           C  
ATOM  10679  CG  HIS B 478      91.038 -15.416  20.180  1.00  0.91           C  
ATOM  10680  ND1 HIS B 478      90.179 -14.345  20.294  1.00  0.91           N  
ATOM  10681  CD2 HIS B 478      91.821 -15.269  19.077  1.00  0.91           C  
ATOM  10682  CE1 HIS B 478      90.453 -13.565  19.271  1.00  0.91           C  
ATOM  10683  NE2 HIS B 478      91.440 -14.078  18.498  1.00  0.91           N  
ATOM  10684  N   LYS B 479      87.951 -16.789  19.925  1.00  0.91           N  
ATOM  10685  CA  LYS B 479      86.555 -16.415  19.927  1.00  0.91           C  
ATOM  10686  C   LYS B 479      85.597 -17.577  20.120  1.00  0.91           C  
ATOM  10687  O   LYS B 479      84.509 -17.415  20.667  1.00  0.91           O  
ATOM  10688  CB  LYS B 479      86.179 -15.719  18.602  1.00  0.91           C  
ATOM  10689  CG  LYS B 479      86.805 -14.329  18.442  1.00  0.91           C  
ATOM  10690  CD  LYS B 479      86.281 -13.624  17.183  1.00  0.91           C  
ATOM  10691  CE  LYS B 479      86.768 -12.179  17.052  1.00  0.91           C  
ATOM  10692  NZ  LYS B 479      86.284 -11.598  15.789  1.00  0.91           N  
ATOM  10693  N   PHE B 480      85.953 -18.777  19.628  1.00  0.94           N  
ATOM  10694  CA  PHE B 480      85.000 -19.859  19.500  1.00  0.94           C  
ATOM  10695  C   PHE B 480      84.832 -20.696  20.753  1.00  0.94           C  
ATOM  10696  O   PHE B 480      85.729 -21.395  21.215  1.00  0.94           O  
ATOM  10697  CB  PHE B 480      85.337 -20.780  18.310  1.00  0.94           C  
ATOM  10698  CG  PHE B 480      85.075 -20.026  17.039  1.00  0.94           C  
ATOM  10699  CD1 PHE B 480      86.045 -19.163  16.508  1.00  0.94           C  
ATOM  10700  CD2 PHE B 480      83.821 -20.110  16.409  1.00  0.94           C  
ATOM  10701  CE1 PHE B 480      85.764 -18.378  15.384  1.00  0.94           C  
ATOM  10702  CE2 PHE B 480      83.538 -19.329  15.282  1.00  0.94           C  
ATOM  10703  CZ  PHE B 480      84.508 -18.458  14.774  1.00  0.94           C  
ATOM  10704  N   GLN B 481      83.604 -20.667  21.303  1.00  0.92           N  
ATOM  10705  CA  GLN B 481      83.263 -21.298  22.556  1.00  0.92           C  
ATOM  10706  C   GLN B 481      82.066 -22.226  22.413  1.00  0.92           C  
ATOM  10707  O   GLN B 481      81.348 -22.297  21.417  1.00  0.92           O  
ATOM  10708  CB  GLN B 481      82.926 -20.248  23.651  1.00  0.92           C  
ATOM  10709  CG  GLN B 481      84.100 -19.312  24.031  1.00  0.92           C  
ATOM  10710  CD  GLN B 481      83.720 -18.423  25.217  1.00  0.92           C  
ATOM  10711  OE1 GLN B 481      82.852 -18.774  26.021  1.00  0.92           O  
ATOM  10712  NE2 GLN B 481      84.394 -17.261  25.348  1.00  0.92           N  
ATOM  10713  N   ASN B 482      81.821 -23.003  23.475  1.00  0.94           N  
ATOM  10714  CA  ASN B 482      80.642 -23.816  23.609  1.00  0.94           C  
ATOM  10715  C   ASN B 482      79.890 -23.320  24.827  1.00  0.94           C  
ATOM  10716  O   ASN B 482      80.473 -23.035  25.862  1.00  0.94           O  
ATOM  10717  CB  ASN B 482      81.019 -25.324  23.710  1.00  0.94           C  
ATOM  10718  CG  ASN B 482      79.826 -26.197  24.067  1.00  0.94           C  
ATOM  10719  OD1 ASN B 482      79.868 -26.944  25.040  1.00  0.94           O  
ATOM  10720  ND2 ASN B 482      78.715 -26.043  23.323  1.00  0.94           N  
ATOM  10721  N   LYS B 483      78.557 -23.185  24.692  1.00  0.94           N  
ATOM  10722  CA  LYS B 483      77.688 -23.001  25.826  1.00  0.94           C  
ATOM  10723  C   LYS B 483      76.487 -23.903  25.633  1.00  0.94           C  
ATOM  10724  O   LYS B 483      75.464 -23.484  25.101  1.00  0.94           O  
ATOM  10725  CB  LYS B 483      77.193 -21.535  25.943  1.00  0.94           C  
ATOM  10726  CG  LYS B 483      78.297 -20.507  26.228  1.00  0.94           C  
ATOM  10727  CD  LYS B 483      78.842 -20.627  27.657  1.00  0.94           C  
ATOM  10728  CE  LYS B 483      80.177 -19.912  27.883  1.00  0.94           C  
ATOM  10729  NZ  LYS B 483      81.290 -20.635  27.263  1.00  0.94           N  
ATOM  10730  N   THR B 484      76.581 -25.182  26.061  1.00  0.96           N  
ATOM  10731  CA  THR B 484      75.482 -26.146  25.978  1.00  0.96           C  
ATOM  10732  C   THR B 484      74.237 -25.655  26.678  1.00  0.96           C  
ATOM  10733  O   THR B 484      74.279 -25.274  27.849  1.00  0.96           O  
ATOM  10734  CB  THR B 484      75.843 -27.520  26.535  1.00  0.96           C  
ATOM  10735  OG1 THR B 484      76.949 -28.023  25.799  1.00  0.96           O  
ATOM  10736  CG2 THR B 484      74.699 -28.546  26.432  1.00  0.96           C  
ATOM  10737  N   ASN B 485      73.098 -25.618  25.966  1.00  0.95           N  
ATOM  10738  CA  ASN B 485      71.803 -25.203  26.477  1.00  0.95           C  
ATOM  10739  C   ASN B 485      71.357 -25.788  27.807  1.00  0.95           C  
ATOM  10740  O   ASN B 485      71.863 -26.784  28.319  1.00  0.95           O  
ATOM  10741  CB  ASN B 485      70.669 -25.416  25.443  1.00  0.95           C  
ATOM  10742  CG  ASN B 485      70.727 -24.321  24.398  1.00  0.95           C  
ATOM  10743  OD1 ASN B 485      71.195 -23.224  24.692  1.00  0.95           O  
ATOM  10744  ND2 ASN B 485      70.180 -24.591  23.192  1.00  0.95           N  
ATOM  10745  N   GLY B 486      70.371 -25.108  28.413  1.00  0.98           N  
ATOM  10746  CA  GLY B 486      69.718 -25.595  29.603  1.00  0.98           C  
ATOM  10747  C   GLY B 486      68.311 -25.095  29.626  1.00  0.98           C  
ATOM  10748  O   GLY B 486      67.904 -24.286  28.796  1.00  0.98           O  
ATOM  10749  N   ILE B 487      67.543 -25.542  30.624  1.00  0.97           N  
ATOM  10750  CA  ILE B 487      66.178 -25.127  30.846  1.00  0.97           C  
ATOM  10751  C   ILE B 487      66.061 -24.719  32.296  1.00  0.97           C  
ATOM  10752  O   ILE B 487      66.816 -25.179  33.146  1.00  0.97           O  
ATOM  10753  CB  ILE B 487      65.184 -26.247  30.557  1.00  0.97           C  
ATOM  10754  CG1 ILE B 487      65.499 -27.506  31.403  1.00  0.97           C  
ATOM  10755  CG2 ILE B 487      65.240 -26.543  29.042  1.00  0.97           C  
ATOM  10756  CD1 ILE B 487      64.521 -28.649  31.176  1.00  0.97           C  
ATOM  10757  N   THR B 488      65.124 -23.816  32.644  1.00  0.98           N  
ATOM  10758  CA  THR B 488      64.962 -23.418  34.041  1.00  0.98           C  
ATOM  10759  C   THR B 488      64.239 -24.502  34.845  1.00  0.98           C  
ATOM  10760  O   THR B 488      63.137 -24.910  34.465  1.00  0.98           O  
ATOM  10761  CB  THR B 488      64.318 -22.053  34.267  1.00  0.98           C  
ATOM  10762  OG1 THR B 488      63.929 -21.856  35.625  1.00  0.98           O  
ATOM  10763  CG2 THR B 488      63.048 -21.904  33.432  1.00  0.98           C  
ATOM  10764  N   PRO B 489      64.780 -24.987  35.961  1.00  0.99           N  
ATOM  10765  CA  PRO B 489      64.127 -26.003  36.768  1.00  0.99           C  
ATOM  10766  C   PRO B 489      62.992 -25.429  37.585  1.00  0.99           C  
ATOM  10767  O   PRO B 489      62.236 -26.199  38.174  1.00  0.99           O  
ATOM  10768  CB  PRO B 489      65.257 -26.521  37.664  1.00  0.99           C  
ATOM  10769  CG  PRO B 489      66.172 -25.312  37.841  1.00  0.99           C  
ATOM  10770  CD  PRO B 489      66.118 -24.664  36.465  1.00  0.99           C  
ATOM  10771  N   ARG B 490      62.817 -24.093  37.659  1.00  0.93           N  
ATOM  10772  CA  ARG B 490      61.641 -23.547  38.309  1.00  0.93           C  
ATOM  10773  C   ARG B 490      60.408 -23.804  37.461  1.00  0.93           C  
ATOM  10774  O   ARG B 490      59.457 -24.447  37.887  1.00  0.93           O  
ATOM  10775  CB  ARG B 490      61.768 -22.022  38.564  1.00  0.93           C  
ATOM  10776  CG  ARG B 490      62.555 -21.639  39.835  1.00  0.93           C  
ATOM  10777  CD  ARG B 490      64.040 -21.997  39.841  1.00  0.93           C  
ATOM  10778  NE  ARG B 490      64.708 -21.208  38.768  1.00  0.93           N  
ATOM  10779  CZ  ARG B 490      66.028 -21.258  38.552  1.00  0.93           C  
ATOM  10780  NH1 ARG B 490      66.809 -22.095  39.220  1.00  0.93           N  
ATOM  10781  NH2 ARG B 490      66.558 -20.482  37.621  1.00  0.93           N  
ATOM  10782  N   ARG B 491      60.422 -23.372  36.190  1.00  0.93           N  
ATOM  10783  CA  ARG B 491      59.320 -23.636  35.284  1.00  0.93           C  
ATOM  10784  C   ARG B 491      59.211 -25.083  34.836  1.00  0.93           C  
ATOM  10785  O   ARG B 491      58.136 -25.667  34.841  1.00  0.93           O  
ATOM  10786  CB  ARG B 491      59.361 -22.678  34.080  1.00  0.93           C  
ATOM  10787  CG  ARG B 491      58.460 -23.075  32.897  1.00  0.93           C  
ATOM  10788  CD  ARG B 491      58.352 -21.967  31.854  1.00  0.93           C  
ATOM  10789  NE  ARG B 491      56.968 -21.451  31.912  1.00  0.93           N  
ATOM  10790  CZ  ARG B 491      56.503 -20.305  32.408  1.00  0.93           C  
ATOM  10791  NH1 ARG B 491      57.270 -19.327  32.873  1.00  0.93           N  
ATOM  10792  NH2 ARG B 491      55.179 -20.170  32.424  1.00  0.93           N  
ATOM  10793  N   TRP B 492      60.337 -25.722  34.469  1.00  0.93           N  
ATOM  10794  CA  TRP B 492      60.289 -27.028  33.839  1.00  0.93           C  
ATOM  10795  C   TRP B 492      60.441 -28.178  34.818  1.00  0.93           C  
ATOM  10796  O   TRP B 492      60.698 -29.309  34.420  1.00  0.93           O  
ATOM  10797  CB  TRP B 492      61.303 -27.124  32.678  1.00  0.93           C  
ATOM  10798  CG  TRP B 492      61.029 -26.093  31.605  1.00  0.93           C  
ATOM  10799  CD1 TRP B 492      61.709 -24.944  31.324  1.00  0.93           C  
ATOM  10800  CD2 TRP B 492      59.881 -26.091  30.732  1.00  0.93           C  
ATOM  10801  NE1 TRP B 492      61.088 -24.232  30.312  1.00  0.93           N  
ATOM  10802  CE2 TRP B 492      59.945 -24.931  29.963  1.00  0.93           C  
ATOM  10803  CE3 TRP B 492      58.819 -26.991  30.608  1.00  0.93           C  
ATOM  10804  CZ2 TRP B 492      58.955 -24.617  29.035  1.00  0.93           C  
ATOM  10805  CZ3 TRP B 492      57.808 -26.671  29.690  1.00  0.93           C  
ATOM  10806  CH2 TRP B 492      57.868 -25.502  28.923  1.00  0.93           C  
ATOM  10807  N   LEU B 493      60.222 -27.916  36.121  1.00  0.97           N  
ATOM  10808  CA  LEU B 493      60.080 -28.956  37.115  1.00  0.97           C  
ATOM  10809  C   LEU B 493      59.077 -28.522  38.172  1.00  0.97           C  
ATOM  10810  O   LEU B 493      58.014 -29.120  38.306  1.00  0.97           O  
ATOM  10811  CB  LEU B 493      61.447 -29.266  37.765  1.00  0.97           C  
ATOM  10812  CG  LEU B 493      61.661 -30.713  38.249  1.00  0.97           C  
ATOM  10813  CD1 LEU B 493      62.956 -30.736  39.071  1.00  0.97           C  
ATOM  10814  CD2 LEU B 493      60.500 -31.294  39.072  1.00  0.97           C  
ATOM  10815  N   VAL B 494      59.377 -27.451  38.945  1.00  0.96           N  
ATOM  10816  CA  VAL B 494      58.561 -27.014  40.078  1.00  0.96           C  
ATOM  10817  C   VAL B 494      57.143 -26.631  39.687  1.00  0.96           C  
ATOM  10818  O   VAL B 494      56.189 -27.057  40.335  1.00  0.96           O  
ATOM  10819  CB  VAL B 494      59.227 -25.865  40.842  1.00  0.96           C  
ATOM  10820  CG1 VAL B 494      58.368 -25.380  42.029  1.00  0.96           C  
ATOM  10821  CG2 VAL B 494      60.592 -26.337  41.378  1.00  0.96           C  
ATOM  10822  N   LEU B 495      56.963 -25.854  38.597  1.00  0.93           N  
ATOM  10823  CA  LEU B 495      55.635 -25.502  38.124  1.00  0.93           C  
ATOM  10824  C   LEU B 495      54.912 -26.617  37.401  1.00  0.93           C  
ATOM  10825  O   LEU B 495      53.769 -26.947  37.704  1.00  0.93           O  
ATOM  10826  CB  LEU B 495      55.674 -24.322  37.119  1.00  0.93           C  
ATOM  10827  CG  LEU B 495      56.371 -23.045  37.603  1.00  0.93           C  
ATOM  10828  CD1 LEU B 495      56.054 -21.896  36.640  1.00  0.93           C  
ATOM  10829  CD2 LEU B 495      55.994 -22.712  39.039  1.00  0.93           C  
ATOM  10830  N   CYS B 496      55.571 -27.245  36.406  1.00  0.95           N  
ATOM  10831  CA  CYS B 496      54.886 -28.171  35.531  1.00  0.95           C  
ATOM  10832  C   CYS B 496      54.626 -29.528  36.166  1.00  0.95           C  
ATOM  10833  O   CYS B 496      53.689 -30.240  35.816  1.00  0.95           O  
ATOM  10834  CB  CYS B 496      55.656 -28.324  34.194  1.00  0.95           C  
ATOM  10835  SG  CYS B 496      57.286 -29.125  34.318  1.00  0.95           S  
ATOM  10836  N   ASN B 497      55.448 -29.904  37.160  1.00  0.93           N  
ATOM  10837  CA  ASN B 497      55.394 -31.206  37.775  1.00  0.93           C  
ATOM  10838  C   ASN B 497      55.597 -31.112  39.285  1.00  0.93           C  
ATOM  10839  O   ASN B 497      56.588 -31.630  39.815  1.00  0.93           O  
ATOM  10840  CB  ASN B 497      56.492 -32.044  37.101  1.00  0.93           C  
ATOM  10841  CG  ASN B 497      56.289 -33.538  37.256  1.00  0.93           C  
ATOM  10842  OD1 ASN B 497      55.513 -34.051  38.062  1.00  0.93           O  
ATOM  10843  ND2 ASN B 497      57.043 -34.286  36.416  1.00  0.93           N  
ATOM  10844  N   PRO B 498      54.682 -30.480  40.034  1.00  0.93           N  
ATOM  10845  CA  PRO B 498      54.811 -30.293  41.473  1.00  0.93           C  
ATOM  10846  C   PRO B 498      54.878 -31.607  42.216  1.00  0.93           C  
ATOM  10847  O   PRO B 498      55.557 -31.671  43.236  1.00  0.93           O  
ATOM  10848  CB  PRO B 498      53.581 -29.458  41.864  1.00  0.93           C  
ATOM  10849  CG  PRO B 498      52.552 -29.772  40.776  1.00  0.93           C  
ATOM  10850  CD  PRO B 498      53.431 -29.899  39.536  1.00  0.93           C  
ATOM  10851  N   GLY B 499      54.222 -32.675  41.714  1.00  0.92           N  
ATOM  10852  CA  GLY B 499      54.280 -33.990  42.338  1.00  0.92           C  
ATOM  10853  C   GLY B 499      55.644 -34.626  42.256  1.00  0.92           C  
ATOM  10854  O   GLY B 499      56.120 -35.230  43.209  1.00  0.92           O  
ATOM  10855  N   LEU B 500      56.371 -34.478  41.126  1.00  0.93           N  
ATOM  10856  CA  LEU B 500      57.746 -34.947  41.050  1.00  0.93           C  
ATOM  10857  C   LEU B 500      58.658 -34.111  41.920  1.00  0.93           C  
ATOM  10858  O   LEU B 500      59.519 -34.629  42.625  1.00  0.93           O  
ATOM  10859  CB  LEU B 500      58.274 -34.978  39.599  1.00  0.93           C  
ATOM  10860  CG  LEU B 500      59.642 -35.667  39.403  1.00  0.93           C  
ATOM  10861  CD1 LEU B 500      59.592 -37.156  39.783  1.00  0.93           C  
ATOM  10862  CD2 LEU B 500      60.115 -35.515  37.950  1.00  0.93           C  
ATOM  10863  N   ALA B 501      58.445 -32.781  41.933  1.00  0.93           N  
ATOM  10864  CA  ALA B 501      59.196 -31.870  42.765  1.00  0.93           C  
ATOM  10865  C   ALA B 501      59.064 -32.176  44.256  1.00  0.93           C  
ATOM  10866  O   ALA B 501      60.062 -32.208  44.971  1.00  0.93           O  
ATOM  10867  CB  ALA B 501      58.770 -30.420  42.456  1.00  0.93           C  
ATOM  10868  N   GLU B 502      57.840 -32.475  44.732  1.00  0.86           N  
ATOM  10869  CA  GLU B 502      57.549 -32.911  46.084  1.00  0.86           C  
ATOM  10870  C   GLU B 502      58.220 -34.226  46.468  1.00  0.86           C  
ATOM  10871  O   GLU B 502      58.943 -34.290  47.461  1.00  0.86           O  
ATOM  10872  CB  GLU B 502      56.013 -33.006  46.191  1.00  0.86           C  
ATOM  10873  CG  GLU B 502      55.437 -33.394  47.568  1.00  0.86           C  
ATOM  10874  CD  GLU B 502      53.918 -33.222  47.555  1.00  0.86           C  
ATOM  10875  OE1 GLU B 502      53.260 -33.801  46.652  1.00  0.86           O  
ATOM  10876  OE2 GLU B 502      53.408 -32.462  48.420  1.00  0.86           O  
ATOM  10877  N   VAL B 503      58.117 -35.271  45.615  1.00  0.88           N  
ATOM  10878  CA  VAL B 503      58.763 -36.565  45.824  1.00  0.88           C  
ATOM  10879  C   VAL B 503      60.287 -36.455  45.892  1.00  0.88           C  
ATOM  10880  O   VAL B 503      60.956 -37.106  46.696  1.00  0.88           O  
ATOM  10881  CB  VAL B 503      58.324 -37.557  44.743  1.00  0.88           C  
ATOM  10882  CG1 VAL B 503      59.151 -38.860  44.764  1.00  0.88           C  
ATOM  10883  CG2 VAL B 503      56.841 -37.912  44.975  1.00  0.88           C  
ATOM  10884  N   ILE B 504      60.899 -35.598  45.048  1.00  0.90           N  
ATOM  10885  CA  ILE B 504      62.315 -35.264  45.140  1.00  0.90           C  
ATOM  10886  C   ILE B 504      62.666 -34.509  46.423  1.00  0.90           C  
ATOM  10887  O   ILE B 504      63.621 -34.856  47.121  1.00  0.90           O  
ATOM  10888  CB  ILE B 504      62.756 -34.477  43.904  1.00  0.90           C  
ATOM  10889  CG1 ILE B 504      62.631 -35.370  42.642  1.00  0.90           C  
ATOM  10890  CG2 ILE B 504      64.202 -33.952  44.063  1.00  0.90           C  
ATOM  10891  CD1 ILE B 504      62.992 -34.656  41.332  1.00  0.90           C  
ATOM  10892  N   ALA B 505      61.879 -33.479  46.797  1.00  0.91           N  
ATOM  10893  CA  ALA B 505      62.108 -32.641  47.958  1.00  0.91           C  
ATOM  10894  C   ALA B 505      62.056 -33.391  49.282  1.00  0.91           C  
ATOM  10895  O   ALA B 505      62.875 -33.157  50.169  1.00  0.91           O  
ATOM  10896  CB  ALA B 505      61.116 -31.464  47.945  1.00  0.91           C  
ATOM  10897  N   GLU B 506      61.141 -34.374  49.417  1.00  0.85           N  
ATOM  10898  CA  GLU B 506      61.074 -35.288  50.545  1.00  0.85           C  
ATOM  10899  C   GLU B 506      62.383 -36.019  50.799  1.00  0.85           C  
ATOM  10900  O   GLU B 506      62.768 -36.280  51.934  1.00  0.85           O  
ATOM  10901  CB  GLU B 506      60.005 -36.373  50.282  1.00  0.85           C  
ATOM  10902  CG  GLU B 506      58.540 -35.899  50.408  1.00  0.85           C  
ATOM  10903  CD  GLU B 506      57.581 -37.036  50.054  1.00  0.85           C  
ATOM  10904  OE1 GLU B 506      57.925 -38.210  50.355  1.00  0.85           O  
ATOM  10905  OE2 GLU B 506      56.507 -36.742  49.476  1.00  0.85           O  
ATOM  10906  N   ARG B 507      63.095 -36.389  49.716  1.00  0.83           N  
ATOM  10907  CA  ARG B 507      64.339 -37.111  49.816  1.00  0.83           C  
ATOM  10908  C   ARG B 507      65.578 -36.247  49.982  1.00  0.83           C  
ATOM  10909  O   ARG B 507      66.454 -36.590  50.770  1.00  0.83           O  
ATOM  10910  CB  ARG B 507      64.516 -38.056  48.606  1.00  0.83           C  
ATOM  10911  CG  ARG B 507      63.388 -39.102  48.444  1.00  0.83           C  
ATOM  10912  CD  ARG B 507      63.114 -39.940  49.701  1.00  0.83           C  
ATOM  10913  NE  ARG B 507      62.091 -40.974  49.350  1.00  0.83           N  
ATOM  10914  CZ  ARG B 507      62.230 -42.294  49.539  1.00  0.83           C  
ATOM  10915  NH1 ARG B 507      63.321 -42.829  50.069  1.00  0.83           N  
ATOM  10916  NH2 ARG B 507      61.276 -43.127  49.156  1.00  0.83           N  
ATOM  10917  N   ILE B 508      65.714 -35.129  49.230  1.00  0.90           N  
ATOM  10918  CA  ILE B 508      66.966 -34.377  49.233  1.00  0.90           C  
ATOM  10919  C   ILE B 508      66.847 -32.918  49.636  1.00  0.90           C  
ATOM  10920  O   ILE B 508      67.818 -32.166  49.533  1.00  0.90           O  
ATOM  10921  CB  ILE B 508      67.683 -34.445  47.889  1.00  0.90           C  
ATOM  10922  CG1 ILE B 508      66.856 -33.818  46.745  1.00  0.90           C  
ATOM  10923  CG2 ILE B 508      67.991 -35.925  47.590  1.00  0.90           C  
ATOM  10924  CD1 ILE B 508      67.666 -33.586  45.466  1.00  0.90           C  
ATOM  10925  N   GLY B 509      65.681 -32.458  50.129  1.00  0.91           N  
ATOM  10926  CA  GLY B 509      65.468 -31.040  50.408  1.00  0.91           C  
ATOM  10927  C   GLY B 509      65.258 -30.218  49.157  1.00  0.91           C  
ATOM  10928  O   GLY B 509      65.236 -30.740  48.050  1.00  0.91           O  
ATOM  10929  N   GLU B 510      65.061 -28.892  49.296  1.00  0.83           N  
ATOM  10930  CA  GLU B 510      64.657 -28.030  48.191  1.00  0.83           C  
ATOM  10931  C   GLU B 510      65.798 -27.305  47.485  1.00  0.83           C  
ATOM  10932  O   GLU B 510      65.579 -26.564  46.528  1.00  0.83           O  
ATOM  10933  CB  GLU B 510      63.637 -26.974  48.674  1.00  0.83           C  
ATOM  10934  CG  GLU B 510      62.208 -27.541  48.833  1.00  0.83           C  
ATOM  10935  CD  GLU B 510      61.232 -26.463  49.299  1.00  0.83           C  
ATOM  10936  OE1 GLU B 510      61.122 -25.409  48.611  1.00  0.83           O  
ATOM  10937  OE2 GLU B 510      60.588 -26.687  50.354  1.00  0.83           O  
ATOM  10938  N   ASP B 511      67.064 -27.541  47.876  1.00  0.85           N  
ATOM  10939  CA  ASP B 511      68.235 -26.902  47.296  1.00  0.85           C  
ATOM  10940  C   ASP B 511      68.395 -27.113  45.789  1.00  0.85           C  
ATOM  10941  O   ASP B 511      68.854 -26.242  45.059  1.00  0.85           O  
ATOM  10942  CB  ASP B 511      69.504 -27.410  48.011  1.00  0.85           C  
ATOM  10943  CG  ASP B 511      69.471 -27.088  49.496  1.00  0.85           C  
ATOM  10944  OD1 ASP B 511      68.776 -26.122  49.896  1.00  0.85           O  
ATOM  10945  OD2 ASP B 511      70.119 -27.862  50.246  1.00  0.85           O  
ATOM  10946  N   PHE B 512      67.946 -28.279  45.269  1.00  0.90           N  
ATOM  10947  CA  PHE B 512      68.013 -28.629  43.859  1.00  0.90           C  
ATOM  10948  C   PHE B 512      67.344 -27.637  42.909  1.00  0.90           C  
ATOM  10949  O   PHE B 512      67.707 -27.511  41.741  1.00  0.90           O  
ATOM  10950  CB  PHE B 512      67.513 -30.083  43.604  1.00  0.90           C  
ATOM  10951  CG  PHE B 512      66.020 -30.224  43.728  1.00  0.90           C  
ATOM  10952  CD1 PHE B 512      65.434 -30.441  44.979  1.00  0.90           C  
ATOM  10953  CD2 PHE B 512      65.189 -30.111  42.600  1.00  0.90           C  
ATOM  10954  CE1 PHE B 512      64.042 -30.512  45.116  1.00  0.90           C  
ATOM  10955  CE2 PHE B 512      63.797 -30.184  42.736  1.00  0.90           C  
ATOM  10956  CZ  PHE B 512      63.221 -30.376  43.995  1.00  0.90           C  
ATOM  10957  N   ILE B 513      66.345 -26.881  43.398  1.00  0.93           N  
ATOM  10958  CA  ILE B 513      65.593 -25.898  42.640  1.00  0.93           C  
ATOM  10959  C   ILE B 513      66.475 -24.761  42.121  1.00  0.93           C  
ATOM  10960  O   ILE B 513      66.209 -24.156  41.077  1.00  0.93           O  
ATOM  10961  CB  ILE B 513      64.442 -25.360  43.484  1.00  0.93           C  
ATOM  10962  CG1 ILE B 513      63.539 -26.532  43.947  1.00  0.93           C  
ATOM  10963  CG2 ILE B 513      63.629 -24.319  42.680  1.00  0.93           C  
ATOM  10964  CD1 ILE B 513      62.489 -26.122  44.984  1.00  0.93           C  
ATOM  10965  N   SER B 514      67.562 -24.435  42.849  1.00  0.91           N  
ATOM  10966  CA  SER B 514      68.516 -23.409  42.459  1.00  0.91           C  
ATOM  10967  C   SER B 514      69.929 -23.938  42.285  1.00  0.91           C  
ATOM  10968  O   SER B 514      70.863 -23.158  42.120  1.00  0.91           O  
ATOM  10969  CB  SER B 514      68.512 -22.224  43.461  1.00  0.91           C  
ATOM  10970  OG  SER B 514      68.793 -22.634  44.803  1.00  0.91           O  
ATOM  10971  N   ASP B 515      70.085 -25.276  42.263  1.00  0.89           N  
ATOM  10972  CA  ASP B 515      71.348 -25.965  42.102  1.00  0.89           C  
ATOM  10973  C   ASP B 515      71.041 -27.376  41.609  1.00  0.89           C  
ATOM  10974  O   ASP B 515      70.907 -28.327  42.364  1.00  0.89           O  
ATOM  10975  CB  ASP B 515      72.114 -26.030  43.450  1.00  0.89           C  
ATOM  10976  CG  ASP B 515      73.522 -26.574  43.271  1.00  0.89           C  
ATOM  10977  OD1 ASP B 515      73.961 -26.711  42.099  1.00  0.89           O  
ATOM  10978  OD2 ASP B 515      74.165 -26.867  44.309  1.00  0.89           O  
ATOM  10979  N   LEU B 516      70.853 -27.573  40.292  1.00  0.92           N  
ATOM  10980  CA  LEU B 516      70.216 -28.789  39.816  1.00  0.92           C  
ATOM  10981  C   LEU B 516      71.122 -30.016  39.859  1.00  0.92           C  
ATOM  10982  O   LEU B 516      70.660 -31.157  39.843  1.00  0.92           O  
ATOM  10983  CB  LEU B 516      69.626 -28.550  38.410  1.00  0.92           C  
ATOM  10984  CG  LEU B 516      68.505 -29.518  37.965  1.00  0.92           C  
ATOM  10985  CD1 LEU B 516      67.250 -29.336  38.832  1.00  0.92           C  
ATOM  10986  CD2 LEU B 516      68.161 -29.345  36.473  1.00  0.92           C  
ATOM  10987  N   ASP B 517      72.448 -29.829  40.019  1.00  0.90           N  
ATOM  10988  CA  ASP B 517      73.404 -30.906  40.168  1.00  0.90           C  
ATOM  10989  C   ASP B 517      73.243 -31.639  41.499  1.00  0.90           C  
ATOM  10990  O   ASP B 517      73.697 -32.769  41.680  1.00  0.90           O  
ATOM  10991  CB  ASP B 517      74.836 -30.377  39.948  1.00  0.90           C  
ATOM  10992  CG  ASP B 517      75.026 -30.182  38.453  1.00  0.90           C  
ATOM  10993  OD1 ASP B 517      74.916 -31.214  37.736  1.00  0.90           O  
ATOM  10994  OD2 ASP B 517      75.254 -29.034  38.000  1.00  0.90           O  
ATOM  10995  N   GLN B 518      72.461 -31.052  42.429  1.00  0.84           N  
ATOM  10996  CA  GLN B 518      71.975 -31.686  43.636  1.00  0.84           C  
ATOM  10997  C   GLN B 518      71.122 -32.933  43.375  1.00  0.84           C  
ATOM  10998  O   GLN B 518      71.056 -33.842  44.205  1.00  0.84           O  
ATOM  10999  CB  GLN B 518      71.159 -30.649  44.441  1.00  0.84           C  
ATOM  11000  CG  GLN B 518      70.939 -30.941  45.951  1.00  0.84           C  
ATOM  11001  CD  GLN B 518      72.227 -30.746  46.802  1.00  0.84           C  
ATOM  11002  OE1 GLN B 518      73.279 -31.043  46.491  1.00  0.84           O  
ATOM  11003  NE2 GLN B 518      71.898 -30.342  48.108  1.00  0.84           N  
ATOM  11004  N   LEU B 519      70.479 -33.046  42.183  1.00  0.90           N  
ATOM  11005  CA  LEU B 519      69.697 -34.210  41.784  1.00  0.90           C  
ATOM  11006  C   LEU B 519      70.492 -35.514  41.742  1.00  0.90           C  
ATOM  11007  O   LEU B 519      69.922 -36.593  41.873  1.00  0.90           O  
ATOM  11008  CB  LEU B 519      69.007 -34.017  40.409  1.00  0.90           C  
ATOM  11009  CG  LEU B 519      67.875 -32.969  40.364  1.00  0.90           C  
ATOM  11010  CD1 LEU B 519      67.274 -32.905  38.952  1.00  0.90           C  
ATOM  11011  CD2 LEU B 519      66.749 -33.281  41.359  1.00  0.90           C  
ATOM  11012  N   ARG B 520      71.842 -35.461  41.646  1.00  0.83           N  
ATOM  11013  CA  ARG B 520      72.715 -36.628  41.644  1.00  0.83           C  
ATOM  11014  C   ARG B 520      72.605 -37.477  42.905  1.00  0.83           C  
ATOM  11015  O   ARG B 520      72.937 -38.659  42.913  1.00  0.83           O  
ATOM  11016  CB  ARG B 520      74.197 -36.218  41.441  1.00  0.83           C  
ATOM  11017  CG  ARG B 520      74.457 -35.511  40.093  1.00  0.83           C  
ATOM  11018  CD  ARG B 520      75.926 -35.167  39.809  1.00  0.83           C  
ATOM  11019  NE  ARG B 520      76.656 -36.453  39.530  1.00  0.83           N  
ATOM  11020  CZ  ARG B 520      76.634 -37.083  38.343  1.00  0.83           C  
ATOM  11021  NH1 ARG B 520      76.020 -36.567  37.283  1.00  0.83           N  
ATOM  11022  NH2 ARG B 520      77.247 -38.263  38.229  1.00  0.83           N  
ATOM  11023  N   LYS B 521      72.065 -36.905  43.999  1.00  0.82           N  
ATOM  11024  CA  LYS B 521      71.781 -37.607  45.232  1.00  0.82           C  
ATOM  11025  C   LYS B 521      70.655 -38.632  45.089  1.00  0.82           C  
ATOM  11026  O   LYS B 521      70.511 -39.519  45.927  1.00  0.82           O  
ATOM  11027  CB  LYS B 521      71.412 -36.592  46.343  1.00  0.82           C  
ATOM  11028  CG  LYS B 521      72.544 -35.638  46.770  1.00  0.82           C  
ATOM  11029  CD  LYS B 521      72.051 -34.641  47.839  1.00  0.82           C  
ATOM  11030  CE  LYS B 521      73.093 -33.638  48.348  1.00  0.82           C  
ATOM  11031  NZ  LYS B 521      74.146 -34.350  49.101  1.00  0.82           N  
ATOM  11032  N   LEU B 522      69.849 -38.580  44.004  1.00  0.86           N  
ATOM  11033  CA  LEU B 522      68.777 -39.528  43.747  1.00  0.86           C  
ATOM  11034  C   LEU B 522      69.295 -40.892  43.293  1.00  0.86           C  
ATOM  11035  O   LEU B 522      68.576 -41.886  43.356  1.00  0.86           O  
ATOM  11036  CB  LEU B 522      67.773 -38.969  42.710  1.00  0.86           C  
ATOM  11037  CG  LEU B 522      66.674 -38.024  43.253  1.00  0.86           C  
ATOM  11038  CD1 LEU B 522      67.130 -37.062  44.358  1.00  0.86           C  
ATOM  11039  CD2 LEU B 522      66.085 -37.229  42.078  1.00  0.86           C  
ATOM  11040  N   LEU B 523      70.584 -40.999  42.890  1.00  0.85           N  
ATOM  11041  CA  LEU B 523      71.256 -42.257  42.578  1.00  0.85           C  
ATOM  11042  C   LEU B 523      71.263 -43.212  43.762  1.00  0.85           C  
ATOM  11043  O   LEU B 523      71.104 -44.419  43.606  1.00  0.85           O  
ATOM  11044  CB  LEU B 523      72.719 -41.997  42.113  1.00  0.85           C  
ATOM  11045  CG  LEU B 523      73.048 -42.106  40.599  1.00  0.85           C  
ATOM  11046  CD1 LEU B 523      71.855 -41.898  39.656  1.00  0.85           C  
ATOM  11047  CD2 LEU B 523      74.161 -41.102  40.245  1.00  0.85           C  
ATOM  11048  N   SER B 524      71.379 -42.668  44.989  1.00  0.82           N  
ATOM  11049  CA  SER B 524      71.350 -43.417  46.236  1.00  0.82           C  
ATOM  11050  C   SER B 524      70.003 -44.038  46.532  1.00  0.82           C  
ATOM  11051  O   SER B 524      69.885 -44.903  47.390  1.00  0.82           O  
ATOM  11052  CB  SER B 524      71.672 -42.517  47.451  1.00  0.82           C  
ATOM  11053  OG  SER B 524      72.927 -41.860  47.266  1.00  0.82           O  
ATOM  11054  N   PHE B 525      68.947 -43.608  45.815  1.00  0.86           N  
ATOM  11055  CA  PHE B 525      67.600 -44.086  46.008  1.00  0.86           C  
ATOM  11056  C   PHE B 525      67.141 -44.911  44.818  1.00  0.86           C  
ATOM  11057  O   PHE B 525      65.966 -45.239  44.702  1.00  0.86           O  
ATOM  11058  CB  PHE B 525      66.619 -42.901  46.184  1.00  0.86           C  
ATOM  11059  CG  PHE B 525      66.941 -42.118  47.422  1.00  0.86           C  
ATOM  11060  CD1 PHE B 525      67.881 -41.079  47.380  1.00  0.86           C  
ATOM  11061  CD2 PHE B 525      66.317 -42.418  48.643  1.00  0.86           C  
ATOM  11062  CE1 PHE B 525      68.193 -40.347  48.529  1.00  0.86           C  
ATOM  11063  CE2 PHE B 525      66.627 -41.689  49.800  1.00  0.86           C  
ATOM  11064  CZ  PHE B 525      67.566 -40.652  49.742  1.00  0.86           C  
ATOM  11065  N   VAL B 526      68.056 -45.311  43.904  1.00  0.85           N  
ATOM  11066  CA  VAL B 526      67.706 -46.073  42.712  1.00  0.85           C  
ATOM  11067  C   VAL B 526      67.116 -47.437  43.031  1.00  0.85           C  
ATOM  11068  O   VAL B 526      66.274 -47.946  42.295  1.00  0.85           O  
ATOM  11069  CB  VAL B 526      68.865 -46.163  41.721  1.00  0.85           C  
ATOM  11070  CG1 VAL B 526      69.954 -47.155  42.172  1.00  0.85           C  
ATOM  11071  CG2 VAL B 526      68.321 -46.547  40.331  1.00  0.85           C  
ATOM  11072  N   ASP B 527      67.535 -48.024  44.168  1.00  0.83           N  
ATOM  11073  CA  ASP B 527      67.054 -49.283  44.685  1.00  0.83           C  
ATOM  11074  C   ASP B 527      66.136 -49.116  45.907  1.00  0.83           C  
ATOM  11075  O   ASP B 527      65.806 -50.080  46.588  1.00  0.83           O  
ATOM  11076  CB  ASP B 527      68.275 -50.174  45.017  1.00  0.83           C  
ATOM  11077  CG  ASP B 527      69.009 -50.462  43.721  1.00  0.83           C  
ATOM  11078  OD1 ASP B 527      68.374 -51.054  42.807  1.00  0.83           O  
ATOM  11079  OD2 ASP B 527      70.190 -50.057  43.575  1.00  0.83           O  
ATOM  11080  N   ASP B 528      65.662 -47.882  46.215  1.00  0.83           N  
ATOM  11081  CA  ASP B 528      64.674 -47.653  47.260  1.00  0.83           C  
ATOM  11082  C   ASP B 528      63.279 -47.977  46.736  1.00  0.83           C  
ATOM  11083  O   ASP B 528      62.755 -47.332  45.828  1.00  0.83           O  
ATOM  11084  CB  ASP B 528      64.790 -46.189  47.783  1.00  0.83           C  
ATOM  11085  CG  ASP B 528      63.856 -45.781  48.912  1.00  0.83           C  
ATOM  11086  OD1 ASP B 528      64.320 -45.592  50.061  1.00  0.83           O  
ATOM  11087  OD2 ASP B 528      62.661 -45.496  48.646  1.00  0.83           O  
ATOM  11088  N   GLU B 529      62.634 -49.002  47.332  1.00  0.80           N  
ATOM  11089  CA  GLU B 529      61.331 -49.504  46.937  1.00  0.80           C  
ATOM  11090  C   GLU B 529      60.229 -48.478  47.005  1.00  0.80           C  
ATOM  11091  O   GLU B 529      59.365 -48.395  46.130  1.00  0.80           O  
ATOM  11092  CB  GLU B 529      60.907 -50.700  47.825  1.00  0.80           C  
ATOM  11093  CG  GLU B 529      61.826 -51.926  47.700  1.00  0.80           C  
ATOM  11094  CD  GLU B 529      61.905 -52.412  46.279  1.00  0.80           C  
ATOM  11095  OE1 GLU B 529      63.031 -52.787  45.867  1.00  0.80           O  
ATOM  11096  OE2 GLU B 529      60.895 -52.428  45.523  1.00  0.80           O  
ATOM  11097  N   ALA B 530      60.232 -47.635  48.054  1.00  0.89           N  
ATOM  11098  CA  ALA B 530      59.311 -46.535  48.131  1.00  0.89           C  
ATOM  11099  C   ALA B 530      59.544 -45.511  47.022  1.00  0.89           C  
ATOM  11100  O   ALA B 530      58.618 -45.161  46.309  1.00  0.89           O  
ATOM  11101  CB  ALA B 530      59.382 -45.922  49.542  1.00  0.89           C  
ATOM  11102  N   PHE B 531      60.795 -45.078  46.767  1.00  0.85           N  
ATOM  11103  CA  PHE B 531      61.124 -44.094  45.752  1.00  0.85           C  
ATOM  11104  C   PHE B 531      60.773 -44.555  44.345  1.00  0.85           C  
ATOM  11105  O   PHE B 531      60.181 -43.811  43.568  1.00  0.85           O  
ATOM  11106  CB  PHE B 531      62.624 -43.714  45.863  1.00  0.85           C  
ATOM  11107  CG  PHE B 531      62.970 -42.466  45.102  1.00  0.85           C  
ATOM  11108  CD1 PHE B 531      62.417 -41.230  45.471  1.00  0.85           C  
ATOM  11109  CD2 PHE B 531      63.865 -42.515  44.022  1.00  0.85           C  
ATOM  11110  CE1 PHE B 531      62.732 -40.067  44.756  1.00  0.85           C  
ATOM  11111  CE2 PHE B 531      64.174 -41.356  43.300  1.00  0.85           C  
ATOM  11112  CZ  PHE B 531      63.594 -40.134  43.657  1.00  0.85           C  
ATOM  11113  N   ILE B 532      61.055 -45.830  44.006  1.00  0.86           N  
ATOM  11114  CA  ILE B 532      60.632 -46.433  42.747  1.00  0.86           C  
ATOM  11115  C   ILE B 532      59.114 -46.403  42.591  1.00  0.86           C  
ATOM  11116  O   ILE B 532      58.580 -46.012  41.552  1.00  0.86           O  
ATOM  11117  CB  ILE B 532      61.136 -47.874  42.636  1.00  0.86           C  
ATOM  11118  CG1 ILE B 532      62.682 -47.916  42.612  1.00  0.86           C  
ATOM  11119  CG2 ILE B 532      60.562 -48.572  41.377  1.00  0.86           C  
ATOM  11120  CD1 ILE B 532      63.231 -49.332  42.821  1.00  0.86           C  
ATOM  11121  N   ARG B 533      58.369 -46.766  43.651  1.00  0.80           N  
ATOM  11122  CA  ARG B 533      56.923 -46.694  43.657  1.00  0.80           C  
ATOM  11123  C   ARG B 533      56.380 -45.267  43.552  1.00  0.80           C  
ATOM  11124  O   ARG B 533      55.464 -45.001  42.777  1.00  0.80           O  
ATOM  11125  CB  ARG B 533      56.404 -47.378  44.944  1.00  0.80           C  
ATOM  11126  CG  ARG B 533      54.871 -47.407  45.112  1.00  0.80           C  
ATOM  11127  CD  ARG B 533      54.380 -47.971  46.464  1.00  0.80           C  
ATOM  11128  NE  ARG B 533      55.070 -47.319  47.638  1.00  0.80           N  
ATOM  11129  CZ  ARG B 533      54.985 -46.008  47.951  1.00  0.80           C  
ATOM  11130  NH1 ARG B 533      54.229 -45.208  47.241  1.00  0.80           N  
ATOM  11131  NH2 ARG B 533      55.698 -45.499  48.952  1.00  0.80           N  
ATOM  11132  N   ASP B 534      56.934 -44.307  44.317  1.00  0.89           N  
ATOM  11133  CA  ASP B 534      56.513 -42.920  44.314  1.00  0.89           C  
ATOM  11134  C   ASP B 534      56.813 -42.190  42.990  1.00  0.89           C  
ATOM  11135  O   ASP B 534      55.975 -41.450  42.485  1.00  0.89           O  
ATOM  11136  CB  ASP B 534      57.029 -42.198  45.595  1.00  0.89           C  
ATOM  11137  CG  ASP B 534      56.354 -42.798  46.824  1.00  0.89           C  
ATOM  11138  OD1 ASP B 534      55.093 -42.813  46.839  1.00  0.89           O  
ATOM  11139  OD2 ASP B 534      57.023 -43.316  47.760  1.00  0.89           O  
ATOM  11140  N   VAL B 535      57.977 -42.425  42.334  1.00  0.91           N  
ATOM  11141  CA  VAL B 535      58.276 -41.890  41.001  1.00  0.91           C  
ATOM  11142  C   VAL B 535      57.316 -42.396  39.929  1.00  0.91           C  
ATOM  11143  O   VAL B 535      56.805 -41.631  39.109  1.00  0.91           O  
ATOM  11144  CB  VAL B 535      59.716 -42.210  40.588  1.00  0.91           C  
ATOM  11145  CG1 VAL B 535      60.004 -41.870  39.106  1.00  0.91           C  
ATOM  11146  CG2 VAL B 535      60.693 -41.412  41.475  1.00  0.91           C  
ATOM  11147  N   ALA B 536      57.009 -43.712  39.934  1.00  0.90           N  
ATOM  11148  CA  ALA B 536      56.037 -44.302  39.036  1.00  0.90           C  
ATOM  11149  C   ALA B 536      54.623 -43.770  39.247  1.00  0.90           C  
ATOM  11150  O   ALA B 536      53.879 -43.518  38.297  1.00  0.90           O  
ATOM  11151  CB  ALA B 536      56.054 -45.834  39.200  1.00  0.90           C  
ATOM  11152  N   LYS B 537      54.229 -43.561  40.517  1.00  0.86           N  
ATOM  11153  CA  LYS B 537      52.951 -42.998  40.894  1.00  0.86           C  
ATOM  11154  C   LYS B 537      52.722 -41.580  40.405  1.00  0.86           C  
ATOM  11155  O   LYS B 537      51.676 -41.296  39.826  1.00  0.86           O  
ATOM  11156  CB  LYS B 537      52.818 -43.039  42.425  1.00  0.86           C  
ATOM  11157  CG  LYS B 537      51.464 -42.559  42.950  1.00  0.86           C  
ATOM  11158  CD  LYS B 537      51.407 -42.635  44.478  1.00  0.86           C  
ATOM  11159  CE  LYS B 537      50.076 -42.118  45.018  1.00  0.86           C  
ATOM  11160  NZ  LYS B 537      50.074 -42.141  46.491  1.00  0.86           N  
ATOM  11161  N   VAL B 538      53.722 -40.680  40.542  1.00  0.91           N  
ATOM  11162  CA  VAL B 538      53.653 -39.319  40.017  1.00  0.91           C  
ATOM  11163  C   VAL B 538      53.433 -39.329  38.519  1.00  0.91           C  
ATOM  11164  O   VAL B 538      52.644 -38.570  37.958  1.00  0.91           O  
ATOM  11165  CB  VAL B 538      54.949 -38.556  40.281  1.00  0.91           C  
ATOM  11166  CG1 VAL B 538      54.969 -37.204  39.534  1.00  0.91           C  
ATOM  11167  CG2 VAL B 538      55.092 -38.300  41.790  1.00  0.91           C  
ATOM  11168  N   LYS B 539      54.130 -40.237  37.811  1.00  0.90           N  
ATOM  11169  CA  LYS B 539      53.969 -40.389  36.388  1.00  0.90           C  
ATOM  11170  C   LYS B 539      52.572 -40.821  35.983  1.00  0.90           C  
ATOM  11171  O   LYS B 539      51.973 -40.242  35.078  1.00  0.90           O  
ATOM  11172  CB  LYS B 539      55.028 -41.369  35.846  1.00  0.90           C  
ATOM  11173  CG  LYS B 539      55.402 -41.109  34.386  1.00  0.90           C  
ATOM  11174  CD  LYS B 539      56.176 -39.793  34.226  1.00  0.90           C  
ATOM  11175  CE  LYS B 539      56.488 -39.529  32.764  1.00  0.90           C  
ATOM  11176  NZ  LYS B 539      56.997 -38.162  32.548  1.00  0.90           N  
ATOM  11177  N   GLN B 540      51.991 -41.801  36.699  1.00  0.87           N  
ATOM  11178  CA  GLN B 540      50.625 -42.237  36.508  1.00  0.87           C  
ATOM  11179  C   GLN B 540      49.607 -41.130  36.799  1.00  0.87           C  
ATOM  11180  O   GLN B 540      48.695 -40.899  36.027  1.00  0.87           O  
ATOM  11181  CB  GLN B 540      50.363 -43.515  37.345  1.00  0.87           C  
ATOM  11182  CG  GLN B 540      49.109 -44.338  36.963  1.00  0.87           C  
ATOM  11183  CD  GLN B 540      49.203 -44.881  35.537  1.00  0.87           C  
ATOM  11184  OE1 GLN B 540      48.870 -44.221  34.564  1.00  0.87           O  
ATOM  11185  NE2 GLN B 540      49.684 -46.144  35.415  1.00  0.87           N  
ATOM  11186  N   GLU B 541      49.806 -40.352  37.895  1.00  0.85           N  
ATOM  11187  CA  GLU B 541      49.006 -39.173  38.200  1.00  0.85           C  
ATOM  11188  C   GLU B 541      49.044 -38.117  37.110  1.00  0.85           C  
ATOM  11189  O   GLU B 541      48.007 -37.607  36.682  1.00  0.85           O  
ATOM  11190  CB  GLU B 541      49.469 -38.541  39.534  1.00  0.85           C  
ATOM  11191  CG  GLU B 541      49.015 -39.358  40.765  1.00  0.85           C  
ATOM  11192  CD  GLU B 541      49.620 -38.860  42.074  1.00  0.85           C  
ATOM  11193  OE1 GLU B 541      50.072 -37.692  42.135  1.00  0.85           O  
ATOM  11194  OE2 GLU B 541      49.614 -39.667  43.041  1.00  0.85           O  
ATOM  11195  N   ASN B 542      50.238 -37.811  36.568  1.00  0.91           N  
ATOM  11196  CA  ASN B 542      50.388 -36.908  35.442  1.00  0.91           C  
ATOM  11197  C   ASN B 542      49.706 -37.400  34.173  1.00  0.91           C  
ATOM  11198  O   ASN B 542      49.079 -36.618  33.463  1.00  0.91           O  
ATOM  11199  CB  ASN B 542      51.872 -36.612  35.142  1.00  0.91           C  
ATOM  11200  CG  ASN B 542      52.458 -35.721  36.231  1.00  0.91           C  
ATOM  11201  OD1 ASN B 542      51.769 -34.937  36.885  1.00  0.91           O  
ATOM  11202  ND2 ASN B 542      53.798 -35.799  36.387  1.00  0.91           N  
ATOM  11203  N   LYS B 543      49.776 -38.711  33.864  1.00  0.89           N  
ATOM  11204  CA  LYS B 543      49.057 -39.295  32.746  1.00  0.89           C  
ATOM  11205  C   LYS B 543      47.556 -39.161  32.846  1.00  0.89           C  
ATOM  11206  O   LYS B 543      46.901 -38.737  31.894  1.00  0.89           O  
ATOM  11207  CB  LYS B 543      49.358 -40.796  32.630  1.00  0.89           C  
ATOM  11208  CG  LYS B 543      50.762 -41.088  32.116  1.00  0.89           C  
ATOM  11209  CD  LYS B 543      50.941 -42.596  31.977  1.00  0.89           C  
ATOM  11210  CE  LYS B 543      52.177 -42.947  31.190  1.00  0.89           C  
ATOM  11211  NZ  LYS B 543      52.175 -44.372  30.851  1.00  0.89           N  
ATOM  11212  N   LEU B 544      46.984 -39.469  34.025  1.00  0.87           N  
ATOM  11213  CA  LEU B 544      45.576 -39.288  34.317  1.00  0.87           C  
ATOM  11214  C   LEU B 544      45.156 -37.831  34.234  1.00  0.87           C  
ATOM  11215  O   LEU B 544      44.127 -37.495  33.654  1.00  0.87           O  
ATOM  11216  CB  LEU B 544      45.245 -39.811  35.735  1.00  0.87           C  
ATOM  11217  CG  LEU B 544      45.340 -41.340  35.903  1.00  0.87           C  
ATOM  11218  CD1 LEU B 544      45.312 -41.710  37.393  1.00  0.87           C  
ATOM  11219  CD2 LEU B 544      44.198 -42.060  35.175  1.00  0.87           C  
ATOM  11220  N   LYS B 545      45.975 -36.914  34.784  1.00  0.84           N  
ATOM  11221  CA  LYS B 545      45.729 -35.489  34.712  1.00  0.84           C  
ATOM  11222  C   LYS B 545      45.745 -34.938  33.289  1.00  0.84           C  
ATOM  11223  O   LYS B 545      44.863 -34.177  32.894  1.00  0.84           O  
ATOM  11224  CB  LYS B 545      46.762 -34.735  35.587  1.00  0.84           C  
ATOM  11225  CG  LYS B 545      46.507 -33.224  35.729  1.00  0.84           C  
ATOM  11226  CD  LYS B 545      47.605 -32.534  36.557  1.00  0.84           C  
ATOM  11227  CE  LYS B 545      47.405 -31.020  36.771  1.00  0.84           C  
ATOM  11228  NZ  LYS B 545      46.241 -30.720  37.649  1.00  0.84           N  
ATOM  11229  N   PHE B 546      46.739 -35.336  32.468  1.00  0.89           N  
ATOM  11230  CA  PHE B 546      46.848 -34.964  31.075  1.00  0.89           C  
ATOM  11231  C   PHE B 546      45.708 -35.518  30.232  1.00  0.89           C  
ATOM  11232  O   PHE B 546      45.123 -34.822  29.433  1.00  0.89           O  
ATOM  11233  CB  PHE B 546      48.222 -35.407  30.517  1.00  0.89           C  
ATOM  11234  CG  PHE B 546      48.468 -34.832  29.154  1.00  0.89           C  
ATOM  11235  CD1 PHE B 546      48.581 -33.444  28.987  1.00  0.89           C  
ATOM  11236  CD2 PHE B 546      48.528 -35.661  28.028  1.00  0.89           C  
ATOM  11237  CE1 PHE B 546      48.713 -32.888  27.710  1.00  0.89           C  
ATOM  11238  CE2 PHE B 546      48.688 -35.104  26.757  1.00  0.89           C  
ATOM  11239  CZ  PHE B 546      48.761 -33.720  26.590  1.00  0.89           C  
ATOM  11240  N   ALA B 547      45.346 -36.799  30.470  1.00  0.88           N  
ATOM  11241  CA  ALA B 547      44.223 -37.456  29.848  1.00  0.88           C  
ATOM  11242  C   ALA B 547      42.920 -36.750  30.131  1.00  0.88           C  
ATOM  11243  O   ALA B 547      42.138 -36.472  29.221  1.00  0.88           O  
ATOM  11244  CB  ALA B 547      44.146 -38.875  30.429  1.00  0.88           C  
ATOM  11245  N   ALA B 548      42.707 -36.369  31.408  1.00  0.85           N  
ATOM  11246  CA  ALA B 548      41.572 -35.592  31.816  1.00  0.85           C  
ATOM  11247  C   ALA B 548      41.513 -34.240  31.137  1.00  0.85           C  
ATOM  11248  O   ALA B 548      40.484 -33.914  30.565  1.00  0.85           O  
ATOM  11249  CB  ALA B 548      41.574 -35.425  33.347  1.00  0.85           C  
ATOM  11250  N   TYR B 549      42.630 -33.469  31.095  1.00  0.82           N  
ATOM  11251  CA  TYR B 549      42.717 -32.182  30.417  1.00  0.82           C  
ATOM  11252  C   TYR B 549      42.382 -32.289  28.940  1.00  0.82           C  
ATOM  11253  O   TYR B 549      41.606 -31.492  28.410  1.00  0.82           O  
ATOM  11254  CB  TYR B 549      44.143 -31.579  30.636  1.00  0.82           C  
ATOM  11255  CG  TYR B 549      44.479 -30.405  29.737  1.00  0.82           C  
ATOM  11256  CD1 TYR B 549      45.136 -30.647  28.519  1.00  0.82           C  
ATOM  11257  CD2 TYR B 549      44.116 -29.086  30.056  1.00  0.82           C  
ATOM  11258  CE1 TYR B 549      45.407 -29.599  27.631  1.00  0.82           C  
ATOM  11259  CE2 TYR B 549      44.382 -28.037  29.160  1.00  0.82           C  
ATOM  11260  CZ  TYR B 549      45.021 -28.291  27.941  1.00  0.82           C  
ATOM  11261  OH  TYR B 549      45.236 -27.233  27.025  1.00  0.82           O  
ATOM  11262  N   LEU B 550      42.942 -33.305  28.274  1.00  0.79           N  
ATOM  11263  CA  LEU B 550      42.761 -33.582  26.877  1.00  0.79           C  
ATOM  11264  C   LEU B 550      41.331 -33.880  26.497  1.00  0.79           C  
ATOM  11265  O   LEU B 550      40.861 -33.377  25.484  1.00  0.79           O  
ATOM  11266  CB  LEU B 550      43.688 -34.748  26.493  1.00  0.79           C  
ATOM  11267  CG  LEU B 550      44.763 -34.478  25.437  1.00  0.79           C  
ATOM  11268  CD1 LEU B 550      45.578 -33.236  25.772  1.00  0.79           C  
ATOM  11269  CD2 LEU B 550      45.718 -35.680  25.378  1.00  0.79           C  
ATOM  11270  N   GLU B 551      40.585 -34.670  27.300  1.00  0.74           N  
ATOM  11271  CA  GLU B 551      39.212 -34.975  26.931  1.00  0.74           C  
ATOM  11272  C   GLU B 551      38.185 -33.962  27.438  1.00  0.74           C  
ATOM  11273  O   GLU B 551      37.027 -33.970  27.030  1.00  0.74           O  
ATOM  11274  CB  GLU B 551      38.824 -36.425  27.292  1.00  0.74           C  
ATOM  11275  CG  GLU B 551      37.594 -36.908  26.480  1.00  0.74           C  
ATOM  11276  CD  GLU B 551      37.393 -38.417  26.415  1.00  0.74           C  
ATOM  11277  OE1 GLU B 551      36.445 -38.821  25.680  1.00  0.74           O  
ATOM  11278  OE2 GLU B 551      38.186 -39.183  27.013  1.00  0.74           O  
ATOM  11279  N   ARG B 552      38.580 -33.000  28.304  1.00  0.74           N  
ATOM  11280  CA  ARG B 552      37.662 -31.953  28.723  1.00  0.74           C  
ATOM  11281  C   ARG B 552      37.843 -30.623  27.995  1.00  0.74           C  
ATOM  11282  O   ARG B 552      36.974 -29.763  28.083  1.00  0.74           O  
ATOM  11283  CB  ARG B 552      37.785 -31.675  30.244  1.00  0.74           C  
ATOM  11284  CG  ARG B 552      39.144 -31.076  30.643  1.00  0.74           C  
ATOM  11285  CD  ARG B 552      39.223 -30.430  32.027  1.00  0.74           C  
ATOM  11286  NE  ARG B 552      38.491 -29.124  31.949  1.00  0.74           N  
ATOM  11287  CZ  ARG B 552      38.951 -28.089  31.238  1.00  0.74           C  
ATOM  11288  NH1 ARG B 552      40.165 -28.130  30.711  1.00  0.74           N  
ATOM  11289  NH2 ARG B 552      38.213 -27.009  30.988  1.00  0.74           N  
ATOM  11290  N   GLU B 553      38.978 -30.414  27.285  1.00  0.73           N  
ATOM  11291  CA  GLU B 553      39.247 -29.178  26.559  1.00  0.73           C  
ATOM  11292  C   GLU B 553      39.249 -29.430  25.049  1.00  0.73           C  
ATOM  11293  O   GLU B 553      39.214 -28.517  24.237  1.00  0.73           O  
ATOM  11294  CB  GLU B 553      40.632 -28.614  26.997  1.00  0.73           C  
ATOM  11295  CG  GLU B 553      40.845 -27.087  26.784  1.00  0.73           C  
ATOM  11296  CD  GLU B 553      39.934 -26.183  27.622  1.00  0.73           C  
ATOM  11297  OE1 GLU B 553      39.958 -26.340  28.876  1.00  0.73           O  
ATOM  11298  OE2 GLU B 553      39.226 -25.316  27.057  1.00  0.73           O  
ATOM  11299  N   TYR B 554      39.249 -30.719  24.645  1.00  0.78           N  
ATOM  11300  CA  TYR B 554      39.276 -31.178  23.268  1.00  0.78           C  
ATOM  11301  C   TYR B 554      38.583 -32.537  23.278  1.00  0.78           C  
ATOM  11302  O   TYR B 554      38.125 -32.992  24.314  1.00  0.78           O  
ATOM  11303  CB  TYR B 554      40.712 -31.417  22.719  1.00  0.78           C  
ATOM  11304  CG  TYR B 554      41.596 -30.207  22.818  1.00  0.78           C  
ATOM  11305  CD1 TYR B 554      41.473 -29.141  21.912  1.00  0.78           C  
ATOM  11306  CD2 TYR B 554      42.598 -30.151  23.803  1.00  0.78           C  
ATOM  11307  CE1 TYR B 554      42.336 -28.037  21.990  1.00  0.78           C  
ATOM  11308  CE2 TYR B 554      43.457 -29.048  23.883  1.00  0.78           C  
ATOM  11309  CZ  TYR B 554      43.323 -27.991  22.977  1.00  0.78           C  
ATOM  11310  OH  TYR B 554      44.208 -26.901  23.075  1.00  0.78           O  
ATOM  11311  N   LYS B 555      38.468 -33.248  22.129  1.00  0.64           N  
ATOM  11312  CA  LYS B 555      38.042 -34.642  22.172  1.00  0.64           C  
ATOM  11313  C   LYS B 555      39.288 -35.515  22.220  1.00  0.64           C  
ATOM  11314  O   LYS B 555      40.178 -35.383  21.382  1.00  0.64           O  
ATOM  11315  CB  LYS B 555      37.173 -35.060  20.947  1.00  0.64           C  
ATOM  11316  CG  LYS B 555      36.135 -36.181  21.196  1.00  0.64           C  
ATOM  11317  CD  LYS B 555      36.631 -37.408  21.973  1.00  0.64           C  
ATOM  11318  CE  LYS B 555      35.550 -38.450  22.252  1.00  0.64           C  
ATOM  11319  NZ  LYS B 555      36.039 -39.446  23.211  1.00  0.64           N  
ATOM  11320  N   VAL B 556      39.380 -36.450  23.180  1.00  0.73           N  
ATOM  11321  CA  VAL B 556      40.486 -37.378  23.239  1.00  0.73           C  
ATOM  11322  C   VAL B 556      40.000 -38.802  23.424  1.00  0.73           C  
ATOM  11323  O   VAL B 556      38.797 -39.066  23.449  1.00  0.73           O  
ATOM  11324  CB  VAL B 556      41.533 -36.863  24.222  1.00  0.73           C  
ATOM  11325  CG1 VAL B 556      41.833 -37.782  25.422  1.00  0.73           C  
ATOM  11326  CG2 VAL B 556      42.775 -36.569  23.367  1.00  0.73           C  
ATOM  11327  N   HIS B 557      40.896 -39.802  23.459  1.00  0.73           N  
ATOM  11328  CA  HIS B 557      40.534 -41.089  24.013  1.00  0.73           C  
ATOM  11329  C   HIS B 557      41.781 -41.580  24.703  1.00  0.73           C  
ATOM  11330  O   HIS B 557      42.878 -41.361  24.215  1.00  0.73           O  
ATOM  11331  CB  HIS B 557      40.047 -42.126  22.964  1.00  0.73           C  
ATOM  11332  CG  HIS B 557      39.298 -43.262  23.600  1.00  0.73           C  
ATOM  11333  ND1 HIS B 557      38.024 -43.007  24.062  1.00  0.73           N  
ATOM  11334  CD2 HIS B 557      39.694 -44.506  23.974  1.00  0.73           C  
ATOM  11335  CE1 HIS B 557      37.671 -44.093  24.720  1.00  0.73           C  
ATOM  11336  NE2 HIS B 557      38.645 -45.035  24.696  1.00  0.73           N  
ATOM  11337  N   ILE B 558      41.645 -42.236  25.873  1.00  0.82           N  
ATOM  11338  CA  ILE B 558      42.810 -42.673  26.619  1.00  0.82           C  
ATOM  11339  C   ILE B 558      42.701 -44.073  27.164  1.00  0.82           C  
ATOM  11340  O   ILE B 558      41.658 -44.609  27.470  1.00  0.82           O  
ATOM  11341  CB  ILE B 558      43.220 -41.789  27.794  1.00  0.82           C  
ATOM  11342  CG1 ILE B 558      42.154 -41.653  28.915  1.00  0.82           C  
ATOM  11343  CG2 ILE B 558      43.724 -40.427  27.292  1.00  0.82           C  
ATOM  11344  CD1 ILE B 558      40.957 -40.745  28.605  1.00  0.82           C  
ATOM  11345  N   ASN B 559      43.901 -44.662  27.337  1.00  0.85           N  
ATOM  11346  CA  ASN B 559      44.110 -45.788  28.201  1.00  0.85           C  
ATOM  11347  C   ASN B 559      45.366 -45.389  28.952  1.00  0.85           C  
ATOM  11348  O   ASN B 559      46.439 -45.641  28.426  1.00  0.85           O  
ATOM  11349  CB  ASN B 559      44.326 -47.051  27.322  1.00  0.85           C  
ATOM  11350  CG  ASN B 559      44.989 -48.214  28.066  1.00  0.85           C  
ATOM  11351  OD1 ASN B 559      44.953 -48.342  29.268  1.00  0.85           O  
ATOM  11352  ND2 ASN B 559      45.715 -49.045  27.267  1.00  0.85           N  
ATOM  11353  N   PRO B 560      45.330 -44.761  30.128  1.00  0.89           N  
ATOM  11354  CA  PRO B 560      46.514 -44.215  30.788  1.00  0.89           C  
ATOM  11355  C   PRO B 560      47.576 -45.242  31.122  1.00  0.89           C  
ATOM  11356  O   PRO B 560      48.729 -44.905  31.337  1.00  0.89           O  
ATOM  11357  CB  PRO B 560      45.983 -43.480  32.027  1.00  0.89           C  
ATOM  11358  CG  PRO B 560      44.571 -44.036  32.219  1.00  0.89           C  
ATOM  11359  CD  PRO B 560      44.110 -44.366  30.811  1.00  0.89           C  
ATOM  11360  N   ASN B 561      47.213 -46.528  31.149  1.00  0.87           N  
ATOM  11361  CA  ASN B 561      48.156 -47.601  31.309  1.00  0.87           C  
ATOM  11362  C   ASN B 561      49.062 -47.777  30.091  1.00  0.87           C  
ATOM  11363  O   ASN B 561      50.149 -48.353  30.211  1.00  0.87           O  
ATOM  11364  CB  ASN B 561      47.417 -48.910  31.676  1.00  0.87           C  
ATOM  11365  CG  ASN B 561      46.561 -48.661  32.914  1.00  0.87           C  
ATOM  11366  OD1 ASN B 561      45.524 -48.004  32.877  1.00  0.87           O  
ATOM  11367  ND2 ASN B 561      47.012 -49.183  34.077  1.00  0.87           N  
ATOM  11368  N   SER B 562      48.685 -47.249  28.906  1.00  0.94           N  
ATOM  11369  CA  SER B 562      49.522 -47.208  27.718  1.00  0.94           C  
ATOM  11370  C   SER B 562      50.818 -46.435  27.864  1.00  0.94           C  
ATOM  11371  O   SER B 562      50.946 -45.511  28.665  1.00  0.94           O  
ATOM  11372  CB  SER B 562      48.790 -46.716  26.435  1.00  0.94           C  
ATOM  11373  OG  SER B 562      48.573 -45.303  26.416  1.00  0.94           O  
ATOM  11374  N   LEU B 563      51.837 -46.818  27.069  1.00  0.96           N  
ATOM  11375  CA  LEU B 563      53.055 -46.053  26.916  1.00  0.96           C  
ATOM  11376  C   LEU B 563      52.759 -44.746  26.192  1.00  0.96           C  
ATOM  11377  O   LEU B 563      52.264 -44.734  25.064  1.00  0.96           O  
ATOM  11378  CB  LEU B 563      54.122 -46.911  26.185  1.00  0.96           C  
ATOM  11379  CG  LEU B 563      55.576 -46.388  26.175  1.00  0.96           C  
ATOM  11380  CD1 LEU B 563      56.531 -47.532  25.799  1.00  0.96           C  
ATOM  11381  CD2 LEU B 563      55.800 -45.234  25.190  1.00  0.96           C  
ATOM  11382  N   PHE B 564      53.039 -43.600  26.839  1.00  0.96           N  
ATOM  11383  CA  PHE B 564      52.810 -42.285  26.276  1.00  0.96           C  
ATOM  11384  C   PHE B 564      54.046 -41.881  25.506  1.00  0.96           C  
ATOM  11385  O   PHE B 564      55.066 -41.487  26.071  1.00  0.96           O  
ATOM  11386  CB  PHE B 564      52.479 -41.202  27.346  1.00  0.96           C  
ATOM  11387  CG  PHE B 564      51.025 -41.168  27.769  1.00  0.96           C  
ATOM  11388  CD1 PHE B 564      50.143 -42.255  27.617  1.00  0.96           C  
ATOM  11389  CD2 PHE B 564      50.526 -39.986  28.347  1.00  0.96           C  
ATOM  11390  CE1 PHE B 564      48.804 -42.158  28.015  1.00  0.96           C  
ATOM  11391  CE2 PHE B 564      49.185 -39.880  28.739  1.00  0.96           C  
ATOM  11392  CZ  PHE B 564      48.321 -40.968  28.569  1.00  0.96           C  
ATOM  11393  N   ASP B 565      53.954 -42.002  24.174  1.00  0.98           N  
ATOM  11394  CA  ASP B 565      55.021 -41.796  23.228  1.00  0.98           C  
ATOM  11395  C   ASP B 565      54.828 -40.426  22.607  1.00  0.98           C  
ATOM  11396  O   ASP B 565      53.812 -40.151  21.980  1.00  0.98           O  
ATOM  11397  CB  ASP B 565      54.914 -42.937  22.191  1.00  0.98           C  
ATOM  11398  CG  ASP B 565      55.999 -42.902  21.137  1.00  0.98           C  
ATOM  11399  OD1 ASP B 565      56.874 -42.012  21.202  1.00  0.98           O  
ATOM  11400  OD2 ASP B 565      55.966 -43.825  20.273  1.00  0.98           O  
ATOM  11401  N   ILE B 566      55.766 -39.490  22.861  1.00  0.98           N  
ATOM  11402  CA  ILE B 566      55.479 -38.089  22.625  1.00  0.98           C  
ATOM  11403  C   ILE B 566      56.589 -37.372  21.887  1.00  0.98           C  
ATOM  11404  O   ILE B 566      57.728 -37.251  22.331  1.00  0.98           O  
ATOM  11405  CB  ILE B 566      55.106 -37.363  23.915  1.00  0.98           C  
ATOM  11406  CG1 ILE B 566      53.875 -38.074  24.552  1.00  0.98           C  
ATOM  11407  CG2 ILE B 566      54.825 -35.869  23.622  1.00  0.98           C  
ATOM  11408  CD1 ILE B 566      53.174 -37.336  25.690  1.00  0.98           C  
ATOM  11409  N   GLN B 567      56.220 -36.797  20.722  1.00  0.96           N  
ATOM  11410  CA  GLN B 567      57.080 -35.913  19.980  1.00  0.96           C  
ATOM  11411  C   GLN B 567      56.438 -34.542  19.896  1.00  0.96           C  
ATOM  11412  O   GLN B 567      55.506 -34.310  19.130  1.00  0.96           O  
ATOM  11413  CB  GLN B 567      57.325 -36.444  18.551  1.00  0.96           C  
ATOM  11414  CG  GLN B 567      58.493 -35.699  17.872  1.00  0.96           C  
ATOM  11415  CD  GLN B 567      58.826 -36.155  16.450  1.00  0.96           C  
ATOM  11416  OE1 GLN B 567      59.654 -35.560  15.801  1.00  0.96           O  
ATOM  11417  NE2 GLN B 567      58.128 -37.209  15.949  1.00  0.96           N  
ATOM  11418  N   VAL B 568      56.948 -33.569  20.678  1.00  0.98           N  
ATOM  11419  CA  VAL B 568      56.460 -32.202  20.629  1.00  0.98           C  
ATOM  11420  C   VAL B 568      57.602 -31.231  20.399  1.00  0.98           C  
ATOM  11421  O   VAL B 568      58.629 -31.250  21.082  1.00  0.98           O  
ATOM  11422  CB  VAL B 568      55.620 -31.763  21.823  1.00  0.98           C  
ATOM  11423  CG1 VAL B 568      54.257 -32.481  21.797  1.00  0.98           C  
ATOM  11424  CG2 VAL B 568      56.340 -32.030  23.156  1.00  0.98           C  
ATOM  11425  N   LYS B 569      57.432 -30.358  19.384  1.00  0.91           N  
ATOM  11426  CA  LYS B 569      58.448 -29.493  18.816  1.00  0.91           C  
ATOM  11427  C   LYS B 569      57.903 -28.986  17.497  1.00  0.91           C  
ATOM  11428  O   LYS B 569      56.941 -29.532  16.971  1.00  0.91           O  
ATOM  11429  CB  LYS B 569      59.830 -30.182  18.577  1.00  0.91           C  
ATOM  11430  CG  LYS B 569      59.782 -31.497  17.771  1.00  0.91           C  
ATOM  11431  CD  LYS B 569      61.136 -32.234  17.697  1.00  0.91           C  
ATOM  11432  CE  LYS B 569      61.598 -32.861  19.016  1.00  0.91           C  
ATOM  11433  NZ  LYS B 569      63.074 -32.970  19.047  1.00  0.91           N  
ATOM  11434  N   ARG B 570      58.457 -27.889  16.930  1.00  0.89           N  
ATOM  11435  CA  ARG B 570      58.048 -27.398  15.619  1.00  0.89           C  
ATOM  11436  C   ARG B 570      58.203 -28.433  14.507  1.00  0.89           C  
ATOM  11437  O   ARG B 570      59.089 -29.286  14.542  1.00  0.89           O  
ATOM  11438  CB  ARG B 570      58.816 -26.106  15.231  1.00  0.89           C  
ATOM  11439  CG  ARG B 570      58.460 -24.870  16.088  1.00  0.89           C  
ATOM  11440  CD  ARG B 570      57.036 -24.331  15.903  1.00  0.89           C  
ATOM  11441  NE  ARG B 570      56.883 -23.842  14.494  1.00  0.89           N  
ATOM  11442  CZ  ARG B 570      57.003 -22.558  14.116  1.00  0.89           C  
ATOM  11443  NH1 ARG B 570      57.256 -21.603  14.997  1.00  0.89           N  
ATOM  11444  NH2 ARG B 570      56.855 -22.238  12.833  1.00  0.89           N  
ATOM  11445  N   ILE B 571      57.305 -28.405  13.505  1.00  0.96           N  
ATOM  11446  CA  ILE B 571      57.294 -29.412  12.458  1.00  0.96           C  
ATOM  11447  C   ILE B 571      58.352 -29.108  11.414  1.00  0.96           C  
ATOM  11448  O   ILE B 571      58.354 -28.049  10.789  1.00  0.96           O  
ATOM  11449  CB  ILE B 571      55.936 -29.557  11.790  1.00  0.96           C  
ATOM  11450  CG1 ILE B 571      54.787 -29.689  12.819  1.00  0.96           C  
ATOM  11451  CG2 ILE B 571      55.939 -30.753  10.808  1.00  0.96           C  
ATOM  11452  CD1 ILE B 571      54.852 -30.918  13.734  1.00  0.96           C  
ATOM  11453  N   HIS B 572      59.296 -30.043  11.224  1.00  0.93           N  
ATOM  11454  CA  HIS B 572      60.414 -29.854  10.331  1.00  0.93           C  
ATOM  11455  C   HIS B 572      60.847 -31.188   9.791  1.00  0.93           C  
ATOM  11456  O   HIS B 572      60.892 -32.182  10.511  1.00  0.93           O  
ATOM  11457  CB  HIS B 572      61.652 -29.303  11.076  1.00  0.93           C  
ATOM  11458  CG  HIS B 572      61.746 -27.826  11.115  1.00  0.93           C  
ATOM  11459  ND1 HIS B 572      62.232 -27.155  10.010  1.00  0.93           N  
ATOM  11460  CD2 HIS B 572      61.501 -26.966  12.132  1.00  0.93           C  
ATOM  11461  CE1 HIS B 572      62.266 -25.886  10.379  1.00  0.93           C  
ATOM  11462  NE2 HIS B 572      61.837 -25.725  11.655  1.00  0.93           N  
ATOM  11463  N   GLU B 573      61.282 -31.228   8.520  1.00  0.94           N  
ATOM  11464  CA  GLU B 573      61.873 -32.406   7.920  1.00  0.94           C  
ATOM  11465  C   GLU B 573      63.127 -32.889   8.644  1.00  0.94           C  
ATOM  11466  O   GLU B 573      63.304 -34.081   8.870  1.00  0.94           O  
ATOM  11467  CB  GLU B 573      62.188 -32.120   6.443  1.00  0.94           C  
ATOM  11468  CG  GLU B 573      60.934 -31.804   5.598  1.00  0.94           C  
ATOM  11469  CD  GLU B 573      61.320 -31.405   4.178  1.00  0.94           C  
ATOM  11470  OE1 GLU B 573      62.125 -32.138   3.554  1.00  0.94           O  
ATOM  11471  OE2 GLU B 573      60.808 -30.357   3.707  1.00  0.94           O  
ATOM  11472  N   TYR B 574      63.991 -31.952   9.105  1.00  0.91           N  
ATOM  11473  CA  TYR B 574      65.167 -32.262   9.907  1.00  0.91           C  
ATOM  11474  C   TYR B 574      64.890 -32.939  11.241  1.00  0.91           C  
ATOM  11475  O   TYR B 574      65.642 -33.808  11.678  1.00  0.91           O  
ATOM  11476  CB  TYR B 574      66.113 -31.027  10.067  1.00  0.91           C  
ATOM  11477  CG  TYR B 574      65.880 -30.088  11.235  1.00  0.91           C  
ATOM  11478  CD1 TYR B 574      66.394 -30.404  12.507  1.00  0.91           C  
ATOM  11479  CD2 TYR B 574      65.262 -28.840  11.056  1.00  0.91           C  
ATOM  11480  CE1 TYR B 574      66.324 -29.487  13.562  1.00  0.91           C  
ATOM  11481  CE2 TYR B 574      65.204 -27.912  12.109  1.00  0.91           C  
ATOM  11482  CZ  TYR B 574      65.750 -28.232  13.357  1.00  0.91           C  
ATOM  11483  OH  TYR B 574      65.724 -27.313  14.428  1.00  0.91           O  
ATOM  11484  N   LYS B 575      63.793 -32.541  11.921  1.00  0.91           N  
ATOM  11485  CA  LYS B 575      63.379 -33.103  13.191  1.00  0.91           C  
ATOM  11486  C   LYS B 575      62.686 -34.446  13.009  1.00  0.91           C  
ATOM  11487  O   LYS B 575      62.595 -35.229  13.948  1.00  0.91           O  
ATOM  11488  CB  LYS B 575      62.441 -32.117  13.934  1.00  0.91           C  
ATOM  11489  CG  LYS B 575      63.163 -30.844  14.418  1.00  0.91           C  
ATOM  11490  CD  LYS B 575      62.209 -29.793  15.012  1.00  0.91           C  
ATOM  11491  CE  LYS B 575      62.840 -28.446  15.392  1.00  0.91           C  
ATOM  11492  NZ  LYS B 575      63.901 -28.603  16.394  1.00  0.91           N  
ATOM  11493  N   ARG B 576      62.239 -34.742  11.769  1.00  0.93           N  
ATOM  11494  CA  ARG B 576      61.772 -36.039  11.325  1.00  0.93           C  
ATOM  11495  C   ARG B 576      60.487 -36.561  11.955  1.00  0.93           C  
ATOM  11496  O   ARG B 576      60.389 -37.736  12.301  1.00  0.93           O  
ATOM  11497  CB  ARG B 576      62.858 -37.139  11.419  1.00  0.93           C  
ATOM  11498  CG  ARG B 576      64.107 -36.943  10.540  1.00  0.93           C  
ATOM  11499  CD  ARG B 576      65.279 -37.723  11.127  1.00  0.93           C  
ATOM  11500  NE  ARG B 576      66.042 -38.477  10.085  1.00  0.93           N  
ATOM  11501  CZ  ARG B 576      66.972 -39.349  10.469  1.00  0.93           C  
ATOM  11502  NH1 ARG B 576      67.201 -39.611  11.754  1.00  0.93           N  
ATOM  11503  NH2 ARG B 576      67.724 -40.017   9.602  1.00  0.93           N  
ATOM  11504  N   GLN B 577      59.401 -35.754  12.019  1.00  0.96           N  
ATOM  11505  CA  GLN B 577      58.087 -36.261  12.405  1.00  0.96           C  
ATOM  11506  C   GLN B 577      57.621 -37.403  11.495  1.00  0.96           C  
ATOM  11507  O   GLN B 577      56.985 -38.354  11.935  1.00  0.96           O  
ATOM  11508  CB  GLN B 577      57.024 -35.134  12.481  1.00  0.96           C  
ATOM  11509  CG  GLN B 577      57.162 -34.172  13.693  1.00  0.96           C  
ATOM  11510  CD  GLN B 577      58.188 -33.050  13.499  1.00  0.96           C  
ATOM  11511  OE1 GLN B 577      58.734 -32.820  12.422  1.00  0.96           O  
ATOM  11512  NE2 GLN B 577      58.414 -32.268  14.582  1.00  0.96           N  
ATOM  11513  N   LEU B 578      58.037 -37.372  10.211  1.00  0.98           N  
ATOM  11514  CA  LEU B 578      57.883 -38.457   9.258  1.00  0.98           C  
ATOM  11515  C   LEU B 578      58.514 -39.785   9.660  1.00  0.98           C  
ATOM  11516  O   LEU B 578      57.917 -40.830   9.429  1.00  0.98           O  
ATOM  11517  CB  LEU B 578      58.440 -38.056   7.872  1.00  0.98           C  
ATOM  11518  CG  LEU B 578      57.583 -37.000   7.154  1.00  0.98           C  
ATOM  11519  CD1 LEU B 578      58.299 -36.438   5.921  1.00  0.98           C  
ATOM  11520  CD2 LEU B 578      56.222 -37.579   6.740  1.00  0.98           C  
ATOM  11521  N   LEU B 579      59.712 -39.810  10.291  1.00  0.99           N  
ATOM  11522  CA  LEU B 579      60.318 -41.050  10.764  1.00  0.99           C  
ATOM  11523  C   LEU B 579      59.461 -41.722  11.835  1.00  0.99           C  
ATOM  11524  O   LEU B 579      59.199 -42.924  11.788  1.00  0.99           O  
ATOM  11525  CB  LEU B 579      61.772 -40.798  11.249  1.00  0.99           C  
ATOM  11526  CG  LEU B 579      62.546 -42.024  11.779  1.00  0.99           C  
ATOM  11527  CD1 LEU B 579      62.680 -43.149  10.740  1.00  0.99           C  
ATOM  11528  CD2 LEU B 579      63.945 -41.620  12.272  1.00  0.99           C  
ATOM  11529  N   ASN B 580      58.917 -40.920  12.777  1.00  0.98           N  
ATOM  11530  CA  ASN B 580      57.945 -41.349  13.763  1.00  0.98           C  
ATOM  11531  C   ASN B 580      56.665 -41.854  13.118  1.00  0.98           C  
ATOM  11532  O   ASN B 580      56.192 -42.924  13.474  1.00  0.98           O  
ATOM  11533  CB  ASN B 580      57.680 -40.179  14.738  1.00  0.98           C  
ATOM  11534  CG  ASN B 580      56.887 -40.466  16.020  1.00  0.98           C  
ATOM  11535  OD1 ASN B 580      56.517 -39.498  16.686  1.00  0.98           O  
ATOM  11536  ND2 ASN B 580      56.620 -41.741  16.368  1.00  0.98           N  
ATOM  11537  N   CYS B 581      56.130 -41.146  12.099  1.00  0.99           N  
ATOM  11538  CA  CYS B 581      54.970 -41.594  11.342  1.00  0.99           C  
ATOM  11539  C   CYS B 581      55.175 -42.930  10.653  1.00  0.99           C  
ATOM  11540  O   CYS B 581      54.286 -43.776  10.682  1.00  0.99           O  
ATOM  11541  CB  CYS B 581      54.511 -40.569  10.273  1.00  0.99           C  
ATOM  11542  SG  CYS B 581      53.921 -39.015  11.022  1.00  0.99           S  
ATOM  11543  N   LEU B 582      56.364 -43.188  10.061  1.00  0.98           N  
ATOM  11544  CA  LEU B 582      56.665 -44.491   9.484  1.00  0.98           C  
ATOM  11545  C   LEU B 582      56.594 -45.610  10.518  1.00  0.98           C  
ATOM  11546  O   LEU B 582      55.951 -46.628  10.287  1.00  0.98           O  
ATOM  11547  CB  LEU B 582      58.049 -44.542   8.776  1.00  0.98           C  
ATOM  11548  CG  LEU B 582      58.213 -43.646   7.527  1.00  0.98           C  
ATOM  11549  CD1 LEU B 582      59.597 -43.871   6.899  1.00  0.98           C  
ATOM  11550  CD2 LEU B 582      57.132 -43.885   6.463  1.00  0.98           C  
ATOM  11551  N   HIS B 583      57.173 -45.410  11.726  1.00  0.96           N  
ATOM  11552  CA  HIS B 583      57.078 -46.379  12.815  1.00  0.96           C  
ATOM  11553  C   HIS B 583      55.659 -46.648  13.281  1.00  0.96           C  
ATOM  11554  O   HIS B 583      55.289 -47.799  13.512  1.00  0.96           O  
ATOM  11555  CB  HIS B 583      57.934 -45.987  14.044  1.00  0.96           C  
ATOM  11556  CG  HIS B 583      57.713 -46.827  15.275  1.00  0.96           C  
ATOM  11557  ND1 HIS B 583      57.192 -46.224  16.400  1.00  0.96           N  
ATOM  11558  CD2 HIS B 583      57.854 -48.161  15.484  1.00  0.96           C  
ATOM  11559  CE1 HIS B 583      57.026 -47.194  17.274  1.00  0.96           C  
ATOM  11560  NE2 HIS B 583      57.406 -48.394  16.767  1.00  0.96           N  
ATOM  11561  N   VAL B 584      54.818 -45.602  13.391  1.00  0.97           N  
ATOM  11562  CA  VAL B 584      53.415 -45.737  13.749  1.00  0.97           C  
ATOM  11563  C   VAL B 584      52.653 -46.630  12.779  1.00  0.97           C  
ATOM  11564  O   VAL B 584      51.922 -47.538  13.179  1.00  0.97           O  
ATOM  11565  CB  VAL B 584      52.756 -44.363  13.789  1.00  0.97           C  
ATOM  11566  CG1 VAL B 584      51.240 -44.471  14.016  1.00  0.97           C  
ATOM  11567  CG2 VAL B 584      53.355 -43.543  14.943  1.00  0.97           C  
ATOM  11568  N   ILE B 585      52.849 -46.429  11.460  1.00  0.95           N  
ATOM  11569  CA  ILE B 585      52.238 -47.255  10.431  1.00  0.95           C  
ATOM  11570  C   ILE B 585      52.767 -48.687  10.459  1.00  0.95           C  
ATOM  11571  O   ILE B 585      51.996 -49.644  10.404  1.00  0.95           O  
ATOM  11572  CB  ILE B 585      52.375 -46.635   9.048  1.00  0.95           C  
ATOM  11573  CG1 ILE B 585      51.755 -45.216   9.024  1.00  0.95           C  
ATOM  11574  CG2 ILE B 585      51.681 -47.539   8.006  1.00  0.95           C  
ATOM  11575  CD1 ILE B 585      52.062 -44.432   7.742  1.00  0.95           C  
ATOM  11576  N   THR B 586      54.096 -48.873  10.629  1.00  0.94           N  
ATOM  11577  CA  THR B 586      54.734 -50.185  10.770  1.00  0.94           C  
ATOM  11578  C   THR B 586      54.178 -50.973  11.939  1.00  0.94           C  
ATOM  11579  O   THR B 586      53.881 -52.162  11.837  1.00  0.94           O  
ATOM  11580  CB  THR B 586      56.246 -50.081  10.961  1.00  0.94           C  
ATOM  11581  OG1 THR B 586      56.807 -49.395   9.858  1.00  0.94           O  
ATOM  11582  CG2 THR B 586      56.941 -51.447  11.031  1.00  0.94           C  
ATOM  11583  N   LEU B 587      53.980 -50.308  13.096  1.00  0.93           N  
ATOM  11584  CA  LEU B 587      53.371 -50.887  14.276  1.00  0.93           C  
ATOM  11585  C   LEU B 587      51.911 -51.276  14.079  1.00  0.93           C  
ATOM  11586  O   LEU B 587      51.500 -52.371  14.452  1.00  0.93           O  
ATOM  11587  CB  LEU B 587      53.559 -49.927  15.475  1.00  0.93           C  
ATOM  11588  CG  LEU B 587      53.243 -50.511  16.869  1.00  0.93           C  
ATOM  11589  CD1 LEU B 587      54.029 -51.805  17.140  1.00  0.93           C  
ATOM  11590  CD2 LEU B 587      53.560 -49.469  17.956  1.00  0.93           C  
ATOM  11591  N   TYR B 588      51.111 -50.416  13.408  1.00  0.94           N  
ATOM  11592  CA  TYR B 588      49.737 -50.693  13.014  1.00  0.94           C  
ATOM  11593  C   TYR B 588      49.638 -51.921  12.116  1.00  0.94           C  
ATOM  11594  O   TYR B 588      48.828 -52.820  12.346  1.00  0.94           O  
ATOM  11595  CB  TYR B 588      49.176 -49.420  12.299  1.00  0.94           C  
ATOM  11596  CG  TYR B 588      47.843 -49.598  11.619  1.00  0.94           C  
ATOM  11597  CD1 TYR B 588      46.661 -49.650  12.372  1.00  0.94           C  
ATOM  11598  CD2 TYR B 588      47.763 -49.733  10.220  1.00  0.94           C  
ATOM  11599  CE1 TYR B 588      45.424 -49.853  11.742  1.00  0.94           C  
ATOM  11600  CE2 TYR B 588      46.529 -49.928   9.591  1.00  0.94           C  
ATOM  11601  CZ  TYR B 588      45.371 -49.975  10.360  1.00  0.94           C  
ATOM  11602  OH  TYR B 588      44.125 -50.133   9.722  1.00  0.94           O  
ATOM  11603  N   ASN B 589      50.512 -52.020  11.094  1.00  0.92           N  
ATOM  11604  CA  ASN B 589      50.573 -53.186  10.235  1.00  0.92           C  
ATOM  11605  C   ASN B 589      50.969 -54.455  10.982  1.00  0.92           C  
ATOM  11606  O   ASN B 589      50.384 -55.510  10.755  1.00  0.92           O  
ATOM  11607  CB  ASN B 589      51.512 -52.961   9.023  1.00  0.92           C  
ATOM  11608  CG  ASN B 589      51.064 -51.815   8.113  1.00  0.92           C  
ATOM  11609  OD1 ASN B 589      51.891 -51.107   7.549  1.00  0.92           O  
ATOM  11610  ND2 ASN B 589      49.736 -51.644   7.913  1.00  0.92           N  
ATOM  11611  N   ARG B 590      51.936 -54.372  11.919  1.00  0.86           N  
ATOM  11612  CA  ARG B 590      52.338 -55.482  12.769  1.00  0.86           C  
ATOM  11613  C   ARG B 590      51.217 -56.017  13.667  1.00  0.86           C  
ATOM  11614  O   ARG B 590      51.012 -57.227  13.744  1.00  0.86           O  
ATOM  11615  CB  ARG B 590      53.594 -55.104  13.617  1.00  0.86           C  
ATOM  11616  CG  ARG B 590      54.910 -55.767  13.142  1.00  0.86           C  
ATOM  11617  CD  ARG B 590      55.976 -54.852  12.505  1.00  0.86           C  
ATOM  11618  NE  ARG B 590      56.731 -54.179  13.601  1.00  0.86           N  
ATOM  11619  CZ  ARG B 590      58.056 -54.274  13.736  1.00  0.86           C  
ATOM  11620  NH1 ARG B 590      58.898 -54.596  12.763  1.00  0.86           N  
ATOM  11621  NH2 ARG B 590      58.551 -54.058  14.948  1.00  0.86           N  
ATOM  11622  N   ILE B 591      50.432 -55.128  14.321  1.00  0.88           N  
ATOM  11623  CA  ILE B 591      49.290 -55.496  15.161  1.00  0.88           C  
ATOM  11624  C   ILE B 591      48.200 -56.212  14.377  1.00  0.88           C  
ATOM  11625  O   ILE B 591      47.623 -57.200  14.827  1.00  0.88           O  
ATOM  11626  CB  ILE B 591      48.714 -54.279  15.899  1.00  0.88           C  
ATOM  11627  CG1 ILE B 591      49.760 -53.711  16.892  1.00  0.88           C  
ATOM  11628  CG2 ILE B 591      47.409 -54.651  16.648  1.00  0.88           C  
ATOM  11629  CD1 ILE B 591      49.356 -52.377  17.535  1.00  0.88           C  
ATOM  11630  N   LYS B 592      47.908 -55.730  13.153  1.00  0.85           N  
ATOM  11631  CA  LYS B 592      47.006 -56.385  12.230  1.00  0.85           C  
ATOM  11632  C   LYS B 592      47.477 -57.748  11.748  1.00  0.85           C  
ATOM  11633  O   LYS B 592      46.678 -58.667  11.611  1.00  0.85           O  
ATOM  11634  CB  LYS B 592      46.741 -55.471  11.012  1.00  0.85           C  
ATOM  11635  CG  LYS B 592      45.602 -54.473  11.253  1.00  0.85           C  
ATOM  11636  CD  LYS B 592      45.185 -53.777   9.951  1.00  0.85           C  
ATOM  11637  CE  LYS B 592      43.796 -53.141   9.998  1.00  0.85           C  
ATOM  11638  NZ  LYS B 592      42.706 -54.114  10.228  1.00  0.85           N  
ATOM  11639  N   ARG B 593      48.785 -57.895  11.452  1.00  0.81           N  
ATOM  11640  CA  ARG B 593      49.364 -59.117  10.927  1.00  0.81           C  
ATOM  11641  C   ARG B 593      49.298 -60.298  11.886  1.00  0.81           C  
ATOM  11642  O   ARG B 593      48.946 -61.414  11.509  1.00  0.81           O  
ATOM  11643  CB  ARG B 593      50.852 -58.861  10.568  1.00  0.81           C  
ATOM  11644  CG  ARG B 593      51.347 -59.571   9.293  1.00  0.81           C  
ATOM  11645  CD  ARG B 593      52.878 -59.703   9.171  1.00  0.81           C  
ATOM  11646  NE  ARG B 593      53.577 -58.454   9.639  1.00  0.81           N  
ATOM  11647  CZ  ARG B 593      53.659 -57.286   8.988  1.00  0.81           C  
ATOM  11648  NH1 ARG B 593      53.003 -57.045   7.859  1.00  0.81           N  
ATOM  11649  NH2 ARG B 593      54.425 -56.324   9.474  1.00  0.81           N  
ATOM  11650  N   GLU B 594      49.638 -60.051  13.166  1.00  0.78           N  
ATOM  11651  CA  GLU B 594      49.674 -61.052  14.210  1.00  0.78           C  
ATOM  11652  C   GLU B 594      48.626 -60.713  15.280  1.00  0.78           C  
ATOM  11653  O   GLU B 594      49.017 -60.296  16.374  1.00  0.78           O  
ATOM  11654  CB  GLU B 594      51.085 -61.121  14.887  1.00  0.78           C  
ATOM  11655  CG  GLU B 594      52.307 -61.368  13.950  1.00  0.78           C  
ATOM  11656  CD  GLU B 594      53.646 -61.397  14.676  1.00  0.78           C  
ATOM  11657  OE1 GLU B 594      54.101 -62.458  15.184  1.00  0.78           O  
ATOM  11658  OE2 GLU B 594      54.279 -60.307  14.776  1.00  0.78           O  
ATOM  11659  N   PRO B 595      47.297 -60.844  15.106  1.00  0.79           N  
ATOM  11660  CA  PRO B 595      46.318 -60.298  16.047  1.00  0.79           C  
ATOM  11661  C   PRO B 595      46.385 -60.963  17.400  1.00  0.79           C  
ATOM  11662  O   PRO B 595      46.068 -60.322  18.398  1.00  0.79           O  
ATOM  11663  CB  PRO B 595      44.956 -60.516  15.366  1.00  0.79           C  
ATOM  11664  CG  PRO B 595      45.203 -61.681  14.402  1.00  0.79           C  
ATOM  11665  CD  PRO B 595      46.639 -61.424  13.934  1.00  0.79           C  
ATOM  11666  N   ASN B 596      46.828 -62.232  17.429  1.00  0.68           N  
ATOM  11667  CA  ASN B 596      46.973 -63.052  18.607  1.00  0.68           C  
ATOM  11668  C   ASN B 596      48.360 -62.929  19.229  1.00  0.68           C  
ATOM  11669  O   ASN B 596      48.823 -63.826  19.923  1.00  0.68           O  
ATOM  11670  CB  ASN B 596      46.687 -64.529  18.236  1.00  0.68           C  
ATOM  11671  CG  ASN B 596      45.181 -64.725  18.155  1.00  0.68           C  
ATOM  11672  OD1 ASN B 596      44.466 -64.636  19.148  1.00  0.68           O  
ATOM  11673  ND2 ASN B 596      44.665 -65.009  16.938  1.00  0.68           N  
ATOM  11674  N   LYS B 597      49.058 -61.797  19.014  1.00  0.77           N  
ATOM  11675  CA  LYS B 597      50.317 -61.519  19.664  1.00  0.77           C  
ATOM  11676  C   LYS B 597      50.165 -60.352  20.618  1.00  0.77           C  
ATOM  11677  O   LYS B 597      49.431 -59.390  20.382  1.00  0.77           O  
ATOM  11678  CB  LYS B 597      51.392 -61.187  18.619  1.00  0.77           C  
ATOM  11679  CG  LYS B 597      52.820 -60.952  19.143  1.00  0.77           C  
ATOM  11680  CD  LYS B 597      53.710 -60.819  17.909  1.00  0.77           C  
ATOM  11681  CE  LYS B 597      55.227 -60.864  18.071  1.00  0.77           C  
ATOM  11682  NZ  LYS B 597      55.823 -60.919  16.728  1.00  0.77           N  
ATOM  11683  N   PHE B 598      50.857 -60.437  21.774  1.00  0.84           N  
ATOM  11684  CA  PHE B 598      50.908 -59.360  22.733  1.00  0.84           C  
ATOM  11685  C   PHE B 598      51.775 -58.196  22.267  1.00  0.84           C  
ATOM  11686  O   PHE B 598      52.975 -58.321  22.027  1.00  0.84           O  
ATOM  11687  CB  PHE B 598      51.394 -59.851  24.123  1.00  0.84           C  
ATOM  11688  CG  PHE B 598      51.229 -58.761  25.157  1.00  0.84           C  
ATOM  11689  CD1 PHE B 598      49.956 -58.457  25.661  1.00  0.84           C  
ATOM  11690  CD2 PHE B 598      52.322 -57.969  25.551  1.00  0.84           C  
ATOM  11691  CE1 PHE B 598      49.772 -57.373  26.528  1.00  0.84           C  
ATOM  11692  CE2 PHE B 598      52.142 -56.882  26.416  1.00  0.84           C  
ATOM  11693  CZ  PHE B 598      50.863 -56.579  26.898  1.00  0.84           C  
ATOM  11694  N   PHE B 599      51.149 -57.011  22.211  1.00  0.88           N  
ATOM  11695  CA  PHE B 599      51.796 -55.769  21.886  1.00  0.88           C  
ATOM  11696  C   PHE B 599      51.597 -54.840  23.057  1.00  0.88           C  
ATOM  11697  O   PHE B 599      50.522 -54.780  23.647  1.00  0.88           O  
ATOM  11698  CB  PHE B 599      51.180 -55.100  20.634  1.00  0.88           C  
ATOM  11699  CG  PHE B 599      51.482 -55.908  19.405  1.00  0.88           C  
ATOM  11700  CD1 PHE B 599      52.701 -55.724  18.734  1.00  0.88           C  
ATOM  11701  CD2 PHE B 599      50.560 -56.833  18.886  1.00  0.88           C  
ATOM  11702  CE1 PHE B 599      53.008 -56.468  17.589  1.00  0.88           C  
ATOM  11703  CE2 PHE B 599      50.876 -57.598  17.758  1.00  0.88           C  
ATOM  11704  CZ  PHE B 599      52.102 -57.420  17.112  1.00  0.88           C  
ATOM  11705  N   VAL B 600      52.653 -54.100  23.436  1.00  0.93           N  
ATOM  11706  CA  VAL B 600      52.592 -53.122  24.506  1.00  0.93           C  
ATOM  11707  C   VAL B 600      51.664 -51.973  24.118  1.00  0.93           C  
ATOM  11708  O   VAL B 600      51.937 -51.342  23.094  1.00  0.93           O  
ATOM  11709  CB  VAL B 600      53.990 -52.606  24.830  1.00  0.93           C  
ATOM  11710  CG1 VAL B 600      53.954 -51.391  25.780  1.00  0.93           C  
ATOM  11711  CG2 VAL B 600      54.789 -53.762  25.461  1.00  0.93           C  
ATOM  11712  N   PRO B 601      50.570 -51.670  24.834  1.00  0.95           N  
ATOM  11713  CA  PRO B 601      49.676 -50.571  24.497  1.00  0.95           C  
ATOM  11714  C   PRO B 601      50.392 -49.240  24.424  1.00  0.95           C  
ATOM  11715  O   PRO B 601      51.141 -48.901  25.341  1.00  0.95           O  
ATOM  11716  CB  PRO B 601      48.579 -50.616  25.573  1.00  0.95           C  
ATOM  11717  CG  PRO B 601      49.256 -51.294  26.765  1.00  0.95           C  
ATOM  11718  CD  PRO B 601      50.171 -52.314  26.088  1.00  0.95           C  
ATOM  11719  N   ARG B 602      50.193 -48.473  23.340  1.00  0.90           N  
ATOM  11720  CA  ARG B 602      50.938 -47.253  23.129  1.00  0.90           C  
ATOM  11721  C   ARG B 602      50.076 -46.123  22.584  1.00  0.90           C  
ATOM  11722  O   ARG B 602      49.318 -46.273  21.632  1.00  0.90           O  
ATOM  11723  CB  ARG B 602      52.118 -47.539  22.174  1.00  0.90           C  
ATOM  11724  CG  ARG B 602      53.174 -46.423  22.146  1.00  0.90           C  
ATOM  11725  CD  ARG B 602      54.259 -46.592  21.079  1.00  0.90           C  
ATOM  11726  NE  ARG B 602      55.309 -47.555  21.553  1.00  0.90           N  
ATOM  11727  CZ  ARG B 602      56.615 -47.369  21.298  1.00  0.90           C  
ATOM  11728  NH1 ARG B 602      57.075 -46.278  20.707  1.00  0.90           N  
ATOM  11729  NH2 ARG B 602      57.495 -48.321  21.607  1.00  0.90           N  
ATOM  11730  N   THR B 603      50.199 -44.925  23.183  1.00  0.95           N  
ATOM  11731  CA  THR B 603      49.539 -43.720  22.697  1.00  0.95           C  
ATOM  11732  C   THR B 603      50.616 -42.844  22.118  1.00  0.95           C  
ATOM  11733  O   THR B 603      51.459 -42.324  22.843  1.00  0.95           O  
ATOM  11734  CB  THR B 603      48.830 -42.904  23.770  1.00  0.95           C  
ATOM  11735  OG1 THR B 603      47.787 -43.656  24.371  1.00  0.95           O  
ATOM  11736  CG2 THR B 603      48.136 -41.679  23.154  1.00  0.95           C  
ATOM  11737  N   VAL B 604      50.619 -42.663  20.787  1.00  0.97           N  
ATOM  11738  CA  VAL B 604      51.599 -41.854  20.089  1.00  0.97           C  
ATOM  11739  C   VAL B 604      51.024 -40.474  19.866  1.00  0.97           C  
ATOM  11740  O   VAL B 604      49.976 -40.298  19.241  1.00  0.97           O  
ATOM  11741  CB  VAL B 604      52.026 -42.445  18.752  1.00  0.97           C  
ATOM  11742  CG1 VAL B 604      53.076 -41.530  18.081  1.00  0.97           C  
ATOM  11743  CG2 VAL B 604      52.629 -43.843  18.993  1.00  0.97           C  
ATOM  11744  N   MET B 605      51.695 -39.446  20.398  1.00  0.93           N  
ATOM  11745  CA  MET B 605      51.250 -38.083  20.308  1.00  0.93           C  
ATOM  11746  C   MET B 605      52.298 -37.250  19.614  1.00  0.93           C  
ATOM  11747  O   MET B 605      53.447 -37.152  20.045  1.00  0.93           O  
ATOM  11748  CB  MET B 605      50.964 -37.465  21.690  1.00  0.93           C  
ATOM  11749  CG  MET B 605      49.938 -38.249  22.519  1.00  0.93           C  
ATOM  11750  SD  MET B 605      49.599 -37.452  24.099  1.00  0.93           S  
ATOM  11751  CE  MET B 605      49.770 -38.929  25.127  1.00  0.93           C  
ATOM  11752  N   ILE B 606      51.911 -36.607  18.506  1.00  0.96           N  
ATOM  11753  CA  ILE B 606      52.798 -35.750  17.744  1.00  0.96           C  
ATOM  11754  C   ILE B 606      52.184 -34.371  17.776  1.00  0.96           C  
ATOM  11755  O   ILE B 606      50.999 -34.201  17.517  1.00  0.96           O  
ATOM  11756  CB  ILE B 606      53.000 -36.249  16.315  1.00  0.96           C  
ATOM  11757  CG1 ILE B 606      53.619 -37.670  16.353  1.00  0.96           C  
ATOM  11758  CG2 ILE B 606      53.883 -35.263  15.513  1.00  0.96           C  
ATOM  11759  CD1 ILE B 606      53.775 -38.333  14.980  1.00  0.96           C  
ATOM  11760  N   GLY B 607      52.944 -33.328  18.148  1.00  0.98           N  
ATOM  11761  CA  GLY B 607      52.374 -31.989  18.240  1.00  0.98           C  
ATOM  11762  C   GLY B 607      53.355 -30.920  17.882  1.00  0.98           C  
ATOM  11763  O   GLY B 607      54.535 -30.985  18.205  1.00  0.98           O  
ATOM  11764  N   GLY B 608      52.882 -29.857  17.211  1.00  0.98           N  
ATOM  11765  CA  GLY B 608      53.803 -28.842  16.739  1.00  0.98           C  
ATOM  11766  C   GLY B 608      53.202 -27.957  15.697  1.00  0.98           C  
ATOM  11767  O   GLY B 608      52.248 -28.298  15.013  1.00  0.98           O  
ATOM  11768  N   LYS B 609      53.776 -26.760  15.529  1.00  0.93           N  
ATOM  11769  CA  LYS B 609      53.343 -25.833  14.506  1.00  0.93           C  
ATOM  11770  C   LYS B 609      54.263 -25.859  13.302  1.00  0.93           C  
ATOM  11771  O   LYS B 609      55.479 -26.044  13.413  1.00  0.93           O  
ATOM  11772  CB  LYS B 609      53.233 -24.399  15.069  1.00  0.93           C  
ATOM  11773  CG  LYS B 609      52.090 -24.278  16.083  1.00  0.93           C  
ATOM  11774  CD  LYS B 609      52.068 -22.940  16.835  1.00  0.93           C  
ATOM  11775  CE  LYS B 609      50.926 -22.927  17.847  1.00  0.93           C  
ATOM  11776  NZ  LYS B 609      50.866 -21.680  18.633  1.00  0.93           N  
ATOM  11777  N   ALA B 610      53.685 -25.655  12.109  1.00  0.94           N  
ATOM  11778  CA  ALA B 610      54.394 -25.520  10.862  1.00  0.94           C  
ATOM  11779  C   ALA B 610      54.355 -24.060  10.462  1.00  0.94           C  
ATOM  11780  O   ALA B 610      53.395 -23.349  10.748  1.00  0.94           O  
ATOM  11781  CB  ALA B 610      53.691 -26.363   9.784  1.00  0.94           C  
ATOM  11782  N   ALA B 611      55.415 -23.527   9.821  1.00  0.90           N  
ATOM  11783  CA  ALA B 611      55.343 -22.180   9.284  1.00  0.90           C  
ATOM  11784  C   ALA B 611      54.299 -22.090   8.156  1.00  0.90           C  
ATOM  11785  O   ALA B 611      54.181 -23.068   7.416  1.00  0.90           O  
ATOM  11786  CB  ALA B 611      56.734 -21.689   8.834  1.00  0.90           C  
ATOM  11787  N   PRO B 612      53.518 -21.019   7.959  1.00  0.88           N  
ATOM  11788  CA  PRO B 612      52.418 -20.997   7.001  1.00  0.88           C  
ATOM  11789  C   PRO B 612      52.819 -21.322   5.580  1.00  0.88           C  
ATOM  11790  O   PRO B 612      52.048 -21.983   4.887  1.00  0.88           O  
ATOM  11791  CB  PRO B 612      51.817 -19.595   7.142  1.00  0.88           C  
ATOM  11792  CG  PRO B 612      52.004 -19.312   8.631  1.00  0.88           C  
ATOM  11793  CD  PRO B 612      53.379 -19.924   8.911  1.00  0.88           C  
ATOM  11794  N   GLY B 613      54.019 -20.879   5.142  1.00  0.84           N  
ATOM  11795  CA  GLY B 613      54.560 -21.190   3.821  1.00  0.84           C  
ATOM  11796  C   GLY B 613      55.266 -22.522   3.691  1.00  0.84           C  
ATOM  11797  O   GLY B 613      55.681 -22.905   2.602  1.00  0.84           O  
ATOM  11798  N   TYR B 614      55.437 -23.287   4.787  1.00  0.89           N  
ATOM  11799  CA  TYR B 614      56.171 -24.539   4.770  1.00  0.89           C  
ATOM  11800  C   TYR B 614      55.221 -25.671   4.429  1.00  0.89           C  
ATOM  11801  O   TYR B 614      54.667 -26.351   5.293  1.00  0.89           O  
ATOM  11802  CB  TYR B 614      56.846 -24.757   6.152  1.00  0.89           C  
ATOM  11803  CG  TYR B 614      57.930 -25.814   6.260  1.00  0.89           C  
ATOM  11804  CD1 TYR B 614      58.366 -26.671   5.226  1.00  0.89           C  
ATOM  11805  CD2 TYR B 614      58.562 -25.916   7.509  1.00  0.89           C  
ATOM  11806  CE1 TYR B 614      59.419 -27.583   5.446  1.00  0.89           C  
ATOM  11807  CE2 TYR B 614      59.610 -26.815   7.725  1.00  0.89           C  
ATOM  11808  CZ  TYR B 614      60.052 -27.645   6.697  1.00  0.89           C  
ATOM  11809  OH  TYR B 614      61.144 -28.509   6.954  1.00  0.89           O  
ATOM  11810  N   HIS B 615      55.040 -25.905   3.114  1.00  0.89           N  
ATOM  11811  CA  HIS B 615      54.113 -26.884   2.576  1.00  0.89           C  
ATOM  11812  C   HIS B 615      54.345 -28.294   3.090  1.00  0.89           C  
ATOM  11813  O   HIS B 615      53.424 -28.946   3.565  1.00  0.89           O  
ATOM  11814  CB  HIS B 615      54.200 -26.878   1.031  1.00  0.89           C  
ATOM  11815  CG  HIS B 615      53.362 -27.915   0.358  1.00  0.89           C  
ATOM  11816  ND1 HIS B 615      52.001 -27.919   0.570  1.00  0.89           N  
ATOM  11817  CD2 HIS B 615      53.726 -28.949  -0.443  1.00  0.89           C  
ATOM  11818  CE1 HIS B 615      51.559 -28.962  -0.112  1.00  0.89           C  
ATOM  11819  NE2 HIS B 615      52.562 -29.617  -0.742  1.00  0.89           N  
ATOM  11820  N   MET B 616      55.606 -28.781   3.096  1.00  0.92           N  
ATOM  11821  CA  MET B 616      55.904 -30.123   3.558  1.00  0.92           C  
ATOM  11822  C   MET B 616      55.537 -30.353   5.015  1.00  0.92           C  
ATOM  11823  O   MET B 616      54.910 -31.348   5.363  1.00  0.92           O  
ATOM  11824  CB  MET B 616      57.391 -30.453   3.316  1.00  0.92           C  
ATOM  11825  CG  MET B 616      57.764 -31.925   3.584  1.00  0.92           C  
ATOM  11826  SD  MET B 616      56.775 -33.150   2.674  1.00  0.92           S  
ATOM  11827  CE  MET B 616      57.480 -32.784   1.046  1.00  0.92           C  
ATOM  11828  N   ALA B 617      55.833 -29.388   5.903  1.00  0.96           N  
ATOM  11829  CA  ALA B 617      55.432 -29.443   7.287  1.00  0.96           C  
ATOM  11830  C   ALA B 617      53.919 -29.473   7.498  1.00  0.96           C  
ATOM  11831  O   ALA B 617      53.416 -30.222   8.335  1.00  0.96           O  
ATOM  11832  CB  ALA B 617      56.079 -28.266   8.024  1.00  0.96           C  
ATOM  11833  N   LYS B 618      53.135 -28.706   6.708  1.00  0.91           N  
ATOM  11834  CA  LYS B 618      51.685 -28.825   6.702  1.00  0.91           C  
ATOM  11835  C   LYS B 618      51.191 -30.193   6.258  1.00  0.91           C  
ATOM  11836  O   LYS B 618      50.283 -30.761   6.863  1.00  0.91           O  
ATOM  11837  CB  LYS B 618      51.008 -27.740   5.831  1.00  0.91           C  
ATOM  11838  CG  LYS B 618      51.164 -26.334   6.423  1.00  0.91           C  
ATOM  11839  CD  LYS B 618      50.162 -25.306   5.868  1.00  0.91           C  
ATOM  11840  CE  LYS B 618      50.078 -24.093   6.797  1.00  0.91           C  
ATOM  11841  NZ  LYS B 618      49.012 -23.153   6.425  1.00  0.91           N  
ATOM  11842  N   MET B 619      51.815 -30.781   5.215  1.00  0.93           N  
ATOM  11843  CA  MET B 619      51.521 -32.132   4.778  1.00  0.93           C  
ATOM  11844  C   MET B 619      51.803 -33.173   5.855  1.00  0.93           C  
ATOM  11845  O   MET B 619      51.027 -34.103   6.049  1.00  0.93           O  
ATOM  11846  CB  MET B 619      52.272 -32.500   3.472  1.00  0.93           C  
ATOM  11847  CG  MET B 619      51.904 -31.637   2.245  1.00  0.93           C  
ATOM  11848  SD  MET B 619      50.125 -31.447   1.918  1.00  0.93           S  
ATOM  11849  CE  MET B 619      49.774 -33.192   1.593  1.00  0.93           C  
ATOM  11850  N   ILE B 620      52.905 -33.016   6.617  1.00  0.96           N  
ATOM  11851  CA  ILE B 620      53.245 -33.859   7.759  1.00  0.96           C  
ATOM  11852  C   ILE B 620      52.199 -33.800   8.872  1.00  0.96           C  
ATOM  11853  O   ILE B 620      51.789 -34.834   9.395  1.00  0.96           O  
ATOM  11854  CB  ILE B 620      54.636 -33.530   8.303  1.00  0.96           C  
ATOM  11855  CG1 ILE B 620      55.723 -33.811   7.238  1.00  0.96           C  
ATOM  11856  CG2 ILE B 620      54.935 -34.362   9.571  1.00  0.96           C  
ATOM  11857  CD1 ILE B 620      57.116 -33.265   7.591  1.00  0.96           C  
ATOM  11858  N   ILE B 621      51.679 -32.600   9.225  1.00  0.96           N  
ATOM  11859  CA  ILE B 621      50.572 -32.447  10.174  1.00  0.96           C  
ATOM  11860  C   ILE B 621      49.326 -33.176   9.696  1.00  0.96           C  
ATOM  11861  O   ILE B 621      48.666 -33.899  10.445  1.00  0.96           O  
ATOM  11862  CB  ILE B 621      50.232 -30.971  10.410  1.00  0.96           C  
ATOM  11863  CG1 ILE B 621      51.412 -30.283  11.132  1.00  0.96           C  
ATOM  11864  CG2 ILE B 621      48.919 -30.823  11.224  1.00  0.96           C  
ATOM  11865  CD1 ILE B 621      51.262 -28.763  11.261  1.00  0.96           C  
ATOM  11866  N   ARG B 622      49.014 -33.039   8.392  1.00  0.90           N  
ATOM  11867  CA  ARG B 622      47.910 -33.726   7.759  1.00  0.90           C  
ATOM  11868  C   ARG B 622      48.038 -35.241   7.765  1.00  0.90           C  
ATOM  11869  O   ARG B 622      47.051 -35.968   7.898  1.00  0.90           O  
ATOM  11870  CB  ARG B 622      47.687 -33.205   6.317  1.00  0.90           C  
ATOM  11871  CG  ARG B 622      46.415 -33.758   5.638  1.00  0.90           C  
ATOM  11872  CD  ARG B 622      45.142 -33.419   6.419  1.00  0.90           C  
ATOM  11873  NE  ARG B 622      43.984 -34.117   5.790  1.00  0.90           N  
ATOM  11874  CZ  ARG B 622      43.403 -35.206   6.316  1.00  0.90           C  
ATOM  11875  NH1 ARG B 622      43.907 -35.850   7.366  1.00  0.90           N  
ATOM  11876  NH2 ARG B 622      42.270 -35.662   5.785  1.00  0.90           N  
ATOM  11877  N   LEU B 623      49.271 -35.753   7.628  1.00  0.94           N  
ATOM  11878  CA  LEU B 623      49.595 -37.156   7.735  1.00  0.94           C  
ATOM  11879  C   LEU B 623      49.293 -37.736   9.120  1.00  0.94           C  
ATOM  11880  O   LEU B 623      48.700 -38.798   9.242  1.00  0.94           O  
ATOM  11881  CB  LEU B 623      51.086 -37.368   7.361  1.00  0.94           C  
ATOM  11882  CG  LEU B 623      51.448 -38.678   6.618  1.00  0.94           C  
ATOM  11883  CD1 LEU B 623      52.867 -39.125   6.999  1.00  0.94           C  
ATOM  11884  CD2 LEU B 623      50.464 -39.834   6.832  1.00  0.94           C  
ATOM  11885  N   VAL B 624      49.645 -37.020  10.216  1.00  0.95           N  
ATOM  11886  CA  VAL B 624      49.388 -37.492  11.579  1.00  0.95           C  
ATOM  11887  C   VAL B 624      47.909 -37.688  11.859  1.00  0.95           C  
ATOM  11888  O   VAL B 624      47.485 -38.712  12.396  1.00  0.95           O  
ATOM  11889  CB  VAL B 624      49.945 -36.543  12.641  1.00  0.95           C  
ATOM  11890  CG1 VAL B 624      49.692 -37.089  14.066  1.00  0.95           C  
ATOM  11891  CG2 VAL B 624      51.462 -36.381  12.446  1.00  0.95           C  
ATOM  11892  N   THR B 625      47.073 -36.717  11.447  1.00  0.93           N  
ATOM  11893  CA  THR B 625      45.626 -36.806  11.567  1.00  0.93           C  
ATOM  11894  C   THR B 625      45.042 -37.917  10.718  1.00  0.93           C  
ATOM  11895  O   THR B 625      44.244 -38.708  11.200  1.00  0.93           O  
ATOM  11896  CB  THR B 625      44.935 -35.481  11.268  1.00  0.93           C  
ATOM  11897  OG1 THR B 625      45.357 -34.918  10.030  1.00  0.93           O  
ATOM  11898  CG2 THR B 625      45.310 -34.469  12.361  1.00  0.93           C  
ATOM  11899  N   ALA B 626      45.502 -38.064   9.460  1.00  0.94           N  
ATOM  11900  CA  ALA B 626      45.089 -39.118   8.557  1.00  0.94           C  
ATOM  11901  C   ALA B 626      45.399 -40.531   9.037  1.00  0.94           C  
ATOM  11902  O   ALA B 626      44.590 -41.447   8.907  1.00  0.94           O  
ATOM  11903  CB  ALA B 626      45.772 -38.874   7.205  1.00  0.94           C  
ATOM  11904  N   ILE B 627      46.587 -40.743   9.643  1.00  0.95           N  
ATOM  11905  CA  ILE B 627      46.904 -41.984  10.333  1.00  0.95           C  
ATOM  11906  C   ILE B 627      45.975 -42.199  11.513  1.00  0.95           C  
ATOM  11907  O   ILE B 627      45.428 -43.284  11.684  1.00  0.95           O  
ATOM  11908  CB  ILE B 627      48.359 -42.019  10.791  1.00  0.95           C  
ATOM  11909  CG1 ILE B 627      49.314 -42.013   9.579  1.00  0.95           C  
ATOM  11910  CG2 ILE B 627      48.638 -43.266  11.660  1.00  0.95           C  
ATOM  11911  CD1 ILE B 627      50.769 -41.734   9.980  1.00  0.95           C  
ATOM  11912  N   GLY B 628      45.735 -41.146  12.329  1.00  0.92           N  
ATOM  11913  CA  GLY B 628      44.752 -41.134  13.409  1.00  0.92           C  
ATOM  11914  C   GLY B 628      43.390 -41.632  13.030  1.00  0.92           C  
ATOM  11915  O   GLY B 628      42.892 -42.571  13.640  1.00  0.92           O  
ATOM  11916  N   ASP B 629      42.790 -41.048  11.977  1.00  0.88           N  
ATOM  11917  CA  ASP B 629      41.476 -41.380  11.463  1.00  0.88           C  
ATOM  11918  C   ASP B 629      41.338 -42.872  11.115  1.00  0.88           C  
ATOM  11919  O   ASP B 629      40.298 -43.493  11.311  1.00  0.88           O  
ATOM  11920  CB  ASP B 629      41.159 -40.494  10.215  1.00  0.88           C  
ATOM  11921  CG  ASP B 629      41.179 -38.993  10.504  1.00  0.88           C  
ATOM  11922  OD1 ASP B 629      40.935 -38.598  11.673  1.00  0.88           O  
ATOM  11923  OD2 ASP B 629      41.426 -38.217   9.535  1.00  0.88           O  
ATOM  11924  N   VAL B 630      42.415 -43.503  10.600  1.00  0.92           N  
ATOM  11925  CA  VAL B 630      42.432 -44.935  10.337  1.00  0.92           C  
ATOM  11926  C   VAL B 630      42.723 -45.788  11.576  1.00  0.92           C  
ATOM  11927  O   VAL B 630      42.009 -46.733  11.886  1.00  0.92           O  
ATOM  11928  CB  VAL B 630      43.453 -45.254   9.249  1.00  0.92           C  
ATOM  11929  CG1 VAL B 630      43.644 -46.776   9.062  1.00  0.92           C  
ATOM  11930  CG2 VAL B 630      42.977 -44.634   7.919  1.00  0.92           C  
ATOM  11931  N   VAL B 631      43.804 -45.476  12.327  1.00  0.91           N  
ATOM  11932  CA  VAL B 631      44.256 -46.262  13.471  1.00  0.91           C  
ATOM  11933  C   VAL B 631      43.307 -46.237  14.648  1.00  0.91           C  
ATOM  11934  O   VAL B 631      43.050 -47.259  15.288  1.00  0.91           O  
ATOM  11935  CB  VAL B 631      45.638 -45.820  13.945  1.00  0.91           C  
ATOM  11936  CG1 VAL B 631      46.092 -46.631  15.179  1.00  0.91           C  
ATOM  11937  CG2 VAL B 631      46.657 -46.037  12.810  1.00  0.91           C  
ATOM  11938  N   ASN B 632      42.735 -45.067  14.980  1.00  0.87           N  
ATOM  11939  CA  ASN B 632      41.979 -44.894  16.204  1.00  0.87           C  
ATOM  11940  C   ASN B 632      40.619 -45.570  16.149  1.00  0.87           C  
ATOM  11941  O   ASN B 632      39.976 -45.782  17.176  1.00  0.87           O  
ATOM  11942  CB  ASN B 632      41.781 -43.392  16.503  1.00  0.87           C  
ATOM  11943  CG  ASN B 632      43.134 -42.737  16.747  1.00  0.87           C  
ATOM  11944  OD1 ASN B 632      44.135 -43.365  17.097  1.00  0.87           O  
ATOM  11945  ND2 ASN B 632      43.173 -41.395  16.602  1.00  0.87           N  
ATOM  11946  N   HIS B 633      40.174 -45.933  14.935  1.00  0.86           N  
ATOM  11947  CA  HIS B 633      38.886 -46.532  14.705  1.00  0.86           C  
ATOM  11948  C   HIS B 633      38.950 -47.954  14.158  1.00  0.86           C  
ATOM  11949  O   HIS B 633      37.911 -48.520  13.828  1.00  0.86           O  
ATOM  11950  CB  HIS B 633      38.086 -45.637  13.735  1.00  0.86           C  
ATOM  11951  CG  HIS B 633      37.822 -44.271  14.306  1.00  0.86           C  
ATOM  11952  ND1 HIS B 633      38.730 -43.249  14.109  1.00  0.86           N  
ATOM  11953  CD2 HIS B 633      36.766 -43.818  15.029  1.00  0.86           C  
ATOM  11954  CE1 HIS B 633      38.211 -42.197  14.697  1.00  0.86           C  
ATOM  11955  NE2 HIS B 633      37.022 -42.485  15.280  1.00  0.86           N  
ATOM  11956  N   ASP B 634      40.138 -48.607  14.082  1.00  0.88           N  
ATOM  11957  CA  ASP B 634      40.213 -49.998  13.664  1.00  0.88           C  
ATOM  11958  C   ASP B 634      39.928 -50.932  14.860  1.00  0.88           C  
ATOM  11959  O   ASP B 634      40.590 -50.848  15.902  1.00  0.88           O  
ATOM  11960  CB  ASP B 634      41.563 -50.353  12.982  1.00  0.88           C  
ATOM  11961  CG  ASP B 634      41.556 -51.750  12.383  1.00  0.88           C  
ATOM  11962  OD1 ASP B 634      41.728 -52.721  13.161  1.00  0.88           O  
ATOM  11963  OD2 ASP B 634      41.381 -51.923  11.149  1.00  0.88           O  
ATOM  11964  N   PRO B 635      38.964 -51.846  14.773  1.00  0.89           N  
ATOM  11965  CA  PRO B 635      38.591 -52.699  15.889  1.00  0.89           C  
ATOM  11966  C   PRO B 635      39.590 -53.805  16.141  1.00  0.89           C  
ATOM  11967  O   PRO B 635      39.585 -54.356  17.238  1.00  0.89           O  
ATOM  11968  CB  PRO B 635      37.223 -53.265  15.472  1.00  0.89           C  
ATOM  11969  CG  PRO B 635      37.247 -53.224  13.943  1.00  0.89           C  
ATOM  11970  CD  PRO B 635      38.012 -51.938  13.670  1.00  0.89           C  
ATOM  11971  N   ALA B 636      40.453 -54.171  15.175  1.00  0.89           N  
ATOM  11972  CA  ALA B 636      41.465 -55.177  15.398  1.00  0.89           C  
ATOM  11973  C   ALA B 636      42.614 -54.616  16.237  1.00  0.89           C  
ATOM  11974  O   ALA B 636      43.254 -55.307  17.028  1.00  0.89           O  
ATOM  11975  CB  ALA B 636      41.935 -55.747  14.042  1.00  0.89           C  
ATOM  11976  N   VAL B 637      42.872 -53.302  16.095  1.00  0.89           N  
ATOM  11977  CA  VAL B 637      43.813 -52.552  16.901  1.00  0.89           C  
ATOM  11978  C   VAL B 637      43.335 -52.291  18.325  1.00  0.89           C  
ATOM  11979  O   VAL B 637      44.116 -52.328  19.272  1.00  0.89           O  
ATOM  11980  CB  VAL B 637      44.182 -51.258  16.205  1.00  0.89           C  
ATOM  11981  CG1 VAL B 637      45.212 -50.463  17.026  1.00  0.89           C  
ATOM  11982  CG2 VAL B 637      44.793 -51.608  14.835  1.00  0.89           C  
ATOM  11983  N   GLY B 638      42.027 -52.027  18.542  1.00  0.87           N  
ATOM  11984  CA  GLY B 638      41.497 -51.676  19.862  1.00  0.87           C  
ATOM  11985  C   GLY B 638      42.142 -50.434  20.423  1.00  0.87           C  
ATOM  11986  O   GLY B 638      42.275 -49.436  19.728  1.00  0.87           O  
ATOM  11987  N   ASP B 639      42.573 -50.464  21.692  1.00  0.86           N  
ATOM  11988  CA  ASP B 639      43.279 -49.389  22.366  1.00  0.86           C  
ATOM  11989  C   ASP B 639      44.752 -49.747  22.550  1.00  0.86           C  
ATOM  11990  O   ASP B 639      45.499 -49.082  23.269  1.00  0.86           O  
ATOM  11991  CB  ASP B 639      42.609 -49.053  23.726  1.00  0.86           C  
ATOM  11992  CG  ASP B 639      42.110 -50.322  24.394  1.00  0.86           C  
ATOM  11993  OD1 ASP B 639      42.902 -51.297  24.469  1.00  0.86           O  
ATOM  11994  OD2 ASP B 639      40.909 -50.347  24.747  1.00  0.86           O  
ATOM  11995  N   ARG B 640      45.227 -50.785  21.822  1.00  0.87           N  
ATOM  11996  CA  ARG B 640      46.618 -51.194  21.795  1.00  0.87           C  
ATOM  11997  C   ARG B 640      47.482 -50.154  21.082  1.00  0.87           C  
ATOM  11998  O   ARG B 640      48.675 -50.041  21.334  1.00  0.87           O  
ATOM  11999  CB  ARG B 640      46.808 -52.577  21.097  1.00  0.87           C  
ATOM  12000  CG  ARG B 640      46.065 -53.758  21.768  1.00  0.87           C  
ATOM  12001  CD  ARG B 640      45.480 -54.827  20.819  1.00  0.87           C  
ATOM  12002  NE  ARG B 640      46.540 -55.758  20.306  1.00  0.87           N  
ATOM  12003  CZ  ARG B 640      46.252 -56.744  19.434  1.00  0.87           C  
ATOM  12004  NH1 ARG B 640      45.132 -56.720  18.719  1.00  0.87           N  
ATOM  12005  NH2 ARG B 640      47.069 -57.784  19.281  1.00  0.87           N  
ATOM  12006  N   LEU B 641      46.881 -49.331  20.198  1.00  0.93           N  
ATOM  12007  CA  LEU B 641      47.554 -48.203  19.593  1.00  0.93           C  
ATOM  12008  C   LEU B 641      46.581 -47.039  19.439  1.00  0.93           C  
ATOM  12009  O   LEU B 641      45.410 -47.203  19.092  1.00  0.93           O  
ATOM  12010  CB  LEU B 641      48.149 -48.610  18.224  1.00  0.93           C  
ATOM  12011  CG  LEU B 641      48.977 -47.561  17.453  1.00  0.93           C  
ATOM  12012  CD1 LEU B 641      50.220 -47.099  18.224  1.00  0.93           C  
ATOM  12013  CD2 LEU B 641      49.412 -48.164  16.107  1.00  0.93           C  
ATOM  12014  N   ARG B 642      47.041 -45.808  19.715  1.00  0.88           N  
ATOM  12015  CA  ARG B 642      46.277 -44.598  19.491  1.00  0.88           C  
ATOM  12016  C   ARG B 642      47.232 -43.565  18.942  1.00  0.88           C  
ATOM  12017  O   ARG B 642      48.362 -43.448  19.410  1.00  0.88           O  
ATOM  12018  CB  ARG B 642      45.616 -44.046  20.793  1.00  0.88           C  
ATOM  12019  CG  ARG B 642      44.228 -44.639  21.121  1.00  0.88           C  
ATOM  12020  CD  ARG B 642      43.147 -44.186  20.132  1.00  0.88           C  
ATOM  12021  NE  ARG B 642      41.871 -44.918  20.416  1.00  0.88           N  
ATOM  12022  CZ  ARG B 642      41.637 -46.151  19.950  1.00  0.88           C  
ATOM  12023  NH1 ARG B 642      42.570 -46.851  19.316  1.00  0.88           N  
ATOM  12024  NH2 ARG B 642      40.436 -46.703  20.102  1.00  0.88           N  
ATOM  12025  N   VAL B 643      46.808 -42.807  17.914  1.00  0.93           N  
ATOM  12026  CA  VAL B 643      47.640 -41.797  17.279  1.00  0.93           C  
ATOM  12027  C   VAL B 643      46.916 -40.472  17.339  1.00  0.93           C  
ATOM  12028  O   VAL B 643      45.815 -40.314  16.811  1.00  0.93           O  
ATOM  12029  CB  VAL B 643      47.958 -42.103  15.820  1.00  0.93           C  
ATOM  12030  CG1 VAL B 643      49.020 -41.118  15.278  1.00  0.93           C  
ATOM  12031  CG2 VAL B 643      48.467 -43.550  15.712  1.00  0.93           C  
ATOM  12032  N   ILE B 644      47.511 -39.481  18.018  1.00  0.91           N  
ATOM  12033  CA  ILE B 644      46.884 -38.194  18.249  1.00  0.91           C  
ATOM  12034  C   ILE B 644      47.791 -37.083  17.756  1.00  0.91           C  
ATOM  12035  O   ILE B 644      48.993 -37.071  18.003  1.00  0.91           O  
ATOM  12036  CB  ILE B 644      46.594 -37.989  19.735  1.00  0.91           C  
ATOM  12037  CG1 ILE B 644      45.605 -39.049  20.286  1.00  0.91           C  
ATOM  12038  CG2 ILE B 644      46.087 -36.560  20.030  1.00  0.91           C  
ATOM  12039  CD1 ILE B 644      44.208 -39.019  19.646  1.00  0.91           C  
ATOM  12040  N   PHE B 645      47.222 -36.084  17.049  1.00  0.92           N  
ATOM  12041  CA  PHE B 645      47.922 -34.843  16.790  1.00  0.92           C  
ATOM  12042  C   PHE B 645      47.560 -33.870  17.905  1.00  0.92           C  
ATOM  12043  O   PHE B 645      46.385 -33.610  18.154  1.00  0.92           O  
ATOM  12044  CB  PHE B 645      47.561 -34.252  15.402  1.00  0.92           C  
ATOM  12045  CG  PHE B 645      48.412 -33.045  15.101  1.00  0.92           C  
ATOM  12046  CD1 PHE B 645      49.754 -33.199  14.724  1.00  0.92           C  
ATOM  12047  CD2 PHE B 645      47.896 -31.749  15.263  1.00  0.92           C  
ATOM  12048  CE1 PHE B 645      50.574 -32.082  14.528  1.00  0.92           C  
ATOM  12049  CE2 PHE B 645      48.707 -30.628  15.054  1.00  0.92           C  
ATOM  12050  CZ  PHE B 645      50.046 -30.799  14.692  1.00  0.92           C  
ATOM  12051  N   LEU B 646      48.554 -33.321  18.626  1.00  0.92           N  
ATOM  12052  CA  LEU B 646      48.275 -32.408  19.718  1.00  0.92           C  
ATOM  12053  C   LEU B 646      48.183 -30.978  19.212  1.00  0.92           C  
ATOM  12054  O   LEU B 646      49.191 -30.332  18.925  1.00  0.92           O  
ATOM  12055  CB  LEU B 646      49.323 -32.475  20.857  1.00  0.92           C  
ATOM  12056  CG  LEU B 646      49.409 -33.828  21.590  1.00  0.92           C  
ATOM  12057  CD1 LEU B 646      50.510 -33.779  22.658  1.00  0.92           C  
ATOM  12058  CD2 LEU B 646      48.085 -34.221  22.263  1.00  0.92           C  
ATOM  12059  N   GLU B 647      46.939 -30.464  19.097  1.00  0.90           N  
ATOM  12060  CA  GLU B 647      46.634 -29.123  18.632  1.00  0.90           C  
ATOM  12061  C   GLU B 647      47.254 -27.991  19.450  1.00  0.90           C  
ATOM  12062  O   GLU B 647      47.222 -27.966  20.681  1.00  0.90           O  
ATOM  12063  CB  GLU B 647      45.099 -28.892  18.569  1.00  0.90           C  
ATOM  12064  CG  GLU B 647      44.689 -27.588  17.832  1.00  0.90           C  
ATOM  12065  CD  GLU B 647      43.182 -27.362  17.721  1.00  0.90           C  
ATOM  12066  OE1 GLU B 647      42.508 -28.192  17.063  1.00  0.90           O  
ATOM  12067  OE2 GLU B 647      42.707 -26.307  18.217  1.00  0.90           O  
ATOM  12068  N   ASN B 648      47.832 -26.994  18.745  1.00  0.93           N  
ATOM  12069  CA  ASN B 648      48.282 -25.735  19.300  1.00  0.93           C  
ATOM  12070  C   ASN B 648      49.357 -25.848  20.365  1.00  0.93           C  
ATOM  12071  O   ASN B 648      49.262 -25.236  21.430  1.00  0.93           O  
ATOM  12072  CB  ASN B 648      47.073 -24.887  19.776  1.00  0.93           C  
ATOM  12073  CG  ASN B 648      47.404 -23.408  19.886  1.00  0.93           C  
ATOM  12074  OD1 ASN B 648      48.294 -22.879  19.219  1.00  0.93           O  
ATOM  12075  ND2 ASN B 648      46.667 -22.706  20.775  1.00  0.93           N  
ATOM  12076  N   TYR B 649      50.429 -26.612  20.072  1.00  0.94           N  
ATOM  12077  CA  TYR B 649      51.592 -26.730  20.930  1.00  0.94           C  
ATOM  12078  C   TYR B 649      52.254 -25.377  21.225  1.00  0.94           C  
ATOM  12079  O   TYR B 649      52.505 -24.558  20.341  1.00  0.94           O  
ATOM  12080  CB  TYR B 649      52.591 -27.762  20.334  1.00  0.94           C  
ATOM  12081  CG  TYR B 649      53.774 -28.005  21.238  1.00  0.94           C  
ATOM  12082  CD1 TYR B 649      53.588 -28.577  22.507  1.00  0.94           C  
ATOM  12083  CD2 TYR B 649      55.070 -27.628  20.847  1.00  0.94           C  
ATOM  12084  CE1 TYR B 649      54.675 -28.754  23.374  1.00  0.94           C  
ATOM  12085  CE2 TYR B 649      56.161 -27.822  21.708  1.00  0.94           C  
ATOM  12086  CZ  TYR B 649      55.964 -28.383  22.974  1.00  0.94           C  
ATOM  12087  OH  TYR B 649      57.076 -28.638  23.805  1.00  0.94           O  
ATOM  12088  N   ARG B 650      52.499 -25.127  22.523  1.00  0.91           N  
ATOM  12089  CA  ARG B 650      52.902 -23.854  23.060  1.00  0.91           C  
ATOM  12090  C   ARG B 650      53.454 -24.131  24.446  1.00  0.91           C  
ATOM  12091  O   ARG B 650      53.404 -25.271  24.908  1.00  0.91           O  
ATOM  12092  CB  ARG B 650      51.721 -22.850  23.124  1.00  0.91           C  
ATOM  12093  CG  ARG B 650      50.682 -23.170  24.217  1.00  0.91           C  
ATOM  12094  CD  ARG B 650      49.360 -22.404  24.085  1.00  0.91           C  
ATOM  12095  NE  ARG B 650      48.333 -23.360  23.571  1.00  0.91           N  
ATOM  12096  CZ  ARG B 650      47.740 -24.273  24.352  1.00  0.91           C  
ATOM  12097  NH1 ARG B 650      47.910 -24.298  25.665  1.00  0.91           N  
ATOM  12098  NH2 ARG B 650      46.996 -25.216  23.774  1.00  0.91           N  
ATOM  12099  N   VAL B 651      53.990 -23.113  25.149  1.00  0.96           N  
ATOM  12100  CA  VAL B 651      54.631 -23.268  26.451  1.00  0.96           C  
ATOM  12101  C   VAL B 651      53.718 -23.845  27.525  1.00  0.96           C  
ATOM  12102  O   VAL B 651      54.083 -24.811  28.188  1.00  0.96           O  
ATOM  12103  CB  VAL B 651      55.221 -21.939  26.913  1.00  0.96           C  
ATOM  12104  CG1 VAL B 651      55.891 -22.050  28.297  1.00  0.96           C  
ATOM  12105  CG2 VAL B 651      56.266 -21.483  25.881  1.00  0.96           C  
ATOM  12106  N   SER B 652      52.475 -23.336  27.661  1.00  0.95           N  
ATOM  12107  CA  SER B 652      51.483 -23.854  28.586  1.00  0.95           C  
ATOM  12108  C   SER B 652      51.016 -25.265  28.315  1.00  0.95           C  
ATOM  12109  O   SER B 652      50.653 -25.997  29.232  1.00  0.95           O  
ATOM  12110  CB  SER B 652      50.245 -22.941  28.697  1.00  0.95           C  
ATOM  12111  OG  SER B 652      49.501 -22.792  27.477  1.00  0.95           O  
ATOM  12112  N   LEU B 653      50.991 -25.691  27.036  1.00  0.94           N  
ATOM  12113  CA  LEU B 653      50.731 -27.079  26.696  1.00  0.94           C  
ATOM  12114  C   LEU B 653      51.905 -27.977  27.034  1.00  0.94           C  
ATOM  12115  O   LEU B 653      51.730 -29.069  27.569  1.00  0.94           O  
ATOM  12116  CB  LEU B 653      50.314 -27.283  25.218  1.00  0.94           C  
ATOM  12117  CG  LEU B 653      49.722 -28.679  24.900  1.00  0.94           C  
ATOM  12118  CD1 LEU B 653      48.426 -28.945  25.682  1.00  0.94           C  
ATOM  12119  CD2 LEU B 653      49.433 -28.828  23.399  1.00  0.94           C  
ATOM  12120  N   ALA B 654      53.145 -27.508  26.779  1.00  0.98           N  
ATOM  12121  CA  ALA B 654      54.372 -28.203  27.105  1.00  0.98           C  
ATOM  12122  C   ALA B 654      54.501 -28.494  28.593  1.00  0.98           C  
ATOM  12123  O   ALA B 654      54.888 -29.588  28.996  1.00  0.98           O  
ATOM  12124  CB  ALA B 654      55.568 -27.381  26.598  1.00  0.98           C  
ATOM  12125  N   GLU B 655      54.084 -27.530  29.435  1.00  0.94           N  
ATOM  12126  CA  GLU B 655      53.992 -27.676  30.874  1.00  0.94           C  
ATOM  12127  C   GLU B 655      52.980 -28.731  31.323  1.00  0.94           C  
ATOM  12128  O   GLU B 655      53.034 -29.218  32.445  1.00  0.94           O  
ATOM  12129  CB  GLU B 655      53.630 -26.314  31.518  1.00  0.94           C  
ATOM  12130  CG  GLU B 655      54.749 -25.243  31.415  1.00  0.94           C  
ATOM  12131  CD  GLU B 655      54.292 -23.861  31.884  1.00  0.94           C  
ATOM  12132  OE1 GLU B 655      53.390 -23.758  32.745  1.00  0.94           O  
ATOM  12133  OE2 GLU B 655      54.861 -22.850  31.387  1.00  0.94           O  
ATOM  12134  N   LYS B 656      52.026 -29.146  30.466  1.00  0.92           N  
ATOM  12135  CA  LYS B 656      51.100 -30.207  30.817  1.00  0.92           C  
ATOM  12136  C   LYS B 656      51.463 -31.547  30.198  1.00  0.92           C  
ATOM  12137  O   LYS B 656      51.353 -32.586  30.845  1.00  0.92           O  
ATOM  12138  CB  LYS B 656      49.659 -29.838  30.398  1.00  0.92           C  
ATOM  12139  CG  LYS B 656      49.182 -28.522  31.023  1.00  0.92           C  
ATOM  12140  CD  LYS B 656      47.749 -28.157  30.609  1.00  0.92           C  
ATOM  12141  CE  LYS B 656      47.380 -26.703  30.929  1.00  0.92           C  
ATOM  12142  NZ  LYS B 656      47.580 -26.470  32.366  1.00  0.92           N  
ATOM  12143  N   VAL B 657      51.906 -31.574  28.923  1.00  0.96           N  
ATOM  12144  CA  VAL B 657      52.192 -32.816  28.223  1.00  0.96           C  
ATOM  12145  C   VAL B 657      53.499 -33.496  28.597  1.00  0.96           C  
ATOM  12146  O   VAL B 657      53.564 -34.712  28.768  1.00  0.96           O  
ATOM  12147  CB  VAL B 657      52.047 -32.661  26.715  1.00  0.96           C  
ATOM  12148  CG1 VAL B 657      53.124 -31.776  26.077  1.00  0.96           C  
ATOM  12149  CG2 VAL B 657      52.058 -34.048  26.064  1.00  0.96           C  
ATOM  12150  N   ILE B 658      54.594 -32.731  28.768  1.00  0.97           N  
ATOM  12151  CA  ILE B 658      55.906 -33.269  29.104  1.00  0.97           C  
ATOM  12152  C   ILE B 658      55.956 -34.011  30.448  1.00  0.97           C  
ATOM  12153  O   ILE B 658      56.551 -35.095  30.497  1.00  0.97           O  
ATOM  12154  CB  ILE B 658      56.976 -32.188  28.968  1.00  0.97           C  
ATOM  12155  CG1 ILE B 658      57.047 -31.725  27.491  1.00  0.97           C  
ATOM  12156  CG2 ILE B 658      58.343 -32.722  29.433  1.00  0.97           C  
ATOM  12157  CD1 ILE B 658      57.988 -30.540  27.254  1.00  0.97           C  
ATOM  12158  N   PRO B 659      55.338 -33.578  31.554  1.00  0.98           N  
ATOM  12159  CA  PRO B 659      55.247 -34.362  32.781  1.00  0.98           C  
ATOM  12160  C   PRO B 659      54.578 -35.708  32.626  1.00  0.98           C  
ATOM  12161  O   PRO B 659      54.866 -36.605  33.411  1.00  0.98           O  
ATOM  12162  CB  PRO B 659      54.535 -33.441  33.778  1.00  0.98           C  
ATOM  12163  CG  PRO B 659      54.956 -32.056  33.294  1.00  0.98           C  
ATOM  12164  CD  PRO B 659      54.887 -32.206  31.785  1.00  0.98           C  
ATOM  12165  N   ALA B 660      53.706 -35.888  31.618  1.00  0.97           N  
ATOM  12166  CA  ALA B 660      52.948 -37.099  31.430  1.00  0.97           C  
ATOM  12167  C   ALA B 660      53.563 -38.076  30.439  1.00  0.97           C  
ATOM  12168  O   ALA B 660      53.084 -39.189  30.268  1.00  0.97           O  
ATOM  12169  CB  ALA B 660      51.564 -36.682  30.911  1.00  0.97           C  
ATOM  12170  N   ALA B 661      54.673 -37.717  29.779  1.00  0.99           N  
ATOM  12171  CA  ALA B 661      55.246 -38.559  28.755  1.00  0.99           C  
ATOM  12172  C   ALA B 661      56.182 -39.661  29.220  1.00  0.99           C  
ATOM  12173  O   ALA B 661      57.124 -39.387  29.964  1.00  0.99           O  
ATOM  12174  CB  ALA B 661      56.082 -37.649  27.873  1.00  0.99           C  
ATOM  12175  N   ASP B 662      55.987 -40.920  28.775  1.00  0.98           N  
ATOM  12176  CA  ASP B 662      56.925 -41.995  29.045  1.00  0.98           C  
ATOM  12177  C   ASP B 662      58.135 -41.948  28.136  1.00  0.98           C  
ATOM  12178  O   ASP B 662      59.265 -42.121  28.581  1.00  0.98           O  
ATOM  12179  CB  ASP B 662      56.323 -43.393  28.838  1.00  0.98           C  
ATOM  12180  CG  ASP B 662      55.189 -43.600  29.785  1.00  0.98           C  
ATOM  12181  OD1 ASP B 662      55.304 -43.371  31.011  1.00  0.98           O  
ATOM  12182  OD2 ASP B 662      54.132 -44.015  29.251  1.00  0.98           O  
ATOM  12183  N   LEU B 663      57.912 -41.723  26.826  1.00  0.99           N  
ATOM  12184  CA  LEU B 663      58.961 -41.759  25.833  1.00  0.99           C  
ATOM  12185  C   LEU B 663      59.082 -40.422  25.138  1.00  0.99           C  
ATOM  12186  O   LEU B 663      58.104 -39.785  24.753  1.00  0.99           O  
ATOM  12187  CB  LEU B 663      58.718 -42.873  24.794  1.00  0.99           C  
ATOM  12188  CG  LEU B 663      59.843 -43.100  23.766  1.00  0.99           C  
ATOM  12189  CD1 LEU B 663      61.118 -43.638  24.433  1.00  0.99           C  
ATOM  12190  CD2 LEU B 663      59.363 -44.062  22.670  1.00  0.99           C  
ATOM  12191  N   SER B 664      60.335 -39.964  25.007  1.00  0.99           N  
ATOM  12192  CA  SER B 664      60.703 -38.692  24.435  1.00  0.99           C  
ATOM  12193  C   SER B 664      61.343 -38.909  23.092  1.00  0.99           C  
ATOM  12194  O   SER B 664      62.437 -39.467  22.994  1.00  0.99           O  
ATOM  12195  CB  SER B 664      61.744 -38.004  25.348  1.00  0.99           C  
ATOM  12196  OG  SER B 664      62.193 -36.736  24.867  1.00  0.99           O  
ATOM  12197  N   GLU B 665      60.673 -38.444  22.029  1.00  0.96           N  
ATOM  12198  CA  GLU B 665      61.143 -38.584  20.673  1.00  0.96           C  
ATOM  12199  C   GLU B 665      62.045 -37.437  20.254  1.00  0.96           C  
ATOM  12200  O   GLU B 665      61.628 -36.294  20.042  1.00  0.96           O  
ATOM  12201  CB  GLU B 665      59.930 -38.648  19.728  1.00  0.96           C  
ATOM  12202  CG  GLU B 665      59.190 -40.004  19.761  1.00  0.96           C  
ATOM  12203  CD  GLU B 665      60.035 -41.155  19.229  1.00  0.96           C  
ATOM  12204  OE1 GLU B 665      61.004 -40.892  18.471  1.00  0.96           O  
ATOM  12205  OE2 GLU B 665      59.740 -42.319  19.591  1.00  0.96           O  
ATOM  12206  N   GLN B 666      63.353 -37.729  20.118  1.00  0.96           N  
ATOM  12207  CA  GLN B 666      64.378 -36.750  19.824  1.00  0.96           C  
ATOM  12208  C   GLN B 666      65.215 -37.260  18.661  1.00  0.96           C  
ATOM  12209  O   GLN B 666      66.415 -37.474  18.753  1.00  0.96           O  
ATOM  12210  CB  GLN B 666      65.247 -36.446  21.074  1.00  0.96           C  
ATOM  12211  CG  GLN B 666      64.425 -36.083  22.339  1.00  0.96           C  
ATOM  12212  CD  GLN B 666      63.537 -34.853  22.144  1.00  0.96           C  
ATOM  12213  OE1 GLN B 666      63.859 -33.904  21.420  1.00  0.96           O  
ATOM  12214  NE2 GLN B 666      62.370 -34.835  22.821  1.00  0.96           N  
ATOM  12215  N   ILE B 667      64.538 -37.489  17.521  1.00  0.98           N  
ATOM  12216  CA  ILE B 667      65.001 -38.314  16.418  1.00  0.98           C  
ATOM  12217  C   ILE B 667      65.561 -37.618  15.189  1.00  0.98           C  
ATOM  12218  O   ILE B 667      65.638 -38.208  14.103  1.00  0.98           O  
ATOM  12219  CB  ILE B 667      63.860 -39.207  15.974  1.00  0.98           C  
ATOM  12220  CG1 ILE B 667      62.627 -38.403  15.501  1.00  0.98           C  
ATOM  12221  CG2 ILE B 667      63.492 -40.085  17.174  1.00  0.98           C  
ATOM  12222  CD1 ILE B 667      61.463 -39.295  15.065  1.00  0.98           C  
ATOM  12223  N   SER B 668      66.007 -36.358  15.330  1.00  0.97           N  
ATOM  12224  CA  SER B 668      66.661 -35.552  14.316  1.00  0.97           C  
ATOM  12225  C   SER B 668      67.855 -36.186  13.644  1.00  0.97           C  
ATOM  12226  O   SER B 668      68.554 -37.020  14.199  1.00  0.97           O  
ATOM  12227  CB  SER B 668      67.106 -34.184  14.874  1.00  0.97           C  
ATOM  12228  OG  SER B 668      67.933 -34.302  16.043  1.00  0.97           O  
ATOM  12229  N   THR B 669      68.101 -35.834  12.366  1.00  0.96           N  
ATOM  12230  CA  THR B 669      69.253 -36.356  11.629  1.00  0.96           C  
ATOM  12231  C   THR B 669      70.568 -35.914  12.229  1.00  0.96           C  
ATOM  12232  O   THR B 669      70.786 -34.727  12.426  1.00  0.96           O  
ATOM  12233  CB  THR B 669      69.285 -35.942  10.172  1.00  0.96           C  
ATOM  12234  OG1 THR B 669      67.998 -36.067   9.591  1.00  0.96           O  
ATOM  12235  CG2 THR B 669      70.233 -36.832   9.360  1.00  0.96           C  
ATOM  12236  N   ALA B 670      71.500 -36.847  12.516  1.00  0.95           N  
ATOM  12237  CA  ALA B 670      72.750 -36.532  13.180  1.00  0.95           C  
ATOM  12238  C   ALA B 670      73.540 -35.380  12.560  1.00  0.95           C  
ATOM  12239  O   ALA B 670      74.030 -35.459  11.433  1.00  0.95           O  
ATOM  12240  CB  ALA B 670      73.624 -37.796  13.287  1.00  0.95           C  
ATOM  12241  N   GLY B 671      73.649 -34.265  13.313  1.00  0.92           N  
ATOM  12242  CA  GLY B 671      74.261 -33.030  12.866  1.00  0.92           C  
ATOM  12243  C   GLY B 671      73.294 -31.934  12.466  1.00  0.92           C  
ATOM  12244  O   GLY B 671      73.740 -30.893  11.995  1.00  0.92           O  
ATOM  12245  N   THR B 672      71.956 -32.108  12.617  1.00  0.92           N  
ATOM  12246  CA  THR B 672      70.996 -31.077  12.215  1.00  0.92           C  
ATOM  12247  C   THR B 672      70.317 -30.336  13.355  1.00  0.92           C  
ATOM  12248  O   THR B 672      70.021 -29.150  13.213  1.00  0.92           O  
ATOM  12249  CB  THR B 672      69.883 -31.571  11.284  1.00  0.92           C  
ATOM  12250  OG1 THR B 672      69.013 -32.510  11.904  1.00  0.92           O  
ATOM  12251  CG2 THR B 672      70.485 -32.243  10.042  1.00  0.92           C  
ATOM  12252  N   GLU B 673      70.064 -30.956  14.526  1.00  0.91           N  
ATOM  12253  CA  GLU B 673      69.498 -30.235  15.656  1.00  0.91           C  
ATOM  12254  C   GLU B 673      70.661 -29.703  16.477  1.00  0.91           C  
ATOM  12255  O   GLU B 673      71.423 -30.444  17.089  1.00  0.91           O  
ATOM  12256  CB  GLU B 673      68.555 -31.146  16.498  1.00  0.91           C  
ATOM  12257  CG  GLU B 673      67.794 -30.547  17.724  1.00  0.91           C  
ATOM  12258  CD  GLU B 673      66.390 -29.984  17.509  1.00  0.91           C  
ATOM  12259  OE1 GLU B 673      66.213 -28.747  17.691  1.00  0.91           O  
ATOM  12260  OE2 GLU B 673      65.410 -30.737  17.230  1.00  0.91           O  
ATOM  12261  N   ALA B 674      70.842 -28.362  16.523  1.00  0.95           N  
ATOM  12262  CA  ALA B 674      71.985 -27.720  17.154  1.00  0.95           C  
ATOM  12263  C   ALA B 674      72.099 -28.003  18.645  1.00  0.95           C  
ATOM  12264  O   ALA B 674      73.175 -27.937  19.231  1.00  0.95           O  
ATOM  12265  CB  ALA B 674      71.901 -26.200  16.950  1.00  0.95           C  
ATOM  12266  N   SER B 675      70.966 -28.343  19.287  1.00  0.96           N  
ATOM  12267  CA  SER B 675      70.953 -28.722  20.686  1.00  0.96           C  
ATOM  12268  C   SER B 675      69.638 -29.349  21.089  1.00  0.96           C  
ATOM  12269  O   SER B 675      69.577 -30.460  21.578  1.00  0.96           O  
ATOM  12270  CB  SER B 675      71.200 -27.504  21.600  1.00  0.96           C  
ATOM  12271  OG  SER B 675      71.274 -27.832  22.986  1.00  0.96           O  
ATOM  12272  N   GLY B 676      68.526 -28.616  20.843  1.00  0.96           N  
ATOM  12273  CA  GLY B 676      67.235 -28.960  21.412  1.00  0.96           C  
ATOM  12274  C   GLY B 676      67.125 -28.489  22.845  1.00  0.96           C  
ATOM  12275  O   GLY B 676      68.110 -28.330  23.557  1.00  0.96           O  
ATOM  12276  N   THR B 677      65.896 -28.230  23.319  1.00  0.96           N  
ATOM  12277  CA  THR B 677      65.677 -27.956  24.738  1.00  0.96           C  
ATOM  12278  C   THR B 677      64.493 -28.732  25.261  1.00  0.96           C  
ATOM  12279  O   THR B 677      64.314 -28.882  26.464  1.00  0.96           O  
ATOM  12280  CB  THR B 677      65.463 -26.483  25.093  1.00  0.96           C  
ATOM  12281  OG1 THR B 677      64.426 -25.869  24.332  1.00  0.96           O  
ATOM  12282  CG2 THR B 677      66.754 -25.690  24.841  1.00  0.96           C  
ATOM  12283  N   GLY B 678      63.641 -29.302  24.372  1.00  0.99           N  
ATOM  12284  CA  GLY B 678      62.537 -30.163  24.787  1.00  0.99           C  
ATOM  12285  C   GLY B 678      63.029 -31.442  25.374  1.00  0.99           C  
ATOM  12286  O   GLY B 678      62.504 -31.918  26.371  1.00  0.99           O  
ATOM  12287  N   ASN B 679      64.123 -31.971  24.814  1.00  0.97           N  
ATOM  12288  CA  ASN B 679      64.784 -33.185  25.222  1.00  0.97           C  
ATOM  12289  C   ASN B 679      65.180 -33.175  26.694  1.00  0.97           C  
ATOM  12290  O   ASN B 679      64.900 -34.117  27.433  1.00  0.97           O  
ATOM  12291  CB  ASN B 679      66.011 -33.446  24.291  1.00  0.97           C  
ATOM  12292  CG  ASN B 679      66.969 -32.258  24.130  1.00  0.97           C  
ATOM  12293  OD1 ASN B 679      66.761 -31.163  24.639  1.00  0.97           O  
ATOM  12294  ND2 ASN B 679      68.034 -32.488  23.330  1.00  0.97           N  
ATOM  12295  N   MET B 680      65.756 -32.052  27.154  1.00  0.97           N  
ATOM  12296  CA  MET B 680      66.073 -31.786  28.537  1.00  0.97           C  
ATOM  12297  C   MET B 680      64.849 -31.798  29.439  1.00  0.97           C  
ATOM  12298  O   MET B 680      64.861 -32.402  30.509  1.00  0.97           O  
ATOM  12299  CB  MET B 680      66.759 -30.404  28.649  1.00  0.97           C  
ATOM  12300  CG  MET B 680      68.030 -30.269  27.791  1.00  0.97           C  
ATOM  12301  SD  MET B 680      68.656 -28.572  27.675  1.00  0.97           S  
ATOM  12302  CE  MET B 680      69.901 -29.037  26.443  1.00  0.97           C  
ATOM  12303  N   LYS B 681      63.734 -31.167  29.006  1.00  0.96           N  
ATOM  12304  CA  LYS B 681      62.500 -31.098  29.774  1.00  0.96           C  
ATOM  12305  C   LYS B 681      61.894 -32.464  30.013  1.00  0.96           C  
ATOM  12306  O   LYS B 681      61.462 -32.787  31.117  1.00  0.96           O  
ATOM  12307  CB  LYS B 681      61.438 -30.213  29.077  1.00  0.96           C  
ATOM  12308  CG  LYS B 681      61.880 -28.773  28.799  1.00  0.96           C  
ATOM  12309  CD  LYS B 681      60.931 -28.082  27.811  1.00  0.96           C  
ATOM  12310  CE  LYS B 681      61.520 -26.821  27.178  1.00  0.96           C  
ATOM  12311  NZ  LYS B 681      60.601 -26.308  26.139  1.00  0.96           N  
ATOM  12312  N   PHE B 682      61.885 -33.316  28.973  1.00  0.98           N  
ATOM  12313  CA  PHE B 682      61.417 -34.685  29.044  1.00  0.98           C  
ATOM  12314  C   PHE B 682      62.205 -35.537  30.026  1.00  0.98           C  
ATOM  12315  O   PHE B 682      61.629 -36.231  30.862  1.00  0.98           O  
ATOM  12316  CB  PHE B 682      61.539 -35.328  27.647  1.00  0.98           C  
ATOM  12317  CG  PHE B 682      60.341 -35.052  26.779  1.00  0.98           C  
ATOM  12318  CD1 PHE B 682      59.181 -35.828  26.919  1.00  0.98           C  
ATOM  12319  CD2 PHE B 682      60.385 -34.106  25.742  1.00  0.98           C  
ATOM  12320  CE1 PHE B 682      58.090 -35.624  26.070  1.00  0.98           C  
ATOM  12321  CE2 PHE B 682      59.282 -33.878  24.912  1.00  0.98           C  
ATOM  12322  CZ  PHE B 682      58.132 -34.644  25.085  1.00  0.98           C  
ATOM  12323  N   MET B 683      63.549 -35.452  29.977  1.00  0.97           N  
ATOM  12324  CA  MET B 683      64.441 -36.145  30.888  1.00  0.97           C  
ATOM  12325  C   MET B 683      64.264 -35.721  32.341  1.00  0.97           C  
ATOM  12326  O   MET B 683      64.179 -36.549  33.245  1.00  0.97           O  
ATOM  12327  CB  MET B 683      65.902 -35.899  30.442  1.00  0.97           C  
ATOM  12328  CG  MET B 683      66.965 -36.557  31.342  1.00  0.97           C  
ATOM  12329  SD  MET B 683      68.648 -36.551  30.662  1.00  0.97           S  
ATOM  12330  CE  MET B 683      68.812 -34.748  30.634  1.00  0.97           C  
ATOM  12331  N   LEU B 684      64.136 -34.400  32.594  1.00  0.98           N  
ATOM  12332  CA  LEU B 684      63.916 -33.828  33.912  1.00  0.98           C  
ATOM  12333  C   LEU B 684      62.620 -34.323  34.548  1.00  0.98           C  
ATOM  12334  O   LEU B 684      62.523 -34.584  35.739  1.00  0.98           O  
ATOM  12335  CB  LEU B 684      63.884 -32.278  33.806  1.00  0.98           C  
ATOM  12336  CG  LEU B 684      64.613 -31.475  34.909  1.00  0.98           C  
ATOM  12337  CD1 LEU B 684      64.052 -30.041  34.953  1.00  0.98           C  
ATOM  12338  CD2 LEU B 684      64.527 -32.113  36.302  1.00  0.98           C  
ATOM  12339  N   ASN B 685      61.582 -34.493  33.708  1.00  0.97           N  
ATOM  12340  CA  ASN B 685      60.248 -34.854  34.120  1.00  0.97           C  
ATOM  12341  C   ASN B 685      59.967 -36.345  34.044  1.00  0.97           C  
ATOM  12342  O   ASN B 685      58.821 -36.789  34.116  1.00  0.97           O  
ATOM  12343  CB  ASN B 685      59.247 -34.102  33.229  1.00  0.97           C  
ATOM  12344  CG  ASN B 685      59.150 -32.691  33.778  1.00  0.97           C  
ATOM  12345  OD1 ASN B 685      58.444 -32.477  34.760  1.00  0.97           O  
ATOM  12346  ND2 ASN B 685      59.900 -31.746  33.187  1.00  0.97           N  
ATOM  12347  N   GLY B 686      61.009 -37.182  33.920  1.00  0.98           N  
ATOM  12348  CA  GLY B 686      60.859 -38.616  34.078  1.00  0.98           C  
ATOM  12349  C   GLY B 686      60.376 -39.357  32.873  1.00  0.98           C  
ATOM  12350  O   GLY B 686      59.669 -40.348  33.000  1.00  0.98           O  
ATOM  12351  N   ALA B 687      60.732 -38.892  31.670  1.00  1.00           N  
ATOM  12352  CA  ALA B 687      60.583 -39.674  30.466  1.00  1.00           C  
ATOM  12353  C   ALA B 687      61.915 -40.305  30.103  1.00  1.00           C  
ATOM  12354  O   ALA B 687      62.979 -39.778  30.419  1.00  1.00           O  
ATOM  12355  CB  ALA B 687      60.132 -38.778  29.300  1.00  1.00           C  
ATOM  12356  N   LEU B 688      61.883 -41.457  29.413  1.00  0.98           N  
ATOM  12357  CA  LEU B 688      63.063 -42.041  28.809  1.00  0.98           C  
ATOM  12358  C   LEU B 688      63.171 -41.514  27.388  1.00  0.98           C  
ATOM  12359  O   LEU B 688      62.180 -41.136  26.771  1.00  0.98           O  
ATOM  12360  CB  LEU B 688      63.017 -43.591  28.819  1.00  0.98           C  
ATOM  12361  CG  LEU B 688      62.960 -44.200  30.237  1.00  0.98           C  
ATOM  12362  CD1 LEU B 688      62.899 -45.730  30.212  1.00  0.98           C  
ATOM  12363  CD2 LEU B 688      64.167 -43.774  31.078  1.00  0.98           C  
ATOM  12364  N   THR B 689      64.386 -41.455  26.815  1.00  0.99           N  
ATOM  12365  CA  THR B 689      64.583 -40.796  25.526  1.00  0.99           C  
ATOM  12366  C   THR B 689      65.014 -41.766  24.459  1.00  0.99           C  
ATOM  12367  O   THR B 689      65.988 -42.499  24.617  1.00  0.99           O  
ATOM  12368  CB  THR B 689      65.630 -39.695  25.588  1.00  0.99           C  
ATOM  12369  OG1 THR B 689      65.185 -38.656  26.446  1.00  0.99           O  
ATOM  12370  CG2 THR B 689      65.888 -39.037  24.223  1.00  0.99           C  
ATOM  12371  N   ILE B 690      64.305 -41.757  23.313  1.00  0.98           N  
ATOM  12372  CA  ILE B 690      64.739 -42.416  22.098  1.00  0.98           C  
ATOM  12373  C   ILE B 690      65.226 -41.322  21.180  1.00  0.98           C  
ATOM  12374  O   ILE B 690      64.610 -40.269  20.997  1.00  0.98           O  
ATOM  12375  CB  ILE B 690      63.675 -43.299  21.447  1.00  0.98           C  
ATOM  12376  CG1 ILE B 690      64.220 -44.050  20.210  1.00  0.98           C  
ATOM  12377  CG2 ILE B 690      62.441 -42.459  21.087  1.00  0.98           C  
ATOM  12378  CD1 ILE B 690      63.301 -45.182  19.738  1.00  0.98           C  
ATOM  12379  N   GLY B 691      66.434 -41.485  20.631  1.00  0.99           N  
ATOM  12380  CA  GLY B 691      67.011 -40.381  19.907  1.00  0.99           C  
ATOM  12381  C   GLY B 691      68.285 -40.759  19.247  1.00  0.99           C  
ATOM  12382  O   GLY B 691      68.882 -41.800  19.501  1.00  0.99           O  
ATOM  12383  N   THR B 692      68.741 -39.881  18.362  1.00  0.97           N  
ATOM  12384  CA  THR B 692      69.998 -39.987  17.662  1.00  0.97           C  
ATOM  12385  C   THR B 692      71.076 -39.302  18.473  1.00  0.97           C  
ATOM  12386  O   THR B 692      70.804 -38.510  19.374  1.00  0.97           O  
ATOM  12387  CB  THR B 692      69.906 -39.285  16.319  1.00  0.97           C  
ATOM  12388  OG1 THR B 692      69.341 -37.992  16.515  1.00  0.97           O  
ATOM  12389  CG2 THR B 692      68.960 -40.077  15.405  1.00  0.97           C  
ATOM  12390  N   MET B 693      72.361 -39.581  18.171  1.00  0.93           N  
ATOM  12391  CA  MET B 693      73.463 -38.822  18.739  1.00  0.93           C  
ATOM  12392  C   MET B 693      73.616 -37.470  18.051  1.00  0.93           C  
ATOM  12393  O   MET B 693      74.539 -37.250  17.272  1.00  0.93           O  
ATOM  12394  CB  MET B 693      74.801 -39.596  18.670  1.00  0.93           C  
ATOM  12395  CG  MET B 693      74.862 -40.798  19.627  1.00  0.93           C  
ATOM  12396  SD  MET B 693      74.918 -40.315  21.380  1.00  0.93           S  
ATOM  12397  CE  MET B 693      76.487 -41.150  21.743  1.00  0.93           C  
ATOM  12398  N   ASP B 694      72.692 -36.542  18.350  1.00  0.93           N  
ATOM  12399  CA  ASP B 694      72.610 -35.237  17.751  1.00  0.93           C  
ATOM  12400  C   ASP B 694      72.455 -34.222  18.876  1.00  0.93           C  
ATOM  12401  O   ASP B 694      72.105 -34.580  19.990  1.00  0.93           O  
ATOM  12402  CB  ASP B 694      71.397 -35.243  16.786  1.00  0.93           C  
ATOM  12403  CG  ASP B 694      71.371 -34.018  15.900  1.00  0.93           C  
ATOM  12404  OD1 ASP B 694      72.459 -33.445  15.659  1.00  0.93           O  
ATOM  12405  OD2 ASP B 694      70.286 -33.631  15.419  1.00  0.93           O  
ATOM  12406  N   GLY B 695      72.760 -32.928  18.602  1.00  0.95           N  
ATOM  12407  CA  GLY B 695      72.693 -31.824  19.567  1.00  0.95           C  
ATOM  12408  C   GLY B 695      73.057 -32.120  21.005  1.00  0.95           C  
ATOM  12409  O   GLY B 695      74.141 -32.612  21.324  1.00  0.95           O  
ATOM  12410  N   ALA B 696      72.141 -31.827  21.941  1.00  0.95           N  
ATOM  12411  CA  ALA B 696      72.379 -32.052  23.344  1.00  0.95           C  
ATOM  12412  C   ALA B 696      72.081 -33.480  23.769  1.00  0.95           C  
ATOM  12413  O   ALA B 696      72.446 -33.883  24.871  1.00  0.95           O  
ATOM  12414  CB  ALA B 696      71.526 -31.083  24.172  1.00  0.95           C  
ATOM  12415  N   ASN B 697      71.476 -34.315  22.888  1.00  0.95           N  
ATOM  12416  CA  ASN B 697      71.184 -35.716  23.166  1.00  0.95           C  
ATOM  12417  C   ASN B 697      72.449 -36.485  23.512  1.00  0.95           C  
ATOM  12418  O   ASN B 697      72.441 -37.343  24.387  1.00  0.95           O  
ATOM  12419  CB  ASN B 697      70.536 -36.481  21.982  1.00  0.95           C  
ATOM  12420  CG  ASN B 697      69.235 -35.862  21.489  1.00  0.95           C  
ATOM  12421  OD1 ASN B 697      68.553 -35.082  22.160  1.00  0.95           O  
ATOM  12422  ND2 ASN B 697      68.852 -36.278  20.258  1.00  0.95           N  
ATOM  12423  N   VAL B 698      73.577 -36.148  22.847  1.00  0.95           N  
ATOM  12424  CA  VAL B 698      74.890 -36.720  23.104  1.00  0.95           C  
ATOM  12425  C   VAL B 698      75.348 -36.512  24.537  1.00  0.95           C  
ATOM  12426  O   VAL B 698      75.762 -37.437  25.230  1.00  0.95           O  
ATOM  12427  CB  VAL B 698      75.934 -36.074  22.193  1.00  0.95           C  
ATOM  12428  CG1 VAL B 698      77.314 -36.745  22.376  1.00  0.95           C  
ATOM  12429  CG2 VAL B 698      75.481 -36.194  20.728  1.00  0.95           C  
ATOM  12430  N   GLU B 699      75.231 -35.270  25.037  1.00  0.94           N  
ATOM  12431  CA  GLU B 699      75.545 -34.921  26.402  1.00  0.94           C  
ATOM  12432  C   GLU B 699      74.575 -35.520  27.403  1.00  0.94           C  
ATOM  12433  O   GLU B 699      74.971 -35.953  28.477  1.00  0.94           O  
ATOM  12434  CB  GLU B 699      75.639 -33.388  26.539  1.00  0.94           C  
ATOM  12435  CG  GLU B 699      76.842 -32.838  25.739  1.00  0.94           C  
ATOM  12436  CD  GLU B 699      76.910 -31.325  25.732  1.00  0.94           C  
ATOM  12437  OE1 GLU B 699      77.360 -30.752  26.764  1.00  0.94           O  
ATOM  12438  OE2 GLU B 699      76.551 -30.713  24.697  1.00  0.94           O  
ATOM  12439  N   MET B 700      73.269 -35.583  27.083  1.00  0.95           N  
ATOM  12440  CA  MET B 700      72.287 -36.247  27.922  1.00  0.95           C  
ATOM  12441  C   MET B 700      72.549 -37.741  28.075  1.00  0.95           C  
ATOM  12442  O   MET B 700      72.486 -38.285  29.176  1.00  0.95           O  
ATOM  12443  CB  MET B 700      70.870 -36.018  27.362  1.00  0.95           C  
ATOM  12444  CG  MET B 700      70.416 -34.547  27.361  1.00  0.95           C  
ATOM  12445  SD  MET B 700      69.004 -34.235  26.271  1.00  0.95           S  
ATOM  12446  CE  MET B 700      67.784 -35.317  27.064  1.00  0.95           C  
ATOM  12447  N   ALA B 701      72.912 -38.427  26.973  1.00  0.95           N  
ATOM  12448  CA  ALA B 701      73.349 -39.804  26.998  1.00  0.95           C  
ATOM  12449  C   ALA B 701      74.629 -40.014  27.806  1.00  0.95           C  
ATOM  12450  O   ALA B 701      74.726 -40.946  28.595  1.00  0.95           O  
ATOM  12451  CB  ALA B 701      73.506 -40.308  25.550  1.00  0.95           C  
ATOM  12452  N   GLU B 702      75.625 -39.113  27.678  1.00  0.92           N  
ATOM  12453  CA  GLU B 702      76.844 -39.124  28.472  1.00  0.92           C  
ATOM  12454  C   GLU B 702      76.606 -38.963  29.968  1.00  0.92           C  
ATOM  12455  O   GLU B 702      77.130 -39.734  30.770  1.00  0.92           O  
ATOM  12456  CB  GLU B 702      77.767 -37.995  27.947  1.00  0.92           C  
ATOM  12457  CG  GLU B 702      79.088 -37.755  28.720  1.00  0.92           C  
ATOM  12458  CD  GLU B 702      79.942 -36.740  27.989  1.00  0.92           C  
ATOM  12459  OE1 GLU B 702      80.429 -37.061  26.876  1.00  0.92           O  
ATOM  12460  OE2 GLU B 702      80.080 -35.571  28.441  1.00  0.92           O  
ATOM  12461  N   GLU B 703      75.756 -37.999  30.386  1.00  0.93           N  
ATOM  12462  CA  GLU B 703      75.415 -37.806  31.785  1.00  0.93           C  
ATOM  12463  C   GLU B 703      74.663 -38.977  32.407  1.00  0.93           C  
ATOM  12464  O   GLU B 703      74.971 -39.414  33.517  1.00  0.93           O  
ATOM  12465  CB  GLU B 703      74.557 -36.530  31.977  1.00  0.93           C  
ATOM  12466  CG  GLU B 703      75.287 -35.192  31.695  1.00  0.93           C  
ATOM  12467  CD  GLU B 703      76.422 -34.855  32.657  1.00  0.93           C  
ATOM  12468  OE1 GLU B 703      76.408 -35.297  33.839  1.00  0.93           O  
ATOM  12469  OE2 GLU B 703      77.314 -34.087  32.205  1.00  0.93           O  
ATOM  12470  N   ALA B 704      73.646 -39.531  31.710  1.00  0.95           N  
ATOM  12471  CA  ALA B 704      72.829 -40.596  32.254  1.00  0.95           C  
ATOM  12472  C   ALA B 704      73.400 -41.988  32.074  1.00  0.95           C  
ATOM  12473  O   ALA B 704      72.982 -42.927  32.746  1.00  0.95           O  
ATOM  12474  CB  ALA B 704      71.440 -40.557  31.587  1.00  0.95           C  
ATOM  12475  N   GLY B 705      74.380 -42.143  31.171  1.00  0.93           N  
ATOM  12476  CA  GLY B 705      74.885 -43.433  30.734  1.00  0.93           C  
ATOM  12477  C   GLY B 705      74.122 -43.907  29.523  1.00  0.93           C  
ATOM  12478  O   GLY B 705      72.902 -43.771  29.431  1.00  0.93           O  
ATOM  12479  N   GLU B 706      74.830 -44.500  28.541  1.00  0.89           N  
ATOM  12480  CA  GLU B 706      74.264 -44.898  27.264  1.00  0.89           C  
ATOM  12481  C   GLU B 706      73.389 -46.145  27.386  1.00  0.89           C  
ATOM  12482  O   GLU B 706      72.482 -46.381  26.588  1.00  0.89           O  
ATOM  12483  CB  GLU B 706      75.379 -45.058  26.188  1.00  0.89           C  
ATOM  12484  CG  GLU B 706      74.983 -44.487  24.791  1.00  0.89           C  
ATOM  12485  CD  GLU B 706      76.111 -44.406  23.751  1.00  0.89           C  
ATOM  12486  OE1 GLU B 706      77.204 -43.895  24.099  1.00  0.89           O  
ATOM  12487  OE2 GLU B 706      75.866 -44.790  22.570  1.00  0.89           O  
ATOM  12488  N   GLU B 707      73.581 -46.945  28.460  1.00  0.89           N  
ATOM  12489  CA  GLU B 707      72.672 -48.007  28.873  1.00  0.89           C  
ATOM  12490  C   GLU B 707      71.307 -47.485  29.274  1.00  0.89           C  
ATOM  12491  O   GLU B 707      70.289 -48.132  29.055  1.00  0.89           O  
ATOM  12492  CB  GLU B 707      73.212 -48.910  30.023  1.00  0.89           C  
ATOM  12493  CG  GLU B 707      74.704 -48.715  30.374  1.00  0.89           C  
ATOM  12494  CD  GLU B 707      74.940 -47.406  31.123  1.00  0.89           C  
ATOM  12495  OE1 GLU B 707      74.425 -47.239  32.257  1.00  0.89           O  
ATOM  12496  OE2 GLU B 707      75.600 -46.531  30.506  1.00  0.89           O  
ATOM  12497  N   ASN B 708      71.264 -46.270  29.851  1.00  0.92           N  
ATOM  12498  CA  ASN B 708      70.058 -45.659  30.349  1.00  0.92           C  
ATOM  12499  C   ASN B 708      69.390 -44.794  29.288  1.00  0.92           C  
ATOM  12500  O   ASN B 708      68.527 -43.982  29.595  1.00  0.92           O  
ATOM  12501  CB  ASN B 708      70.348 -44.829  31.623  1.00  0.92           C  
ATOM  12502  CG  ASN B 708      70.931 -45.796  32.648  1.00  0.92           C  
ATOM  12503  OD1 ASN B 708      70.257 -46.736  33.071  1.00  0.92           O  
ATOM  12504  ND2 ASN B 708      72.206 -45.588  33.042  1.00  0.92           N  
ATOM  12505  N   PHE B 709      69.735 -45.008  27.997  1.00  0.94           N  
ATOM  12506  CA  PHE B 709      69.210 -44.266  26.873  1.00  0.94           C  
ATOM  12507  C   PHE B 709      68.846 -45.213  25.739  1.00  0.94           C  
ATOM  12508  O   PHE B 709      69.344 -46.330  25.624  1.00  0.94           O  
ATOM  12509  CB  PHE B 709      70.299 -43.282  26.355  1.00  0.94           C  
ATOM  12510  CG  PHE B 709      69.877 -41.846  26.476  1.00  0.94           C  
ATOM  12511  CD1 PHE B 709      69.706 -41.262  27.738  1.00  0.94           C  
ATOM  12512  CD2 PHE B 709      69.689 -41.051  25.335  1.00  0.94           C  
ATOM  12513  CE1 PHE B 709      69.349 -39.917  27.867  1.00  0.94           C  
ATOM  12514  CE2 PHE B 709      69.341 -39.701  25.450  1.00  0.94           C  
ATOM  12515  CZ  PHE B 709      69.161 -39.141  26.719  1.00  0.94           C  
ATOM  12516  N   PHE B 710      67.957 -44.762  24.833  1.00  0.95           N  
ATOM  12517  CA  PHE B 710      67.600 -45.505  23.639  1.00  0.95           C  
ATOM  12518  C   PHE B 710      68.192 -44.812  22.422  1.00  0.95           C  
ATOM  12519  O   PHE B 710      67.503 -44.306  21.540  1.00  0.95           O  
ATOM  12520  CB  PHE B 710      66.067 -45.669  23.510  1.00  0.95           C  
ATOM  12521  CG  PHE B 710      65.525 -46.551  24.592  1.00  0.95           C  
ATOM  12522  CD1 PHE B 710      65.724 -47.941  24.542  1.00  0.95           C  
ATOM  12523  CD2 PHE B 710      64.755 -46.007  25.632  1.00  0.95           C  
ATOM  12524  CE1 PHE B 710      65.166 -48.775  25.518  1.00  0.95           C  
ATOM  12525  CE2 PHE B 710      64.189 -46.840  26.603  1.00  0.95           C  
ATOM  12526  CZ  PHE B 710      64.400 -48.223  26.549  1.00  0.95           C  
ATOM  12527  N   ILE B 711      69.537 -44.767  22.367  1.00  0.95           N  
ATOM  12528  CA  ILE B 711      70.281 -44.309  21.205  1.00  0.95           C  
ATOM  12529  C   ILE B 711      70.120 -45.235  20.003  1.00  0.95           C  
ATOM  12530  O   ILE B 711      70.191 -46.455  20.128  1.00  0.95           O  
ATOM  12531  CB  ILE B 711      71.760 -44.090  21.525  1.00  0.95           C  
ATOM  12532  CG1 ILE B 711      71.963 -42.972  22.578  1.00  0.95           C  
ATOM  12533  CG2 ILE B 711      72.581 -43.767  20.258  1.00  0.95           C  
ATOM  12534  CD1 ILE B 711      71.486 -41.582  22.132  1.00  0.95           C  
ATOM  12535  N   PHE B 712      69.936 -44.649  18.803  1.00  0.95           N  
ATOM  12536  CA  PHE B 712      69.851 -45.381  17.556  1.00  0.95           C  
ATOM  12537  C   PHE B 712      70.442 -44.549  16.430  1.00  0.95           C  
ATOM  12538  O   PHE B 712      70.802 -43.385  16.605  1.00  0.95           O  
ATOM  12539  CB  PHE B 712      68.395 -45.823  17.206  1.00  0.95           C  
ATOM  12540  CG  PHE B 712      67.502 -44.693  16.759  1.00  0.95           C  
ATOM  12541  CD1 PHE B 712      66.912 -43.833  17.692  1.00  0.95           C  
ATOM  12542  CD2 PHE B 712      67.305 -44.450  15.388  1.00  0.95           C  
ATOM  12543  CE1 PHE B 712      66.152 -42.738  17.266  1.00  0.95           C  
ATOM  12544  CE2 PHE B 712      66.552 -43.352  14.961  1.00  0.95           C  
ATOM  12545  CZ  PHE B 712      65.976 -42.494  15.900  1.00  0.95           C  
ATOM  12546  N   GLY B 713      70.525 -45.165  15.238  1.00  0.98           N  
ATOM  12547  CA  GLY B 713      70.765 -44.494  13.973  1.00  0.98           C  
ATOM  12548  C   GLY B 713      72.160 -44.032  13.692  1.00  0.98           C  
ATOM  12549  O   GLY B 713      73.112 -44.215  14.454  1.00  0.98           O  
ATOM  12550  N   MET B 714      72.295 -43.406  12.518  1.00  0.93           N  
ATOM  12551  CA  MET B 714      73.522 -42.855  11.992  1.00  0.93           C  
ATOM  12552  C   MET B 714      74.186 -41.839  12.909  1.00  0.93           C  
ATOM  12553  O   MET B 714      73.538 -41.024  13.565  1.00  0.93           O  
ATOM  12554  CB  MET B 714      73.245 -42.145  10.645  1.00  0.93           C  
ATOM  12555  CG  MET B 714      72.739 -43.066   9.521  1.00  0.93           C  
ATOM  12556  SD  MET B 714      72.412 -42.163   7.975  1.00  0.93           S  
ATOM  12557  CE  MET B 714      74.096 -42.387   7.364  1.00  0.93           C  
ATOM  12558  N   ARG B 715      75.529 -41.863  12.977  1.00  0.87           N  
ATOM  12559  CA  ARG B 715      76.297 -40.822  13.623  1.00  0.87           C  
ATOM  12560  C   ARG B 715      76.609 -39.747  12.588  1.00  0.87           C  
ATOM  12561  O   ARG B 715      76.306 -39.893  11.403  1.00  0.87           O  
ATOM  12562  CB  ARG B 715      77.579 -41.403  14.270  1.00  0.87           C  
ATOM  12563  CG  ARG B 715      77.348 -42.532  15.308  1.00  0.87           C  
ATOM  12564  CD  ARG B 715      76.598 -42.077  16.563  1.00  0.87           C  
ATOM  12565  NE  ARG B 715      76.542 -43.198  17.567  1.00  0.87           N  
ATOM  12566  CZ  ARG B 715      75.499 -44.023  17.739  1.00  0.87           C  
ATOM  12567  NH1 ARG B 715      74.467 -44.040  16.903  1.00  0.87           N  
ATOM  12568  NH2 ARG B 715      75.481 -44.843  18.791  1.00  0.87           N  
ATOM  12569  N   VAL B 716      77.207 -38.608  12.996  1.00  0.88           N  
ATOM  12570  CA  VAL B 716      77.508 -37.482  12.109  1.00  0.88           C  
ATOM  12571  C   VAL B 716      78.447 -37.919  10.992  1.00  0.88           C  
ATOM  12572  O   VAL B 716      78.277 -37.599   9.814  1.00  0.88           O  
ATOM  12573  CB  VAL B 716      78.123 -36.320  12.894  1.00  0.88           C  
ATOM  12574  CG1 VAL B 716      78.627 -35.191  11.965  1.00  0.88           C  
ATOM  12575  CG2 VAL B 716      77.069 -35.755  13.864  1.00  0.88           C  
ATOM  12576  N   GLU B 717      79.430 -38.757  11.358  1.00  0.80           N  
ATOM  12577  CA  GLU B 717      80.403 -39.383  10.503  1.00  0.80           C  
ATOM  12578  C   GLU B 717      79.779 -40.232   9.413  1.00  0.80           C  
ATOM  12579  O   GLU B 717      80.236 -40.251   8.270  1.00  0.80           O  
ATOM  12580  CB  GLU B 717      81.333 -40.305  11.342  1.00  0.80           C  
ATOM  12581  CG  GLU B 717      81.851 -39.692  12.674  1.00  0.80           C  
ATOM  12582  CD  GLU B 717      80.901 -39.859  13.868  1.00  0.80           C  
ATOM  12583  OE1 GLU B 717      79.937 -39.056  13.977  1.00  0.80           O  
ATOM  12584  OE2 GLU B 717      81.124 -40.788  14.678  1.00  0.80           O  
ATOM  12585  N   ASP B 718      78.724 -40.990   9.752  1.00  0.88           N  
ATOM  12586  CA  ASP B 718      78.003 -41.827   8.820  1.00  0.88           C  
ATOM  12587  C   ASP B 718      77.215 -41.006   7.814  1.00  0.88           C  
ATOM  12588  O   ASP B 718      77.203 -41.307   6.619  1.00  0.88           O  
ATOM  12589  CB  ASP B 718      77.099 -42.831   9.564  1.00  0.88           C  
ATOM  12590  CG  ASP B 718      77.930 -43.569  10.595  1.00  0.88           C  
ATOM  12591  OD1 ASP B 718      79.065 -44.004  10.249  1.00  0.88           O  
ATOM  12592  OD2 ASP B 718      77.442 -43.644  11.751  1.00  0.88           O  
ATOM  12593  N   VAL B 719      76.562 -39.912   8.271  1.00  0.89           N  
ATOM  12594  CA  VAL B 719      75.804 -39.006   7.422  1.00  0.89           C  
ATOM  12595  C   VAL B 719      76.680 -38.387   6.344  1.00  0.89           C  
ATOM  12596  O   VAL B 719      76.333 -38.418   5.172  1.00  0.89           O  
ATOM  12597  CB  VAL B 719      75.113 -37.925   8.250  1.00  0.89           C  
ATOM  12598  CG1 VAL B 719      74.369 -36.911   7.358  1.00  0.89           C  
ATOM  12599  CG2 VAL B 719      74.088 -38.575   9.200  1.00  0.89           C  
ATOM  12600  N   ASP B 720      77.888 -37.912   6.725  1.00  0.82           N  
ATOM  12601  CA  ASP B 720      78.881 -37.377   5.817  1.00  0.82           C  
ATOM  12602  C   ASP B 720      79.385 -38.402   4.796  1.00  0.82           C  
ATOM  12603  O   ASP B 720      79.463 -38.117   3.602  1.00  0.82           O  
ATOM  12604  CB  ASP B 720      80.032 -36.802   6.674  1.00  0.82           C  
ATOM  12605  CG  ASP B 720      81.013 -36.005   5.835  1.00  0.82           C  
ATOM  12606  OD1 ASP B 720      80.659 -34.890   5.384  1.00  0.82           O  
ATOM  12607  OD2 ASP B 720      82.139 -36.527   5.627  1.00  0.82           O  
ATOM  12608  N   LYS B 721      79.661 -39.665   5.212  1.00  0.81           N  
ATOM  12609  CA  LYS B 721      80.053 -40.723   4.285  1.00  0.81           C  
ATOM  12610  C   LYS B 721      79.008 -40.960   3.205  1.00  0.81           C  
ATOM  12611  O   LYS B 721      79.314 -41.156   2.032  1.00  0.81           O  
ATOM  12612  CB  LYS B 721      80.267 -42.084   5.003  1.00  0.81           C  
ATOM  12613  CG  LYS B 721      81.532 -42.176   5.864  1.00  0.81           C  
ATOM  12614  CD  LYS B 721      81.630 -43.556   6.539  1.00  0.81           C  
ATOM  12615  CE  LYS B 721      82.794 -43.698   7.523  1.00  0.81           C  
ATOM  12616  NZ  LYS B 721      82.559 -42.845   8.710  1.00  0.81           N  
ATOM  12617  N   LEU B 722      77.727 -40.931   3.612  1.00  0.85           N  
ATOM  12618  CA  LEU B 722      76.597 -41.051   2.727  1.00  0.85           C  
ATOM  12619  C   LEU B 722      76.429 -39.849   1.809  1.00  0.85           C  
ATOM  12620  O   LEU B 722      76.188 -40.011   0.617  1.00  0.85           O  
ATOM  12621  CB  LEU B 722      75.341 -41.361   3.574  1.00  0.85           C  
ATOM  12622  CG  LEU B 722      74.281 -42.277   2.924  1.00  0.85           C  
ATOM  12623  CD1 LEU B 722      74.890 -43.613   2.461  1.00  0.85           C  
ATOM  12624  CD2 LEU B 722      73.154 -42.540   3.937  1.00  0.85           C  
ATOM  12625  N   ASP B 723      76.599 -38.613   2.316  1.00  0.82           N  
ATOM  12626  CA  ASP B 723      76.571 -37.408   1.509  1.00  0.82           C  
ATOM  12627  C   ASP B 723      77.694 -37.290   0.478  1.00  0.82           C  
ATOM  12628  O   ASP B 723      77.438 -36.913  -0.662  1.00  0.82           O  
ATOM  12629  CB  ASP B 723      76.489 -36.151   2.401  1.00  0.82           C  
ATOM  12630  CG  ASP B 723      75.077 -36.009   2.884  1.00  0.82           C  
ATOM  12631  OD1 ASP B 723      74.128 -35.950   2.053  1.00  0.82           O  
ATOM  12632  OD2 ASP B 723      74.842 -35.994   4.117  1.00  0.82           O  
ATOM  12633  N   GLN B 724      78.953 -37.652   0.808  1.00  0.78           N  
ATOM  12634  CA  GLN B 724      80.040 -37.675  -0.161  1.00  0.78           C  
ATOM  12635  C   GLN B 724      79.831 -38.654  -1.320  1.00  0.78           C  
ATOM  12636  O   GLN B 724      80.124 -38.346  -2.468  1.00  0.78           O  
ATOM  12637  CB  GLN B 724      81.394 -37.958   0.533  1.00  0.78           C  
ATOM  12638  CG  GLN B 724      81.863 -36.794   1.441  1.00  0.78           C  
ATOM  12639  CD  GLN B 724      83.291 -37.016   1.940  1.00  0.78           C  
ATOM  12640  OE1 GLN B 724      84.200 -37.319   1.163  1.00  0.78           O  
ATOM  12641  NE2 GLN B 724      83.522 -36.847   3.259  1.00  0.78           N  
ATOM  12642  N   ARG B 725      79.300 -39.867  -1.046  1.00  0.73           N  
ATOM  12643  CA  ARG B 725      78.931 -40.816  -2.089  1.00  0.73           C  
ATOM  12644  C   ARG B 725      77.681 -40.417  -2.858  1.00  0.73           C  
ATOM  12645  O   ARG B 725      77.527 -40.718  -4.040  1.00  0.73           O  
ATOM  12646  CB  ARG B 725      78.697 -42.222  -1.480  1.00  0.73           C  
ATOM  12647  CG  ARG B 725      78.154 -43.275  -2.471  1.00  0.73           C  
ATOM  12648  CD  ARG B 725      77.949 -44.638  -1.825  1.00  0.73           C  
ATOM  12649  NE  ARG B 725      77.237 -45.512  -2.816  1.00  0.73           N  
ATOM  12650  CZ  ARG B 725      75.911 -45.659  -2.878  1.00  0.73           C  
ATOM  12651  NH1 ARG B 725      75.054 -44.901  -2.202  1.00  0.73           N  
ATOM  12652  NH2 ARG B 725      75.404 -46.630  -3.627  1.00  0.73           N  
ATOM  12653  N   GLY B 726      76.733 -39.760  -2.170  1.00  0.86           N  
ATOM  12654  CA  GLY B 726      75.394 -39.517  -2.667  1.00  0.86           C  
ATOM  12655  C   GLY B 726      74.407 -40.431  -1.991  1.00  0.86           C  
ATOM  12656  O   GLY B 726      74.518 -41.659  -2.016  1.00  0.86           O  
ATOM  12657  N   TYR B 727      73.380 -39.827  -1.363  1.00  0.87           N  
ATOM  12658  CA  TYR B 727      72.279 -40.538  -0.745  1.00  0.87           C  
ATOM  12659  C   TYR B 727      71.281 -41.021  -1.785  1.00  0.87           C  
ATOM  12660  O   TYR B 727      70.761 -40.247  -2.580  1.00  0.87           O  
ATOM  12661  CB  TYR B 727      71.544 -39.623   0.281  1.00  0.87           C  
ATOM  12662  CG  TYR B 727      70.320 -40.258   0.920  1.00  0.87           C  
ATOM  12663  CD1 TYR B 727      70.416 -41.412   1.715  1.00  0.87           C  
ATOM  12664  CD2 TYR B 727      69.048 -39.703   0.703  1.00  0.87           C  
ATOM  12665  CE1 TYR B 727      69.273 -41.981   2.301  1.00  0.87           C  
ATOM  12666  CE2 TYR B 727      67.908 -40.263   1.293  1.00  0.87           C  
ATOM  12667  CZ  TYR B 727      68.020 -41.397   2.099  1.00  0.87           C  
ATOM  12668  OH  TYR B 727      66.871 -41.923   2.727  1.00  0.87           O  
ATOM  12669  N   ASN B 728      70.960 -42.327  -1.762  1.00  0.88           N  
ATOM  12670  CA  ASN B 728      69.920 -42.869  -2.594  1.00  0.88           C  
ATOM  12671  C   ASN B 728      68.955 -43.636  -1.709  1.00  0.88           C  
ATOM  12672  O   ASN B 728      69.275 -44.673  -1.127  1.00  0.88           O  
ATOM  12673  CB  ASN B 728      70.592 -43.754  -3.659  1.00  0.88           C  
ATOM  12674  CG  ASN B 728      69.620 -44.305  -4.684  1.00  0.88           C  
ATOM  12675  OD1 ASN B 728      68.422 -44.032  -4.673  1.00  0.88           O  
ATOM  12676  ND2 ASN B 728      70.175 -45.136  -5.596  1.00  0.88           N  
ATOM  12677  N   ALA B 729      67.716 -43.134  -1.581  1.00  0.93           N  
ATOM  12678  CA  ALA B 729      66.727 -43.714  -0.706  1.00  0.93           C  
ATOM  12679  C   ALA B 729      66.217 -45.052  -1.222  1.00  0.93           C  
ATOM  12680  O   ALA B 729      65.836 -45.941  -0.457  1.00  0.93           O  
ATOM  12681  CB  ALA B 729      65.575 -42.722  -0.522  1.00  0.93           C  
ATOM  12682  N   GLN B 730      66.285 -45.245  -2.552  1.00  0.86           N  
ATOM  12683  CA  GLN B 730      65.873 -46.437  -3.255  1.00  0.86           C  
ATOM  12684  C   GLN B 730      66.608 -47.692  -2.792  1.00  0.86           C  
ATOM  12685  O   GLN B 730      66.028 -48.762  -2.681  1.00  0.86           O  
ATOM  12686  CB  GLN B 730      66.064 -46.209  -4.770  1.00  0.86           C  
ATOM  12687  CG  GLN B 730      65.359 -47.236  -5.685  1.00  0.86           C  
ATOM  12688  CD  GLN B 730      63.835 -47.097  -5.631  1.00  0.86           C  
ATOM  12689  OE1 GLN B 730      63.276 -46.018  -5.788  1.00  0.86           O  
ATOM  12690  NE2 GLN B 730      63.126 -48.228  -5.410  1.00  0.86           N  
ATOM  12691  N   GLU B 731      67.905 -47.569  -2.431  1.00  0.85           N  
ATOM  12692  CA  GLU B 731      68.736 -48.667  -1.965  1.00  0.85           C  
ATOM  12693  C   GLU B 731      68.177 -49.357  -0.718  1.00  0.85           C  
ATOM  12694  O   GLU B 731      68.118 -50.582  -0.630  1.00  0.85           O  
ATOM  12695  CB  GLU B 731      70.186 -48.148  -1.728  1.00  0.85           C  
ATOM  12696  CG  GLU B 731      70.752 -47.454  -2.997  1.00  0.85           C  
ATOM  12697  CD  GLU B 731      72.142 -46.813  -2.931  1.00  0.85           C  
ATOM  12698  OE1 GLU B 731      72.552 -46.167  -1.933  1.00  0.85           O  
ATOM  12699  OE2 GLU B 731      72.809 -46.850  -4.000  1.00  0.85           O  
ATOM  12700  N   TYR B 732      67.691 -48.567   0.262  1.00  0.89           N  
ATOM  12701  CA  TYR B 732      66.963 -49.039   1.428  1.00  0.89           C  
ATOM  12702  C   TYR B 732      65.584 -49.582   1.076  1.00  0.89           C  
ATOM  12703  O   TYR B 732      65.165 -50.635   1.551  1.00  0.89           O  
ATOM  12704  CB  TYR B 732      66.786 -47.902   2.472  1.00  0.89           C  
ATOM  12705  CG  TYR B 732      68.098 -47.225   2.739  1.00  0.89           C  
ATOM  12706  CD1 TYR B 732      69.007 -47.758   3.665  1.00  0.89           C  
ATOM  12707  CD2 TYR B 732      68.465 -46.087   2.004  1.00  0.89           C  
ATOM  12708  CE1 TYR B 732      70.282 -47.191   3.814  1.00  0.89           C  
ATOM  12709  CE2 TYR B 732      69.738 -45.526   2.144  1.00  0.89           C  
ATOM  12710  CZ  TYR B 732      70.649 -46.089   3.039  1.00  0.89           C  
ATOM  12711  OH  TYR B 732      71.948 -45.564   3.107  1.00  0.89           O  
ATOM  12712  N   TYR B 733      64.840 -48.890   0.184  1.00  0.88           N  
ATOM  12713  CA  TYR B 733      63.498 -49.266  -0.243  1.00  0.88           C  
ATOM  12714  C   TYR B 733      63.477 -50.656  -0.860  1.00  0.88           C  
ATOM  12715  O   TYR B 733      62.662 -51.514  -0.517  1.00  0.88           O  
ATOM  12716  CB  TYR B 733      62.990 -48.223  -1.279  1.00  0.88           C  
ATOM  12717  CG  TYR B 733      61.528 -48.368  -1.612  1.00  0.88           C  
ATOM  12718  CD1 TYR B 733      60.572 -47.788  -0.774  1.00  0.88           C  
ATOM  12719  CD2 TYR B 733      61.097 -49.037  -2.772  1.00  0.88           C  
ATOM  12720  CE1 TYR B 733      59.211 -47.875  -1.087  1.00  0.88           C  
ATOM  12721  CE2 TYR B 733      59.727 -49.131  -3.079  1.00  0.88           C  
ATOM  12722  CZ  TYR B 733      58.775 -48.572  -2.220  1.00  0.88           C  
ATOM  12723  OH  TYR B 733      57.387 -48.670  -2.478  1.00  0.88           O  
ATOM  12724  N   ASP B 734      64.457 -50.950  -1.723  1.00  0.88           N  
ATOM  12725  CA  ASP B 734      64.580 -52.205  -2.421  1.00  0.88           C  
ATOM  12726  C   ASP B 734      64.995 -53.357  -1.515  1.00  0.88           C  
ATOM  12727  O   ASP B 734      64.925 -54.526  -1.900  1.00  0.88           O  
ATOM  12728  CB  ASP B 734      65.618 -52.061  -3.548  1.00  0.88           C  
ATOM  12729  CG  ASP B 734      65.135 -51.127  -4.645  1.00  0.88           C  
ATOM  12730  OD1 ASP B 734      63.950 -50.708  -4.622  1.00  0.88           O  
ATOM  12731  OD2 ASP B 734      65.961 -50.858  -5.550  1.00  0.88           O  
ATOM  12732  N   ARG B 735      65.447 -53.080  -0.276  1.00  0.83           N  
ATOM  12733  CA  ARG B 735      65.841 -54.119   0.651  1.00  0.83           C  
ATOM  12734  C   ARG B 735      64.972 -54.263   1.885  1.00  0.83           C  
ATOM  12735  O   ARG B 735      65.082 -55.274   2.567  1.00  0.83           O  
ATOM  12736  CB  ARG B 735      67.317 -53.919   1.061  1.00  0.83           C  
ATOM  12737  CG  ARG B 735      68.292 -54.111  -0.120  1.00  0.83           C  
ATOM  12738  CD  ARG B 735      68.275 -55.532  -0.700  1.00  0.83           C  
ATOM  12739  NE  ARG B 735      69.129 -55.537  -1.927  1.00  0.83           N  
ATOM  12740  CZ  ARG B 735      68.673 -55.238  -3.152  1.00  0.83           C  
ATOM  12741  NH1 ARG B 735      67.395 -54.966  -3.391  1.00  0.83           N  
ATOM  12742  NH2 ARG B 735      69.528 -55.220  -4.172  1.00  0.83           N  
ATOM  12743  N   ILE B 736      64.033 -53.337   2.176  1.00  0.91           N  
ATOM  12744  CA  ILE B 736      63.223 -53.450   3.388  1.00  0.91           C  
ATOM  12745  C   ILE B 736      61.743 -53.675   3.044  1.00  0.91           C  
ATOM  12746  O   ILE B 736      61.048 -52.720   2.684  1.00  0.91           O  
ATOM  12747  CB  ILE B 736      63.344 -52.197   4.251  1.00  0.91           C  
ATOM  12748  CG1 ILE B 736      64.822 -51.837   4.541  1.00  0.91           C  
ATOM  12749  CG2 ILE B 736      62.601 -52.410   5.591  1.00  0.91           C  
ATOM  12750  CD1 ILE B 736      65.015 -50.388   5.005  1.00  0.91           C  
ATOM  12751  N   PRO B 737      61.165 -54.882   3.158  1.00  0.92           N  
ATOM  12752  CA  PRO B 737      59.782 -55.121   2.742  1.00  0.92           C  
ATOM  12753  C   PRO B 737      58.746 -54.397   3.568  1.00  0.92           C  
ATOM  12754  O   PRO B 737      57.752 -53.941   3.008  1.00  0.92           O  
ATOM  12755  CB  PRO B 737      59.608 -56.645   2.840  1.00  0.92           C  
ATOM  12756  CG  PRO B 737      61.012 -57.181   2.567  1.00  0.92           C  
ATOM  12757  CD  PRO B 737      61.919 -56.137   3.225  1.00  0.92           C  
ATOM  12758  N   GLU B 738      58.951 -54.269   4.896  1.00  0.88           N  
ATOM  12759  CA  GLU B 738      58.051 -53.521   5.754  1.00  0.88           C  
ATOM  12760  C   GLU B 738      57.980 -52.047   5.388  1.00  0.88           C  
ATOM  12761  O   GLU B 738      56.909 -51.450   5.370  1.00  0.88           O  
ATOM  12762  CB  GLU B 738      58.415 -53.674   7.250  1.00  0.88           C  
ATOM  12763  CG  GLU B 738      58.208 -55.103   7.801  1.00  0.88           C  
ATOM  12764  CD  GLU B 738      57.875 -55.132   9.289  1.00  0.88           C  
ATOM  12765  OE1 GLU B 738      58.516 -54.428  10.112  1.00  0.88           O  
ATOM  12766  OE2 GLU B 738      56.931 -55.884   9.639  1.00  0.88           O  
ATOM  12767  N   LEU B 739      59.123 -51.426   5.031  1.00  0.92           N  
ATOM  12768  CA  LEU B 739      59.159 -50.050   4.574  1.00  0.92           C  
ATOM  12769  C   LEU B 739      58.390 -49.836   3.285  1.00  0.92           C  
ATOM  12770  O   LEU B 739      57.611 -48.894   3.176  1.00  0.92           O  
ATOM  12771  CB  LEU B 739      60.617 -49.575   4.396  1.00  0.92           C  
ATOM  12772  CG  LEU B 739      60.805 -48.124   3.909  1.00  0.92           C  
ATOM  12773  CD1 LEU B 739      60.141 -47.105   4.845  1.00  0.92           C  
ATOM  1