CNRS Nantes University UFIP UFIP
home |  start a new run |  job status |  references&downloads |  examples |  help  

Should you encounter any unexpected behaviour,
please let us know.


***  model_01_2ATI  ***

elNémo ID: 211208141234120949

Job options:

ID        	=	 211208141234120949
JOBID     	=	 model_01_2ATI
USERID    	=	 unknown
PRIVAT    	=	 0

NMODES    	=	 5
DQMIN     	=	 -100
DQMAX     	=	 100
DQSTEP    	=	 20
DOGRAPHS  	=	 on

DOPROJMODS	=	 0
DORMSD    	=	 0

NRBL      	=	 0
CUTOFF    	=	 0
CAONLY    	=	 0


Input data for this run:

HEADER model_01_2ATI

TITLE     SWISS-MODEL SERVER (https://swissmodel.expasy.org)
TITLE    2 Untitled Project
EXPDTA    THEORETICAL MODEL (SWISS-MODEL SERVER)
AUTHOR    SWISS-MODEL SERVER (SEE REFERENCE IN JRNL Records)
REVDAT   1   08-DEC-21 1MOD    1       12:10
JRNL        AUTH   A.WATERHOUSE,M.BERTONI,S.BIENERT,G.STUDER,G.TAURIELLO,
JRNL        AUTH 2 R.GUMIENNY,F.T.HEER,T.A.P.DE BEER,C.REMPFER,L.BORDOLI,
JRNL        AUTH 3 R.LEPORE,T.SCHWEDE
JRNL        TITL   SWISS-MODEL: HOMOLOGY MODELLING OF PROTEIN STRUCTURES AND
JRNL        TITL 2 COMPLEXES
JRNL        REF    NUCLEIC.ACIDS.RES..           V.  46 W296  2018
JRNL        PMID   29788355
JRNL        DOI    10.1093/nar/gky427
REMARK   1
REMARK   1 REFERENCE 1
REMARK   1  AUTH   S.BIENERT,A.WATERHOUSE,T.A.P.DE BEER,G.TAURIELLO,G.STUDER,
REMARK   1  AUTH 2 L.BORDOLI,T.SCHWEDE
REMARK   1  TITL   THE SWISS-MODEL REPOSITORY - NEW FEATURES AND FUNCTIONALITY
REMARK   1  REF    NUCLEIC.ACIDS.RES..           V.  45       2017
REMARK   1  REFN                   ISSN 0305-1048
REMARK   1  PMID   27899672
REMARK   1  DOI    10.1093/nar/gkw1132
REMARK   1
REMARK   1 REFERENCE 2
REMARK   1  AUTH   N.GUEX,M.C.PEITSCH,T.SCHWEDE
REMARK   1  TITL   AUTOMATED COMPARATIVE PROTEIN STRUCTURE MODELING WITH
REMARK   1  TITL 2 SWISS-MODEL AND SWISS-PDBVIEWER: A HISTORICAL PERSPECTIVE
REMARK   1  REF    ELECTROPHORESIS               V.  30       2009
REMARK   1  REFN                   ISSN 0173-0835
REMARK   1  PMID   19517507
REMARK   1  DOI    10.1002/elps.200900140
REMARK   1
REMARK   1 REFERENCE 3
REMARK   1  AUTH   G.STUDER,G.TAURIELLO,S.BIENERT,M.BIASINI,N.JOHNER,T.SCHWEDE
REMARK   1  TITL   PROMOD3 - A VERSATILE HOMOLOGY MODELLING TOOLBOX
REMARK   1  REF    PLOS COMP. BIOL.              V.  17       2021
REMARK   1  REFN                   ISSN 
REMARK   1  PMID   33507980
REMARK   1  DOI    https://doi.org/10.1371/journal.pcbi.1008667
REMARK   1
REMARK   1 REFERENCE 4
REMARK   1  AUTH   G.STUDER,C.REMPFER,A.WATERHOUSE,R.GUMIENNY,J.HAAS,T.SCHWEDE
REMARK   1  TITL   QMEANDISCO - DISTANCE CONSTRAINTS APPLIED ON MODEL QUALITY 
REMARK   1  TITL 2 ESTIMATION
REMARK   1  REF    BIOINFORMATICS                V.  36       2020
REMARK   1  REFN                   ISSN 
REMARK   1  PMID   31697312
REMARK   1  DOI    https://doi.org/10.1093/bioinformatics/btz828
REMARK   1
REMARK   1 REFERENCE 5
REMARK   1  AUTH   P.BENKERT,M.BIASINI,T.SCHWEDE
REMARK   1  TITL   TOWARD THE ESTIMATION OF THE ABSOLUTE QUALITY OF INDIVIDUAL
REMARK   1  TITL 2 PROTEIN STRUCTURE MODELS
REMARK   1  REF    BIOINFORMATICS                V.  27       2011
REMARK   1  REFN                   ISSN 1367-4803
REMARK   1  PMID   21134891
REMARK   1  DOI    10.1093/bioinformatics/btq662
REMARK   1
REMARK   1 REFERENCE 6
REMARK   1  AUTH   M.BERTONI,F.KIEFER,M.BIASINI,L.BORDOLI,T.SCHWEDE
REMARK   1  TITL   MODELING PROTEIN QUATERNARY STRUCTURE OF HOMO- AND
REMARK   1  TITL 2 HETERO-OLIGOMERS BEYOND BINARY INTERACTIONS BY HOMOLOGY
REMARK   1  REF    SCI.REP.                      V.   7       2017
REMARK   1  REFN                   ISSN
REMARK   1  PMID   28874689
REMARK   1  DOI    10.1038/s41598-017-09654-8
REMARK   1
REMARK   1 DISCLAIMER
REMARK   1 The SWISS-MODEL SERVER produces theoretical models for proteins.
REMARK   1 The results of any theoretical modelling procedure is
REMARK   1 NON-EXPERIMENTAL and MUST be considered with care. These models may
REMARK   1 contain significant errors. This is especially true for automated
REMARK   1 modeling since there is no human intervention during model
REMARK   1 building. Please read the header section and the logfile carefully
REMARK   1 to know what templates and alignments were used during the model
REMARK   1 building process. All information by the SWISS-MODEL SERVER is
REMARK   1 provided "AS-IS", without any warranty, expressed or implied.
REMARK   2
REMARK   2 COPYRIGHT NOTICE
REMARK   2 This SWISS-MODEL protein model is copyright. It is produced by the
REMARK   2 SWISS-MODEL server, developed by the Computational Structural
REMARK   2 Biology Group at the SIB Swiss Institute of Bioinformatics at the
REMARK   2 Biozentrum, University of Basel (https://swissmodel.expasy.org). This
REMARK   2 model is licensed under the CC BY-SA 4.0 Creative Commons
REMARK   2 Attribution-ShareAlike 4.0 International License
REMARK   2 (https://creativecommons.org/licenses/by-sa/4.0/legalcode), i.e. you
REMARK   2 can copy and redistribute the model in any medium or format,
REMARK   2 transform and build upon the model for any purpose, even
REMARK   2 commercially, under the following terms:
REMARK   2 Attribution - You must give appropriate credit, provide a link to
REMARK   2 the license, and indicate if changes were made. You may do so in any
REMARK   2 reasonable manner, but not in any way that suggests the licensor
REMARK   2 endorses you or your use. When you publish, patent or distribute
REMARK   2 results that were fully or partially based on the model, please cite
REMARK   2 the corresponding papers mentioned under JRNL.
REMARK   2 ShareAlike - If you remix, transform, or build upon the material,
REMARK   2 you must distribute your contributions under the same license as the
REMARK   2 original.
REMARK   2 No additional restrictions - you may not apply legal terms or
REMARK   2 technological measures that legally restrict others from doing
REMARK   2 anything the license permits.
REMARK   2 Find a human-readable summary of (and not a substitute for) the
REMARK   2 CC BY-SA 4.0 license at this link:
REMARK   2 https://creativecommons.org/licenses/by-sa/4.0/
REMARK   3 
REMARK   3 MODEL INFORMATION
REMARK   3  ENGIN   PROMOD3
REMARK   3  VERSN   3.2.1
REMARK   3  OSTAT   homo-dimer
REMARK   3  OSRSN   PREDICTION
REMARK   3  QSPRD   0.891
REMARK   3  GMQE    0.89
REMARK   3  QMNV    4.3.0
REMARK   3  QMNDG   0.87
REMARK   3  MODT    FALSE
REMARK   3 
REMARK   3 MODEL LIGAND 1
REMARK   3  NAME    GLC
REMARK   3  BIND    A.135
REMARK   3  BIND 2  A.136
REMARK   3  BIND 3  A.139
REMARK   3  BIND 4  A.284
REMARK   3  BIND 5  A.377
REMARK   3  BIND 6  A.455
REMARK   3  BIND 7  A.484
REMARK   3  BIND 8  A.573
REMARK   3  BIND 9  A.672
REMARK   3  BIND 10  A.673
REMARK   3  BIND 11  A.674
REMARK   3  BIND 12  A.675
REMARK   3  BIND 13  A.676
REMARK   3  BIND 14  _.1
REMARK   3 
REMARK   3 MODEL LIGAND 2
REMARK   3  NAME    GLC
REMARK   3  BIND    B.135
REMARK   3  BIND 2  B.136
REMARK   3  BIND 3  B.139
REMARK   3  BIND 4  B.284
REMARK   3  BIND 5  B.377
REMARK   3  BIND 6  B.455
REMARK   3  BIND 7  B.484
REMARK   3  BIND 8  B.573
REMARK   3  BIND 9  B.672
REMARK   3  BIND 10  B.673
REMARK   3  BIND 11  B.674
REMARK   3  BIND 12  B.675
REMARK   3  BIND 13  B.676
REMARK   3  BIND 14  _.4
REMARK   3 
REMARK   3 MODEL LIGAND 3
REMARK   3  NAME    IHU
REMARK   3  BIND    A.40
REMARK   3  BIND 2  A.41
REMARK   3  BIND 3  A.42
REMARK   3  BIND 4  A.44
REMARK   3  BIND 5  A.45
REMARK   3  BIND 6  B.67
REMARK   3  BIND 7  B.68
REMARK   3  BIND 8  B.71
REMARK   3  BIND 9  B.72
REMARK   3  BIND 10  B.191
REMARK   3  BIND 11  B.193
REMARK   3  BIND 12  B.227
REMARK   3  BIND 13  _.2
REMARK   3 
REMARK   3 MODEL LIGAND 4
REMARK   3  NAME    IHU
REMARK   3  BIND    A.67
REMARK   3  BIND 2  A.68
REMARK   3  BIND 3  A.71
REMARK   3  BIND 4  A.72
REMARK   3  BIND 5  A.191
REMARK   3  BIND 6  A.193
REMARK   3  BIND 7  A.227
REMARK   3  BIND 8  B.39
REMARK   3  BIND 9  B.40
REMARK   3  BIND 10  B.41
REMARK   3  BIND 11  B.42
REMARK   3  BIND 12  B.44
REMARK   3  BIND 13  B.45
REMARK   3  BIND 14  _.5
REMARK   3 
REMARK   3 MODEL LIGAND 5
REMARK   3  NAME    PLP
REMARK   3  BIND    A.90
REMARK   3  BIND 2  A.134
REMARK   3  BIND 3  A.135
REMARK   3  BIND 4  A.491
REMARK   3  BIND 5  A.567
REMARK   3  BIND 6  A.568
REMARK   3  BIND 7  A.574
REMARK   3  BIND 8  A.648
REMARK   3  BIND 9  A.649
REMARK   3  BIND 10  A.650
REMARK   3  BIND 11  A.653
REMARK   3  BIND 12  A.675
REMARK   3  BIND 13  A.676
REMARK   3  BIND 14  A.677
REMARK   3  BIND 15  A.680
REMARK   3  BIND 16  _.3
REMARK   3 
REMARK   3 MODEL LIGAND 6
REMARK   3  NAME    PLP
REMARK   3  BIND    B.90
REMARK   3  BIND 2  B.134
REMARK   3  BIND 3  B.135
REMARK   3  BIND 4  B.491
REMARK   3  BIND 5  B.568
REMARK   3  BIND 6  B.574
REMARK   3  BIND 7  B.648
REMARK   3  BIND 8  B.649
REMARK   3  BIND 9  B.650
REMARK   3  BIND 10  B.653
REMARK   3  BIND 11  B.672
REMARK   3  BIND 12  B.675
REMARK   3  BIND 13  B.676
REMARK   3  BIND 14  B.677
REMARK   3  BIND 15  B.680
REMARK   3  BIND 16  _.6
REMARK   3 
REMARK   3 TEMPLATE 1
REMARK   3  PDBID   2ati
REMARK   3  CHAIN   A
REMARK   3  MMCIF   A
REMARK   3  PDBV    2021-12-03
REMARK   3  SMTLE   2ati.1.A
REMARK   3  SMTLV   2021-12-08
REMARK   3  MTHD    X-RAY DIFFRACTION 1.90 A
REMARK   3  FOUND   HHblits
REMARK   3  GMQE    0.95
REMARK   3  SIM     0.62
REMARK   3  SID     100.00
REMARK   3  OSTAT   homo-dimer
REMARK   3  LIGND   GLC
REMARK   3  LIGND 2 GLC
REMARK   3  LIGND 3 IHU
REMARK   3  LIGND 4 IHU
REMARK   3  LIGND 5 PLP
REMARK   3  LIGND 6 PLP
REMARK   3  ALN A TRG AKPLTDQEKRRQISIRGIVGVENVAELKKSFNRHLHFTLVKDRNVATTRDYYFALAHT
REMARK   3  ALN A TRG VRDHLVGRWIRTQQHYYDKCPKRVYYLSLEFYMGRTLQNTMINLGLQNACDEAIYQLG
REMARK   3  ALN A TRG LDIEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEYGIFNQKIRDGW
REMARK   3  ALN A TRG QVEEADDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNTGTKWIDTQVVLALPYDTPVPG
REMARK   3  ALN A TRG YMNNTVNTMRLWSARAPNDFNLRDFNVGDYIQAVLDRNLAENISRVLYPNDNFFEGKE
REMARK   3  ALN A TRG LRLKQEYFVVAATLQDIIRRFKASKFGSTRGAGTVFDAFPDQVAIQLNDTHPALAIPE
REMARK   3  ALN A TRG LMRIFVDIEKLPWSKAWELTQKTFAYTNHTVLPEALERWPVDLVEKLLPRHLEIIYEI
REMARK   3  ALN A TRG NQKHLDRIVALFPKDVDRLRRMSLIEEEGSKRINMAHLCIVGSHAVNGVAKIHSDIVK
REMARK   3  ALN A TRG TKVFKDFSELEPDKFQNKTNGITPRRWLLLCNPGLAELIAEKIGEDYVKDLSQLTKLH
REMARK   3  ALN A TRG SFLGDDVFLRELAKVKQENKLKFSQFLETEYKVKINPSSMFDVQVKRIHEYKRQLLNC
REMARK   3  ALN A TRG LHVITMYNRIKKDPKKLFVPRTVIIGGKAAPGYHMAKMIIKLITSVADVVNNDPMVGS
REMARK   3  ALN A TRG KLKVIFLENYRVSLAEKVIPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGAN
REMARK   3  ALN A TRG VEMAEEAGEENLFIFGMRIDDVAALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPKQ
REMARK   3  ALN A TRG PDLFKDIINMLFYHDRFKVFADYEAYVKCQDKVSQLYMNPKAWNTMVLKNIAASGKFS
REMARK   3  ALN A TRG SDRTIKEYAQNIWNVEPSDLKISLSNESNKVNGN
REMARK   3  ALN A TPL AKPLTDQEKRRQISIRGIVGVENVAELKKSFNRHLHFTLVKDRNVATTRDYYFALAHT
REMARK   3  ALN A TPL VRDHLVGRWIRTQQHYYDKCPKRVYYLSLEFYMGRTLQNTMINLGLQNACDEAIYQLG
REMARK   3  ALN A TPL LDIEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEYGIFNQKIRDGW
REMARK   3  ALN A TPL QVEEADDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNTGTKWIDTQVVLALPYDTPVPG
REMARK   3  ALN A TPL YMNNTVNTMRLWSARAPNDFNLRDFNVGDYIQAVLDRNLAENISRVLYPNDNFFEGKE
REMARK   3  ALN A TPL LRLKQEYFVVAATLQDIIRRFKASKFGSTRGAGTVFDAFPDQVAIQLNDTHPALAIPE
REMARK   3  ALN A TPL LMRIFVDIEKLPWSKAWELTQKTFAYTNHTVLPEALERWPVDLVEKLLPRHLEIIYEI
REMARK   3  ALN A TPL NQKHLDRIVALFPKDVDRLRRMSLIEEEGSKRINMAHLCIVGSHAVNGVAKIHSDIVK
REMARK   3  ALN A TPL TKVFKDFSELEPDKFQNKTNGITPRRWLLLCNPGLAELIAEKIGEDYVKDLSQLTKLH
REMARK   3  ALN A TPL SFLGDDVFLRELAKVKQENKLKFSQFLETEYKVKINPSSMFDVQVKRIHEYKRQLLNC
REMARK   3  ALN A TPL LHVITMYNRIKKDPKKLFVPRTVIIGGKAAPGYHMAKMIIKLITSVADVVNNDPMVGS
REMARK   3  ALN A TPL KLKVIFLENYRVSLAEKVIPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGAN
REMARK   3  ALN A TPL VEMAEEAGEENLFIFGMRIDDVAALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPKQ
REMARK   3  ALN A TPL PDLFKDIINMLFYHDRFKVFADYEAYVKCQDKVSQLYMNPKAWNTMVLKNIAASGKFS
REMARK   3  ALN A TPL SDRTIKEYAQNIWNVEPSDLKISLSNESNKVNGN
REMARK   3  ALN A OFF 0
ATOM      1  N   ASN A  23       9.024 102.823 127.544  1.00  0.84           N  
ATOM      2  CA  ASN A  23       7.621 102.405 127.272  1.00  0.84           C  
ATOM      3  C   ASN A  23       7.548 101.240 126.287  1.00  0.84           C  
ATOM      4  O   ASN A  23       8.579 100.794 125.791  1.00  0.84           O  
ATOM      5  CB  ASN A  23       6.679 103.619 126.980  1.00  0.84           C  
ATOM      6  CG  ASN A  23       6.854 104.186 125.569  1.00  0.84           C  
ATOM      7  OD1 ASN A  23       6.723 103.455 124.588  1.00  0.84           O  
ATOM      8  ND2 ASN A  23       7.148 105.493 125.452  1.00  0.84           N  
ATOM      9  N   VAL A  24       6.344 100.697 126.007  1.00  0.87           N  
ATOM     10  CA  VAL A  24       6.150  99.549 125.127  1.00  0.87           C  
ATOM     11  C   VAL A  24       6.587  99.792 123.683  1.00  0.87           C  
ATOM     12  O   VAL A  24       7.260  98.964 123.072  1.00  0.87           O  
ATOM     13  CB  VAL A  24       4.682  99.128 125.164  1.00  0.87           C  
ATOM     14  CG1 VAL A  24       4.409  97.942 124.218  1.00  0.87           C  
ATOM     15  CG2 VAL A  24       4.312  98.711 126.602  1.00  0.87           C  
ATOM     16  N   ALA A  25       6.248 100.961 123.102  1.00  0.85           N  
ATOM     17  CA  ALA A  25       6.577 101.310 121.733  1.00  0.85           C  
ATOM     18  C   ALA A  25       8.079 101.421 121.495  1.00  0.85           C  
ATOM     19  O   ALA A  25       8.615 100.889 120.522  1.00  0.85           O  
ATOM     20  CB  ALA A  25       5.869 102.628 121.362  1.00  0.85           C  
ATOM     21  N   GLU A  26       8.798 102.064 122.435  1.00  0.79           N  
ATOM     22  CA  GLU A  26      10.246 102.166 122.437  1.00  0.79           C  
ATOM     23  C   GLU A  26      10.945 100.817 122.502  1.00  0.79           C  
ATOM     24  O   GLU A  26      11.906 100.561 121.777  1.00  0.79           O  
ATOM     25  CB  GLU A  26      10.707 103.001 123.646  1.00  0.79           C  
ATOM     26  CG  GLU A  26      10.207 104.460 123.604  1.00  0.79           C  
ATOM     27  CD  GLU A  26      10.510 105.152 124.922  1.00  0.79           C  
ATOM     28  OE1 GLU A  26      11.251 106.156 124.946  1.00  0.79           O  
ATOM     29  OE2 GLU A  26       9.976 104.632 125.945  1.00  0.79           O  
ATOM     30  N   LEU A  27      10.450  99.897 123.358  1.00  0.85           N  
ATOM     31  CA  LEU A  27      10.963  98.543 123.474  1.00  0.85           C  
ATOM     32  C   LEU A  27      10.812  97.727 122.199  1.00  0.85           C  
ATOM     33  O   LEU A  27      11.755  97.053 121.787  1.00  0.85           O  
ATOM     34  CB  LEU A  27      10.309  97.801 124.664  1.00  0.85           C  
ATOM     35  CG  LEU A  27      10.750  98.326 126.047  1.00  0.85           C  
ATOM     36  CD1 LEU A  27       9.818  97.785 127.138  1.00  0.85           C  
ATOM     37  CD2 LEU A  27      12.203  97.951 126.376  1.00  0.85           C  
ATOM     38  N   LYS A  28       9.657  97.807 121.499  1.00  0.80           N  
ATOM     39  CA  LYS A  28       9.496  97.178 120.194  1.00  0.80           C  
ATOM     40  C   LYS A  28      10.446  97.729 119.138  1.00  0.80           C  
ATOM     41  O   LYS A  28      11.110  96.977 118.428  1.00  0.80           O  
ATOM     42  CB  LYS A  28       8.048  97.311 119.658  1.00  0.80           C  
ATOM     43  CG  LYS A  28       7.014  96.621 120.557  1.00  0.80           C  
ATOM     44  CD  LYS A  28       5.632  96.426 119.910  1.00  0.80           C  
ATOM     45  CE  LYS A  28       4.973  97.700 119.378  1.00  0.80           C  
ATOM     46  NZ  LYS A  28       3.597  97.393 118.935  1.00  0.80           N  
ATOM     47  N   LYS A  29      10.591  99.069 119.050  1.00  0.79           N  
ATOM     48  CA  LYS A  29      11.527  99.697 118.131  1.00  0.79           C  
ATOM     49  C   LYS A  29      12.987  99.351 118.410  1.00  0.79           C  
ATOM     50  O   LYS A  29      13.768  99.132 117.485  1.00  0.79           O  
ATOM     51  CB  LYS A  29      11.357 101.238 118.095  1.00  0.79           C  
ATOM     52  CG  LYS A  29      10.014 101.677 117.483  1.00  0.79           C  
ATOM     53  CD  LYS A  29       9.877 103.201 117.293  1.00  0.79           C  
ATOM     54  CE  LYS A  29      10.131 103.709 115.866  1.00  0.79           C  
ATOM     55  NZ  LYS A  29      11.502 103.376 115.422  1.00  0.79           N  
ATOM     56  N   SER A  30      13.398  99.288 119.691  1.00  0.83           N  
ATOM     57  CA  SER A  30      14.712  98.798 120.093  1.00  0.83           C  
ATOM     58  C   SER A  30      14.946  97.332 119.789  1.00  0.83           C  
ATOM     59  O   SER A  30      16.013  96.974 119.293  1.00  0.83           O  
ATOM     60  CB  SER A  30      15.023  99.057 121.587  1.00  0.83           C  
ATOM     61  OG  SER A  30      15.297 100.447 121.804  1.00  0.83           O  
ATOM     62  N   PHE A  31      13.941  96.459 120.012  1.00  0.87           N  
ATOM     63  CA  PHE A  31      13.982  95.057 119.624  1.00  0.87           C  
ATOM     64  C   PHE A  31      14.164  94.897 118.116  1.00  0.87           C  
ATOM     65  O   PHE A  31      15.020  94.145 117.658  1.00  0.87           O  
ATOM     66  CB  PHE A  31      12.671  94.366 120.106  1.00  0.87           C  
ATOM     67  CG  PHE A  31      12.589  92.890 119.800  1.00  0.87           C  
ATOM     68  CD1 PHE A  31      12.129  92.446 118.547  1.00  0.87           C  
ATOM     69  CD2 PHE A  31      12.906  91.935 120.778  1.00  0.87           C  
ATOM     70  CE1 PHE A  31      11.978  91.081 118.276  1.00  0.87           C  
ATOM     71  CE2 PHE A  31      12.754  90.568 120.513  1.00  0.87           C  
ATOM     72  CZ  PHE A  31      12.288  90.142 119.265  1.00  0.87           C  
ATOM     73  N   ASN A  32      13.400  95.655 117.300  1.00  0.80           N  
ATOM     74  CA  ASN A  32      13.549  95.676 115.852  1.00  0.80           C  
ATOM     75  C   ASN A  32      14.915  96.190 115.398  1.00  0.80           C  
ATOM     76  O   ASN A  32      15.532  95.625 114.498  1.00  0.80           O  
ATOM     77  CB  ASN A  32      12.435  96.518 115.168  1.00  0.80           C  
ATOM     78  CG  ASN A  32      11.015  96.029 115.462  1.00  0.80           C  
ATOM     79  OD1 ASN A  32      10.077  96.825 115.519  1.00  0.80           O  
ATOM     80  ND2 ASN A  32      10.822  94.701 115.626  1.00  0.80           N  
ATOM     81  N   ARG A  33      15.441  97.255 116.042  1.00  0.76           N  
ATOM     82  CA  ARG A  33      16.775  97.777 115.785  1.00  0.76           C  
ATOM     83  C   ARG A  33      17.880  96.764 116.070  1.00  0.76           C  
ATOM     84  O   ARG A  33      18.770  96.546 115.249  1.00  0.76           O  
ATOM     85  CB  ARG A  33      17.020  99.030 116.672  1.00  0.76           C  
ATOM     86  CG  ARG A  33      18.311  99.817 116.355  1.00  0.76           C  
ATOM     87  CD  ARG A  33      18.808 100.750 117.472  1.00  0.76           C  
ATOM     88  NE  ARG A  33      17.717 101.738 117.791  1.00  0.76           N  
ATOM     89  CZ  ARG A  33      17.045 101.782 118.951  1.00  0.76           C  
ATOM     90  NH1 ARG A  33      17.355 101.013 119.985  1.00  0.76           N  
ATOM     91  NH2 ARG A  33      16.025 102.627 119.088  1.00  0.76           N  
ATOM     92  N   HIS A  34      17.824  96.083 117.233  1.00  0.81           N  
ATOM     93  CA  HIS A  34      18.746  95.011 117.571  1.00  0.81           C  
ATOM     94  C   HIS A  34      18.618  93.800 116.665  1.00  0.81           C  
ATOM     95  O   HIS A  34      19.612  93.227 116.235  1.00  0.81           O  
ATOM     96  CB  HIS A  34      18.613  94.582 119.050  1.00  0.81           C  
ATOM     97  CG  HIS A  34      19.429  95.449 119.957  1.00  0.81           C  
ATOM     98  ND1 HIS A  34      20.804  95.389 119.827  1.00  0.81           N  
ATOM     99  CD2 HIS A  34      19.083  96.327 120.936  1.00  0.81           C  
ATOM    100  CE1 HIS A  34      21.268  96.235 120.729  1.00  0.81           C  
ATOM    101  NE2 HIS A  34      20.271  96.823 121.427  1.00  0.81           N  
ATOM    102  N   LEU A  35      17.393  93.382 116.307  1.00  0.84           N  
ATOM    103  CA  LEU A  35      17.188  92.289 115.375  1.00  0.84           C  
ATOM    104  C   LEU A  35      17.769  92.562 113.987  1.00  0.84           C  
ATOM    105  O   LEU A  35      18.467  91.730 113.410  1.00  0.84           O  
ATOM    106  CB  LEU A  35      15.674  91.998 115.286  1.00  0.84           C  
ATOM    107  CG  LEU A  35      15.286  90.709 114.541  1.00  0.84           C  
ATOM    108  CD1 LEU A  35      15.829  89.448 115.232  1.00  0.84           C  
ATOM    109  CD2 LEU A  35      13.760  90.632 114.430  1.00  0.84           C  
ATOM    110  N   HIS A  36      17.549  93.778 113.449  1.00  0.76           N  
ATOM    111  CA  HIS A  36      18.133  94.181 112.183  1.00  0.76           C  
ATOM    112  C   HIS A  36      19.653  94.345 112.211  1.00  0.76           C  
ATOM    113  O   HIS A  36      20.360  93.697 111.449  1.00  0.76           O  
ATOM    114  CB  HIS A  36      17.485  95.508 111.719  1.00  0.76           C  
ATOM    115  CG  HIS A  36      17.932  95.984 110.372  1.00  0.76           C  
ATOM    116  ND1 HIS A  36      17.470  95.360 109.233  1.00  0.76           N  
ATOM    117  CD2 HIS A  36      18.790  96.982 110.044  1.00  0.76           C  
ATOM    118  CE1 HIS A  36      18.053  95.987 108.235  1.00  0.76           C  
ATOM    119  NE2 HIS A  36      18.865  96.981 108.669  1.00  0.76           N  
ATOM    120  N   PHE A  37      20.224  95.176 113.109  1.00  0.77           N  
ATOM    121  CA  PHE A  37      21.654  95.476 113.063  1.00  0.77           C  
ATOM    122  C   PHE A  37      22.525  94.464 113.797  1.00  0.77           C  
ATOM    123  O   PHE A  37      23.530  93.973 113.284  1.00  0.77           O  
ATOM    124  CB  PHE A  37      21.945  96.879 113.661  1.00  0.77           C  
ATOM    125  CG  PHE A  37      21.387  97.974 112.791  1.00  0.77           C  
ATOM    126  CD1 PHE A  37      21.984  98.274 111.556  1.00  0.77           C  
ATOM    127  CD2 PHE A  37      20.300  98.753 113.221  1.00  0.77           C  
ATOM    128  CE1 PHE A  37      21.522  99.344 110.778  1.00  0.77           C  
ATOM    129  CE2 PHE A  37      19.825  99.817 112.443  1.00  0.77           C  
ATOM    130  CZ  PHE A  37      20.442 100.117 111.222  1.00  0.77           C  
ATOM    131  N   THR A  38      22.165  94.118 115.045  1.00  0.76           N  
ATOM    132  CA  THR A  38      22.935  93.207 115.890  1.00  0.76           C  
ATOM    133  C   THR A  38      22.852  91.768 115.419  1.00  0.76           C  
ATOM    134  O   THR A  38      23.844  91.036 115.438  1.00  0.76           O  
ATOM    135  CB  THR A  38      22.565  93.311 117.368  1.00  0.76           C  
ATOM    136  OG1 THR A  38      22.671  94.667 117.774  1.00  0.76           O  
ATOM    137  CG2 THR A  38      23.529  92.513 118.257  1.00  0.76           C  
ATOM    138  N   LEU A  39      21.661  91.314 114.969  1.00  0.78           N  
ATOM    139  CA  LEU A  39      21.469  89.935 114.548  1.00  0.78           C  
ATOM    140  C   LEU A  39      21.483  89.733 113.039  1.00  0.78           C  
ATOM    141  O   LEU A  39      21.667  88.601 112.592  1.00  0.78           O  
ATOM    142  CB  LEU A  39      20.147  89.329 115.099  1.00  0.78           C  
ATOM    143  CG  LEU A  39      20.147  88.916 116.588  1.00  0.78           C  
ATOM    144  CD1 LEU A  39      21.253  87.891 116.881  1.00  0.78           C  
ATOM    145  CD2 LEU A  39      20.199  90.098 117.566  1.00  0.78           C  
ATOM    146  N   VAL A  40      21.346  90.801 112.223  1.00  0.77           N  
ATOM    147  CA  VAL A  40      21.314  90.725 110.761  1.00  0.77           C  
ATOM    148  C   VAL A  40      20.111  89.921 110.257  1.00  0.77           C  
ATOM    149  O   VAL A  40      20.215  89.017 109.426  1.00  0.77           O  
ATOM    150  CB  VAL A  40      22.657  90.328 110.126  1.00  0.77           C  
ATOM    151  CG1 VAL A  40      22.678  90.637 108.612  1.00  0.77           C  
ATOM    152  CG2 VAL A  40      23.801  91.113 110.804  1.00  0.77           C  
ATOM    153  N   LYS A  41      18.907  90.229 110.791  1.00  0.73           N  
ATOM    154  CA  LYS A  41      17.696  89.476 110.517  1.00  0.73           C  
ATOM    155  C   LYS A  41      16.483  90.375 110.340  1.00  0.73           C  
ATOM    156  O   LYS A  41      16.375  91.454 110.917  1.00  0.73           O  
ATOM    157  CB  LYS A  41      17.337  88.513 111.687  1.00  0.73           C  
ATOM    158  CG  LYS A  41      18.335  87.378 111.965  1.00  0.73           C  
ATOM    159  CD  LYS A  41      18.505  86.436 110.768  1.00  0.73           C  
ATOM    160  CE  LYS A  41      19.454  85.263 111.017  1.00  0.73           C  
ATOM    161  NZ  LYS A  41      18.775  84.129 111.665  1.00  0.73           N  
ATOM    162  N   ASP A  42      15.508  89.904 109.537  1.00  0.72           N  
ATOM    163  CA  ASP A  42      14.208  90.509 109.355  1.00  0.72           C  
ATOM    164  C   ASP A  42      13.172  89.828 110.268  1.00  0.72           C  
ATOM    165  O   ASP A  42      13.419  89.574 111.443  1.00  0.72           O  
ATOM    166  CB  ASP A  42      13.848  90.476 107.838  1.00  0.72           C  
ATOM    167  CG  ASP A  42      13.841  89.086 107.218  1.00  0.72           C  
ATOM    168  OD1 ASP A  42      14.007  88.075 107.949  1.00  0.72           O  
ATOM    169  OD2 ASP A  42      13.582  89.012 105.994  1.00  0.72           O  
ATOM    170  N   ARG A  43      11.962  89.506 109.764  1.00  0.74           N  
ATOM    171  CA  ARG A  43      11.035  88.635 110.475  1.00  0.74           C  
ATOM    172  C   ARG A  43      10.813  87.325 109.737  1.00  0.74           C  
ATOM    173  O   ARG A  43      10.069  86.471 110.212  1.00  0.74           O  
ATOM    174  CB  ARG A  43       9.653  89.314 110.690  1.00  0.74           C  
ATOM    175  CG  ARG A  43       9.653  90.508 111.673  1.00  0.74           C  
ATOM    176  CD  ARG A  43      10.167  90.211 113.092  1.00  0.74           C  
ATOM    177  NE  ARG A  43       9.382  89.072 113.679  1.00  0.74           N  
ATOM    178  CZ  ARG A  43       8.300  89.183 114.459  1.00  0.74           C  
ATOM    179  NH1 ARG A  43       7.675  90.335 114.659  1.00  0.74           N  
ATOM    180  NH2 ARG A  43       7.813  88.104 115.067  1.00  0.74           N  
ATOM    181  N   ASN A  44      11.470  87.119 108.579  1.00  0.63           N  
ATOM    182  CA  ASN A  44      11.296  85.933 107.760  1.00  0.63           C  
ATOM    183  C   ASN A  44      12.298  84.860 108.150  1.00  0.63           C  
ATOM    184  O   ASN A  44      11.959  83.687 108.280  1.00  0.63           O  
ATOM    185  CB  ASN A  44      11.502  86.263 106.260  1.00  0.63           C  
ATOM    186  CG  ASN A  44      10.477  87.295 105.803  1.00  0.63           C  
ATOM    187  OD1 ASN A  44       9.274  87.041 105.771  1.00  0.63           O  
ATOM    188  ND2 ASN A  44      10.955  88.500 105.421  1.00  0.63           N  
ATOM    189  N   VAL A  45      13.575  85.247 108.356  1.00  0.71           N  
ATOM    190  CA  VAL A  45      14.648  84.296 108.638  1.00  0.71           C  
ATOM    191  C   VAL A  45      15.221  84.477 110.039  1.00  0.71           C  
ATOM    192  O   VAL A  45      16.266  83.925 110.400  1.00  0.71           O  
ATOM    193  CB  VAL A  45      15.754  84.332 107.583  1.00  0.71           C  
ATOM    194  CG1 VAL A  45      15.175  83.811 106.252  1.00  0.71           C  
ATOM    195  CG2 VAL A  45      16.323  85.752 107.402  1.00  0.71           C  
ATOM    196  N   ALA A  46      14.526  85.248 110.895  1.00  0.80           N  
ATOM    197  CA  ALA A  46      14.825  85.371 112.307  1.00  0.80           C  
ATOM    198  C   ALA A  46      14.375  84.159 113.121  1.00  0.80           C  
ATOM    199  O   ALA A  46      13.211  83.763 113.099  1.00  0.80           O  
ATOM    200  CB  ALA A  46      14.150  86.626 112.882  1.00  0.80           C  
ATOM    201  N   THR A  47      15.304  83.541 113.874  1.00  0.81           N  
ATOM    202  CA  THR A  47      15.012  82.402 114.736  1.00  0.81           C  
ATOM    203  C   THR A  47      14.618  82.851 116.128  1.00  0.81           C  
ATOM    204  O   THR A  47      14.822  83.999 116.519  1.00  0.81           O  
ATOM    205  CB  THR A  47      16.180  81.416 114.883  1.00  0.81           C  
ATOM    206  OG1 THR A  47      17.300  81.962 115.575  1.00  0.81           O  
ATOM    207  CG2 THR A  47      16.677  80.965 113.504  1.00  0.81           C  
ATOM    208  N   THR A  48      14.096  81.927 116.961  1.00  0.84           N  
ATOM    209  CA  THR A  48      13.841  82.159 118.383  1.00  0.84           C  
ATOM    210  C   THR A  48      15.086  82.579 119.143  1.00  0.84           C  
ATOM    211  O   THR A  48      15.046  83.447 120.010  1.00  0.84           O  
ATOM    212  CB  THR A  48      13.239  80.948 119.078  1.00  0.84           C  
ATOM    213  OG1 THR A  48      12.171  80.439 118.295  1.00  0.84           O  
ATOM    214  CG2 THR A  48      12.671  81.324 120.449  1.00  0.84           C  
ATOM    215  N   ARG A  49      16.262  82.007 118.802  1.00  0.80           N  
ATOM    216  CA  ARG A  49      17.535  82.438 119.354  1.00  0.80           C  
ATOM    217  C   ARG A  49      17.940  83.859 118.947  1.00  0.80           C  
ATOM    218  O   ARG A  49      18.404  84.633 119.784  1.00  0.80           O  
ATOM    219  CB  ARG A  49      18.650  81.374 119.128  1.00  0.80           C  
ATOM    220  CG  ARG A  49      19.978  81.691 119.858  1.00  0.80           C  
ATOM    221  CD  ARG A  49      21.013  80.549 119.948  1.00  0.80           C  
ATOM    222  NE  ARG A  49      20.737  79.689 121.158  1.00  0.80           N  
ATOM    223  CZ  ARG A  49      20.408  78.390 121.155  1.00  0.80           C  
ATOM    224  NH1 ARG A  49      20.068  77.749 120.043  1.00  0.80           N  
ATOM    225  NH2 ARG A  49      20.438  77.723 122.305  1.00  0.80           N  
ATOM    226  N   ASP A  50      17.714  84.277 117.680  1.00  0.85           N  
ATOM    227  CA  ASP A  50      17.884  85.666 117.264  1.00  0.85           C  
ATOM    228  C   ASP A  50      16.936  86.626 117.998  1.00  0.85           C  
ATOM    229  O   ASP A  50      17.340  87.686 118.477  1.00  0.85           O  
ATOM    230  CB  ASP A  50      17.656  85.847 115.742  1.00  0.85           C  
ATOM    231  CG  ASP A  50      18.573  84.971 114.920  1.00  0.85           C  
ATOM    232  OD1 ASP A  50      19.812  85.154 114.934  1.00  0.85           O  
ATOM    233  OD2 ASP A  50      18.015  84.109 114.184  1.00  0.85           O  
ATOM    234  N   TYR A  51      15.648  86.244 118.149  1.00  0.87           N  
ATOM    235  CA  TYR A  51      14.659  86.977 118.927  1.00  0.87           C  
ATOM    236  C   TYR A  51      15.030  87.108 120.407  1.00  0.87           C  
ATOM    237  O   TYR A  51      14.893  88.179 120.998  1.00  0.87           O  
ATOM    238  CB  TYR A  51      13.255  86.312 118.834  1.00  0.87           C  
ATOM    239  CG  TYR A  51      12.613  86.355 117.467  1.00  0.87           C  
ATOM    240  CD1 TYR A  51      12.638  87.505 116.656  1.00  0.87           C  
ATOM    241  CD2 TYR A  51      11.877  85.241 117.022  1.00  0.87           C  
ATOM    242  CE1 TYR A  51      11.946  87.531 115.436  1.00  0.87           C  
ATOM    243  CE2 TYR A  51      11.222  85.252 115.784  1.00  0.87           C  
ATOM    244  CZ  TYR A  51      11.246  86.404 114.997  1.00  0.87           C  
ATOM    245  OH  TYR A  51      10.558  86.436 113.766  1.00  0.87           O  
ATOM    246  N   TYR A  52      15.556  86.035 121.040  1.00  0.89           N  
ATOM    247  CA  TYR A  52      16.108  86.078 122.387  1.00  0.89           C  
ATOM    248  C   TYR A  52      17.250  87.091 122.507  1.00  0.89           C  
ATOM    249  O   TYR A  52      17.239  87.941 123.395  1.00  0.89           O  
ATOM    250  CB  TYR A  52      16.573  84.642 122.816  1.00  0.89           C  
ATOM    251  CG  TYR A  52      17.522  84.650 123.996  1.00  0.89           C  
ATOM    252  CD1 TYR A  52      17.081  85.066 125.262  1.00  0.89           C  
ATOM    253  CD2 TYR A  52      18.898  84.442 123.784  1.00  0.89           C  
ATOM    254  CE1 TYR A  52      18.008  85.334 126.278  1.00  0.89           C  
ATOM    255  CE2 TYR A  52      19.823  84.698 124.806  1.00  0.89           C  
ATOM    256  CZ  TYR A  52      19.375  85.170 126.042  1.00  0.89           C  
ATOM    257  OH  TYR A  52      20.291  85.525 127.046  1.00  0.89           O  
ATOM    258  N   PHE A  53      18.239  87.062 121.592  1.00  0.88           N  
ATOM    259  CA  PHE A  53      19.347  88.002 121.606  1.00  0.88           C  
ATOM    260  C   PHE A  53      18.911  89.446 121.401  1.00  0.88           C  
ATOM    261  O   PHE A  53      19.414  90.354 122.061  1.00  0.88           O  
ATOM    262  CB  PHE A  53      20.403  87.645 120.534  1.00  0.88           C  
ATOM    263  CG  PHE A  53      21.260  86.465 120.908  1.00  0.88           C  
ATOM    264  CD1 PHE A  53      21.962  86.431 122.127  1.00  0.88           C  
ATOM    265  CD2 PHE A  53      21.464  85.426 119.983  1.00  0.88           C  
ATOM    266  CE1 PHE A  53      22.838  85.376 122.415  1.00  0.88           C  
ATOM    267  CE2 PHE A  53      22.343  84.374 120.268  1.00  0.88           C  
ATOM    268  CZ  PHE A  53      23.025  84.346 121.488  1.00  0.88           C  
ATOM    269  N   ALA A  54      17.935  89.698 120.506  1.00  0.90           N  
ATOM    270  CA  ALA A  54      17.357  91.010 120.312  1.00  0.90           C  
ATOM    271  C   ALA A  54      16.695  91.574 121.573  1.00  0.90           C  
ATOM    272  O   ALA A  54      16.899  92.736 121.932  1.00  0.90           O  
ATOM    273  CB  ALA A  54      16.340  90.947 119.157  1.00  0.90           C  
ATOM    274  N   LEU A  55      15.927  90.747 122.314  1.00  0.91           N  
ATOM    275  CA  LEU A  55      15.410  91.096 123.630  1.00  0.91           C  
ATOM    276  C   LEU A  55      16.498  91.280 124.685  1.00  0.91           C  
ATOM    277  O   LEU A  55      16.499  92.266 125.419  1.00  0.91           O  
ATOM    278  CB  LEU A  55      14.382  90.037 124.107  1.00  0.91           C  
ATOM    279  CG  LEU A  55      13.686  90.320 125.460  1.00  0.91           C  
ATOM    280  CD1 LEU A  55      12.985  91.688 125.507  1.00  0.91           C  
ATOM    281  CD2 LEU A  55      12.672  89.209 125.771  1.00  0.91           C  
ATOM    282  N   ALA A  56      17.485  90.365 124.758  1.00  0.94           N  
ATOM    283  CA  ALA A  56      18.565  90.411 125.726  1.00  0.94           C  
ATOM    284  C   ALA A  56      19.454  91.645 125.620  1.00  0.94           C  
ATOM    285  O   ALA A  56      19.720  92.309 126.621  1.00  0.94           O  
ATOM    286  CB  ALA A  56      19.415  89.133 125.605  1.00  0.94           C  
ATOM    287  N   HIS A  57      19.875  92.037 124.397  1.00  0.86           N  
ATOM    288  CA  HIS A  57      20.581  93.295 124.183  1.00  0.86           C  
ATOM    289  C   HIS A  57      19.723  94.512 124.527  1.00  0.86           C  
ATOM    290  O   HIS A  57      20.174  95.420 125.214  1.00  0.86           O  
ATOM    291  CB  HIS A  57      21.139  93.428 122.746  1.00  0.86           C  
ATOM    292  CG  HIS A  57      22.264  92.476 122.444  1.00  0.86           C  
ATOM    293  ND1 HIS A  57      23.503  92.664 123.035  1.00  0.86           N  
ATOM    294  CD2 HIS A  57      22.294  91.376 121.645  1.00  0.86           C  
ATOM    295  CE1 HIS A  57      24.253  91.678 122.588  1.00  0.86           C  
ATOM    296  NE2 HIS A  57      23.572  90.868 121.744  1.00  0.86           N  
ATOM    297  N   THR A  58      18.426  94.520 124.139  1.00  0.88           N  
ATOM    298  CA  THR A  58      17.487  95.610 124.448  1.00  0.88           C  
ATOM    299  C   THR A  58      17.302  95.831 125.942  1.00  0.88           C  
ATOM    300  O   THR A  58      17.322  96.957 126.436  1.00  0.88           O  
ATOM    301  CB  THR A  58      16.097  95.369 123.846  1.00  0.88           C  
ATOM    302  OG1 THR A  58      16.163  95.322 122.428  1.00  0.88           O  
ATOM    303  CG2 THR A  58      15.102  96.489 124.199  1.00  0.88           C  
ATOM    304  N   VAL A  59      17.143  94.745 126.721  1.00  0.91           N  
ATOM    305  CA  VAL A  59      17.094  94.779 128.175  1.00  0.91           C  
ATOM    306  C   VAL A  59      18.413  95.225 128.797  1.00  0.91           C  
ATOM    307  O   VAL A  59      18.444  96.026 129.733  1.00  0.91           O  
ATOM    308  CB  VAL A  59      16.660  93.416 128.703  1.00  0.91           C  
ATOM    309  CG1 VAL A  59      16.784  93.325 130.236  1.00  0.91           C  
ATOM    310  CG2 VAL A  59      15.194  93.191 128.285  1.00  0.91           C  
ATOM    311  N   ARG A  60      19.555  94.740 128.271  1.00  0.83           N  
ATOM    312  CA  ARG A  60      20.877  95.116 128.732  1.00  0.83           C  
ATOM    313  C   ARG A  60      21.204  96.590 128.570  1.00  0.83           C  
ATOM    314  O   ARG A  60      21.791  97.207 129.454  1.00  0.83           O  
ATOM    315  CB  ARG A  60      21.960  94.313 127.991  1.00  0.83           C  
ATOM    316  CG  ARG A  60      23.374  94.478 128.587  1.00  0.83           C  
ATOM    317  CD  ARG A  60      24.466  94.029 127.624  1.00  0.83           C  
ATOM    318  NE  ARG A  60      24.422  95.009 126.493  1.00  0.83           N  
ATOM    319  CZ  ARG A  60      24.958  94.782 125.293  1.00  0.83           C  
ATOM    320  NH1 ARG A  60      25.732  93.719 125.072  1.00  0.83           N  
ATOM    321  NH2 ARG A  60      24.663  95.623 124.304  1.00  0.83           N  
ATOM    322  N   ASP A  61      20.819  97.217 127.451  1.00  0.85           N  
ATOM    323  CA  ASP A  61      21.077  98.616 127.177  1.00  0.85           C  
ATOM    324  C   ASP A  61      20.463  99.563 128.237  1.00  0.85           C  
ATOM    325  O   ASP A  61      21.037 100.592 128.597  1.00  0.85           O  
ATOM    326  CB  ASP A  61      20.649  98.907 125.719  1.00  0.85           C  
ATOM    327  CG  ASP A  61      21.546  98.194 124.697  1.00  0.85           C  
ATOM    328  OD1 ASP A  61      22.579  97.552 125.054  1.00  0.85           O  
ATOM    329  OD2 ASP A  61      21.181  98.301 123.497  1.00  0.85           O  
ATOM    330  N   HIS A  62      19.329  99.171 128.863  1.00  0.84           N  
ATOM    331  CA  HIS A  62      18.747  99.850 130.022  1.00  0.84           C  
ATOM    332  C   HIS A  62      19.569  99.757 131.318  1.00  0.84           C  
ATOM    333  O   HIS A  62      19.381 100.550 132.250  1.00  0.84           O  
ATOM    334  CB  HIS A  62      17.335  99.291 130.318  1.00  0.84           C  
ATOM    335  CG  HIS A  62      16.295  99.845 129.401  1.00  0.84           C  
ATOM    336  ND1 HIS A  62      15.827 101.118 129.656  1.00  0.84           N  
ATOM    337  CD2 HIS A  62      15.704  99.337 128.288  1.00  0.84           C  
ATOM    338  CE1 HIS A  62      14.963 101.365 128.693  1.00  0.84           C  
ATOM    339  NE2 HIS A  62      14.849 100.320 127.836  1.00  0.84           N  
ATOM    340  N   LEU A  63      20.507  98.792 131.430  1.00  0.86           N  
ATOM    341  CA  LEU A  63      21.506  98.742 132.490  1.00  0.86           C  
ATOM    342  C   LEU A  63      22.599  99.781 132.323  1.00  0.86           C  
ATOM    343  O   LEU A  63      23.041 100.394 133.294  1.00  0.86           O  
ATOM    344  CB  LEU A  63      22.231  97.373 132.564  1.00  0.86           C  
ATOM    345  CG  LEU A  63      21.324  96.198 132.951  1.00  0.86           C  
ATOM    346  CD1 LEU A  63      21.999  94.864 132.622  1.00  0.86           C  
ATOM    347  CD2 LEU A  63      21.018  96.262 134.448  1.00  0.86           C  
ATOM    348  N   VAL A  64      23.068  99.999 131.076  1.00  0.83           N  
ATOM    349  CA  VAL A  64      24.327 100.661 130.737  1.00  0.83           C  
ATOM    350  C   VAL A  64      24.464 102.051 131.333  1.00  0.83           C  
ATOM    351  O   VAL A  64      25.471 102.398 131.951  1.00  0.83           O  
ATOM    352  CB  VAL A  64      24.472 100.740 129.219  1.00  0.83           C  
ATOM    353  CG1 VAL A  64      25.695 101.574 128.797  1.00  0.83           C  
ATOM    354  CG2 VAL A  64      24.610  99.317 128.642  1.00  0.83           C  
ATOM    355  N   GLY A  65      23.393 102.867 131.248  1.00  0.82           N  
ATOM    356  CA  GLY A  65      23.402 104.229 131.769  1.00  0.82           C  
ATOM    357  C   GLY A  65      23.284 104.331 133.271  1.00  0.82           C  
ATOM    358  O   GLY A  65      23.356 105.425 133.824  1.00  0.82           O  
ATOM    359  N   ARG A  66      23.103 103.207 133.986  1.00  0.80           N  
ATOM    360  CA  ARG A  66      23.247 103.148 135.432  1.00  0.80           C  
ATOM    361  C   ARG A  66      24.565 102.490 135.809  1.00  0.80           C  
ATOM    362  O   ARG A  66      25.201 102.891 136.781  1.00  0.80           O  
ATOM    363  CB  ARG A  66      22.080 102.357 136.071  1.00  0.80           C  
ATOM    364  CG  ARG A  66      20.822 103.222 136.280  1.00  0.80           C  
ATOM    365  CD  ARG A  66      19.588 102.444 136.755  1.00  0.80           C  
ATOM    366  NE  ARG A  66      19.031 101.753 135.543  1.00  0.80           N  
ATOM    367  CZ  ARG A  66      17.740 101.437 135.383  1.00  0.80           C  
ATOM    368  NH1 ARG A  66      16.874 101.498 136.390  1.00  0.80           N  
ATOM    369  NH2 ARG A  66      17.323 101.030 134.186  1.00  0.80           N  
ATOM    370  N   TRP A  67      25.050 101.508 135.024  1.00  0.87           N  
ATOM    371  CA  TRP A  67      26.299 100.806 135.275  1.00  0.87           C  
ATOM    372  C   TRP A  67      27.532 101.699 135.219  1.00  0.87           C  
ATOM    373  O   TRP A  67      28.360 101.693 136.130  1.00  0.87           O  
ATOM    374  CB  TRP A  67      26.424  99.619 134.281  1.00  0.87           C  
ATOM    375  CG  TRP A  67      27.411  98.513 134.640  1.00  0.87           C  
ATOM    376  CD1 TRP A  67      28.032  98.239 135.830  1.00  0.87           C  
ATOM    377  CD2 TRP A  67      27.810  97.473 133.728  1.00  0.87           C  
ATOM    378  NE1 TRP A  67      28.787  97.092 135.721  1.00  0.87           N  
ATOM    379  CE2 TRP A  67      28.667  96.606 134.443  1.00  0.87           C  
ATOM    380  CE3 TRP A  67      27.493  97.230 132.392  1.00  0.87           C  
ATOM    381  CZ2 TRP A  67      29.217  95.487 133.835  1.00  0.87           C  
ATOM    382  CZ3 TRP A  67      28.060  96.103 131.777  1.00  0.87           C  
ATOM    383  CH2 TRP A  67      28.912  95.244 132.487  1.00  0.87           C  
ATOM    384  N   ILE A  68      27.635 102.564 134.184  1.00  0.83           N  
ATOM    385  CA  ILE A  68      28.711 103.544 134.058  1.00  0.83           C  
ATOM    386  C   ILE A  68      28.695 104.545 135.212  1.00  0.83           C  
ATOM    387  O   ILE A  68      29.714 104.808 135.848  1.00  0.83           O  
ATOM    388  CB  ILE A  68      28.655 104.263 132.704  1.00  0.83           C  
ATOM    389  CG1 ILE A  68      28.806 103.240 131.548  1.00  0.83           C  
ATOM    390  CG2 ILE A  68      29.758 105.346 132.616  1.00  0.83           C  
ATOM    391  CD1 ILE A  68      28.536 103.827 130.157  1.00  0.83           C  
ATOM    392  N   ARG A  69      27.504 105.073 135.576  1.00  0.78           N  
ATOM    393  CA  ARG A  69      27.342 105.960 136.720  1.00  0.78           C  
ATOM    394  C   ARG A  69      27.690 105.322 138.059  1.00  0.78           C  
ATOM    395  O   ARG A  69      28.342 105.948 138.890  1.00  0.78           O  
ATOM    396  CB  ARG A  69      25.911 106.555 136.805  1.00  0.78           C  
ATOM    397  CG  ARG A  69      25.691 107.753 135.857  1.00  0.78           C  
ATOM    398  CD  ARG A  69      24.350 108.475 136.064  1.00  0.78           C  
ATOM    399  NE  ARG A  69      23.291 107.572 135.525  1.00  0.78           N  
ATOM    400  CZ  ARG A  69      21.972 107.796 135.577  1.00  0.78           C  
ATOM    401  NH1 ARG A  69      21.178 106.987 134.879  1.00  0.78           N  
ATOM    402  NH2 ARG A  69      21.441 108.784 136.282  1.00  0.78           N  
ATOM    403  N   THR A  70      27.284 104.057 138.291  1.00  0.84           N  
ATOM    404  CA  THR A  70      27.559 103.323 139.529  1.00  0.84           C  
ATOM    405  C   THR A  70      29.047 103.151 139.767  1.00  0.84           C  
ATOM    406  O   THR A  70      29.580 103.496 140.821  1.00  0.84           O  
ATOM    407  CB  THR A  70      26.926 101.930 139.531  1.00  0.84           C  
ATOM    408  OG1 THR A  70      25.517 102.003 139.358  1.00  0.84           O  
ATOM    409  CG2 THR A  70      27.148 101.235 140.878  1.00  0.84           C  
ATOM    410  N   GLN A  71      29.790 102.683 138.745  1.00  0.81           N  
ATOM    411  CA  GLN A  71      31.231 102.531 138.831  1.00  0.81           C  
ATOM    412  C   GLN A  71      31.985 103.853 138.927  1.00  0.81           C  
ATOM    413  O   GLN A  71      32.935 103.986 139.701  1.00  0.81           O  
ATOM    414  CB  GLN A  71      31.754 101.650 137.672  1.00  0.81           C  
ATOM    415  CG  GLN A  71      31.120 100.233 137.647  1.00  0.81           C  
ATOM    416  CD  GLN A  71      31.300  99.492 138.974  1.00  0.81           C  
ATOM    417  OE1 GLN A  71      32.406  99.423 139.519  1.00  0.81           O  
ATOM    418  NE2 GLN A  71      30.200  98.920 139.517  1.00  0.81           N  
ATOM    419  N   GLN A  72      31.549 104.889 138.180  1.00  0.74           N  
ATOM    420  CA  GLN A  72      32.078 106.240 138.281  1.00  0.74           C  
ATOM    421  C   GLN A  72      31.886 106.865 139.660  1.00  0.74           C  
ATOM    422  O   GLN A  72      32.799 107.475 140.206  1.00  0.74           O  
ATOM    423  CB  GLN A  72      31.420 107.139 137.207  1.00  0.74           C  
ATOM    424  CG  GLN A  72      31.950 108.593 137.179  1.00  0.74           C  
ATOM    425  CD  GLN A  72      31.309 109.437 136.077  1.00  0.74           C  
ATOM    426  OE1 GLN A  72      31.984 110.072 135.271  1.00  0.74           O  
ATOM    427  NE2 GLN A  72      29.957 109.479 136.050  1.00  0.74           N  
ATOM    428  N   HIS A  73      30.707 106.686 140.291  1.00  0.77           N  
ATOM    429  CA  HIS A  73      30.429 107.111 141.659  1.00  0.77           C  
ATOM    430  C   HIS A  73      31.350 106.449 142.675  1.00  0.77           C  
ATOM    431  O   HIS A  73      31.926 107.098 143.550  1.00  0.77           O  
ATOM    432  CB  HIS A  73      28.955 106.784 142.004  1.00  0.77           C  
ATOM    433  CG  HIS A  73      28.530 107.058 143.412  1.00  0.77           C  
ATOM    434  ND1 HIS A  73      28.613 108.337 143.932  1.00  0.77           N  
ATOM    435  CD2 HIS A  73      27.979 106.211 144.320  1.00  0.77           C  
ATOM    436  CE1 HIS A  73      28.105 108.240 145.145  1.00  0.77           C  
ATOM    437  NE2 HIS A  73      27.707 106.977 145.431  1.00  0.77           N  
ATOM    438  N   TYR A  74      31.581 105.128 142.534  1.00  0.82           N  
ATOM    439  CA  TYR A  74      32.551 104.411 143.342  1.00  0.82           C  
ATOM    440  C   TYR A  74      33.984 104.908 143.159  1.00  0.82           C  
ATOM    441  O   TYR A  74      34.760 104.944 144.111  1.00  0.82           O  
ATOM    442  CB  TYR A  74      32.516 102.880 143.089  1.00  0.82           C  
ATOM    443  CG  TYR A  74      31.198 102.215 143.394  1.00  0.82           C  
ATOM    444  CD1 TYR A  74      30.219 102.752 144.257  1.00  0.82           C  
ATOM    445  CD2 TYR A  74      30.960 100.960 142.807  1.00  0.82           C  
ATOM    446  CE1 TYR A  74      29.021 102.062 144.489  1.00  0.82           C  
ATOM    447  CE2 TYR A  74      29.769 100.267 143.049  1.00  0.82           C  
ATOM    448  CZ  TYR A  74      28.795 100.829 143.878  1.00  0.82           C  
ATOM    449  OH  TYR A  74      27.589 100.152 144.125  1.00  0.82           O  
ATOM    450  N   TYR A  75      34.403 105.280 141.935  1.00  0.81           N  
ATOM    451  CA  TYR A  75      35.664 105.973 141.694  1.00  0.81           C  
ATOM    452  C   TYR A  75      35.731 107.384 142.296  1.00  0.81           C  
ATOM    453  O   TYR A  75      36.700 107.760 142.953  1.00  0.81           O  
ATOM    454  CB  TYR A  75      35.930 105.991 140.161  1.00  0.81           C  
ATOM    455  CG  TYR A  75      37.199 106.711 139.780  1.00  0.81           C  
ATOM    456  CD1 TYR A  75      38.465 106.144 140.012  1.00  0.81           C  
ATOM    457  CD2 TYR A  75      37.119 107.992 139.211  1.00  0.81           C  
ATOM    458  CE1 TYR A  75      39.630 106.851 139.674  1.00  0.81           C  
ATOM    459  CE2 TYR A  75      38.280 108.697 138.870  1.00  0.81           C  
ATOM    460  CZ  TYR A  75      39.535 108.124 139.101  1.00  0.81           C  
ATOM    461  OH  TYR A  75      40.702 108.824 138.744  1.00  0.81           O  
ATOM    462  N   ASP A  76      34.687 108.199 142.097  1.00  0.78           N  
ATOM    463  CA  ASP A  76      34.665 109.560 142.541  1.00  0.78           C  
ATOM    464  C   ASP A  76      34.644 109.740 144.079  1.00  0.78           C  
ATOM    465  O   ASP A  76      35.341 110.597 144.622  1.00  0.78           O  
ATOM    466  CB  ASP A  76      33.477 110.271 141.873  1.00  0.78           C  
ATOM    467  CG  ASP A  76      33.662 111.706 142.225  1.00  0.78           C  
ATOM    468  OD1 ASP A  76      33.093 112.218 143.203  1.00  0.78           O  
ATOM    469  OD2 ASP A  76      34.571 112.278 141.595  1.00  0.78           O  
ATOM    470  N   LYS A  77      33.825 108.969 144.806  1.00  0.77           N  
ATOM    471  CA  LYS A  77      33.637 109.158 146.238  1.00  0.77           C  
ATOM    472  C   LYS A  77      34.407 108.165 147.085  1.00  0.77           C  
ATOM    473  O   LYS A  77      34.503 108.343 148.295  1.00  0.77           O  
ATOM    474  CB  LYS A  77      32.128 109.007 146.577  1.00  0.77           C  
ATOM    475  CG  LYS A  77      31.254 110.127 145.984  1.00  0.77           C  
ATOM    476  CD  LYS A  77      31.490 111.479 146.685  1.00  0.77           C  
ATOM    477  CE  LYS A  77      30.804 112.691 146.046  1.00  0.77           C  
ATOM    478  NZ  LYS A  77      31.263 112.880 144.680  1.00  0.77           N  
ATOM    479  N   CYS A  78      34.985 107.108 146.476  1.00  0.84           N  
ATOM    480  CA  CYS A  78      35.728 106.054 147.165  1.00  0.84           C  
ATOM    481  C   CYS A  78      35.101 105.469 148.439  1.00  0.84           C  
ATOM    482  O   CYS A  78      35.780 105.425 149.468  1.00  0.84           O  
ATOM    483  CB  CYS A  78      37.197 106.469 147.440  1.00  0.84           C  
ATOM    484  SG  CYS A  78      38.149 106.772 145.917  1.00  0.84           S  
ATOM    485  N   PRO A  79      33.855 104.988 148.473  1.00  0.87           N  
ATOM    486  CA  PRO A  79      33.365 104.226 149.615  1.00  0.87           C  
ATOM    487  C   PRO A  79      34.126 102.920 149.778  1.00  0.87           C  
ATOM    488  O   PRO A  79      34.725 102.430 148.818  1.00  0.87           O  
ATOM    489  CB  PRO A  79      31.890 103.986 149.260  1.00  0.87           C  
ATOM    490  CG  PRO A  79      31.904 103.841 147.736  1.00  0.87           C  
ATOM    491  CD  PRO A  79      32.976 104.844 147.307  1.00  0.87           C  
ATOM    492  N   LYS A  80      34.135 102.339 150.994  1.00  0.85           N  
ATOM    493  CA  LYS A  80      34.765 101.055 151.223  1.00  0.85           C  
ATOM    494  C   LYS A  80      34.148  99.931 150.394  1.00  0.85           C  
ATOM    495  O   LYS A  80      32.930  99.784 150.295  1.00  0.85           O  
ATOM    496  CB  LYS A  80      34.780 100.687 152.725  1.00  0.85           C  
ATOM    497  CG  LYS A  80      35.443  99.330 153.000  1.00  0.85           C  
ATOM    498  CD  LYS A  80      35.665  99.025 154.484  1.00  0.85           C  
ATOM    499  CE  LYS A  80      36.482  97.743 154.625  1.00  0.85           C  
ATOM    500  NZ  LYS A  80      36.753  97.428 156.039  1.00  0.85           N  
ATOM    501  N   ARG A  81      35.009  99.122 149.753  1.00  0.85           N  
ATOM    502  CA  ARG A  81      34.610  98.180 148.739  1.00  0.85           C  
ATOM    503  C   ARG A  81      34.571  96.767 149.279  1.00  0.85           C  
ATOM    504  O   ARG A  81      35.433  96.341 150.050  1.00  0.85           O  
ATOM    505  CB  ARG A  81      35.597  98.231 147.549  1.00  0.85           C  
ATOM    506  CG  ARG A  81      35.753  99.642 146.949  1.00  0.85           C  
ATOM    507  CD  ARG A  81      36.906  99.720 145.951  1.00  0.85           C  
ATOM    508  NE  ARG A  81      37.117 101.163 145.610  1.00  0.85           N  
ATOM    509  CZ  ARG A  81      36.509 101.822 144.614  1.00  0.85           C  
ATOM    510  NH1 ARG A  81      35.669 101.224 143.774  1.00  0.85           N  
ATOM    511  NH2 ARG A  81      36.757 103.122 144.482  1.00  0.85           N  
ATOM    512  N   VAL A  82      33.552  96.001 148.861  1.00  0.93           N  
ATOM    513  CA  VAL A  82      33.360  94.627 149.284  1.00  0.93           C  
ATOM    514  C   VAL A  82      33.694  93.722 148.121  1.00  0.93           C  
ATOM    515  O   VAL A  82      33.111  93.797 147.041  1.00  0.93           O  
ATOM    516  CB  VAL A  82      31.935  94.345 149.749  1.00  0.93           C  
ATOM    517  CG1 VAL A  82      31.783  92.870 150.175  1.00  0.93           C  
ATOM    518  CG2 VAL A  82      31.605  95.271 150.936  1.00  0.93           C  
ATOM    519  N   TYR A  83      34.662  92.820 148.310  1.00  0.95           N  
ATOM    520  CA  TYR A  83      35.073  91.899 147.281  1.00  0.95           C  
ATOM    521  C   TYR A  83      34.674  90.505 147.697  1.00  0.95           C  
ATOM    522  O   TYR A  83      35.177  89.946 148.670  1.00  0.95           O  
ATOM    523  CB  TYR A  83      36.600  91.964 147.082  1.00  0.95           C  
ATOM    524  CG  TYR A  83      36.977  93.318 146.554  1.00  0.95           C  
ATOM    525  CD1 TYR A  83      36.694  93.633 145.223  1.00  0.95           C  
ATOM    526  CD2 TYR A  83      37.614  94.276 147.356  1.00  0.95           C  
ATOM    527  CE1 TYR A  83      37.081  94.862 144.672  1.00  0.95           C  
ATOM    528  CE2 TYR A  83      38.030  95.499 146.806  1.00  0.95           C  
ATOM    529  CZ  TYR A  83      37.788  95.778 145.454  1.00  0.95           C  
ATOM    530  OH  TYR A  83      38.331  96.936 144.861  1.00  0.95           O  
ATOM    531  N   TYR A  84      33.734  89.895 146.958  1.00  0.96           N  
ATOM    532  CA  TYR A  84      33.274  88.558 147.254  1.00  0.96           C  
ATOM    533  C   TYR A  84      34.017  87.597 146.344  1.00  0.96           C  
ATOM    534  O   TYR A  84      33.790  87.553 145.135  1.00  0.96           O  
ATOM    535  CB  TYR A  84      31.739  88.467 147.064  1.00  0.96           C  
ATOM    536  CG  TYR A  84      31.195  87.293 147.824  1.00  0.96           C  
ATOM    537  CD1 TYR A  84      30.872  87.429 149.185  1.00  0.96           C  
ATOM    538  CD2 TYR A  84      31.043  86.043 147.205  1.00  0.96           C  
ATOM    539  CE1 TYR A  84      30.392  86.332 149.913  1.00  0.96           C  
ATOM    540  CE2 TYR A  84      30.562  84.947 147.934  1.00  0.96           C  
ATOM    541  CZ  TYR A  84      30.221  85.098 149.281  1.00  0.96           C  
ATOM    542  OH  TYR A  84      29.681  84.011 149.992  1.00  0.96           O  
ATOM    543  N   LEU A  85      34.956  86.820 146.913  1.00  0.97           N  
ATOM    544  CA  LEU A  85      35.895  86.032 146.146  1.00  0.97           C  
ATOM    545  C   LEU A  85      35.539  84.564 146.261  1.00  0.97           C  
ATOM    546  O   LEU A  85      35.468  83.991 147.351  1.00  0.97           O  
ATOM    547  CB  LEU A  85      37.329  86.308 146.662  1.00  0.97           C  
ATOM    548  CG  LEU A  85      38.473  85.539 145.968  1.00  0.97           C  
ATOM    549  CD1 LEU A  85      38.497  85.718 144.444  1.00  0.97           C  
ATOM    550  CD2 LEU A  85      39.827  85.961 146.561  1.00  0.97           C  
ATOM    551  N   SER A  86      35.274  83.910 145.114  1.00  0.95           N  
ATOM    552  CA  SER A  86      34.801  82.540 145.121  1.00  0.95           C  
ATOM    553  C   SER A  86      35.228  81.807 143.876  1.00  0.95           C  
ATOM    554  O   SER A  86      35.650  82.383 142.877  1.00  0.95           O  
ATOM    555  CB  SER A  86      33.253  82.435 145.242  1.00  0.95           C  
ATOM    556  OG  SER A  86      32.841  81.096 145.540  1.00  0.95           O  
ATOM    557  N   LEU A  87      35.111  80.473 143.926  1.00  0.95           N  
ATOM    558  CA  LEU A  87      35.325  79.589 142.806  1.00  0.95           C  
ATOM    559  C   LEU A  87      33.970  79.218 142.214  1.00  0.95           C  
ATOM    560  O   LEU A  87      33.908  78.545 141.185  1.00  0.95           O  
ATOM    561  CB  LEU A  87      36.063  78.300 143.271  1.00  0.95           C  
ATOM    562  CG  LEU A  87      37.607  78.404 143.379  1.00  0.95           C  
ATOM    563  CD1 LEU A  87      38.262  78.493 141.995  1.00  0.95           C  
ATOM    564  CD2 LEU A  87      38.107  79.549 144.273  1.00  0.95           C  
ATOM    565  N   GLU A  88      32.855  79.680 142.825  1.00  0.93           N  
ATOM    566  CA  GLU A  88      31.516  79.360 142.378  1.00  0.93           C  
ATOM    567  C   GLU A  88      30.577  80.562 142.382  1.00  0.93           C  
ATOM    568  O   GLU A  88      30.446  81.281 143.369  1.00  0.93           O  
ATOM    569  CB  GLU A  88      30.841  78.305 143.283  1.00  0.93           C  
ATOM    570  CG  GLU A  88      31.559  76.943 143.373  1.00  0.93           C  
ATOM    571  CD  GLU A  88      30.679  75.866 143.993  1.00  0.93           C  
ATOM    572  OE1 GLU A  88      31.224  74.759 144.223  1.00  0.93           O  
ATOM    573  OE2 GLU A  88      29.447  76.083 144.176  1.00  0.93           O  
ATOM    574  N   PHE A  89      29.847  80.769 141.269  1.00  0.92           N  
ATOM    575  CA  PHE A  89      28.762  81.733 141.173  1.00  0.92           C  
ATOM    576  C   PHE A  89      27.626  81.085 140.403  1.00  0.92           C  
ATOM    577  O   PHE A  89      27.573  81.111 139.175  1.00  0.92           O  
ATOM    578  CB  PHE A  89      29.171  83.035 140.432  1.00  0.92           C  
ATOM    579  CG  PHE A  89      29.998  83.904 141.333  1.00  0.92           C  
ATOM    580  CD1 PHE A  89      31.395  83.783 141.354  1.00  0.92           C  
ATOM    581  CD2 PHE A  89      29.379  84.832 142.188  1.00  0.92           C  
ATOM    582  CE1 PHE A  89      32.160  84.558 142.231  1.00  0.92           C  
ATOM    583  CE2 PHE A  89      30.145  85.622 143.056  1.00  0.92           C  
ATOM    584  CZ  PHE A  89      31.538  85.481 143.081  1.00  0.92           C  
ATOM    585  N   TYR A  90      26.651  80.475 141.103  1.00  0.91           N  
ATOM    586  CA  TYR A  90      25.588  79.706 140.473  1.00  0.91           C  
ATOM    587  C   TYR A  90      24.430  80.614 140.068  1.00  0.91           C  
ATOM    588  O   TYR A  90      23.319  80.549 140.599  1.00  0.91           O  
ATOM    589  CB  TYR A  90      25.131  78.562 141.419  1.00  0.91           C  
ATOM    590  CG  TYR A  90      24.532  77.338 140.764  1.00  0.91           C  
ATOM    591  CD1 TYR A  90      24.321  77.179 139.378  1.00  0.91           C  
ATOM    592  CD2 TYR A  90      24.226  76.264 141.616  1.00  0.91           C  
ATOM    593  CE1 TYR A  90      23.831  75.965 138.869  1.00  0.91           C  
ATOM    594  CE2 TYR A  90      23.743  75.051 141.108  1.00  0.91           C  
ATOM    595  CZ  TYR A  90      23.553  74.903 139.732  1.00  0.91           C  
ATOM    596  OH  TYR A  90      23.100  73.673 139.217  1.00  0.91           O  
ATOM    597  N   MET A  91      24.699  81.537 139.126  1.00  0.92           N  
ATOM    598  CA  MET A  91      23.802  82.605 138.730  1.00  0.92           C  
ATOM    599  C   MET A  91      22.492  82.129 138.125  1.00  0.92           C  
ATOM    600  O   MET A  91      21.428  82.611 138.515  1.00  0.92           O  
ATOM    601  CB  MET A  91      24.501  83.572 137.744  1.00  0.92           C  
ATOM    602  CG  MET A  91      25.797  84.208 138.289  1.00  0.92           C  
ATOM    603  SD  MET A  91      25.586  85.219 139.785  1.00  0.92           S  
ATOM    604  CE  MET A  91      24.926  86.696 138.960  1.00  0.92           C  
ATOM    605  N   GLY A  92      22.537  81.134 137.211  1.00  0.96           N  
ATOM    606  CA  GLY A  92      21.381  80.736 136.410  1.00  0.96           C  
ATOM    607  C   GLY A  92      21.138  81.667 135.253  1.00  0.96           C  
ATOM    608  O   GLY A  92      22.055  82.312 134.759  1.00  0.96           O  
ATOM    609  N   ARG A  93      19.892  81.730 134.755  1.00  0.90           N  
ATOM    610  CA  ARG A  93      19.472  82.712 133.764  1.00  0.90           C  
ATOM    611  C   ARG A  93      19.486  84.154 134.258  1.00  0.90           C  
ATOM    612  O   ARG A  93      19.225  84.425 135.432  1.00  0.90           O  
ATOM    613  CB  ARG A  93      18.059  82.386 133.255  1.00  0.90           C  
ATOM    614  CG  ARG A  93      18.028  81.117 132.398  1.00  0.90           C  
ATOM    615  CD  ARG A  93      16.652  80.914 131.779  1.00  0.90           C  
ATOM    616  NE  ARG A  93      16.747  79.655 130.990  1.00  0.90           N  
ATOM    617  CZ  ARG A  93      15.733  78.807 130.818  1.00  0.90           C  
ATOM    618  NH1 ARG A  93      14.551  79.066 131.364  1.00  0.90           N  
ATOM    619  NH2 ARG A  93      15.874  77.740 130.039  1.00  0.90           N  
ATOM    620  N   THR A  94      19.776  85.122 133.371  1.00  0.95           N  
ATOM    621  CA  THR A  94      19.924  86.527 133.729  1.00  0.95           C  
ATOM    622  C   THR A  94      18.769  87.360 133.214  1.00  0.95           C  
ATOM    623  O   THR A  94      18.372  88.321 133.876  1.00  0.95           O  
ATOM    624  CB  THR A  94      21.224  87.092 133.161  1.00  0.95           C  
ATOM    625  OG1 THR A  94      22.333  86.489 133.812  1.00  0.95           O  
ATOM    626  CG2 THR A  94      21.388  88.606 133.366  1.00  0.95           C  
ATOM    627  N   LEU A  95      18.148  87.019 132.057  1.00  0.93           N  
ATOM    628  CA  LEU A  95      17.209  87.907 131.372  1.00  0.93           C  
ATOM    629  C   LEU A  95      16.008  88.342 132.200  1.00  0.93           C  
ATOM    630  O   LEU A  95      15.790  89.537 132.416  1.00  0.93           O  
ATOM    631  CB  LEU A  95      16.718  87.244 130.053  1.00  0.93           C  
ATOM    632  CG  LEU A  95      15.672  88.029 129.224  1.00  0.93           C  
ATOM    633  CD1 LEU A  95      16.099  89.467 128.897  1.00  0.93           C  
ATOM    634  CD2 LEU A  95      15.357  87.289 127.916  1.00  0.93           C  
ATOM    635  N   GLN A  96      15.249  87.385 132.767  1.00  0.91           N  
ATOM    636  CA  GLN A  96      14.079  87.683 133.572  1.00  0.91           C  
ATOM    637  C   GLN A  96      14.397  88.451 134.854  1.00  0.91           C  
ATOM    638  O   GLN A  96      13.723  89.412 135.220  1.00  0.91           O  
ATOM    639  CB  GLN A  96      13.283  86.398 133.883  1.00  0.91           C  
ATOM    640  CG  GLN A  96      11.803  86.696 134.211  1.00  0.91           C  
ATOM    641  CD  GLN A  96      11.052  85.448 134.673  1.00  0.91           C  
ATOM    642  OE1 GLN A  96      11.593  84.349 134.802  1.00  0.91           O  
ATOM    643  NE2 GLN A  96       9.763  85.651 135.029  1.00  0.91           N  
ATOM    644  N   ASN A  97      15.500  88.081 135.546  1.00  0.93           N  
ATOM    645  CA  ASN A  97      15.974  88.737 136.758  1.00  0.93           C  
ATOM    646  C   ASN A  97      16.351  90.194 136.508  1.00  0.93           C  
ATOM    647  O   ASN A  97      15.994  91.075 137.287  1.00  0.93           O  
ATOM    648  CB  ASN A  97      17.179  87.938 137.339  1.00  0.93           C  
ATOM    649  CG  ASN A  97      17.467  88.107 138.840  1.00  0.93           C  
ATOM    650  OD1 ASN A  97      18.042  87.184 139.431  1.00  0.93           O  
ATOM    651  ND2 ASN A  97      17.117  89.245 139.470  1.00  0.93           N  
ATOM    652  N   THR A  98      17.044  90.486 135.389  1.00  0.94           N  
ATOM    653  CA  THR A  98      17.334  91.852 134.956  1.00  0.94           C  
ATOM    654  C   THR A  98      16.077  92.636 134.641  1.00  0.94           C  
ATOM    655  O   THR A  98      15.910  93.766 135.093  1.00  0.94           O  
ATOM    656  CB  THR A  98      18.256  91.901 133.744  1.00  0.94           C  
ATOM    657  OG1 THR A  98      19.513  91.345 134.092  1.00  0.94           O  
ATOM    658  CG2 THR A  98      18.547  93.342 133.306  1.00  0.94           C  
ATOM    659  N   MET A  99      15.107  92.051 133.906  1.00  0.90           N  
ATOM    660  CA  MET A  99      13.842  92.716 133.631  1.00  0.90           C  
ATOM    661  C   MET A  99      13.028  93.041 134.877  1.00  0.90           C  
ATOM    662  O   MET A  99      12.467  94.128 134.985  1.00  0.90           O  
ATOM    663  CB  MET A  99      12.955  91.903 132.662  1.00  0.90           C  
ATOM    664  CG  MET A  99      13.533  91.813 131.239  1.00  0.90           C  
ATOM    665  SD  MET A  99      12.363  91.233 129.976  1.00  0.90           S  
ATOM    666  CE  MET A  99      12.011  89.617 130.709  1.00  0.90           C  
ATOM    667  N   ILE A 100      12.952  92.124 135.859  1.00  0.90           N  
ATOM    668  CA  ILE A 100      12.307  92.375 137.143  1.00  0.90           C  
ATOM    669  C   ILE A 100      13.010  93.439 137.972  1.00  0.90           C  
ATOM    670  O   ILE A 100      12.372  94.374 138.451  1.00  0.90           O  
ATOM    671  CB  ILE A 100      12.162  91.074 137.926  1.00  0.90           C  
ATOM    672  CG1 ILE A 100      11.150  90.171 137.186  1.00  0.90           C  
ATOM    673  CG2 ILE A 100      11.714  91.322 139.389  1.00  0.90           C  
ATOM    674  CD1 ILE A 100      11.163  88.727 137.679  1.00  0.90           C  
ATOM    675  N   ASN A 101      14.353  93.382 138.111  1.00  0.91           N  
ATOM    676  CA  ASN A 101      15.093  94.318 138.952  1.00  0.91           C  
ATOM    677  C   ASN A 101      15.091  95.744 138.399  1.00  0.91           C  
ATOM    678  O   ASN A 101      15.183  96.713 139.153  1.00  0.91           O  
ATOM    679  CB  ASN A 101      16.548  93.837 139.233  1.00  0.91           C  
ATOM    680  CG  ASN A 101      16.561  92.645 140.195  1.00  0.91           C  
ATOM    681  OD1 ASN A 101      15.549  91.985 140.436  1.00  0.91           O  
ATOM    682  ND2 ASN A 101      17.747  92.354 140.780  1.00  0.91           N  
ATOM    683  N   LEU A 102      14.920  95.905 137.069  1.00  0.90           N  
ATOM    684  CA  LEU A 102      14.778  97.207 136.443  1.00  0.90           C  
ATOM    685  C   LEU A 102      13.328  97.636 136.234  1.00  0.90           C  
ATOM    686  O   LEU A 102      13.084  98.732 135.733  1.00  0.90           O  
ATOM    687  CB  LEU A 102      15.446  97.218 135.044  1.00  0.90           C  
ATOM    688  CG  LEU A 102      16.948  96.872 135.016  1.00  0.90           C  
ATOM    689  CD1 LEU A 102      17.453  96.980 133.569  1.00  0.90           C  
ATOM    690  CD2 LEU A 102      17.787  97.734 135.971  1.00  0.90           C  
ATOM    691  N   GLY A 103      12.329  96.807 136.617  1.00  0.90           N  
ATOM    692  CA  GLY A 103      10.909  97.157 136.507  1.00  0.90           C  
ATOM    693  C   GLY A 103      10.299  97.016 135.132  1.00  0.90           C  
ATOM    694  O   GLY A 103       9.182  97.458 134.880  1.00  0.90           O  
ATOM    695  N   LEU A 104      11.013  96.396 134.180  1.00  0.87           N  
ATOM    696  CA  LEU A 104      10.649  96.422 132.776  1.00  0.87           C  
ATOM    697  C   LEU A 104       9.878  95.198 132.310  1.00  0.87           C  
ATOM    698  O   LEU A 104       9.413  95.168 131.173  1.00  0.87           O  
ATOM    699  CB  LEU A 104      11.927  96.514 131.900  1.00  0.87           C  
ATOM    700  CG  LEU A 104      12.696  97.844 132.019  1.00  0.87           C  
ATOM    701  CD1 LEU A 104      14.048  97.739 131.301  1.00  0.87           C  
ATOM    702  CD2 LEU A 104      11.897  99.025 131.445  1.00  0.87           C  
ATOM    703  N   GLN A 105       9.683  94.165 133.162  1.00  0.85           N  
ATOM    704  CA  GLN A 105       9.140  92.874 132.741  1.00  0.85           C  
ATOM    705  C   GLN A 105       7.787  92.936 132.043  1.00  0.85           C  
ATOM    706  O   GLN A 105       7.633  92.436 130.936  1.00  0.85           O  
ATOM    707  CB  GLN A 105       9.031  91.916 133.959  1.00  0.85           C  
ATOM    708  CG  GLN A 105       8.528  90.490 133.602  1.00  0.85           C  
ATOM    709  CD  GLN A 105       8.414  89.570 134.821  1.00  0.85           C  
ATOM    710  OE1 GLN A 105       9.062  88.529 134.917  1.00  0.85           O  
ATOM    711  NE2 GLN A 105       7.550  89.951 135.789  1.00  0.85           N  
ATOM    712  N   ASN A 106       6.788  93.614 132.638  1.00  0.81           N  
ATOM    713  CA  ASN A 106       5.455  93.767 132.074  1.00  0.81           C  
ATOM    714  C   ASN A 106       5.441  94.558 130.767  1.00  0.81           C  
ATOM    715  O   ASN A 106       4.727  94.232 129.823  1.00  0.81           O  
ATOM    716  CB  ASN A 106       4.504  94.436 133.101  1.00  0.81           C  
ATOM    717  CG  ASN A 106       4.491  93.635 134.403  1.00  0.81           C  
ATOM    718  OD1 ASN A 106       5.482  93.598 135.137  1.00  0.81           O  
ATOM    719  ND2 ASN A 106       3.354  92.974 134.710  1.00  0.81           N  
ATOM    720  N   ALA A 107       6.263  95.623 130.674  1.00  0.89           N  
ATOM    721  CA  ALA A 107       6.429  96.399 129.461  1.00  0.89           C  
ATOM    722  C   ALA A 107       7.065  95.605 128.319  1.00  0.89           C  
ATOM    723  O   ALA A 107       6.639  95.693 127.169  1.00  0.89           O  
ATOM    724  CB  ALA A 107       7.270  97.653 129.774  1.00  0.89           C  
ATOM    725  N   CYS A 108       8.096  94.791 128.626  1.00  0.88           N  
ATOM    726  CA  CYS A 108       8.697  93.851 127.695  1.00  0.88           C  
ATOM    727  C   CYS A 108       7.753  92.745 127.255  1.00  0.88           C  
ATOM    728  O   CYS A 108       7.709  92.416 126.076  1.00  0.88           O  
ATOM    729  CB  CYS A 108       9.974  93.203 128.278  1.00  0.88           C  
ATOM    730  SG  CYS A 108      11.335  94.402 128.479  1.00  0.88           S  
ATOM    731  N   ASP A 109       6.960  92.163 128.175  1.00  0.86           N  
ATOM    732  CA  ASP A 109       5.976  91.126 127.898  1.00  0.86           C  
ATOM    733  C   ASP A 109       4.932  91.583 126.870  1.00  0.86           C  
ATOM    734  O   ASP A 109       4.753  90.981 125.811  1.00  0.86           O  
ATOM    735  CB  ASP A 109       5.338  90.786 129.272  1.00  0.86           C  
ATOM    736  CG  ASP A 109       4.540  89.496 129.289  1.00  0.86           C  
ATOM    737  OD1 ASP A 109       3.928  89.239 130.357  1.00  0.86           O  
ATOM    738  OD2 ASP A 109       4.556  88.763 128.273  1.00  0.86           O  
ATOM    739  N   GLU A 110       4.335  92.772 127.104  1.00  0.82           N  
ATOM    740  CA  GLU A 110       3.439  93.445 126.177  1.00  0.82           C  
ATOM    741  C   GLU A 110       4.103  93.778 124.839  1.00  0.82           C  
ATOM    742  O   GLU A 110       3.555  93.556 123.761  1.00  0.82           O  
ATOM    743  CB  GLU A 110       2.910  94.731 126.860  1.00  0.82           C  
ATOM    744  CG  GLU A 110       1.871  95.549 126.052  1.00  0.82           C  
ATOM    745  CD  GLU A 110       0.556  94.809 125.814  1.00  0.82           C  
ATOM    746  OE1 GLU A 110      -0.086  94.404 126.811  1.00  0.82           O  
ATOM    747  OE2 GLU A 110       0.160  94.697 124.623  1.00  0.82           O  
ATOM    748  N   ALA A 111       5.359  94.275 124.854  1.00  0.90           N  
ATOM    749  CA  ALA A 111       6.117  94.529 123.644  1.00  0.90           C  
ATOM    750  C   ALA A 111       6.384  93.287 122.790  1.00  0.90           C  
ATOM    751  O   ALA A 111       6.187  93.309 121.577  1.00  0.90           O  
ATOM    752  CB  ALA A 111       7.449  95.215 124.012  1.00  0.90           C  
ATOM    753  N   ILE A 112       6.796  92.164 123.412  1.00  0.86           N  
ATOM    754  CA  ILE A 112       6.997  90.870 122.768  1.00  0.86           C  
ATOM    755  C   ILE A 112       5.694  90.280 122.238  1.00  0.86           C  
ATOM    756  O   ILE A 112       5.627  89.821 121.095  1.00  0.86           O  
ATOM    757  CB  ILE A 112       7.734  89.916 123.714  1.00  0.86           C  
ATOM    758  CG1 ILE A 112       9.181  90.405 123.992  1.00  0.86           C  
ATOM    759  CG2 ILE A 112       7.762  88.465 123.190  1.00  0.86           C  
ATOM    760  CD1 ILE A 112      10.097  90.483 122.761  1.00  0.86           C  
ATOM    761  N   TYR A 113       4.596  90.357 123.020  1.00  0.86           N  
ATOM    762  CA  TYR A 113       3.258  89.952 122.613  1.00  0.86           C  
ATOM    763  C   TYR A 113       2.770  90.715 121.375  1.00  0.86           C  
ATOM    764  O   TYR A 113       2.320  90.128 120.391  1.00  0.86           O  
ATOM    765  CB  TYR A 113       2.305  90.168 123.826  1.00  0.86           C  
ATOM    766  CG  TYR A 113       0.859  89.869 123.533  1.00  0.86           C  
ATOM    767  CD1 TYR A 113       0.452  88.582 123.143  1.00  0.86           C  
ATOM    768  CD2 TYR A 113      -0.101  90.891 123.626  1.00  0.86           C  
ATOM    769  CE1 TYR A 113      -0.894  88.326 122.837  1.00  0.86           C  
ATOM    770  CE2 TYR A 113      -1.445  90.637 123.321  1.00  0.86           C  
ATOM    771  CZ  TYR A 113      -1.838  89.354 122.923  1.00  0.86           C  
ATOM    772  OH  TYR A 113      -3.187  89.100 122.611  1.00  0.86           O  
ATOM    773  N   GLN A 114       2.951  92.050 121.343  1.00  0.83           N  
ATOM    774  CA  GLN A 114       2.574  92.878 120.211  1.00  0.83           C  
ATOM    775  C   GLN A 114       3.510  92.763 119.008  1.00  0.83           C  
ATOM    776  O   GLN A 114       3.279  93.388 117.972  1.00  0.83           O  
ATOM    777  CB  GLN A 114       2.537  94.367 120.612  1.00  0.83           C  
ATOM    778  CG  GLN A 114       1.396  94.751 121.574  1.00  0.83           C  
ATOM    779  CD  GLN A 114       1.414  96.259 121.826  1.00  0.83           C  
ATOM    780  OE1 GLN A 114       2.031  97.030 121.076  1.00  0.83           O  
ATOM    781  NE2 GLN A 114       0.720  96.698 122.891  1.00  0.83           N  
ATOM    782  N   LEU A 115       4.590  91.968 119.105  1.00  0.85           N  
ATOM    783  CA  LEU A 115       5.429  91.606 117.979  1.00  0.85           C  
ATOM    784  C   LEU A 115       5.099  90.206 117.478  1.00  0.85           C  
ATOM    785  O   LEU A 115       5.724  89.713 116.533  1.00  0.85           O  
ATOM    786  CB  LEU A 115       6.922  91.664 118.379  1.00  0.85           C  
ATOM    787  CG  LEU A 115       7.457  93.099 118.545  1.00  0.85           C  
ATOM    788  CD1 LEU A 115       8.786  93.079 119.306  1.00  0.85           C  
ATOM    789  CD2 LEU A 115       7.619  93.818 117.196  1.00  0.85           C  
ATOM    790  N   GLY A 116       4.082  89.543 118.073  1.00  0.85           N  
ATOM    791  CA  GLY A 116       3.628  88.217 117.668  1.00  0.85           C  
ATOM    792  C   GLY A 116       4.534  87.108 118.121  1.00  0.85           C  
ATOM    793  O   GLY A 116       4.811  86.183 117.364  1.00  0.85           O  
ATOM    794  N   LEU A 117       5.041  87.195 119.361  1.00  0.82           N  
ATOM    795  CA  LEU A 117       5.963  86.232 119.928  1.00  0.82           C  
ATOM    796  C   LEU A 117       5.567  85.951 121.369  1.00  0.82           C  
ATOM    797  O   LEU A 117       4.794  86.693 121.971  1.00  0.82           O  
ATOM    798  CB  LEU A 117       7.410  86.793 119.921  1.00  0.82           C  
ATOM    799  CG  LEU A 117       8.026  87.011 118.525  1.00  0.82           C  
ATOM    800  CD1 LEU A 117       9.355  87.771 118.642  1.00  0.82           C  
ATOM    801  CD2 LEU A 117       8.232  85.684 117.782  1.00  0.82           C  
ATOM    802  N   ASP A 118       6.103  84.864 121.958  1.00  0.85           N  
ATOM    803  CA  ASP A 118       5.890  84.494 123.341  1.00  0.85           C  
ATOM    804  C   ASP A 118       7.178  84.776 124.117  1.00  0.85           C  
ATOM    805  O   ASP A 118       8.279  84.463 123.667  1.00  0.85           O  
ATOM    806  CB  ASP A 118       5.491  82.997 123.391  1.00  0.85           C  
ATOM    807  CG  ASP A 118       5.266  82.525 124.814  1.00  0.85           C  
ATOM    808  OD1 ASP A 118       4.092  82.494 125.249  1.00  0.85           O  
ATOM    809  OD2 ASP A 118       6.288  82.237 125.490  1.00  0.85           O  
ATOM    810  N   ILE A 119       7.082  85.433 125.294  1.00  0.84           N  
ATOM    811  CA  ILE A 119       8.251  85.768 126.095  1.00  0.84           C  
ATOM    812  C   ILE A 119       8.926  84.575 126.770  1.00  0.84           C  
ATOM    813  O   ILE A 119      10.154  84.490 126.772  1.00  0.84           O  
ATOM    814  CB  ILE A 119       8.006  86.953 127.026  1.00  0.84           C  
ATOM    815  CG1 ILE A 119       9.342  87.602 127.464  1.00  0.84           C  
ATOM    816  CG2 ILE A 119       7.114  86.564 128.223  1.00  0.84           C  
ATOM    817  CD1 ILE A 119       9.177  89.043 127.959  1.00  0.84           C  
ATOM    818  N   GLU A 120       8.162  83.581 127.290  1.00  0.79           N  
ATOM    819  CA  GLU A 120       8.704  82.365 127.890  1.00  0.79           C  
ATOM    820  C   GLU A 120       9.471  81.526 126.877  1.00  0.79           C  
ATOM    821  O   GLU A 120      10.532  80.980 127.180  1.00  0.79           O  
ATOM    822  CB  GLU A 120       7.634  81.474 128.585  1.00  0.79           C  
ATOM    823  CG  GLU A 120       7.105  82.051 129.925  1.00  0.79           C  
ATOM    824  CD  GLU A 120       6.384  81.016 130.775  1.00  0.79           C  
ATOM    825  OE1 GLU A 120       7.011  80.017 131.224  1.00  0.79           O  
ATOM    826  OE2 GLU A 120       5.167  81.175 131.069  1.00  0.79           O  
ATOM    827  N   GLU A 121       8.987  81.448 125.616  1.00  0.80           N  
ATOM    828  CA  GLU A 121       9.713  80.812 124.521  1.00  0.80           C  
ATOM    829  C   GLU A 121      11.087  81.440 124.281  1.00  0.80           C  
ATOM    830  O   GLU A 121      12.097  80.748 124.153  1.00  0.80           O  
ATOM    831  CB  GLU A 121       8.913  80.870 123.193  1.00  0.80           C  
ATOM    832  CG  GLU A 121       9.453  79.905 122.100  1.00  0.80           C  
ATOM    833  CD  GLU A 121       9.047  80.291 120.676  1.00  0.80           C  
ATOM    834  OE1 GLU A 121       7.848  80.578 120.446  1.00  0.80           O  
ATOM    835  OE2 GLU A 121       9.954  80.292 119.798  1.00  0.80           O  
ATOM    836  N   LEU A 122      11.178  82.791 124.282  1.00  0.88           N  
ATOM    837  CA  LEU A 122      12.453  83.488 124.199  1.00  0.88           C  
ATOM    838  C   LEU A 122      13.349  83.251 125.410  1.00  0.88           C  
ATOM    839  O   LEU A 122      14.544  83.006 125.275  1.00  0.88           O  
ATOM    840  CB  LEU A 122      12.298  85.021 124.008  1.00  0.88           C  
ATOM    841  CG  LEU A 122      11.430  85.467 122.811  1.00  0.88           C  
ATOM    842  CD1 LEU A 122      11.584  86.975 122.566  1.00  0.88           C  
ATOM    843  CD2 LEU A 122      11.714  84.684 121.523  1.00  0.88           C  
ATOM    844  N   GLU A 123      12.790  83.295 126.633  1.00  0.88           N  
ATOM    845  CA  GLU A 123      13.513  83.050 127.870  1.00  0.88           C  
ATOM    846  C   GLU A 123      14.068  81.642 128.024  1.00  0.88           C  
ATOM    847  O   GLU A 123      15.154  81.455 128.572  1.00  0.88           O  
ATOM    848  CB  GLU A 123      12.669  83.441 129.096  1.00  0.88           C  
ATOM    849  CG  GLU A 123      12.511  84.975 129.200  1.00  0.88           C  
ATOM    850  CD  GLU A 123      11.808  85.420 130.474  1.00  0.88           C  
ATOM    851  OE1 GLU A 123      11.992  86.614 130.826  1.00  0.88           O  
ATOM    852  OE2 GLU A 123      11.120  84.591 131.114  1.00  0.88           O  
ATOM    853  N   GLU A 124      13.376  80.600 127.514  1.00  0.84           N  
ATOM    854  CA  GLU A 124      13.900  79.243 127.538  1.00  0.84           C  
ATOM    855  C   GLU A 124      15.132  79.017 126.664  1.00  0.84           C  
ATOM    856  O   GLU A 124      15.904  78.095 126.917  1.00  0.84           O  
ATOM    857  CB  GLU A 124      12.830  78.167 127.220  1.00  0.84           C  
ATOM    858  CG  GLU A 124      11.847  77.867 128.385  1.00  0.84           C  
ATOM    859  CD  GLU A 124      12.545  77.441 129.662  1.00  0.84           C  
ATOM    860  OE1 GLU A 124      13.490  76.615 129.637  1.00  0.84           O  
ATOM    861  OE2 GLU A 124      12.222  77.991 130.750  1.00  0.84           O  
ATOM    862  N   ILE A 125      15.386  79.885 125.660  1.00  0.88           N  
ATOM    863  CA  ILE A 125      16.627  79.897 124.890  1.00  0.88           C  
ATOM    864  C   ILE A 125      17.853  80.200 125.739  1.00  0.88           C  
ATOM    865  O   ILE A 125      18.938  79.694 125.470  1.00  0.88           O  
ATOM    866  CB  ILE A 125      16.575  80.894 123.731  1.00  0.88           C  
ATOM    867  CG1 ILE A 125      15.426  80.583 122.743  1.00  0.88           C  
ATOM    868  CG2 ILE A 125      17.925  80.967 122.981  1.00  0.88           C  
ATOM    869  CD1 ILE A 125      15.565  79.257 121.981  1.00  0.88           C  
ATOM    870  N   GLU A 126      17.737  81.053 126.778  1.00  0.90           N  
ATOM    871  CA  GLU A 126      18.868  81.385 127.625  1.00  0.90           C  
ATOM    872  C   GLU A 126      19.443  80.179 128.368  1.00  0.90           C  
ATOM    873  O   GLU A 126      18.836  79.629 129.289  1.00  0.90           O  
ATOM    874  CB  GLU A 126      18.513  82.513 128.627  1.00  0.90           C  
ATOM    875  CG  GLU A 126      19.736  83.097 129.383  1.00  0.90           C  
ATOM    876  CD  GLU A 126      19.404  84.287 130.274  1.00  0.90           C  
ATOM    877  OE1 GLU A 126      18.230  84.482 130.670  1.00  0.90           O  
ATOM    878  OE2 GLU A 126      20.352  85.027 130.644  1.00  0.90           O  
ATOM    879  N   GLU A 127      20.648  79.726 127.970  1.00  0.89           N  
ATOM    880  CA  GLU A 127      21.400  78.698 128.657  1.00  0.89           C  
ATOM    881  C   GLU A 127      21.708  79.133 130.107  1.00  0.89           C  
ATOM    882  O   GLU A 127      22.091  80.279 130.347  1.00  0.89           O  
ATOM    883  CB  GLU A 127      22.716  78.349 127.881  1.00  0.89           C  
ATOM    884  CG  GLU A 127      22.848  78.834 126.390  1.00  0.89           C  
ATOM    885  CD  GLU A 127      22.019  78.166 125.280  1.00  0.89           C  
ATOM    886  OE1 GLU A 127      21.937  78.788 124.177  1.00  0.89           O  
ATOM    887  OE2 GLU A 127      21.506  77.037 125.452  1.00  0.89           O  
ATOM    888  N   ASP A 128      21.530  78.267 131.137  1.00  0.92           N  
ATOM    889  CA  ASP A 128      21.872  78.627 132.509  1.00  0.92           C  
ATOM    890  C   ASP A 128      23.360  78.955 132.689  1.00  0.92           C  
ATOM    891  O   ASP A 128      24.239  78.228 132.233  1.00  0.92           O  
ATOM    892  CB  ASP A 128      21.550  77.489 133.530  1.00  0.92           C  
ATOM    893  CG  ASP A 128      20.075  77.275 133.789  1.00  0.92           C  
ATOM    894  OD1 ASP A 128      19.614  77.585 134.920  1.00  0.92           O  
ATOM    895  OD2 ASP A 128      19.371  76.714 132.908  1.00  0.92           O  
ATOM    896  N   ALA A 129      23.700  80.031 133.431  1.00  0.95           N  
ATOM    897  CA  ALA A 129      25.060  80.243 133.885  1.00  0.95           C  
ATOM    898  C   ALA A 129      25.380  79.322 135.065  1.00  0.95           C  
ATOM    899  O   ALA A 129      25.273  79.685 136.240  1.00  0.95           O  
ATOM    900  CB  ALA A 129      25.286  81.725 134.236  1.00  0.95           C  
ATOM    901  N   GLY A 130      25.752  78.064 134.747  1.00  0.85           N  
ATOM    902  CA  GLY A 130      25.947  76.955 135.673  1.00  0.85           C  
ATOM    903  C   GLY A 130      27.266  76.935 136.393  1.00  0.85           C  
ATOM    904  O   GLY A 130      27.865  75.884 136.591  1.00  0.85           O  
ATOM    905  N   LEU A 131      27.783  78.094 136.819  1.00  0.90           N  
ATOM    906  CA  LEU A 131      29.136  78.212 137.332  1.00  0.90           C  
ATOM    907  C   LEU A 131      29.242  77.955 138.833  1.00  0.90           C  
ATOM    908  O   LEU A 131      30.035  78.587 139.526  1.00  0.90           O  
ATOM    909  CB  LEU A 131      29.734  79.604 136.998  1.00  0.90           C  
ATOM    910  CG  LEU A 131      29.575  80.055 135.530  1.00  0.90           C  
ATOM    911  CD1 LEU A 131      30.193  81.447 135.342  1.00  0.90           C  
ATOM    912  CD2 LEU A 131      30.189  79.070 134.526  1.00  0.90           C  
ATOM    913  N   GLY A 132      28.451  77.014 139.385  1.00  0.92           N  
ATOM    914  CA  GLY A 132      28.532  76.630 140.787  1.00  0.92           C  
ATOM    915  C   GLY A 132      27.959  75.260 140.997  1.00  0.92           C  
ATOM    916  O   GLY A 132      27.170  74.774 140.193  1.00  0.92           O  
ATOM    917  N   ASN A 133      28.360  74.580 142.085  1.00  0.84           N  
ATOM    918  CA  ASN A 133      27.937  73.224 142.376  1.00  0.84           C  
ATOM    919  C   ASN A 133      26.554  73.123 142.973  1.00  0.84           C  
ATOM    920  O   ASN A 133      25.772  72.237 142.620  1.00  0.84           O  
ATOM    921  CB  ASN A 133      28.915  72.568 143.383  1.00  0.84           C  
ATOM    922  CG  ASN A 133      30.039  71.944 142.580  1.00  0.84           C  
ATOM    923  OD1 ASN A 133      29.781  70.934 141.914  1.00  0.84           O  
ATOM    924  ND2 ASN A 133      31.248  72.532 142.611  1.00  0.84           N  
ATOM    925  N   GLY A 134      26.243  74.002 143.934  1.00  0.92           N  
ATOM    926  CA  GLY A 134      25.068  73.804 144.758  1.00  0.92           C  
ATOM    927  C   GLY A 134      24.816  74.971 145.654  1.00  0.92           C  
ATOM    928  O   GLY A 134      24.620  76.098 145.208  1.00  0.92           O  
ATOM    929  N   GLY A 135      24.782  74.730 146.980  1.00  0.93           N  
ATOM    930  CA  GLY A 135      24.435  75.767 147.950  1.00  0.93           C  
ATOM    931  C   GLY A 135      25.458  76.866 148.073  1.00  0.93           C  
ATOM    932  O   GLY A 135      25.101  78.029 148.244  1.00  0.93           O  
ATOM    933  N   LEU A 136      26.751  76.508 147.950  1.00  0.89           N  
ATOM    934  CA  LEU A 136      27.892  77.402 148.059  1.00  0.89           C  
ATOM    935  C   LEU A 136      27.894  78.525 147.026  1.00  0.89           C  
ATOM    936  O   LEU A 136      27.817  79.709 147.364  1.00  0.89           O  
ATOM    937  CB  LEU A 136      29.166  76.526 147.913  1.00  0.89           C  
ATOM    938  CG  LEU A 136      30.528  77.248 147.951  1.00  0.89           C  
ATOM    939  CD1 LEU A 136      30.731  78.034 149.251  1.00  0.89           C  
ATOM    940  CD2 LEU A 136      31.660  76.224 147.777  1.00  0.89           C  
ATOM    941  N   GLY A 137      27.873  78.182 145.719  1.00  0.94           N  
ATOM    942  CA  GLY A 137      27.797  79.181 144.664  1.00  0.94           C  
ATOM    943  C   GLY A 137      26.462  79.843 144.501  1.00  0.94           C  
ATOM    944  O   GLY A 137      26.362  80.938 143.950  1.00  0.94           O  
ATOM    945  N   ARG A 138      25.368  79.207 144.957  1.00  0.89           N  
ATOM    946  CA  ARG A 138      24.059  79.830 144.911  1.00  0.89           C  
ATOM    947  C   ARG A 138      23.884  80.904 145.966  1.00  0.89           C  
ATOM    948  O   ARG A 138      23.210  81.906 145.721  1.00  0.89           O  
ATOM    949  CB  ARG A 138      22.923  78.787 144.978  1.00  0.89           C  
ATOM    950  CG  ARG A 138      21.511  79.321 144.640  1.00  0.89           C  
ATOM    951  CD  ARG A 138      21.392  80.002 143.264  1.00  0.89           C  
ATOM    952  NE  ARG A 138      21.375  81.491 143.468  1.00  0.89           N  
ATOM    953  CZ  ARG A 138      21.040  82.351 142.493  1.00  0.89           C  
ATOM    954  NH1 ARG A 138      20.927  81.935 141.237  1.00  0.89           N  
ATOM    955  NH2 ARG A 138      20.867  83.639 142.775  1.00  0.89           N  
ATOM    956  N   LEU A 139      24.524  80.742 147.144  1.00  0.95           N  
ATOM    957  CA  LEU A 139      24.607  81.773 148.161  1.00  0.95           C  
ATOM    958  C   LEU A 139      25.337  83.008 147.656  1.00  0.95           C  
ATOM    959  O   LEU A 139      24.850  84.128 147.791  1.00  0.95           O  
ATOM    960  CB  LEU A 139      25.334  81.236 149.416  1.00  0.95           C  
ATOM    961  CG  LEU A 139      25.261  82.173 150.638  1.00  0.95           C  
ATOM    962  CD1 LEU A 139      23.844  82.222 151.230  1.00  0.95           C  
ATOM    963  CD2 LEU A 139      26.261  81.735 151.712  1.00  0.95           C  
ATOM    964  N   ALA A 140      26.481  82.813 146.963  1.00  0.97           N  
ATOM    965  CA  ALA A 140      27.243  83.875 146.332  1.00  0.97           C  
ATOM    966  C   ALA A 140      26.434  84.662 145.305  1.00  0.97           C  
ATOM    967  O   ALA A 140      26.387  85.890 145.314  1.00  0.97           O  
ATOM    968  CB  ALA A 140      28.466  83.245 145.635  1.00  0.97           C  
ATOM    969  N   ALA A 141      25.700  83.947 144.437  1.00  0.97           N  
ATOM    970  CA  ALA A 141      24.776  84.517 143.486  1.00  0.97           C  
ATOM    971  C   ALA A 141      23.578  85.258 144.098  1.00  0.97           C  
ATOM    972  O   ALA A 141      23.126  86.273 143.574  1.00  0.97           O  
ATOM    973  CB  ALA A 141      24.325  83.384 142.551  1.00  0.97           C  
ATOM    974  N   CYS A 142      23.002  84.777 145.225  1.00  0.97           N  
ATOM    975  CA  CYS A 142      22.005  85.527 145.992  1.00  0.97           C  
ATOM    976  C   CYS A 142      22.567  86.797 146.613  1.00  0.97           C  
ATOM    977  O   CYS A 142      21.953  87.862 146.559  1.00  0.97           O  
ATOM    978  CB  CYS A 142      21.392  84.672 147.134  1.00  0.97           C  
ATOM    979  SG  CYS A 142      20.373  83.293 146.509  1.00  0.97           S  
ATOM    980  N   PHE A 143      23.781  86.713 147.187  1.00  0.96           N  
ATOM    981  CA  PHE A 143      24.469  87.819 147.821  1.00  0.96           C  
ATOM    982  C   PHE A 143      24.751  88.977 146.880  1.00  0.96           C  
ATOM    983  O   PHE A 143      24.592  90.130 147.269  1.00  0.96           O  
ATOM    984  CB  PHE A 143      25.789  87.348 148.492  1.00  0.96           C  
ATOM    985  CG  PHE A 143      25.609  86.627 149.813  1.00  0.96           C  
ATOM    986  CD1 PHE A 143      24.367  86.309 150.403  1.00  0.96           C  
ATOM    987  CD2 PHE A 143      26.778  86.293 150.514  1.00  0.96           C  
ATOM    988  CE1 PHE A 143      24.305  85.693 151.660  1.00  0.96           C  
ATOM    989  CE2 PHE A 143      26.725  85.670 151.766  1.00  0.96           C  
ATOM    990  CZ  PHE A 143      25.484  85.371 152.340  1.00  0.96           C  
ATOM    991  N   LEU A 144      25.130  88.727 145.608  1.00  0.96           N  
ATOM    992  CA  LEU A 144      25.327  89.795 144.635  1.00  0.96           C  
ATOM    993  C   LEU A 144      24.081  90.657 144.388  1.00  0.96           C  
ATOM    994  O   LEU A 144      24.167  91.887 144.392  1.00  0.96           O  
ATOM    995  CB  LEU A 144      25.822  89.245 143.271  1.00  0.96           C  
ATOM    996  CG  LEU A 144      27.198  88.545 143.272  1.00  0.96           C  
ATOM    997  CD1 LEU A 144      27.557  88.110 141.844  1.00  0.96           C  
ATOM    998  CD2 LEU A 144      28.321  89.420 143.847  1.00  0.96           C  
ATOM    999  N   ASP A 145      22.888  90.035 144.227  1.00  0.95           N  
ATOM   1000  CA  ASP A 145      21.604  90.711 144.072  1.00  0.95           C  
ATOM   1001  C   ASP A 145      21.264  91.555 145.308  1.00  0.95           C  
ATOM   1002  O   ASP A 145      20.900  92.729 145.208  1.00  0.95           O  
ATOM   1003  CB  ASP A 145      20.531  89.617 143.759  1.00  0.95           C  
ATOM   1004  CG  ASP A 145      19.097  90.117 143.651  1.00  0.95           C  
ATOM   1005  OD1 ASP A 145      18.523  90.137 142.536  1.00  0.95           O  
ATOM   1006  OD2 ASP A 145      18.507  90.402 144.729  1.00  0.95           O  
ATOM   1007  N   SER A 146      21.447  90.994 146.520  1.00  0.96           N  
ATOM   1008  CA  SER A 146      21.274  91.721 147.774  1.00  0.96           C  
ATOM   1009  C   SER A 146      22.238  92.870 147.991  1.00  0.96           C  
ATOM   1010  O   SER A 146      21.831  93.959 148.387  1.00  0.96           O  
ATOM   1011  CB  SER A 146      21.367  90.799 149.006  1.00  0.96           C  
ATOM   1012  OG  SER A 146      20.197  89.996 149.089  1.00  0.96           O  
ATOM   1013  N   MET A 147      23.546  92.697 147.712  1.00  0.94           N  
ATOM   1014  CA  MET A 147      24.522  93.773 147.802  1.00  0.94           C  
ATOM   1015  C   MET A 147      24.263  94.916 146.829  1.00  0.94           C  
ATOM   1016  O   MET A 147      24.375  96.081 147.199  1.00  0.94           O  
ATOM   1017  CB  MET A 147      25.973  93.256 147.641  1.00  0.94           C  
ATOM   1018  CG  MET A 147      26.436  92.391 148.832  1.00  0.94           C  
ATOM   1019  SD  MET A 147      28.199  91.947 148.853  1.00  0.94           S  
ATOM   1020  CE  MET A 147      28.172  90.829 147.428  1.00  0.94           C  
ATOM   1021  N   ALA A 148      23.870  94.622 145.571  1.00  0.96           N  
ATOM   1022  CA  ALA A 148      23.418  95.628 144.625  1.00  0.96           C  
ATOM   1023  C   ALA A 148      22.126  96.337 145.040  1.00  0.96           C  
ATOM   1024  O   ALA A 148      22.008  97.559 144.965  1.00  0.96           O  
ATOM   1025  CB  ALA A 148      23.254  94.971 143.242  1.00  0.96           C  
ATOM   1026  N   THR A 149      21.130  95.583 145.548  1.00  0.93           N  
ATOM   1027  CA  THR A 149      19.857  96.101 146.064  1.00  0.93           C  
ATOM   1028  C   THR A 149      20.028  97.018 147.262  1.00  0.93           C  
ATOM   1029  O   THR A 149      19.319  98.011 147.408  1.00  0.93           O  
ATOM   1030  CB  THR A 149      18.861  94.991 146.386  1.00  0.93           C  
ATOM   1031  OG1 THR A 149      18.583  94.261 145.197  1.00  0.93           O  
ATOM   1032  CG2 THR A 149      17.508  95.537 146.867  1.00  0.93           C  
ATOM   1033  N   LEU A 150      21.013  96.734 148.135  1.00  0.90           N  
ATOM   1034  CA  LEU A 150      21.339  97.565 149.282  1.00  0.90           C  
ATOM   1035  C   LEU A 150      22.447  98.577 149.002  1.00  0.90           C  
ATOM   1036  O   LEU A 150      22.931  99.233 149.921  1.00  0.90           O  
ATOM   1037  CB  LEU A 150      21.788  96.670 150.466  1.00  0.90           C  
ATOM   1038  CG  LEU A 150      20.693  95.725 151.004  1.00  0.90           C  
ATOM   1039  CD1 LEU A 150      21.304  94.729 151.997  1.00  0.90           C  
ATOM   1040  CD2 LEU A 150      19.529  96.489 151.652  1.00  0.90           C  
ATOM   1041  N   GLY A 151      22.887  98.734 147.733  1.00  0.91           N  
ATOM   1042  CA  GLY A 151      23.754  99.839 147.314  1.00  0.91           C  
ATOM   1043  C   GLY A 151      25.204  99.738 147.686  1.00  0.91           C  
ATOM   1044  O   GLY A 151      25.972 100.678 147.503  1.00  0.91           O  
ATOM   1045  N   LEU A 152      25.636  98.597 148.241  1.00  0.91           N  
ATOM   1046  CA  LEU A 152      27.013  98.392 148.634  1.00  0.91           C  
ATOM   1047  C   LEU A 152      27.966  98.382 147.450  1.00  0.91           C  
ATOM   1048  O   LEU A 152      27.657  97.839 146.388  1.00  0.91           O  
ATOM   1049  CB  LEU A 152      27.192  97.086 149.448  1.00  0.91           C  
ATOM   1050  CG  LEU A 152      26.347  97.007 150.737  1.00  0.91           C  
ATOM   1051  CD1 LEU A 152      26.618  95.683 151.463  1.00  0.91           C  
ATOM   1052  CD2 LEU A 152      26.615  98.184 151.685  1.00  0.91           C  
ATOM   1053  N   ALA A 153      29.178  98.957 147.625  1.00  0.92           N  
ATOM   1054  CA  ALA A 153      30.223  98.990 146.621  1.00  0.92           C  
ATOM   1055  C   ALA A 153      30.885  97.630 146.446  1.00  0.92           C  
ATOM   1056  O   ALA A 153      32.026  97.389 146.840  1.00  0.92           O  
ATOM   1057  CB  ALA A 153      31.259 100.075 146.977  1.00  0.92           C  
ATOM   1058  N   ALA A 154      30.127  96.687 145.872  1.00  0.95           N  
ATOM   1059  CA  ALA A 154      30.412  95.284 145.943  1.00  0.95           C  
ATOM   1060  C   ALA A 154      30.697  94.677 144.589  1.00  0.95           C  
ATOM   1061  O   ALA A 154      30.002  94.906 143.600  1.00  0.95           O  
ATOM   1062  CB  ALA A 154      29.233  94.543 146.589  1.00  0.95           C  
ATOM   1063  N   TYR A 155      31.756  93.860 144.545  1.00  0.95           N  
ATOM   1064  CA  TYR A 155      32.226  93.209 143.349  1.00  0.95           C  
ATOM   1065  C   TYR A 155      32.261  91.712 143.595  1.00  0.95           C  
ATOM   1066  O   TYR A 155      32.767  91.240 144.614  1.00  0.95           O  
ATOM   1067  CB  TYR A 155      33.666  93.654 142.981  1.00  0.95           C  
ATOM   1068  CG  TYR A 155      33.767  95.123 142.660  1.00  0.95           C  
ATOM   1069  CD1 TYR A 155      33.742  95.554 141.326  1.00  0.95           C  
ATOM   1070  CD2 TYR A 155      33.916  96.086 143.675  1.00  0.95           C  
ATOM   1071  CE1 TYR A 155      33.805  96.917 141.011  1.00  0.95           C  
ATOM   1072  CE2 TYR A 155      33.977  97.452 143.366  1.00  0.95           C  
ATOM   1073  CZ  TYR A 155      33.923  97.867 142.032  1.00  0.95           C  
ATOM   1074  OH  TYR A 155      34.013  99.234 141.698  1.00  0.95           O  
ATOM   1075  N   GLY A 156      31.732  90.913 142.649  1.00  0.98           N  
ATOM   1076  CA  GLY A 156      31.922  89.465 142.665  1.00  0.98           C  
ATOM   1077  C   GLY A 156      33.135  89.117 141.859  1.00  0.98           C  
ATOM   1078  O   GLY A 156      33.307  89.638 140.763  1.00  0.98           O  
ATOM   1079  N   TYR A 157      34.002  88.228 142.362  1.00  0.96           N  
ATOM   1080  CA  TYR A 157      35.209  87.834 141.662  1.00  0.96           C  
ATOM   1081  C   TYR A 157      35.297  86.327 141.569  1.00  0.96           C  
ATOM   1082  O   TYR A 157      35.334  85.624 142.581  1.00  0.96           O  
ATOM   1083  CB  TYR A 157      36.462  88.356 142.396  1.00  0.96           C  
ATOM   1084  CG  TYR A 157      36.821  89.722 141.896  1.00  0.96           C  
ATOM   1085  CD1 TYR A 157      36.327  90.886 142.503  1.00  0.96           C  
ATOM   1086  CD2 TYR A 157      37.717  89.839 140.823  1.00  0.96           C  
ATOM   1087  CE1 TYR A 157      36.785  92.142 142.077  1.00  0.96           C  
ATOM   1088  CE2 TYR A 157      38.209  91.091 140.433  1.00  0.96           C  
ATOM   1089  CZ  TYR A 157      37.750  92.240 141.078  1.00  0.96           C  
ATOM   1090  OH  TYR A 157      38.252  93.509 140.749  1.00  0.96           O  
ATOM   1091  N   GLY A 158      35.330  85.797 140.328  1.00  0.99           N  
ATOM   1092  CA  GLY A 158      35.368  84.359 140.091  1.00  0.99           C  
ATOM   1093  C   GLY A 158      36.051  83.980 138.806  1.00  0.99           C  
ATOM   1094  O   GLY A 158      36.751  84.767 138.173  1.00  0.99           O  
ATOM   1095  N   ILE A 159      35.839  82.730 138.362  1.00  0.97           N  
ATOM   1096  CA  ILE A 159      36.422  82.199 137.140  1.00  0.97           C  
ATOM   1097  C   ILE A 159      35.340  82.089 136.089  1.00  0.97           C  
ATOM   1098  O   ILE A 159      34.244  81.584 136.328  1.00  0.97           O  
ATOM   1099  CB  ILE A 159      37.079  80.830 137.340  1.00  0.97           C  
ATOM   1100  CG1 ILE A 159      38.182  80.938 138.413  1.00  0.97           C  
ATOM   1101  CG2 ILE A 159      37.661  80.295 136.008  1.00  0.97           C  
ATOM   1102  CD1 ILE A 159      38.895  79.616 138.706  1.00  0.97           C  
ATOM   1103  N   ARG A 160      35.629  82.561 134.864  1.00  0.91           N  
ATOM   1104  CA  ARG A 160      34.769  82.356 133.722  1.00  0.91           C  
ATOM   1105  C   ARG A 160      35.076  81.002 133.114  1.00  0.91           C  
ATOM   1106  O   ARG A 160      35.857  80.875 132.168  1.00  0.91           O  
ATOM   1107  CB  ARG A 160      34.974  83.488 132.696  1.00  0.91           C  
ATOM   1108  CG  ARG A 160      34.018  83.464 131.489  1.00  0.91           C  
ATOM   1109  CD  ARG A 160      34.174  84.733 130.650  1.00  0.91           C  
ATOM   1110  NE  ARG A 160      33.399  84.577 129.389  1.00  0.91           N  
ATOM   1111  CZ  ARG A 160      33.879  84.038 128.265  1.00  0.91           C  
ATOM   1112  NH1 ARG A 160      35.054  83.415 128.219  1.00  0.91           N  
ATOM   1113  NH2 ARG A 160      33.161  84.127 127.151  1.00  0.91           N  
ATOM   1114  N   TYR A 161      34.481  79.940 133.701  1.00  0.91           N  
ATOM   1115  CA  TYR A 161      34.568  78.591 133.182  1.00  0.91           C  
ATOM   1116  C   TYR A 161      33.922  78.477 131.812  1.00  0.91           C  
ATOM   1117  O   TYR A 161      32.814  78.963 131.589  1.00  0.91           O  
ATOM   1118  CB  TYR A 161      33.917  77.520 134.098  1.00  0.91           C  
ATOM   1119  CG  TYR A 161      34.434  77.572 135.508  1.00  0.91           C  
ATOM   1120  CD1 TYR A 161      35.716  77.092 135.828  1.00  0.91           C  
ATOM   1121  CD2 TYR A 161      33.609  78.045 136.542  1.00  0.91           C  
ATOM   1122  CE1 TYR A 161      36.153  77.066 137.162  1.00  0.91           C  
ATOM   1123  CE2 TYR A 161      34.047  78.028 137.872  1.00  0.91           C  
ATOM   1124  CZ  TYR A 161      35.315  77.527 138.182  1.00  0.91           C  
ATOM   1125  OH  TYR A 161      35.741  77.474 139.523  1.00  0.91           O  
ATOM   1126  N   GLU A 162      34.598  77.812 130.858  1.00  0.87           N  
ATOM   1127  CA  GLU A 162      34.012  77.517 129.563  1.00  0.87           C  
ATOM   1128  C   GLU A 162      32.848  76.538 129.662  1.00  0.87           C  
ATOM   1129  O   GLU A 162      31.830  76.682 128.990  1.00  0.87           O  
ATOM   1130  CB  GLU A 162      35.076  77.017 128.562  1.00  0.87           C  
ATOM   1131  CG  GLU A 162      34.542  76.946 127.111  1.00  0.87           C  
ATOM   1132  CD  GLU A 162      35.565  76.387 126.135  1.00  0.87           C  
ATOM   1133  OE1 GLU A 162      36.789  76.579 126.345  1.00  0.87           O  
ATOM   1134  OE2 GLU A 162      35.116  75.732 125.155  1.00  0.87           O  
ATOM   1135  N   TYR A 163      32.985  75.535 130.549  1.00  0.87           N  
ATOM   1136  CA  TYR A 163      31.963  74.555 130.842  1.00  0.87           C  
ATOM   1137  C   TYR A 163      31.638  74.582 132.336  1.00  0.87           C  
ATOM   1138  O   TYR A 163      32.526  74.466 133.184  1.00  0.87           O  
ATOM   1139  CB  TYR A 163      32.444  73.128 130.450  1.00  0.87           C  
ATOM   1140  CG  TYR A 163      32.771  73.039 128.979  1.00  0.87           C  
ATOM   1141  CD1 TYR A 163      34.062  73.322 128.498  1.00  0.87           C  
ATOM   1142  CD2 TYR A 163      31.783  72.667 128.056  1.00  0.87           C  
ATOM   1143  CE1 TYR A 163      34.346  73.277 127.129  1.00  0.87           C  
ATOM   1144  CE2 TYR A 163      32.062  72.619 126.683  1.00  0.87           C  
ATOM   1145  CZ  TYR A 163      33.343  72.942 126.223  1.00  0.87           C  
ATOM   1146  OH  TYR A 163      33.665  72.895 124.856  1.00  0.87           O  
ATOM   1147  N   GLY A 164      30.350  74.751 132.712  1.00  0.91           N  
ATOM   1148  CA  GLY A 164      29.909  74.758 134.104  1.00  0.91           C  
ATOM   1149  C   GLY A 164      29.570  73.392 134.651  1.00  0.91           C  
ATOM   1150  O   GLY A 164      30.154  72.369 134.291  1.00  0.91           O  
ATOM   1151  N   ILE A 165      28.609  73.335 135.597  1.00  0.83           N  
ATOM   1152  CA  ILE A 165      28.123  72.088 136.171  1.00  0.83           C  
ATOM   1153  C   ILE A 165      27.331  71.243 135.172  1.00  0.83           C  
ATOM   1154  O   ILE A 165      26.178  71.528 134.845  1.00  0.83           O  
ATOM   1155  CB  ILE A 165      27.377  72.288 137.501  1.00  0.83           C  
ATOM   1156  CG1 ILE A 165      27.058  70.961 138.231  1.00  0.83           C  
ATOM   1157  CG2 ILE A 165      26.099  73.143 137.345  1.00  0.83           C  
ATOM   1158  CD1 ILE A 165      28.301  70.205 138.708  1.00  0.83           C  
ATOM   1159  N   PHE A 166      27.965  70.151 134.678  1.00  0.85           N  
ATOM   1160  CA  PHE A 166      27.518  69.222 133.642  1.00  0.85           C  
ATOM   1161  C   PHE A 166      26.022  69.077 133.377  1.00  0.85           C  
ATOM   1162  O   PHE A 166      25.188  69.018 134.282  1.00  0.85           O  
ATOM   1163  CB  PHE A 166      28.157  67.812 133.814  1.00  0.85           C  
ATOM   1164  CG  PHE A 166      27.665  67.092 135.041  1.00  0.85           C  
ATOM   1165  CD1 PHE A 166      28.338  67.211 136.269  1.00  0.85           C  
ATOM   1166  CD2 PHE A 166      26.514  66.288 134.968  1.00  0.85           C  
ATOM   1167  CE1 PHE A 166      27.856  66.555 137.409  1.00  0.85           C  
ATOM   1168  CE2 PHE A 166      26.027  65.634 136.103  1.00  0.85           C  
ATOM   1169  CZ  PHE A 166      26.701  65.771 137.320  1.00  0.85           C  
ATOM   1170  N   ASN A 167      25.619  68.986 132.099  1.00  0.84           N  
ATOM   1171  CA  ASN A 167      24.236  68.717 131.757  1.00  0.84           C  
ATOM   1172  C   ASN A 167      23.934  67.263 132.072  1.00  0.84           C  
ATOM   1173  O   ASN A 167      24.575  66.346 131.573  1.00  0.84           O  
ATOM   1174  CB  ASN A 167      23.911  69.032 130.272  1.00  0.84           C  
ATOM   1175  CG  ASN A 167      23.752  70.532 129.990  1.00  0.84           C  
ATOM   1176  OD1 ASN A 167      23.075  70.894 129.030  1.00  0.84           O  
ATOM   1177  ND2 ASN A 167      24.330  71.401 130.847  1.00  0.84           N  
ATOM   1178  N   GLN A 168      22.968  67.023 132.967  1.00  0.84           N  
ATOM   1179  CA  GLN A 168      22.655  65.684 133.410  1.00  0.84           C  
ATOM   1180  C   GLN A 168      21.602  65.076 132.512  1.00  0.84           C  
ATOM   1181  O   GLN A 168      20.585  65.700 132.218  1.00  0.84           O  
ATOM   1182  CB  GLN A 168      22.133  65.733 134.863  1.00  0.84           C  
ATOM   1183  CG  GLN A 168      21.702  64.382 135.480  1.00  0.84           C  
ATOM   1184  CD  GLN A 168      21.038  64.615 136.837  1.00  0.84           C  
ATOM   1185  OE1 GLN A 168      20.214  65.522 136.980  1.00  0.84           O  
ATOM   1186  NE2 GLN A 168      21.403  63.813 137.859  1.00  0.84           N  
ATOM   1187  N   LYS A 169      21.838  63.837 132.061  1.00  0.84           N  
ATOM   1188  CA  LYS A 169      20.834  63.042 131.393  1.00  0.84           C  
ATOM   1189  C   LYS A 169      20.686  61.747 132.151  1.00  0.84           C  
ATOM   1190  O   LYS A 169      21.657  61.198 132.669  1.00  0.84           O  
ATOM   1191  CB  LYS A 169      21.258  62.669 129.954  1.00  0.84           C  
ATOM   1192  CG  LYS A 169      21.570  63.862 129.037  1.00  0.84           C  
ATOM   1193  CD  LYS A 169      20.354  64.714 128.624  1.00  0.84           C  
ATOM   1194  CE  LYS A 169      20.711  65.963 127.799  1.00  0.84           C  
ATOM   1195  NZ  LYS A 169      21.356  65.588 126.535  1.00  0.84           N  
ATOM   1196  N   ILE A 170      19.470  61.199 132.225  1.00  0.86           N  
ATOM   1197  CA  ILE A 170      19.265  59.840 132.676  1.00  0.86           C  
ATOM   1198  C   ILE A 170      19.247  58.918 131.473  1.00  0.86           C  
ATOM   1199  O   ILE A 170      18.539  59.132 130.487  1.00  0.86           O  
ATOM   1200  CB  ILE A 170      18.006  59.699 133.520  1.00  0.86           C  
ATOM   1201  CG1 ILE A 170      18.151  60.479 134.852  1.00  0.86           C  
ATOM   1202  CG2 ILE A 170      17.669  58.220 133.791  1.00  0.86           C  
ATOM   1203  CD1 ILE A 170      19.231  59.970 135.816  1.00  0.86           C  
ATOM   1204  N   ARG A 171      20.059  57.849 131.491  1.00  0.79           N  
ATOM   1205  CA  ARG A 171      19.996  56.804 130.490  1.00  0.79           C  
ATOM   1206  C   ARG A 171      19.935  55.485 131.225  1.00  0.79           C  
ATOM   1207  O   ARG A 171      20.745  55.229 132.111  1.00  0.79           O  
ATOM   1208  CB  ARG A 171      21.194  56.858 129.505  1.00  0.79           C  
ATOM   1209  CG  ARG A 171      20.793  56.600 128.036  1.00  0.79           C  
ATOM   1210  CD  ARG A 171      20.563  57.856 127.176  1.00  0.79           C  
ATOM   1211  NE  ARG A 171      19.562  58.730 127.871  1.00  0.79           N  
ATOM   1212  CZ  ARG A 171      18.840  59.713 127.318  1.00  0.79           C  
ATOM   1213  NH1 ARG A 171      18.920  60.003 126.026  1.00  0.79           N  
ATOM   1214  NH2 ARG A 171      18.021  60.408 128.105  1.00  0.79           N  
ATOM   1215  N   ASP A 172      18.900  54.661 130.947  1.00  0.86           N  
ATOM   1216  CA  ASP A 172      18.710  53.335 131.529  1.00  0.86           C  
ATOM   1217  C   ASP A 172      18.559  53.362 133.060  1.00  0.86           C  
ATOM   1218  O   ASP A 172      18.772  52.405 133.811  1.00  0.86           O  
ATOM   1219  CB  ASP A 172      19.782  52.370 130.968  1.00  0.86           C  
ATOM   1220  CG  ASP A 172      19.768  52.542 129.456  1.00  0.86           C  
ATOM   1221  OD1 ASP A 172      18.683  52.313 128.865  1.00  0.86           O  
ATOM   1222  OD2 ASP A 172      20.796  53.006 128.902  1.00  0.86           O  
ATOM   1223  N   GLY A 173      18.123  54.537 133.552  1.00  0.91           N  
ATOM   1224  CA  GLY A 173      18.009  54.891 134.952  1.00  0.91           C  
ATOM   1225  C   GLY A 173      19.285  55.367 135.615  1.00  0.91           C  
ATOM   1226  O   GLY A 173      19.277  55.696 136.797  1.00  0.91           O  
ATOM   1227  N   TRP A 174      20.408  55.439 134.885  1.00  0.88           N  
ATOM   1228  CA  TRP A 174      21.693  55.876 135.400  1.00  0.88           C  
ATOM   1229  C   TRP A 174      21.965  57.328 135.050  1.00  0.88           C  
ATOM   1230  O   TRP A 174      21.568  57.812 133.993  1.00  0.88           O  
ATOM   1231  CB  TRP A 174      22.855  55.061 134.778  1.00  0.88           C  
ATOM   1232  CG  TRP A 174      22.804  53.572 135.038  1.00  0.88           C  
ATOM   1233  CD1 TRP A 174      22.295  52.582 134.245  1.00  0.88           C  
ATOM   1234  CD2 TRP A 174      23.379  52.924 136.184  1.00  0.88           C  
ATOM   1235  NE1 TRP A 174      22.519  51.348 134.819  1.00  0.88           N  
ATOM   1236  CE2 TRP A 174      23.193  51.535 136.005  1.00  0.88           C  
ATOM   1237  CE3 TRP A 174      24.027  53.427 137.310  1.00  0.88           C  
ATOM   1238  CZ2 TRP A 174      23.657  50.628 136.947  1.00  0.88           C  
ATOM   1239  CZ3 TRP A 174      24.485  52.509 138.266  1.00  0.88           C  
ATOM   1240  CH2 TRP A 174      24.304  51.128 138.088  1.00  0.88           C  
ATOM   1241  N   GLN A 175      22.682  58.066 135.927  1.00  0.86           N  
ATOM   1242  CA  GLN A 175      23.209  59.379 135.586  1.00  0.86           C  
ATOM   1243  C   GLN A 175      24.289  59.338 134.507  1.00  0.86           C  
ATOM   1244  O   GLN A 175      25.281  58.619 134.624  1.00  0.86           O  
ATOM   1245  CB  GLN A 175      23.777  60.120 136.829  1.00  0.86           C  
ATOM   1246  CG  GLN A 175      24.428  61.488 136.490  1.00  0.86           C  
ATOM   1247  CD  GLN A 175      24.849  62.282 137.727  1.00  0.86           C  
ATOM   1248  OE1 GLN A 175      24.015  62.743 138.511  1.00  0.86           O  
ATOM   1249  NE2 GLN A 175      26.172  62.482 137.896  1.00  0.86           N  
ATOM   1250  N   VAL A 176      24.117  60.159 133.455  1.00  0.84           N  
ATOM   1251  CA  VAL A 176      25.085  60.393 132.403  1.00  0.84           C  
ATOM   1252  C   VAL A 176      25.463  61.867 132.418  1.00  0.84           C  
ATOM   1253  O   VAL A 176      24.608  62.751 132.523  1.00  0.84           O  
ATOM   1254  CB  VAL A 176      24.507  60.014 131.039  1.00  0.84           C  
ATOM   1255  CG1 VAL A 176      25.429  60.434 129.877  1.00  0.84           C  
ATOM   1256  CG2 VAL A 176      24.271  58.492 131.012  1.00  0.84           C  
ATOM   1257  N   GLU A 177      26.776  62.157 132.327  1.00  0.83           N  
ATOM   1258  CA  GLU A 177      27.325  63.493 132.251  1.00  0.83           C  
ATOM   1259  C   GLU A 177      27.455  63.973 130.797  1.00  0.83           C  
ATOM   1260  O   GLU A 177      28.070  63.309 129.965  1.00  0.83           O  
ATOM   1261  CB  GLU A 177      28.743  63.532 132.893  1.00  0.83           C  
ATOM   1262  CG  GLU A 177      28.798  63.408 134.444  1.00  0.83           C  
ATOM   1263  CD  GLU A 177      28.712  62.012 135.049  1.00  0.83           C  
ATOM   1264  OE1 GLU A 177      29.629  61.171 134.865  1.00  0.83           O  
ATOM   1265  OE2 GLU A 177      27.760  61.753 135.829  1.00  0.83           O  
ATOM   1266  N   GLU A 178      26.897  65.158 130.456  1.00  0.82           N  
ATOM   1267  CA  GLU A 178      27.136  65.843 129.190  1.00  0.82           C  
ATOM   1268  C   GLU A 178      27.754  67.214 129.421  1.00  0.82           C  
ATOM   1269  O   GLU A 178      27.575  67.856 130.454  1.00  0.82           O  
ATOM   1270  CB  GLU A 178      25.852  66.048 128.348  1.00  0.82           C  
ATOM   1271  CG  GLU A 178      25.515  64.848 127.438  1.00  0.82           C  
ATOM   1272  CD  GLU A 178      24.242  65.077 126.656  1.00  0.82           C  
ATOM   1273  OE1 GLU A 178      23.488  64.086 126.464  1.00  0.82           O  
ATOM   1274  OE2 GLU A 178      23.906  66.237 126.281  1.00  0.82           O  
ATOM   1275  N   ALA A 179      28.521  67.721 128.436  1.00  0.85           N  
ATOM   1276  CA  ALA A 179      29.246  68.968 128.575  1.00  0.85           C  
ATOM   1277  C   ALA A 179      28.375  70.224 128.488  1.00  0.85           C  
ATOM   1278  O   ALA A 179      27.672  70.457 127.507  1.00  0.85           O  
ATOM   1279  CB  ALA A 179      30.368  69.040 127.523  1.00  0.85           C  
ATOM   1280  N   ASP A 180      28.436  71.077 129.531  1.00  0.86           N  
ATOM   1281  CA  ASP A 180      27.728  72.337 129.655  1.00  0.86           C  
ATOM   1282  C   ASP A 180      28.313  73.443 128.757  1.00  0.86           C  
ATOM   1283  O   ASP A 180      29.024  74.339 129.200  1.00  0.86           O  
ATOM   1284  CB  ASP A 180      27.777  72.687 131.166  1.00  0.86           C  
ATOM   1285  CG  ASP A 180      26.910  73.879 131.521  1.00  0.86           C  
ATOM   1286  OD1 ASP A 180      25.692  73.812 131.226  1.00  0.86           O  
ATOM   1287  OD2 ASP A 180      27.458  74.843 132.111  1.00  0.86           O  
ATOM   1288  N   ASP A 181      28.059  73.382 127.434  1.00  0.84           N  
ATOM   1289  CA  ASP A 181      28.657  74.246 126.423  1.00  0.84           C  
ATOM   1290  C   ASP A 181      27.939  75.603 126.322  1.00  0.84           C  
ATOM   1291  O   ASP A 181      27.508  76.050 125.258  1.00  0.84           O  
ATOM   1292  CB  ASP A 181      28.652  73.435 125.094  1.00  0.84           C  
ATOM   1293  CG  ASP A 181      29.697  73.858 124.077  1.00  0.84           C  
ATOM   1294  OD1 ASP A 181      30.380  74.894 124.230  1.00  0.84           O  
ATOM   1295  OD2 ASP A 181      29.841  73.106 123.073  1.00  0.84           O  
ATOM   1296  N   TRP A 182      27.785  76.295 127.472  1.00  0.86           N  
ATOM   1297  CA  TRP A 182      26.941  77.468 127.651  1.00  0.86           C  
ATOM   1298  C   TRP A 182      27.359  78.688 126.833  1.00  0.86           C  
ATOM   1299  O   TRP A 182      26.539  79.510 126.429  1.00  0.86           O  
ATOM   1300  CB  TRP A 182      26.772  77.813 129.165  1.00  0.86           C  
ATOM   1301  CG  TRP A 182      27.963  78.442 129.886  1.00  0.86           C  
ATOM   1302  CD1 TRP A 182      29.161  77.882 130.238  1.00  0.86           C  
ATOM   1303  CD2 TRP A 182      28.012  79.812 130.333  1.00  0.86           C  
ATOM   1304  NE1 TRP A 182      29.972  78.825 130.840  1.00  0.86           N  
ATOM   1305  CE2 TRP A 182      29.281  80.010 130.918  1.00  0.86           C  
ATOM   1306  CE3 TRP A 182      27.082  80.850 130.267  1.00  0.86           C  
ATOM   1307  CZ2 TRP A 182      29.644  81.246 131.436  1.00  0.86           C  
ATOM   1308  CZ3 TRP A 182      27.448  82.096 130.798  1.00  0.86           C  
ATOM   1309  CH2 TRP A 182      28.712  82.293 131.375  1.00  0.86           C  
ATOM   1310  N   LEU A 183      28.664  78.823 126.529  1.00  0.86           N  
ATOM   1311  CA  LEU A 183      29.188  79.958 125.793  1.00  0.86           C  
ATOM   1312  C   LEU A 183      29.243  79.731 124.287  1.00  0.86           C  
ATOM   1313  O   LEU A 183      29.666  80.615 123.544  1.00  0.86           O  
ATOM   1314  CB  LEU A 183      30.628  80.273 126.266  1.00  0.86           C  
ATOM   1315  CG  LEU A 183      30.724  80.759 127.724  1.00  0.86           C  
ATOM   1316  CD1 LEU A 183      32.189  80.774 128.174  1.00  0.86           C  
ATOM   1317  CD2 LEU A 183      30.090  82.144 127.919  1.00  0.86           C  
ATOM   1318  N   ARG A 184      28.773  78.570 123.776  1.00  0.78           N  
ATOM   1319  CA  ARG A 184      28.892  78.170 122.377  1.00  0.78           C  
ATOM   1320  C   ARG A 184      28.295  79.150 121.370  1.00  0.78           C  
ATOM   1321  O   ARG A 184      28.845  79.383 120.295  1.00  0.78           O  
ATOM   1322  CB  ARG A 184      28.192  76.800 122.186  1.00  0.78           C  
ATOM   1323  CG  ARG A 184      28.297  76.192 120.771  1.00  0.78           C  
ATOM   1324  CD  ARG A 184      27.361  75.002 120.539  1.00  0.78           C  
ATOM   1325  NE  ARG A 184      27.923  73.800 121.214  1.00  0.78           N  
ATOM   1326  CZ  ARG A 184      27.277  72.634 121.325  1.00  0.78           C  
ATOM   1327  NH1 ARG A 184      26.089  72.410 120.782  1.00  0.78           N  
ATOM   1328  NH2 ARG A 184      27.837  71.683 122.060  1.00  0.78           N  
ATOM   1329  N   TYR A 185      27.135  79.745 121.702  1.00  0.83           N  
ATOM   1330  CA  TYR A 185      26.430  80.656 120.820  1.00  0.83           C  
ATOM   1331  C   TYR A 185      26.619  82.111 121.231  1.00  0.83           C  
ATOM   1332  O   TYR A 185      26.050  83.012 120.615  1.00  0.83           O  
ATOM   1333  CB  TYR A 185      24.917  80.309 120.787  1.00  0.83           C  
ATOM   1334  CG  TYR A 185      24.706  78.899 120.289  1.00  0.83           C  
ATOM   1335  CD1 TYR A 185      24.066  77.943 121.097  1.00  0.83           C  
ATOM   1336  CD2 TYR A 185      25.172  78.508 119.020  1.00  0.83           C  
ATOM   1337  CE1 TYR A 185      23.912  76.621 120.652  1.00  0.83           C  
ATOM   1338  CE2 TYR A 185      25.008  77.190 118.568  1.00  0.83           C  
ATOM   1339  CZ  TYR A 185      24.385  76.245 119.390  1.00  0.83           C  
ATOM   1340  OH  TYR A 185      24.285  74.902 118.969  1.00  0.83           O  
ATOM   1341  N   GLY A 186      27.468  82.375 122.249  1.00  0.85           N  
ATOM   1342  CA  GLY A 186      27.729  83.713 122.770  1.00  0.85           C  
ATOM   1343  C   GLY A 186      26.853  84.128 123.930  1.00  0.85           C  
ATOM   1344  O   GLY A 186      25.677  83.791 124.031  1.00  0.85           O  
ATOM   1345  N   ASN A 187      27.428  84.928 124.846  1.00  0.88           N  
ATOM   1346  CA  ASN A 187      26.775  85.416 126.043  1.00  0.88           C  
ATOM   1347  C   ASN A 187      26.539  86.920 125.851  1.00  0.88           C  
ATOM   1348  O   ASN A 187      27.510  87.642 125.630  1.00  0.88           O  
ATOM   1349  CB  ASN A 187      27.721  85.133 127.246  1.00  0.88           C  
ATOM   1350  CG  ASN A 187      27.200  85.623 128.594  1.00  0.88           C  
ATOM   1351  OD1 ASN A 187      26.062  86.073 128.737  1.00  0.88           O  
ATOM   1352  ND2 ASN A 187      28.069  85.561 129.629  1.00  0.88           N  
ATOM   1353  N   PRO A 188      25.327  87.477 125.903  1.00  0.91           N  
ATOM   1354  CA  PRO A 188      25.110  88.890 125.612  1.00  0.91           C  
ATOM   1355  C   PRO A 188      25.361  89.743 126.842  1.00  0.91           C  
ATOM   1356  O   PRO A 188      25.407  90.969 126.720  1.00  0.91           O  
ATOM   1357  CB  PRO A 188      23.631  88.929 125.190  1.00  0.91           C  
ATOM   1358  CG  PRO A 188      22.975  87.806 126.001  1.00  0.91           C  
ATOM   1359  CD  PRO A 188      24.071  86.741 126.081  1.00  0.91           C  
ATOM   1360  N   TRP A 189      25.492  89.126 128.034  1.00  0.89           N  
ATOM   1361  CA  TRP A 189      25.512  89.826 129.302  1.00  0.89           C  
ATOM   1362  C   TRP A 189      26.910  90.121 129.803  1.00  0.89           C  
ATOM   1363  O   TRP A 189      27.071  90.801 130.809  1.00  0.89           O  
ATOM   1364  CB  TRP A 189      24.824  88.965 130.395  1.00  0.89           C  
ATOM   1365  CG  TRP A 189      23.411  88.543 130.058  1.00  0.89           C  
ATOM   1366  CD1 TRP A 189      22.941  87.290 129.779  1.00  0.89           C  
ATOM   1367  CD2 TRP A 189      22.285  89.433 129.967  1.00  0.89           C  
ATOM   1368  NE1 TRP A 189      21.593  87.337 129.509  1.00  0.89           N  
ATOM   1369  CE2 TRP A 189      21.176  88.646 129.594  1.00  0.89           C  
ATOM   1370  CE3 TRP A 189      22.159  90.806 130.180  1.00  0.89           C  
ATOM   1371  CZ2 TRP A 189      19.932  89.224 129.396  1.00  0.89           C  
ATOM   1372  CZ3 TRP A 189      20.891  91.382 130.007  1.00  0.89           C  
ATOM   1373  CH2 TRP A 189      19.794  90.605 129.605  1.00  0.89           C  
ATOM   1374  N   GLU A 190      27.957  89.653 129.108  1.00  0.89           N  
ATOM   1375  CA  GLU A 190      29.327  89.844 129.533  1.00  0.89           C  
ATOM   1376  C   GLU A 190      30.026  90.833 128.624  1.00  0.89           C  
ATOM   1377  O   GLU A 190      29.825  90.869 127.410  1.00  0.89           O  
ATOM   1378  CB  GLU A 190      30.105  88.501 129.563  1.00  0.89           C  
ATOM   1379  CG  GLU A 190      30.337  87.848 128.174  1.00  0.89           C  
ATOM   1380  CD  GLU A 190      30.911  86.441 128.232  1.00  0.89           C  
ATOM   1381  OE1 GLU A 190      31.008  85.835 129.330  1.00  0.89           O  
ATOM   1382  OE2 GLU A 190      31.260  85.903 127.151  1.00  0.89           O  
ATOM   1383  N   LYS A 191      30.878  91.697 129.198  1.00  0.84           N  
ATOM   1384  CA  LYS A 191      31.726  92.564 128.416  1.00  0.84           C  
ATOM   1385  C   LYS A 191      33.173  92.285 128.749  1.00  0.84           C  
ATOM   1386  O   LYS A 191      33.640  92.467 129.872  1.00  0.84           O  
ATOM   1387  CB  LYS A 191      31.401  94.062 128.642  1.00  0.84           C  
ATOM   1388  CG  LYS A 191      32.310  95.050 127.879  1.00  0.84           C  
ATOM   1389  CD  LYS A 191      32.236  94.913 126.346  1.00  0.84           C  
ATOM   1390  CE  LYS A 191      33.197  95.838 125.588  1.00  0.84           C  
ATOM   1391  NZ  LYS A 191      34.597  95.366 125.668  1.00  0.84           N  
ATOM   1392  N   SER A 192      33.946  91.847 127.737  1.00  0.87           N  
ATOM   1393  CA  SER A 192      35.387  91.682 127.820  1.00  0.87           C  
ATOM   1394  C   SER A 192      36.116  92.964 128.181  1.00  0.87           C  
ATOM   1395  O   SER A 192      35.752  94.055 127.734  1.00  0.87           O  
ATOM   1396  CB  SER A 192      35.978  91.163 126.478  1.00  0.87           C  
ATOM   1397  OG  SER A 192      35.654  92.030 125.379  1.00  0.87           O  
ATOM   1398  N   ARG A 193      37.174  92.872 129.003  1.00  0.82           N  
ATOM   1399  CA  ARG A 193      37.965  94.028 129.369  1.00  0.82           C  
ATOM   1400  C   ARG A 193      39.406  93.862 128.906  1.00  0.82           C  
ATOM   1401  O   ARG A 193      40.202  93.204 129.580  1.00  0.82           O  
ATOM   1402  CB  ARG A 193      37.936  94.188 130.904  1.00  0.82           C  
ATOM   1403  CG  ARG A 193      36.525  94.383 131.491  1.00  0.82           C  
ATOM   1404  CD  ARG A 193      35.727  95.552 130.906  1.00  0.82           C  
ATOM   1405  NE  ARG A 193      36.513  96.809 131.139  1.00  0.82           N  
ATOM   1406  CZ  ARG A 193      36.065  97.820 131.892  1.00  0.82           C  
ATOM   1407  NH1 ARG A 193      35.078  97.673 132.769  1.00  0.82           N  
ATOM   1408  NH2 ARG A 193      36.646  99.010 131.780  1.00  0.82           N  
ATOM   1409  N   PRO A 194      39.815  94.461 127.783  1.00  0.77           N  
ATOM   1410  CA  PRO A 194      41.192  94.388 127.316  1.00  0.77           C  
ATOM   1411  C   PRO A 194      42.149  95.159 128.192  1.00  0.77           C  
ATOM   1412  O   PRO A 194      43.330  94.820 128.220  1.00  0.77           O  
ATOM   1413  CB  PRO A 194      41.146  94.995 125.899  1.00  0.77           C  
ATOM   1414  CG  PRO A 194      39.708  94.753 125.442  1.00  0.77           C  
ATOM   1415  CD  PRO A 194      38.921  94.960 126.734  1.00  0.77           C  
ATOM   1416  N   GLU A 195      41.680  96.222 128.877  1.00  0.77           N  
ATOM   1417  CA  GLU A 195      42.544  97.134 129.600  1.00  0.77           C  
ATOM   1418  C   GLU A 195      42.925  96.620 130.979  1.00  0.77           C  
ATOM   1419  O   GLU A 195      43.863  97.100 131.613  1.00  0.77           O  
ATOM   1420  CB  GLU A 195      41.901  98.544 129.708  1.00  0.77           C  
ATOM   1421  CG  GLU A 195      40.674  98.702 130.651  1.00  0.77           C  
ATOM   1422  CD  GLU A 195      39.329  98.312 130.059  1.00  0.77           C  
ATOM   1423  OE1 GLU A 195      38.477  99.230 129.894  1.00  0.77           O  
ATOM   1424  OE2 GLU A 195      39.055  97.107 129.831  1.00  0.77           O  
ATOM   1425  N   PHE A 196      42.213  95.589 131.472  1.00  0.81           N  
ATOM   1426  CA  PHE A 196      42.412  95.067 132.807  1.00  0.81           C  
ATOM   1427  C   PHE A 196      43.006  93.669 132.805  1.00  0.81           C  
ATOM   1428  O   PHE A 196      43.060  93.013 133.846  1.00  0.81           O  
ATOM   1429  CB  PHE A 196      41.083  95.085 133.607  1.00  0.81           C  
ATOM   1430  CG  PHE A 196      40.658  96.485 133.973  1.00  0.81           C  
ATOM   1431  CD1 PHE A 196      41.550  97.402 134.560  1.00  0.81           C  
ATOM   1432  CD2 PHE A 196      39.324  96.878 133.780  1.00  0.81           C  
ATOM   1433  CE1 PHE A 196      41.122  98.680 134.940  1.00  0.81           C  
ATOM   1434  CE2 PHE A 196      38.883  98.142 134.193  1.00  0.81           C  
ATOM   1435  CZ  PHE A 196      39.785  99.047 134.763  1.00  0.81           C  
ATOM   1436  N   MET A 197      43.530  93.202 131.657  1.00  0.83           N  
ATOM   1437  CA  MET A 197      44.259  91.947 131.523  1.00  0.83           C  
ATOM   1438  C   MET A 197      45.490  91.869 132.443  1.00  0.83           C  
ATOM   1439  O   MET A 197      46.101  92.891 132.766  1.00  0.83           O  
ATOM   1440  CB  MET A 197      44.628  91.747 130.028  1.00  0.83           C  
ATOM   1441  CG  MET A 197      44.896  90.298 129.572  1.00  0.83           C  
ATOM   1442  SD  MET A 197      45.204  90.193 127.777  1.00  0.83           S  
ATOM   1443  CE  MET A 197      44.730  88.458 127.535  1.00  0.83           C  
ATOM   1444  N   LEU A 198      45.848  90.666 132.947  1.00  0.91           N  
ATOM   1445  CA  LEU A 198      46.913  90.512 133.935  1.00  0.91           C  
ATOM   1446  C   LEU A 198      47.681  89.206 133.750  1.00  0.91           C  
ATOM   1447  O   LEU A 198      47.100  88.230 133.275  1.00  0.91           O  
ATOM   1448  CB  LEU A 198      46.341  90.471 135.376  1.00  0.91           C  
ATOM   1449  CG  LEU A 198      45.958  91.843 135.953  1.00  0.91           C  
ATOM   1450  CD1 LEU A 198      45.100  91.645 137.202  1.00  0.91           C  
ATOM   1451  CD2 LEU A 198      47.199  92.687 136.284  1.00  0.91           C  
ATOM   1452  N   PRO A 199      48.966  89.111 134.096  1.00  0.93           N  
ATOM   1453  CA  PRO A 199      49.674  87.841 134.177  1.00  0.93           C  
ATOM   1454  C   PRO A 199      49.460  87.121 135.508  1.00  0.93           C  
ATOM   1455  O   PRO A 199      49.355  87.747 136.563  1.00  0.93           O  
ATOM   1456  CB  PRO A 199      51.142  88.273 134.023  1.00  0.93           C  
ATOM   1457  CG  PRO A 199      51.207  89.633 134.726  1.00  0.93           C  
ATOM   1458  CD  PRO A 199      49.835  90.247 134.430  1.00  0.93           C  
ATOM   1459  N   VAL A 200      49.409  85.780 135.476  1.00  0.93           N  
ATOM   1460  CA  VAL A 200      49.450  84.907 136.634  1.00  0.93           C  
ATOM   1461  C   VAL A 200      50.664  84.002 136.461  1.00  0.93           C  
ATOM   1462  O   VAL A 200      50.941  83.515 135.366  1.00  0.93           O  
ATOM   1463  CB  VAL A 200      48.179  84.071 136.780  1.00  0.93           C  
ATOM   1464  CG1 VAL A 200      48.277  83.107 137.981  1.00  0.93           C  
ATOM   1465  CG2 VAL A 200      46.975  85.019 136.963  1.00  0.93           C  
ATOM   1466  N   HIS A 201      51.440  83.776 137.541  1.00  0.90           N  
ATOM   1467  CA  HIS A 201      52.699  83.045 137.501  1.00  0.90           C  
ATOM   1468  C   HIS A 201      52.589  81.710 138.208  1.00  0.90           C  
ATOM   1469  O   HIS A 201      52.020  81.615 139.290  1.00  0.90           O  
ATOM   1470  CB  HIS A 201      53.818  83.833 138.218  1.00  0.90           C  
ATOM   1471  CG  HIS A 201      54.191  85.078 137.483  1.00  0.90           C  
ATOM   1472  ND1 HIS A 201      55.191  85.015 136.534  1.00  0.90           N  
ATOM   1473  CD2 HIS A 201      53.667  86.330 137.537  1.00  0.90           C  
ATOM   1474  CE1 HIS A 201      55.260  86.230 136.027  1.00  0.90           C  
ATOM   1475  NE2 HIS A 201      54.358  87.066 136.598  1.00  0.90           N  
ATOM   1476  N   PHE A 202      53.152  80.648 137.610  1.00  0.90           N  
ATOM   1477  CA  PHE A 202      53.156  79.314 138.179  1.00  0.90           C  
ATOM   1478  C   PHE A 202      54.555  78.724 138.119  1.00  0.90           C  
ATOM   1479  O   PHE A 202      55.397  79.146 137.324  1.00  0.90           O  
ATOM   1480  CB  PHE A 202      52.220  78.360 137.385  1.00  0.90           C  
ATOM   1481  CG  PHE A 202      50.774  78.758 137.513  1.00  0.90           C  
ATOM   1482  CD1 PHE A 202      50.032  78.370 138.640  1.00  0.90           C  
ATOM   1483  CD2 PHE A 202      50.130  79.481 136.493  1.00  0.90           C  
ATOM   1484  CE1 PHE A 202      48.667  78.667 138.733  1.00  0.90           C  
ATOM   1485  CE2 PHE A 202      48.766  79.789 136.589  1.00  0.90           C  
ATOM   1486  CZ  PHE A 202      48.033  79.377 137.708  1.00  0.90           C  
ATOM   1487  N   TYR A 203      54.817  77.693 138.952  1.00  0.89           N  
ATOM   1488  CA  TYR A 203      56.078  76.972 139.035  1.00  0.89           C  
ATOM   1489  C   TYR A 203      57.243  77.878 139.391  1.00  0.89           C  
ATOM   1490  O   TYR A 203      57.137  78.664 140.337  1.00  0.89           O  
ATOM   1491  CB  TYR A 203      56.386  76.118 137.773  1.00  0.89           C  
ATOM   1492  CG  TYR A 203      55.262  75.168 137.446  1.00  0.89           C  
ATOM   1493  CD1 TYR A 203      55.120  73.963 138.152  1.00  0.89           C  
ATOM   1494  CD2 TYR A 203      54.368  75.441 136.398  1.00  0.89           C  
ATOM   1495  CE1 TYR A 203      54.095  73.058 137.833  1.00  0.89           C  
ATOM   1496  CE2 TYR A 203      53.359  74.529 136.059  1.00  0.89           C  
ATOM   1497  CZ  TYR A 203      53.228  73.335 136.772  1.00  0.89           C  
ATOM   1498  OH  TYR A 203      52.230  72.419 136.384  1.00  0.89           O  
ATOM   1499  N   GLY A 204      58.382  77.804 138.688  1.00  0.90           N  
ATOM   1500  CA  GLY A 204      59.601  78.541 139.004  1.00  0.90           C  
ATOM   1501  C   GLY A 204      60.265  78.226 140.317  1.00  0.90           C  
ATOM   1502  O   GLY A 204      60.114  77.158 140.902  1.00  0.90           O  
ATOM   1503  N   LYS A 205      61.095  79.163 140.784  1.00  0.85           N  
ATOM   1504  CA  LYS A 205      61.942  78.972 141.934  1.00  0.85           C  
ATOM   1505  C   LYS A 205      62.066  80.294 142.667  1.00  0.85           C  
ATOM   1506  O   LYS A 205      61.717  81.354 142.147  1.00  0.85           O  
ATOM   1507  CB  LYS A 205      63.349  78.503 141.479  1.00  0.85           C  
ATOM   1508  CG  LYS A 205      64.038  79.582 140.637  1.00  0.85           C  
ATOM   1509  CD  LYS A 205      65.393  79.230 140.024  1.00  0.85           C  
ATOM   1510  CE  LYS A 205      65.980  80.551 139.530  1.00  0.85           C  
ATOM   1511  NZ  LYS A 205      67.126  80.395 138.628  1.00  0.85           N  
ATOM   1512  N   VAL A 206      62.584  80.272 143.904  1.00  0.88           N  
ATOM   1513  CA  VAL A 206      62.700  81.465 144.721  1.00  0.88           C  
ATOM   1514  C   VAL A 206      64.166  81.778 144.952  1.00  0.88           C  
ATOM   1515  O   VAL A 206      64.947  80.908 145.333  1.00  0.88           O  
ATOM   1516  CB  VAL A 206      61.998  81.304 146.061  1.00  0.88           C  
ATOM   1517  CG1 VAL A 206      61.962  82.653 146.798  1.00  0.88           C  
ATOM   1518  CG2 VAL A 206      60.557  80.808 145.839  1.00  0.88           C  
ATOM   1519  N   GLU A 207      64.577  83.040 144.719  1.00  0.82           N  
ATOM   1520  CA  GLU A 207      65.922  83.507 145.002  1.00  0.82           C  
ATOM   1521  C   GLU A 207      65.832  84.701 145.941  1.00  0.82           C  
ATOM   1522  O   GLU A 207      65.235  85.737 145.644  1.00  0.82           O  
ATOM   1523  CB  GLU A 207      66.727  83.870 143.725  1.00  0.82           C  
ATOM   1524  CG  GLU A 207      67.121  82.631 142.870  1.00  0.82           C  
ATOM   1525  CD  GLU A 207      68.007  82.962 141.665  1.00  0.82           C  
ATOM   1526  OE1 GLU A 207      68.363  84.152 141.491  1.00  0.82           O  
ATOM   1527  OE2 GLU A 207      68.306  82.017 140.881  1.00  0.82           O  
ATOM   1528  N   HIS A 208      66.416  84.579 147.147  1.00  0.80           N  
ATOM   1529  CA  HIS A 208      66.350  85.611 148.168  1.00  0.80           C  
ATOM   1530  C   HIS A 208      67.509  86.579 148.046  1.00  0.80           C  
ATOM   1531  O   HIS A 208      68.577  86.369 148.614  1.00  0.80           O  
ATOM   1532  CB  HIS A 208      66.343  84.987 149.579  1.00  0.80           C  
ATOM   1533  CG  HIS A 208      65.139  84.125 149.771  1.00  0.80           C  
ATOM   1534  ND1 HIS A 208      63.913  84.738 149.947  1.00  0.80           N  
ATOM   1535  CD2 HIS A 208      64.992  82.774 149.701  1.00  0.80           C  
ATOM   1536  CE1 HIS A 208      63.044  83.743 149.986  1.00  0.80           C  
ATOM   1537  NE2 HIS A 208      63.644  82.544 149.840  1.00  0.80           N  
ATOM   1538  N   THR A 209      67.330  87.671 147.275  1.00  0.83           N  
ATOM   1539  CA  THR A 209      68.395  88.634 147.009  1.00  0.83           C  
ATOM   1540  C   THR A 209      68.334  89.841 147.925  1.00  0.83           C  
ATOM   1541  O   THR A 209      67.374  90.077 148.656  1.00  0.83           O  
ATOM   1542  CB  THR A 209      68.531  89.075 145.544  1.00  0.83           C  
ATOM   1543  OG1 THR A 209      67.552  90.014 145.116  1.00  0.83           O  
ATOM   1544  CG2 THR A 209      68.387  87.852 144.629  1.00  0.83           C  
ATOM   1545  N   ASN A 210      69.387  90.681 147.884  1.00  0.78           N  
ATOM   1546  CA  ASN A 210      69.547  91.876 148.695  1.00  0.78           C  
ATOM   1547  C   ASN A 210      68.557  92.991 148.364  1.00  0.78           C  
ATOM   1548  O   ASN A 210      68.356  93.920 149.137  1.00  0.78           O  
ATOM   1549  CB  ASN A 210      71.010  92.412 148.606  1.00  0.78           C  
ATOM   1550  CG  ASN A 210      71.478  92.688 147.172  1.00  0.78           C  
ATOM   1551  OD1 ASN A 210      70.869  92.292 146.177  1.00  0.78           O  
ATOM   1552  ND2 ASN A 210      72.630  93.384 147.050  1.00  0.78           N  
ATOM   1553  N   THR A 211      67.871  92.903 147.209  1.00  0.76           N  
ATOM   1554  CA  THR A 211      66.837  93.860 146.824  1.00  0.76           C  
ATOM   1555  C   THR A 211      65.455  93.330 147.169  1.00  0.76           C  
ATOM   1556  O   THR A 211      64.439  93.839 146.682  1.00  0.76           O  
ATOM   1557  CB  THR A 211      66.873  94.258 145.349  1.00  0.76           C  
ATOM   1558  OG1 THR A 211      66.641  93.163 144.476  1.00  0.76           O  
ATOM   1559  CG2 THR A 211      68.255  94.815 144.989  1.00  0.76           C  
ATOM   1560  N   GLY A 212      65.386  92.286 148.022  1.00  0.81           N  
ATOM   1561  CA  GLY A 212      64.175  91.595 148.451  1.00  0.81           C  
ATOM   1562  C   GLY A 212      63.856  90.441 147.545  1.00  0.81           C  
ATOM   1563  O   GLY A 212      64.073  90.525 146.339  1.00  0.81           O  
ATOM   1564  N   THR A 213      63.338  89.336 148.113  1.00  0.84           N  
ATOM   1565  CA  THR A 213      62.932  88.086 147.463  1.00  0.84           C  
ATOM   1566  C   THR A 213      62.410  88.151 146.035  1.00  0.84           C  
ATOM   1567  O   THR A 213      61.586  88.990 145.676  1.00  0.84           O  
ATOM   1568  CB  THR A 213      61.937  87.306 148.312  1.00  0.84           C  
ATOM   1569  OG1 THR A 213      62.424  87.178 149.642  1.00  0.84           O  
ATOM   1570  CG2 THR A 213      61.731  85.884 147.783  1.00  0.84           C  
ATOM   1571  N   LYS A 214      62.897  87.245 145.164  1.00  0.85           N  
ATOM   1572  CA  LYS A 214      62.456  87.128 143.791  1.00  0.85           C  
ATOM   1573  C   LYS A 214      61.841  85.764 143.552  1.00  0.85           C  
ATOM   1574  O   LYS A 214      62.342  84.747 144.024  1.00  0.85           O  
ATOM   1575  CB  LYS A 214      63.625  87.287 142.785  1.00  0.85           C  
ATOM   1576  CG  LYS A 214      64.490  88.540 142.984  1.00  0.85           C  
ATOM   1577  CD  LYS A 214      63.704  89.859 142.911  1.00  0.85           C  
ATOM   1578  CE  LYS A 214      64.621  91.065 143.119  1.00  0.85           C  
ATOM   1579  NZ  LYS A 214      64.054  91.994 144.114  1.00  0.85           N  
ATOM   1580  N   TRP A 215      60.744  85.715 142.774  1.00  0.84           N  
ATOM   1581  CA  TRP A 215      60.165  84.481 142.279  1.00  0.84           C  
ATOM   1582  C   TRP A 215      60.387  84.529 140.775  1.00  0.84           C  
ATOM   1583  O   TRP A 215      59.914  85.441 140.099  1.00  0.84           O  
ATOM   1584  CB  TRP A 215      58.666  84.381 142.689  1.00  0.84           C  
ATOM   1585  CG  TRP A 215      57.927  83.137 142.404  1.00  0.84           C  
ATOM   1586  CD1 TRP A 215      58.340  81.947 141.866  1.00  0.84           C  
ATOM   1587  CD2 TRP A 215      56.458  83.019 142.308  1.00  0.84           C  
ATOM   1588  NE1 TRP A 215      57.280  81.165 141.345  1.00  0.84           N  
ATOM   1589  CE2 TRP A 215      56.128  81.868 141.779  1.00  0.84           C  
ATOM   1590  CE3 TRP A 215      55.498  84.010 142.582  1.00  0.84           C  
ATOM   1591  CZ2 TRP A 215      54.800  81.313 141.809  1.00  0.84           C  
ATOM   1592  CZ3 TRP A 215      54.149  83.609 142.374  1.00  0.84           C  
ATOM   1593  CH2 TRP A 215      53.808  82.292 142.072  1.00  0.84           C  
ATOM   1594  N   ILE A 216      61.203  83.601 140.241  1.00  0.87           N  
ATOM   1595  CA  ILE A 216      61.695  83.672 138.872  1.00  0.87           C  
ATOM   1596  C   ILE A 216      61.706  82.282 138.260  1.00  0.87           C  
ATOM   1597  O   ILE A 216      61.378  81.295 138.919  1.00  0.87           O  
ATOM   1598  CB  ILE A 216      63.067  84.340 138.725  1.00  0.87           C  
ATOM   1599  CG1 ILE A 216      64.136  83.692 139.625  1.00  0.87           C  
ATOM   1600  CG2 ILE A 216      62.948  85.853 139.017  1.00  0.87           C  
ATOM   1601  CD1 ILE A 216      65.550  83.996 139.122  1.00  0.87           C  
ATOM   1602  N   ASP A 217      62.012  82.198 136.948  1.00  0.84           N  
ATOM   1603  CA  ASP A 217      61.962  81.013 136.102  1.00  0.84           C  
ATOM   1604  C   ASP A 217      60.537  80.439 136.016  1.00  0.84           C  
ATOM   1605  O   ASP A 217      60.304  79.232 135.936  1.00  0.84           O  
ATOM   1606  CB  ASP A 217      63.049  79.952 136.475  1.00  0.84           C  
ATOM   1607  CG  ASP A 217      64.479  80.483 136.431  1.00  0.84           C  
ATOM   1608  OD1 ASP A 217      64.698  81.694 136.191  1.00  0.84           O  
ATOM   1609  OD2 ASP A 217      65.410  79.673 136.703  1.00  0.84           O  
ATOM   1610  N   THR A 218      59.530  81.335 136.024  1.00  0.85           N  
ATOM   1611  CA  THR A 218      58.115  81.011 136.118  1.00  0.85           C  
ATOM   1612  C   THR A 218      57.470  80.722 134.779  1.00  0.85           C  
ATOM   1613  O   THR A 218      57.966  81.053 133.705  1.00  0.85           O  
ATOM   1614  CB  THR A 218      57.290  82.105 136.802  1.00  0.85           C  
ATOM   1615  OG1 THR A 218      57.572  83.388 136.257  1.00  0.85           O  
ATOM   1616  CG2 THR A 218      57.658  82.157 138.289  1.00  0.85           C  
ATOM   1617  N   GLN A 219      56.298  80.067 134.826  1.00  0.80           N  
ATOM   1618  CA  GLN A 219      55.435  79.860 133.685  1.00  0.80           C  
ATOM   1619  C   GLN A 219      54.274  80.826 133.799  1.00  0.80           C  
ATOM   1620  O   GLN A 219      53.678  80.967 134.865  1.00  0.80           O  
ATOM   1621  CB  GLN A 219      54.891  78.413 133.666  1.00  0.80           C  
ATOM   1622  CG  GLN A 219      55.998  77.350 133.488  1.00  0.80           C  
ATOM   1623  CD  GLN A 219      56.622  77.465 132.098  1.00  0.80           C  
ATOM   1624  OE1 GLN A 219      55.935  77.284 131.094  1.00  0.80           O  
ATOM   1625  NE2 GLN A 219      57.934  77.781 132.026  1.00  0.80           N  
ATOM   1626  N   VAL A 220      53.938  81.534 132.705  1.00  0.85           N  
ATOM   1627  CA  VAL A 220      53.002  82.646 132.752  1.00  0.85           C  
ATOM   1628  C   VAL A 220      51.725  82.296 132.011  1.00  0.85           C  
ATOM   1629  O   VAL A 220      51.738  81.868 130.858  1.00  0.85           O  
ATOM   1630  CB  VAL A 220      53.591  83.929 132.160  1.00  0.85           C  
ATOM   1631  CG1 VAL A 220      52.622  85.114 132.361  1.00  0.85           C  
ATOM   1632  CG2 VAL A 220      54.934  84.242 132.850  1.00  0.85           C  
ATOM   1633  N   VAL A 221      50.572  82.493 132.675  1.00  0.88           N  
ATOM   1634  CA  VAL A 221      49.250  82.354 132.086  1.00  0.88           C  
ATOM   1635  C   VAL A 221      48.602  83.715 132.195  1.00  0.88           C  
ATOM   1636  O   VAL A 221      48.738  84.403 133.202  1.00  0.88           O  
ATOM   1637  CB  VAL A 221      48.389  81.307 132.790  1.00  0.88           C  
ATOM   1638  CG1 VAL A 221      46.999  81.192 132.127  1.00  0.88           C  
ATOM   1639  CG2 VAL A 221      49.115  79.949 132.729  1.00  0.88           C  
ATOM   1640  N   LEU A 222      47.908  84.184 131.147  1.00  0.87           N  
ATOM   1641  CA  LEU A 222      47.269  85.484 131.163  1.00  0.87           C  
ATOM   1642  C   LEU A 222      45.820  85.345 131.589  1.00  0.87           C  
ATOM   1643  O   LEU A 222      45.120  84.403 131.223  1.00  0.87           O  
ATOM   1644  CB  LEU A 222      47.359  86.187 129.785  1.00  0.87           C  
ATOM   1645  CG  LEU A 222      48.589  87.106 129.605  1.00  0.87           C  
ATOM   1646  CD1 LEU A 222      49.924  86.426 129.937  1.00  0.87           C  
ATOM   1647  CD2 LEU A 222      48.628  87.648 128.170  1.00  0.87           C  
ATOM   1648  N   ALA A 223      45.338  86.309 132.386  1.00  0.94           N  
ATOM   1649  CA  ALA A 223      43.987  86.363 132.879  1.00  0.94           C  
ATOM   1650  C   ALA A 223      43.259  87.528 132.228  1.00  0.94           C  
ATOM   1651  O   ALA A 223      43.639  88.691 132.367  1.00  0.94           O  
ATOM   1652  CB  ALA A 223      44.003  86.530 134.412  1.00  0.94           C  
ATOM   1653  N   LEU A 224      42.183  87.228 131.480  1.00  0.91           N  
ATOM   1654  CA  LEU A 224      41.383  88.202 130.767  1.00  0.91           C  
ATOM   1655  C   LEU A 224      40.056  88.373 131.502  1.00  0.91           C  
ATOM   1656  O   LEU A 224      39.291  87.406 131.569  1.00  0.91           O  
ATOM   1657  CB  LEU A 224      41.130  87.694 129.325  1.00  0.91           C  
ATOM   1658  CG  LEU A 224      40.376  88.652 128.374  1.00  0.91           C  
ATOM   1659  CD1 LEU A 224      41.041  90.030 128.227  1.00  0.91           C  
ATOM   1660  CD2 LEU A 224      40.249  87.999 126.989  1.00  0.91           C  
ATOM   1661  N   PRO A 225      39.735  89.516 132.107  1.00  0.96           N  
ATOM   1662  CA  PRO A 225      38.492  89.690 132.835  1.00  0.96           C  
ATOM   1663  C   PRO A 225      37.329  90.016 131.922  1.00  0.96           C  
ATOM   1664  O   PRO A 225      37.474  90.717 130.918  1.00  0.96           O  
ATOM   1665  CB  PRO A 225      38.774  90.834 133.819  1.00  0.96           C  
ATOM   1666  CG  PRO A 225      39.937  91.629 133.218  1.00  0.96           C  
ATOM   1667  CD  PRO A 225      40.615  90.677 132.229  1.00  0.96           C  
ATOM   1668  N   TYR A 226      36.152  89.485 132.274  1.00  0.93           N  
ATOM   1669  CA  TYR A 226      34.896  89.772 131.628  1.00  0.93           C  
ATOM   1670  C   TYR A 226      33.988  90.307 132.722  1.00  0.93           C  
ATOM   1671  O   TYR A 226      33.824  89.678 133.769  1.00  0.93           O  
ATOM   1672  CB  TYR A 226      34.254  88.501 130.992  1.00  0.93           C  
ATOM   1673  CG  TYR A 226      35.010  88.006 129.776  1.00  0.93           C  
ATOM   1674  CD1 TYR A 226      34.410  88.011 128.501  1.00  0.93           C  
ATOM   1675  CD2 TYR A 226      36.309  87.481 129.894  1.00  0.93           C  
ATOM   1676  CE1 TYR A 226      35.112  87.553 127.372  1.00  0.93           C  
ATOM   1677  CE2 TYR A 226      37.026  87.065 128.767  1.00  0.93           C  
ATOM   1678  CZ  TYR A 226      36.433  87.108 127.504  1.00  0.93           C  
ATOM   1679  OH  TYR A 226      37.214  86.752 126.383  1.00  0.93           O  
ATOM   1680  N   ASP A 227      33.404  91.500 132.507  1.00  0.92           N  
ATOM   1681  CA  ASP A 227      32.536  92.163 133.455  1.00  0.92           C  
ATOM   1682  C   ASP A 227      31.079  91.855 133.119  1.00  0.92           C  
ATOM   1683  O   ASP A 227      30.622  92.064 131.994  1.00  0.92           O  
ATOM   1684  CB  ASP A 227      32.747  93.706 133.412  1.00  0.92           C  
ATOM   1685  CG  ASP A 227      34.031  94.156 134.074  1.00  0.92           C  
ATOM   1686  OD1 ASP A 227      34.442  95.327 133.839  1.00  0.92           O  
ATOM   1687  OD2 ASP A 227      34.651  93.399 134.859  1.00  0.92           O  
ATOM   1688  N   THR A 228      30.315  91.359 134.109  1.00  0.94           N  
ATOM   1689  CA  THR A 228      28.901  91.015 133.985  1.00  0.94           C  
ATOM   1690  C   THR A 228      28.119  91.902 134.946  1.00  0.94           C  
ATOM   1691  O   THR A 228      28.480  91.961 136.125  1.00  0.94           O  
ATOM   1692  CB  THR A 228      28.622  89.558 134.346  1.00  0.94           C  
ATOM   1693  OG1 THR A 228      29.272  88.700 133.419  1.00  0.94           O  
ATOM   1694  CG2 THR A 228      27.128  89.205 134.268  1.00  0.94           C  
ATOM   1695  N   PRO A 229      27.079  92.633 134.547  1.00  0.96           N  
ATOM   1696  CA  PRO A 229      26.374  93.561 135.420  1.00  0.96           C  
ATOM   1697  C   PRO A 229      25.430  92.866 136.391  1.00  0.96           C  
ATOM   1698  O   PRO A 229      24.770  91.891 136.039  1.00  0.96           O  
ATOM   1699  CB  PRO A 229      25.589  94.438 134.431  1.00  0.96           C  
ATOM   1700  CG  PRO A 229      25.277  93.503 133.262  1.00  0.96           C  
ATOM   1701  CD  PRO A 229      26.507  92.606 133.201  1.00  0.96           C  
ATOM   1702  N   VAL A 230      25.343  93.375 137.631  1.00  0.97           N  
ATOM   1703  CA  VAL A 230      24.429  92.896 138.652  1.00  0.97           C  
ATOM   1704  C   VAL A 230      23.475  94.031 139.028  1.00  0.97           C  
ATOM   1705  O   VAL A 230      23.906  94.974 139.697  1.00  0.97           O  
ATOM   1706  CB  VAL A 230      25.175  92.463 139.910  1.00  0.97           C  
ATOM   1707  CG1 VAL A 230      24.180  91.918 140.954  1.00  0.97           C  
ATOM   1708  CG2 VAL A 230      26.221  91.386 139.554  1.00  0.97           C  
ATOM   1709  N   PRO A 231      22.196  94.023 138.663  1.00  0.96           N  
ATOM   1710  CA  PRO A 231      21.311  95.149 138.949  1.00  0.96           C  
ATOM   1711  C   PRO A 231      20.628  95.007 140.292  1.00  0.96           C  
ATOM   1712  O   PRO A 231      20.073  93.953 140.596  1.00  0.96           O  
ATOM   1713  CB  PRO A 231      20.264  95.086 137.824  1.00  0.96           C  
ATOM   1714  CG  PRO A 231      20.213  93.608 137.420  1.00  0.96           C  
ATOM   1715  CD  PRO A 231      21.655  93.145 137.619  1.00  0.96           C  
ATOM   1716  N   GLY A 232      20.628  96.069 141.121  1.00  0.95           N  
ATOM   1717  CA  GLY A 232      19.772  96.132 142.300  1.00  0.95           C  
ATOM   1718  C   GLY A 232      18.301  96.217 141.975  1.00  0.95           C  
ATOM   1719  O   GLY A 232      17.905  96.748 140.942  1.00  0.95           O  
ATOM   1720  N   TYR A 233      17.423  95.719 142.870  1.00  0.91           N  
ATOM   1721  CA  TYR A 233      15.987  95.904 142.720  1.00  0.91           C  
ATOM   1722  C   TYR A 233      15.581  97.354 142.923  1.00  0.91           C  
ATOM   1723  O   TYR A 233      15.607  97.867 144.043  1.00  0.91           O  
ATOM   1724  CB  TYR A 233      15.194  95.005 143.711  1.00  0.91           C  
ATOM   1725  CG  TYR A 233      13.684  95.090 143.544  1.00  0.91           C  
ATOM   1726  CD1 TYR A 233      13.032  94.443 142.481  1.00  0.91           C  
ATOM   1727  CD2 TYR A 233      12.908  95.845 144.446  1.00  0.91           C  
ATOM   1728  CE1 TYR A 233      11.642  94.564 142.314  1.00  0.91           C  
ATOM   1729  CE2 TYR A 233      11.518  95.975 144.275  1.00  0.91           C  
ATOM   1730  CZ  TYR A 233      10.880  95.335 143.208  1.00  0.91           C  
ATOM   1731  OH  TYR A 233       9.478  95.437 143.031  1.00  0.91           O  
ATOM   1732  N   MET A 234      15.162  98.035 141.839  1.00  0.86           N  
ATOM   1733  CA  MET A 234      14.544  99.348 141.885  1.00  0.86           C  
ATOM   1734  C   MET A 234      15.335 100.406 142.658  1.00  0.86           C  
ATOM   1735  O   MET A 234      14.861 100.996 143.635  1.00  0.86           O  
ATOM   1736  CB  MET A 234      13.059  99.264 142.329  1.00  0.86           C  
ATOM   1737  CG  MET A 234      12.220  98.271 141.492  1.00  0.86           C  
ATOM   1738  SD  MET A 234      12.169  98.624 139.709  1.00  0.86           S  
ATOM   1739  CE  MET A 234      10.899  99.918 139.800  1.00  0.86           C  
ATOM   1740  N   ASN A 235      16.594 100.630 142.244  1.00  0.87           N  
ATOM   1741  CA  ASN A 235      17.453 101.689 142.734  1.00  0.87           C  
ATOM   1742  C   ASN A 235      18.318 102.191 141.578  1.00  0.87           C  
ATOM   1743  O   ASN A 235      18.022 101.959 140.403  1.00  0.87           O  
ATOM   1744  CB  ASN A 235      18.273 101.271 143.997  1.00  0.87           C  
ATOM   1745  CG  ASN A 235      19.258 100.125 143.766  1.00  0.87           C  
ATOM   1746  OD1 ASN A 235      19.482  99.652 142.652  1.00  0.87           O  
ATOM   1747  ND2 ASN A 235      19.899  99.668 144.864  1.00  0.87           N  
ATOM   1748  N   ASN A 236      19.417 102.903 141.884  1.00  0.69           N  
ATOM   1749  CA  ASN A 236      20.299 103.450 140.872  1.00  0.69           C  
ATOM   1750  C   ASN A 236      21.469 102.524 140.547  1.00  0.69           C  
ATOM   1751  O   ASN A 236      22.272 102.818 139.662  1.00  0.69           O  
ATOM   1752  CB  ASN A 236      20.877 104.782 141.406  1.00  0.69           C  
ATOM   1753  CG  ASN A 236      19.752 105.803 141.517  1.00  0.69           C  
ATOM   1754  OD1 ASN A 236      19.272 106.301 140.494  1.00  0.69           O  
ATOM   1755  ND2 ASN A 236      19.315 106.122 142.756  1.00  0.69           N  
ATOM   1756  N   THR A 237      21.574 101.372 141.234  1.00  0.88           N  
ATOM   1757  CA  THR A 237      22.840 100.673 141.426  1.00  0.88           C  
ATOM   1758  C   THR A 237      22.979  99.451 140.555  1.00  0.88           C  
ATOM   1759  O   THR A 237      22.223  98.483 140.656  1.00  0.88           O  
ATOM   1760  CB  THR A 237      23.021 100.215 142.870  1.00  0.88           C  
ATOM   1761  OG1 THR A 237      22.884 101.336 143.729  1.00  0.88           O  
ATOM   1762  CG2 THR A 237      24.423  99.640 143.124  1.00  0.88           C  
ATOM   1763  N   VAL A 238      24.006  99.441 139.683  1.00  0.93           N  
ATOM   1764  CA  VAL A 238      24.393  98.253 138.941  1.00  0.93           C  
ATOM   1765  C   VAL A 238      25.842  97.930 139.278  1.00  0.93           C  
ATOM   1766  O   VAL A 238      26.781  98.643 138.923  1.00  0.93           O  
ATOM   1767  CB  VAL A 238      24.196  98.387 137.434  1.00  0.93           C  
ATOM   1768  CG1 VAL A 238      24.578  97.077 136.717  1.00  0.93           C  
ATOM   1769  CG2 VAL A 238      22.724  98.732 137.130  1.00  0.93           C  
ATOM   1770  N   ASN A 239      26.047  96.818 140.005  1.00  0.94           N  
ATOM   1771  CA  ASN A 239      27.346  96.347 140.447  1.00  0.94           C  
ATOM   1772  C   ASN A 239      27.954  95.417 139.411  1.00  0.94           C  
ATOM   1773  O   ASN A 239      27.335  95.086 138.405  1.00  0.94           O  
ATOM   1774  CB  ASN A 239      27.239  95.644 141.827  1.00  0.94           C  
ATOM   1775  CG  ASN A 239      27.182  96.693 142.932  1.00  0.94           C  
ATOM   1776  OD1 ASN A 239      27.486  97.870 142.734  1.00  0.94           O  
ATOM   1777  ND2 ASN A 239      26.820  96.259 144.159  1.00  0.94           N  
ATOM   1778  N   THR A 240      29.212  94.987 139.620  1.00  0.95           N  
ATOM   1779  CA  THR A 240      29.944  94.205 138.628  1.00  0.95           C  
ATOM   1780  C   THR A 240      30.336  92.867 139.203  1.00  0.95           C  
ATOM   1781  O   THR A 240      30.954  92.771 140.262  1.00  0.95           O  
ATOM   1782  CB  THR A 240      31.221  94.891 138.149  1.00  0.95           C  
ATOM   1783  OG1 THR A 240      30.902  96.125 137.526  1.00  0.95           O  
ATOM   1784  CG2 THR A 240      31.964  94.065 137.089  1.00  0.95           C  
ATOM   1785  N   MET A 241      30.014  91.776 138.488  1.00  0.95           N  
ATOM   1786  CA  MET A 241      30.631  90.486 138.706  1.00  0.95           C  
ATOM   1787  C   MET A 241      31.722  90.337 137.662  1.00  0.95           C  
ATOM   1788  O   MET A 241      31.468  90.418 136.464  1.00  0.95           O  
ATOM   1789  CB  MET A 241      29.604  89.337 138.581  1.00  0.95           C  
ATOM   1790  CG  MET A 241      30.204  87.933 138.808  1.00  0.95           C  
ATOM   1791  SD  MET A 241      29.005  86.567 138.722  1.00  0.95           S  
ATOM   1792  CE  MET A 241      28.562  86.775 136.974  1.00  0.95           C  
ATOM   1793  N   ARG A 242      32.976  90.148 138.097  1.00  0.92           N  
ATOM   1794  CA  ARG A 242      34.126  90.080 137.228  1.00  0.92           C  
ATOM   1795  C   ARG A 242      34.642  88.658 137.210  1.00  0.92           C  
ATOM   1796  O   ARG A 242      35.018  88.078 138.230  1.00  0.92           O  
ATOM   1797  CB  ARG A 242      35.223  91.065 137.699  1.00  0.92           C  
ATOM   1798  CG  ARG A 242      36.523  91.012 136.870  1.00  0.92           C  
ATOM   1799  CD  ARG A 242      37.453  92.214 137.084  1.00  0.92           C  
ATOM   1800  NE  ARG A 242      36.826  93.373 136.383  1.00  0.92           N  
ATOM   1801  CZ  ARG A 242      37.467  94.483 136.014  1.00  0.92           C  
ATOM   1802  NH1 ARG A 242      38.694  94.787 136.424  1.00  0.92           N  
ATOM   1803  NH2 ARG A 242      36.845  95.320 135.187  1.00  0.92           N  
ATOM   1804  N   LEU A 243      34.644  88.040 136.020  1.00  0.96           N  
ATOM   1805  CA  LEU A 243      35.011  86.651 135.874  1.00  0.96           C  
ATOM   1806  C   LEU A 243      36.229  86.528 134.976  1.00  0.96           C  
ATOM   1807  O   LEU A 243      36.267  87.045 133.859  1.00  0.96           O  
ATOM   1808  CB  LEU A 243      33.844  85.820 135.291  1.00  0.96           C  
ATOM   1809  CG  LEU A 243      32.545  85.787 136.120  1.00  0.96           C  
ATOM   1810  CD1 LEU A 243      31.499  84.937 135.383  1.00  0.96           C  
ATOM   1811  CD2 LEU A 243      32.757  85.223 137.532  1.00  0.96           C  
ATOM   1812  N   TRP A 244      37.279  85.837 135.457  1.00  0.93           N  
ATOM   1813  CA  TRP A 244      38.539  85.710 134.744  1.00  0.93           C  
ATOM   1814  C   TRP A 244      38.562  84.501 133.810  1.00  0.93           C  
ATOM   1815  O   TRP A 244      38.254  83.381 134.213  1.00  0.93           O  
ATOM   1816  CB  TRP A 244      39.726  85.577 135.738  1.00  0.93           C  
ATOM   1817  CG  TRP A 244      39.853  86.706 136.751  1.00  0.93           C  
ATOM   1818  CD1 TRP A 244      39.456  86.725 138.061  1.00  0.93           C  
ATOM   1819  CD2 TRP A 244      40.492  87.972 136.507  1.00  0.93           C  
ATOM   1820  NE1 TRP A 244      39.798  87.922 138.650  1.00  0.93           N  
ATOM   1821  CE2 TRP A 244      40.414  88.710 137.709  1.00  0.93           C  
ATOM   1822  CE3 TRP A 244      41.129  88.493 135.384  1.00  0.93           C  
ATOM   1823  CZ2 TRP A 244      40.937  89.991 137.793  1.00  0.93           C  
ATOM   1824  CZ3 TRP A 244      41.718  89.762 135.496  1.00  0.93           C  
ATOM   1825  CH2 TRP A 244      41.588  90.517 136.669  1.00  0.93           C  
ATOM   1826  N   SER A 245      38.958  84.694 132.535  1.00  0.93           N  
ATOM   1827  CA  SER A 245      39.206  83.602 131.591  1.00  0.93           C  
ATOM   1828  C   SER A 245      40.679  83.553 131.264  1.00  0.93           C  
ATOM   1829  O   SER A 245      41.320  84.577 131.038  1.00  0.93           O  
ATOM   1830  CB  SER A 245      38.481  83.736 130.218  1.00  0.93           C  
ATOM   1831  OG  SER A 245      37.180  83.139 130.222  1.00  0.93           O  
ATOM   1832  N   ALA A 246      41.257  82.340 131.238  1.00  0.92           N  
ATOM   1833  CA  ALA A 246      42.640  82.102 130.890  1.00  0.92           C  
ATOM   1834  C   ALA A 246      42.969  82.284 129.404  1.00  0.92           C  
ATOM   1835  O   ALA A 246      42.137  82.098 128.511  1.00  0.92           O  
ATOM   1836  CB  ALA A 246      43.063  80.708 131.396  1.00  0.92           C  
ATOM   1837  N   ARG A 247      44.226  82.677 129.120  1.00  0.80           N  
ATOM   1838  CA  ARG A 247      44.808  82.742 127.794  1.00  0.80           C  
ATOM   1839  C   ARG A 247      46.307  82.467 127.901  1.00  0.80           C  
ATOM   1840  O   ARG A 247      46.940  82.705 128.928  1.00  0.80           O  
ATOM   1841  CB  ARG A 247      44.648  84.141 127.126  1.00  0.80           C  
ATOM   1842  CG  ARG A 247      43.229  84.536 126.654  1.00  0.80           C  
ATOM   1843  CD  ARG A 247      42.645  83.639 125.548  1.00  0.80           C  
ATOM   1844  NE  ARG A 247      41.661  84.464 124.754  1.00  0.80           N  
ATOM   1845  CZ  ARG A 247      40.383  84.684 125.089  1.00  0.80           C  
ATOM   1846  NH1 ARG A 247      39.828  84.096 126.145  1.00  0.80           N  
ATOM   1847  NH2 ARG A 247      39.641  85.518 124.357  1.00  0.80           N  
ATOM   1848  N   ALA A 248      46.932  81.952 126.823  1.00  0.85           N  
ATOM   1849  CA  ALA A 248      48.367  81.744 126.751  1.00  0.85           C  
ATOM   1850  C   ALA A 248      49.151  83.030 126.402  1.00  0.85           C  
ATOM   1851  O   ALA A 248      48.553  83.992 125.909  1.00  0.85           O  
ATOM   1852  CB  ALA A 248      48.640  80.609 125.742  1.00  0.85           C  
ATOM   1853  N   PRO A 249      50.464  83.145 126.645  1.00  0.81           N  
ATOM   1854  CA  PRO A 249      51.142  84.439 126.563  1.00  0.81           C  
ATOM   1855  C   PRO A 249      51.417  84.870 125.131  1.00  0.81           C  
ATOM   1856  O   PRO A 249      51.267  86.059 124.869  1.00  0.81           O  
ATOM   1857  CB  PRO A 249      52.427  84.255 127.397  1.00  0.81           C  
ATOM   1858  CG  PRO A 249      52.651  82.742 127.461  1.00  0.81           C  
ATOM   1859  CD  PRO A 249      51.224  82.201 127.467  1.00  0.81           C  
ATOM   1860  N   ASN A 250      51.796  83.916 124.243  1.00  0.72           N  
ATOM   1861  CA  ASN A 250      51.936  83.979 122.780  1.00  0.72           C  
ATOM   1862  C   ASN A 250      53.327  83.616 122.302  1.00  0.72           C  
ATOM   1863  O   ASN A 250      53.448  82.979 121.257  1.00  0.72           O  
ATOM   1864  CB  ASN A 250      51.560  85.311 122.065  1.00  0.72           C  
ATOM   1865  CG  ASN A 250      50.062  85.545 122.143  1.00  0.72           C  
ATOM   1866  OD1 ASN A 250      49.294  84.660 122.525  1.00  0.72           O  
ATOM   1867  ND2 ASN A 250      49.608  86.758 121.763  1.00  0.72           N  
ATOM   1868  N   ASP A 251      54.372  83.982 123.065  1.00  0.71           N  
ATOM   1869  CA  ASP A 251      55.749  83.606 122.811  1.00  0.71           C  
ATOM   1870  C   ASP A 251      56.070  82.324 123.583  1.00  0.71           C  
ATOM   1871  O   ASP A 251      55.562  82.107 124.685  1.00  0.71           O  
ATOM   1872  CB  ASP A 251      56.701  84.776 123.188  1.00  0.71           C  
ATOM   1873  CG  ASP A 251      58.137  84.507 122.760  1.00  0.71           C  
ATOM   1874  OD1 ASP A 251      59.060  84.977 123.471  1.00  0.71           O  
ATOM   1875  OD2 ASP A 251      58.312  83.816 121.725  1.00  0.71           O  
ATOM   1876  N   PHE A 252      56.881  81.449 122.963  1.00  0.60           N  
ATOM   1877  CA  PHE A 252      57.310  80.155 123.455  1.00  0.60           C  
ATOM   1878  C   PHE A 252      58.510  79.766 122.602  1.00  0.60           C  
ATOM   1879  O   PHE A 252      58.740  80.345 121.543  1.00  0.60           O  
ATOM   1880  CB  PHE A 252      56.257  79.030 123.276  1.00  0.60           C  
ATOM   1881  CG  PHE A 252      55.083  79.119 124.211  1.00  0.60           C  
ATOM   1882  CD1 PHE A 252      55.230  78.743 125.555  1.00  0.60           C  
ATOM   1883  CD2 PHE A 252      53.808  79.482 123.741  1.00  0.60           C  
ATOM   1884  CE1 PHE A 252      54.125  78.726 126.417  1.00  0.60           C  
ATOM   1885  CE2 PHE A 252      52.696  79.449 124.594  1.00  0.60           C  
ATOM   1886  CZ  PHE A 252      52.855  79.066 125.932  1.00  0.60           C  
ATOM   1887  N   ASN A 253      59.310  78.757 122.998  1.00  0.52           N  
ATOM   1888  CA  ASN A 253      60.496  78.388 122.244  1.00  0.52           C  
ATOM   1889  C   ASN A 253      60.649  76.880 122.089  1.00  0.52           C  
ATOM   1890  O   ASN A 253      59.938  76.079 122.682  1.00  0.52           O  
ATOM   1891  CB  ASN A 253      61.780  79.065 122.816  1.00  0.52           C  
ATOM   1892  CG  ASN A 253      62.353  78.366 124.050  1.00  0.52           C  
ATOM   1893  OD1 ASN A 253      63.374  77.681 123.924  1.00  0.52           O  
ATOM   1894  ND2 ASN A 253      61.692  78.488 125.214  1.00  0.52           N  
ATOM   1895  N   LEU A 254      61.627  76.441 121.269  1.00  0.38           N  
ATOM   1896  CA  LEU A 254      61.881  75.042 120.955  1.00  0.38           C  
ATOM   1897  C   LEU A 254      62.139  74.145 122.159  1.00  0.38           C  
ATOM   1898  O   LEU A 254      61.826  72.960 122.134  1.00  0.38           O  
ATOM   1899  CB  LEU A 254      63.100  74.913 120.007  1.00  0.38           C  
ATOM   1900  CG  LEU A 254      62.945  75.608 118.639  1.00  0.38           C  
ATOM   1901  CD1 LEU A 254      64.261  75.516 117.852  1.00  0.38           C  
ATOM   1902  CD2 LEU A 254      61.804  75.002 117.811  1.00  0.38           C  
ATOM   1903  N   ARG A 255      62.704  74.693 123.254  1.00  0.53           N  
ATOM   1904  CA  ARG A 255      62.998  73.945 124.462  1.00  0.53           C  
ATOM   1905  C   ARG A 255      61.757  73.611 125.278  1.00  0.53           C  
ATOM   1906  O   ARG A 255      61.798  72.736 126.139  1.00  0.53           O  
ATOM   1907  CB  ARG A 255      63.974  74.753 125.353  1.00  0.53           C  
ATOM   1908  CG  ARG A 255      65.323  75.039 124.663  1.00  0.53           C  
ATOM   1909  CD  ARG A 255      66.202  76.015 125.445  1.00  0.53           C  
ATOM   1910  NE  ARG A 255      67.471  76.152 124.657  1.00  0.53           N  
ATOM   1911  CZ  ARG A 255      68.451  77.019 124.943  1.00  0.53           C  
ATOM   1912  NH1 ARG A 255      69.531  77.068 124.165  1.00  0.53           N  
ATOM   1913  NH2 ARG A 255      68.371  77.837 125.987  1.00  0.53           N  
ATOM   1914  N   ASP A 256      60.620  74.281 125.003  1.00  0.59           N  
ATOM   1915  CA  ASP A 256      59.387  74.086 125.735  1.00  0.59           C  
ATOM   1916  C   ASP A 256      58.575  72.931 125.144  1.00  0.59           C  
ATOM   1917  O   ASP A 256      57.617  72.442 125.741  1.00  0.59           O  
ATOM   1918  CB  ASP A 256      58.523  75.381 125.674  1.00  0.59           C  
ATOM   1919  CG  ASP A 256      59.298  76.634 126.045  1.00  0.59           C  
ATOM   1920  OD1 ASP A 256      60.263  76.566 126.848  1.00  0.59           O  
ATOM   1921  OD2 ASP A 256      58.957  77.707 125.474  1.00  0.59           O  
ATOM   1922  N   PHE A 257      58.953  72.453 123.938  1.00  0.59           N  
ATOM   1923  CA  PHE A 257      58.137  71.554 123.144  1.00  0.59           C  
ATOM   1924  C   PHE A 257      58.849  70.254 122.851  1.00  0.59           C  
ATOM   1925  O   PHE A 257      59.968  70.233 122.349  1.00  0.59           O  
ATOM   1926  CB  PHE A 257      57.780  72.184 121.772  1.00  0.59           C  
ATOM   1927  CG  PHE A 257      57.008  73.451 121.974  1.00  0.59           C  
ATOM   1928  CD1 PHE A 257      55.822  73.450 122.726  1.00  0.59           C  
ATOM   1929  CD2 PHE A 257      57.471  74.660 121.431  1.00  0.59           C  
ATOM   1930  CE1 PHE A 257      55.126  74.638 122.959  1.00  0.59           C  
ATOM   1931  CE2 PHE A 257      56.770  75.852 121.650  1.00  0.59           C  
ATOM   1932  CZ  PHE A 257      55.590  75.834 122.407  1.00  0.59           C  
ATOM   1933  N   ASN A 258      58.168  69.112 123.089  1.00  0.45           N  
ATOM   1934  CA  ASN A 258      58.747  67.771 123.046  1.00  0.45           C  
ATOM   1935  C   ASN A 258      59.471  67.401 121.750  1.00  0.45           C  
ATOM   1936  O   ASN A 258      60.495  66.727 121.771  1.00  0.45           O  
ATOM   1937  CB  ASN A 258      57.647  66.698 123.271  1.00  0.45           C  
ATOM   1938  CG  ASN A 258      56.974  66.911 124.622  1.00  0.45           C  
ATOM   1939  OD1 ASN A 258      57.635  67.074 125.644  1.00  0.45           O  
ATOM   1940  ND2 ASN A 258      55.621  66.911 124.644  1.00  0.45           N  
ATOM   1941  N   VAL A 259      58.937  67.824 120.587  1.00  0.53           N  
ATOM   1942  CA  VAL A 259      59.554  67.560 119.293  1.00  0.53           C  
ATOM   1943  C   VAL A 259      59.907  68.844 118.553  1.00  0.53           C  
ATOM   1944  O   VAL A 259      60.294  68.815 117.389  1.00  0.53           O  
ATOM   1945  CB  VAL A 259      58.655  66.697 118.407  1.00  0.53           C  
ATOM   1946  CG1 VAL A 259      58.488  65.309 119.057  1.00  0.53           C  
ATOM   1947  CG2 VAL A 259      57.284  67.365 118.169  1.00  0.53           C  
ATOM   1948  N   GLY A 260      59.773  70.026 119.199  1.00  0.46           N  
ATOM   1949  CA  GLY A 260      60.149  71.314 118.604  1.00  0.46           C  
ATOM   1950  C   GLY A 260      59.209  71.891 117.561  1.00  0.46           C  
ATOM   1951  O   GLY A 260      59.466  72.959 117.016  1.00  0.46           O  
ATOM   1952  N   ASP A 261      58.105  71.193 117.242  1.00  0.59           N  
ATOM   1953  CA  ASP A 261      57.139  71.565 116.223  1.00  0.59           C  
ATOM   1954  C   ASP A 261      56.358  72.867 116.472  1.00  0.59           C  
ATOM   1955  O   ASP A 261      55.941  73.186 117.583  1.00  0.59           O  
ATOM   1956  CB  ASP A 261      56.210  70.347 115.956  1.00  0.59           C  
ATOM   1957  CG  ASP A 261      55.137  70.636 114.923  1.00  0.59           C  
ATOM   1958  OD1 ASP A 261      53.960  70.311 115.208  1.00  0.59           O  
ATOM   1959  OD2 ASP A 261      55.459  71.259 113.881  1.00  0.59           O  
ATOM   1960  N   TYR A 262      56.102  73.619 115.377  1.00  0.51           N  
ATOM   1961  CA  TYR A 262      55.239  74.785 115.344  1.00  0.51           C  
ATOM   1962  C   TYR A 262      53.768  74.423 115.523  1.00  0.51           C  
ATOM   1963  O   TYR A 262      53.050  75.091 116.265  1.00  0.51           O  
ATOM   1964  CB  TYR A 262      55.450  75.582 114.014  1.00  0.51           C  
ATOM   1965  CG  TYR A 262      54.442  76.700 113.818  1.00  0.51           C  
ATOM   1966  CD1 TYR A 262      54.537  77.912 114.522  1.00  0.51           C  
ATOM   1967  CD2 TYR A 262      53.323  76.483 112.993  1.00  0.51           C  
ATOM   1968  CE1 TYR A 262      53.521  78.877 114.417  1.00  0.51           C  
ATOM   1969  CE2 TYR A 262      52.307  77.442 112.889  1.00  0.51           C  
ATOM   1970  CZ  TYR A 262      52.404  78.637 113.606  1.00  0.51           C  
ATOM   1971  OH  TYR A 262      51.363  79.587 113.525  1.00  0.51           O  
ATOM   1972  N   ILE A 263      53.257  73.372 114.843  1.00  0.55           N  
ATOM   1973  CA  ILE A 263      51.835  73.050 114.911  1.00  0.55           C  
ATOM   1974  C   ILE A 263      51.459  72.597 116.306  1.00  0.55           C  
ATOM   1975  O   ILE A 263      50.516  73.118 116.902  1.00  0.55           O  
ATOM   1976  CB  ILE A 263      51.409  72.031 113.856  1.00  0.55           C  
ATOM   1977  CG1 ILE A 263      51.648  72.573 112.423  1.00  0.55           C  
ATOM   1978  CG2 ILE A 263      49.933  71.609 114.059  1.00  0.55           C  
ATOM   1979  CD1 ILE A 263      50.769  73.767 112.023  1.00  0.55           C  
ATOM   1980  N   GLN A 264      52.271  71.701 116.901  1.00  0.61           N  
ATOM   1981  CA  GLN A 264      52.150  71.287 118.286  1.00  0.61           C  
ATOM   1982  C   GLN A 264      52.261  72.448 119.267  1.00  0.61           C  
ATOM   1983  O   GLN A 264      51.452  72.566 120.180  1.00  0.61           O  
ATOM   1984  CB  GLN A 264      53.206  70.206 118.622  1.00  0.61           C  
ATOM   1985  CG  GLN A 264      52.990  69.510 119.989  1.00  0.61           C  
ATOM   1986  CD  GLN A 264      51.677  68.723 120.017  1.00  0.61           C  
ATOM   1987  OE1 GLN A 264      51.459  67.812 119.215  1.00  0.61           O  
ATOM   1988  NE2 GLN A 264      50.772  69.053 120.962  1.00  0.61           N  
ATOM   1989  N   ALA A 265      53.200  73.396 119.052  1.00  0.68           N  
ATOM   1990  CA  ALA A 265      53.356  74.582 119.876  1.00  0.68           C  
ATOM   1991  C   ALA A 265      52.109  75.453 119.977  1.00  0.68           C  
ATOM   1992  O   ALA A 265      51.745  75.963 121.038  1.00  0.68           O  
ATOM   1993  CB  ALA A 265      54.491  75.448 119.295  1.00  0.68           C  
ATOM   1994  N   VAL A 266      51.400  75.638 118.851  1.00  0.64           N  
ATOM   1995  CA  VAL A 266      50.114  76.310 118.836  1.00  0.64           C  
ATOM   1996  C   VAL A 266      49.017  75.519 119.555  1.00  0.64           C  
ATOM   1997  O   VAL A 266      48.201  76.097 120.269  1.00  0.64           O  
ATOM   1998  CB  VAL A 266      49.714  76.747 117.434  1.00  0.64           C  
ATOM   1999  CG1 VAL A 266      48.395  77.534 117.486  1.00  0.64           C  
ATOM   2000  CG2 VAL A 266      50.818  77.667 116.871  1.00  0.64           C  
ATOM   2001  N   LEU A 267      48.976  74.175 119.428  1.00  0.64           N  
ATOM   2002  CA  LEU A 267      48.061  73.329 120.193  1.00  0.64           C  
ATOM   2003  C   LEU A 267      48.317  73.328 121.706  1.00  0.64           C  
ATOM   2004  O   LEU A 267      47.383  73.401 122.506  1.00  0.64           O  
ATOM   2005  CB  LEU A 267      48.050  71.863 119.684  1.00  0.64           C  
ATOM   2006  CG  LEU A 267      47.755  71.672 118.178  1.00  0.64           C  
ATOM   2007  CD1 LEU A 267      47.617  70.178 117.851  1.00  0.64           C  
ATOM   2008  CD2 LEU A 267      46.530  72.460 117.688  1.00  0.64           C  
ATOM   2009  N   ASP A 268      49.597  73.301 122.138  1.00  0.68           N  
ATOM   2010  CA  ASP A 268      50.037  73.240 123.529  1.00  0.68           C  
ATOM   2011  C   ASP A 268      49.645  74.477 124.351  1.00  0.68           C  
ATOM   2012  O   ASP A 268      49.636  74.461 125.582  1.00  0.68           O  
ATOM   2013  CB  ASP A 268      51.576  73.010 123.590  1.00  0.68           C  
ATOM   2014  CG  ASP A 268      51.967  71.593 123.191  1.00  0.68           C  
ATOM   2015  OD1 ASP A 268      51.064  70.731 123.045  1.00  0.68           O  
ATOM   2016  OD2 ASP A 268      53.190  71.339 123.045  1.00  0.68           O  
ATOM   2017  N   ARG A 269      49.196  75.567 123.685  1.00  0.72           N  
ATOM   2018  CA  ARG A 269      48.539  76.716 124.298  1.00  0.72           C  
ATOM   2019  C   ARG A 269      47.328  76.336 125.140  1.00  0.72           C  
ATOM   2020  O   ARG A 269      47.088  76.923 126.198  1.00  0.72           O  
ATOM   2021  CB  ARG A 269      48.016  77.697 123.224  1.00  0.72           C  
ATOM   2022  CG  ARG A 269      49.117  78.467 122.469  1.00  0.72           C  
ATOM   2023  CD  ARG A 269      48.589  79.279 121.282  1.00  0.72           C  
ATOM   2024  NE  ARG A 269      47.510  80.174 121.799  1.00  0.72           N  
ATOM   2025  CZ  ARG A 269      47.623  81.459 122.151  1.00  0.72           C  
ATOM   2026  NH1 ARG A 269      48.788  82.078 122.229  1.00  0.72           N  
ATOM   2027  NH2 ARG A 269      46.507  82.133 122.402  1.00  0.72           N  
ATOM   2028  N   ASN A 270      46.572  75.301 124.703  1.00  0.81           N  
ATOM   2029  CA  ASN A 270      45.368  74.807 125.349  1.00  0.81           C  
ATOM   2030  C   ASN A 270      45.611  74.371 126.789  1.00  0.81           C  
ATOM   2031  O   ASN A 270      44.730  74.474 127.635  1.00  0.81           O  
ATOM   2032  CB  ASN A 270      44.706  73.639 124.562  1.00  0.81           C  
ATOM   2033  CG  ASN A 270      44.149  73.997 123.177  1.00  0.81           C  
ATOM   2034  OD1 ASN A 270      43.856  73.082 122.400  1.00  0.81           O  
ATOM   2035  ND2 ASN A 270      43.943  75.289 122.846  1.00  0.81           N  
ATOM   2036  N   LEU A 271      46.832  73.917 127.132  1.00  0.78           N  
ATOM   2037  CA  LEU A 271      47.221  73.583 128.492  1.00  0.78           C  
ATOM   2038  C   LEU A 271      47.132  74.760 129.468  1.00  0.78           C  
ATOM   2039  O   LEU A 271      46.673  74.606 130.598  1.00  0.78           O  
ATOM   2040  CB  LEU A 271      48.661  73.015 128.507  1.00  0.78           C  
ATOM   2041  CG  LEU A 271      48.870  71.764 127.625  1.00  0.78           C  
ATOM   2042  CD1 LEU A 271      50.361  71.401 127.563  1.00  0.78           C  
ATOM   2043  CD2 LEU A 271      48.049  70.560 128.110  1.00  0.78           C  
ATOM   2044  N   ALA A 272      47.544  75.974 129.042  1.00  0.83           N  
ATOM   2045  CA  ALA A 272      47.395  77.201 129.808  1.00  0.83           C  
ATOM   2046  C   ALA A 272      45.940  77.647 129.977  1.00  0.83           C  
ATOM   2047  O   ALA A 272      45.506  78.040 131.059  1.00  0.83           O  
ATOM   2048  CB  ALA A 272      48.208  78.325 129.135  1.00  0.83           C  
ATOM   2049  N   GLU A 273      45.140  77.552 128.895  1.00  0.85           N  
ATOM   2050  CA  GLU A 273      43.711  77.826 128.871  1.00  0.85           C  
ATOM   2051  C   GLU A 273      42.913  76.908 129.782  1.00  0.85           C  
ATOM   2052  O   GLU A 273      41.930  77.314 130.403  1.00  0.85           O  
ATOM   2053  CB  GLU A 273      43.144  77.578 127.461  1.00  0.85           C  
ATOM   2054  CG  GLU A 273      43.675  78.470 126.319  1.00  0.85           C  
ATOM   2055  CD  GLU A 273      43.360  77.806 124.984  1.00  0.85           C  
ATOM   2056  OE1 GLU A 273      42.244  77.231 124.856  1.00  0.85           O  
ATOM   2057  OE2 GLU A 273      44.274  77.758 124.125  1.00  0.85           O  
ATOM   2058  N   ASN A 274      43.331  75.626 129.879  1.00  0.86           N  
ATOM   2059  CA  ASN A 274      42.622  74.559 130.561  1.00  0.86           C  
ATOM   2060  C   ASN A 274      42.387  74.774 132.047  1.00  0.86           C  
ATOM   2061  O   ASN A 274      41.528  74.125 132.640  1.00  0.86           O  
ATOM   2062  CB  ASN A 274      43.278  73.172 130.305  1.00  0.86           C  
ATOM   2063  CG  ASN A 274      42.837  72.645 128.941  1.00  0.86           C  
ATOM   2064  OD1 ASN A 274      41.852  73.101 128.358  1.00  0.86           O  
ATOM   2065  ND2 ASN A 274      43.537  71.615 128.419  1.00  0.86           N  
ATOM   2066  N   ILE A 275      43.067  75.759 132.663  1.00  0.90           N  
ATOM   2067  CA  ILE A 275      42.766  76.249 133.999  1.00  0.90           C  
ATOM   2068  C   ILE A 275      41.335  76.783 134.096  1.00  0.90           C  
ATOM   2069  O   ILE A 275      40.597  76.442 135.016  1.00  0.90           O  
ATOM   2070  CB  ILE A 275      43.789  77.304 134.426  1.00  0.90           C  
ATOM   2071  CG1 ILE A 275      45.214  76.691 134.407  1.00  0.90           C  
ATOM   2072  CG2 ILE A 275      43.440  77.863 135.826  1.00  0.90           C  
ATOM   2073  CD1 ILE A 275      46.329  77.712 134.662  1.00  0.90           C  
ATOM   2074  N   SER A 276      40.848  77.563 133.108  1.00  0.92           N  
ATOM   2075  CA  SER A 276      39.473  78.061 133.130  1.00  0.92           C  
ATOM   2076  C   SER A 276      38.553  77.267 132.221  1.00  0.92           C  
ATOM   2077  O   SER A 276      37.491  77.745 131.832  1.00  0.92           O  
ATOM   2078  CB  SER A 276      39.323  79.579 132.806  1.00  0.92           C  
ATOM   2079  OG  SER A 276      39.675  79.916 131.462  1.00  0.92           O  
ATOM   2080  N   ARG A 277      38.913  76.032 131.822  1.00  0.84           N  
ATOM   2081  CA  ARG A 277      38.038  75.235 130.976  1.00  0.84           C  
ATOM   2082  C   ARG A 277      36.783  74.719 131.672  1.00  0.84           C  
ATOM   2083  O   ARG A 277      35.690  74.803 131.122  1.00  0.84           O  
ATOM   2084  CB  ARG A 277      38.801  74.046 130.344  1.00  0.84           C  
ATOM   2085  CG  ARG A 277      38.131  73.399 129.109  1.00  0.84           C  
ATOM   2086  CD  ARG A 277      38.168  74.255 127.830  1.00  0.84           C  
ATOM   2087  NE  ARG A 277      39.575  74.286 127.337  1.00  0.84           N  
ATOM   2088  CZ  ARG A 277      40.087  75.212 126.520  1.00  0.84           C  
ATOM   2089  NH1 ARG A 277      39.407  76.224 126.005  1.00  0.84           N  
ATOM   2090  NH2 ARG A 277      41.366  75.087 126.182  1.00  0.84           N  
ATOM   2091  N   VAL A 278      36.885  74.184 132.905  1.00  0.89           N  
ATOM   2092  CA  VAL A 278      35.765  73.463 133.497  1.00  0.89           C  
ATOM   2093  C   VAL A 278      35.681  73.611 135.007  1.00  0.89           C  
ATOM   2094  O   VAL A 278      36.681  73.595 135.724  1.00  0.89           O  
ATOM   2095  CB  VAL A 278      35.785  71.989 133.082  1.00  0.89           C  
ATOM   2096  CG1 VAL A 278      37.041  71.255 133.598  1.00  0.89           C  
ATOM   2097  CG2 VAL A 278      34.491  71.263 133.503  1.00  0.89           C  
ATOM   2098  N   LEU A 279      34.451  73.781 135.536  1.00  0.90           N  
ATOM   2099  CA  LEU A 279      34.155  73.691 136.956  1.00  0.90           C  
ATOM   2100  C   LEU A 279      34.388  72.290 137.528  1.00  0.90           C  
ATOM   2101  O   LEU A 279      33.944  71.284 136.976  1.00  0.90           O  
ATOM   2102  CB  LEU A 279      32.679  74.105 137.199  1.00  0.90           C  
ATOM   2103  CG  LEU A 279      32.168  74.028 138.656  1.00  0.90           C  
ATOM   2104  CD1 LEU A 279      32.850  75.037 139.592  1.00  0.90           C  
ATOM   2105  CD2 LEU A 279      30.649  74.227 138.689  1.00  0.90           C  
ATOM   2106  N   TYR A 280      35.072  72.177 138.688  1.00  0.87           N  
ATOM   2107  CA  TYR A 280      35.159  70.916 139.410  1.00  0.87           C  
ATOM   2108  C   TYR A 280      33.812  70.544 140.053  1.00  0.87           C  
ATOM   2109  O   TYR A 280      33.281  71.353 140.816  1.00  0.87           O  
ATOM   2110  CB  TYR A 280      36.264  70.932 140.503  1.00  0.87           C  
ATOM   2111  CG  TYR A 280      37.567  70.450 139.924  1.00  0.87           C  
ATOM   2112  CD1 TYR A 280      38.069  69.185 140.275  1.00  0.87           C  
ATOM   2113  CD2 TYR A 280      38.271  71.222 138.984  1.00  0.87           C  
ATOM   2114  CE1 TYR A 280      39.254  68.704 139.704  1.00  0.87           C  
ATOM   2115  CE2 TYR A 280      39.450  70.738 138.401  1.00  0.87           C  
ATOM   2116  CZ  TYR A 280      39.938  69.478 138.763  1.00  0.87           C  
ATOM   2117  OH  TYR A 280      41.100  68.984 138.147  1.00  0.87           O  
ATOM   2118  N   PRO A 281      33.205  69.376 139.844  1.00  0.87           N  
ATOM   2119  CA  PRO A 281      31.756  69.247 140.026  1.00  0.87           C  
ATOM   2120  C   PRO A 281      31.469  68.530 141.333  1.00  0.87           C  
ATOM   2121  O   PRO A 281      30.521  67.742 141.424  1.00  0.87           O  
ATOM   2122  CB  PRO A 281      31.372  68.348 138.840  1.00  0.87           C  
ATOM   2123  CG  PRO A 281      32.565  67.403 138.724  1.00  0.87           C  
ATOM   2124  CD  PRO A 281      33.730  68.354 138.932  1.00  0.87           C  
ATOM   2125  N   ASN A 282      32.245  68.844 142.381  1.00  0.84           N  
ATOM   2126  CA  ASN A 282      32.220  68.146 143.646  1.00  0.84           C  
ATOM   2127  C   ASN A 282      31.606  69.026 144.727  1.00  0.84           C  
ATOM   2128  O   ASN A 282      32.212  69.985 145.195  1.00  0.84           O  
ATOM   2129  CB  ASN A 282      33.663  67.759 144.065  1.00  0.84           C  
ATOM   2130  CG  ASN A 282      34.282  66.827 143.022  1.00  0.84           C  
ATOM   2131  OD1 ASN A 282      33.613  65.958 142.459  1.00  0.84           O  
ATOM   2132  ND2 ASN A 282      35.597  67.015 142.766  1.00  0.84           N  
ATOM   2133  N   ASP A 283      30.378  68.689 145.172  1.00  0.82           N  
ATOM   2134  CA  ASP A 283      29.699  69.361 146.262  1.00  0.82           C  
ATOM   2135  C   ASP A 283      30.074  68.639 147.554  1.00  0.82           C  
ATOM   2136  O   ASP A 283      29.949  67.420 147.653  1.00  0.82           O  
ATOM   2137  CB  ASP A 283      28.166  69.341 146.003  1.00  0.82           C  
ATOM   2138  CG  ASP A 283      27.393  70.276 146.919  1.00  0.82           C  
ATOM   2139  OD1 ASP A 283      27.422  70.043 148.151  1.00  0.82           O  
ATOM   2140  OD2 ASP A 283      26.736  71.217 146.404  1.00  0.82           O  
ATOM   2141  N   ASN A 284      30.609  69.383 148.550  1.00  0.79           N  
ATOM   2142  CA  ASN A 284      31.029  68.858 149.844  1.00  0.79           C  
ATOM   2143  C   ASN A 284      32.023  67.694 149.783  1.00  0.79           C  
ATOM   2144  O   ASN A 284      31.943  66.739 150.554  1.00  0.79           O  
ATOM   2145  CB  ASN A 284      29.803  68.497 150.726  1.00  0.79           C  
ATOM   2146  CG  ASN A 284      29.211  69.756 151.337  1.00  0.79           C  
ATOM   2147  OD1 ASN A 284      29.571  70.125 152.457  1.00  0.79           O  
ATOM   2148  ND2 ASN A 284      28.268  70.422 150.643  1.00  0.79           N  
ATOM   2149  N   PHE A 285      33.016  67.772 148.878  1.00  0.83           N  
ATOM   2150  CA  PHE A 285      34.045  66.762 148.769  1.00  0.83           C  
ATOM   2151  C   PHE A 285      35.323  67.414 148.255  1.00  0.83           C  
ATOM   2152  O   PHE A 285      35.286  68.225 147.330  1.00  0.83           O  
ATOM   2153  CB  PHE A 285      33.560  65.631 147.819  1.00  0.83           C  
ATOM   2154  CG  PHE A 285      34.529  64.486 147.756  1.00  0.83           C  
ATOM   2155  CD1 PHE A 285      34.668  63.620 148.851  1.00  0.83           C  
ATOM   2156  CD2 PHE A 285      35.326  64.284 146.617  1.00  0.83           C  
ATOM   2157  CE1 PHE A 285      35.591  62.568 148.813  1.00  0.83           C  
ATOM   2158  CE2 PHE A 285      36.252  63.234 146.575  1.00  0.83           C  
ATOM   2159  CZ  PHE A 285      36.385  62.377 147.675  1.00  0.83           C  
ATOM   2160  N   PHE A 286      36.488  67.073 148.837  1.00  0.84           N  
ATOM   2161  CA  PHE A 286      37.779  67.574 148.401  1.00  0.84           C  
ATOM   2162  C   PHE A 286      38.465  66.591 147.446  1.00  0.84           C  
ATOM   2163  O   PHE A 286      38.703  65.430 147.768  1.00  0.84           O  
ATOM   2164  CB  PHE A 286      38.668  67.869 149.646  1.00  0.84           C  
ATOM   2165  CG  PHE A 286      40.080  68.286 149.303  1.00  0.84           C  
ATOM   2166  CD1 PHE A 286      40.341  69.362 148.438  1.00  0.84           C  
ATOM   2167  CD2 PHE A 286      41.163  67.573 149.841  1.00  0.84           C  
ATOM   2168  CE1 PHE A 286      41.657  69.729 148.132  1.00  0.84           C  
ATOM   2169  CE2 PHE A 286      42.479  67.921 149.518  1.00  0.84           C  
ATOM   2170  CZ  PHE A 286      42.728  69.007 148.669  1.00  0.84           C  
ATOM   2171  N   GLU A 287      38.842  67.066 146.240  1.00  0.80           N  
ATOM   2172  CA  GLU A 287      39.567  66.276 145.267  1.00  0.80           C  
ATOM   2173  C   GLU A 287      40.902  66.955 144.971  1.00  0.80           C  
ATOM   2174  O   GLU A 287      40.963  68.077 144.475  1.00  0.80           O  
ATOM   2175  CB  GLU A 287      38.760  66.098 143.963  1.00  0.80           C  
ATOM   2176  CG  GLU A 287      39.420  65.105 142.982  1.00  0.80           C  
ATOM   2177  CD  GLU A 287      38.802  65.148 141.589  1.00  0.80           C  
ATOM   2178  OE1 GLU A 287      37.778  65.838 141.367  1.00  0.80           O  
ATOM   2179  OE2 GLU A 287      39.409  64.489 140.703  1.00  0.80           O  
ATOM   2180  N   GLY A 288      42.036  66.289 145.283  1.00  0.88           N  
ATOM   2181  CA  GLY A 288      43.370  66.897 145.241  1.00  0.88           C  
ATOM   2182  C   GLY A 288      44.079  66.940 143.906  1.00  0.88           C  
ATOM   2183  O   GLY A 288      45.294  66.777 143.847  1.00  0.88           O  
ATOM   2184  N   LYS A 289      43.363  67.147 142.788  1.00  0.83           N  
ATOM   2185  CA  LYS A 289      43.972  67.326 141.476  1.00  0.83           C  
ATOM   2186  C   LYS A 289      44.757  68.639 141.328  1.00  0.83           C  
ATOM   2187  O   LYS A 289      44.303  69.706 141.733  1.00  0.83           O  
ATOM   2188  CB  LYS A 289      42.899  67.287 140.361  1.00  0.83           C  
ATOM   2189  CG  LYS A 289      42.138  65.958 140.191  1.00  0.83           C  
ATOM   2190  CD  LYS A 289      42.943  64.819 139.541  1.00  0.83           C  
ATOM   2191  CE  LYS A 289      42.130  63.954 138.555  1.00  0.83           C  
ATOM   2192  NZ  LYS A 289      41.052  63.174 139.190  1.00  0.83           N  
ATOM   2193  N   GLU A 290      45.942  68.619 140.667  1.00  0.88           N  
ATOM   2194  CA  GLU A 290      46.794  69.798 140.479  1.00  0.88           C  
ATOM   2195  C   GLU A 290      46.120  70.948 139.728  1.00  0.88           C  
ATOM   2196  O   GLU A 290      46.317  72.127 140.017  1.00  0.88           O  
ATOM   2197  CB  GLU A 290      48.119  69.425 139.752  1.00  0.88           C  
ATOM   2198  CG  GLU A 290      49.160  70.580 139.725  1.00  0.88           C  
ATOM   2199  CD  GLU A 290      50.445  70.246 138.979  1.00  0.88           C  
ATOM   2200  OE1 GLU A 290      50.657  70.810 137.871  1.00  0.88           O  
ATOM   2201  OE2 GLU A 290      51.261  69.452 139.508  1.00  0.88           O  
ATOM   2202  N   LEU A 291      45.269  70.627 138.732  1.00  0.91           N  
ATOM   2203  CA  LEU A 291      44.508  71.604 137.973  1.00  0.91           C  
ATOM   2204  C   LEU A 291      43.547  72.439 138.820  1.00  0.91           C  
ATOM   2205  O   LEU A 291      43.418  73.641 138.612  1.00  0.91           O  
ATOM   2206  CB  LEU A 291      43.757  70.904 136.816  1.00  0.91           C  
ATOM   2207  CG  LEU A 291      43.050  71.847 135.820  1.00  0.91           C  
ATOM   2208  CD1 LEU A 291      44.055  72.704 135.034  1.00  0.91           C  
ATOM   2209  CD2 LEU A 291      42.174  71.048 134.844  1.00  0.91           C  
ATOM   2210  N   ARG A 292      42.883  71.841 139.832  1.00  0.87           N  
ATOM   2211  CA  ARG A 292      42.058  72.565 140.789  1.00  0.87           C  
ATOM   2212  C   ARG A 292      42.856  73.583 141.609  1.00  0.87           C  
ATOM   2213  O   ARG A 292      42.445  74.731 141.740  1.00  0.87           O  
ATOM   2214  CB  ARG A 292      41.321  71.552 141.700  1.00  0.87           C  
ATOM   2215  CG  ARG A 292      40.604  72.135 142.934  1.00  0.87           C  
ATOM   2216  CD  ARG A 292      39.491  73.158 142.677  1.00  0.87           C  
ATOM   2217  NE  ARG A 292      39.105  73.606 144.046  1.00  0.87           N  
ATOM   2218  CZ  ARG A 292      37.958  74.167 144.421  1.00  0.87           C  
ATOM   2219  NH1 ARG A 292      37.023  74.541 143.554  1.00  0.87           N  
ATOM   2220  NH2 ARG A 292      37.740  74.415 145.703  1.00  0.87           N  
ATOM   2221  N   LEU A 293      44.062  73.222 142.098  1.00  0.94           N  
ATOM   2222  CA  LEU A 293      44.962  74.140 142.793  1.00  0.94           C  
ATOM   2223  C   LEU A 293      45.385  75.329 141.921  1.00  0.94           C  
ATOM   2224  O   LEU A 293      45.474  76.476 142.362  1.00  0.94           O  
ATOM   2225  CB  LEU A 293      46.210  73.362 143.289  1.00  0.94           C  
ATOM   2226  CG  LEU A 293      47.195  74.153 144.178  1.00  0.94           C  
ATOM   2227  CD1 LEU A 293      46.538  74.642 145.474  1.00  0.94           C  
ATOM   2228  CD2 LEU A 293      48.420  73.286 144.513  1.00  0.94           C  
ATOM   2229  N   LYS A 294      45.606  75.090 140.609  1.00  0.93           N  
ATOM   2230  CA  LYS A 294      45.812  76.148 139.632  1.00  0.93           C  
ATOM   2231  C   LYS A 294      44.632  77.099 139.497  1.00  0.93           C  
ATOM   2232  O   LYS A 294      44.830  78.305 139.397  1.00  0.93           O  
ATOM   2233  CB  LYS A 294      46.172  75.594 138.232  1.00  0.93           C  
ATOM   2234  CG  LYS A 294      47.542  74.914 138.222  1.00  0.93           C  
ATOM   2235  CD  LYS A 294      47.849  74.148 136.927  1.00  0.93           C  
ATOM   2236  CE  LYS A 294      49.233  73.503 137.020  1.00  0.93           C  
ATOM   2237  NZ  LYS A 294      49.377  72.320 136.146  1.00  0.93           N  
ATOM   2238  N   GLN A 295      43.379  76.596 139.521  1.00  0.92           N  
ATOM   2239  CA  GLN A 295      42.179  77.422 139.528  1.00  0.92           C  
ATOM   2240  C   GLN A 295      42.074  78.321 140.745  1.00  0.92           C  
ATOM   2241  O   GLN A 295      41.806  79.517 140.625  1.00  0.92           O  
ATOM   2242  CB  GLN A 295      40.900  76.550 139.474  1.00  0.92           C  
ATOM   2243  CG  GLN A 295      40.792  75.773 138.153  1.00  0.92           C  
ATOM   2244  CD  GLN A 295      39.527  74.920 138.074  1.00  0.92           C  
ATOM   2245  OE1 GLN A 295      38.972  74.453 139.070  1.00  0.92           O  
ATOM   2246  NE2 GLN A 295      39.069  74.704 136.820  1.00  0.92           N  
ATOM   2247  N   GLU A 296      42.343  77.766 141.942  1.00  0.94           N  
ATOM   2248  CA  GLU A 296      42.350  78.488 143.201  1.00  0.94           C  
ATOM   2249  C   GLU A 296      43.372  79.612 143.216  1.00  0.94           C  
ATOM   2250  O   GLU A 296      43.076  80.746 143.588  1.00  0.94           O  
ATOM   2251  CB  GLU A 296      42.649  77.502 144.350  1.00  0.94           C  
ATOM   2252  CG  GLU A 296      41.558  76.417 144.512  1.00  0.94           C  
ATOM   2253  CD  GLU A 296      41.979  75.282 145.441  1.00  0.94           C  
ATOM   2254  OE1 GLU A 296      43.053  75.362 146.086  1.00  0.94           O  
ATOM   2255  OE2 GLU A 296      41.218  74.280 145.467  1.00  0.94           O  
ATOM   2256  N   TYR A 297      44.604  79.349 142.740  1.00  0.96           N  
ATOM   2257  CA  TYR A 297      45.598  80.388 142.559  1.00  0.96           C  
ATOM   2258  C   TYR A 297      45.266  81.411 141.465  1.00  0.96           C  
ATOM   2259  O   TYR A 297      45.445  82.612 141.657  1.00  0.96           O  
ATOM   2260  CB  TYR A 297      46.991  79.758 142.312  1.00  0.96           C  
ATOM   2261  CG  TYR A 297      48.051  80.819 142.431  1.00  0.96           C  
ATOM   2262  CD1 TYR A 297      48.275  81.446 143.668  1.00  0.96           C  
ATOM   2263  CD2 TYR A 297      48.741  81.277 141.298  1.00  0.96           C  
ATOM   2264  CE1 TYR A 297      49.174  82.514 143.766  1.00  0.96           C  
ATOM   2265  CE2 TYR A 297      49.653  82.336 141.401  1.00  0.96           C  
ATOM   2266  CZ  TYR A 297      49.876  82.945 142.638  1.00  0.96           C  
ATOM   2267  OH  TYR A 297      50.789  84.008 142.740  1.00  0.96           O  
ATOM   2268  N   PHE A 298      44.760  80.974 140.293  1.00  0.96           N  
ATOM   2269  CA  PHE A 298      44.458  81.833 139.157  1.00  0.96           C  
ATOM   2270  C   PHE A 298      43.446  82.923 139.486  1.00  0.96           C  
ATOM   2271  O   PHE A 298      43.667  84.101 139.201  1.00  0.96           O  
ATOM   2272  CB  PHE A 298      43.950  80.927 137.996  1.00  0.96           C  
ATOM   2273  CG  PHE A 298      43.553  81.665 136.747  1.00  0.96           C  
ATOM   2274  CD1 PHE A 298      44.523  82.192 135.879  1.00  0.96           C  
ATOM   2275  CD2 PHE A 298      42.193  81.828 136.436  1.00  0.96           C  
ATOM   2276  CE1 PHE A 298      44.138  82.886 134.724  1.00  0.96           C  
ATOM   2277  CE2 PHE A 298      41.804  82.521 135.284  1.00  0.96           C  
ATOM   2278  CZ  PHE A 298      42.778  83.058 134.435  1.00  0.96           C  
ATOM   2279  N   VAL A 299      42.335  82.560 140.159  1.00  0.97           N  
ATOM   2280  CA  VAL A 299      41.348  83.529 140.604  1.00  0.97           C  
ATOM   2281  C   VAL A 299      41.896  84.486 141.654  1.00  0.97           C  
ATOM   2282  O   VAL A 299      41.667  85.692 141.587  1.00  0.97           O  
ATOM   2283  CB  VAL A 299      40.049  82.857 141.037  1.00  0.97           C  
ATOM   2284  CG1 VAL A 299      40.191  82.048 142.338  1.00  0.97           C  
ATOM   2285  CG2 VAL A 299      38.917  83.894 141.146  1.00  0.97           C  
ATOM   2286  N   VAL A 300      42.685  83.986 142.626  1.00  0.97           N  
ATOM   2287  CA  VAL A 300      43.326  84.780 143.661  1.00  0.97           C  
ATOM   2288  C   VAL A 300      44.326  85.797 143.124  1.00  0.97           C  
ATOM   2289  O   VAL A 300      44.241  86.987 143.432  1.00  0.97           O  
ATOM   2290  CB  VAL A 300      44.011  83.819 144.632  1.00  0.97           C  
ATOM   2291  CG1 VAL A 300      45.142  84.475 145.444  1.00  0.97           C  
ATOM   2292  CG2 VAL A 300      42.942  83.232 145.574  1.00  0.97           C  
ATOM   2293  N   ALA A 301      45.277  85.358 142.276  1.00  0.97           N  
ATOM   2294  CA  ALA A 301      46.360  86.180 141.778  1.00  0.97           C  
ATOM   2295  C   ALA A 301      45.897  87.301 140.868  1.00  0.97           C  
ATOM   2296  O   ALA A 301      46.330  88.447 140.978  1.00  0.97           O  
ATOM   2297  CB  ALA A 301      47.367  85.280 141.040  1.00  0.97           C  
ATOM   2298  N   ALA A 302      44.962  87.002 139.946  1.00  0.97           N  
ATOM   2299  CA  ALA A 302      44.353  88.003 139.103  1.00  0.97           C  
ATOM   2300  C   ALA A 302      43.504  89.004 139.887  1.00  0.97           C  
ATOM   2301  O   ALA A 302      43.606  90.218 139.708  1.00  0.97           O  
ATOM   2302  CB  ALA A 302      43.516  87.282 138.035  1.00  0.97           C  
ATOM   2303  N   THR A 303      42.677  88.512 140.834  1.00  0.96           N  
ATOM   2304  CA  THR A 303      41.819  89.351 141.670  1.00  0.96           C  
ATOM   2305  C   THR A 303      42.580  90.309 142.556  1.00  0.96           C  
ATOM   2306  O   THR A 303      42.298  91.504 142.570  1.00  0.96           O  
ATOM   2307  CB  THR A 303      40.896  88.530 142.558  1.00  0.96           C  
ATOM   2308  OG1 THR A 303      40.028  87.764 141.736  1.00  0.96           O  
ATOM   2309  CG2 THR A 303      40.013  89.409 143.456  1.00  0.96           C  
ATOM   2310  N   LEU A 304      43.606  89.839 143.294  1.00  0.95           N  
ATOM   2311  CA  LEU A 304      44.380  90.698 144.178  1.00  0.95           C  
ATOM   2312  C   LEU A 304      45.160  91.782 143.456  1.00  0.95           C  
ATOM   2313  O   LEU A 304      45.172  92.934 143.885  1.00  0.95           O  
ATOM   2314  CB  LEU A 304      45.307  89.875 145.098  1.00  0.95           C  
ATOM   2315  CG  LEU A 304      44.553  89.189 146.256  1.00  0.95           C  
ATOM   2316  CD1 LEU A 304      45.469  88.194 146.969  1.00  0.95           C  
ATOM   2317  CD2 LEU A 304      44.020  90.205 147.277  1.00  0.95           C  
ATOM   2318  N   GLN A 305      45.772  91.465 142.298  1.00  0.91           N  
ATOM   2319  CA  GLN A 305      46.391  92.461 141.442  1.00  0.91           C  
ATOM   2320  C   GLN A 305      45.402  93.515 140.935  1.00  0.91           C  
ATOM   2321  O   GLN A 305      45.699  94.707 140.953  1.00  0.91           O  
ATOM   2322  CB  GLN A 305      47.073  91.773 140.238  1.00  0.91           C  
ATOM   2323  CG  GLN A 305      48.382  91.030 140.591  1.00  0.91           C  
ATOM   2324  CD  GLN A 305      48.965  90.345 139.351  1.00  0.91           C  
ATOM   2325  OE1 GLN A 305      49.889  90.846 138.709  1.00  0.91           O  
ATOM   2326  NE2 GLN A 305      48.404  89.167 139.001  1.00  0.91           N  
ATOM   2327  N   ASP A 306      44.181  93.119 140.511  1.00  0.91           N  
ATOM   2328  CA  ASP A 306      43.129  94.039 140.106  1.00  0.91           C  
ATOM   2329  C   ASP A 306      42.630  94.946 141.245  1.00  0.91           C  
ATOM   2330  O   ASP A 306      42.449  96.151 141.064  1.00  0.91           O  
ATOM   2331  CB  ASP A 306      41.981  93.223 139.453  1.00  0.91           C  
ATOM   2332  CG  ASP A 306      41.063  94.077 138.609  1.00  0.91           C  
ATOM   2333  OD1 ASP A 306      41.562  94.849 137.752  1.00  0.91           O  
ATOM   2334  OD2 ASP A 306      39.816  93.972 138.767  1.00  0.91           O  
ATOM   2335  N   ILE A 307      42.440  94.398 142.466  1.00  0.92           N  
ATOM   2336  CA  ILE A 307      42.088  95.160 143.665  1.00  0.92           C  
ATOM   2337  C   ILE A 307      43.155  96.178 144.052  1.00  0.92           C  
ATOM   2338  O   ILE A 307      42.855  97.344 144.313  1.00  0.92           O  
ATOM   2339  CB  ILE A 307      41.806  94.229 144.851  1.00  0.92           C  
ATOM   2340  CG1 ILE A 307      40.537  93.393 144.565  1.00  0.92           C  
ATOM   2341  CG2 ILE A 307      41.651  95.017 146.178  1.00  0.92           C  
ATOM   2342  CD1 ILE A 307      40.272  92.296 145.603  1.00  0.92           C  
ATOM   2343  N   ILE A 308      44.442  95.775 144.063  1.00  0.89           N  
ATOM   2344  CA  ILE A 308      45.570  96.655 144.345  1.00  0.89           C  
ATOM   2345  C   ILE A 308      45.748  97.724 143.274  1.00  0.89           C  
ATOM   2346  O   ILE A 308      45.950  98.897 143.581  1.00  0.89           O  
ATOM   2347  CB  ILE A 308      46.837  95.846 144.616  1.00  0.89           C  
ATOM   2348  CG1 ILE A 308      46.652  95.087 145.955  1.00  0.89           C  
ATOM   2349  CG2 ILE A 308      48.092  96.748 144.658  1.00  0.89           C  
ATOM   2350  CD1 ILE A 308      47.749  94.063 146.248  1.00  0.89           C  
ATOM   2351  N   ARG A 309      45.594  97.369 141.982  1.00  0.80           N  
ATOM   2352  CA  ARG A 309      45.593  98.307 140.869  1.00  0.80           C  
ATOM   2353  C   ARG A 309      44.504  99.370 140.990  1.00  0.80           C  
ATOM   2354  O   ARG A 309      44.750 100.558 140.794  1.00  0.80           O  
ATOM   2355  CB  ARG A 309      45.441  97.504 139.547  1.00  0.80           C  
ATOM   2356  CG  ARG A 309      45.387  98.330 138.246  1.00  0.80           C  
ATOM   2357  CD  ARG A 309      45.600  97.505 136.963  1.00  0.80           C  
ATOM   2358  NE  ARG A 309      44.515  96.473 136.867  1.00  0.80           N  
ATOM   2359  CZ  ARG A 309      44.513  95.454 135.996  1.00  0.80           C  
ATOM   2360  NH1 ARG A 309      45.401  95.350 135.011  1.00  0.80           N  
ATOM   2361  NH2 ARG A 309      43.568  94.528 136.098  1.00  0.80           N  
ATOM   2362  N   ARG A 310      43.279  98.972 141.382  1.00  0.79           N  
ATOM   2363  CA  ARG A 310      42.188  99.879 141.691  1.00  0.79           C  
ATOM   2364  C   ARG A 310      42.435 100.787 142.894  1.00  0.79           C  
ATOM   2365  O   ARG A 310      42.096 101.968 142.875  1.00  0.79           O  
ATOM   2366  CB  ARG A 310      40.897  99.055 141.893  1.00  0.79           C  
ATOM   2367  CG  ARG A 310      39.596  99.886 141.896  1.00  0.79           C  
ATOM   2368  CD  ARG A 310      38.306  99.054 141.961  1.00  0.79           C  
ATOM   2369  NE  ARG A 310      38.243  98.234 140.708  1.00  0.79           N  
ATOM   2370  CZ  ARG A 310      38.498  96.919 140.631  1.00  0.79           C  
ATOM   2371  NH1 ARG A 310      38.586  96.143 141.702  1.00  0.79           N  
ATOM   2372  NH2 ARG A 310      38.690  96.380 139.429  1.00  0.79           N  
ATOM   2373  N   PHE A 311      43.044 100.266 143.980  1.00  0.82           N  
ATOM   2374  CA  PHE A 311      43.438 101.052 145.140  1.00  0.82           C  
ATOM   2375  C   PHE A 311      44.490 102.119 144.812  1.00  0.82           C  
ATOM   2376  O   PHE A 311      44.350 103.284 145.183  1.00  0.82           O  
ATOM   2377  CB  PHE A 311      43.954 100.082 146.245  1.00  0.82           C  
ATOM   2378  CG  PHE A 311      44.410 100.781 147.503  1.00  0.82           C  
ATOM   2379  CD1 PHE A 311      43.483 101.247 148.450  1.00  0.82           C  
ATOM   2380  CD2 PHE A 311      45.782 100.969 147.746  1.00  0.82           C  
ATOM   2381  CE1 PHE A 311      43.919 101.885 149.620  1.00  0.82           C  
ATOM   2382  CE2 PHE A 311      46.222 101.605 148.913  1.00  0.82           C  
ATOM   2383  CZ  PHE A 311      45.290 102.062 149.852  1.00  0.82           C  
ATOM   2384  N   LYS A 312      45.551 101.759 144.063  1.00  0.74           N  
ATOM   2385  CA  LYS A 312      46.655 102.661 143.769  1.00  0.74           C  
ATOM   2386  C   LYS A 312      46.314 103.708 142.717  1.00  0.74           C  
ATOM   2387  O   LYS A 312      46.960 104.748 142.640  1.00  0.74           O  
ATOM   2388  CB  LYS A 312      47.909 101.872 143.307  1.00  0.74           C  
ATOM   2389  CG  LYS A 312      48.469 100.926 144.384  1.00  0.74           C  
ATOM   2390  CD  LYS A 312      49.663 100.078 143.906  1.00  0.74           C  
ATOM   2391  CE  LYS A 312      51.024 100.764 144.067  1.00  0.74           C  
ATOM   2392  NZ  LYS A 312      52.095  99.814 143.748  1.00  0.74           N  
ATOM   2393  N   ALA A 313      45.255 103.479 141.918  1.00  0.77           N  
ATOM   2394  CA  ALA A 313      44.768 104.430 140.940  1.00  0.77           C  
ATOM   2395  C   ALA A 313      43.623 105.283 141.483  1.00  0.77           C  
ATOM   2396  O   ALA A 313      42.993 106.050 140.760  1.00  0.77           O  
ATOM   2397  CB  ALA A 313      44.284 103.648 139.703  1.00  0.77           C  
ATOM   2398  N   SER A 314      43.318 105.176 142.790  1.00  0.76           N  
ATOM   2399  CA  SER A 314      42.238 105.926 143.411  1.00  0.76           C  
ATOM   2400  C   SER A 314      42.651 107.322 143.860  1.00  0.76           C  
ATOM   2401  O   SER A 314      43.827 107.664 143.937  1.00  0.76           O  
ATOM   2402  CB  SER A 314      41.619 105.163 144.618  1.00  0.76           C  
ATOM   2403  OG  SER A 314      42.474 105.140 145.765  1.00  0.76           O  
ATOM   2404  N   LYS A 315      41.666 108.170 144.229  1.00  0.67           N  
ATOM   2405  CA  LYS A 315      41.909 109.474 144.833  1.00  0.67           C  
ATOM   2406  C   LYS A 315      42.646 109.418 146.169  1.00  0.67           C  
ATOM   2407  O   LYS A 315      43.418 110.306 146.525  1.00  0.67           O  
ATOM   2408  CB  LYS A 315      40.577 110.224 145.041  1.00  0.67           C  
ATOM   2409  CG  LYS A 315      39.887 110.564 143.714  1.00  0.67           C  
ATOM   2410  CD  LYS A 315      38.597 111.330 143.950  1.00  0.67           C  
ATOM   2411  CE  LYS A 315      37.868 111.780 142.712  1.00  0.67           C  
ATOM   2412  NZ  LYS A 315      36.711 112.489 143.294  1.00  0.67           N  
ATOM   2413  N   PHE A 316      42.432 108.344 146.955  1.00  0.61           N  
ATOM   2414  CA  PHE A 316      43.248 108.070 148.121  1.00  0.61           C  
ATOM   2415  C   PHE A 316      44.684 107.741 147.757  1.00  0.61           C  
ATOM   2416  O   PHE A 316      45.607 108.190 148.426  1.00  0.61           O  
ATOM   2417  CB  PHE A 316      42.675 106.901 148.962  1.00  0.61           C  
ATOM   2418  CG  PHE A 316      41.491 107.364 149.760  1.00  0.61           C  
ATOM   2419  CD1 PHE A 316      41.651 108.369 150.730  1.00  0.61           C  
ATOM   2420  CD2 PHE A 316      40.225 106.784 149.582  1.00  0.61           C  
ATOM   2421  CE1 PHE A 316      40.564 108.796 151.502  1.00  0.61           C  
ATOM   2422  CE2 PHE A 316      39.135 107.209 150.355  1.00  0.61           C  
ATOM   2423  CZ  PHE A 316      39.304 108.216 151.312  1.00  0.61           C  
ATOM   2424  N   GLY A 317      44.912 106.962 146.678  1.00  0.64           N  
ATOM   2425  CA  GLY A 317      46.231 106.482 146.266  1.00  0.64           C  
ATOM   2426  C   GLY A 317      47.246 107.547 145.938  1.00  0.64           C  
ATOM   2427  O   GLY A 317      48.438 107.362 146.165  1.00  0.64           O  
ATOM   2428  N   SER A 318      46.802 108.717 145.450  1.00  0.65           N  
ATOM   2429  CA  SER A 318      47.688 109.819 145.100  1.00  0.65           C  
ATOM   2430  C   SER A 318      47.934 110.780 146.251  1.00  0.65           C  
ATOM   2431  O   SER A 318      48.752 111.691 146.144  1.00  0.65           O  
ATOM   2432  CB  SER A 318      47.091 110.648 143.931  1.00  0.65           C  
ATOM   2433  OG  SER A 318      45.769 111.106 144.234  1.00  0.65           O  
ATOM   2434  N   THR A 319      47.253 110.587 147.396  1.00  0.60           N  
ATOM   2435  CA  THR A 319      47.333 111.484 148.549  1.00  0.60           C  
ATOM   2436  C   THR A 319      47.911 110.779 149.760  1.00  0.60           C  
ATOM   2437  O   THR A 319      47.873 111.278 150.884  1.00  0.60           O  
ATOM   2438  CB  THR A 319      45.991 112.114 148.921  1.00  0.60           C  
ATOM   2439  OG1 THR A 319      44.946 111.157 149.041  1.00  0.60           O  
ATOM   2440  CG2 THR A 319      45.564 113.092 147.818  1.00  0.60           C  
ATOM   2441  N   ARG A 320      48.513 109.589 149.577  1.00  0.51           N  
ATOM   2442  CA  ARG A 320      49.114 108.859 150.675  1.00  0.51           C  
ATOM   2443  C   ARG A 320      50.529 109.318 151.000  1.00  0.51           C  
ATOM   2444  O   ARG A 320      51.466 109.133 150.228  1.00  0.51           O  
ATOM   2445  CB  ARG A 320      49.188 107.343 150.395  1.00  0.51           C  
ATOM   2446  CG  ARG A 320      47.865 106.667 149.988  1.00  0.51           C  
ATOM   2447  CD  ARG A 320      46.712 106.787 150.990  1.00  0.51           C  
ATOM   2448  NE  ARG A 320      47.132 106.019 152.211  1.00  0.51           N  
ATOM   2449  CZ  ARG A 320      46.891 106.383 153.475  1.00  0.51           C  
ATOM   2450  NH1 ARG A 320      47.525 105.768 154.473  1.00  0.51           N  
ATOM   2451  NH2 ARG A 320      46.030 107.356 153.764  1.00  0.51           N  
ATOM   2452  N   GLY A 321      50.721 109.907 152.197  1.00  0.55           N  
ATOM   2453  CA  GLY A 321      52.043 110.249 152.713  1.00  0.55           C  
ATOM   2454  C   GLY A 321      52.892 109.070 153.142  1.00  0.55           C  
ATOM   2455  O   GLY A 321      52.524 107.909 152.983  1.00  0.55           O  
ATOM   2456  N   ALA A 322      54.079 109.377 153.711  1.00  0.47           N  
ATOM   2457  CA  ALA A 322      55.043 108.459 154.314  1.00  0.47           C  
ATOM   2458  C   ALA A 322      55.743 107.450 153.400  1.00  0.47           C  
ATOM   2459  O   ALA A 322      56.846 107.001 153.695  1.00  0.47           O  
ATOM   2460  CB  ALA A 322      54.426 107.726 155.524  1.00  0.47           C  
ATOM   2461  N   GLY A 323      55.141 107.088 152.253  1.00  0.54           N  
ATOM   2462  CA  GLY A 323      55.701 106.156 151.277  1.00  0.54           C  
ATOM   2463  C   GLY A 323      55.346 104.720 151.556  1.00  0.54           C  
ATOM   2464  O   GLY A 323      55.614 103.838 150.750  1.00  0.54           O  
ATOM   2465  N   THR A 324      54.682 104.462 152.696  1.00  0.55           N  
ATOM   2466  CA  THR A 324      54.048 103.202 153.062  1.00  0.55           C  
ATOM   2467  C   THR A 324      52.820 102.916 152.222  1.00  0.55           C  
ATOM   2468  O   THR A 324      52.587 101.802 151.762  1.00  0.55           O  
ATOM   2469  CB  THR A 324      53.601 103.235 154.525  1.00  0.55           C  
ATOM   2470  OG1 THR A 324      52.937 104.459 154.855  1.00  0.55           O  
ATOM   2471  CG2 THR A 324      54.854 103.149 155.410  1.00  0.55           C  
ATOM   2472  N   VAL A 325      51.992 103.960 152.049  1.00  0.72           N  
ATOM   2473  CA  VAL A 325      50.792 104.129 151.236  1.00  0.72           C  
ATOM   2474  C   VAL A 325      49.601 103.221 151.516  1.00  0.72           C  
ATOM   2475  O   VAL A 325      48.448 103.648 151.416  1.00  0.72           O  
ATOM   2476  CB  VAL A 325      51.016 104.301 149.727  1.00  0.72           C  
ATOM   2477  CG1 VAL A 325      52.156 105.309 149.486  1.00  0.72           C  
ATOM   2478  CG2 VAL A 325      51.305 102.971 149.005  1.00  0.72           C  
ATOM   2479  N   PHE A 326      49.828 101.981 151.970  1.00  0.81           N  
ATOM   2480  CA  PHE A 326      48.815 100.947 152.063  1.00  0.81           C  
ATOM   2481  C   PHE A 326      48.134 100.876 153.414  1.00  0.81           C  
ATOM   2482  O   PHE A 326      47.276 100.028 153.634  1.00  0.81           O  
ATOM   2483  CB  PHE A 326      49.448  99.560 151.792  1.00  0.81           C  
ATOM   2484  CG  PHE A 326      49.598  99.322 150.322  1.00  0.81           C  
ATOM   2485  CD1 PHE A 326      50.823  99.531 149.670  1.00  0.81           C  
ATOM   2486  CD2 PHE A 326      48.507  98.833 149.585  1.00  0.81           C  
ATOM   2487  CE1 PHE A 326      50.955  99.253 148.305  1.00  0.81           C  
ATOM   2488  CE2 PHE A 326      48.638  98.538 148.223  1.00  0.81           C  
ATOM   2489  CZ  PHE A 326      49.867  98.745 147.586  1.00  0.81           C  
ATOM   2490  N   ASP A 327      48.428 101.787 154.353  1.00  0.81           N  
ATOM   2491  CA  ASP A 327      47.881 101.768 155.705  1.00  0.81           C  
ATOM   2492  C   ASP A 327      46.356 101.849 155.765  1.00  0.81           C  
ATOM   2493  O   ASP A 327      45.720 101.282 156.644  1.00  0.81           O  
ATOM   2494  CB  ASP A 327      48.494 102.912 156.551  1.00  0.81           C  
ATOM   2495  CG  ASP A 327      49.974 103.039 156.166  1.00  0.81           C  
ATOM   2496  OD1 ASP A 327      50.747 102.192 156.678  1.00  0.81           O  
ATOM   2497  OD2 ASP A 327      50.233 103.881 155.255  1.00  0.81           O  
ATOM   2498  N   ALA A 328      45.745 102.547 154.785  1.00  0.83           N  
ATOM   2499  CA  ALA A 328      44.308 102.692 154.663  1.00  0.83           C  
ATOM   2500  C   ALA A 328      43.683 101.659 153.721  1.00  0.83           C  
ATOM   2501  O   ALA A 328      42.514 101.755 153.353  1.00  0.83           O  
ATOM   2502  CB  ALA A 328      43.993 104.113 154.147  1.00  0.83           C  
ATOM   2503  N   PHE A 329      44.438 100.617 153.308  1.00  0.86           N  
ATOM   2504  CA  PHE A 329      43.917  99.514 152.511  1.00  0.86           C  
ATOM   2505  C   PHE A 329      42.787  98.738 153.203  1.00  0.86           C  
ATOM   2506  O   PHE A 329      41.770  98.536 152.538  1.00  0.86           O  
ATOM   2507  CB  PHE A 329      45.087  98.594 152.051  1.00  0.86           C  
ATOM   2508  CG  PHE A 329      44.711  97.539 151.045  1.00  0.86           C  
ATOM   2509  CD1 PHE A 329      44.779  97.816 149.672  1.00  0.86           C  
ATOM   2510  CD2 PHE A 329      44.378  96.239 151.460  1.00  0.86           C  
ATOM   2511  CE1 PHE A 329      44.538  96.812 148.724  1.00  0.86           C  
ATOM   2512  CE2 PHE A 329      44.137  95.232 150.519  1.00  0.86           C  
ATOM   2513  CZ  PHE A 329      44.221  95.516 149.150  1.00  0.86           C  
ATOM   2514  N   PRO A 330      42.794  98.344 154.485  1.00  0.93           N  
ATOM   2515  CA  PRO A 330      41.685  97.592 155.070  1.00  0.93           C  
ATOM   2516  C   PRO A 330      40.431  98.411 155.260  1.00  0.93           C  
ATOM   2517  O   PRO A 330      39.396  97.836 155.579  1.00  0.93           O  
ATOM   2518  CB  PRO A 330      42.216  97.141 156.438  1.00  0.93           C  
ATOM   2519  CG  PRO A 330      43.731  97.131 156.262  1.00  0.93           C  
ATOM   2520  CD  PRO A 330      43.951  98.353 155.382  1.00  0.93           C  
ATOM   2521  N   ASP A 331      40.493  99.741 155.081  1.00  0.87           N  
ATOM   2522  CA  ASP A 331      39.362 100.632 155.217  1.00  0.87           C  
ATOM   2523  C   ASP A 331      38.853 101.073 153.850  1.00  0.87           C  
ATOM   2524  O   ASP A 331      37.840 101.757 153.721  1.00  0.87           O  
ATOM   2525  CB  ASP A 331      39.771 101.820 156.107  1.00  0.87           C  
ATOM   2526  CG  ASP A 331      40.081 101.237 157.473  1.00  0.87           C  
ATOM   2527  OD1 ASP A 331      39.142 100.641 158.069  1.00  0.87           O  
ATOM   2528  OD2 ASP A 331      41.258 101.331 157.901  1.00  0.87           O  
ATOM   2529  N   GLN A 332      39.507 100.608 152.769  1.00  0.86           N  
ATOM   2530  CA  GLN A 332      38.998 100.710 151.415  1.00  0.86           C  
ATOM   2531  C   GLN A 332      38.634  99.349 150.849  1.00  0.86           C  
ATOM   2532  O   GLN A 332      37.868  99.255 149.891  1.00  0.86           O  
ATOM   2533  CB  GLN A 332      40.071 101.355 150.503  1.00  0.86           C  
ATOM   2534  CG  GLN A 332      40.075 102.897 150.581  1.00  0.86           C  
ATOM   2535  CD  GLN A 332      38.836 103.459 149.882  1.00  0.86           C  
ATOM   2536  OE1 GLN A 332      38.740 103.453 148.651  1.00  0.86           O  
ATOM   2537  NE2 GLN A 332      37.862 103.947 150.681  1.00  0.86           N  
ATOM   2538  N   VAL A 333      39.150  98.259 151.440  1.00  0.92           N  
ATOM   2539  CA  VAL A 333      39.039  96.914 150.908  1.00  0.92           C  
ATOM   2540  C   VAL A 333      38.584  95.953 151.997  1.00  0.92           C  
ATOM   2541  O   VAL A 333      39.186  95.859 153.063  1.00  0.92           O  
ATOM   2542  CB  VAL A 333      40.397  96.453 150.364  1.00  0.92           C  
ATOM   2543  CG1 VAL A 333      40.359  95.009 149.833  1.00  0.92           C  
ATOM   2544  CG2 VAL A 333      40.863  97.410 149.246  1.00  0.92           C  
ATOM   2545  N   ALA A 334      37.502  95.190 151.752  1.00  0.96           N  
ATOM   2546  CA  ALA A 334      37.199  93.984 152.498  1.00  0.96           C  
ATOM   2547  C   ALA A 334      37.101  92.842 151.505  1.00  0.96           C  
ATOM   2548  O   ALA A 334      36.451  92.973 150.469  1.00  0.96           O  
ATOM   2549  CB  ALA A 334      35.863  94.094 153.265  1.00  0.96           C  
ATOM   2550  N   ILE A 335      37.754  91.694 151.778  1.00  0.96           N  
ATOM   2551  CA  ILE A 335      37.699  90.539 150.892  1.00  0.96           C  
ATOM   2552  C   ILE A 335      37.118  89.359 151.646  1.00  0.96           C  
ATOM   2553  O   ILE A 335      37.675  88.871 152.628  1.00  0.96           O  
ATOM   2554  CB  ILE A 335      39.050  90.152 150.285  1.00  0.96           C  
ATOM   2555  CG1 ILE A 335      39.716  91.367 149.597  1.00  0.96           C  
ATOM   2556  CG2 ILE A 335      38.843  88.986 149.285  1.00  0.96           C  
ATOM   2557  CD1 ILE A 335      41.138  91.102 149.089  1.00  0.96           C  
ATOM   2558  N   GLN A 336      35.961  88.853 151.180  1.00  0.95           N  
ATOM   2559  CA  GLN A 336      35.313  87.704 151.776  1.00  0.95           C  
ATOM   2560  C   GLN A 336      35.739  86.436 151.060  1.00  0.95           C  
ATOM   2561  O   GLN A 336      35.533  86.274 149.855  1.00  0.95           O  
ATOM   2562  CB  GLN A 336      33.768  87.830 151.729  1.00  0.95           C  
ATOM   2563  CG  GLN A 336      33.014  86.813 152.627  1.00  0.95           C  
ATOM   2564  CD  GLN A 336      33.225  87.110 154.114  1.00  0.95           C  
ATOM   2565  OE1 GLN A 336      33.334  88.266 154.523  1.00  0.95           O  
ATOM   2566  NE2 GLN A 336      33.254  86.061 154.961  1.00  0.95           N  
ATOM   2567  N   LEU A 337      36.346  85.495 151.805  1.00  0.96           N  
ATOM   2568  CA  LEU A 337      36.718  84.183 151.324  1.00  0.96           C  
ATOM   2569  C   LEU A 337      35.509  83.273 151.429  1.00  0.96           C  
ATOM   2570  O   LEU A 337      34.975  83.007 152.510  1.00  0.96           O  
ATOM   2571  CB  LEU A 337      37.888  83.572 152.149  1.00  0.96           C  
ATOM   2572  CG  LEU A 337      39.329  84.036 151.805  1.00  0.96           C  
ATOM   2573  CD1 LEU A 337      39.433  85.295 150.928  1.00  0.96           C  
ATOM   2574  CD2 LEU A 337      40.137  84.227 153.098  1.00  0.96           C  
ATOM   2575  N   ASN A 338      35.034  82.775 150.274  1.00  0.94           N  
ATOM   2576  CA  ASN A 338      33.911  81.873 150.215  1.00  0.94           C  
ATOM   2577  C   ASN A 338      34.419  80.435 150.339  1.00  0.94           C  
ATOM   2578  O   ASN A 338      35.007  79.886 149.409  1.00  0.94           O  
ATOM   2579  CB  ASN A 338      33.161  82.143 148.880  1.00  0.94           C  
ATOM   2580  CG  ASN A 338      31.746  81.585 148.772  1.00  0.94           C  
ATOM   2581  OD1 ASN A 338      31.192  81.460 147.680  1.00  0.94           O  
ATOM   2582  ND2 ASN A 338      31.096  81.291 149.916  1.00  0.94           N  
ATOM   2583  N   ASP A 339      34.216  79.827 151.530  1.00  0.91           N  
ATOM   2584  CA  ASP A 339      34.848  78.601 151.985  1.00  0.91           C  
ATOM   2585  C   ASP A 339      36.381  78.626 151.913  1.00  0.91           C  
ATOM   2586  O   ASP A 339      37.002  79.690 151.915  1.00  0.91           O  
ATOM   2587  CB  ASP A 339      34.178  77.353 151.354  1.00  0.91           C  
ATOM   2588  CG  ASP A 339      34.150  76.216 152.355  1.00  0.91           C  
ATOM   2589  OD1 ASP A 339      34.891  75.234 152.134  1.00  0.91           O  
ATOM   2590  OD2 ASP A 339      33.413  76.330 153.370  1.00  0.91           O  
ATOM   2591  N   THR A 340      37.061  77.463 151.896  1.00  0.91           N  
ATOM   2592  CA  THR A 340      38.528  77.439 151.913  1.00  0.91           C  
ATOM   2593  C   THR A 340      39.141  77.626 150.547  1.00  0.91           C  
ATOM   2594  O   THR A 340      40.347  77.823 150.417  1.00  0.91           O  
ATOM   2595  CB  THR A 340      39.133  76.177 152.502  1.00  0.91           C  
ATOM   2596  OG1 THR A 340      38.542  75.001 151.975  1.00  0.91           O  
ATOM   2597  CG2 THR A 340      38.864  76.177 154.008  1.00  0.91           C  
ATOM   2598  N   HIS A 341      38.310  77.624 149.495  1.00  0.92           N  
ATOM   2599  CA  HIS A 341      38.723  77.618 148.105  1.00  0.92           C  
ATOM   2600  C   HIS A 341      39.613  78.794 147.674  1.00  0.92           C  
ATOM   2601  O   HIS A 341      40.497  78.575 146.851  1.00  0.92           O  
ATOM   2602  CB  HIS A 341      37.507  77.488 147.151  1.00  0.92           C  
ATOM   2603  CG  HIS A 341      36.503  76.405 147.454  1.00  0.92           C  
ATOM   2604  ND1 HIS A 341      35.543  76.146 146.484  1.00  0.92           N  
ATOM   2605  CD2 HIS A 341      36.271  75.640 148.554  1.00  0.92           C  
ATOM   2606  CE1 HIS A 341      34.745  75.239 147.024  1.00  0.92           C  
ATOM   2607  NE2 HIS A 341      35.146  74.899 148.271  1.00  0.92           N  
ATOM   2608  N   PRO A 342      39.508  80.041 148.148  1.00  0.98           N  
ATOM   2609  CA  PRO A 342      40.470  81.064 147.756  1.00  0.98           C  
ATOM   2610  C   PRO A 342      41.387  81.386 148.926  1.00  0.98           C  
ATOM   2611  O   PRO A 342      41.867  82.513 149.027  1.00  0.98           O  
ATOM   2612  CB  PRO A 342      39.549  82.239 147.413  1.00  0.98           C  
ATOM   2613  CG  PRO A 342      38.418  82.141 148.438  1.00  0.98           C  
ATOM   2614  CD  PRO A 342      38.253  80.633 148.634  1.00  0.98           C  
ATOM   2615  N   ALA A 343      41.728  80.401 149.786  1.00  0.96           N  
ATOM   2616  CA  ALA A 343      42.614  80.570 150.933  1.00  0.96           C  
ATOM   2617  C   ALA A 343      44.012  81.074 150.595  1.00  0.96           C  
ATOM   2618  O   ALA A 343      44.651  81.777 151.378  1.00  0.96           O  
ATOM   2619  CB  ALA A 343      42.754  79.237 151.684  1.00  0.96           C  
ATOM   2620  N   LEU A 344      44.507  80.767 149.377  1.00  0.95           N  
ATOM   2621  CA  LEU A 344      45.766  81.265 148.845  1.00  0.95           C  
ATOM   2622  C   LEU A 344      45.840  82.785 148.702  1.00  0.95           C  
ATOM   2623  O   LEU A 344      46.918  83.344 148.510  1.00  0.95           O  
ATOM   2624  CB  LEU A 344      46.063  80.618 147.471  1.00  0.95           C  
ATOM   2625  CG  LEU A 344      46.414  79.118 147.549  1.00  0.95           C  
ATOM   2626  CD1 LEU A 344      46.391  78.497 146.147  1.00  0.95           C  
ATOM   2627  CD2 LEU A 344      47.787  78.881 148.202  1.00  0.95           C  
ATOM   2628  N   ALA A 345      44.710  83.508 148.854  1.00  0.97           N  
ATOM   2629  CA  ALA A 345      44.673  84.953 148.917  1.00  0.97           C  
ATOM   2630  C   ALA A 345      45.491  85.541 150.060  1.00  0.97           C  
ATOM   2631  O   ALA A 345      46.175  86.546 149.889  1.00  0.97           O  
ATOM   2632  CB  ALA A 345      43.209  85.423 149.002  1.00  0.97           C  
ATOM   2633  N   ILE A 346      45.475  84.905 151.246  1.00  0.95           N  
ATOM   2634  CA  ILE A 346      46.255  85.324 152.405  1.00  0.95           C  
ATOM   2635  C   ILE A 346      47.773  85.302 152.174  1.00  0.95           C  
ATOM   2636  O   ILE A 346      48.405  86.328 152.436  1.00  0.95           O  
ATOM   2637  CB  ILE A 346      45.824  84.514 153.630  1.00  0.95           C  
ATOM   2638  CG1 ILE A 346      44.371  84.887 154.009  1.00  0.95           C  
ATOM   2639  CG2 ILE A 346      46.772  84.718 154.836  1.00  0.95           C  
ATOM   2640  CD1 ILE A 346      43.634  83.757 154.729  1.00  0.95           C  
ATOM   2641  N   PRO A 347      48.444  84.271 151.642  1.00  0.98           N  
ATOM   2642  CA  PRO A 347      49.864  84.373 151.329  1.00  0.98           C  
ATOM   2643  C   PRO A 347      50.129  85.204 150.087  1.00  0.98           C  
ATOM   2644  O   PRO A 347      51.203  85.791 150.009  1.00  0.98           O  
ATOM   2645  CB  PRO A 347      50.337  82.915 151.176  1.00  0.98           C  
ATOM   2646  CG  PRO A 347      49.064  82.132 150.854  1.00  0.98           C  
ATOM   2647  CD  PRO A 347      48.003  82.876 151.664  1.00  0.98           C  
ATOM   2648  N   GLU A 348      49.213  85.275 149.097  1.00  0.94           N  
ATOM   2649  CA  GLU A 348      49.393  86.136 147.933  1.00  0.94           C  
ATOM   2650  C   GLU A 348      49.376  87.623 148.265  1.00  0.94           C  
ATOM   2651  O   GLU A 348      50.209  88.391 147.788  1.00  0.94           O  
ATOM   2652  CB  GLU A 348      48.367  85.805 146.818  1.00  0.94           C  
ATOM   2653  CG  GLU A 348      48.449  86.670 145.523  1.00  0.94           C  
ATOM   2654  CD  GLU A 348      49.763  86.601 144.761  1.00  0.94           C  
ATOM   2655  OE1 GLU A 348      50.713  85.912 145.202  1.00  0.94           O  
ATOM   2656  OE2 GLU A 348      49.874  87.270 143.700  1.00  0.94           O  
ATOM   2657  N   LEU A 349      48.465  88.079 149.152  1.00  0.95           N  
ATOM   2658  CA  LEU A 349      48.430  89.465 149.605  1.00  0.95           C  
ATOM   2659  C   LEU A 349      49.720  89.852 150.333  1.00  0.95           C  
ATOM   2660  O   LEU A 349      50.328  90.890 150.071  1.00  0.95           O  
ATOM   2661  CB  LEU A 349      47.188  89.710 150.510  1.00  0.95           C  
ATOM   2662  CG  LEU A 349      46.474  91.086 150.412  1.00  0.95           C  
ATOM   2663  CD1 LEU A 349      46.068  91.584 151.806  1.00  0.95           C  
ATOM   2664  CD2 LEU A 349      47.248  92.189 149.677  1.00  0.95           C  
ATOM   2665  N   MET A 350      50.226  88.945 151.199  1.00  0.93           N  
ATOM   2666  CA  MET A 350      51.536  89.057 151.819  1.00  0.93           C  
ATOM   2667  C   MET A 350      52.681  89.098 150.819  1.00  0.93           C  
ATOM   2668  O   MET A 350      53.590  89.914 150.944  1.00  0.93           O  
ATOM   2669  CB  MET A 350      51.790  87.869 152.782  1.00  0.93           C  
ATOM   2670  CG  MET A 350      50.935  87.924 154.057  1.00  0.93           C  
ATOM   2671  SD  MET A 350      51.295  89.368 155.091  1.00  0.93           S  
ATOM   2672  CE  MET A 350      52.876  88.822 155.782  1.00  0.93           C  
ATOM   2673  N   ARG A 351      52.656  88.246 149.776  1.00  0.90           N  
ATOM   2674  CA  ARG A 351      53.651  88.247 148.720  1.00  0.90           C  
ATOM   2675  C   ARG A 351      53.704  89.553 147.939  1.00  0.90           C  
ATOM   2676  O   ARG A 351      54.772  90.104 147.689  1.00  0.90           O  
ATOM   2677  CB  ARG A 351      53.384  87.093 147.725  1.00  0.90           C  
ATOM   2678  CG  ARG A 351      54.573  86.829 146.781  1.00  0.90           C  
ATOM   2679  CD  ARG A 351      54.290  85.815 145.670  1.00  0.90           C  
ATOM   2680  NE  ARG A 351      53.243  86.396 144.770  1.00  0.90           N  
ATOM   2681  CZ  ARG A 351      53.431  87.326 143.830  1.00  0.90           C  
ATOM   2682  NH1 ARG A 351      54.636  87.825 143.578  1.00  0.90           N  
ATOM   2683  NH2 ARG A 351      52.387  87.779 143.143  1.00  0.90           N  
ATOM   2684  N   ILE A 352      52.544  90.122 147.556  1.00  0.92           N  
ATOM   2685  CA  ILE A 352      52.500  91.423 146.900  1.00  0.92           C  
ATOM   2686  C   ILE A 352      52.981  92.541 147.822  1.00  0.92           C  
ATOM   2687  O   ILE A 352      53.813  93.362 147.437  1.00  0.92           O  
ATOM   2688  CB  ILE A 352      51.122  91.731 146.313  1.00  0.92           C  
ATOM   2689  CG1 ILE A 352      50.711  90.634 145.297  1.00  0.92           C  
ATOM   2690  CG2 ILE A 352      51.148  93.123 145.635  1.00  0.92           C  
ATOM   2691  CD1 ILE A 352      49.239  90.707 144.867  1.00  0.92           C  
ATOM   2692  N   PHE A 353      52.531  92.568 149.094  1.00  0.91           N  
ATOM   2693  CA  PHE A 353      52.989  93.548 150.065  1.00  0.91           C  
ATOM   2694  C   PHE A 353      54.480  93.488 150.389  1.00  0.91           C  
ATOM   2695  O   PHE A 353      55.138  94.523 150.437  1.00  0.91           O  
ATOM   2696  CB  PHE A 353      52.204  93.418 151.402  1.00  0.91           C  
ATOM   2697  CG  PHE A 353      50.780  93.932 151.377  1.00  0.91           C  
ATOM   2698  CD1 PHE A 353      49.932  93.534 152.426  1.00  0.91           C  
ATOM   2699  CD2 PHE A 353      50.280  94.842 150.422  1.00  0.91           C  
ATOM   2700  CE1 PHE A 353      48.629  94.032 152.531  1.00  0.91           C  
ATOM   2701  CE2 PHE A 353      48.971  95.333 150.519  1.00  0.91           C  
ATOM   2702  CZ  PHE A 353      48.148  94.936 151.577  1.00  0.91           C  
ATOM   2703  N   VAL A 354      55.062  92.297 150.619  1.00  0.88           N  
ATOM   2704  CA  VAL A 354      56.464  92.182 151.005  1.00  0.88           C  
ATOM   2705  C   VAL A 354      57.414  92.192 149.810  1.00  0.88           C  
ATOM   2706  O   VAL A 354      58.355  92.986 149.759  1.00  0.88           O  
ATOM   2707  CB  VAL A 354      56.695  90.931 151.858  1.00  0.88           C  
ATOM   2708  CG1 VAL A 354      58.182  90.785 152.249  1.00  0.88           C  
ATOM   2709  CG2 VAL A 354      55.838  91.034 153.138  1.00  0.88           C  
ATOM   2710  N   ASP A 355      57.196  91.327 148.797  1.00  0.89           N  
ATOM   2711  CA  ASP A 355      58.139  91.135 147.704  1.00  0.89           C  
ATOM   2712  C   ASP A 355      58.109  92.284 146.700  1.00  0.89           C  
ATOM   2713  O   ASP A 355      59.144  92.727 146.196  1.00  0.89           O  
ATOM   2714  CB  ASP A 355      57.891  89.789 146.956  1.00  0.89           C  
ATOM   2715  CG  ASP A 355      58.043  88.575 147.852  1.00  0.89           C  
ATOM   2716  OD1 ASP A 355      58.499  88.710 149.013  1.00  0.89           O  
ATOM   2717  OD2 ASP A 355      57.722  87.445 147.395  1.00  0.89           O  
ATOM   2718  N   ILE A 356      56.900  92.791 146.377  1.00  0.86           N  
ATOM   2719  CA  ILE A 356      56.713  93.802 145.346  1.00  0.86           C  
ATOM   2720  C   ILE A 356      56.677  95.201 145.942  1.00  0.86           C  
ATOM   2721  O   ILE A 356      57.510  96.042 145.608  1.00  0.86           O  
ATOM   2722  CB  ILE A 356      55.456  93.532 144.507  1.00  0.86           C  
ATOM   2723  CG1 ILE A 356      55.499  92.095 143.920  1.00  0.86           C  
ATOM   2724  CG2 ILE A 356      55.328  94.602 143.396  1.00  0.86           C  
ATOM   2725  CD1 ILE A 356      54.246  91.709 143.122  1.00  0.86           C  
ATOM   2726  N   GLU A 357      55.733  95.480 146.865  1.00  0.82           N  
ATOM   2727  CA  GLU A 357      55.481  96.825 147.364  1.00  0.82           C  
ATOM   2728  C   GLU A 357      56.418  97.235 148.501  1.00  0.82           C  
ATOM   2729  O   GLU A 357      56.522  98.407 148.851  1.00  0.82           O  
ATOM   2730  CB  GLU A 357      54.013  96.933 147.852  1.00  0.82           C  
ATOM   2731  CG  GLU A 357      52.928  96.602 146.788  1.00  0.82           C  
ATOM   2732  CD  GLU A 357      52.744  97.654 145.712  1.00  0.82           C  
ATOM   2733  OE1 GLU A 357      51.820  97.476 144.865  1.00  0.82           O  
ATOM   2734  OE2 GLU A 357      53.449  98.696 145.688  1.00  0.82           O  
ATOM   2735  N   LYS A 358      57.150  96.260 149.079  1.00  0.81           N  
ATOM   2736  CA  LYS A 358      58.209  96.445 150.062  1.00  0.81           C  
ATOM   2737  C   LYS A 358      57.767  96.913 151.436  1.00  0.81           C  
ATOM   2738  O   LYS A 358      58.440  97.694 152.108  1.00  0.81           O  
ATOM   2739  CB  LYS A 358      59.387  97.309 149.535  1.00  0.81           C  
ATOM   2740  CG  LYS A 358      59.985  96.808 148.212  1.00  0.81           C  
ATOM   2741  CD  LYS A 358      60.453  95.347 148.301  1.00  0.81           C  
ATOM   2742  CE  LYS A 358      61.239  94.858 147.094  1.00  0.81           C  
ATOM   2743  NZ  LYS A 358      62.464  95.666 146.989  1.00  0.81           N  
ATOM   2744  N   LEU A 359      56.649  96.366 151.932  1.00  0.83           N  
ATOM   2745  CA  LEU A 359      56.203  96.591 153.288  1.00  0.83           C  
ATOM   2746  C   LEU A 359      56.830  95.561 154.225  1.00  0.83           C  
ATOM   2747  O   LEU A 359      56.969  94.399 153.840  1.00  0.83           O  
ATOM   2748  CB  LEU A 359      54.661  96.500 153.390  1.00  0.83           C  
ATOM   2749  CG  LEU A 359      53.914  97.496 152.480  1.00  0.83           C  
ATOM   2750  CD1 LEU A 359      52.399  97.274 152.572  1.00  0.83           C  
ATOM   2751  CD2 LEU A 359      54.252  98.960 152.799  1.00  0.83           C  
ATOM   2752  N   PRO A 360      57.242  95.887 155.450  1.00  0.85           N  
ATOM   2753  CA  PRO A 360      57.761  94.898 156.388  1.00  0.85           C  
ATOM   2754  C   PRO A 360      56.689  93.911 156.828  1.00  0.85           C  
ATOM   2755  O   PRO A 360      55.503  94.241 156.818  1.00  0.85           O  
ATOM   2756  CB  PRO A 360      58.284  95.752 157.557  1.00  0.85           C  
ATOM   2757  CG  PRO A 360      57.410  97.010 157.528  1.00  0.85           C  
ATOM   2758  CD  PRO A 360      57.179  97.229 156.033  1.00  0.85           C  
ATOM   2759  N   TRP A 361      57.093  92.686 157.233  1.00  0.84           N  
ATOM   2760  CA  TRP A 361      56.199  91.573 157.522  1.00  0.84           C  
ATOM   2761  C   TRP A 361      55.134  91.886 158.568  1.00  0.84           C  
ATOM   2762  O   TRP A 361      53.969  91.537 158.405  1.00  0.84           O  
ATOM   2763  CB  TRP A 361      57.031  90.333 157.976  1.00  0.84           C  
ATOM   2764  CG  TRP A 361      56.218  89.097 158.361  1.00  0.84           C  
ATOM   2765  CD1 TRP A 361      55.603  88.826 159.556  1.00  0.84           C  
ATOM   2766  CD2 TRP A 361      55.859  88.028 157.469  1.00  0.84           C  
ATOM   2767  NE1 TRP A 361      54.866  87.667 159.464  1.00  0.84           N  
ATOM   2768  CE2 TRP A 361      55.007  87.164 158.192  1.00  0.84           C  
ATOM   2769  CE3 TRP A 361      56.188  87.770 156.139  1.00  0.84           C  
ATOM   2770  CZ2 TRP A 361      54.468  86.035 157.597  1.00  0.84           C  
ATOM   2771  CZ3 TRP A 361      55.654  86.617 155.543  1.00  0.84           C  
ATOM   2772  CH2 TRP A 361      54.809  85.759 156.264  1.00  0.84           C  
ATOM   2773  N   SER A 362      55.499  92.577 159.664  1.00  0.85           N  
ATOM   2774  CA  SER A 362      54.576  92.960 160.723  1.00  0.85           C  
ATOM   2775  C   SER A 362      53.455  93.864 160.248  1.00  0.85           C  
ATOM   2776  O   SER A 362      52.285  93.633 160.544  1.00  0.85           O  
ATOM   2777  CB  SER A 362      55.332  93.683 161.871  1.00  0.85           C  
ATOM   2778  OG  SER A 362      56.220  94.680 161.354  1.00  0.85           O  
ATOM   2779  N   LYS A 363      53.787  94.894 159.448  1.00  0.81           N  
ATOM   2780  CA  LYS A 363      52.806  95.769 158.844  1.00  0.81           C  
ATOM   2781  C   LYS A 363      51.971  95.077 157.780  1.00  0.81           C  
ATOM   2782  O   LYS A 363      50.750  95.201 157.747  1.00  0.81           O  
ATOM   2783  CB  LYS A 363      53.480  97.037 158.265  1.00  0.81           C  
ATOM   2784  CG  LYS A 363      52.496  98.158 157.881  1.00  0.81           C  
ATOM   2785  CD  LYS A 363      51.625  98.621 159.065  1.00  0.81           C  
ATOM   2786  CE  LYS A 363      50.725  99.811 158.728  1.00  0.81           C  
ATOM   2787  NZ  LYS A 363      49.749 100.033 159.811  1.00  0.81           N  
ATOM   2788  N   ALA A 364      52.605  94.266 156.910  1.00  0.91           N  
ATOM   2789  CA  ALA A 364      51.917  93.489 155.901  1.00  0.91           C  
ATOM   2790  C   ALA A 364      50.907  92.506 156.489  1.00  0.91           C  
ATOM   2791  O   ALA A 364      49.784  92.379 155.999  1.00  0.91           O  
ATOM   2792  CB  ALA A 364      52.963  92.734 155.057  1.00  0.91           C  
ATOM   2793  N   TRP A 365      51.272  91.810 157.586  1.00  0.86           N  
ATOM   2794  CA  TRP A 365      50.389  90.931 158.328  1.00  0.86           C  
ATOM   2795  C   TRP A 365      49.213  91.653 158.977  1.00  0.86           C  
ATOM   2796  O   TRP A 365      48.077  91.194 158.867  1.00  0.86           O  
ATOM   2797  CB  TRP A 365      51.205  90.114 159.365  1.00  0.86           C  
ATOM   2798  CG  TRP A 365      50.449  89.006 160.085  1.00  0.86           C  
ATOM   2799  CD1 TRP A 365      50.165  88.905 161.419  1.00  0.86           C  
ATOM   2800  CD2 TRP A 365      49.841  87.862 159.454  1.00  0.86           C  
ATOM   2801  NE1 TRP A 365      49.440  87.759 161.669  1.00  0.86           N  
ATOM   2802  CE2 TRP A 365      49.221  87.111 160.475  1.00  0.86           C  
ATOM   2803  CE3 TRP A 365      49.776  87.452 158.124  1.00  0.86           C  
ATOM   2804  CZ2 TRP A 365      48.521  85.947 160.182  1.00  0.86           C  
ATOM   2805  CZ3 TRP A 365      49.053  86.288 157.825  1.00  0.86           C  
ATOM   2806  CH2 TRP A 365      48.437  85.543 158.840  1.00  0.86           C  
ATOM   2807  N   GLU A 366      49.433  92.836 159.599  1.00  0.86           N  
ATOM   2808  CA  GLU A 366      48.367  93.652 160.173  1.00  0.86           C  
ATOM   2809  C   GLU A 366      47.306  94.040 159.138  1.00  0.86           C  
ATOM   2810  O   GLU A 366      46.104  93.850 159.337  1.00  0.86           O  
ATOM   2811  CB  GLU A 366      48.962  94.959 160.776  1.00  0.86           C  
ATOM   2812  CG  GLU A 366      47.913  95.886 161.456  1.00  0.86           C  
ATOM   2813  CD  GLU A 366      48.232  97.372 161.339  1.00  0.86           C  
ATOM   2814  OE1 GLU A 366      48.437  97.837 160.188  1.00  0.86           O  
ATOM   2815  OE2 GLU A 366      48.219  98.091 162.366  1.00  0.86           O  
ATOM   2816  N   LEU A 367      47.749  94.543 157.966  1.00  0.90           N  
ATOM   2817  CA  LEU A 367      46.899  94.900 156.847  1.00  0.90           C  
ATOM   2818  C   LEU A 367      46.196  93.696 156.249  1.00  0.90           C  
ATOM   2819  O   LEU A 367      45.013  93.756 155.933  1.00  0.90           O  
ATOM   2820  CB  LEU A 367      47.684  95.658 155.749  1.00  0.90           C  
ATOM   2821  CG  LEU A 367      48.389  96.950 156.220  1.00  0.90           C  
ATOM   2822  CD1 LEU A 367      49.189  97.542 155.053  1.00  0.90           C  
ATOM   2823  CD2 LEU A 367      47.433  98.008 156.786  1.00  0.90           C  
ATOM   2824  N   THR A 368      46.890  92.551 156.122  1.00  0.92           N  
ATOM   2825  CA  THR A 368      46.326  91.288 155.648  1.00  0.92           C  
ATOM   2826  C   THR A 368      45.225  90.758 156.541  1.00  0.92           C  
ATOM   2827  O   THR A 368      44.130  90.467 156.064  1.00  0.92           O  
ATOM   2828  CB  THR A 368      47.395  90.213 155.501  1.00  0.92           C  
ATOM   2829  OG1 THR A 368      48.330  90.620 154.515  1.00  0.92           O  
ATOM   2830  CG2 THR A 368      46.820  88.880 155.010  1.00  0.92           C  
ATOM   2831  N   GLN A 369      45.440  90.700 157.875  1.00  0.89           N  
ATOM   2832  CA  GLN A 369      44.436  90.221 158.814  1.00  0.89           C  
ATOM   2833  C   GLN A 369      43.163  91.051 158.826  1.00  0.89           C  
ATOM   2834  O   GLN A 369      42.070  90.510 158.912  1.00  0.89           O  
ATOM   2835  CB  GLN A 369      44.974  90.102 160.264  1.00  0.89           C  
ATOM   2836  CG  GLN A 369      46.004  88.963 160.452  1.00  0.89           C  
ATOM   2837  CD  GLN A 369      46.297  88.740 161.937  1.00  0.89           C  
ATOM   2838  OE1 GLN A 369      46.745  89.627 162.664  1.00  0.89           O  
ATOM   2839  NE2 GLN A 369      46.030  87.510 162.434  1.00  0.89           N  
ATOM   2840  N   LYS A 370      43.265  92.387 158.714  1.00  0.90           N  
ATOM   2841  CA  LYS A 370      42.108  93.269 158.682  1.00  0.90           C  
ATOM   2842  C   LYS A 370      41.395  93.300 157.324  1.00  0.90           C  
ATOM   2843  O   LYS A 370      40.284  93.814 157.200  1.00  0.90           O  
ATOM   2844  CB  LYS A 370      42.568  94.709 159.015  1.00  0.90           C  
ATOM   2845  CG  LYS A 370      43.120  94.923 160.434  1.00  0.90           C  
ATOM   2846  CD  LYS A 370      43.822  96.291 160.530  1.00  0.90           C  
ATOM   2847  CE  LYS A 370      44.399  96.632 161.905  1.00  0.90           C  
ATOM   2848  NZ  LYS A 370      43.301  96.908 162.853  1.00  0.90           N  
ATOM   2849  N   THR A 371      42.042  92.784 156.260  1.00  0.94           N  
ATOM   2850  CA  THR A 371      41.470  92.697 154.913  1.00  0.94           C  
ATOM   2851  C   THR A 371      40.507  91.540 154.750  1.00  0.94           C  
ATOM   2852  O   THR A 371      39.460  91.660 154.109  1.00  0.94           O  
ATOM   2853  CB  THR A 371      42.536  92.541 153.833  1.00  0.94           C  
ATOM   2854  OG1 THR A 371      43.379  93.682 153.824  1.00  0.94           O  
ATOM   2855  CG2 THR A 371      41.927  92.510 152.427  1.00  0.94           C  
ATOM   2856  N   PHE A 372      40.863  90.364 155.297  1.00  0.95           N  
ATOM   2857  CA  PHE A 372      40.203  89.110 154.985  1.00  0.95           C  
ATOM   2858  C   PHE A 372      39.186  88.650 156.015  1.00  0.95           C  
ATOM   2859  O   PHE A 372      39.353  88.778 157.226  1.00  0.95           O  
ATOM   2860  CB  PHE A 372      41.231  87.961 154.809  1.00  0.95           C  
ATOM   2861  CG  PHE A 372      41.997  88.108 153.527  1.00  0.95           C  
ATOM   2862  CD1 PHE A 372      43.382  88.327 153.532  1.00  0.95           C  
ATOM   2863  CD2 PHE A 372      41.334  87.982 152.297  1.00  0.95           C  
ATOM   2864  CE1 PHE A 372      44.089  88.434 152.328  1.00  0.95           C  
ATOM   2865  CE2 PHE A 372      42.036  88.098 151.091  1.00  0.95           C  
ATOM   2866  CZ  PHE A 372      43.415  88.334 151.107  1.00  0.95           C  
ATOM   2867  N   ALA A 373      38.099  88.028 155.525  1.00  0.97           N  
ATOM   2868  CA  ALA A 373      37.122  87.371 156.360  1.00  0.97           C  
ATOM   2869  C   ALA A 373      36.698  86.052 155.729  1.00  0.97           C  
ATOM   2870  O   ALA A 373      36.705  85.893 154.511  1.00  0.97           O  
ATOM   2871  CB  ALA A 373      35.913  88.287 156.593  1.00  0.97           C  
ATOM   2872  N   TYR A 374      36.349  85.051 156.560  1.00  0.93           N  
ATOM   2873  CA  TYR A 374      36.193  83.668 156.141  1.00  0.93           C  
ATOM   2874  C   TYR A 374      34.792  83.142 156.438  1.00  0.93           C  
ATOM   2875  O   TYR A 374      34.360  83.052 157.587  1.00  0.93           O  
ATOM   2876  CB  TYR A 374      37.282  82.837 156.888  1.00  0.93           C  
ATOM   2877  CG  TYR A 374      37.210  81.331 156.766  1.00  0.93           C  
ATOM   2878  CD1 TYR A 374      36.966  80.677 155.544  1.00  0.93           C  
ATOM   2879  CD2 TYR A 374      37.461  80.549 157.909  1.00  0.93           C  
ATOM   2880  CE1 TYR A 374      36.956  79.274 155.484  1.00  0.93           C  
ATOM   2881  CE2 TYR A 374      37.435  79.151 157.852  1.00  0.93           C  
ATOM   2882  CZ  TYR A 374      37.181  78.518 156.636  1.00  0.93           C  
ATOM   2883  OH  TYR A 374      37.147  77.115 156.574  1.00  0.93           O  
ATOM   2884  N   THR A 375      34.053  82.731 155.386  1.00  0.93           N  
ATOM   2885  CA  THR A 375      32.755  82.078 155.549  1.00  0.93           C  
ATOM   2886  C   THR A 375      32.945  80.590 155.399  1.00  0.93           C  
ATOM   2887  O   THR A 375      33.273  80.120 154.314  1.00  0.93           O  
ATOM   2888  CB  THR A 375      31.712  82.455 154.502  1.00  0.93           C  
ATOM   2889  OG1 THR A 375      31.519  83.855 154.427  1.00  0.93           O  
ATOM   2890  CG2 THR A 375      30.345  81.850 154.848  1.00  0.93           C  
ATOM   2891  N   ASN A 376      32.721  79.808 156.469  1.00  0.90           N  
ATOM   2892  CA  ASN A 376      32.904  78.368 156.484  1.00  0.90           C  
ATOM   2893  C   ASN A 376      31.567  77.683 156.198  1.00  0.90           C  
ATOM   2894  O   ASN A 376      30.598  77.886 156.923  1.00  0.90           O  
ATOM   2895  CB  ASN A 376      33.439  77.984 157.900  1.00  0.90           C  
ATOM   2896  CG  ASN A 376      34.023  76.578 158.022  1.00  0.90           C  
ATOM   2897  OD1 ASN A 376      35.222  76.420 158.264  1.00  0.90           O  
ATOM   2898  ND2 ASN A 376      33.177  75.534 157.899  1.00  0.90           N  
ATOM   2899  N   HIS A 377      31.482  76.835 155.155  1.00  0.88           N  
ATOM   2900  CA  HIS A 377      30.265  76.114 154.795  1.00  0.88           C  
ATOM   2901  C   HIS A 377      30.363  74.634 155.094  1.00  0.88           C  
ATOM   2902  O   HIS A 377      29.366  73.918 155.124  1.00  0.88           O  
ATOM   2903  CB  HIS A 377      30.042  76.203 153.271  1.00  0.88           C  
ATOM   2904  CG  HIS A 377      29.831  77.608 152.836  1.00  0.88           C  
ATOM   2905  ND1 HIS A 377      28.544  78.086 152.689  1.00  0.88           N  
ATOM   2906  CD2 HIS A 377      30.732  78.606 152.659  1.00  0.88           C  
ATOM   2907  CE1 HIS A 377      28.687  79.365 152.428  1.00  0.88           C  
ATOM   2908  NE2 HIS A 377      29.988  79.734 152.400  1.00  0.88           N  
ATOM   2909  N   THR A 378      31.581  74.125 155.316  1.00  0.76           N  
ATOM   2910  CA  THR A 378      31.840  72.703 155.488  1.00  0.76           C  
ATOM   2911  C   THR A 378      31.548  72.174 156.884  1.00  0.76           C  
ATOM   2912  O   THR A 378      31.610  72.887 157.887  1.00  0.76           O  
ATOM   2913  CB  THR A 378      33.262  72.333 155.086  1.00  0.76           C  
ATOM   2914  OG1 THR A 378      34.211  73.210 155.673  1.00  0.76           O  
ATOM   2915  CG2 THR A 378      33.402  72.502 153.570  1.00  0.76           C  
ATOM   2916  N   VAL A 379      31.181  70.873 156.970  1.00  0.79           N  
ATOM   2917  CA  VAL A 379      31.091  70.150 158.239  1.00  0.79           C  
ATOM   2918  C   VAL A 379      31.865  68.842 158.154  1.00  0.79           C  
ATOM   2919  O   VAL A 379      32.587  68.453 159.068  1.00  0.79           O  
ATOM   2920  CB  VAL A 379      29.652  69.794 158.637  1.00  0.79           C  
ATOM   2921  CG1 VAL A 379      29.627  69.370 160.120  1.00  0.79           C  
ATOM   2922  CG2 VAL A 379      28.713  70.994 158.426  1.00  0.79           C  
ATOM   2923  N   LEU A 380      31.722  68.114 157.027  1.00  0.81           N  
ATOM   2924  CA  LEU A 380      32.314  66.807 156.819  1.00  0.81           C  
ATOM   2925  C   LEU A 380      33.850  66.771 156.762  1.00  0.81           C  
ATOM   2926  O   LEU A 380      34.436  67.637 156.108  1.00  0.81           O  
ATOM   2927  CB  LEU A 380      31.788  66.189 155.506  1.00  0.81           C  
ATOM   2928  CG  LEU A 380      30.257  66.071 155.382  1.00  0.81           C  
ATOM   2929  CD1 LEU A 380      29.925  65.525 153.990  1.00  0.81           C  
ATOM   2930  CD2 LEU A 380      29.644  65.164 156.460  1.00  0.81           C  
ATOM   2931  N   PRO A 381      34.559  65.793 157.343  1.00  0.83           N  
ATOM   2932  CA  PRO A 381      36.013  65.668 157.221  1.00  0.83           C  
ATOM   2933  C   PRO A 381      36.513  65.488 155.800  1.00  0.83           C  
ATOM   2934  O   PRO A 381      37.612  65.947 155.489  1.00  0.83           O  
ATOM   2935  CB  PRO A 381      36.361  64.452 158.095  1.00  0.83           C  
ATOM   2936  CG  PRO A 381      35.257  64.440 159.153  1.00  0.83           C  
ATOM   2937  CD  PRO A 381      34.028  64.881 158.359  1.00  0.83           C  
ATOM   2938  N   GLU A 382      35.734  64.830 154.918  1.00  0.82           N  
ATOM   2939  CA  GLU A 382      36.075  64.646 153.520  1.00  0.82           C  
ATOM   2940  C   GLU A 382      35.898  65.907 152.677  1.00  0.82           C  
ATOM   2941  O   GLU A 382      36.336  65.973 151.530  1.00  0.82           O  
ATOM   2942  CB  GLU A 382      35.259  63.485 152.893  1.00  0.82           C  
ATOM   2943  CG  GLU A 382      33.716  63.669 152.890  1.00  0.82           C  
ATOM   2944  CD  GLU A 382      33.001  63.014 154.061  1.00  0.82           C  
ATOM   2945  OE1 GLU A 382      33.482  63.083 155.222  1.00  0.82           O  
ATOM   2946  OE2 GLU A 382      31.924  62.405 153.826  1.00  0.82           O  
ATOM   2947  N   ALA A 383      35.259  66.956 153.233  1.00  0.87           N  
ATOM   2948  CA  ALA A 383      35.027  68.206 152.543  1.00  0.87           C  
ATOM   2949  C   ALA A 383      36.060  69.271 152.889  1.00  0.87           C  
ATOM   2950  O   ALA A 383      36.023  70.376 152.356  1.00  0.87           O  
ATOM   2951  CB  ALA A 383      33.627  68.724 152.930  1.00  0.87           C  
ATOM   2952  N   LEU A 384      37.031  68.970 153.775  1.00  0.85           N  
ATOM   2953  CA  LEU A 384      38.034  69.933 154.190  1.00  0.85           C  
ATOM   2954  C   LEU A 384      39.243  69.921 153.269  1.00  0.85           C  
ATOM   2955  O   LEU A 384      39.943  68.915 153.147  1.00  0.85           O  
ATOM   2956  CB  LEU A 384      38.526  69.644 155.631  1.00  0.85           C  
ATOM   2957  CG  LEU A 384      37.428  69.723 156.711  1.00  0.85           C  
ATOM   2958  CD1 LEU A 384      37.986  69.286 158.073  1.00  0.85           C  
ATOM   2959  CD2 LEU A 384      36.813  71.126 156.821  1.00  0.85           C  
ATOM   2960  N   GLU A 385      39.531  71.057 152.600  1.00  0.86           N  
ATOM   2961  CA  GLU A 385      40.642  71.172 151.675  1.00  0.86           C  
ATOM   2962  C   GLU A 385      42.003  71.152 152.357  1.00  0.86           C  
ATOM   2963  O   GLU A 385      42.313  71.939 153.255  1.00  0.86           O  
ATOM   2964  CB  GLU A 385      40.492  72.396 150.749  1.00  0.86           C  
ATOM   2965  CG  GLU A 385      39.127  72.397 150.016  1.00  0.86           C  
ATOM   2966  CD  GLU A 385      38.989  73.527 149.010  1.00  0.86           C  
ATOM   2967  OE1 GLU A 385      39.123  74.702 149.431  1.00  0.86           O  
ATOM   2968  OE2 GLU A 385      38.674  73.229 147.829  1.00  0.86           O  
ATOM   2969  N   ARG A 386      42.839  70.174 151.962  1.00  0.85           N  
ATOM   2970  CA  ARG A 386      44.062  69.821 152.654  1.00  0.85           C  
ATOM   2971  C   ARG A 386      45.111  69.450 151.617  1.00  0.85           C  
ATOM   2972  O   ARG A 386      45.275  68.280 151.257  1.00  0.85           O  
ATOM   2973  CB  ARG A 386      43.814  68.619 153.606  1.00  0.85           C  
ATOM   2974  CG  ARG A 386      42.886  68.949 154.799  1.00  0.85           C  
ATOM   2975  CD  ARG A 386      42.210  67.731 155.435  1.00  0.85           C  
ATOM   2976  NE  ARG A 386      43.306  66.913 156.023  1.00  0.85           N  
ATOM   2977  CZ  ARG A 386      43.323  65.583 156.160  1.00  0.85           C  
ATOM   2978  NH1 ARG A 386      42.298  64.820 155.803  1.00  0.85           N  
ATOM   2979  NH2 ARG A 386      44.413  65.026 156.675  1.00  0.85           N  
ATOM   2980  N   TRP A 387      45.836  70.444 151.074  1.00  0.89           N  
ATOM   2981  CA  TRP A 387      46.733  70.268 149.941  1.00  0.89           C  
ATOM   2982  C   TRP A 387      48.098  69.702 150.341  1.00  0.89           C  
ATOM   2983  O   TRP A 387      48.715  70.279 151.235  1.00  0.89           O  
ATOM   2984  CB  TRP A 387      46.956  71.616 149.208  1.00  0.89           C  
ATOM   2985  CG  TRP A 387      45.747  72.081 148.419  1.00  0.89           C  
ATOM   2986  CD1 TRP A 387      44.907  73.144 148.621  1.00  0.89           C  
ATOM   2987  CD2 TRP A 387      45.300  71.440 147.212  1.00  0.89           C  
ATOM   2988  NE1 TRP A 387      43.946  73.182 147.635  1.00  0.89           N  
ATOM   2989  CE2 TRP A 387      44.163  72.144 146.772  1.00  0.89           C  
ATOM   2990  CE3 TRP A 387      45.801  70.361 146.489  1.00  0.89           C  
ATOM   2991  CZ2 TRP A 387      43.496  71.769 145.620  1.00  0.89           C  
ATOM   2992  CZ3 TRP A 387      45.142  70.004 145.304  1.00  0.89           C  
ATOM   2993  CH2 TRP A 387      43.987  70.681 144.887  1.00  0.89           C  
ATOM   2994  N   PRO A 388      48.629  68.609 149.767  1.00  0.92           N  
ATOM   2995  CA  PRO A 388      50.016  68.169 149.957  1.00  0.92           C  
ATOM   2996  C   PRO A 388      51.079  69.244 149.803  1.00  0.92           C  
ATOM   2997  O   PRO A 388      51.005  70.024 148.852  1.00  0.92           O  
ATOM   2998  CB  PRO A 388      50.205  67.034 148.938  1.00  0.92           C  
ATOM   2999  CG  PRO A 388      48.788  66.500 148.725  1.00  0.92           C  
ATOM   3000  CD  PRO A 388      47.951  67.776 148.775  1.00  0.92           C  
ATOM   3001  N   VAL A 389      52.085  69.291 150.700  1.00  0.90           N  
ATOM   3002  CA  VAL A 389      53.139  70.301 150.670  1.00  0.90           C  
ATOM   3003  C   VAL A 389      53.968  70.260 149.397  1.00  0.90           C  
ATOM   3004  O   VAL A 389      54.247  71.298 148.809  1.00  0.90           O  
ATOM   3005  CB  VAL A 389      54.044  70.300 151.901  1.00  0.90           C  
ATOM   3006  CG1 VAL A 389      53.201  70.660 153.141  1.00  0.90           C  
ATOM   3007  CG2 VAL A 389      54.770  68.953 152.087  1.00  0.90           C  
ATOM   3008  N   ASP A 390      54.300  69.056 148.894  1.00  0.87           N  
ATOM   3009  CA  ASP A 390      55.075  68.778 147.702  1.00  0.87           C  
ATOM   3010  C   ASP A 390      54.455  69.388 146.448  1.00  0.87           C  
ATOM   3011  O   ASP A 390      55.114  69.966 145.583  1.00  0.87           O  
ATOM   3012  CB  ASP A 390      55.145  67.235 147.480  1.00  0.87           C  
ATOM   3013  CG  ASP A 390      55.302  66.458 148.781  1.00  0.87           C  
ATOM   3014  OD1 ASP A 390      56.374  65.846 148.983  1.00  0.87           O  
ATOM   3015  OD2 ASP A 390      54.315  66.462 149.566  1.00  0.87           O  
ATOM   3016  N   LEU A 391      53.117  69.276 146.338  1.00  0.89           N  
ATOM   3017  CA  LEU A 391      52.333  69.843 145.260  1.00  0.89           C  
ATOM   3018  C   LEU A 391      52.334  71.364 145.278  1.00  0.89           C  
ATOM   3019  O   LEU A 391      52.526  72.020 144.253  1.00  0.89           O  
ATOM   3020  CB  LEU A 391      50.883  69.308 145.342  1.00  0.89           C  
ATOM   3021  CG  LEU A 391      50.046  69.513 144.064  1.00  0.89           C  
ATOM   3022  CD1 LEU A 391      50.562  68.639 142.912  1.00  0.89           C  
ATOM   3023  CD2 LEU A 391      48.569  69.207 144.339  1.00  0.89           C  
ATOM   3024  N   VAL A 392      52.165  71.960 146.477  1.00  0.91           N  
ATOM   3025  CA  VAL A 392      52.266  73.395 146.692  1.00  0.91           C  
ATOM   3026  C   VAL A 392      53.674  73.916 146.438  1.00  0.91           C  
ATOM   3027  O   VAL A 392      53.843  74.929 145.769  1.00  0.91           O  
ATOM   3028  CB  VAL A 392      51.767  73.802 148.076  1.00  0.91           C  
ATOM   3029  CG1 VAL A 392      51.828  75.335 148.251  1.00  0.91           C  
ATOM   3030  CG2 VAL A 392      50.305  73.334 148.228  1.00  0.91           C  
ATOM   3031  N   GLU A 393      54.729  73.213 146.901  1.00  0.87           N  
ATOM   3032  CA  GLU A 393      56.122  73.560 146.657  1.00  0.87           C  
ATOM   3033  C   GLU A 393      56.495  73.565 145.186  1.00  0.87           C  
ATOM   3034  O   GLU A 393      57.131  74.487 144.684  1.00  0.87           O  
ATOM   3035  CB  GLU A 393      57.074  72.598 147.412  1.00  0.87           C  
ATOM   3036  CG  GLU A 393      58.517  73.152 147.537  1.00  0.87           C  
ATOM   3037  CD  GLU A 393      59.333  72.516 148.672  1.00  0.87           C  
ATOM   3038  OE1 GLU A 393      60.528  72.219 148.415  1.00  0.87           O  
ATOM   3039  OE2 GLU A 393      58.779  72.382 149.795  1.00  0.87           O  
ATOM   3040  N   LYS A 394      56.040  72.545 144.432  1.00  0.86           N  
ATOM   3041  CA  LYS A 394      56.209  72.488 142.993  1.00  0.86           C  
ATOM   3042  C   LYS A 394      55.514  73.623 142.242  1.00  0.86           C  
ATOM   3043  O   LYS A 394      56.079  74.233 141.338  1.00  0.86           O  
ATOM   3044  CB  LYS A 394      55.619  71.146 142.480  1.00  0.86           C  
ATOM   3045  CG  LYS A 394      55.928  70.823 141.007  1.00  0.86           C  
ATOM   3046  CD  LYS A 394      54.786  70.085 140.280  1.00  0.86           C  
ATOM   3047  CE  LYS A 394      54.379  68.745 140.902  1.00  0.86           C  
ATOM   3048  NZ  LYS A 394      53.370  68.086 140.050  1.00  0.86           N  
ATOM   3049  N   LEU A 395      54.246  73.920 142.585  1.00  0.92           N  
ATOM   3050  CA  LEU A 395      53.450  74.889 141.858  1.00  0.92           C  
ATOM   3051  C   LEU A 395      53.661  76.339 142.281  1.00  0.92           C  
ATOM   3052  O   LEU A 395      53.639  77.245 141.448  1.00  0.92           O  
ATOM   3053  CB  LEU A 395      51.952  74.525 141.989  1.00  0.92           C  
ATOM   3054  CG  LEU A 395      51.020  75.292 141.027  1.00  0.92           C  
ATOM   3055  CD1 LEU A 395      51.291  74.932 139.559  1.00  0.92           C  
ATOM   3056  CD2 LEU A 395      49.552  75.030 141.383  1.00  0.92           C  
ATOM   3057  N   LEU A 396      53.844  76.591 143.589  1.00  0.92           N  
ATOM   3058  CA  LEU A 396      53.801  77.910 144.197  1.00  0.92           C  
ATOM   3059  C   LEU A 396      54.846  78.040 145.313  1.00  0.92           C  
ATOM   3060  O   LEU A 396      54.473  78.213 146.480  1.00  0.92           O  
ATOM   3061  CB  LEU A 396      52.408  78.155 144.842  1.00  0.92           C  
ATOM   3062  CG  LEU A 396      51.198  78.112 143.890  1.00  0.92           C  
ATOM   3063  CD1 LEU A 396      49.897  78.220 144.697  1.00  0.92           C  
ATOM   3064  CD2 LEU A 396      51.259  79.223 142.833  1.00  0.92           C  
ATOM   3065  N   PRO A 397      56.157  77.963 145.061  1.00  0.93           N  
ATOM   3066  CA  PRO A 397      57.158  77.795 146.116  1.00  0.93           C  
ATOM   3067  C   PRO A 397      57.246  78.978 147.063  1.00  0.93           C  
ATOM   3068  O   PRO A 397      57.421  78.779 148.263  1.00  0.93           O  
ATOM   3069  CB  PRO A 397      58.472  77.559 145.347  1.00  0.93           C  
ATOM   3070  CG  PRO A 397      58.233  78.174 143.962  1.00  0.93           C  
ATOM   3071  CD  PRO A 397      56.753  77.885 143.723  1.00  0.93           C  
ATOM   3072  N   ARG A 398      57.107  80.226 146.571  1.00  0.87           N  
ATOM   3073  CA  ARG A 398      57.132  81.411 147.414  1.00  0.87           C  
ATOM   3074  C   ARG A 398      55.979  81.460 148.409  1.00  0.87           C  
ATOM   3075  O   ARG A 398      56.143  81.789 149.582  1.00  0.87           O  
ATOM   3076  CB  ARG A 398      57.162  82.699 146.548  1.00  0.87           C  
ATOM   3077  CG  ARG A 398      57.277  84.018 147.349  1.00  0.87           C  
ATOM   3078  CD  ARG A 398      58.426  84.034 148.364  1.00  0.87           C  
ATOM   3079  NE  ARG A 398      58.447  85.376 149.022  1.00  0.87           N  
ATOM   3080  CZ  ARG A 398      59.066  85.600 150.188  1.00  0.87           C  
ATOM   3081  NH1 ARG A 398      59.688  84.641 150.870  1.00  0.87           N  
ATOM   3082  NH2 ARG A 398      59.143  86.835 150.666  1.00  0.87           N  
ATOM   3083  N   HIS A 399      54.767  81.075 147.980  1.00  0.92           N  
ATOM   3084  CA  HIS A 399      53.611  80.952 148.843  1.00  0.92           C  
ATOM   3085  C   HIS A 399      53.788  79.929 149.944  1.00  0.92           C  
ATOM   3086  O   HIS A 399      53.367  80.163 151.073  1.00  0.92           O  
ATOM   3087  CB  HIS A 399      52.345  80.622 148.037  1.00  0.92           C  
ATOM   3088  CG  HIS A 399      52.083  81.688 147.031  1.00  0.92           C  
ATOM   3089  ND1 HIS A 399      52.761  81.676 145.827  1.00  0.92           N  
ATOM   3090  CD2 HIS A 399      51.302  82.792 147.127  1.00  0.92           C  
ATOM   3091  CE1 HIS A 399      52.365  82.768 145.207  1.00  0.92           C  
ATOM   3092  NE2 HIS A 399      51.493  83.479 145.955  1.00  0.92           N  
ATOM   3093  N   LEU A 400      54.451  78.788 149.667  1.00  0.92           N  
ATOM   3094  CA  LEU A 400      54.798  77.824 150.699  1.00  0.92           C  
ATOM   3095  C   LEU A 400      55.736  78.377 151.773  1.00  0.92           C  
ATOM   3096  O   LEU A 400      55.509  78.168 152.965  1.00  0.92           O  
ATOM   3097  CB  LEU A 400      55.387  76.533 150.093  1.00  0.92           C  
ATOM   3098  CG  LEU A 400      55.594  75.397 151.118  1.00  0.92           C  
ATOM   3099  CD1 LEU A 400      54.297  74.959 151.811  1.00  0.92           C  
ATOM   3100  CD2 LEU A 400      56.221  74.184 150.441  1.00  0.92           C  
ATOM   3101  N   GLU A 401      56.770  79.167 151.395  1.00  0.88           N  
ATOM   3102  CA  GLU A 401      57.629  79.870 152.345  1.00  0.88           C  
ATOM   3103  C   GLU A 401      56.843  80.814 153.248  1.00  0.88           C  
ATOM   3104  O   GLU A 401      57.004  80.832 154.467  1.00  0.88           O  
ATOM   3105  CB  GLU A 401      58.669  80.769 151.626  1.00  0.88           C  
ATOM   3106  CG  GLU A 401      59.708  80.050 150.735  1.00  0.88           C  
ATOM   3107  CD  GLU A 401      60.664  81.045 150.088  1.00  0.88           C  
ATOM   3108  OE1 GLU A 401      60.324  82.258 150.020  1.00  0.88           O  
ATOM   3109  OE2 GLU A 401      61.762  80.620 149.656  1.00  0.88           O  
ATOM   3110  N   ILE A 402      55.920  81.596 152.653  1.00  0.92           N  
ATOM   3111  CA  ILE A 402      55.024  82.496 153.363  1.00  0.92           C  
ATOM   3112  C   ILE A 402      54.089  81.744 154.309  1.00  0.92           C  
ATOM   3113  O   ILE A 402      53.931  82.129 155.463  1.00  0.92           O  
ATOM   3114  CB  ILE A 402      54.278  83.390 152.370  1.00  0.92           C  
ATOM   3115  CG1 ILE A 402      55.298  84.288 151.624  1.00  0.92           C  
ATOM   3116  CG2 ILE A 402      53.208  84.261 153.068  1.00  0.92           C  
ATOM   3117  CD1 ILE A 402      54.705  85.043 150.431  1.00  0.92           C  
ATOM   3118  N   ILE A 403      53.491  80.608 153.885  1.00  0.93           N  
ATOM   3119  CA  ILE A 403      52.680  79.741 154.744  1.00  0.93           C  
ATOM   3120  C   ILE A 403      53.472  79.152 155.910  1.00  0.93           C  
ATOM   3121  O   ILE A 403      52.997  79.146 157.046  1.00  0.93           O  
ATOM   3122  CB  ILE A 403      51.968  78.644 153.945  1.00  0.93           C  
ATOM   3123  CG1 ILE A 403      50.905  79.284 153.018  1.00  0.93           C  
ATOM   3124  CG2 ILE A 403      51.303  77.599 154.878  1.00  0.93           C  
ATOM   3125  CD1 ILE A 403      50.357  78.322 151.957  1.00  0.93           C  
ATOM   3126  N   TYR A 404      54.720  78.682 155.688  1.00  0.91           N  
ATOM   3127  CA  TYR A 404      55.600  78.246 156.765  1.00  0.91           C  
ATOM   3128  C   TYR A 404      55.939  79.352 157.765  1.00  0.91           C  
ATOM   3129  O   TYR A 404      55.862  79.135 158.972  1.00  0.91           O  
ATOM   3130  CB  TYR A 404      56.938  77.659 156.223  1.00  0.91           C  
ATOM   3131  CG  TYR A 404      56.826  76.313 155.537  1.00  0.91           C  
ATOM   3132  CD1 TYR A 404      55.953  75.296 155.974  1.00  0.91           C  
ATOM   3133  CD2 TYR A 404      57.713  76.021 154.483  1.00  0.91           C  
ATOM   3134  CE1 TYR A 404      55.958  74.034 155.359  1.00  0.91           C  
ATOM   3135  CE2 TYR A 404      57.727  74.756 153.876  1.00  0.91           C  
ATOM   3136  CZ  TYR A 404      56.840  73.765 154.308  1.00  0.91           C  
ATOM   3137  OH  TYR A 404      56.822  72.494 153.695  1.00  0.91           O  
ATOM   3138  N   GLU A 405      56.267  80.573 157.301  1.00  0.88           N  
ATOM   3139  CA  GLU A 405      56.507  81.730 158.152  1.00  0.88           C  
ATOM   3140  C   GLU A 405      55.279  82.167 158.955  1.00  0.88           C  
ATOM   3141  O   GLU A 405      55.354  82.438 160.154  1.00  0.88           O  
ATOM   3142  CB  GLU A 405      57.055  82.868 157.269  1.00  0.88           C  
ATOM   3143  CG  GLU A 405      57.343  84.215 157.954  1.00  0.88           C  
ATOM   3144  CD  GLU A 405      58.441  84.253 159.000  1.00  0.88           C  
ATOM   3145  OE1 GLU A 405      58.903  83.228 159.553  1.00  0.88           O  
ATOM   3146  OE2 GLU A 405      58.779  85.432 159.321  1.00  0.88           O  
ATOM   3147  N   ILE A 406      54.070  82.167 158.337  1.00  0.91           N  
ATOM   3148  CA  ILE A 406      52.807  82.376 159.053  1.00  0.91           C  
ATOM   3149  C   ILE A 406      52.593  81.303 160.116  1.00  0.91           C  
ATOM   3150  O   ILE A 406      52.236  81.604 161.256  1.00  0.91           O  
ATOM   3151  CB  ILE A 406      51.580  82.431 158.124  1.00  0.91           C  
ATOM   3152  CG1 ILE A 406      51.658  83.644 157.166  1.00  0.91           C  
ATOM   3153  CG2 ILE A 406      50.264  82.515 158.938  1.00  0.91           C  
ATOM   3154  CD1 ILE A 406      50.686  83.549 155.981  1.00  0.91           C  
ATOM   3155  N   ASN A 407      52.861  80.016 159.787  1.00  0.90           N  
ATOM   3156  CA  ASN A 407      52.771  78.917 160.734  1.00  0.90           C  
ATOM   3157  C   ASN A 407      53.729  79.075 161.908  1.00  0.90           C  
ATOM   3158  O   ASN A 407      53.327  78.911 163.053  1.00  0.90           O  
ATOM   3159  CB  ASN A 407      53.012  77.547 160.033  1.00  0.90           C  
ATOM   3160  CG  ASN A 407      52.509  76.393 160.900  1.00  0.90           C  
ATOM   3161  OD1 ASN A 407      51.491  76.514 161.581  1.00  0.90           O  
ATOM   3162  ND2 ASN A 407      53.191  75.229 160.864  1.00  0.90           N  
ATOM   3163  N   GLN A 408      55.002  79.452 161.669  1.00  0.87           N  
ATOM   3164  CA  GLN A 408      55.963  79.656 162.739  1.00  0.87           C  
ATOM   3165  C   GLN A 408      55.541  80.735 163.725  1.00  0.87           C  
ATOM   3166  O   GLN A 408      55.453  80.487 164.921  1.00  0.87           O  
ATOM   3167  CB  GLN A 408      57.352  80.020 162.157  1.00  0.87           C  
ATOM   3168  CG  GLN A 408      58.482  80.107 163.214  1.00  0.87           C  
ATOM   3169  CD  GLN A 408      58.717  78.754 163.887  1.00  0.87           C  
ATOM   3170  OE1 GLN A 408      59.028  77.756 163.232  1.00  0.87           O  
ATOM   3171  NE2 GLN A 408      58.563  78.691 165.227  1.00  0.87           N  
ATOM   3172  N   LYS A 409      55.151  81.927 163.231  1.00  0.87           N  
ATOM   3173  CA  LYS A 409      54.726  83.044 164.061  1.00  0.87           C  
ATOM   3174  C   LYS A 409      53.461  82.762 164.865  1.00  0.87           C  
ATOM   3175  O   LYS A 409      53.303  83.198 166.005  1.00  0.87           O  
ATOM   3176  CB  LYS A 409      54.566  84.319 163.187  1.00  0.87           C  
ATOM   3177  CG  LYS A 409      55.882  84.768 162.520  1.00  0.87           C  
ATOM   3178  CD  LYS A 409      56.929  85.272 163.528  1.00  0.87           C  
ATOM   3179  CE  LYS A 409      58.373  85.201 163.026  1.00  0.87           C  
ATOM   3180  NZ  LYS A 409      58.550  86.073 161.862  1.00  0.87           N  
ATOM   3181  N   HIS A 410      52.525  81.994 164.280  1.00  0.86           N  
ATOM   3182  CA  HIS A 410      51.382  81.426 164.974  1.00  0.86           C  
ATOM   3183  C   HIS A 410      51.770  80.436 166.081  1.00  0.86           C  
ATOM   3184  O   HIS A 410      51.326  80.552 167.224  1.00  0.86           O  
ATOM   3185  CB  HIS A 410      50.507  80.748 163.897  1.00  0.86           C  
ATOM   3186  CG  HIS A 410      49.359  79.930 164.366  1.00  0.86           C  
ATOM   3187  ND1 HIS A 410      48.304  80.505 165.046  1.00  0.86           N  
ATOM   3188  CD2 HIS A 410      49.119  78.619 164.132  1.00  0.86           C  
ATOM   3189  CE1 HIS A 410      47.437  79.525 165.211  1.00  0.86           C  
ATOM   3190  NE2 HIS A 410      47.883  78.365 164.674  1.00  0.86           N  
ATOM   3191  N   LEU A 411      52.676  79.476 165.798  1.00  0.85           N  
ATOM   3192  CA  LEU A 411      53.192  78.526 166.773  1.00  0.85           C  
ATOM   3193  C   LEU A 411      53.987  79.165 167.907  1.00  0.85           C  
ATOM   3194  O   LEU A 411      53.811  78.781 169.063  1.00  0.85           O  
ATOM   3195  CB  LEU A 411      54.022  77.401 166.105  1.00  0.85           C  
ATOM   3196  CG  LEU A 411      53.208  76.455 165.192  1.00  0.85           C  
ATOM   3197  CD1 LEU A 411      54.138  75.458 164.485  1.00  0.85           C  
ATOM   3198  CD2 LEU A 411      52.109  75.692 165.944  1.00  0.85           C  
ATOM   3199  N   ASP A 412      54.823  80.193 167.629  1.00  0.82           N  
ATOM   3200  CA  ASP A 412      55.579  80.956 168.617  1.00  0.82           C  
ATOM   3201  C   ASP A 412      54.675  81.539 169.711  1.00  0.82           C  
ATOM   3202  O   ASP A 412      54.953  81.468 170.910  1.00  0.82           O  
ATOM   3203  CB  ASP A 412      56.299  82.163 167.938  1.00  0.82           C  
ATOM   3204  CG  ASP A 412      57.358  81.781 166.915  1.00  0.82           C  
ATOM   3205  OD1 ASP A 412      57.900  80.652 166.989  1.00  0.82           O  
ATOM   3206  OD2 ASP A 412      57.655  82.653 166.053  1.00  0.82           O  
ATOM   3207  N   ARG A 413      53.513  82.098 169.310  1.00  0.73           N  
ATOM   3208  CA  ARG A 413      52.486  82.585 170.213  1.00  0.73           C  
ATOM   3209  C   ARG A 413      51.860  81.500 171.080  1.00  0.73           C  
ATOM   3210  O   ARG A 413      51.659  81.694 172.276  1.00  0.73           O  
ATOM   3211  CB  ARG A 413      51.362  83.291 169.413  1.00  0.73           C  
ATOM   3212  CG  ARG A 413      51.811  84.591 168.717  1.00  0.73           C  
ATOM   3213  CD  ARG A 413      52.073  85.748 169.688  1.00  0.73           C  
ATOM   3214  NE  ARG A 413      52.415  86.968 168.881  1.00  0.73           N  
ATOM   3215  CZ  ARG A 413      51.519  87.806 168.340  1.00  0.73           C  
ATOM   3216  NH1 ARG A 413      50.213  87.565 168.390  1.00  0.73           N  
ATOM   3217  NH2 ARG A 413      51.943  88.914 167.735  1.00  0.73           N  
ATOM   3218  N   ILE A 414      51.549  80.323 170.503  1.00  0.79           N  
ATOM   3219  CA  ILE A 414      51.000  79.184 171.234  1.00  0.79           C  
ATOM   3220  C   ILE A 414      51.988  78.630 172.252  1.00  0.79           C  
ATOM   3221  O   ILE A 414      51.610  78.347 173.387  1.00  0.79           O  
ATOM   3222  CB  ILE A 414      50.492  78.088 170.300  1.00  0.79           C  
ATOM   3223  CG1 ILE A 414      49.421  78.650 169.336  1.00  0.79           C  
ATOM   3224  CG2 ILE A 414      49.896  76.910 171.112  1.00  0.79           C  
ATOM   3225  CD1 ILE A 414      49.177  77.743 168.127  1.00  0.79           C  
ATOM   3226  N   VAL A 415      53.292  78.523 171.902  1.00  0.76           N  
ATOM   3227  CA  VAL A 415      54.353  78.144 172.838  1.00  0.76           C  
ATOM   3228  C   VAL A 415      54.464  79.114 174.007  1.00  0.76           C  
ATOM   3229  O   VAL A 415      54.571  78.701 175.157  1.00  0.76           O  
ATOM   3230  CB  VAL A 415      55.724  78.031 172.157  1.00  0.76           C  
ATOM   3231  CG1 VAL A 415      56.844  77.714 173.174  1.00  0.76           C  
ATOM   3232  CG2 VAL A 415      55.686  76.902 171.113  1.00  0.76           C  
ATOM   3233  N   ALA A 416      54.404  80.436 173.753  1.00  0.78           N  
ATOM   3234  CA  ALA A 416      54.415  81.437 174.804  1.00  0.78           C  
ATOM   3235  C   ALA A 416      53.208  81.387 175.745  1.00  0.78           C  
ATOM   3236  O   ALA A 416      53.348  81.470 176.963  1.00  0.78           O  
ATOM   3237  CB  ALA A 416      54.513  82.831 174.151  1.00  0.78           C  
ATOM   3238  N   LEU A 417      51.985  81.241 175.195  1.00  0.76           N  
ATOM   3239  CA  LEU A 417      50.764  81.117 175.976  1.00  0.76           C  
ATOM   3240  C   LEU A 417      50.625  79.804 176.738  1.00  0.76           C  
ATOM   3241  O   LEU A 417      50.211  79.782 177.896  1.00  0.76           O  
ATOM   3242  CB  LEU A 417      49.523  81.295 175.067  1.00  0.76           C  
ATOM   3243  CG  LEU A 417      49.361  82.713 174.481  1.00  0.76           C  
ATOM   3244  CD1 LEU A 417      48.280  82.713 173.391  1.00  0.76           C  
ATOM   3245  CD2 LEU A 417      49.020  83.749 175.564  1.00  0.76           C  
ATOM   3246  N   PHE A 418      50.972  78.663 176.112  1.00  0.76           N  
ATOM   3247  CA  PHE A 418      50.748  77.348 176.686  1.00  0.76           C  
ATOM   3248  C   PHE A 418      52.004  76.482 176.619  1.00  0.76           C  
ATOM   3249  O   PHE A 418      52.006  75.523 175.844  1.00  0.76           O  
ATOM   3250  CB  PHE A 418      49.616  76.603 175.919  1.00  0.76           C  
ATOM   3251  CG  PHE A 418      48.311  77.337 176.034  1.00  0.76           C  
ATOM   3252  CD1 PHE A 418      47.791  78.051 174.941  1.00  0.76           C  
ATOM   3253  CD2 PHE A 418      47.598  77.329 177.244  1.00  0.76           C  
ATOM   3254  CE1 PHE A 418      46.584  78.752 175.059  1.00  0.76           C  
ATOM   3255  CE2 PHE A 418      46.389  78.026 177.363  1.00  0.76           C  
ATOM   3256  CZ  PHE A 418      45.881  78.736 176.269  1.00  0.76           C  
ATOM   3257  N   PRO A 419      53.077  76.687 177.404  1.00  0.79           N  
ATOM   3258  CA  PRO A 419      54.382  76.064 177.139  1.00  0.79           C  
ATOM   3259  C   PRO A 419      54.443  74.554 177.302  1.00  0.79           C  
ATOM   3260  O   PRO A 419      55.497  73.970 177.072  1.00  0.79           O  
ATOM   3261  CB  PRO A 419      55.327  76.723 178.165  1.00  0.79           C  
ATOM   3262  CG  PRO A 419      54.698  78.087 178.445  1.00  0.79           C  
ATOM   3263  CD  PRO A 419      53.200  77.803 178.355  1.00  0.79           C  
ATOM   3264  N   LYS A 420      53.361  73.909 177.771  1.00  0.72           N  
ATOM   3265  CA  LYS A 420      53.334  72.493 178.069  1.00  0.72           C  
ATOM   3266  C   LYS A 420      52.221  71.738 177.335  1.00  0.72           C  
ATOM   3267  O   LYS A 420      52.105  70.526 177.500  1.00  0.72           O  
ATOM   3268  CB  LYS A 420      53.225  72.321 179.611  1.00  0.72           C  
ATOM   3269  CG  LYS A 420      54.565  72.605 180.323  1.00  0.72           C  
ATOM   3270  CD  LYS A 420      54.441  72.996 181.808  1.00  0.72           C  
ATOM   3271  CE  LYS A 420      54.072  74.472 182.008  1.00  0.72           C  
ATOM   3272  NZ  LYS A 420      54.083  74.820 183.449  1.00  0.72           N  
ATOM   3273  N   ASP A 421      51.408  72.387 176.461  1.00  0.77           N  
ATOM   3274  CA  ASP A 421      50.462  71.662 175.610  1.00  0.77           C  
ATOM   3275  C   ASP A 421      51.112  71.458 174.241  1.00  0.77           C  
ATOM   3276  O   ASP A 421      50.959  72.235 173.298  1.00  0.77           O  
ATOM   3277  CB  ASP A 421      49.061  72.350 175.539  1.00  0.77           C  
ATOM   3278  CG  ASP A 421      47.989  71.525 174.821  1.00  0.77           C  
ATOM   3279  OD1 ASP A 421      46.802  71.957 174.837  1.00  0.77           O  
ATOM   3280  OD2 ASP A 421      48.321  70.496 174.175  1.00  0.77           O  
ATOM   3281  N   VAL A 422      51.889  70.365 174.115  1.00  0.81           N  
ATOM   3282  CA  VAL A 422      52.593  70.029 172.890  1.00  0.81           C  
ATOM   3283  C   VAL A 422      51.686  69.432 171.828  1.00  0.81           C  
ATOM   3284  O   VAL A 422      51.991  69.491 170.637  1.00  0.81           O  
ATOM   3285  CB  VAL A 422      53.776  69.095 173.137  1.00  0.81           C  
ATOM   3286  CG1 VAL A 422      54.864  69.868 173.906  1.00  0.81           C  
ATOM   3287  CG2 VAL A 422      53.353  67.828 173.909  1.00  0.81           C  
ATOM   3288  N   ASP A 423      50.512  68.884 172.213  1.00  0.82           N  
ATOM   3289  CA  ASP A 423      49.517  68.435 171.263  1.00  0.82           C  
ATOM   3290  C   ASP A 423      48.887  69.637 170.564  1.00  0.82           C  
ATOM   3291  O   ASP A 423      48.734  69.653 169.347  1.00  0.82           O  
ATOM   3292  CB  ASP A 423      48.464  67.528 171.949  1.00  0.82           C  
ATOM   3293  CG  ASP A 423      47.553  66.930 170.901  1.00  0.82           C  
ATOM   3294  OD1 ASP A 423      46.362  67.323 170.836  1.00  0.82           O  
ATOM   3295  OD2 ASP A 423      48.049  66.104 170.094  1.00  0.82           O  
ATOM   3296  N   ARG A 424      48.582  70.719 171.312  1.00  0.78           N  
ATOM   3297  CA  ARG A 424      48.004  71.946 170.779  1.00  0.78           C  
ATOM   3298  C   ARG A 424      48.808  72.595 169.677  1.00  0.78           C  
ATOM   3299  O   ARG A 424      48.253  73.143 168.729  1.00  0.78           O  
ATOM   3300  CB  ARG A 424      47.764  72.950 171.912  1.00  0.78           C  
ATOM   3301  CG  ARG A 424      46.882  74.172 171.621  1.00  0.78           C  
ATOM   3302  CD  ARG A 424      46.469  74.852 172.931  1.00  0.78           C  
ATOM   3303  NE  ARG A 424      45.434  75.876 172.590  1.00  0.78           N  
ATOM   3304  CZ  ARG A 424      44.357  76.128 173.336  1.00  0.78           C  
ATOM   3305  NH1 ARG A 424      44.066  75.490 174.463  1.00  0.78           N  
ATOM   3306  NH2 ARG A 424      43.469  77.030 172.942  1.00  0.78           N  
ATOM   3307  N   LEU A 425      50.146  72.493 169.749  1.00  0.84           N  
ATOM   3308  CA  LEU A 425      51.034  72.912 168.684  1.00  0.84           C  
ATOM   3309  C   LEU A 425      50.813  72.186 167.360  1.00  0.84           C  
ATOM   3310  O   LEU A 425      50.726  72.827 166.319  1.00  0.84           O  
ATOM   3311  CB  LEU A 425      52.507  72.731 169.124  1.00  0.84           C  
ATOM   3312  CG  LEU A 425      52.911  73.587 170.342  1.00  0.84           C  
ATOM   3313  CD1 LEU A 425      54.323  73.216 170.818  1.00  0.84           C  
ATOM   3314  CD2 LEU A 425      52.838  75.089 170.032  1.00  0.84           C  
ATOM   3315  N   ARG A 426      50.659  70.841 167.337  1.00  0.78           N  
ATOM   3316  CA  ARG A 426      50.239  70.160 166.114  1.00  0.78           C  
ATOM   3317  C   ARG A 426      48.768  70.413 165.772  1.00  0.78           C  
ATOM   3318  O   ARG A 426      48.409  70.622 164.619  1.00  0.78           O  
ATOM   3319  CB  ARG A 426      50.588  68.643 166.078  1.00  0.78           C  
ATOM   3320  CG  ARG A 426      49.775  67.737 167.018  1.00  0.78           C  
ATOM   3321  CD  ARG A 426      49.889  66.239 166.714  1.00  0.78           C  
ATOM   3322  NE  ARG A 426      48.821  65.603 167.548  1.00  0.78           N  
ATOM   3323  CZ  ARG A 426      47.585  65.380 167.090  1.00  0.78           C  
ATOM   3324  NH1 ARG A 426      47.297  65.238 165.804  1.00  0.78           N  
ATOM   3325  NH2 ARG A 426      46.607  65.363 167.994  1.00  0.78           N  
ATOM   3326  N   ARG A 427      47.878  70.443 166.787  1.00  0.84           N  
ATOM   3327  CA  ARG A 427      46.433  70.582 166.669  1.00  0.84           C  
ATOM   3328  C   ARG A 427      45.990  71.888 166.011  1.00  0.84           C  
ATOM   3329  O   ARG A 427      45.003  71.937 165.278  1.00  0.84           O  
ATOM   3330  CB  ARG A 427      45.824  70.409 168.086  1.00  0.84           C  
ATOM   3331  CG  ARG A 427      44.358  69.942 168.170  1.00  0.84           C  
ATOM   3332  CD  ARG A 427      43.997  69.318 169.535  1.00  0.84           C  
ATOM   3333  NE  ARG A 427      43.943  70.405 170.566  1.00  0.84           N  
ATOM   3334  CZ  ARG A 427      44.660  70.483 171.698  1.00  0.84           C  
ATOM   3335  NH1 ARG A 427      45.595  69.605 172.042  1.00  0.84           N  
ATOM   3336  NH2 ARG A 427      44.434  71.499 172.535  1.00  0.84           N  
ATOM   3337  N   MET A 428      46.739  72.981 166.257  1.00  0.89           N  
ATOM   3338  CA  MET A 428      46.522  74.276 165.642  1.00  0.89           C  
ATOM   3339  C   MET A 428      47.517  74.596 164.525  1.00  0.89           C  
ATOM   3340  O   MET A 428      47.498  75.705 163.993  1.00  0.89           O  
ATOM   3341  CB  MET A 428      46.656  75.385 166.719  1.00  0.89           C  
ATOM   3342  CG  MET A 428      45.621  75.287 167.858  1.00  0.89           C  
ATOM   3343  SD  MET A 428      45.784  76.581 169.131  1.00  0.89           S  
ATOM   3344  CE  MET A 428      45.326  77.988 168.083  1.00  0.89           C  
ATOM   3345  N   SER A 429      48.421  73.667 164.147  1.00  0.91           N  
ATOM   3346  CA  SER A 429      49.389  73.869 163.063  1.00  0.91           C  
ATOM   3347  C   SER A 429      48.741  74.034 161.701  1.00  0.91           C  
ATOM   3348  O   SER A 429      47.802  73.333 161.340  1.00  0.91           O  
ATOM   3349  CB  SER A 429      50.412  72.699 162.936  1.00  0.91           C  
ATOM   3350  OG  SER A 429      51.442  72.927 161.961  1.00  0.91           O  
ATOM   3351  N   LEU A 430      49.288  74.924 160.849  1.00  0.92           N  
ATOM   3352  CA  LEU A 430      48.827  75.054 159.477  1.00  0.92           C  
ATOM   3353  C   LEU A 430      49.294  73.890 158.613  1.00  0.92           C  
ATOM   3354  O   LEU A 430      48.802  73.691 157.504  1.00  0.92           O  
ATOM   3355  CB  LEU A 430      49.321  76.355 158.792  1.00  0.92           C  
ATOM   3356  CG  LEU A 430      49.060  77.674 159.547  1.00  0.92           C  
ATOM   3357  CD1 LEU A 430      49.356  78.854 158.612  1.00  0.92           C  
ATOM   3358  CD2 LEU A 430      47.633  77.785 160.093  1.00  0.92           C  
ATOM   3359  N   ILE A 431      50.262  73.098 159.109  1.00  0.91           N  
ATOM   3360  CA  ILE A 431      50.797  71.935 158.431  1.00  0.91           C  
ATOM   3361  C   ILE A 431      50.423  70.705 159.238  1.00  0.91           C  
ATOM   3362  O   ILE A 431      50.714  70.600 160.428  1.00  0.91           O  
ATOM   3363  CB  ILE A 431      52.317  71.986 158.262  1.00  0.91           C  
ATOM   3364  CG1 ILE A 431      52.798  73.324 157.640  1.00  0.91           C  
ATOM   3365  CG2 ILE A 431      52.806  70.772 157.436  1.00  0.91           C  
ATOM   3366  CD1 ILE A 431      52.277  73.612 156.225  1.00  0.91           C  
ATOM   3367  N   GLU A 432      49.756  69.736 158.588  1.00  0.87           N  
ATOM   3368  CA  GLU A 432      49.466  68.431 159.136  1.00  0.87           C  
ATOM   3369  C   GLU A 432      50.702  67.574 158.964  1.00  0.87           C  
ATOM   3370  O   GLU A 432      51.251  67.474 157.864  1.00  0.87           O  
ATOM   3371  CB  GLU A 432      48.277  67.773 158.402  1.00  0.87           C  
ATOM   3372  CG  GLU A 432      46.983  68.622 158.475  1.00  0.87           C  
ATOM   3373  CD  GLU A 432      45.873  68.075 157.603  1.00  0.87           C  
ATOM   3374  OE1 GLU A 432      46.058  67.023 156.935  1.00  0.87           O  
ATOM   3375  OE2 GLU A 432      44.777  68.693 157.563  1.00  0.87           O  
ATOM   3376  N   GLU A 433      51.198  66.966 160.054  1.00  0.73           N  
ATOM   3377  CA  GLU A 433      52.540  66.420 160.083  1.00  0.73           C  
ATOM   3378  C   GLU A 433      52.526  64.920 159.867  1.00  0.73           C  
ATOM   3379  O   GLU A 433      53.518  64.323 159.433  1.00  0.73           O  
ATOM   3380  CB  GLU A 433      53.192  66.757 161.453  1.00  0.73           C  
ATOM   3381  CG  GLU A 433      54.631  67.317 161.348  1.00  0.73           C  
ATOM   3382  CD  GLU A 433      54.683  68.591 160.507  1.00  0.73           C  
ATOM   3383  OE1 GLU A 433      54.959  68.434 159.288  1.00  0.73           O  
ATOM   3384  OE2 GLU A 433      54.479  69.697 161.058  1.00  0.73           O  
ATOM   3385  N   GLU A 434      51.357  64.320 160.150  1.00  0.67           N  
ATOM   3386  CA  GLU A 434      50.956  62.940 160.059  1.00  0.67           C  
ATOM   3387  C   GLU A 434      51.088  62.327 158.665  1.00  0.67           C  
ATOM   3388  O   GLU A 434      50.297  62.565 157.754  1.00  0.67           O  
ATOM   3389  CB  GLU A 434      49.478  62.829 160.535  1.00  0.67           C  
ATOM   3390  CG  GLU A 434      49.222  63.072 162.058  1.00  0.67           C  
ATOM   3391  CD  GLU A 434      49.234  64.516 162.581  1.00  0.67           C  
ATOM   3392  OE1 GLU A 434      48.911  64.678 163.792  1.00  0.67           O  
ATOM   3393  OE2 GLU A 434      49.551  65.463 161.821  1.00  0.67           O  
ATOM   3394  N   GLY A 435      52.101  61.453 158.477  1.00  0.76           N  
ATOM   3395  CA  GLY A 435      52.354  60.784 157.204  1.00  0.76           C  
ATOM   3396  C   GLY A 435      52.911  61.691 156.133  1.00  0.76           C  
ATOM   3397  O   GLY A 435      54.010  62.228 156.261  1.00  0.76           O  
ATOM   3398  N   SER A 436      52.163  61.864 155.024  1.00  0.82           N  
ATOM   3399  CA  SER A 436      52.553  62.770 153.950  1.00  0.82           C  
ATOM   3400  C   SER A 436      51.919  64.121 154.203  1.00  0.82           C  
ATOM   3401  O   SER A 436      50.701  64.238 154.323  1.00  0.82           O  
ATOM   3402  CB  SER A 436      52.185  62.277 152.528  1.00  0.82           C  
ATOM   3403  OG  SER A 436      52.796  63.123 151.555  1.00  0.82           O  
ATOM   3404  N   LYS A 437      52.771  65.151 154.359  1.00  0.85           N  
ATOM   3405  CA  LYS A 437      52.429  66.456 154.886  1.00  0.85           C  
ATOM   3406  C   LYS A 437      51.470  67.279 154.053  1.00  0.85           C  
ATOM   3407  O   LYS A 437      51.521  67.306 152.825  1.00  0.85           O  
ATOM   3408  CB  LYS A 437      53.714  67.256 155.179  1.00  0.85           C  
ATOM   3409  CG  LYS A 437      54.464  66.660 156.374  1.00  0.85           C  
ATOM   3410  CD  LYS A 437      55.939  67.093 156.447  1.00  0.85           C  
ATOM   3411  CE  LYS A 437      56.707  66.610 157.691  1.00  0.85           C  
ATOM   3412  NZ  LYS A 437      55.994  65.472 158.335  1.00  0.85           N  
ATOM   3413  N   ARG A 438      50.557  68.001 154.726  1.00  0.86           N  
ATOM   3414  CA  ARG A 438      49.473  68.684 154.053  1.00  0.86           C  
ATOM   3415  C   ARG A 438      49.235  70.029 154.688  1.00  0.86           C  
ATOM   3416  O   ARG A 438      49.357  70.197 155.895  1.00  0.86           O  
ATOM   3417  CB  ARG A 438      48.138  67.893 154.121  1.00  0.86           C  
ATOM   3418  CG  ARG A 438      48.288  66.396 153.794  1.00  0.86           C  
ATOM   3419  CD  ARG A 438      46.981  65.611 153.832  1.00  0.86           C  
ATOM   3420  NE  ARG A 438      46.249  65.936 152.564  1.00  0.86           N  
ATOM   3421  CZ  ARG A 438      46.113  65.126 151.508  1.00  0.86           C  
ATOM   3422  NH1 ARG A 438      46.607  63.895 151.486  1.00  0.86           N  
ATOM   3423  NH2 ARG A 438      45.468  65.595 150.444  1.00  0.86           N  
ATOM   3424  N   ILE A 439      48.877  71.042 153.886  1.00  0.93           N  
ATOM   3425  CA  ILE A 439      48.521  72.350 154.398  1.00  0.93           C  
ATOM   3426  C   ILE A 439      47.040  72.369 154.719  1.00  0.93           C  
ATOM   3427  O   ILE A 439      46.200  72.095 153.861  1.00  0.93           O  
ATOM   3428  CB  ILE A 439      48.833  73.486 153.429  1.00  0.93           C  
ATOM   3429  CG1 ILE A 439      50.255  73.328 152.843  1.00  0.93           C  
ATOM   3430  CG2 ILE A 439      48.656  74.834 154.170  1.00  0.93           C  
ATOM   3431  CD1 ILE A 439      50.648  74.462 151.893  1.00  0.93           C  
ATOM   3432  N   ASN A 440      46.675  72.704 155.970  1.00  0.92           N  
ATOM   3433  CA  ASN A 440      45.296  72.803 156.388  1.00  0.92           C  
ATOM   3434  C   ASN A 440      44.779  74.201 156.054  1.00  0.92           C  
ATOM   3435  O   ASN A 440      45.053  75.192 156.734  1.00  0.92           O  
ATOM   3436  CB  ASN A 440      45.154  72.465 157.895  1.00  0.92           C  
ATOM   3437  CG  ASN A 440      43.690  72.235 158.249  1.00  0.92           C  
ATOM   3438  OD1 ASN A 440      42.893  73.177 158.317  1.00  0.92           O  
ATOM   3439  ND2 ASN A 440      43.299  70.952 158.423  1.00  0.92           N  
ATOM   3440  N   MET A 441      44.019  74.311 154.948  1.00  0.93           N  
ATOM   3441  CA  MET A 441      43.575  75.583 154.410  1.00  0.93           C  
ATOM   3442  C   MET A 441      42.587  76.317 155.308  1.00  0.93           C  
ATOM   3443  O   MET A 441      42.596  77.543 155.388  1.00  0.93           O  
ATOM   3444  CB  MET A 441      43.020  75.419 152.976  1.00  0.93           C  
ATOM   3445  CG  MET A 441      43.960  74.652 152.016  1.00  0.93           C  
ATOM   3446  SD  MET A 441      45.699  75.201 151.959  1.00  0.93           S  
ATOM   3447  CE  MET A 441      45.467  76.685 150.945  1.00  0.93           C  
ATOM   3448  N   ALA A 442      41.736  75.580 156.052  1.00  0.95           N  
ATOM   3449  CA  ALA A 442      40.827  76.149 157.031  1.00  0.95           C  
ATOM   3450  C   ALA A 442      41.541  76.866 158.173  1.00  0.95           C  
ATOM   3451  O   ALA A 442      41.200  77.992 158.530  1.00  0.95           O  
ATOM   3452  CB  ALA A 442      39.919  75.039 157.593  1.00  0.95           C  
ATOM   3453  N   HIS A 443      42.610  76.261 158.733  1.00  0.92           N  
ATOM   3454  CA  HIS A 443      43.457  76.913 159.724  1.00  0.92           C  
ATOM   3455  C   HIS A 443      44.164  78.150 159.184  1.00  0.92           C  
ATOM   3456  O   HIS A 443      44.233  79.178 159.858  1.00  0.92           O  
ATOM   3457  CB  HIS A 443      44.500  75.946 160.316  1.00  0.92           C  
ATOM   3458  CG  HIS A 443      43.914  74.841 161.140  1.00  0.92           C  
ATOM   3459  ND1 HIS A 443      44.790  74.050 161.843  1.00  0.92           N  
ATOM   3460  CD2 HIS A 443      42.636  74.436 161.363  1.00  0.92           C  
ATOM   3461  CE1 HIS A 443      44.047  73.172 162.479  1.00  0.92           C  
ATOM   3462  NE2 HIS A 443      42.728  73.361 162.226  1.00  0.92           N  
ATOM   3463  N   LEU A 444      44.663  78.102 157.925  1.00  0.95           N  
ATOM   3464  CA  LEU A 444      45.252  79.249 157.242  1.00  0.95           C  
ATOM   3465  C   LEU A 444      44.271  80.415 157.101  1.00  0.95           C  
ATOM   3466  O   LEU A 444      44.603  81.567 157.389  1.00  0.95           O  
ATOM   3467  CB  LEU A 444      45.795  78.823 155.849  1.00  0.95           C  
ATOM   3468  CG  LEU A 444      46.399  79.943 154.966  1.00  0.95           C  
ATOM   3469  CD1 LEU A 444      47.610  80.635 155.613  1.00  0.95           C  
ATOM   3470  CD2 LEU A 444      46.783  79.377 153.589  1.00  0.95           C  
ATOM   3471  N   CYS A 445      43.005  80.130 156.727  1.00  0.96           N  
ATOM   3472  CA  CYS A 445      41.935  81.115 156.692  1.00  0.96           C  
ATOM   3473  C   CYS A 445      41.638  81.752 158.041  1.00  0.96           C  
ATOM   3474  O   CYS A 445      41.470  82.965 158.127  1.00  0.96           O  
ATOM   3475  CB  CYS A 445      40.607  80.525 156.156  1.00  0.96           C  
ATOM   3476  SG  CYS A 445      40.640  80.122 154.386  1.00  0.96           S  
ATOM   3477  N   ILE A 446      41.587  80.970 159.139  1.00  0.93           N  
ATOM   3478  CA  ILE A 446      41.337  81.490 160.482  1.00  0.93           C  
ATOM   3479  C   ILE A 446      42.423  82.446 160.960  1.00  0.93           C  
ATOM   3480  O   ILE A 446      42.131  83.547 161.432  1.00  0.93           O  
ATOM   3481  CB  ILE A 446      41.164  80.348 161.487  1.00  0.93           C  
ATOM   3482  CG1 ILE A 446      39.909  79.512 161.141  1.00  0.93           C  
ATOM   3483  CG2 ILE A 446      41.060  80.875 162.939  1.00  0.93           C  
ATOM   3484  CD1 ILE A 446      39.904  78.130 161.801  1.00  0.93           C  
ATOM   3485  N   VAL A 447      43.716  82.088 160.813  1.00  0.92           N  
ATOM   3486  CA  VAL A 447      44.813  82.960 161.220  1.00  0.92           C  
ATOM   3487  C   VAL A 447      44.937  84.221 160.373  1.00  0.92           C  
ATOM   3488  O   VAL A 447      45.226  85.300 160.887  1.00  0.92           O  
ATOM   3489  CB  VAL A 447      46.161  82.253 161.360  1.00  0.92           C  
ATOM   3490  CG1 VAL A 447      46.010  81.111 162.383  1.00  0.92           C  
ATOM   3491  CG2 VAL A 447      46.694  81.713 160.021  1.00  0.92           C  
ATOM   3492  N   GLY A 448      44.701  84.125 159.047  1.00  0.94           N  
ATOM   3493  CA  GLY A 448      44.833  85.239 158.112  1.00  0.94           C  
ATOM   3494  C   GLY A 448      43.675  86.195 158.016  1.00  0.94           C  
ATOM   3495  O   GLY A 448      43.747  87.154 157.258  1.00  0.94           O  
ATOM   3496  N   SER A 449      42.583  85.951 158.758  1.00  0.95           N  
ATOM   3497  CA  SER A 449      41.350  86.730 158.685  1.00  0.95           C  
ATOM   3498  C   SER A 449      41.036  87.366 160.018  1.00  0.95           C  
ATOM   3499  O   SER A 449      41.439  86.846 161.056  1.00  0.95           O  
ATOM   3500  CB  SER A 449      40.118  85.841 158.382  1.00  0.95           C  
ATOM   3501  OG  SER A 449      40.265  85.171 157.133  1.00  0.95           O  
ATOM   3502  N   HIS A 450      40.281  88.490 160.058  1.00  0.93           N  
ATOM   3503  CA  HIS A 450      39.821  89.062 161.321  1.00  0.93           C  
ATOM   3504  C   HIS A 450      38.490  88.494 161.773  1.00  0.93           C  
ATOM   3505  O   HIS A 450      38.134  88.597 162.944  1.00  0.93           O  
ATOM   3506  CB  HIS A 450      39.668  90.606 161.285  1.00  0.93           C  
ATOM   3507  CG  HIS A 450      38.597  91.141 160.377  1.00  0.93           C  
ATOM   3508  ND1 HIS A 450      38.877  91.246 159.039  1.00  0.93           N  
ATOM   3509  CD2 HIS A 450      37.346  91.610 160.633  1.00  0.93           C  
ATOM   3510  CE1 HIS A 450      37.805  91.776 158.493  1.00  0.93           C  
ATOM   3511  NE2 HIS A 450      36.841  92.019 159.415  1.00  0.93           N  
ATOM   3512  N   ALA A 451      37.737  87.849 160.865  1.00  0.96           N  
ATOM   3513  CA  ALA A 451      36.423  87.330 161.169  1.00  0.96           C  
ATOM   3514  C   ALA A 451      36.208  85.982 160.503  1.00  0.96           C  
ATOM   3515  O   ALA A 451      36.591  85.757 159.355  1.00  0.96           O  
ATOM   3516  CB  ALA A 451      35.335  88.318 160.708  1.00  0.96           C  
ATOM   3517  N   VAL A 452      35.605  85.037 161.246  1.00  0.96           N  
ATOM   3518  CA  VAL A 452      35.316  83.689 160.795  1.00  0.96           C  
ATOM   3519  C   VAL A 452      33.869  83.413 161.130  1.00  0.96           C  
ATOM   3520  O   VAL A 452      33.429  83.656 162.252  1.00  0.96           O  
ATOM   3521  CB  VAL A 452      36.192  82.645 161.491  1.00  0.96           C  
ATOM   3522  CG1 VAL A 452      35.785  81.208 161.094  1.00  0.96           C  
ATOM   3523  CG2 VAL A 452      37.666  82.903 161.128  1.00  0.96           C  
ATOM   3524  N   ASN A 453      33.058  82.894 160.191  1.00  0.92           N  
ATOM   3525  CA  ASN A 453      31.679  82.592 160.520  1.00  0.92           C  
ATOM   3526  C   ASN A 453      31.174  81.308 159.896  1.00  0.92           C  
ATOM   3527  O   ASN A 453      31.531  80.938 158.779  1.00  0.92           O  
ATOM   3528  CB  ASN A 453      30.730  83.787 160.215  1.00  0.92           C  
ATOM   3529  CG  ASN A 453      30.614  84.120 158.730  1.00  0.92           C  
ATOM   3530  OD1 ASN A 453      31.337  84.954 158.188  1.00  0.92           O  
ATOM   3531  ND2 ASN A 453      29.625  83.492 158.057  1.00  0.92           N  
ATOM   3532  N   GLY A 454      30.290  80.607 160.636  1.00  0.93           N  
ATOM   3533  CA  GLY A 454      29.418  79.582 160.076  1.00  0.93           C  
ATOM   3534  C   GLY A 454      28.184  80.191 159.458  1.00  0.93           C  
ATOM   3535  O   GLY A 454      27.987  81.409 159.480  1.00  0.93           O  
ATOM   3536  N   VAL A 455      27.315  79.337 158.893  1.00  0.94           N  
ATOM   3537  CA  VAL A 455      26.220  79.766 158.028  1.00  0.94           C  
ATOM   3538  C   VAL A 455      24.831  79.476 158.595  1.00  0.94           C  
ATOM   3539  O   VAL A 455      23.811  79.737 157.951  1.00  0.94           O  
ATOM   3540  CB  VAL A 455      26.362  79.142 156.643  1.00  0.94           C  
ATOM   3541  CG1 VAL A 455      27.474  79.888 155.883  1.00  0.94           C  
ATOM   3542  CG2 VAL A 455      26.700  77.642 156.726  1.00  0.94           C  
ATOM   3543  N   ALA A 456      24.755  78.980 159.841  1.00  0.95           N  
ATOM   3544  CA  ALA A 456      23.532  78.835 160.609  1.00  0.95           C  
ATOM   3545  C   ALA A 456      23.944  78.779 162.064  1.00  0.95           C  
ATOM   3546  O   ALA A 456      25.105  78.489 162.353  1.00  0.95           O  
ATOM   3547  CB  ALA A 456      22.733  77.564 160.256  1.00  0.95           C  
ATOM   3548  N   LYS A 457      23.046  79.065 163.034  1.00  0.89           N  
ATOM   3549  CA  LYS A 457      23.427  79.119 164.445  1.00  0.89           C  
ATOM   3550  C   LYS A 457      23.991  77.819 165.008  1.00  0.89           C  
ATOM   3551  O   LYS A 457      25.020  77.823 165.681  1.00  0.89           O  
ATOM   3552  CB  LYS A 457      22.252  79.567 165.346  1.00  0.89           C  
ATOM   3553  CG  LYS A 457      21.992  81.082 165.309  1.00  0.89           C  
ATOM   3554  CD  LYS A 457      20.968  81.516 166.373  1.00  0.89           C  
ATOM   3555  CE  LYS A 457      19.540  81.103 166.013  1.00  0.89           C  
ATOM   3556  NZ  LYS A 457      18.631  81.267 167.153  1.00  0.89           N  
ATOM   3557  N   ILE A 458      23.363  76.665 164.699  1.00  0.88           N  
ATOM   3558  CA  ILE A 458      23.854  75.350 165.101  1.00  0.88           C  
ATOM   3559  C   ILE A 458      25.229  75.033 164.516  1.00  0.88           C  
ATOM   3560  O   ILE A 458      26.128  74.548 165.199  1.00  0.88           O  
ATOM   3561  CB  ILE A 458      22.830  74.250 164.799  1.00  0.88           C  
ATOM   3562  CG1 ILE A 458      23.285  72.882 165.365  1.00  0.88           C  
ATOM   3563  CG2 ILE A 458      22.491  74.176 163.291  1.00  0.88           C  
ATOM   3564  CD1 ILE A 458      22.209  71.793 165.281  1.00  0.88           C  
ATOM   3565  N   HIS A 459      25.450  75.371 163.229  1.00  0.88           N  
ATOM   3566  CA  HIS A 459      26.731  75.233 162.564  1.00  0.88           C  
ATOM   3567  C   HIS A 459      27.810  76.122 163.156  1.00  0.88           C  
ATOM   3568  O   HIS A 459      28.925  75.674 163.405  1.00  0.88           O  
ATOM   3569  CB  HIS A 459      26.575  75.539 161.061  1.00  0.88           C  
ATOM   3570  CG  HIS A 459      27.823  75.341 160.262  1.00  0.88           C  
ATOM   3571  ND1 HIS A 459      28.333  76.390 159.523  1.00  0.88           N  
ATOM   3572  CD2 HIS A 459      28.573  74.224 160.084  1.00  0.88           C  
ATOM   3573  CE1 HIS A 459      29.385  75.884 158.906  1.00  0.88           C  
ATOM   3574  NE2 HIS A 459      29.576  74.578 159.209  1.00  0.88           N  
ATOM   3575  N   SER A 460      27.488  77.396 163.457  1.00  0.91           N  
ATOM   3576  CA  SER A 460      28.413  78.334 164.080  1.00  0.91           C  
ATOM   3577  C   SER A 460      28.929  77.895 165.427  1.00  0.91           C  
ATOM   3578  O   SER A 460      30.123  78.036 165.683  1.00  0.91           O  
ATOM   3579  CB  SER A 460      27.811  79.743 164.278  1.00  0.91           C  
ATOM   3580  OG  SER A 460      27.917  80.496 163.074  1.00  0.91           O  
ATOM   3581  N   ASP A 461      28.078  77.339 166.318  1.00  0.85           N  
ATOM   3582  CA  ASP A 461      28.568  76.786 167.571  1.00  0.85           C  
ATOM   3583  C   ASP A 461      29.473  75.570 167.355  1.00  0.85           C  
ATOM   3584  O   ASP A 461      30.557  75.491 167.915  1.00  0.85           O  
ATOM   3585  CB  ASP A 461      27.426  76.463 168.566  1.00  0.85           C  
ATOM   3586  CG  ASP A 461      28.027  76.406 169.962  1.00  0.85           C  
ATOM   3587  OD1 ASP A 461      28.304  77.499 170.514  1.00  0.85           O  
ATOM   3588  OD2 ASP A 461      28.298  75.279 170.454  1.00  0.85           O  
ATOM   3589  N   ILE A 462      29.113  74.624 166.461  1.00  0.84           N  
ATOM   3590  CA  ILE A 462      29.956  73.466 166.158  1.00  0.84           C  
ATOM   3591  C   ILE A 462      31.324  73.865 165.598  1.00  0.84           C  
ATOM   3592  O   ILE A 462      32.360  73.334 166.004  1.00  0.84           O  
ATOM   3593  CB  ILE A 462      29.230  72.477 165.243  1.00  0.84           C  
ATOM   3594  CG1 ILE A 462      27.986  71.910 165.974  1.00  0.84           C  
ATOM   3595  CG2 ILE A 462      30.173  71.331 164.804  1.00  0.84           C  
ATOM   3596  CD1 ILE A 462      27.043  71.109 165.066  1.00  0.84           C  
ATOM   3597  N   VAL A 463      31.369  74.866 164.695  1.00  0.86           N  
ATOM   3598  CA  VAL A 463      32.595  75.492 164.213  1.00  0.86           C  
ATOM   3599  C   VAL A 463      33.399  76.142 165.345  1.00  0.86           C  
ATOM   3600  O   VAL A 463      34.608  75.939 165.462  1.00  0.86           O  
ATOM   3601  CB  VAL A 463      32.241  76.514 163.121  1.00  0.86           C  
ATOM   3602  CG1 VAL A 463      33.414  77.424 162.702  1.00  0.86           C  
ATOM   3603  CG2 VAL A 463      31.751  75.754 161.871  1.00  0.86           C  
ATOM   3604  N   LYS A 464      32.741  76.917 166.232  1.00  0.78           N  
ATOM   3605  CA  LYS A 464      33.384  77.622 167.328  1.00  0.78           C  
ATOM   3606  C   LYS A 464      33.816  76.778 168.524  1.00  0.78           C  
ATOM   3607  O   LYS A 464      34.934  76.930 169.010  1.00  0.78           O  
ATOM   3608  CB  LYS A 464      32.444  78.753 167.823  1.00  0.78           C  
ATOM   3609  CG  LYS A 464      33.069  79.715 168.848  1.00  0.78           C  
ATOM   3610  CD  LYS A 464      32.233  80.997 169.033  1.00  0.78           C  
ATOM   3611  CE  LYS A 464      32.983  82.082 169.817  1.00  0.78           C  
ATOM   3612  NZ  LYS A 464      32.464  83.433 169.501  1.00  0.78           N  
ATOM   3613  N   THR A 465      32.958  75.885 169.050  1.00  0.75           N  
ATOM   3614  CA  THR A 465      33.145  75.248 170.356  1.00  0.75           C  
ATOM   3615  C   THR A 465      33.617  73.812 170.238  1.00  0.75           C  
ATOM   3616  O   THR A 465      33.964  73.173 171.230  1.00  0.75           O  
ATOM   3617  CB  THR A 465      31.872  75.261 171.221  1.00  0.75           C  
ATOM   3618  OG1 THR A 465      30.831  74.448 170.693  1.00  0.75           O  
ATOM   3619  CG2 THR A 465      31.325  76.688 171.336  1.00  0.75           C  
ATOM   3620  N   LYS A 466      33.675  73.268 169.006  1.00  0.79           N  
ATOM   3621  CA  LYS A 466      34.188  71.934 168.748  1.00  0.79           C  
ATOM   3622  C   LYS A 466      35.318  72.006 167.737  1.00  0.79           C  
ATOM   3623  O   LYS A 466      36.483  71.868 168.100  1.00  0.79           O  
ATOM   3624  CB  LYS A 466      33.102  70.910 168.286  1.00  0.79           C  
ATOM   3625  CG  LYS A 466      32.178  70.398 169.416  1.00  0.79           C  
ATOM   3626  CD  LYS A 466      30.975  71.321 169.689  1.00  0.79           C  
ATOM   3627  CE  LYS A 466      30.434  71.289 171.127  1.00  0.79           C  
ATOM   3628  NZ  LYS A 466      29.653  70.057 171.371  1.00  0.79           N  
ATOM   3629  N   VAL A 467      35.010  72.214 166.439  1.00  0.84           N  
ATOM   3630  CA  VAL A 467      35.947  72.013 165.333  1.00  0.84           C  
ATOM   3631  C   VAL A 467      37.197  72.883 165.404  1.00  0.84           C  
ATOM   3632  O   VAL A 467      38.316  72.406 165.219  1.00  0.84           O  
ATOM   3633  CB  VAL A 467      35.249  72.208 163.986  1.00  0.84           C  
ATOM   3634  CG1 VAL A 467      36.211  71.933 162.812  1.00  0.84           C  
ATOM   3635  CG2 VAL A 467      34.051  71.243 163.885  1.00  0.84           C  
ATOM   3636  N   PHE A 468      37.048  74.182 165.724  1.00  0.87           N  
ATOM   3637  CA  PHE A 468      38.170  75.097 165.832  1.00  0.87           C  
ATOM   3638  C   PHE A 468      38.281  75.650 167.238  1.00  0.87           C  
ATOM   3639  O   PHE A 468      38.742  76.772 167.444  1.00  0.87           O  
ATOM   3640  CB  PHE A 468      38.074  76.253 164.809  1.00  0.87           C  
ATOM   3641  CG  PHE A 468      38.013  75.701 163.410  1.00  0.87           C  
ATOM   3642  CD1 PHE A 468      36.889  75.962 162.615  1.00  0.87           C  
ATOM   3643  CD2 PHE A 468      39.053  74.916 162.879  1.00  0.87           C  
ATOM   3644  CE1 PHE A 468      36.791  75.451 161.316  1.00  0.87           C  
ATOM   3645  CE2 PHE A 468      38.956  74.393 161.581  1.00  0.87           C  
ATOM   3646  CZ  PHE A 468      37.826  74.662 160.800  1.00  0.87           C  
ATOM   3647  N   LYS A 469      37.891  74.852 168.257  1.00  0.87           N  
ATOM   3648  CA  LYS A 469      37.856  75.245 169.661  1.00  0.87           C  
ATOM   3649  C   LYS A 469      39.166  75.817 170.182  1.00  0.87           C  
ATOM   3650  O   LYS A 469      39.215  76.863 170.822  1.00  0.87           O  
ATOM   3651  CB  LYS A 469      37.529  73.999 170.520  1.00  0.87           C  
ATOM   3652  CG  LYS A 469      37.444  74.259 172.038  1.00  0.87           C  
ATOM   3653  CD  LYS A 469      37.607  72.986 172.891  1.00  0.87           C  
ATOM   3654  CE  LYS A 469      38.984  72.289 172.806  1.00  0.87           C  
ATOM   3655  NZ  LYS A 469      40.070  73.134 173.317  1.00  0.87           N  
ATOM   3656  N   ASP A 470      40.302  75.167 169.877  1.00  0.89           N  
ATOM   3657  CA  ASP A 470      41.586  75.621 170.359  1.00  0.89           C  
ATOM   3658  C   ASP A 470      42.023  76.967 169.750  1.00  0.89           C  
ATOM   3659  O   ASP A 470      42.783  77.704 170.376  1.00  0.89           O  
ATOM   3660  CB  ASP A 470      42.638  74.507 170.153  1.00  0.89           C  
ATOM   3661  CG  ASP A 470      42.220  73.250 170.875  1.00  0.89           C  
ATOM   3662  OD1 ASP A 470      42.159  73.256 172.115  1.00  0.89           O  
ATOM   3663  OD2 ASP A 470      42.024  72.212 170.208  1.00  0.89           O  
ATOM   3664  N   PHE A 471      41.520  77.349 168.551  1.00  0.89           N  
ATOM   3665  CA  PHE A 471      41.620  78.710 168.026  1.00  0.89           C  
ATOM   3666  C   PHE A 471      40.698  79.690 168.742  1.00  0.89           C  
ATOM   3667  O   PHE A 471      41.101  80.790 169.111  1.00  0.89           O  
ATOM   3668  CB  PHE A 471      41.268  78.795 166.512  1.00  0.89           C  
ATOM   3669  CG  PHE A 471      42.278  78.074 165.668  1.00  0.89           C  
ATOM   3670  CD1 PHE A 471      42.179  76.690 165.452  1.00  0.89           C  
ATOM   3671  CD2 PHE A 471      43.333  78.785 165.068  1.00  0.89           C  
ATOM   3672  CE1 PHE A 471      43.131  76.022 164.673  1.00  0.89           C  
ATOM   3673  CE2 PHE A 471      44.279  78.121 164.277  1.00  0.89           C  
ATOM   3674  CZ  PHE A 471      44.180  76.739 164.086  1.00  0.89           C  
ATOM   3675  N   SER A 472      39.425  79.312 168.978  1.00  0.90           N  
ATOM   3676  CA  SER A 472      38.412  80.219 169.510  1.00  0.90           C  
ATOM   3677  C   SER A 472      38.623  80.613 170.963  1.00  0.90           C  
ATOM   3678  O   SER A 472      38.202  81.684 171.386  1.00  0.90           O  
ATOM   3679  CB  SER A 472      36.971  79.678 169.310  1.00  0.90           C  
ATOM   3680  OG  SER A 472      36.684  78.570 170.162  1.00  0.90           O  
ATOM   3681  N   GLU A 473      39.330  79.774 171.744  1.00  0.81           N  
ATOM   3682  CA  GLU A 473      39.839  80.099 173.068  1.00  0.81           C  
ATOM   3683  C   GLU A 473      40.839  81.257 173.071  1.00  0.81           C  
ATOM   3684  O   GLU A 473      40.822  82.102 173.963  1.00  0.81           O  
ATOM   3685  CB  GLU A 473      40.525  78.854 173.683  1.00  0.81           C  
ATOM   3686  CG  GLU A 473      39.542  77.708 174.040  1.00  0.81           C  
ATOM   3687  CD  GLU A 473      40.230  76.398 174.394  1.00  0.81           C  
ATOM   3688  OE1 GLU A 473      41.482  76.365 174.518  1.00  0.81           O  
ATOM   3689  OE2 GLU A 473      39.518  75.367 174.499  1.00  0.81           O  
ATOM   3690  N   LEU A 474      41.747  81.327 172.070  1.00  0.78           N  
ATOM   3691  CA  LEU A 474      42.665  82.449 171.898  1.00  0.78           C  
ATOM   3692  C   LEU A 474      41.961  83.735 171.476  1.00  0.78           C  
ATOM   3693  O   LEU A 474      42.288  84.818 171.956  1.00  0.78           O  
ATOM   3694  CB  LEU A 474      43.791  82.161 170.859  1.00  0.78           C  
ATOM   3695  CG  LEU A 474      45.029  81.414 171.402  1.00  0.78           C  
ATOM   3696  CD1 LEU A 474      44.740  79.954 171.754  1.00  0.78           C  
ATOM   3697  CD2 LEU A 474      46.177  81.472 170.381  1.00  0.78           C  
ATOM   3698  N   GLU A 475      40.990  83.642 170.549  1.00  0.82           N  
ATOM   3699  CA  GLU A 475      40.367  84.803 169.936  1.00  0.82           C  
ATOM   3700  C   GLU A 475      38.843  84.618 169.819  1.00  0.82           C  
ATOM   3701  O   GLU A 475      38.330  84.221 168.766  1.00  0.82           O  
ATOM   3702  CB  GLU A 475      41.063  85.115 168.577  1.00  0.82           C  
ATOM   3703  CG  GLU A 475      41.367  83.880 167.684  1.00  0.82           C  
ATOM   3704  CD  GLU A 475      42.157  84.216 166.433  1.00  0.82           C  
ATOM   3705  OE1 GLU A 475      42.235  83.354 165.515  1.00  0.82           O  
ATOM   3706  OE2 GLU A 475      42.643  85.367 166.284  1.00  0.82           O  
ATOM   3707  N   PRO A 476      38.047  84.894 170.870  1.00  0.91           N  
ATOM   3708  CA  PRO A 476      36.625  84.543 170.904  1.00  0.91           C  
ATOM   3709  C   PRO A 476      35.764  85.329 169.941  1.00  0.91           C  
ATOM   3710  O   PRO A 476      34.789  84.786 169.414  1.00  0.91           O  
ATOM   3711  CB  PRO A 476      36.196  84.836 172.355  1.00  0.91           C  
ATOM   3712  CG  PRO A 476      37.485  84.662 173.155  1.00  0.91           C  
ATOM   3713  CD  PRO A 476      38.530  85.253 172.211  1.00  0.91           C  
ATOM   3714  N   ASP A 477      36.071  86.618 169.751  1.00  0.85           N  
ATOM   3715  CA  ASP A 477      35.298  87.610 169.031  1.00  0.85           C  
ATOM   3716  C   ASP A 477      35.316  87.399 167.522  1.00  0.85           C  
ATOM   3717  O   ASP A 477      34.392  87.762 166.795  1.00  0.85           O  
ATOM   3718  CB  ASP A 477      35.868  89.007 169.384  1.00  0.85           C  
ATOM   3719  CG  ASP A 477      36.039  89.112 170.892  1.00  0.85           C  
ATOM   3720  OD1 ASP A 477      35.140  89.680 171.551  1.00  0.85           O  
ATOM   3721  OD2 ASP A 477      37.055  88.553 171.387  1.00  0.85           O  
ATOM   3722  N   LYS A 478      36.377  86.732 167.026  1.00  0.89           N  
ATOM   3723  CA  LYS A 478      36.556  86.365 165.635  1.00  0.89           C  
ATOM   3724  C   LYS A 478      35.474  85.431 165.113  1.00  0.89           C  
ATOM   3725  O   LYS A 478      35.001  85.561 163.985  1.00  0.89           O  
ATOM   3726  CB  LYS A 478      37.939  85.687 165.471  1.00  0.89           C  
ATOM   3727  CG  LYS A 478      38.222  85.175 164.049  1.00  0.89           C  
ATOM   3728  CD  LYS A 478      39.658  84.677 163.845  1.00  0.89           C  
ATOM   3729  CE  LYS A 478      40.695  85.800 163.897  1.00  0.89           C  
ATOM   3730  NZ  LYS A 478      42.028  85.246 163.604  1.00  0.89           N  
ATOM   3731  N   PHE A 479      35.062  84.455 165.941  1.00  0.89           N  
ATOM   3732  CA  PHE A 479      34.160  83.396 165.541  1.00  0.89           C  
ATOM   3733  C   PHE A 479      32.698  83.791 165.723  1.00  0.89           C  
ATOM   3734  O   PHE A 479      32.180  83.865 166.841  1.00  0.89           O  
ATOM   3735  CB  PHE A 479      34.448  82.113 166.354  1.00  0.89           C  
ATOM   3736  CG  PHE A 479      35.687  81.432 165.854  1.00  0.89           C  
ATOM   3737  CD1 PHE A 479      36.966  81.814 166.298  1.00  0.89           C  
ATOM   3738  CD2 PHE A 479      35.570  80.385 164.927  1.00  0.89           C  
ATOM   3739  CE1 PHE A 479      38.108  81.161 165.818  1.00  0.89           C  
ATOM   3740  CE2 PHE A 479      36.709  79.728 164.448  1.00  0.89           C  
ATOM   3741  CZ  PHE A 479      37.977  80.115 164.895  1.00  0.89           C  
ATOM   3742  N   GLN A 480      31.997  84.026 164.599  1.00  0.89           N  
ATOM   3743  CA  GLN A 480      30.668  84.600 164.546  1.00  0.89           C  
ATOM   3744  C   GLN A 480      29.633  83.685 163.881  1.00  0.89           C  
ATOM   3745  O   GLN A 480      29.885  82.568 163.422  1.00  0.89           O  
ATOM   3746  CB  GLN A 480      30.673  85.937 163.745  1.00  0.89           C  
ATOM   3747  CG  GLN A 480      31.563  87.069 164.316  1.00  0.89           C  
ATOM   3748  CD  GLN A 480      31.307  88.376 163.552  1.00  0.89           C  
ATOM   3749  OE1 GLN A 480      30.233  88.569 162.967  1.00  0.89           O  
ATOM   3750  NE2 GLN A 480      32.292  89.298 163.564  1.00  0.89           N  
ATOM   3751  N   ASN A 481      28.387  84.185 163.822  1.00  0.90           N  
ATOM   3752  CA  ASN A 481      27.283  83.627 163.077  1.00  0.90           C  
ATOM   3753  C   ASN A 481      26.858  84.650 162.041  1.00  0.90           C  
ATOM   3754  O   ASN A 481      26.844  85.848 162.317  1.00  0.90           O  
ATOM   3755  CB  ASN A 481      26.134  83.268 164.064  1.00  0.90           C  
ATOM   3756  CG  ASN A 481      24.819  82.891 163.388  1.00  0.90           C  
ATOM   3757  OD1 ASN A 481      23.802  83.538 163.628  1.00  0.90           O  
ATOM   3758  ND2 ASN A 481      24.834  81.863 162.517  1.00  0.90           N  
ATOM   3759  N   LYS A 482      26.545  84.182 160.818  1.00  0.92           N  
ATOM   3760  CA  LYS A 482      25.853  84.954 159.804  1.00  0.92           C  
ATOM   3761  C   LYS A 482      24.921  83.995 159.096  1.00  0.92           C  
ATOM   3762  O   LYS A 482      25.279  83.403 158.080  1.00  0.92           O  
ATOM   3763  CB  LYS A 482      26.809  85.552 158.734  1.00  0.92           C  
ATOM   3764  CG  LYS A 482      27.801  86.591 159.269  1.00  0.92           C  
ATOM   3765  CD  LYS A 482      27.096  87.911 159.596  1.00  0.92           C  
ATOM   3766  CE  LYS A 482      27.876  88.815 160.545  1.00  0.92           C  
ATOM   3767  NZ  LYS A 482      27.744  88.345 161.933  1.00  0.92           N  
ATOM   3768  N   THR A 483      23.708  83.763 159.638  1.00  0.95           N  
ATOM   3769  CA  THR A 483      22.785  82.782 159.068  1.00  0.95           C  
ATOM   3770  C   THR A 483      22.339  83.133 157.660  1.00  0.95           C  
ATOM   3771  O   THR A 483      21.889  84.250 157.393  1.00  0.95           O  
ATOM   3772  CB  THR A 483      21.586  82.465 159.959  1.00  0.95           C  
ATOM   3773  OG1 THR A 483      22.072  81.893 161.165  1.00  0.95           O  
ATOM   3774  CG2 THR A 483      20.632  81.438 159.320  1.00  0.95           C  
ATOM   3775  N   ASN A 484      22.487  82.176 156.717  1.00  0.95           N  
ATOM   3776  CA  ASN A 484      22.115  82.272 155.311  1.00  0.95           C  
ATOM   3777  C   ASN A 484      20.767  82.907 154.979  1.00  0.95           C  
ATOM   3778  O   ASN A 484      19.858  83.043 155.800  1.00  0.95           O  
ATOM   3779  CB  ASN A 484      22.180  80.889 154.602  1.00  0.95           C  
ATOM   3780  CG  ASN A 484      23.619  80.466 154.347  1.00  0.95           C  
ATOM   3781  OD1 ASN A 484      24.572  81.221 154.531  1.00  0.95           O  
ATOM   3782  ND2 ASN A 484      23.786  79.217 153.855  1.00  0.95           N  
ATOM   3783  N   GLY A 485      20.626  83.310 153.706  1.00  0.98           N  
ATOM   3784  CA  GLY A 485      19.378  83.810 153.182  1.00  0.98           C  
ATOM   3785  C   GLY A 485      19.355  83.633 151.696  1.00  0.98           C  
ATOM   3786  O   GLY A 485      20.332  83.201 151.085  1.00  0.98           O  
ATOM   3787  N   ILE A 486      18.229  83.998 151.076  1.00  0.96           N  
ATOM   3788  CA  ILE A 486      17.995  83.906 149.650  1.00  0.96           C  
ATOM   3789  C   ILE A 486      17.435  85.224 149.152  1.00  0.96           C  
ATOM   3790  O   ILE A 486      16.806  85.971 149.893  1.00  0.96           O  
ATOM   3791  CB  ILE A 486      16.997  82.799 149.321  1.00  0.96           C  
ATOM   3792  CG1 ILE A 486      15.756  82.875 150.246  1.00  0.96           C  
ATOM   3793  CG2 ILE A 486      17.728  81.446 149.456  1.00  0.96           C  
ATOM   3794  CD1 ILE A 486      14.599  81.994 149.787  1.00  0.96           C  
ATOM   3795  N   THR A 487      17.642  85.573 147.867  1.00  0.96           N  
ATOM   3796  CA  THR A 487      17.043  86.789 147.315  1.00  0.96           C  
ATOM   3797  C   THR A 487      15.551  86.592 147.013  1.00  0.96           C  
ATOM   3798  O   THR A 487      15.203  85.655 146.288  1.00  0.96           O  
ATOM   3799  CB  THR A 487      17.770  87.375 146.096  1.00  0.96           C  
ATOM   3800  OG1 THR A 487      17.009  88.393 145.454  1.00  0.96           O  
ATOM   3801  CG2 THR A 487      18.069  86.310 145.032  1.00  0.96           C  
ATOM   3802  N   PRO A 488      14.620  87.426 147.490  1.00  0.97           N  
ATOM   3803  CA  PRO A 488      13.213  87.318 147.131  1.00  0.97           C  
ATOM   3804  C   PRO A 488      12.953  87.842 145.730  1.00  0.97           C  
ATOM   3805  O   PRO A 488      11.850  87.657 145.222  1.00  0.97           O  
ATOM   3806  CB  PRO A 488      12.503  88.170 148.198  1.00  0.97           C  
ATOM   3807  CG  PRO A 488      13.532  89.237 148.576  1.00  0.97           C  
ATOM   3808  CD  PRO A 488      14.851  88.470 148.495  1.00  0.97           C  
ATOM   3809  N   ARG A 489      13.918  88.500 145.055  1.00  0.91           N  
ATOM   3810  CA  ARG A 489      13.735  88.888 143.666  1.00  0.91           C  
ATOM   3811  C   ARG A 489      13.711  87.670 142.758  1.00  0.91           C  
ATOM   3812  O   ARG A 489      12.794  87.481 141.964  1.00  0.91           O  
ATOM   3813  CB  ARG A 489      14.831  89.872 143.190  1.00  0.91           C  
ATOM   3814  CG  ARG A 489      14.594  91.341 143.602  1.00  0.91           C  
ATOM   3815  CD  ARG A 489      14.635  91.686 145.098  1.00  0.91           C  
ATOM   3816  NE  ARG A 489      16.030  91.488 145.575  1.00  0.91           N  
ATOM   3817  CZ  ARG A 489      16.427  91.634 146.843  1.00  0.91           C  
ATOM   3818  NH1 ARG A 489      15.645  92.059 147.825  1.00  0.91           N  
ATOM   3819  NH2 ARG A 489      17.678  91.308 147.139  1.00  0.91           N  
ATOM   3820  N   ARG A 490      14.688  86.756 142.910  1.00  0.92           N  
ATOM   3821  CA  ARG A 490      14.659  85.501 142.184  1.00  0.92           C  
ATOM   3822  C   ARG A 490      13.727  84.474 142.811  1.00  0.92           C  
ATOM   3823  O   ARG A 490      12.940  83.821 142.131  1.00  0.92           O  
ATOM   3824  CB  ARG A 490      16.077  84.910 142.028  1.00  0.92           C  
ATOM   3825  CG  ARG A 490      16.112  83.677 141.102  1.00  0.92           C  
ATOM   3826  CD  ARG A 490      17.513  83.186 140.743  1.00  0.92           C  
ATOM   3827  NE  ARG A 490      18.168  84.252 139.912  1.00  0.92           N  
ATOM   3828  CZ  ARG A 490      18.536  84.093 138.634  1.00  0.92           C  
ATOM   3829  NH1 ARG A 490      18.246  83.030 137.904  1.00  0.92           N  
ATOM   3830  NH2 ARG A 490      19.177  85.095 138.040  1.00  0.92           N  
ATOM   3831  N   TRP A 491      13.765  84.318 144.148  1.00  0.93           N  
ATOM   3832  CA  TRP A 491      13.127  83.190 144.806  1.00  0.93           C  
ATOM   3833  C   TRP A 491      11.761  83.525 145.375  1.00  0.93           C  
ATOM   3834  O   TRP A 491      11.197  82.765 146.158  1.00  0.93           O  
ATOM   3835  CB  TRP A 491      14.062  82.568 145.874  1.00  0.93           C  
ATOM   3836  CG  TRP A 491      15.393  82.122 145.283  1.00  0.93           C  
ATOM   3837  CD1 TRP A 491      16.629  82.687 145.433  1.00  0.93           C  
ATOM   3838  CD2 TRP A 491      15.543  81.072 144.311  1.00  0.93           C  
ATOM   3839  NE1 TRP A 491      17.551  82.051 144.624  1.00  0.93           N  
ATOM   3840  CE2 TRP A 491      16.897  81.073 143.909  1.00  0.93           C  
ATOM   3841  CE3 TRP A 491      14.627  80.181 143.752  1.00  0.93           C  
ATOM   3842  CZ2 TRP A 491      17.351  80.193 142.936  1.00  0.93           C  
ATOM   3843  CZ3 TRP A 491      15.089  79.294 142.770  1.00  0.93           C  
ATOM   3844  CH2 TRP A 491      16.430  79.304 142.360  1.00  0.93           C  
ATOM   3845  N   LEU A 492      11.172  84.647 144.927  1.00  0.95           N  
ATOM   3846  CA  LEU A 492       9.749  84.889 145.052  1.00  0.95           C  
ATOM   3847  C   LEU A 492       9.238  85.562 143.788  1.00  0.95           C  
ATOM   3848  O   LEU A 492       8.421  84.985 143.079  1.00  0.95           O  
ATOM   3849  CB  LEU A 492       9.391  85.701 146.324  1.00  0.95           C  
ATOM   3850  CG  LEU A 492       7.898  86.072 146.486  1.00  0.95           C  
ATOM   3851  CD1 LEU A 492       6.974  84.846 146.487  1.00  0.95           C  
ATOM   3852  CD2 LEU A 492       7.685  86.883 147.770  1.00  0.95           C  
ATOM   3853  N   LEU A 493       9.696  86.789 143.441  1.00  0.92           N  
ATOM   3854  CA  LEU A 493       9.111  87.536 142.326  1.00  0.92           C  
ATOM   3855  C   LEU A 493       9.237  86.880 140.952  1.00  0.92           C  
ATOM   3856  O   LEU A 493       8.274  86.826 140.191  1.00  0.92           O  
ATOM   3857  CB  LEU A 493       9.696  88.967 142.176  1.00  0.92           C  
ATOM   3858  CG  LEU A 493       9.675  89.881 143.417  1.00  0.92           C  
ATOM   3859  CD1 LEU A 493      10.013  91.311 142.973  1.00  0.92           C  
ATOM   3860  CD2 LEU A 493       8.332  89.888 144.155  1.00  0.92           C  
ATOM   3861  N   LEU A 494      10.438  86.377 140.605  1.00  0.92           N  
ATOM   3862  CA  LEU A 494      10.705  85.725 139.334  1.00  0.92           C  
ATOM   3863  C   LEU A 494      10.033  84.376 139.185  1.00  0.92           C  
ATOM   3864  O   LEU A 494       9.308  84.121 138.226  1.00  0.92           O  
ATOM   3865  CB  LEU A 494      12.246  85.595 139.213  1.00  0.92           C  
ATOM   3866  CG  LEU A 494      12.840  85.137 137.867  1.00  0.92           C  
ATOM   3867  CD1 LEU A 494      14.298  85.606 137.764  1.00  0.92           C  
ATOM   3868  CD2 LEU A 494      12.801  83.617 137.657  1.00  0.92           C  
ATOM   3869  N   CYS A 495      10.231  83.478 140.168  1.00  0.95           N  
ATOM   3870  CA  CYS A 495       9.685  82.138 140.122  1.00  0.95           C  
ATOM   3871  C   CYS A 495       8.174  82.073 140.296  1.00  0.95           C  
ATOM   3872  O   CYS A 495       7.487  81.266 139.675  1.00  0.95           O  
ATOM   3873  CB  CYS A 495      10.411  81.214 141.137  1.00  0.95           C  
ATOM   3874  SG  CYS A 495      10.242  81.692 142.890  1.00  0.95           S  
ATOM   3875  N   ASN A 496       7.613  82.934 141.162  1.00  0.93           N  
ATOM   3876  CA  ASN A 496       6.249  82.814 141.622  1.00  0.93           C  
ATOM   3877  C   ASN A 496       5.540  84.164 141.579  1.00  0.93           C  
ATOM   3878  O   ASN A 496       5.179  84.709 142.630  1.00  0.93           O  
ATOM   3879  CB  ASN A 496       6.317  82.256 143.060  1.00  0.93           C  
ATOM   3880  CG  ASN A 496       5.005  81.659 143.538  1.00  0.93           C  
ATOM   3881  OD1 ASN A 496       3.917  81.863 142.996  1.00  0.93           O  
ATOM   3882  ND2 ASN A 496       5.114  80.869 144.631  1.00  0.93           N  
ATOM   3883  N   PRO A 497       5.303  84.756 140.401  1.00  0.92           N  
ATOM   3884  CA  PRO A 497       4.742  86.095 140.284  1.00  0.92           C  
ATOM   3885  C   PRO A 497       3.352  86.186 140.873  1.00  0.92           C  
ATOM   3886  O   PRO A 497       3.016  87.231 141.416  1.00  0.92           O  
ATOM   3887  CB  PRO A 497       4.773  86.394 138.775  1.00  0.92           C  
ATOM   3888  CG  PRO A 497       4.765  85.014 138.110  1.00  0.92           C  
ATOM   3889  CD  PRO A 497       5.591  84.175 139.084  1.00  0.92           C  
ATOM   3890  N   GLY A 498       2.543  85.106 140.820  1.00  0.90           N  
ATOM   3891  CA  GLY A 498       1.198  85.105 141.385  1.00  0.90           C  
ATOM   3892  C   GLY A 498       1.167  85.162 142.891  1.00  0.90           C  
ATOM   3893  O   GLY A 498       0.333  85.845 143.472  1.00  0.90           O  
ATOM   3894  N   LEU A 499       2.098  84.482 143.598  1.00  0.91           N  
ATOM   3895  CA  LEU A 499       2.217  84.636 145.043  1.00  0.91           C  
ATOM   3896  C   LEU A 499       2.706  86.018 145.425  1.00  0.91           C  
ATOM   3897  O   LEU A 499       2.190  86.646 146.346  1.00  0.91           O  
ATOM   3898  CB  LEU A 499       3.140  83.564 145.672  1.00  0.91           C  
ATOM   3899  CG  LEU A 499       3.215  83.563 147.217  1.00  0.91           C  
ATOM   3900  CD1 LEU A 499       1.840  83.377 147.874  1.00  0.91           C  
ATOM   3901  CD2 LEU A 499       4.180  82.475 147.711  1.00  0.91           C  
ATOM   3902  N   ALA A 500       3.691  86.552 144.679  1.00  0.92           N  
ATOM   3903  CA  ALA A 500       4.179  87.899 144.869  1.00  0.92           C  
ATOM   3904  C   ALA A 500       3.106  88.970 144.679  1.00  0.92           C  
ATOM   3905  O   ALA A 500       2.938  89.852 145.515  1.00  0.92           O  
ATOM   3906  CB  ALA A 500       5.323  88.136 143.868  1.00  0.92           C  
ATOM   3907  N   GLU A 501       2.305  88.865 143.604  1.00  0.83           N  
ATOM   3908  CA  GLU A 501       1.186  89.738 143.304  1.00  0.83           C  
ATOM   3909  C   GLU A 501       0.110  89.715 144.384  1.00  0.83           C  
ATOM   3910  O   GLU A 501      -0.308  90.756 144.886  1.00  0.83           O  
ATOM   3911  CB  GLU A 501       0.642  89.296 141.927  1.00  0.83           C  
ATOM   3912  CG  GLU A 501      -0.423  90.200 141.270  1.00  0.83           C  
ATOM   3913  CD  GLU A 501      -0.547  89.850 139.787  1.00  0.83           C  
ATOM   3914  OE1 GLU A 501      -0.304  90.758 138.948  1.00  0.83           O  
ATOM   3915  OE2 GLU A 501      -0.844  88.666 139.480  1.00  0.83           O  
ATOM   3916  N   LEU A 502      -0.270  88.508 144.854  1.00  0.87           N  
ATOM   3917  CA  LEU A 502      -1.208  88.292 145.946  1.00  0.87           C  
ATOM   3918  C   LEU A 502      -0.730  88.884 147.284  1.00  0.87           C  
ATOM   3919  O   LEU A 502      -1.470  89.544 148.015  1.00  0.87           O  
ATOM   3920  CB  LEU A 502      -1.425  86.755 146.057  1.00  0.87           C  
ATOM   3921  CG  LEU A 502      -2.732  86.218 146.686  1.00  0.87           C  
ATOM   3922  CD1 LEU A 502      -2.435  85.141 147.742  1.00  0.87           C  
ATOM   3923  CD2 LEU A 502      -3.690  87.284 147.230  1.00  0.87           C  
ATOM   3924  N   ILE A 503       0.564  88.710 147.637  1.00  0.87           N  
ATOM   3925  CA  ILE A 503       1.169  89.369 148.794  1.00  0.87           C  
ATOM   3926  C   ILE A 503       1.174  90.890 148.641  1.00  0.87           C  
ATOM   3927  O   ILE A 503       0.789  91.620 149.555  1.00  0.87           O  
ATOM   3928  CB  ILE A 503       2.581  88.835 149.072  1.00  0.87           C  
ATOM   3929  CG1 ILE A 503       2.509  87.350 149.507  1.00  0.87           C  
ATOM   3930  CG2 ILE A 503       3.300  89.667 150.159  1.00  0.87           C  
ATOM   3931  CD1 ILE A 503       3.880  86.665 149.583  1.00  0.87           C  
ATOM   3932  N   ALA A 504       1.547  91.409 147.453  1.00  0.88           N  
ATOM   3933  CA  ALA A 504       1.587  92.827 147.158  1.00  0.88           C  
ATOM   3934  C   ALA A 504       0.242  93.534 147.300  1.00  0.88           C  
ATOM   3935  O   ALA A 504       0.171  94.622 147.873  1.00  0.88           O  
ATOM   3936  CB  ALA A 504       2.172  93.052 145.750  1.00  0.88           C  
ATOM   3937  N   GLU A 505      -0.868  92.906 146.849  1.00  0.82           N  
ATOM   3938  CA  GLU A 505      -2.216  93.409 147.068  1.00  0.82           C  
ATOM   3939  C   GLU A 505      -2.583  93.571 148.537  1.00  0.82           C  
ATOM   3940  O   GLU A 505      -3.161  94.574 148.949  1.00  0.82           O  
ATOM   3941  CB  GLU A 505      -3.288  92.432 146.524  1.00  0.82           C  
ATOM   3942  CG  GLU A 505      -3.390  92.296 144.992  1.00  0.82           C  
ATOM   3943  CD  GLU A 505      -4.610  91.438 144.670  1.00  0.82           C  
ATOM   3944  OE1 GLU A 505      -5.517  91.948 143.965  1.00  0.82           O  
ATOM   3945  OE2 GLU A 505      -4.667  90.289 145.183  1.00  0.82           O  
ATOM   3946  N   LYS A 506      -2.268  92.564 149.376  1.00  0.84           N  
ATOM   3947  CA  LYS A 506      -2.796  92.533 150.725  1.00  0.84           C  
ATOM   3948  C   LYS A 506      -1.885  93.201 151.755  1.00  0.84           C  
ATOM   3949  O   LYS A 506      -2.339  93.507 152.858  1.00  0.84           O  
ATOM   3950  CB  LYS A 506      -3.122  91.075 151.159  1.00  0.84           C  
ATOM   3951  CG  LYS A 506      -4.077  90.288 150.225  1.00  0.84           C  
ATOM   3952  CD  LYS A 506      -5.468  90.920 150.003  1.00  0.84           C  
ATOM   3953  CE  LYS A 506      -6.389  90.111 149.064  1.00  0.84           C  
ATOM   3954  NZ  LYS A 506      -6.999  88.956 149.755  1.00  0.84           N  
ATOM   3955  N   ILE A 507      -0.593  93.497 151.445  1.00  0.87           N  
ATOM   3956  CA  ILE A 507       0.275  94.179 152.413  1.00  0.87           C  
ATOM   3957  C   ILE A 507       1.168  95.302 151.883  1.00  0.87           C  
ATOM   3958  O   ILE A 507       1.834  95.934 152.709  1.00  0.87           O  
ATOM   3959  CB  ILE A 507       1.189  93.229 153.210  1.00  0.87           C  
ATOM   3960  CG1 ILE A 507       2.173  92.434 152.328  1.00  0.87           C  
ATOM   3961  CG2 ILE A 507       0.329  92.299 154.090  1.00  0.87           C  
ATOM   3962  CD1 ILE A 507       3.358  91.871 153.122  1.00  0.87           C  
ATOM   3963  N   GLY A 508       1.182  95.619 150.565  1.00  0.87           N  
ATOM   3964  CA  GLY A 508       2.130  96.569 149.952  1.00  0.87           C  
ATOM   3965  C   GLY A 508       3.312  95.859 149.326  1.00  0.87           C  
ATOM   3966  O   GLY A 508       3.461  94.655 149.502  1.00  0.87           O  
ATOM   3967  N   GLU A 509       4.197  96.559 148.568  1.00  0.83           N  
ATOM   3968  CA  GLU A 509       5.327  95.907 147.890  1.00  0.83           C  
ATOM   3969  C   GLU A 509       6.632  96.024 148.663  1.00  0.83           C  
ATOM   3970  O   GLU A 509       7.671  95.482 148.284  1.00  0.83           O  
ATOM   3971  CB  GLU A 509       5.571  96.356 146.418  1.00  0.83           C  
ATOM   3972  CG  GLU A 509       6.242  97.740 146.190  1.00  0.83           C  
ATOM   3973  CD  GLU A 509       6.953  97.824 144.829  1.00  0.83           C  
ATOM   3974  OE1 GLU A 509       7.975  97.105 144.623  1.00  0.83           O  
ATOM   3975  OE2 GLU A 509       6.488  98.637 143.992  1.00  0.83           O  
ATOM   3976  N   ASP A 510       6.594  96.676 149.838  1.00  0.82           N  
ATOM   3977  CA  ASP A 510       7.704  96.998 150.716  1.00  0.82           C  
ATOM   3978  C   ASP A 510       8.522  95.774 151.124  1.00  0.82           C  
ATOM   3979  O   ASP A 510       9.738  95.827 151.327  1.00  0.82           O  
ATOM   3980  CB  ASP A 510       7.152  97.711 151.980  1.00  0.82           C  
ATOM   3981  CG  ASP A 510       6.129  98.776 151.604  1.00  0.82           C  
ATOM   3982  OD1 ASP A 510       4.999  98.378 151.202  1.00  0.82           O  
ATOM   3983  OD2 ASP A 510       6.466  99.977 151.707  1.00  0.82           O  
ATOM   3984  N   TYR A 511       7.845  94.604 151.170  1.00  0.88           N  
ATOM   3985  CA  TYR A 511       8.407  93.302 151.464  1.00  0.88           C  
ATOM   3986  C   TYR A 511       9.587  92.890 150.574  1.00  0.88           C  
ATOM   3987  O   TYR A 511      10.435  92.092 150.963  1.00  0.88           O  
ATOM   3988  CB  TYR A 511       7.320  92.188 151.558  1.00  0.88           C  
ATOM   3989  CG  TYR A 511       6.803  91.766 150.210  1.00  0.88           C  
ATOM   3990  CD1 TYR A 511       5.741  92.450 149.608  1.00  0.88           C  
ATOM   3991  CD2 TYR A 511       7.431  90.724 149.505  1.00  0.88           C  
ATOM   3992  CE1 TYR A 511       5.341  92.136 148.301  1.00  0.88           C  
ATOM   3993  CE2 TYR A 511       7.041  90.418 148.196  1.00  0.88           C  
ATOM   3994  CZ  TYR A 511       6.006  91.135 147.592  1.00  0.88           C  
ATOM   3995  OH  TYR A 511       5.667  90.877 146.254  1.00  0.88           O  
ATOM   3996  N   VAL A 512       9.680  93.426 149.341  1.00  0.88           N  
ATOM   3997  CA  VAL A 512      10.757  93.102 148.420  1.00  0.88           C  
ATOM   3998  C   VAL A 512      12.100  93.721 148.826  1.00  0.88           C  
ATOM   3999  O   VAL A 512      13.161  93.221 148.447  1.00  0.88           O  
ATOM   4000  CB  VAL A 512      10.392  93.504 146.993  1.00  0.88           C  
ATOM   4001  CG1 VAL A 512      11.436  92.973 145.993  1.00  0.88           C  
ATOM   4002  CG2 VAL A 512       9.020  92.909 146.624  1.00  0.88           C  
ATOM   4003  N   LYS A 513      12.100  94.806 149.637  1.00  0.83           N  
ATOM   4004  CA  LYS A 513      13.329  95.398 150.162  1.00  0.83           C  
ATOM   4005  C   LYS A 513      13.496  95.192 151.669  1.00  0.83           C  
ATOM   4006  O   LYS A 513      14.614  95.258 152.189  1.00  0.83           O  
ATOM   4007  CB  LYS A 513      13.404  96.916 149.834  1.00  0.83           C  
ATOM   4008  CG  LYS A 513      13.642  97.212 148.339  1.00  0.83           C  
ATOM   4009  CD  LYS A 513      13.883  98.711 148.041  1.00  0.83           C  
ATOM   4010  CE  LYS A 513      14.344  98.981 146.597  1.00  0.83           C  
ATOM   4011  NZ  LYS A 513      14.609 100.419 146.332  1.00  0.83           N  
ATOM   4012  N   ASP A 514      12.409  94.888 152.404  1.00  0.84           N  
ATOM   4013  CA  ASP A 514      12.485  94.378 153.759  1.00  0.84           C  
ATOM   4014  C   ASP A 514      11.527  93.201 153.871  1.00  0.84           C  
ATOM   4015  O   ASP A 514      10.320  93.362 154.012  1.00  0.84           O  
ATOM   4016  CB  ASP A 514      12.112  95.478 154.789  1.00  0.84           C  
ATOM   4017  CG  ASP A 514      12.068  94.963 156.220  1.00  0.84           C  
ATOM   4018  OD1 ASP A 514      11.474  95.667 157.067  1.00  0.84           O  
ATOM   4019  OD2 ASP A 514      12.556  93.831 156.487  1.00  0.84           O  
ATOM   4020  N   LEU A 515      12.044  91.962 153.898  1.00  0.91           N  
ATOM   4021  CA  LEU A 515      11.197  90.785 153.917  1.00  0.91           C  
ATOM   4022  C   LEU A 515      10.566  90.535 155.287  1.00  0.91           C  
ATOM   4023  O   LEU A 515       9.645  89.732 155.430  1.00  0.91           O  
ATOM   4024  CB  LEU A 515      11.973  89.558 153.373  1.00  0.91           C  
ATOM   4025  CG  LEU A 515      11.105  88.413 152.797  1.00  0.91           C  
ATOM   4026  CD1 LEU A 515      10.401  88.826 151.496  1.00  0.91           C  
ATOM   4027  CD2 LEU A 515      11.927  87.136 152.557  1.00  0.91           C  
ATOM   4028  N   SER A 516      10.982  91.266 156.350  1.00  0.90           N  
ATOM   4029  CA  SER A 516      10.362  91.157 157.670  1.00  0.90           C  
ATOM   4030  C   SER A 516       8.904  91.614 157.686  1.00  0.90           C  
ATOM   4031  O   SER A 516       8.087  91.150 158.485  1.00  0.90           O  
ATOM   4032  CB  SER A 516      11.169  91.887 158.777  1.00  0.90           C  
ATOM   4033  OG  SER A 516      11.020  93.305 158.742  1.00  0.90           O  
ATOM   4034  N   GLN A 517       8.526  92.474 156.715  1.00  0.84           N  
ATOM   4035  CA  GLN A 517       7.177  92.950 156.476  1.00  0.84           C  
ATOM   4036  C   GLN A 517       6.172  91.866 156.081  1.00  0.84           C  
ATOM   4037  O   GLN A 517       4.964  92.099 156.075  1.00  0.84           O  
ATOM   4038  CB  GLN A 517       7.183  94.053 155.387  1.00  0.84           C  
ATOM   4039  CG  GLN A 517       8.121  95.247 155.696  1.00  0.84           C  
ATOM   4040  CD  GLN A 517       7.794  95.899 157.040  1.00  0.84           C  
ATOM   4041  OE1 GLN A 517       6.631  96.179 157.346  1.00  0.84           O  
ATOM   4042  NE2 GLN A 517       8.832  96.141 157.871  1.00  0.84           N  
ATOM   4043  N   LEU A 518       6.619  90.618 155.808  1.00  0.89           N  
ATOM   4044  CA  LEU A 518       5.728  89.478 155.632  1.00  0.89           C  
ATOM   4045  C   LEU A 518       5.001  89.087 156.917  1.00  0.89           C  
ATOM   4046  O   LEU A 518       3.968  88.427 156.879  1.00  0.89           O  
ATOM   4047  CB  LEU A 518       6.466  88.230 155.090  1.00  0.89           C  
ATOM   4048  CG  LEU A 518       7.045  88.367 153.666  1.00  0.89           C  
ATOM   4049  CD1 LEU A 518       7.690  87.039 153.254  1.00  0.89           C  
ATOM   4050  CD2 LEU A 518       5.992  88.761 152.622  1.00  0.89           C  
ATOM   4051  N   THR A 519       5.454  89.571 158.091  1.00  0.87           N  
ATOM   4052  CA  THR A 519       4.750  89.415 159.369  1.00  0.87           C  
ATOM   4053  C   THR A 519       3.408  90.141 159.409  1.00  0.87           C  
ATOM   4054  O   THR A 519       2.523  89.837 160.204  1.00  0.87           O  
ATOM   4055  CB  THR A 519       5.572  89.873 160.567  1.00  0.87           C  
ATOM   4056  OG1 THR A 519       6.061  91.200 160.406  1.00  0.87           O  
ATOM   4057  CG2 THR A 519       6.783  88.946 160.752  1.00  0.87           C  
ATOM   4058  N   LYS A 520       3.166  91.077 158.464  1.00  0.81           N  
ATOM   4059  CA  LYS A 520       1.869  91.700 158.260  1.00  0.81           C  
ATOM   4060  C   LYS A 520       0.843  90.724 157.674  1.00  0.81           C  
ATOM   4061  O   LYS A 520      -0.356  90.994 157.676  1.00  0.81           O  
ATOM   4062  CB  LYS A 520       1.999  92.947 157.333  1.00  0.81           C  
ATOM   4063  CG  LYS A 520       2.879  94.057 157.938  1.00  0.81           C  
ATOM   4064  CD  LYS A 520       3.349  95.165 156.966  1.00  0.81           C  
ATOM   4065  CE  LYS A 520       2.336  96.266 156.617  1.00  0.81           C  
ATOM   4066  NZ  LYS A 520       1.489  95.890 155.467  1.00  0.81           N  
ATOM   4067  N   LEU A 521       1.282  89.547 157.172  1.00  0.85           N  
ATOM   4068  CA  LEU A 521       0.397  88.505 156.688  1.00  0.85           C  
ATOM   4069  C   LEU A 521      -0.247  87.677 157.798  1.00  0.85           C  
ATOM   4070  O   LEU A 521      -1.274  87.039 157.572  1.00  0.85           O  
ATOM   4071  CB  LEU A 521       1.122  87.547 155.713  1.00  0.85           C  
ATOM   4072  CG  LEU A 521       1.637  88.205 154.416  1.00  0.85           C  
ATOM   4073  CD1 LEU A 521       2.507  87.212 153.633  1.00  0.85           C  
ATOM   4074  CD2 LEU A 521       0.488  88.708 153.530  1.00  0.85           C  
ATOM   4075  N   HIS A 522       0.283  87.709 159.048  1.00  0.83           N  
ATOM   4076  CA  HIS A 522      -0.303  87.013 160.195  1.00  0.83           C  
ATOM   4077  C   HIS A 522      -1.722  87.467 160.522  1.00  0.83           C  
ATOM   4078  O   HIS A 522      -2.539  86.693 161.014  1.00  0.83           O  
ATOM   4079  CB  HIS A 522       0.556  87.133 161.480  1.00  0.83           C  
ATOM   4080  CG  HIS A 522       1.766  86.244 161.491  1.00  0.83           C  
ATOM   4081  ND1 HIS A 522       2.982  86.725 161.054  1.00  0.83           N  
ATOM   4082  CD2 HIS A 522       1.898  84.960 161.920  1.00  0.83           C  
ATOM   4083  CE1 HIS A 522       3.831  85.732 161.225  1.00  0.83           C  
ATOM   4084  NE2 HIS A 522       3.227  84.637 161.746  1.00  0.83           N  
ATOM   4085  N   SER A 523      -2.075  88.726 160.205  1.00  0.81           N  
ATOM   4086  CA  SER A 523      -3.423  89.270 160.330  1.00  0.81           C  
ATOM   4087  C   SER A 523      -4.480  88.508 159.547  1.00  0.81           C  
ATOM   4088  O   SER A 523      -5.638  88.429 159.949  1.00  0.81           O  
ATOM   4089  CB  SER A 523      -3.490  90.737 159.842  1.00  0.81           C  
ATOM   4090  OG  SER A 523      -2.577  91.540 160.589  1.00  0.81           O  
ATOM   4091  N   PHE A 524      -4.107  87.908 158.400  1.00  0.83           N  
ATOM   4092  CA  PHE A 524      -5.047  87.285 157.487  1.00  0.83           C  
ATOM   4093  C   PHE A 524      -5.229  85.792 157.745  1.00  0.83           C  
ATOM   4094  O   PHE A 524      -5.818  85.085 156.935  1.00  0.83           O  
ATOM   4095  CB  PHE A 524      -4.608  87.481 156.016  1.00  0.83           C  
ATOM   4096  CG  PHE A 524      -4.576  88.934 155.641  1.00  0.83           C  
ATOM   4097  CD1 PHE A 524      -3.357  89.626 155.592  1.00  0.83           C  
ATOM   4098  CD2 PHE A 524      -5.758  89.614 155.306  1.00  0.83           C  
ATOM   4099  CE1 PHE A 524      -3.313  90.977 155.227  1.00  0.83           C  
ATOM   4100  CE2 PHE A 524      -5.721  90.967 154.941  1.00  0.83           C  
ATOM   4101  CZ  PHE A 524      -4.498  91.649 154.904  1.00  0.83           C  
ATOM   4102  N   LEU A 525      -4.788  85.259 158.907  1.00  0.78           N  
ATOM   4103  CA  LEU A 525      -5.038  83.874 159.307  1.00  0.78           C  
ATOM   4104  C   LEU A 525      -6.524  83.531 159.417  1.00  0.78           C  
ATOM   4105  O   LEU A 525      -6.949  82.411 159.145  1.00  0.78           O  
ATOM   4106  CB  LEU A 525      -4.345  83.549 160.656  1.00  0.78           C  
ATOM   4107  CG  LEU A 525      -2.806  83.456 160.580  1.00  0.78           C  
ATOM   4108  CD1 LEU A 525      -2.203  83.509 161.991  1.00  0.78           C  
ATOM   4109  CD2 LEU A 525      -2.329  82.182 159.867  1.00  0.78           C  
ATOM   4110  N   GLY A 526      -7.359  84.514 159.814  1.00  0.77           N  
ATOM   4111  CA  GLY A 526      -8.811  84.364 159.839  1.00  0.77           C  
ATOM   4112  C   GLY A 526      -9.513  84.560 158.512  1.00  0.77           C  
ATOM   4113  O   GLY A 526     -10.727  84.403 158.436  1.00  0.77           O  
ATOM   4114  N   ASP A 527      -8.792  84.923 157.433  1.00  0.83           N  
ATOM   4115  CA  ASP A 527      -9.384  85.214 156.142  1.00  0.83           C  
ATOM   4116  C   ASP A 527      -9.399  83.957 155.273  1.00  0.83           C  
ATOM   4117  O   ASP A 527      -8.441  83.605 154.585  1.00  0.83           O  
ATOM   4118  CB  ASP A 527      -8.624  86.405 155.487  1.00  0.83           C  
ATOM   4119  CG  ASP A 527      -9.217  86.892 154.171  1.00  0.83           C  
ATOM   4120  OD1 ASP A 527      -8.703  87.915 153.649  1.00  0.83           O  
ATOM   4121  OD2 ASP A 527     -10.144  86.227 153.641  1.00  0.83           O  
ATOM   4122  N   ASP A 528     -10.548  83.254 155.259  1.00  0.79           N  
ATOM   4123  CA  ASP A 528     -10.806  82.124 154.393  1.00  0.79           C  
ATOM   4124  C   ASP A 528     -10.802  82.470 152.907  1.00  0.79           C  
ATOM   4125  O   ASP A 528     -10.482  81.621 152.076  1.00  0.79           O  
ATOM   4126  CB  ASP A 528     -12.156  81.468 154.775  1.00  0.79           C  
ATOM   4127  CG  ASP A 528     -11.914  80.541 155.932  1.00  0.79           C  
ATOM   4128  OD1 ASP A 528     -12.287  80.842 157.092  1.00  0.79           O  
ATOM   4129  OD2 ASP A 528     -11.274  79.480 155.690  1.00  0.79           O  
ATOM   4130  N   VAL A 529     -11.138  83.718 152.510  1.00  0.83           N  
ATOM   4131  CA  VAL A 529     -11.025  84.146 151.120  1.00  0.83           C  
ATOM   4132  C   VAL A 529      -9.565  84.196 150.701  1.00  0.83           C  
ATOM   4133  O   VAL A 529      -9.195  83.603 149.690  1.00  0.83           O  
ATOM   4134  CB  VAL A 529     -11.739  85.468 150.840  1.00  0.83           C  
ATOM   4135  CG1 VAL A 529     -11.606  85.861 149.353  1.00  0.83           C  
ATOM   4136  CG2 VAL A 529     -13.227  85.313 151.216  1.00  0.83           C  
ATOM   4137  N   PHE A 530      -8.685  84.788 151.535  1.00  0.81           N  
ATOM   4138  CA  PHE A 530      -7.240  84.784 151.338  1.00  0.81           C  
ATOM   4139  C   PHE A 530      -6.627  83.386 151.332  1.00  0.81           C  
ATOM   4140  O   PHE A 530      -5.786  83.069 150.494  1.00  0.81           O  
ATOM   4141  CB  PHE A 530      -6.560  85.673 152.410  1.00  0.81           C  
ATOM   4142  CG  PHE A 530      -5.075  85.862 152.229  1.00  0.81           C  
ATOM   4143  CD1 PHE A 530      -4.533  86.406 151.053  1.00  0.81           C  
ATOM   4144  CD2 PHE A 530      -4.208  85.536 153.279  1.00  0.81           C  
ATOM   4145  CE1 PHE A 530      -3.157  86.638 150.936  1.00  0.81           C  
ATOM   4146  CE2 PHE A 530      -2.836  85.786 153.174  1.00  0.81           C  
ATOM   4147  CZ  PHE A 530      -2.305  86.326 151.998  1.00  0.81           C  
ATOM   4148  N   LEU A 531      -7.057  82.475 152.229  1.00  0.86           N  
ATOM   4149  CA  LEU A 531      -6.634  81.080 152.190  1.00  0.86           C  
ATOM   4150  C   LEU A 531      -7.024  80.366 150.890  1.00  0.86           C  
ATOM   4151  O   LEU A 531      -6.244  79.603 150.322  1.00  0.86           O  
ATOM   4152  CB  LEU A 531      -7.174  80.283 153.405  1.00  0.86           C  
ATOM   4153  CG  LEU A 531      -6.666  80.772 154.781  1.00  0.86           C  
ATOM   4154  CD1 LEU A 531      -7.378  80.018 155.915  1.00  0.86           C  
ATOM   4155  CD2 LEU A 531      -5.144  80.652 154.947  1.00  0.86           C  
ATOM   4156  N   ARG A 532      -8.236  80.624 150.358  1.00  0.78           N  
ATOM   4157  CA  ARG A 532      -8.653  80.190 149.032  1.00  0.78           C  
ATOM   4158  C   ARG A 532      -7.856  80.805 147.876  1.00  0.78           C  
ATOM   4159  O   ARG A 532      -7.490  80.101 146.935  1.00  0.78           O  
ATOM   4160  CB  ARG A 532     -10.176  80.428 148.858  1.00  0.78           C  
ATOM   4161  CG  ARG A 532     -11.015  79.255 149.413  1.00  0.78           C  
ATOM   4162  CD  ARG A 532     -12.280  79.626 150.199  1.00  0.78           C  
ATOM   4163  NE  ARG A 532     -13.102  80.554 149.360  1.00  0.78           N  
ATOM   4164  CZ  ARG A 532     -14.253  81.100 149.776  1.00  0.78           C  
ATOM   4165  NH1 ARG A 532     -14.776  80.795 150.960  1.00  0.78           N  
ATOM   4166  NH2 ARG A 532     -14.895  81.962 148.992  1.00  0.78           N  
ATOM   4167  N   GLU A 533      -7.535  82.115 147.920  1.00  0.82           N  
ATOM   4168  CA  GLU A 533      -6.647  82.772 146.965  1.00  0.82           C  
ATOM   4169  C   GLU A 533      -5.237  82.172 146.975  1.00  0.82           C  
ATOM   4170  O   GLU A 533      -4.662  81.858 145.933  1.00  0.82           O  
ATOM   4171  CB  GLU A 533      -6.534  84.283 147.296  1.00  0.82           C  
ATOM   4172  CG  GLU A 533      -7.839  85.112 147.121  1.00  0.82           C  
ATOM   4173  CD  GLU A 533      -7.773  86.444 147.863  1.00  0.82           C  
ATOM   4174  OE1 GLU A 533      -8.748  87.232 147.851  1.00  0.82           O  
ATOM   4175  OE2 GLU A 533      -6.733  86.717 148.511  1.00  0.82           O  
ATOM   4176  N   LEU A 534      -4.675  81.935 148.178  1.00  0.88           N  
ATOM   4177  CA  LEU A 534      -3.383  81.310 148.409  1.00  0.88           C  
ATOM   4178  C   LEU A 534      -3.297  79.885 147.865  1.00  0.88           C  
ATOM   4179  O   LEU A 534      -2.347  79.509 147.173  1.00  0.88           O  
ATOM   4180  CB  LEU A 534      -3.128  81.305 149.940  1.00  0.88           C  
ATOM   4181  CG  LEU A 534      -1.692  80.987 150.396  1.00  0.88           C  
ATOM   4182  CD1 LEU A 534      -0.734  82.123 150.014  1.00  0.88           C  
ATOM   4183  CD2 LEU A 534      -1.667  80.763 151.916  1.00  0.88           C  
ATOM   4184  N   ALA A 535      -4.346  79.075 148.114  1.00  0.90           N  
ATOM   4185  CA  ALA A 535      -4.516  77.746 147.566  1.00  0.90           C  
ATOM   4186  C   ALA A 535      -4.617  77.719 146.043  1.00  0.90           C  
ATOM   4187  O   ALA A 535      -4.019  76.874 145.377  1.00  0.90           O  
ATOM   4188  CB  ALA A 535      -5.779  77.113 148.181  1.00  0.90           C  
ATOM   4189  N   LYS A 536      -5.354  78.678 145.442  1.00  0.85           N  
ATOM   4190  CA  LYS A 536      -5.458  78.824 144.000  1.00  0.85           C  
ATOM   4191  C   LYS A 536      -4.118  79.102 143.325  1.00  0.85           C  
ATOM   4192  O   LYS A 536      -3.779  78.463 142.330  1.00  0.85           O  
ATOM   4193  CB  LYS A 536      -6.484  79.930 143.638  1.00  0.85           C  
ATOM   4194  CG  LYS A 536      -6.650  80.134 142.123  1.00  0.85           C  
ATOM   4195  CD  LYS A 536      -7.765  81.124 141.738  1.00  0.85           C  
ATOM   4196  CE  LYS A 536      -7.653  81.634 140.292  1.00  0.85           C  
ATOM   4197  NZ  LYS A 536      -7.613  80.492 139.368  1.00  0.85           N  
ATOM   4198  N   VAL A 537      -3.292  80.004 143.900  1.00  0.90           N  
ATOM   4199  CA  VAL A 537      -1.939  80.290 143.427  1.00  0.90           C  
ATOM   4200  C   VAL A 537      -1.050  79.051 143.443  1.00  0.90           C  
ATOM   4201  O   VAL A 537      -0.342  78.752 142.480  1.00  0.90           O  
ATOM   4202  CB  VAL A 537      -1.297  81.398 144.264  1.00  0.90           C  
ATOM   4203  CG1 VAL A 537       0.209  81.555 143.968  1.00  0.90           C  
ATOM   4204  CG2 VAL A 537      -2.012  82.730 143.965  1.00  0.90           C  
ATOM   4205  N   LYS A 538      -1.101  78.248 144.528  1.00  0.90           N  
ATOM   4206  CA  LYS A 538      -0.391  76.982 144.593  1.00  0.90           C  
ATOM   4207  C   LYS A 538      -0.843  75.994 143.523  1.00  0.90           C  
ATOM   4208  O   LYS A 538      -0.025  75.409 142.814  1.00  0.90           O  
ATOM   4209  CB  LYS A 538      -0.572  76.349 145.998  1.00  0.90           C  
ATOM   4210  CG  LYS A 538       0.161  75.011 146.229  1.00  0.90           C  
ATOM   4211  CD  LYS A 538       1.693  75.059 146.060  1.00  0.90           C  
ATOM   4212  CE  LYS A 538       2.388  76.002 147.046  1.00  0.90           C  
ATOM   4213  NZ  LYS A 538       3.848  75.964 146.853  1.00  0.90           N  
ATOM   4214  N   GLN A 539      -2.165  75.835 143.334  1.00  0.86           N  
ATOM   4215  CA  GLN A 539      -2.733  74.946 142.341  1.00  0.86           C  
ATOM   4216  C   GLN A 539      -2.421  75.312 140.892  1.00  0.86           C  
ATOM   4217  O   GLN A 539      -2.126  74.444 140.071  1.00  0.86           O  
ATOM   4218  CB  GLN A 539      -4.260  74.826 142.552  1.00  0.86           C  
ATOM   4219  CG  GLN A 539      -4.927  73.687 141.743  1.00  0.86           C  
ATOM   4220  CD  GLN A 539      -4.310  72.325 142.081  1.00  0.86           C  
ATOM   4221  OE1 GLN A 539      -4.183  71.934 143.241  1.00  0.86           O  
ATOM   4222  NE2 GLN A 539      -3.906  71.570 141.035  1.00  0.86           N  
ATOM   4223  N   GLU A 540      -2.457  76.607 140.527  1.00  0.86           N  
ATOM   4224  CA  GLU A 540      -2.062  77.079 139.207  1.00  0.86           C  
ATOM   4225  C   GLU A 540      -0.574  76.920 138.916  1.00  0.86           C  
ATOM   4226  O   GLU A 540      -0.185  76.527 137.815  1.00  0.86           O  
ATOM   4227  CB  GLU A 540      -2.619  78.492 138.927  1.00  0.86           C  
ATOM   4228  CG  GLU A 540      -4.159  78.401 138.775  1.00  0.86           C  
ATOM   4229  CD  GLU A 540      -4.882  79.718 138.571  1.00  0.86           C  
ATOM   4230  OE1 GLU A 540      -4.787  80.618 139.437  1.00  0.86           O  
ATOM   4231  OE2 GLU A 540      -5.734  79.790 137.643  1.00  0.86           O  
ATOM   4232  N   ASN A 541       0.310  77.128 139.918  1.00  0.90           N  
ATOM   4233  CA  ASN A 541       1.713  76.741 139.814  1.00  0.90           C  
ATOM   4234  C   ASN A 541       1.904  75.233 139.613  1.00  0.90           C  
ATOM   4235  O   ASN A 541       2.699  74.804 138.777  1.00  0.90           O  
ATOM   4236  CB  ASN A 541       2.517  77.179 141.062  1.00  0.90           C  
ATOM   4237  CG  ASN A 541       2.671  78.696 141.084  1.00  0.90           C  
ATOM   4238  OD1 ASN A 541       2.716  79.368 140.054  1.00  0.90           O  
ATOM   4239  ND2 ASN A 541       2.820  79.254 142.306  1.00  0.90           N  
ATOM   4240  N   LYS A 542       1.137  74.384 140.336  1.00  0.89           N  
ATOM   4241  CA  LYS A 542       1.099  72.942 140.120  1.00  0.89           C  
ATOM   4242  C   LYS A 542       0.634  72.558 138.722  1.00  0.89           C  
ATOM   4243  O   LYS A 542       1.256  71.730 138.069  1.00  0.89           O  
ATOM   4244  CB  LYS A 542       0.222  72.226 141.182  1.00  0.89           C  
ATOM   4245  CG  LYS A 542       0.864  72.254 142.576  1.00  0.89           C  
ATOM   4246  CD  LYS A 542      -0.049  71.820 143.739  1.00  0.89           C  
ATOM   4247  CE  LYS A 542      -0.488  70.355 143.692  1.00  0.89           C  
ATOM   4248  NZ  LYS A 542      -0.948  69.923 145.023  1.00  0.89           N  
ATOM   4249  N   LEU A 543      -0.423  73.198 138.185  1.00  0.87           N  
ATOM   4250  CA  LEU A 543      -0.863  73.033 136.806  1.00  0.87           C  
ATOM   4251  C   LEU A 543       0.180  73.425 135.766  1.00  0.87           C  
ATOM   4252  O   LEU A 543       0.367  72.730 134.766  1.00  0.87           O  
ATOM   4253  CB  LEU A 543      -2.159  73.844 136.559  1.00  0.87           C  
ATOM   4254  CG  LEU A 543      -3.442  73.037 136.829  1.00  0.87           C  
ATOM   4255  CD1 LEU A 543      -4.628  73.976 137.094  1.00  0.87           C  
ATOM   4256  CD2 LEU A 543      -3.755  72.101 135.650  1.00  0.87           C  
ATOM   4257  N   LYS A 544       0.906  74.542 135.967  1.00  0.83           N  
ATOM   4258  CA  LYS A 544       2.008  74.941 135.105  1.00  0.83           C  
ATOM   4259  C   LYS A 544       3.169  73.947 135.127  1.00  0.83           C  
ATOM   4260  O   LYS A 544       3.712  73.570 134.088  1.00  0.83           O  
ATOM   4261  CB  LYS A 544       2.485  76.368 135.473  1.00  0.83           C  
ATOM   4262  CG  LYS A 544       3.217  77.106 134.334  1.00  0.83           C  
ATOM   4263  CD  LYS A 544       3.552  78.559 134.722  1.00  0.83           C  
ATOM   4264  CE  LYS A 544       3.774  79.532 133.551  1.00  0.83           C  
ATOM   4265  NZ  LYS A 544       4.946  79.169 132.743  1.00  0.83           N  
ATOM   4266  N   PHE A 545       3.551  73.454 136.324  1.00  0.87           N  
ATOM   4267  CA  PHE A 545       4.553  72.413 136.476  1.00  0.87           C  
ATOM   4268  C   PHE A 545       4.123  71.037 135.951  1.00  0.87           C  
ATOM   4269  O   PHE A 545       4.922  70.326 135.348  1.00  0.87           O  
ATOM   4270  CB  PHE A 545       5.078  72.347 137.935  1.00  0.87           C  
ATOM   4271  CG  PHE A 545       6.425  71.669 137.977  1.00  0.87           C  
ATOM   4272  CD1 PHE A 545       7.536  72.275 137.364  1.00  0.87           C  
ATOM   4273  CD2 PHE A 545       6.581  70.404 138.563  1.00  0.87           C  
ATOM   4274  CE1 PHE A 545       8.770  71.615 137.302  1.00  0.87           C  
ATOM   4275  CE2 PHE A 545       7.815  69.744 138.508  1.00  0.87           C  
ATOM   4276  CZ  PHE A 545       8.905  70.342 137.867  1.00  0.87           C  
ATOM   4277  N   SER A 546       2.846  70.625 136.106  1.00  0.84           N  
ATOM   4278  CA  SER A 546       2.314  69.387 135.526  1.00  0.84           C  
ATOM   4279  C   SER A 546       2.446  69.332 134.018  1.00  0.84           C  
ATOM   4280  O   SER A 546       2.810  68.304 133.460  1.00  0.84           O  
ATOM   4281  CB  SER A 546       0.812  69.140 135.823  1.00  0.84           C  
ATOM   4282  OG  SER A 546       0.615  68.832 137.199  1.00  0.84           O  
ATOM   4283  N   GLN A 547       2.202  70.456 133.314  1.00  0.77           N  
ATOM   4284  CA  GLN A 547       2.433  70.572 131.879  1.00  0.77           C  
ATOM   4285  C   GLN A 547       3.888  70.353 131.485  1.00  0.77           C  
ATOM   4286  O   GLN A 547       4.177  69.673 130.504  1.00  0.77           O  
ATOM   4287  CB  GLN A 547       1.951  71.947 131.362  1.00  0.77           C  
ATOM   4288  CG  GLN A 547       0.414  72.084 131.413  1.00  0.77           C  
ATOM   4289  CD  GLN A 547      -0.010  73.532 131.178  1.00  0.77           C  
ATOM   4290  OE1 GLN A 547      -0.049  74.039 130.059  1.00  0.77           O  
ATOM   4291  NE2 GLN A 547      -0.334  74.238 132.285  1.00  0.77           N  
ATOM   4292  N   PHE A 548       4.852  70.877 132.272  1.00  0.81           N  
ATOM   4293  CA  PHE A 548       6.263  70.551 132.125  1.00  0.81           C  
ATOM   4294  C   PHE A 548       6.534  69.061 132.369  1.00  0.81           C  
ATOM   4295  O   PHE A 548       7.159  68.392 131.552  1.00  0.81           O  
ATOM   4296  CB  PHE A 548       7.083  71.456 133.094  1.00  0.81           C  
ATOM   4297  CG  PHE A 548       8.572  71.272 132.967  1.00  0.81           C  
ATOM   4298  CD1 PHE A 548       9.274  71.834 131.890  1.00  0.81           C  
ATOM   4299  CD2 PHE A 548       9.273  70.511 133.918  1.00  0.81           C  
ATOM   4300  CE1 PHE A 548      10.656  71.638 131.762  1.00  0.81           C  
ATOM   4301  CE2 PHE A 548      10.654  70.312 133.794  1.00  0.81           C  
ATOM   4302  CZ  PHE A 548      11.346  70.879 132.716  1.00  0.81           C  
ATOM   4303  N   LEU A 549       5.994  68.475 133.458  1.00  0.81           N  
ATOM   4304  CA  LEU A 549       6.167  67.062 133.757  1.00  0.81           C  
ATOM   4305  C   LEU A 549       5.616  66.114 132.701  1.00  0.81           C  
ATOM   4306  O   LEU A 549       6.301  65.171 132.327  1.00  0.81           O  
ATOM   4307  CB  LEU A 549       5.544  66.677 135.124  1.00  0.81           C  
ATOM   4308  CG  LEU A 549       6.274  67.237 136.362  1.00  0.81           C  
ATOM   4309  CD1 LEU A 549       5.479  66.902 137.635  1.00  0.81           C  
ATOM   4310  CD2 LEU A 549       7.708  66.696 136.476  1.00  0.81           C  
ATOM   4311  N   GLU A 550       4.402  66.351 132.162  1.00  0.73           N  
ATOM   4312  CA  GLU A 550       3.812  65.487 131.148  1.00  0.73           C  
ATOM   4313  C   GLU A 550       4.394  65.719 129.754  1.00  0.73           C  
ATOM   4314  O   GLU A 550       4.235  64.896 128.855  1.00  0.73           O  
ATOM   4315  CB  GLU A 550       2.267  65.634 131.092  1.00  0.73           C  
ATOM   4316  CG  GLU A 550       1.559  65.258 132.417  1.00  0.73           C  
ATOM   4317  CD  GLU A 550       0.072  65.040 132.250  1.00  0.73           C  
ATOM   4318  OE1 GLU A 550      -0.574  65.622 131.342  1.00  0.73           O  
ATOM   4319  OE2 GLU A 550      -0.502  64.241 133.039  1.00  0.73           O  
ATOM   4320  N   THR A 551       5.103  66.853 129.538  1.00  0.75           N  
ATOM   4321  CA  THR A 551       5.856  67.086 128.300  1.00  0.75           C  
ATOM   4322  C   THR A 551       7.178  66.348 128.309  1.00  0.75           C  
ATOM   4323  O   THR A 551       7.498  65.611 127.379  1.00  0.75           O  
ATOM   4324  CB  THR A 551       6.165  68.560 128.035  1.00  0.75           C  
ATOM   4325  OG1 THR A 551       4.953  69.293 127.928  1.00  0.75           O  
ATOM   4326  CG2 THR A 551       6.889  68.758 126.694  1.00  0.75           C  
ATOM   4327  N   GLU A 552       7.975  66.514 129.385  1.00  0.72           N  
ATOM   4328  CA  GLU A 552       9.283  65.895 129.521  1.00  0.72           C  
ATOM   4329  C   GLU A 552       9.227  64.397 129.816  1.00  0.72           C  
ATOM   4330  O   GLU A 552      10.013  63.602 129.302  1.00  0.72           O  
ATOM   4331  CB  GLU A 552      10.102  66.594 130.637  1.00  0.72           C  
ATOM   4332  CG  GLU A 552      10.260  68.129 130.470  1.00  0.72           C  
ATOM   4333  CD  GLU A 552      11.105  68.564 129.275  1.00  0.72           C  
ATOM   4334  OE1 GLU A 552      10.521  69.161 128.334  1.00  0.72           O  
ATOM   4335  OE2 GLU A 552      12.345  68.360 129.326  1.00  0.72           O  
ATOM   4336  N   TYR A 553       8.283  63.959 130.676  1.00  0.72           N  
ATOM   4337  CA  TYR A 553       8.220  62.598 131.170  1.00  0.72           C  
ATOM   4338  C   TYR A 553       6.922  61.941 130.750  1.00  0.72           C  
ATOM   4339  O   TYR A 553       5.834  62.497 130.868  1.00  0.72           O  
ATOM   4340  CB  TYR A 553       8.291  62.532 132.724  1.00  0.72           C  
ATOM   4341  CG  TYR A 553       9.561  63.171 133.205  1.00  0.72           C  
ATOM   4342  CD1 TYR A 553       9.545  64.439 133.812  1.00  0.72           C  
ATOM   4343  CD2 TYR A 553      10.791  62.532 132.989  1.00  0.72           C  
ATOM   4344  CE1 TYR A 553      10.745  65.072 134.167  1.00  0.72           C  
ATOM   4345  CE2 TYR A 553      11.992  63.166 133.334  1.00  0.72           C  
ATOM   4346  CZ  TYR A 553      11.965  64.437 133.914  1.00  0.72           C  
ATOM   4347  OH  TYR A 553      13.176  65.095 134.182  1.00  0.72           O  
ATOM   4348  N   LYS A 554       6.986  60.681 130.275  1.00  0.65           N  
ATOM   4349  CA  LYS A 554       5.811  59.924 129.871  1.00  0.65           C  
ATOM   4350  C   LYS A 554       5.059  59.329 131.071  1.00  0.65           C  
ATOM   4351  O   LYS A 554       4.847  58.123 131.187  1.00  0.65           O  
ATOM   4352  CB  LYS A 554       6.250  58.829 128.864  1.00  0.65           C  
ATOM   4353  CG  LYS A 554       5.104  58.173 128.075  1.00  0.65           C  
ATOM   4354  CD  LYS A 554       5.620  57.058 127.150  1.00  0.65           C  
ATOM   4355  CE  LYS A 554       4.491  56.282 126.468  1.00  0.65           C  
ATOM   4356  NZ  LYS A 554       5.052  55.193 125.637  1.00  0.65           N  
ATOM   4357  N   VAL A 555       4.644  60.191 132.016  1.00  0.71           N  
ATOM   4358  CA  VAL A 555       3.974  59.814 133.245  1.00  0.71           C  
ATOM   4359  C   VAL A 555       2.755  60.695 133.395  1.00  0.71           C  
ATOM   4360  O   VAL A 555       2.857  61.917 133.432  1.00  0.71           O  
ATOM   4361  CB  VAL A 555       4.860  59.995 134.481  1.00  0.71           C  
ATOM   4362  CG1 VAL A 555       4.107  59.613 135.774  1.00  0.71           C  
ATOM   4363  CG2 VAL A 555       6.126  59.127 134.344  1.00  0.71           C  
ATOM   4364  N   LYS A 556       1.548  60.098 133.491  1.00  0.72           N  
ATOM   4365  CA  LYS A 556       0.334  60.854 133.743  1.00  0.72           C  
ATOM   4366  C   LYS A 556       0.275  61.394 135.170  1.00  0.72           C  
ATOM   4367  O   LYS A 556       0.371  60.638 136.141  1.00  0.72           O  
ATOM   4368  CB  LYS A 556      -0.931  60.003 133.433  1.00  0.72           C  
ATOM   4369  CG  LYS A 556      -2.247  60.805 133.392  1.00  0.72           C  
ATOM   4370  CD  LYS A 556      -2.319  61.760 132.184  1.00  0.72           C  
ATOM   4371  CE  LYS A 556      -3.247  62.963 132.412  1.00  0.72           C  
ATOM   4372  NZ  LYS A 556      -2.774  64.115 131.628  1.00  0.72           N  
ATOM   4373  N   ILE A 557       0.122  62.722 135.324  1.00  0.83           N  
ATOM   4374  CA  ILE A 557       0.185  63.390 136.613  1.00  0.83           C  
ATOM   4375  C   ILE A 557      -1.215  63.624 137.157  1.00  0.83           C  
ATOM   4376  O   ILE A 557      -2.149  64.014 136.457  1.00  0.83           O  
ATOM   4377  CB  ILE A 557       0.985  64.696 136.555  1.00  0.83           C  
ATOM   4378  CG1 ILE A 557       2.421  64.461 136.015  1.00  0.83           C  
ATOM   4379  CG2 ILE A 557       1.042  65.402 137.932  1.00  0.83           C  
ATOM   4380  CD1 ILE A 557       3.303  63.531 136.862  1.00  0.83           C  
ATOM   4381  N   ASN A 558      -1.400  63.363 138.466  1.00  0.85           N  
ATOM   4382  CA  ASN A 558      -2.631  63.623 139.177  1.00  0.85           C  
ATOM   4383  C   ASN A 558      -2.641  65.098 139.620  1.00  0.85           C  
ATOM   4384  O   ASN A 558      -1.683  65.512 140.270  1.00  0.85           O  
ATOM   4385  CB  ASN A 558      -2.686  62.646 140.386  1.00  0.85           C  
ATOM   4386  CG  ASN A 558      -4.033  62.655 141.096  1.00  0.85           C  
ATOM   4387  OD1 ASN A 558      -4.891  63.503 140.858  1.00  0.85           O  
ATOM   4388  ND2 ASN A 558      -4.240  61.673 142.002  1.00  0.85           N  
ATOM   4389  N   PRO A 559      -3.619  65.953 139.323  1.00  0.83           N  
ATOM   4390  CA  PRO A 559      -3.501  67.377 139.623  1.00  0.83           C  
ATOM   4391  C   PRO A 559      -3.829  67.688 141.069  1.00  0.83           C  
ATOM   4392  O   PRO A 559      -3.482  68.777 141.521  1.00  0.83           O  
ATOM   4393  CB  PRO A 559      -4.511  68.038 138.665  1.00  0.83           C  
ATOM   4394  CG  PRO A 559      -5.552  66.947 138.398  1.00  0.83           C  
ATOM   4395  CD  PRO A 559      -4.705  65.677 138.380  1.00  0.83           C  
ATOM   4396  N   SER A 560      -4.511  66.793 141.811  1.00  0.88           N  
ATOM   4397  CA  SER A 560      -4.912  67.059 143.189  1.00  0.88           C  
ATOM   4398  C   SER A 560      -3.965  66.440 144.197  1.00  0.88           C  
ATOM   4399  O   SER A 560      -4.085  66.656 145.405  1.00  0.88           O  
ATOM   4400  CB  SER A 560      -6.337  66.512 143.480  1.00  0.88           C  
ATOM   4401  OG  SER A 560      -6.430  65.109 143.218  1.00  0.88           O  
ATOM   4402  N   SER A 561      -2.961  65.680 143.722  1.00  0.93           N  
ATOM   4403  CA  SER A 561      -1.947  65.063 144.558  1.00  0.93           C  
ATOM   4404  C   SER A 561      -1.069  66.046 145.303  1.00  0.93           C  
ATOM   4405  O   SER A 561      -0.855  67.186 144.888  1.00  0.93           O  
ATOM   4406  CB  SER A 561      -1.037  64.057 143.804  1.00  0.93           C  
ATOM   4407  OG  SER A 561      -0.274  64.693 142.782  1.00  0.93           O  
ATOM   4408  N   MET A 562      -0.540  65.620 146.462  1.00  0.93           N  
ATOM   4409  CA  MET A 562       0.513  66.334 147.150  1.00  0.93           C  
ATOM   4410  C   MET A 562       1.804  66.276 146.341  1.00  0.93           C  
ATOM   4411  O   MET A 562       2.298  65.199 146.003  1.00  0.93           O  
ATOM   4412  CB  MET A 562       0.750  65.701 148.542  1.00  0.93           C  
ATOM   4413  CG  MET A 562       1.726  66.470 149.457  1.00  0.93           C  
ATOM   4414  SD  MET A 562       2.410  65.475 150.819  1.00  0.93           S  
ATOM   4415  CE  MET A 562       0.850  64.932 151.572  1.00  0.93           C  
ATOM   4416  N   PHE A 563       2.385  67.436 145.996  1.00  0.95           N  
ATOM   4417  CA  PHE A 563       3.654  67.508 145.305  1.00  0.95           C  
ATOM   4418  C   PHE A 563       4.749  67.484 146.352  1.00  0.95           C  
ATOM   4419  O   PHE A 563       4.948  68.426 147.122  1.00  0.95           O  
ATOM   4420  CB  PHE A 563       3.772  68.767 144.402  1.00  0.95           C  
ATOM   4421  CG  PHE A 563       3.118  68.607 143.044  1.00  0.95           C  
ATOM   4422  CD1 PHE A 563       2.073  67.699 142.764  1.00  0.95           C  
ATOM   4423  CD2 PHE A 563       3.581  69.430 142.002  1.00  0.95           C  
ATOM   4424  CE1 PHE A 563       1.511  67.622 141.484  1.00  0.95           C  
ATOM   4425  CE2 PHE A 563       3.027  69.351 140.718  1.00  0.95           C  
ATOM   4426  CZ  PHE A 563       1.993  68.445 140.462  1.00  0.95           C  
ATOM   4427  N   ASP A 564       5.455  66.349 146.397  1.00  0.97           N  
ATOM   4428  CA  ASP A 564       6.311  65.928 147.472  1.00  0.97           C  
ATOM   4429  C   ASP A 564       7.732  65.941 146.928  1.00  0.97           C  
ATOM   4430  O   ASP A 564       8.077  65.164 146.040  1.00  0.97           O  
ATOM   4431  CB  ASP A 564       5.773  64.515 147.819  1.00  0.97           C  
ATOM   4432  CG  ASP A 564       6.398  63.887 149.038  1.00  0.97           C  
ATOM   4433  OD1 ASP A 564       7.250  64.536 149.677  1.00  0.97           O  
ATOM   4434  OD2 ASP A 564       5.969  62.749 149.371  1.00  0.97           O  
ATOM   4435  N   VAL A 565       8.571  66.909 147.354  1.00  0.98           N  
ATOM   4436  CA  VAL A 565       9.732  67.281 146.555  1.00  0.98           C  
ATOM   4437  C   VAL A 565      11.022  67.339 147.350  1.00  0.98           C  
ATOM   4438  O   VAL A 565      11.171  68.092 148.316  1.00  0.98           O  
ATOM   4439  CB  VAL A 565       9.530  68.612 145.826  1.00  0.98           C  
ATOM   4440  CG1 VAL A 565      10.707  68.909 144.874  1.00  0.98           C  
ATOM   4441  CG2 VAL A 565       8.221  68.560 145.012  1.00  0.98           C  
ATOM   4442  N   GLN A 566      12.039  66.577 146.891  1.00  0.96           N  
ATOM   4443  CA  GLN A 566      13.400  66.741 147.350  1.00  0.96           C  
ATOM   4444  C   GLN A 566      14.338  67.054 146.198  1.00  0.96           C  
ATOM   4445  O   GLN A 566      14.722  66.182 145.421  1.00  0.96           O  
ATOM   4446  CB  GLN A 566      13.931  65.493 148.100  1.00  0.96           C  
ATOM   4447  CG  GLN A 566      15.229  65.859 148.855  1.00  0.96           C  
ATOM   4448  CD  GLN A 566      15.616  64.982 150.046  1.00  0.96           C  
ATOM   4449  OE1 GLN A 566      16.367  65.471 150.897  1.00  0.96           O  
ATOM   4450  NE2 GLN A 566      15.134  63.729 150.129  1.00  0.96           N  
ATOM   4451  N   VAL A 567      14.778  68.322 146.078  1.00  0.97           N  
ATOM   4452  CA  VAL A 567      15.700  68.727 145.028  1.00  0.97           C  
ATOM   4453  C   VAL A 567      16.919  69.439 145.602  1.00  0.97           C  
ATOM   4454  O   VAL A 567      16.816  70.437 146.318  1.00  0.97           O  
ATOM   4455  CB  VAL A 567      15.049  69.544 143.913  1.00  0.97           C  
ATOM   4456  CG1 VAL A 567      14.133  68.635 143.069  1.00  0.97           C  
ATOM   4457  CG2 VAL A 567      14.243  70.733 144.465  1.00  0.97           C  
ATOM   4458  N   LYS A 568      18.125  68.911 145.291  1.00  0.90           N  
ATOM   4459  CA  LYS A 568      19.397  69.227 145.931  1.00  0.90           C  
ATOM   4460  C   LYS A 568      20.398  68.177 145.467  1.00  0.90           C  
ATOM   4461  O   LYS A 568      20.008  67.127 144.968  1.00  0.90           O  
ATOM   4462  CB  LYS A 568      19.362  69.219 147.496  1.00  0.90           C  
ATOM   4463  CG  LYS A 568      18.999  67.851 148.101  1.00  0.90           C  
ATOM   4464  CD  LYS A 568      18.729  67.830 149.617  1.00  0.90           C  
ATOM   4465  CE  LYS A 568      17.449  68.555 150.047  1.00  0.90           C  
ATOM   4466  NZ  LYS A 568      16.997  68.039 151.354  1.00  0.90           N  
ATOM   4467  N   ARG A 569      21.725  68.429 145.571  1.00  0.88           N  
ATOM   4468  CA  ARG A 569      22.751  67.474 145.156  1.00  0.88           C  
ATOM   4469  C   ARG A 569      22.664  66.120 145.868  1.00  0.88           C  
ATOM   4470  O   ARG A 569      22.268  66.027 147.029  1.00  0.88           O  
ATOM   4471  CB  ARG A 569      24.182  68.051 145.337  1.00  0.88           C  
ATOM   4472  CG  ARG A 569      24.497  69.323 144.513  1.00  0.88           C  
ATOM   4473  CD  ARG A 569      24.558  69.146 142.989  1.00  0.88           C  
ATOM   4474  NE  ARG A 569      25.671  68.192 142.662  1.00  0.88           N  
ATOM   4475  CZ  ARG A 569      26.921  68.542 142.319  1.00  0.88           C  
ATOM   4476  NH1 ARG A 569      27.286  69.809 142.206  1.00  0.88           N  
ATOM   4477  NH2 ARG A 569      27.816  67.588 142.069  1.00  0.88           N  
ATOM   4478  N   ILE A 570      23.001  65.017 145.166  1.00  0.95           N  
ATOM   4479  CA  ILE A 570      22.837  63.673 145.707  1.00  0.95           C  
ATOM   4480  C   ILE A 570      24.018  63.310 146.592  1.00  0.95           C  
ATOM   4481  O   ILE A 570      25.160  63.264 146.137  1.00  0.95           O  
ATOM   4482  CB  ILE A 570      22.651  62.617 144.620  1.00  0.95           C  
ATOM   4483  CG1 ILE A 570      21.600  63.033 143.559  1.00  0.95           C  
ATOM   4484  CG2 ILE A 570      22.286  61.255 145.257  1.00  0.95           C  
ATOM   4485  CD1 ILE A 570      20.186  63.306 144.088  1.00  0.95           C  
ATOM   4486  N   HIS A 571      23.771  63.063 147.896  1.00  0.91           N  
ATOM   4487  CA  HIS A 571      24.836  62.802 148.845  1.00  0.91           C  
ATOM   4488  C   HIS A 571      24.279  61.993 149.996  1.00  0.91           C  
ATOM   4489  O   HIS A 571      23.115  62.147 150.359  1.00  0.91           O  
ATOM   4490  CB  HIS A 571      25.417  64.132 149.408  1.00  0.91           C  
ATOM   4491  CG  HIS A 571      26.827  64.079 149.945  1.00  0.91           C  
ATOM   4492  ND1 HIS A 571      27.751  64.915 149.361  1.00  0.91           N  
ATOM   4493  CD2 HIS A 571      27.422  63.368 150.944  1.00  0.91           C  
ATOM   4494  CE1 HIS A 571      28.886  64.706 149.995  1.00  0.91           C  
ATOM   4495  NE2 HIS A 571      28.743  63.772 150.966  1.00  0.91           N  
ATOM   4496  N   GLU A 572      25.105  61.142 150.640  1.00  0.92           N  
ATOM   4497  CA  GLU A 572      24.705  60.278 151.744  1.00  0.92           C  
ATOM   4498  C   GLU A 572      24.065  61.020 152.922  1.00  0.92           C  
ATOM   4499  O   GLU A 572      23.007  60.635 153.416  1.00  0.92           O  
ATOM   4500  CB  GLU A 572      25.956  59.529 152.274  1.00  0.92           C  
ATOM   4501  CG  GLU A 572      26.652  58.596 151.252  1.00  0.92           C  
ATOM   4502  CD  GLU A 572      28.082  58.189 151.641  1.00  0.92           C  
ATOM   4503  OE1 GLU A 572      28.633  58.675 152.670  1.00  0.92           O  
ATOM   4504  OE2 GLU A 572      28.644  57.380 150.861  1.00  0.92           O  
ATOM   4505  N   TYR A 573      24.665  62.153 153.356  1.00  0.89           N  
ATOM   4506  CA  TYR A 573      24.159  62.982 154.442  1.00  0.89           C  
ATOM   4507  C   TYR A 573      22.804  63.628 154.180  1.00  0.89           C  
ATOM   4508  O   TYR A 573      21.975  63.771 155.076  1.00  0.89           O  
ATOM   4509  CB  TYR A 573      25.218  64.016 154.934  1.00  0.89           C  
ATOM   4510  CG  TYR A 573      25.345  65.313 154.165  1.00  0.89           C  
ATOM   4511  CD1 TYR A 573      24.544  66.420 154.495  1.00  0.89           C  
ATOM   4512  CD2 TYR A 573      26.347  65.477 153.199  1.00  0.89           C  
ATOM   4513  CE1 TYR A 573      24.768  67.667 153.899  1.00  0.89           C  
ATOM   4514  CE2 TYR A 573      26.585  66.727 152.606  1.00  0.89           C  
ATOM   4515  CZ  TYR A 573      25.811  67.829 152.983  1.00  0.89           C  
ATOM   4516  OH  TYR A 573      26.070  69.110 152.454  1.00  0.89           O  
ATOM   4517  N   LYS A 574      22.545  64.022 152.916  1.00  0.92           N  
ATOM   4518  CA  LYS A 574      21.326  64.693 152.509  1.00  0.92           C  
ATOM   4519  C   LYS A 574      20.154  63.728 152.376  1.00  0.92           C  
ATOM   4520  O   LYS A 574      18.999  64.147 152.349  1.00  0.92           O  
ATOM   4521  CB  LYS A 574      21.545  65.474 151.189  1.00  0.92           C  
ATOM   4522  CG  LYS A 574      22.544  66.638 151.341  1.00  0.92           C  
ATOM   4523  CD  LYS A 574      22.662  67.493 150.066  1.00  0.92           C  
ATOM   4524  CE  LYS A 574      23.760  68.570 150.074  1.00  0.92           C  
ATOM   4525  NZ  LYS A 574      23.616  69.511 151.196  1.00  0.92           N  
ATOM   4526  N   ARG A 575      20.440  62.406 152.353  1.00  0.91           N  
ATOM   4527  CA  ARG A 575      19.485  61.347 152.626  1.00  0.91           C  
ATOM   4528  C   ARG A 575      18.348  61.168 151.617  1.00  0.91           C  
ATOM   4529  O   ARG A 575      17.228  60.803 151.973  1.00  0.91           O  
ATOM   4530  CB  ARG A 575      18.933  61.444 154.074  1.00  0.91           C  
ATOM   4531  CG  ARG A 575      19.851  60.914 155.197  1.00  0.91           C  
ATOM   4532  CD  ARG A 575      19.298  61.410 156.536  1.00  0.91           C  
ATOM   4533  NE  ARG A 575      19.722  60.560 157.688  1.00  0.91           N  
ATOM   4534  CZ  ARG A 575      19.134  60.683 158.883  1.00  0.91           C  
ATOM   4535  NH1 ARG A 575      18.164  61.559 159.130  1.00  0.91           N  
ATOM   4536  NH2 ARG A 575      19.498  59.921 159.906  1.00  0.91           N  
ATOM   4537  N   GLN A 576      18.620  61.272 150.296  1.00  0.95           N  
ATOM   4538  CA  GLN A 576      17.659  60.888 149.260  1.00  0.95           C  
ATOM   4539  C   GLN A 576      17.260  59.414 149.353  1.00  0.95           C  
ATOM   4540  O   GLN A 576      16.150  59.008 149.016  1.00  0.95           O  
ATOM   4541  CB  GLN A 576      18.182  61.171 147.828  1.00  0.95           C  
ATOM   4542  CG  GLN A 576      18.301  62.673 147.473  1.00  0.95           C  
ATOM   4543  CD  GLN A 576      19.612  63.318 147.927  1.00  0.95           C  
ATOM   4544  OE1 GLN A 576      20.465  62.734 148.598  1.00  0.95           O  
ATOM   4545  NE2 GLN A 576      19.797  64.588 147.501  1.00  0.95           N  
ATOM   4546  N   LEU A 577      18.175  58.584 149.882  1.00  0.95           N  
ATOM   4547  CA  LEU A 577      17.969  57.186 150.203  1.00  0.95           C  
ATOM   4548  C   LEU A 577      16.838  56.940 151.206  1.00  0.95           C  
ATOM   4549  O   LEU A 577      16.013  56.052 151.016  1.00  0.95           O  
ATOM   4550  CB  LEU A 577      19.305  56.623 150.749  1.00  0.95           C  
ATOM   4551  CG  LEU A 577      19.724  55.261 150.167  1.00  0.95           C  
ATOM   4552  CD1 LEU A 577      21.192  55.005 150.535  1.00  0.95           C  
ATOM   4553  CD2 LEU A 577      18.833  54.098 150.628  1.00  0.95           C  
ATOM   4554  N   LEU A 578      16.736  57.758 152.280  1.00  0.97           N  
ATOM   4555  CA  LEU A 578      15.702  57.652 153.308  1.00  0.97           C  
ATOM   4556  C   LEU A 578      14.301  57.894 152.732  1.00  0.97           C  
ATOM   4557  O   LEU A 578      13.345  57.156 152.973  1.00  0.97           O  
ATOM   4558  CB  LEU A 578      16.003  58.691 154.430  1.00  0.97           C  
ATOM   4559  CG  LEU A 578      15.698  58.296 155.898  1.00  0.97           C  
ATOM   4560  CD1 LEU A 578      15.448  59.556 156.742  1.00  0.97           C  
ATOM   4561  CD2 LEU A 578      14.538  57.311 156.079  1.00  0.97           C  
ATOM   4562  N   ASN A 579      14.197  58.929 151.874  1.00  0.97           N  
ATOM   4563  CA  ASN A 579      13.029  59.310 151.100  1.00  0.97           C  
ATOM   4564  C   ASN A 579      12.610  58.201 150.133  1.00  0.97           C  
ATOM   4565  O   ASN A 579      11.441  57.837 150.045  1.00  0.97           O  
ATOM   4566  CB  ASN A 579      13.420  60.644 150.406  1.00  0.97           C  
ATOM   4567  CG  ASN A 579      12.346  61.427 149.650  1.00  0.97           C  
ATOM   4568  OD1 ASN A 579      12.730  62.184 148.753  1.00  0.97           O  
ATOM   4569  ND2 ASN A 579      11.057  61.314 150.018  1.00  0.97           N  
ATOM   4570  N   CYS A 580      13.584  57.563 149.448  1.00  0.96           N  
ATOM   4571  CA  CYS A 580      13.350  56.397 148.606  1.00  0.96           C  
ATOM   4572  C   CYS A 580      12.765  55.196 149.356  1.00  0.96           C  
ATOM   4573  O   CYS A 580      11.838  54.551 148.871  1.00  0.96           O  
ATOM   4574  CB  CYS A 580      14.653  55.995 147.863  1.00  0.96           C  
ATOM   4575  SG  CYS A 580      14.364  54.874 146.448  1.00  0.96           S  
ATOM   4576  N   LEU A 581      13.237  54.898 150.593  1.00  0.94           N  
ATOM   4577  CA  LEU A 581      12.653  53.849 151.428  1.00  0.94           C  
ATOM   4578  C   LEU A 581      11.174  54.089 151.727  1.00  0.94           C  
ATOM   4579  O   LEU A 581      10.348  53.191 151.596  1.00  0.94           O  
ATOM   4580  CB  LEU A 581      13.369  53.693 152.802  1.00  0.94           C  
ATOM   4581  CG  LEU A 581      14.872  53.343 152.773  1.00  0.94           C  
ATOM   4582  CD1 LEU A 581      15.423  53.285 154.207  1.00  0.94           C  
ATOM   4583  CD2 LEU A 581      15.173  52.022 152.052  1.00  0.94           C  
ATOM   4584  N   HIS A 582      10.792  55.337 152.079  1.00  0.94           N  
ATOM   4585  CA  HIS A 582       9.405  55.719 152.316  1.00  0.94           C  
ATOM   4586  C   HIS A 582       8.500  55.590 151.094  1.00  0.94           C  
ATOM   4587  O   HIS A 582       7.355  55.157 151.211  1.00  0.94           O  
ATOM   4588  CB  HIS A 582       9.295  57.145 152.899  1.00  0.94           C  
ATOM   4589  CG  HIS A 582       7.886  57.596 153.150  1.00  0.94           C  
ATOM   4590  ND1 HIS A 582       7.420  58.697 152.469  1.00  0.94           N  
ATOM   4591  CD2 HIS A 582       6.899  57.068 153.922  1.00  0.94           C  
ATOM   4592  CE1 HIS A 582       6.162  58.825 152.829  1.00  0.94           C  
ATOM   4593  NE2 HIS A 582       5.792  57.864 153.712  1.00  0.94           N  
ATOM   4594  N   VAL A 583       8.993  55.915 149.881  1.00  0.96           N  
ATOM   4595  CA  VAL A 583       8.271  55.691 148.629  1.00  0.96           C  
ATOM   4596  C   VAL A 583       7.928  54.221 148.410  1.00  0.96           C  
ATOM   4597  O   VAL A 583       6.801  53.871 148.051  1.00  0.96           O  
ATOM   4598  CB  VAL A 583       9.067  56.225 147.440  1.00  0.96           C  
ATOM   4599  CG1 VAL A 583       8.427  55.844 146.089  1.00  0.96           C  
ATOM   4600  CG2 VAL A 583       9.139  57.758 147.549  1.00  0.96           C  
ATOM   4601  N   ILE A 584       8.882  53.310 148.686  1.00  0.95           N  
ATOM   4602  CA  ILE A 584       8.657  51.870 148.672  1.00  0.95           C  
ATOM   4603  C   ILE A 584       7.638  51.444 149.733  1.00  0.95           C  
ATOM   4604  O   ILE A 584       6.729  50.660 149.463  1.00  0.95           O  
ATOM   4605  CB  ILE A 584       9.964  51.092 148.809  1.00  0.95           C  
ATOM   4606  CG1 ILE A 584      10.963  51.481 147.690  1.00  0.95           C  
ATOM   4607  CG2 ILE A 584       9.672  49.578 148.754  1.00  0.95           C  
ATOM   4608  CD1 ILE A 584      12.392  50.992 147.955  1.00  0.95           C  
ATOM   4609  N   THR A 585       7.706  52.001 150.961  1.00  0.93           N  
ATOM   4610  CA  THR A 585       6.707  51.773 152.011  1.00  0.93           C  
ATOM   4611  C   THR A 585       5.304  52.204 151.620  1.00  0.93           C  
ATOM   4612  O   THR A 585       4.341  51.461 151.800  1.00  0.93           O  
ATOM   4613  CB  THR A 585       7.049  52.459 153.327  1.00  0.93           C  
ATOM   4614  OG1 THR A 585       8.379  52.131 153.679  1.00  0.93           O  
ATOM   4615  CG2 THR A 585       6.154  51.963 154.469  1.00  0.93           C  
ATOM   4616  N   MET A 586       5.139  53.396 151.005  1.00  0.92           N  
ATOM   4617  CA  MET A 586       3.863  53.846 150.467  1.00  0.92           C  
ATOM   4618  C   MET A 586       3.318  52.938 149.372  1.00  0.92           C  
ATOM   4619  O   MET A 586       2.138  52.592 149.378  1.00  0.92           O  
ATOM   4620  CB  MET A 586       3.942  55.292 149.922  1.00  0.92           C  
ATOM   4621  CG  MET A 586       4.098  56.351 151.028  1.00  0.92           C  
ATOM   4622  SD  MET A 586       3.835  58.065 150.469  1.00  0.92           S  
ATOM   4623  CE  MET A 586       5.351  58.211 149.481  1.00  0.92           C  
ATOM   4624  N   TYR A 587       4.182  52.480 148.442  1.00  0.93           N  
ATOM   4625  CA  TYR A 587       3.844  51.483 147.438  1.00  0.93           C  
ATOM   4626  C   TYR A 587       3.364  50.169 148.067  1.00  0.93           C  
ATOM   4627  O   TYR A 587       2.291  49.671 147.735  1.00  0.93           O  
ATOM   4628  CB  TYR A 587       5.097  51.279 146.526  1.00  0.93           C  
ATOM   4629  CG  TYR A 587       5.008  50.104 145.582  1.00  0.93           C  
ATOM   4630  CD1 TYR A 587       4.304  50.183 144.370  1.00  0.93           C  
ATOM   4631  CD2 TYR A 587       5.613  48.888 145.939  1.00  0.93           C  
ATOM   4632  CE1 TYR A 587       4.195  49.059 143.532  1.00  0.93           C  
ATOM   4633  CE2 TYR A 587       5.495  47.764 145.115  1.00  0.93           C  
ATOM   4634  CZ  TYR A 587       4.789  47.845 143.914  1.00  0.93           C  
ATOM   4635  OH  TYR A 587       4.738  46.684 143.095  1.00  0.93           O  
ATOM   4636  N   ASN A 588       4.104  49.620 149.052  1.00  0.90           N  
ATOM   4637  CA  ASN A 588       3.746  48.390 149.744  1.00  0.90           C  
ATOM   4638  C   ASN A 588       2.420  48.471 150.490  1.00  0.90           C  
ATOM   4639  O   ASN A 588       1.628  47.531 150.465  1.00  0.90           O  
ATOM   4640  CB  ASN A 588       4.856  47.967 150.736  1.00  0.90           C  
ATOM   4641  CG  ASN A 588       6.076  47.486 149.961  1.00  0.90           C  
ATOM   4642  OD1 ASN A 588       5.982  46.993 148.835  1.00  0.90           O  
ATOM   4643  ND2 ASN A 588       7.263  47.584 150.597  1.00  0.90           N  
ATOM   4644  N   ARG A 589       2.123  49.612 151.144  1.00  0.85           N  
ATOM   4645  CA  ARG A 589       0.835  49.856 151.771  1.00  0.85           C  
ATOM   4646  C   ARG A 589      -0.338  49.827 150.789  1.00  0.85           C  
ATOM   4647  O   ARG A 589      -1.364  49.215 151.072  1.00  0.85           O  
ATOM   4648  CB  ARG A 589       0.850  51.218 152.509  1.00  0.85           C  
ATOM   4649  CG  ARG A 589       1.717  51.225 153.787  1.00  0.85           C  
ATOM   4650  CD  ARG A 589       1.889  52.633 154.369  1.00  0.85           C  
ATOM   4651  NE  ARG A 589       2.631  52.527 155.661  1.00  0.85           N  
ATOM   4652  CZ  ARG A 589       2.693  53.503 156.572  1.00  0.85           C  
ATOM   4653  NH1 ARG A 589       2.095  54.674 156.393  1.00  0.85           N  
ATOM   4654  NH2 ARG A 589       3.372  53.330 157.698  1.00  0.85           N  
ATOM   4655  N   ILE A 590      -0.201  50.452 149.599  1.00  0.88           N  
ATOM   4656  CA  ILE A 590      -1.209  50.397 148.541  1.00  0.88           C  
ATOM   4657  C   ILE A 590      -1.391  48.996 147.971  1.00  0.88           C  
ATOM   4658  O   ILE A 590      -2.510  48.537 147.761  1.00  0.88           O  
ATOM   4659  CB  ILE A 590      -0.883  51.359 147.396  1.00  0.88           C  
ATOM   4660  CG1 ILE A 590      -0.833  52.822 147.894  1.00  0.88           C  
ATOM   4661  CG2 ILE A 590      -1.926  51.216 146.261  1.00  0.88           C  
ATOM   4662  CD1 ILE A 590      -0.178  53.772 146.883  1.00  0.88           C  
ATOM   4663  N   LYS A 591      -0.289  48.266 147.707  1.00  0.86           N  
ATOM   4664  CA  LYS A 591      -0.344  46.902 147.203  1.00  0.86           C  
ATOM   4665  C   LYS A 591      -0.975  45.920 148.179  1.00  0.86           C  
ATOM   4666  O   LYS A 591      -1.735  45.037 147.789  1.00  0.86           O  
ATOM   4667  CB  LYS A 591       1.064  46.390 146.810  1.00  0.86           C  
ATOM   4668  CG  LYS A 591       1.735  47.179 145.671  1.00  0.86           C  
ATOM   4669  CD  LYS A 591       1.060  47.080 144.291  1.00  0.86           C  
ATOM   4670  CE  LYS A 591       1.141  45.688 143.660  1.00  0.86           C  
ATOM   4671  NZ  LYS A 591       0.675  45.749 142.268  1.00  0.86           N  
ATOM   4672  N   LYS A 592      -0.668  46.057 149.483  1.00  0.82           N  
ATOM   4673  CA  LYS A 592      -1.278  45.276 150.540  1.00  0.82           C  
ATOM   4674  C   LYS A 592      -2.766  45.547 150.750  1.00  0.82           C  
ATOM   4675  O   LYS A 592      -3.528  44.633 151.065  1.00  0.82           O  
ATOM   4676  CB  LYS A 592      -0.526  45.503 151.877  1.00  0.82           C  
ATOM   4677  CG  LYS A 592      -0.971  44.539 152.990  1.00  0.82           C  
ATOM   4678  CD  LYS A 592      -0.274  44.792 154.334  1.00  0.82           C  
ATOM   4679  CE  LYS A 592      -0.697  43.810 155.431  1.00  0.82           C  
ATOM   4680  NZ  LYS A 592      -2.170  43.842 155.600  1.00  0.82           N  
ATOM   4681  N   ASP A 593      -3.200  46.816 150.624  1.00  0.81           N  
ATOM   4682  CA  ASP A 593      -4.533  47.239 151.009  1.00  0.81           C  
ATOM   4683  C   ASP A 593      -5.115  48.197 149.942  1.00  0.81           C  
ATOM   4684  O   ASP A 593      -5.098  49.419 150.121  1.00  0.81           O  
ATOM   4685  CB  ASP A 593      -4.353  47.877 152.419  1.00  0.81           C  
ATOM   4686  CG  ASP A 593      -5.603  47.917 153.276  1.00  0.81           C  
ATOM   4687  OD1 ASP A 593      -6.724  47.797 152.728  1.00  0.81           O  
ATOM   4688  OD2 ASP A 593      -5.414  48.099 154.518  1.00  0.81           O  
ATOM   4689  N   PRO A 594      -5.638  47.728 148.787  1.00  0.83           N  
ATOM   4690  CA  PRO A 594      -5.836  48.610 147.630  1.00  0.83           C  
ATOM   4691  C   PRO A 594      -7.033  49.526 147.748  1.00  0.83           C  
ATOM   4692  O   PRO A 594      -7.132  50.496 146.988  1.00  0.83           O  
ATOM   4693  CB  PRO A 594      -6.043  47.645 146.446  1.00  0.83           C  
ATOM   4694  CG  PRO A 594      -5.282  46.391 146.867  1.00  0.83           C  
ATOM   4695  CD  PRO A 594      -5.563  46.320 148.366  1.00  0.83           C  
ATOM   4696  N   LYS A 595      -7.972  49.203 148.655  1.00  0.73           N  
ATOM   4697  CA  LYS A 595      -9.216  49.926 148.831  1.00  0.73           C  
ATOM   4698  C   LYS A 595      -9.130  50.906 149.983  1.00  0.73           C  
ATOM   4699  O   LYS A 595     -10.055  51.679 150.224  1.00  0.73           O  
ATOM   4700  CB  LYS A 595     -10.375  48.941 149.130  1.00  0.73           C  
ATOM   4701  CG  LYS A 595     -10.751  48.048 147.937  1.00  0.73           C  
ATOM   4702  CD  LYS A 595     -11.986  47.182 148.244  1.00  0.73           C  
ATOM   4703  CE  LYS A 595     -12.491  46.398 147.030  1.00  0.73           C  
ATOM   4704  NZ  LYS A 595     -13.702  45.623 147.385  1.00  0.73           N  
ATOM   4705  N   LYS A 596      -8.003  50.914 150.713  1.00  0.73           N  
ATOM   4706  CA  LYS A 596      -7.753  51.842 151.788  1.00  0.73           C  
ATOM   4707  C   LYS A 596      -7.675  53.303 151.371  1.00  0.73           C  
ATOM   4708  O   LYS A 596      -7.213  53.657 150.285  1.00  0.73           O  
ATOM   4709  CB  LYS A 596      -6.461  51.437 152.519  1.00  0.73           C  
ATOM   4710  CG  LYS A 596      -6.214  52.135 153.865  1.00  0.73           C  
ATOM   4711  CD  LYS A 596      -5.033  51.468 154.572  1.00  0.73           C  
ATOM   4712  CE  LYS A 596      -4.960  51.742 156.068  1.00  0.73           C  
ATOM   4713  NZ  LYS A 596      -4.065  50.728 156.661  1.00  0.73           N  
ATOM   4714  N   LEU A 597      -8.118  54.205 152.271  1.00  0.73           N  
ATOM   4715  CA  LEU A 597      -7.921  55.632 152.148  1.00  0.73           C  
ATOM   4716  C   LEU A 597      -6.439  56.009 152.096  1.00  0.73           C  
ATOM   4717  O   LEU A 597      -5.699  55.873 153.070  1.00  0.73           O  
ATOM   4718  CB  LEU A 597      -8.606  56.371 153.323  1.00  0.73           C  
ATOM   4719  CG  LEU A 597      -8.859  57.870 153.073  1.00  0.73           C  
ATOM   4720  CD1 LEU A 597     -10.068  58.079 152.148  1.00  0.73           C  
ATOM   4721  CD2 LEU A 597      -9.078  58.607 154.402  1.00  0.73           C  
ATOM   4722  N   PHE A 598      -5.974  56.470 150.923  1.00  0.85           N  
ATOM   4723  CA  PHE A 598      -4.601  56.847 150.687  1.00  0.85           C  
ATOM   4724  C   PHE A 598      -4.611  58.265 150.155  1.00  0.85           C  
ATOM   4725  O   PHE A 598      -5.410  58.617 149.289  1.00  0.85           O  
ATOM   4726  CB  PHE A 598      -3.931  55.870 149.680  1.00  0.85           C  
ATOM   4727  CG  PHE A 598      -2.460  56.156 149.503  1.00  0.85           C  
ATOM   4728  CD1 PHE A 598      -2.024  57.026 148.489  1.00  0.85           C  
ATOM   4729  CD2 PHE A 598      -1.510  55.592 150.369  1.00  0.85           C  
ATOM   4730  CE1 PHE A 598      -0.667  57.340 148.352  1.00  0.85           C  
ATOM   4731  CE2 PHE A 598      -0.148  55.897 150.231  1.00  0.85           C  
ATOM   4732  CZ  PHE A 598       0.270  56.779 149.226  1.00  0.85           C  
ATOM   4733  N   VAL A 599      -3.717  59.121 150.675  1.00  0.91           N  
ATOM   4734  CA  VAL A 599      -3.648  60.519 150.298  1.00  0.91           C  
ATOM   4735  C   VAL A 599      -2.684  60.659 149.126  1.00  0.91           C  
ATOM   4736  O   VAL A 599      -1.504  60.348 149.302  1.00  0.91           O  
ATOM   4737  CB  VAL A 599      -3.180  61.378 151.463  1.00  0.91           C  
ATOM   4738  CG1 VAL A 599      -3.241  62.870 151.084  1.00  0.91           C  
ATOM   4739  CG2 VAL A 599      -4.097  61.091 152.667  1.00  0.91           C  
ATOM   4740  N   PRO A 600      -3.089  61.069 147.922  1.00  0.95           N  
ATOM   4741  CA  PRO A 600      -2.290  60.831 146.729  1.00  0.95           C  
ATOM   4742  C   PRO A 600      -1.074  61.731 146.651  1.00  0.95           C  
ATOM   4743  O   PRO A 600      -1.147  62.906 147.016  1.00  0.95           O  
ATOM   4744  CB  PRO A 600      -3.268  61.076 145.564  1.00  0.95           C  
ATOM   4745  CG  PRO A 600      -4.333  62.008 146.149  1.00  0.95           C  
ATOM   4746  CD  PRO A 600      -4.442  61.521 147.592  1.00  0.95           C  
ATOM   4747  N   ARG A 601       0.068  61.198 146.178  1.00  0.92           N  
ATOM   4748  CA  ARG A 601       1.315  61.935 146.128  1.00  0.92           C  
ATOM   4749  C   ARG A 601       1.995  61.831 144.771  1.00  0.92           C  
ATOM   4750  O   ARG A 601       2.004  60.788 144.119  1.00  0.92           O  
ATOM   4751  CB  ARG A 601       2.339  61.473 147.194  1.00  0.92           C  
ATOM   4752  CG  ARG A 601       1.894  61.620 148.665  1.00  0.92           C  
ATOM   4753  CD  ARG A 601       3.116  61.793 149.571  1.00  0.92           C  
ATOM   4754  NE  ARG A 601       2.697  61.825 151.006  1.00  0.92           N  
ATOM   4755  CZ  ARG A 601       3.570  62.139 151.971  1.00  0.92           C  
ATOM   4756  NH1 ARG A 601       4.846  62.412 151.725  1.00  0.92           N  
ATOM   4757  NH2 ARG A 601       3.178  62.175 153.243  1.00  0.92           N  
ATOM   4758  N   THR A 602       2.628  62.936 144.338  1.00  0.95           N  
ATOM   4759  CA  THR A 602       3.575  62.936 143.229  1.00  0.95           C  
ATOM   4760  C   THR A 602       4.918  63.216 143.853  1.00  0.95           C  
ATOM   4761  O   THR A 602       5.180  64.331 144.302  1.00  0.95           O  
ATOM   4762  CB  THR A 602       3.327  64.009 142.171  1.00  0.95           C  
ATOM   4763  OG1 THR A 602       2.061  63.821 141.555  1.00  0.95           O  
ATOM   4764  CG2 THR A 602       4.365  63.918 141.040  1.00  0.95           C  
ATOM   4765  N   VAL A 603       5.801  62.202 143.917  1.00  0.96           N  
ATOM   4766  CA  VAL A 603       7.077  62.305 144.609  1.00  0.96           C  
ATOM   4767  C   VAL A 603       8.166  62.642 143.613  1.00  0.96           C  
ATOM   4768  O   VAL A 603       8.384  61.937 142.632  1.00  0.96           O  
ATOM   4769  CB  VAL A 603       7.450  61.049 145.393  1.00  0.96           C  
ATOM   4770  CG1 VAL A 603       8.719  61.320 146.230  1.00  0.96           C  
ATOM   4771  CG2 VAL A 603       6.285  60.669 146.329  1.00  0.96           C  
ATOM   4772  N   ILE A 604       8.865  63.766 143.823  1.00  0.95           N  
ATOM   4773  CA  ILE A 604       9.837  64.297 142.889  1.00  0.95           C  
ATOM   4774  C   ILE A 604      11.182  64.380 143.584  1.00  0.95           C  
ATOM   4775  O   ILE A 604      11.381  65.154 144.519  1.00  0.95           O  
ATOM   4776  CB  ILE A 604       9.433  65.677 142.367  1.00  0.95           C  
ATOM   4777  CG1 ILE A 604       8.006  65.644 141.758  1.00  0.95           C  
ATOM   4778  CG2 ILE A 604      10.477  66.161 141.335  1.00  0.95           C  
ATOM   4779  CD1 ILE A 604       7.447  67.027 141.405  1.00  0.95           C  
ATOM   4780  N   ILE A 605      12.167  63.584 143.130  1.00  0.97           N  
ATOM   4781  CA  ILE A 605      13.509  63.604 143.693  1.00  0.97           C  
ATOM   4782  C   ILE A 605      14.445  64.013 142.575  1.00  0.97           C  
ATOM   4783  O   ILE A 605      14.415  63.448 141.489  1.00  0.97           O  
ATOM   4784  CB  ILE A 605      13.944  62.267 144.299  1.00  0.97           C  
ATOM   4785  CG1 ILE A 605      12.893  61.757 145.318  1.00  0.97           C  
ATOM   4786  CG2 ILE A 605      15.325  62.456 144.972  1.00  0.97           C  
ATOM   4787  CD1 ILE A 605      13.182  60.357 145.881  1.00  0.97           C  
ATOM   4788  N   GLY A 606      15.289  65.043 142.759  1.00  0.98           N  
ATOM   4789  CA  GLY A 606      16.147  65.492 141.666  1.00  0.98           C  
ATOM   4790  C   GLY A 606      17.439  66.064 142.141  1.00  0.98           C  
ATOM   4791  O   GLY A 606      17.528  66.691 143.192  1.00  0.98           O  
ATOM   4792  N   GLY A 607      18.506  65.889 141.352  1.00  0.97           N  
ATOM   4793  CA  GLY A 607      19.805  66.370 141.772  1.00  0.97           C  
ATOM   4794  C   GLY A 607      20.911  65.700 141.036  1.00  0.97           C  
ATOM   4795  O   GLY A 607      20.763  64.612 140.492  1.00  0.97           O  
ATOM   4796  N   LYS A 608      22.082  66.349 141.014  1.00  0.92           N  
ATOM   4797  CA  LYS A 608      23.259  65.840 140.345  1.00  0.92           C  
ATOM   4798  C   LYS A 608      24.189  65.164 141.344  1.00  0.92           C  
ATOM   4799  O   LYS A 608      24.521  65.719 142.394  1.00  0.92           O  
ATOM   4800  CB  LYS A 608      23.989  66.994 139.607  1.00  0.92           C  
ATOM   4801  CG  LYS A 608      23.137  67.621 138.488  1.00  0.92           C  
ATOM   4802  CD  LYS A 608      23.843  68.764 137.733  1.00  0.92           C  
ATOM   4803  CE  LYS A 608      22.961  69.331 136.613  1.00  0.92           C  
ATOM   4804  NZ  LYS A 608      23.603  70.444 135.882  1.00  0.92           N  
ATOM   4805  N   ALA A 609      24.643  63.934 141.047  1.00  0.94           N  
ATOM   4806  CA  ALA A 609      25.700  63.274 141.788  1.00  0.94           C  
ATOM   4807  C   ALA A 609      27.053  63.753 141.277  1.00  0.94           C  
ATOM   4808  O   ALA A 609      27.188  64.141 140.121  1.00  0.94           O  
ATOM   4809  CB  ALA A 609      25.590  61.745 141.618  1.00  0.94           C  
ATOM   4810  N   ALA A 610      28.112  63.779 142.111  1.00  0.90           N  
ATOM   4811  CA  ALA A 610      29.452  64.014 141.590  1.00  0.90           C  
ATOM   4812  C   ALA A 610      29.931  62.850 140.689  1.00  0.90           C  
ATOM   4813  O   ALA A 610      29.589  61.707 140.995  1.00  0.90           O  
ATOM   4814  CB  ALA A 610      30.447  64.317 142.726  1.00  0.90           C  
ATOM   4815  N   PRO A 611      30.680  63.014 139.592  1.00  0.89           N  
ATOM   4816  CA  PRO A 611      30.855  61.955 138.595  1.00  0.89           C  
ATOM   4817  C   PRO A 611      31.522  60.676 139.067  1.00  0.89           C  
ATOM   4818  O   PRO A 611      31.161  59.608 138.571  1.00  0.89           O  
ATOM   4819  CB  PRO A 611      31.662  62.627 137.482  1.00  0.89           C  
ATOM   4820  CG  PRO A 611      31.150  64.063 137.520  1.00  0.89           C  
ATOM   4821  CD  PRO A 611      30.988  64.323 139.016  1.00  0.89           C  
ATOM   4822  N   GLY A 612      32.498  60.771 139.995  1.00  0.84           N  
ATOM   4823  CA  GLY A 612      33.170  59.629 140.618  1.00  0.84           C  
ATOM   4824  C   GLY A 612      32.477  59.100 141.848  1.00  0.84           C  
ATOM   4825  O   GLY A 612      32.910  58.128 142.460  1.00  0.84           O  
ATOM   4826  N   TYR A 613      31.372  59.735 142.275  1.00  0.88           N  
ATOM   4827  CA  TYR A 613      30.684  59.400 143.506  1.00  0.88           C  
ATOM   4828  C   TYR A 613      29.729  58.240 143.271  1.00  0.88           C  
ATOM   4829  O   TYR A 613      28.535  58.403 143.021  1.00  0.88           O  
ATOM   4830  CB  TYR A 613      29.963  60.672 144.017  1.00  0.88           C  
ATOM   4831  CG  TYR A 613      29.424  60.684 145.424  1.00  0.88           C  
ATOM   4832  CD1 TYR A 613      29.408  59.592 146.318  1.00  0.88           C  
ATOM   4833  CD2 TYR A 613      28.903  61.916 145.854  1.00  0.88           C  
ATOM   4834  CE1 TYR A 613      28.866  59.741 147.608  1.00  0.88           C  
ATOM   4835  CE2 TYR A 613      28.379  62.068 147.139  1.00  0.88           C  
ATOM   4836  CZ  TYR A 613      28.360  60.980 148.010  1.00  0.88           C  
ATOM   4837  OH  TYR A 613      27.873  61.173 149.308  1.00  0.88           O  
ATOM   4838  N   HIS A 614      30.275  57.010 143.368  1.00  0.89           N  
ATOM   4839  CA  HIS A 614      29.583  55.764 143.079  1.00  0.89           C  
ATOM   4840  C   HIS A 614      28.312  55.563 143.888  1.00  0.89           C  
ATOM   4841  O   HIS A 614      27.250  55.304 143.333  1.00  0.89           O  
ATOM   4842  CB  HIS A 614      30.550  54.580 143.331  1.00  0.89           C  
ATOM   4843  CG  HIS A 614      29.949  53.228 143.127  1.00  0.89           C  
ATOM   4844  ND1 HIS A 614      29.422  52.905 141.895  1.00  0.89           N  
ATOM   4845  CD2 HIS A 614      29.791  52.201 144.001  1.00  0.89           C  
ATOM   4846  CE1 HIS A 614      28.951  51.678 142.043  1.00  0.89           C  
ATOM   4847  NE2 HIS A 614      29.150  51.210 143.297  1.00  0.89           N  
ATOM   4848  N   MET A 615      28.359  55.776 145.219  1.00  0.91           N  
ATOM   4849  CA  MET A 615      27.202  55.617 146.085  1.00  0.91           C  
ATOM   4850  C   MET A 615      26.037  56.537 145.717  1.00  0.91           C  
ATOM   4851  O   MET A 615      24.887  56.113 145.639  1.00  0.91           O  
ATOM   4852  CB  MET A 615      27.627  55.824 147.560  1.00  0.91           C  
ATOM   4853  CG  MET A 615      26.546  55.469 148.599  1.00  0.91           C  
ATOM   4854  SD  MET A 615      26.079  53.710 148.605  1.00  0.91           S  
ATOM   4855  CE  MET A 615      24.301  54.048 148.610  1.00  0.91           C  
ATOM   4856  N   ALA A 616      26.316  57.816 145.395  1.00  0.96           N  
ATOM   4857  CA  ALA A 616      25.331  58.750 144.890  1.00  0.96           C  
ATOM   4858  C   ALA A 616      24.722  58.358 143.540  1.00  0.96           C  
ATOM   4859  O   ALA A 616      23.512  58.450 143.341  1.00  0.96           O  
ATOM   4860  CB  ALA A 616      25.964  60.148 144.810  1.00  0.96           C  
ATOM   4861  N   LYS A 617      25.536  57.862 142.583  1.00  0.92           N  
ATOM   4862  CA  LYS A 617      25.044  57.302 141.330  1.00  0.92           C  
ATOM   4863  C   LYS A 617      24.172  56.056 141.515  1.00  0.92           C  
ATOM   4864  O   LYS A 617      23.141  55.906 140.858  1.00  0.92           O  
ATOM   4865  CB  LYS A 617      26.201  57.048 140.326  1.00  0.92           C  
ATOM   4866  CG  LYS A 617      26.745  58.361 139.731  1.00  0.92           C  
ATOM   4867  CD  LYS A 617      27.783  58.171 138.605  1.00  0.92           C  
ATOM   4868  CE  LYS A 617      27.918  59.433 137.737  1.00  0.92           C  
ATOM   4869  NZ  LYS A 617      29.010  59.331 136.746  1.00  0.92           N  
ATOM   4870  N   MET A 618      24.528  55.155 142.456  1.00  0.93           N  
ATOM   4871  CA  MET A 618      23.686  54.039 142.867  1.00  0.93           C  
ATOM   4872  C   MET A 618      22.341  54.464 143.462  1.00  0.93           C  
ATOM   4873  O   MET A 618      21.309  53.860 143.169  1.00  0.93           O  
ATOM   4874  CB  MET A 618      24.417  53.101 143.865  1.00  0.93           C  
ATOM   4875  CG  MET A 618      25.645  52.369 143.279  1.00  0.93           C  
ATOM   4876  SD  MET A 618      25.355  51.474 141.723  1.00  0.93           S  
ATOM   4877  CE  MET A 618      24.226  50.218 142.380  1.00  0.93           C  
ATOM   4878  N   ILE A 619      22.302  55.541 144.283  1.00  0.96           N  
ATOM   4879  CA  ILE A 619      21.064  56.135 144.797  1.00  0.96           C  
ATOM   4880  C   ILE A 619      20.154  56.633 143.678  1.00  0.96           C  
ATOM   4881  O   ILE A 619      18.955  56.357 143.683  1.00  0.96           O  
ATOM   4882  CB  ILE A 619      21.331  57.258 145.811  1.00  0.96           C  
ATOM   4883  CG1 ILE A 619      22.000  56.685 147.081  1.00  0.96           C  
ATOM   4884  CG2 ILE A 619      20.027  58.000 146.196  1.00  0.96           C  
ATOM   4885  CD1 ILE A 619      22.609  57.754 148.000  1.00  0.96           C  
ATOM   4886  N   ILE A 620      20.699  57.319 142.647  1.00  0.96           N  
ATOM   4887  CA  ILE A 620      19.936  57.738 141.469  1.00  0.96           C  
ATOM   4888  C   ILE A 620      19.330  56.548 140.733  1.00  0.96           C  
ATOM   4889  O   ILE A 620      18.151  56.547 140.376  1.00  0.96           O  
ATOM   4890  CB  ILE A 620      20.788  58.568 140.501  1.00  0.96           C  
ATOM   4891  CG1 ILE A 620      21.228  59.885 141.185  1.00  0.96           C  
ATOM   4892  CG2 ILE A 620      20.013  58.863 139.192  1.00  0.96           C  
ATOM   4893  CD1 ILE A 620      22.201  60.725 140.349  1.00  0.96           C  
ATOM   4894  N   LYS A 621      20.110  55.466 140.535  1.00  0.93           N  
ATOM   4895  CA  LYS A 621      19.615  54.253 139.911  1.00  0.93           C  
ATOM   4896  C   LYS A 621      18.529  53.539 140.709  1.00  0.93           C  
ATOM   4897  O   LYS A 621      17.554  53.035 140.151  1.00  0.93           O  
ATOM   4898  CB  LYS A 621      20.769  53.305 139.515  1.00  0.93           C  
ATOM   4899  CG  LYS A 621      20.485  52.535 138.213  1.00  0.93           C  
ATOM   4900  CD  LYS A 621      19.631  51.264 138.353  1.00  0.93           C  
ATOM   4901  CE  LYS A 621      18.897  50.897 137.056  1.00  0.93           C  
ATOM   4902  NZ  LYS A 621      17.674  51.727 136.896  1.00  0.93           N  
ATOM   4903  N   LEU A 622      18.650  53.504 142.050  1.00  0.94           N  
ATOM   4904  CA  LEU A 622      17.611  52.990 142.926  1.00  0.94           C  
ATOM   4905  C   LEU A 622      16.305  53.771 142.814  1.00  0.94           C  
ATOM   4906  O   LEU A 622      15.236  53.185 142.657  1.00  0.94           O  
ATOM   4907  CB  LEU A 622      18.108  52.995 144.394  1.00  0.94           C  
ATOM   4908  CG  LEU A 622      17.155  52.345 145.422  1.00  0.94           C  
ATOM   4909  CD1 LEU A 622      16.978  50.837 145.182  1.00  0.94           C  
ATOM   4910  CD2 LEU A 622      17.650  52.596 146.854  1.00  0.94           C  
ATOM   4911  N   ILE A 623      16.363  55.121 142.819  1.00  0.95           N  
ATOM   4912  CA  ILE A 623      15.190  55.977 142.656  1.00  0.95           C  
ATOM   4913  C   ILE A 623      14.513  55.795 141.306  1.00  0.95           C  
ATOM   4914  O   ILE A 623      13.291  55.664 141.234  1.00  0.95           O  
ATOM   4915  CB  ILE A 623      15.524  57.455 142.869  1.00  0.95           C  
ATOM   4916  CG1 ILE A 623      16.029  57.698 144.310  1.00  0.95           C  
ATOM   4917  CG2 ILE A 623      14.285  58.344 142.594  1.00  0.95           C  
ATOM   4918  CD1 ILE A 623      16.803  59.013 144.449  1.00  0.95           C  
ATOM   4919  N   THR A 624      15.279  55.739 140.193  1.00  0.93           N  
ATOM   4920  CA  THR A 624      14.704  55.495 138.868  1.00  0.93           C  
ATOM   4921  C   THR A 624      14.046  54.139 138.746  1.00  0.93           C  
ATOM   4922  O   THR A 624      12.900  54.046 138.329  1.00  0.93           O  
ATOM   4923  CB  THR A 624      15.676  55.656 137.704  1.00  0.93           C  
ATOM   4924  OG1 THR A 624      16.840  54.851 137.849  1.00  0.93           O  
ATOM   4925  CG2 THR A 624      16.143  57.117 137.625  1.00  0.93           C  
ATOM   4926  N   SER A 625      14.708  53.061 139.208  1.00  0.93           N  
ATOM   4927  CA  SER A 625      14.132  51.721 139.209  1.00  0.93           C  
ATOM   4928  C   SER A 625      12.871  51.585 140.053  1.00  0.93           C  
ATOM   4929  O   SER A 625      11.917  50.910 139.670  1.00  0.93           O  
ATOM   4930  CB  SER A 625      15.122  50.661 139.741  1.00  0.93           C  
ATOM   4931  OG  SER A 625      16.069  50.239 138.754  1.00  0.93           O  
ATOM   4932  N   VAL A 626      12.822  52.227 141.241  1.00  0.94           N  
ATOM   4933  CA  VAL A 626      11.603  52.323 142.040  1.00  0.94           C  
ATOM   4934  C   VAL A 626      10.509  53.078 141.297  1.00  0.94           C  
ATOM   4935  O   VAL A 626       9.359  52.644 141.258  1.00  0.94           O  
ATOM   4936  CB  VAL A 626      11.868  52.952 143.409  1.00  0.94           C  
ATOM   4937  CG1 VAL A 626      10.561  53.261 144.172  1.00  0.94           C  
ATOM   4938  CG2 VAL A 626      12.714  51.970 144.244  1.00  0.94           C  
ATOM   4939  N   ALA A 627      10.848  54.198 140.630  1.00  0.92           N  
ATOM   4940  CA  ALA A 627       9.922  54.955 139.815  1.00  0.92           C  
ATOM   4941  C   ALA A 627       9.328  54.172 138.651  1.00  0.92           C  
ATOM   4942  O   ALA A 627       8.116  54.205 138.443  1.00  0.92           O  
ATOM   4943  CB  ALA A 627      10.604  56.237 139.298  1.00  0.92           C  
ATOM   4944  N   ASP A 628      10.143  53.393 137.910  1.00  0.87           N  
ATOM   4945  CA  ASP A 628       9.681  52.537 136.831  1.00  0.87           C  
ATOM   4946  C   ASP A 628       8.646  51.503 137.295  1.00  0.87           C  
ATOM   4947  O   ASP A 628       7.607  51.309 136.662  1.00  0.87           O  
ATOM   4948  CB  ASP A 628      10.877  51.804 136.164  1.00  0.87           C  
ATOM   4949  CG  ASP A 628      11.839  52.785 135.509  1.00  0.87           C  
ATOM   4950  OD1 ASP A 628      11.343  53.727 134.840  1.00  0.87           O  
ATOM   4951  OD2 ASP A 628      13.075  52.578 135.645  1.00  0.87           O  
ATOM   4952  N   VAL A 629       8.875  50.844 138.451  1.00  0.91           N  
ATOM   4953  CA  VAL A 629       7.900  49.939 139.051  1.00  0.91           C  
ATOM   4954  C   VAL A 629       6.641  50.644 139.562  1.00  0.91           C  
ATOM   4955  O   VAL A 629       5.521  50.240 139.256  1.00  0.91           O  
ATOM   4956  CB  VAL A 629       8.537  49.115 140.173  1.00  0.91           C  
ATOM   4957  CG1 VAL A 629       7.507  48.191 140.861  1.00  0.91           C  
ATOM   4958  CG2 VAL A 629       9.669  48.257 139.573  1.00  0.91           C  
ATOM   4959  N   VAL A 630       6.778  51.745 140.334  1.00  0.91           N  
ATOM   4960  CA  VAL A 630       5.643  52.460 140.918  1.00  0.91           C  
ATOM   4961  C   VAL A 630       4.754  53.140 139.884  1.00  0.91           C  
ATOM   4962  O   VAL A 630       3.528  53.052 139.936  1.00  0.91           O  
ATOM   4963  CB  VAL A 630       6.097  53.479 141.967  1.00  0.91           C  
ATOM   4964  CG1 VAL A 630       4.906  54.295 142.514  1.00  0.91           C  
ATOM   4965  CG2 VAL A 630       6.766  52.738 143.142  1.00  0.91           C  
ATOM   4966  N   ASN A 631       5.345  53.822 138.879  1.00  0.86           N  
ATOM   4967  CA  ASN A 631       4.602  54.575 137.880  1.00  0.86           C  
ATOM   4968  C   ASN A 631       3.676  53.731 137.024  1.00  0.86           C  
ATOM   4969  O   ASN A 631       2.598  54.195 136.648  1.00  0.86           O  
ATOM   4970  CB  ASN A 631       5.539  55.362 136.928  1.00  0.86           C  
ATOM   4971  CG  ASN A 631       6.129  56.558 137.662  1.00  0.86           C  
ATOM   4972  OD1 ASN A 631       5.484  57.174 138.514  1.00  0.86           O  
ATOM   4973  ND2 ASN A 631       7.373  56.935 137.303  1.00  0.86           N  
ATOM   4974  N   ASN A 632       4.086  52.493 136.696  1.00  0.85           N  
ATOM   4975  CA  ASN A 632       3.393  51.645 135.746  1.00  0.85           C  
ATOM   4976  C   ASN A 632       2.497  50.601 136.407  1.00  0.85           C  
ATOM   4977  O   ASN A 632       1.846  49.818 135.718  1.00  0.85           O  
ATOM   4978  CB  ASN A 632       4.435  50.923 134.856  1.00  0.85           C  
ATOM   4979  CG  ASN A 632       5.162  51.952 133.997  1.00  0.85           C  
ATOM   4980  OD1 ASN A 632       4.570  52.580 133.119  1.00  0.85           O  
ATOM   4981  ND2 ASN A 632       6.476  52.149 134.241  1.00  0.85           N  
ATOM   4982  N   ASP A 633       2.408  50.556 137.753  1.00  0.87           N  
ATOM   4983  CA  ASP A 633       1.571  49.586 138.432  1.00  0.87           C  
ATOM   4984  C   ASP A 633       0.062  49.925 138.349  1.00  0.87           C  
ATOM   4985  O   ASP A 633      -0.343  51.035 138.717  1.00  0.87           O  
ATOM   4986  CB  ASP A 633       2.045  49.418 139.895  1.00  0.87           C  
ATOM   4987  CG  ASP A 633       1.432  48.193 140.526  1.00  0.87           C  
ATOM   4988  OD1 ASP A 633       2.156  47.180 140.701  1.00  0.87           O  
ATOM   4989  OD2 ASP A 633       0.219  48.200 140.866  1.00  0.87           O  
ATOM   4990  N   PRO A 634      -0.825  49.028 137.901  1.00  0.88           N  
ATOM   4991  CA  PRO A 634      -2.228  49.364 137.684  1.00  0.88           C  
ATOM   4992  C   PRO A 634      -3.022  49.341 138.977  1.00  0.88           C  
ATOM   4993  O   PRO A 634      -4.125  49.880 139.007  1.00  0.88           O  
ATOM   4994  CB  PRO A 634      -2.707  48.269 136.711  1.00  0.88           C  
ATOM   4995  CG  PRO A 634      -1.821  47.061 137.029  1.00  0.88           C  
ATOM   4996  CD  PRO A 634      -0.479  47.716 137.344  1.00  0.88           C  
ATOM   4997  N   MET A 635      -2.511  48.714 140.055  1.00  0.84           N  
ATOM   4998  CA  MET A 635      -3.171  48.678 141.348  1.00  0.84           C  
ATOM   4999  C   MET A 635      -2.933  49.977 142.105  1.00  0.84           C  
ATOM   5000  O   MET A 635      -3.796  50.503 142.814  1.00  0.84           O  
ATOM   5001  CB  MET A 635      -2.625  47.467 142.141  1.00  0.84           C  
ATOM   5002  CG  MET A 635      -3.352  47.146 143.455  1.00  0.84           C  
ATOM   5003  SD  MET A 635      -2.691  45.664 144.275  1.00  0.84           S  
ATOM   5004  CE  MET A 635      -3.493  44.433 143.206  1.00  0.84           C  
ATOM   5005  N   VAL A 636      -1.717  50.536 141.943  1.00  0.88           N  
ATOM   5006  CA  VAL A 636      -1.363  51.869 142.399  1.00  0.88           C  
ATOM   5007  C   VAL A 636      -2.086  52.958 141.619  1.00  0.88           C  
ATOM   5008  O   VAL A 636      -2.663  53.884 142.195  1.00  0.88           O  
ATOM   5009  CB  VAL A 636       0.144  52.078 142.319  1.00  0.88           C  
ATOM   5010  CG1 VAL A 636       0.545  53.488 142.794  1.00  0.88           C  
ATOM   5011  CG2 VAL A 636       0.832  51.014 143.196  1.00  0.88           C  
ATOM   5012  N   GLY A 637      -2.113  52.849 140.273  1.00  0.86           N  
ATOM   5013  CA  GLY A 637      -2.821  53.769 139.386  1.00  0.86           C  
ATOM   5014  C   GLY A 637      -2.434  55.224 139.522  1.00  0.86           C  
ATOM   5015  O   GLY A 637      -1.336  55.636 139.153  1.00  0.86           O  
ATOM   5016  N   SER A 638      -3.356  56.054 140.038  1.00  0.88           N  
ATOM   5017  CA  SER A 638      -3.177  57.486 140.234  1.00  0.88           C  
ATOM   5018  C   SER A 638      -2.906  57.861 141.683  1.00  0.88           C  
ATOM   5019  O   SER A 638      -2.765  59.043 142.000  1.00  0.88           O  
ATOM   5020  CB  SER A 638      -4.444  58.257 139.775  1.00  0.88           C  
ATOM   5021  OG  SER A 638      -5.621  57.719 140.385  1.00  0.88           O  
ATOM   5022  N   LYS A 639      -2.809  56.872 142.602  1.00  0.89           N  
ATOM   5023  CA  LYS A 639      -2.505  57.113 144.006  1.00  0.89           C  
ATOM   5024  C   LYS A 639      -1.090  57.640 144.253  1.00  0.89           C  
ATOM   5025  O   LYS A 639      -0.877  58.535 145.067  1.00  0.89           O  
ATOM   5026  CB  LYS A 639      -2.691  55.832 144.862  1.00  0.89           C  
ATOM   5027  CG  LYS A 639      -4.139  55.315 145.010  1.00  0.89           C  
ATOM   5028  CD  LYS A 639      -4.179  54.195 146.070  1.00  0.89           C  
ATOM   5029  CE  LYS A 639      -5.552  53.622 146.464  1.00  0.89           C  
ATOM   5030  NZ  LYS A 639      -5.987  52.552 145.534  1.00  0.89           N  
ATOM   5031  N   LEU A 640      -0.079  57.086 143.562  1.00  0.93           N  
ATOM   5032  CA  LEU A 640       1.306  57.448 143.791  1.00  0.93           C  
ATOM   5033  C   LEU A 640       2.040  57.475 142.465  1.00  0.93           C  
ATOM   5034  O   LEU A 640       1.953  56.531 141.681  1.00  0.93           O  
ATOM   5035  CB  LEU A 640       1.963  56.421 144.755  1.00  0.93           C  
ATOM   5036  CG  LEU A 640       3.428  56.682 145.163  1.00  0.93           C  
ATOM   5037  CD1 LEU A 640       3.591  57.994 145.940  1.00  0.93           C  
ATOM   5038  CD2 LEU A 640       3.952  55.509 146.008  1.00  0.93           C  
ATOM   5039  N   LYS A 641       2.777  58.567 142.177  1.00  0.89           N  
ATOM   5040  CA  LYS A 641       3.674  58.656 141.036  1.00  0.89           C  
ATOM   5041  C   LYS A 641       5.025  59.137 141.523  1.00  0.89           C  
ATOM   5042  O   LYS A 641       5.121  59.859 142.515  1.00  0.89           O  
ATOM   5043  CB  LYS A 641       3.183  59.626 139.924  1.00  0.89           C  
ATOM   5044  CG  LYS A 641       1.916  59.178 139.171  1.00  0.89           C  
ATOM   5045  CD  LYS A 641       2.049  57.789 138.517  1.00  0.89           C  
ATOM   5046  CE  LYS A 641       0.904  57.463 137.554  1.00  0.89           C  
ATOM   5047  NZ  LYS A 641       0.719  56.002 137.428  1.00  0.89           N  
ATOM   5048  N   VAL A 642       6.111  58.723 140.841  1.00  0.92           N  
ATOM   5049  CA  VAL A 642       7.475  59.028 141.246  1.00  0.92           C  
ATOM   5050  C   VAL A 642       8.251  59.562 140.052  1.00  0.92           C  
ATOM   5051  O   VAL A 642       8.315  58.939 138.995  1.00  0.92           O  
ATOM   5052  CB  VAL A 642       8.210  57.812 141.807  1.00  0.92           C  
ATOM   5053  CG1 VAL A 642       9.590  58.218 142.368  1.00  0.92           C  
ATOM   5054  CG2 VAL A 642       7.374  57.148 142.917  1.00  0.92           C  
ATOM   5055  N   ILE A 643       8.872  60.746 140.183  1.00  0.92           N  
ATOM   5056  CA  ILE A 643       9.638  61.384 139.125  1.00  0.92           C  
ATOM   5057  C   ILE A 643      11.066  61.585 139.607  1.00  0.92           C  
ATOM   5058  O   ILE A 643      11.303  62.109 140.696  1.00  0.92           O  
ATOM   5059  CB  ILE A 643       9.042  62.742 138.731  1.00  0.92           C  
ATOM   5060  CG1 ILE A 643       7.568  62.628 138.259  1.00  0.92           C  
ATOM   5061  CG2 ILE A 643       9.906  63.454 137.662  1.00  0.92           C  
ATOM   5062  CD1 ILE A 643       7.359  61.808 136.979  1.00  0.92           C  
ATOM   5063  N   PHE A 644      12.073  61.198 138.790  1.00  0.93           N  
ATOM   5064  CA  PHE A 644      13.433  61.667 138.987  1.00  0.93           C  
ATOM   5065  C   PHE A 644      13.607  62.921 138.137  1.00  0.93           C  
ATOM   5066  O   PHE A 644      13.356  62.901 136.935  1.00  0.93           O  
ATOM   5067  CB  PHE A 644      14.515  60.607 138.639  1.00  0.93           C  
ATOM   5068  CG  PHE A 644      15.874  61.084 139.101  1.00  0.93           C  
ATOM   5069  CD1 PHE A 644      16.266  60.923 140.441  1.00  0.93           C  
ATOM   5070  CD2 PHE A 644      16.726  61.780 138.226  1.00  0.93           C  
ATOM   5071  CE1 PHE A 644      17.480  61.448 140.901  1.00  0.93           C  
ATOM   5072  CE2 PHE A 644      17.939  62.312 138.682  1.00  0.93           C  
ATOM   5073  CZ  PHE A 644      18.317  62.143 140.019  1.00  0.93           C  
ATOM   5074  N   LEU A 645      14.004  64.054 138.746  1.00  0.93           N  
ATOM   5075  CA  LEU A 645      14.035  65.332 138.055  1.00  0.93           C  
ATOM   5076  C   LEU A 645      15.393  65.592 137.404  1.00  0.93           C  
ATOM   5077  O   LEU A 645      16.367  65.970 138.059  1.00  0.93           O  
ATOM   5078  CB  LEU A 645      13.650  66.497 139.009  1.00  0.93           C  
ATOM   5079  CG  LEU A 645      12.539  67.439 138.491  1.00  0.93           C  
ATOM   5080  CD1 LEU A 645      12.423  68.659 139.419  1.00  0.93           C  
ATOM   5081  CD2 LEU A 645      12.749  67.903 137.043  1.00  0.93           C  
ATOM   5082  N   GLU A 646      15.482  65.368 136.079  1.00  0.90           N  
ATOM   5083  CA  GLU A 646      16.694  65.527 135.296  1.00  0.90           C  
ATOM   5084  C   GLU A 646      17.219  66.950 135.160  1.00  0.90           C  
ATOM   5085  O   GLU A 646      16.492  67.898 134.874  1.00  0.90           O  
ATOM   5086  CB  GLU A 646      16.547  64.942 133.870  1.00  0.90           C  
ATOM   5087  CG  GLU A 646      16.182  63.441 133.874  1.00  0.90           C  
ATOM   5088  CD  GLU A 646      16.295  62.793 132.496  1.00  0.90           C  
ATOM   5089  OE1 GLU A 646      17.389  62.875 131.874  1.00  0.90           O  
ATOM   5090  OE2 GLU A 646      15.301  62.154 132.076  1.00  0.90           O  
ATOM   5091  N   ASN A 647      18.547  67.120 135.328  1.00  0.90           N  
ATOM   5092  CA  ASN A 647      19.277  68.347 135.071  1.00  0.90           C  
ATOM   5093  C   ASN A 647      18.853  69.502 135.964  1.00  0.90           C  
ATOM   5094  O   ASN A 647      18.691  70.641 135.516  1.00  0.90           O  
ATOM   5095  CB  ASN A 647      19.301  68.702 133.554  1.00  0.90           C  
ATOM   5096  CG  ASN A 647      20.478  69.600 133.182  1.00  0.90           C  
ATOM   5097  OD1 ASN A 647      21.495  69.677 133.879  1.00  0.90           O  
ATOM   5098  ND2 ASN A 647      20.357  70.298 132.031  1.00  0.90           N  
ATOM   5099  N   TYR A 648      18.706  69.204 137.275  1.00  0.92           N  
ATOM   5100  CA  TYR A 648      18.421  70.169 138.318  1.00  0.92           C  
ATOM   5101  C   TYR A 648      19.485  71.265 138.406  1.00  0.92           C  
ATOM   5102  O   TYR A 648      20.687  71.021 138.523  1.00  0.92           O  
ATOM   5103  CB  TYR A 648      18.214  69.457 139.685  1.00  0.92           C  
ATOM   5104  CG  TYR A 648      17.811  70.416 140.779  1.00  0.92           C  
ATOM   5105  CD1 TYR A 648      16.610  71.143 140.694  1.00  0.92           C  
ATOM   5106  CD2 TYR A 648      18.652  70.619 141.886  1.00  0.92           C  
ATOM   5107  CE1 TYR A 648      16.266  72.063 141.695  1.00  0.92           C  
ATOM   5108  CE2 TYR A 648      18.301  71.529 142.893  1.00  0.92           C  
ATOM   5109  CZ  TYR A 648      17.109  72.252 142.797  1.00  0.92           C  
ATOM   5110  OH  TYR A 648      16.723  73.094 143.859  1.00  0.92           O  
ATOM   5111  N   ARG A 649      19.017  72.514 138.293  1.00  0.88           N  
ATOM   5112  CA  ARG A 649      19.824  73.691 138.131  1.00  0.88           C  
ATOM   5113  C   ARG A 649      18.896  74.850 138.404  1.00  0.88           C  
ATOM   5114  O   ARG A 649      17.709  74.638 138.657  1.00  0.88           O  
ATOM   5115  CB  ARG A 649      20.436  73.780 136.713  1.00  0.88           C  
ATOM   5116  CG  ARG A 649      19.381  73.959 135.609  1.00  0.88           C  
ATOM   5117  CD  ARG A 649      19.893  73.611 134.214  1.00  0.88           C  
ATOM   5118  NE  ARG A 649      18.850  74.101 133.275  1.00  0.88           N  
ATOM   5119  CZ  ARG A 649      17.713  73.467 132.962  1.00  0.88           C  
ATOM   5120  NH1 ARG A 649      17.463  72.219 133.349  1.00  0.88           N  
ATOM   5121  NH2 ARG A 649      16.793  74.131 132.268  1.00  0.88           N  
ATOM   5122  N   VAL A 650      19.394  76.099 138.371  1.00  0.94           N  
ATOM   5123  CA  VAL A 650      18.642  77.281 138.763  1.00  0.94           C  
ATOM   5124  C   VAL A 650      17.345  77.491 137.980  1.00  0.94           C  
ATOM   5125  O   VAL A 650      16.289  77.641 138.592  1.00  0.94           O  
ATOM   5126  CB  VAL A 650      19.528  78.518 138.678  1.00  0.94           C  
ATOM   5127  CG1 VAL A 650      18.785  79.767 139.187  1.00  0.94           C  
ATOM   5128  CG2 VAL A 650      20.807  78.305 139.515  1.00  0.94           C  
ATOM   5129  N   SER A 651      17.347  77.393 136.630  1.00  0.93           N  
ATOM   5130  CA  SER A 651      16.131  77.601 135.839  1.00  0.93           C  
ATOM   5131  C   SER A 651      15.110  76.474 135.916  1.00  0.93           C  
ATOM   5132  O   SER A 651      13.964  76.608 135.476  1.00  0.93           O  
ATOM   5133  CB  SER A 651      16.410  77.917 134.345  1.00  0.93           C  
ATOM   5134  OG  SER A 651      16.862  76.784 133.597  1.00  0.93           O  
ATOM   5135  N   LEU A 652      15.507  75.314 136.476  1.00  0.93           N  
ATOM   5136  CA  LEU A 652      14.594  74.244 136.836  1.00  0.93           C  
ATOM   5137  C   LEU A 652      14.054  74.427 138.252  1.00  0.93           C  
ATOM   5138  O   LEU A 652      12.875  74.205 138.522  1.00  0.93           O  
ATOM   5139  CB  LEU A 652      15.267  72.861 136.681  1.00  0.93           C  
ATOM   5140  CG  LEU A 652      14.372  71.808 135.993  1.00  0.93           C  
ATOM   5141  CD1 LEU A 652      15.134  70.489 135.871  1.00  0.93           C  
ATOM   5142  CD2 LEU A 652      13.028  71.572 136.701  1.00  0.93           C  
ATOM   5143  N   ALA A 653      14.901  74.894 139.193  1.00  0.98           N  
ATOM   5144  CA  ALA A 653      14.534  75.222 140.559  1.00  0.98           C  
ATOM   5145  C   ALA A 653      13.471  76.307 140.637  1.00  0.98           C  
ATOM   5146  O   ALA A 653      12.511  76.208 141.397  1.00  0.98           O  
ATOM   5147  CB  ALA A 653      15.793  75.649 141.339  1.00  0.98           C  
ATOM   5148  N   GLU A 654      13.589  77.333 139.775  1.00  0.93           N  
ATOM   5149  CA  GLU A 654      12.590  78.363 139.560  1.00  0.93           C  
ATOM   5150  C   GLU A 654      11.227  77.809 139.140  1.00  0.93           C  
ATOM   5151  O   GLU A 654      10.187  78.324 139.531  1.00  0.93           O  
ATOM   5152  CB  GLU A 654      13.126  79.366 138.507  1.00  0.93           C  
ATOM   5153  CG  GLU A 654      14.311  80.214 139.047  1.00  0.93           C  
ATOM   5154  CD  GLU A 654      15.164  80.891 137.974  1.00  0.93           C  
ATOM   5155  OE1 GLU A 654      16.075  81.660 138.387  1.00  0.93           O  
ATOM   5156  OE2 GLU A 654      14.973  80.646 136.759  1.00  0.93           O  
ATOM   5157  N   LYS A 655      11.183  76.723 138.345  1.00  0.92           N  
ATOM   5158  CA  LYS A 655       9.934  76.078 137.973  1.00  0.92           C  
ATOM   5159  C   LYS A 655       9.326  75.170 139.044  1.00  0.92           C  
ATOM   5160  O   LYS A 655       8.130  75.237 139.314  1.00  0.92           O  
ATOM   5161  CB  LYS A 655      10.151  75.234 136.695  1.00  0.92           C  
ATOM   5162  CG  LYS A 655      10.544  76.078 135.476  1.00  0.92           C  
ATOM   5163  CD  LYS A 655      10.968  75.202 134.288  1.00  0.92           C  
ATOM   5164  CE  LYS A 655      11.204  75.978 132.990  1.00  0.92           C  
ATOM   5165  NZ  LYS A 655      12.176  77.072 133.192  1.00  0.92           N  
ATOM   5166  N   VAL A 656      10.122  74.272 139.668  1.00  0.95           N  
ATOM   5167  CA  VAL A 656       9.597  73.285 140.614  1.00  0.95           C  
ATOM   5168  C   VAL A 656       9.177  73.853 141.968  1.00  0.95           C  
ATOM   5169  O   VAL A 656       8.125  73.507 142.505  1.00  0.95           O  
ATOM   5170  CB  VAL A 656      10.513  72.062 140.756  1.00  0.95           C  
ATOM   5171  CG1 VAL A 656      11.863  72.398 141.417  1.00  0.95           C  
ATOM   5172  CG2 VAL A 656       9.789  70.929 141.514  1.00  0.95           C  
ATOM   5173  N   ILE A 657       9.967  74.778 142.553  1.00  0.97           N  
ATOM   5174  CA  ILE A 657       9.762  75.294 143.905  1.00  0.97           C  
ATOM   5175  C   ILE A 657       8.410  75.991 144.148  1.00  0.97           C  
ATOM   5176  O   ILE A 657       7.804  75.731 145.193  1.00  0.97           O  
ATOM   5177  CB  ILE A 657      10.970  76.128 144.357  1.00  0.97           C  
ATOM   5178  CG1 ILE A 657      12.229  75.224 144.435  1.00  0.97           C  
ATOM   5179  CG2 ILE A 657      10.700  76.821 145.710  1.00  0.97           C  
ATOM   5180  CD1 ILE A 657      13.536  75.984 144.690  1.00  0.97           C  
ATOM   5181  N   PRO A 658       7.836  76.825 143.274  1.00  0.98           N  
ATOM   5182  CA  PRO A 658       6.480  77.349 143.437  1.00  0.98           C  
ATOM   5183  C   PRO A 658       5.387  76.300 143.504  1.00  0.98           C  
ATOM   5184  O   PRO A 658       4.392  76.509 144.203  1.00  0.98           O  
ATOM   5185  CB  PRO A 658       6.293  78.258 142.215  1.00  0.98           C  
ATOM   5186  CG  PRO A 658       7.704  78.753 141.926  1.00  0.98           C  
ATOM   5187  CD  PRO A 658       8.551  77.520 142.202  1.00  0.98           C  
ATOM   5188  N   ALA A 659       5.529  75.186 142.766  1.00  0.96           N  
ATOM   5189  CA  ALA A 659       4.548  74.125 142.685  1.00  0.96           C  
ATOM   5190  C   ALA A 659       4.517  73.207 143.901  1.00  0.96           C  
ATOM   5191  O   ALA A 659       3.473  72.678 144.263  1.00  0.96           O  
ATOM   5192  CB  ALA A 659       4.824  73.301 141.415  1.00  0.96           C  
ATOM   5193  N   THR A 660       5.659  73.004 144.578  1.00  0.97           N  
ATOM   5194  CA  THR A 660       5.804  72.101 145.721  1.00  0.97           C  
ATOM   5195  C   THR A 660       4.855  72.336 146.887  1.00  0.97           C  
ATOM   5196  O   THR A 660       4.719  73.460 147.371  1.00  0.97           O  
ATOM   5197  CB  THR A 660       7.217  72.195 146.274  1.00  0.97           C  
ATOM   5198  OG1 THR A 660       8.129  71.791 145.272  1.00  0.97           O  
ATOM   5199  CG2 THR A 660       7.468  71.274 147.470  1.00  0.97           C  
ATOM   5200  N   ASP A 661       4.199  71.267 147.393  1.00  0.97           N  
ATOM   5201  CA  ASP A 661       3.430  71.296 148.625  1.00  0.97           C  
ATOM   5202  C   ASP A 661       4.294  70.908 149.828  1.00  0.97           C  
ATOM   5203  O   ASP A 661       4.259  71.562 150.870  1.00  0.97           O  
ATOM   5204  CB  ASP A 661       2.241  70.307 148.560  1.00  0.97           C  
ATOM   5205  CG  ASP A 661       1.311  70.630 147.415  1.00  0.97           C  
ATOM   5206  OD1 ASP A 661       0.677  71.708 147.397  1.00  0.97           O  
ATOM   5207  OD2 ASP A 661       1.172  69.749 146.530  1.00  0.97           O  
ATOM   5208  N   LEU A 662       5.106  69.831 149.704  1.00  0.97           N  
ATOM   5209  CA  LEU A 662       5.929  69.308 150.787  1.00  0.97           C  
ATOM   5210  C   LEU A 662       7.415  69.352 150.447  1.00  0.97           C  
ATOM   5211  O   LEU A 662       7.864  68.922 149.386  1.00  0.97           O  
ATOM   5212  CB  LEU A 662       5.537  67.856 151.161  1.00  0.97           C  
ATOM   5213  CG  LEU A 662       6.209  67.301 152.439  1.00  0.97           C  
ATOM   5214  CD1 LEU A 662       5.756  68.044 153.706  1.00  0.97           C  
ATOM   5215  CD2 LEU A 662       5.951  65.795 152.578  1.00  0.97           C  
ATOM   5216  N   SER A 663       8.212  69.912 151.373  1.00  0.98           N  
ATOM   5217  CA  SER A 663       9.638  70.172 151.254  1.00  0.98           C  
ATOM   5218  C   SER A 663      10.425  69.209 152.118  1.00  0.98           C  
ATOM   5219  O   SER A 663      10.351  69.246 153.346  1.00  0.98           O  
ATOM   5220  CB  SER A 663       9.896  71.633 151.729  1.00  0.98           C  
ATOM   5221  OG  SER A 663      11.253  71.977 152.036  1.00  0.98           O  
ATOM   5222  N   GLU A 664      11.215  68.327 151.480  1.00  0.96           N  
ATOM   5223  CA  GLU A 664      11.991  67.295 152.143  1.00  0.96           C  
ATOM   5224  C   GLU A 664      13.384  67.757 152.557  1.00  0.96           C  
ATOM   5225  O   GLU A 664      14.265  68.000 151.725  1.00  0.96           O  
ATOM   5226  CB  GLU A 664      12.145  66.114 151.163  1.00  0.96           C  
ATOM   5227  CG  GLU A 664      10.919  65.178 151.114  1.00  0.96           C  
ATOM   5228  CD  GLU A 664      10.876  64.275 152.330  1.00  0.96           C  
ATOM   5229  OE1 GLU A 664      11.801  64.335 153.174  1.00  0.96           O  
ATOM   5230  OE2 GLU A 664       9.922  63.469 152.434  1.00  0.96           O  
ATOM   5231  N   GLN A 665      13.639  67.890 153.876  1.00  0.94           N  
ATOM   5232  CA  GLN A 665      14.866  68.456 154.423  1.00  0.94           C  
ATOM   5233  C   GLN A 665      15.399  67.597 155.558  1.00  0.94           C  
ATOM   5234  O   GLN A 665      15.538  68.017 156.703  1.00  0.94           O  
ATOM   5235  CB  GLN A 665      14.666  69.919 154.892  1.00  0.94           C  
ATOM   5236  CG  GLN A 665      14.008  70.833 153.829  1.00  0.94           C  
ATOM   5237  CD  GLN A 665      14.766  70.904 152.501  1.00  0.94           C  
ATOM   5238  OE1 GLN A 665      15.949  70.582 152.352  1.00  0.94           O  
ATOM   5239  NE2 GLN A 665      14.032  71.334 151.449  1.00  0.94           N  
ATOM   5240  N   ILE A 666      15.689  66.328 155.237  1.00  0.95           N  
ATOM   5241  CA  ILE A 666      15.788  65.234 156.186  1.00  0.95           C  
ATOM   5242  C   ILE A 666      17.193  64.796 156.573  1.00  0.95           C  
ATOM   5243  O   ILE A 666      17.392  63.680 157.060  1.00  0.95           O  
ATOM   5244  CB  ILE A 666      15.028  64.048 155.612  1.00  0.95           C  
ATOM   5245  CG1 ILE A 666      15.544  63.603 154.219  1.00  0.95           C  
ATOM   5246  CG2 ILE A 666      13.552  64.475 155.552  1.00  0.95           C  
ATOM   5247  CD1 ILE A 666      14.746  62.429 153.643  1.00  0.95           C  
ATOM   5248  N   SER A 667      18.208  65.662 156.384  1.00  0.95           N  
ATOM   5249  CA  SER A 667      19.616  65.412 156.688  1.00  0.95           C  
ATOM   5250  C   SER A 667      19.909  64.944 158.106  1.00  0.95           C  
ATOM   5251  O   SER A 667      19.147  65.167 159.043  1.00  0.95           O  
ATOM   5252  CB  SER A 667      20.499  66.647 156.394  1.00  0.95           C  
ATOM   5253  OG  SER A 667      19.978  67.796 157.058  1.00  0.95           O  
ATOM   5254  N   THR A 668      21.016  64.215 158.330  1.00  0.94           N  
ATOM   5255  CA  THR A 668      21.365  63.763 159.679  1.00  0.94           C  
ATOM   5256  C   THR A 668      21.734  64.933 160.564  1.00  0.94           C  
ATOM   5257  O   THR A 668      22.594  65.714 160.178  1.00  0.94           O  
ATOM   5258  CB  THR A 668      22.549  62.809 159.709  1.00  0.94           C  
ATOM   5259  OG1 THR A 668      22.431  61.853 158.675  1.00  0.94           O  
ATOM   5260  CG2 THR A 668      22.604  62.025 161.028  1.00  0.94           C  
ATOM   5261  N   ALA A 669      21.117  65.101 161.756  1.00  0.93           N  
ATOM   5262  CA  ALA A 669      21.319  66.276 162.592  1.00  0.93           C  
ATOM   5263  C   ALA A 669      22.778  66.565 162.955  1.00  0.93           C  
ATOM   5264  O   ALA A 669      23.412  65.823 163.706  1.00  0.93           O  
ATOM   5265  CB  ALA A 669      20.449  66.177 163.861  1.00  0.93           C  
ATOM   5266  N   GLY A 670      23.343  67.653 162.381  1.00  0.91           N  
ATOM   5267  CA  GLY A 670      24.757  67.975 162.464  1.00  0.91           C  
ATOM   5268  C   GLY A 670      25.494  67.841 161.158  1.00  0.91           C  
ATOM   5269  O   GLY A 670      26.718  67.735 161.178  1.00  0.91           O  
ATOM   5270  N   THR A 671      24.814  67.811 159.987  1.00  0.91           N  
ATOM   5271  CA  THR A 671      25.508  67.547 158.716  1.00  0.91           C  
ATOM   5272  C   THR A 671      25.190  68.511 157.595  1.00  0.91           C  
ATOM   5273  O   THR A 671      26.075  68.826 156.800  1.00  0.91           O  
ATOM   5274  CB  THR A 671      25.306  66.136 158.154  1.00  0.91           C  
ATOM   5275  OG1 THR A 671      23.953  65.808 157.866  1.00  0.91           O  
ATOM   5276  CG2 THR A 671      25.805  65.087 159.151  1.00  0.91           C  
ATOM   5277  N   GLU A 672      23.969  69.069 157.508  1.00  0.90           N  
ATOM   5278  CA  GLU A 672      23.679  70.143 156.577  1.00  0.90           C  
ATOM   5279  C   GLU A 672      23.992  71.442 157.288  1.00  0.90           C  
ATOM   5280  O   GLU A 672      23.419  71.780 158.319  1.00  0.90           O  
ATOM   5281  CB  GLU A 672      22.202  70.105 156.106  1.00  0.90           C  
ATOM   5282  CG  GLU A 672      21.772  71.128 155.015  1.00  0.90           C  
ATOM   5283  CD  GLU A 672      22.200  70.769 153.599  1.00  0.90           C  
ATOM   5284  OE1 GLU A 672      21.785  69.701 153.068  1.00  0.90           O  
ATOM   5285  OE2 GLU A 672      22.947  71.568 152.972  1.00  0.90           O  
ATOM   5286  N   ALA A 673      24.955  72.230 156.774  1.00  0.93           N  
ATOM   5287  CA  ALA A 673      25.466  73.378 157.501  1.00  0.93           C  
ATOM   5288  C   ALA A 673      24.461  74.512 157.654  1.00  0.93           C  
ATOM   5289  O   ALA A 673      24.543  75.325 158.570  1.00  0.93           O  
ATOM   5290  CB  ALA A 673      26.722  73.907 156.794  1.00  0.93           C  
ATOM   5291  N   SER A 674      23.455  74.560 156.765  1.00  0.95           N  
ATOM   5292  CA  SER A 674      22.436  75.593 156.787  1.00  0.95           C  
ATOM   5293  C   SER A 674      21.382  75.253 155.765  1.00  0.95           C  
ATOM   5294  O   SER A 674      20.188  75.176 156.060  1.00  0.95           O  
ATOM   5295  CB  SER A 674      23.014  76.990 156.437  1.00  0.95           C  
ATOM   5296  OG  SER A 674      22.083  78.042 156.681  1.00  0.95           O  
ATOM   5297  N   GLY A 675      21.841  74.966 154.529  1.00  0.93           N  
ATOM   5298  CA  GLY A 675      21.001  74.859 153.349  1.00  0.93           C  
ATOM   5299  C   GLY A 675      20.562  76.205 152.822  1.00  0.93           C  
ATOM   5300  O   GLY A 675      20.706  77.241 153.464  1.00  0.93           O  
ATOM   5301  N   THR A 676      20.016  76.225 151.594  1.00  0.93           N  
ATOM   5302  CA  THR A 676      19.317  77.404 151.077  1.00  0.93           C  
ATOM   5303  C   THR A 676      18.076  76.994 150.312  1.00  0.93           C  
ATOM   5304  O   THR A 676      17.317  77.837 149.845  1.00  0.93           O  
ATOM   5305  CB  THR A 676      20.140  78.309 150.144  1.00  0.93           C  
ATOM   5306  OG1 THR A 676      20.706  77.613 149.039  1.00  0.93           O  
ATOM   5307  CG2 THR A 676      21.310  78.949 150.903  1.00  0.93           C  
ATOM   5308  N   GLY A 677      17.794  75.677 150.171  1.00  0.97           N  
ATOM   5309  CA  GLY A 677      16.617  75.193 149.448  1.00  0.97           C  
ATOM   5310  C   GLY A 677      15.382  75.208 150.297  1.00  0.97           C  
ATOM   5311  O   GLY A 677      14.290  75.519 149.836  1.00  0.97           O  
ATOM   5312  N   ASN A 678      15.567  74.922 151.592  1.00  0.95           N  
ATOM   5313  CA  ASN A 678      14.576  74.913 152.649  1.00  0.95           C  
ATOM   5314  C   ASN A 678      13.885  76.265 152.814  1.00  0.95           C  
ATOM   5315  O   ASN A 678      12.661  76.360 152.897  1.00  0.95           O  
ATOM   5316  CB  ASN A 678      15.247  74.417 153.976  1.00  0.95           C  
ATOM   5317  CG  ASN A 678      16.581  75.089 154.343  1.00  0.95           C  
ATOM   5318  OD1 ASN A 678      17.153  75.884 153.594  1.00  0.95           O  
ATOM   5319  ND2 ASN A 678      17.135  74.706 155.514  1.00  0.95           N  
ATOM   5320  N   MET A 679      14.678  77.348 152.768  1.00  0.95           N  
ATOM   5321  CA  MET A 679      14.226  78.725 152.772  1.00  0.95           C  
ATOM   5322  C   MET A 679      13.330  79.083 151.589  1.00  0.95           C  
ATOM   5323  O   MET A 679      12.301  79.739 151.738  1.00  0.95           O  
ATOM   5324  CB  MET A 679      15.466  79.649 152.753  1.00  0.95           C  
ATOM   5325  CG  MET A 679      16.422  79.407 153.935  1.00  0.95           C  
ATOM   5326  SD  MET A 679      17.932  80.405 153.850  1.00  0.95           S  
ATOM   5327  CE  MET A 679      18.625  79.626 155.333  1.00  0.95           C  
ATOM   5328  N   LYS A 680      13.689  78.631 150.367  1.00  0.95           N  
ATOM   5329  CA  LYS A 680      12.931  78.890 149.150  1.00  0.95           C  
ATOM   5330  C   LYS A 680      11.557  78.259 149.169  1.00  0.95           C  
ATOM   5331  O   LYS A 680      10.562  78.879 148.800  1.00  0.95           O  
ATOM   5332  CB  LYS A 680      13.673  78.360 147.902  1.00  0.95           C  
ATOM   5333  CG  LYS A 680      15.054  78.981 147.678  1.00  0.95           C  
ATOM   5334  CD  LYS A 680      15.852  78.196 146.631  1.00  0.95           C  
ATOM   5335  CE  LYS A 680      17.316  78.618 146.554  1.00  0.95           C  
ATOM   5336  NZ  LYS A 680      18.025  77.716 145.626  1.00  0.95           N  
ATOM   5337  N   PHE A 681      11.466  77.003 149.637  1.00  0.95           N  
ATOM   5338  CA  PHE A 681      10.209  76.307 149.823  1.00  0.95           C  
ATOM   5339  C   PHE A 681       9.293  76.982 150.831  1.00  0.95           C  
ATOM   5340  O   PHE A 681       8.099  77.136 150.587  1.00  0.95           O  
ATOM   5341  CB  PHE A 681      10.480  74.864 150.295  1.00  0.95           C  
ATOM   5342  CG  PHE A 681      11.014  74.010 149.179  1.00  0.95           C  
ATOM   5343  CD1 PHE A 681      10.273  73.814 148.003  1.00  0.95           C  
ATOM   5344  CD2 PHE A 681      12.246  73.353 149.317  1.00  0.95           C  
ATOM   5345  CE1 PHE A 681      10.772  73.001 146.979  1.00  0.95           C  
ATOM   5346  CE2 PHE A 681      12.743  72.528 148.302  1.00  0.95           C  
ATOM   5347  CZ  PHE A 681      12.002  72.354 147.130  1.00  0.95           C  
ATOM   5348  N   MET A 682       9.845  77.451 151.967  1.00  0.95           N  
ATOM   5349  CA  MET A 682       9.114  78.195 152.981  1.00  0.95           C  
ATOM   5350  C   MET A 682       8.514  79.497 152.450  1.00  0.95           C  
ATOM   5351  O   MET A 682       7.339  79.797 152.659  1.00  0.95           O  
ATOM   5352  CB  MET A 682      10.092  78.509 154.137  1.00  0.95           C  
ATOM   5353  CG  MET A 682       9.443  79.037 155.427  1.00  0.95           C  
ATOM   5354  SD  MET A 682      10.683  79.617 156.622  1.00  0.95           S  
ATOM   5355  CE  MET A 682       9.551  79.717 158.032  1.00  0.95           C  
ATOM   5356  N   LEU A 683       9.309  80.268 151.675  1.00  0.96           N  
ATOM   5357  CA  LEU A 683       8.886  81.487 151.000  1.00  0.96           C  
ATOM   5358  C   LEU A 683       7.781  81.249 149.965  1.00  0.96           C  
ATOM   5359  O   LEU A 683       6.833  82.016 149.822  1.00  0.96           O  
ATOM   5360  CB  LEU A 683      10.109  82.169 150.321  1.00  0.96           C  
ATOM   5361  CG  LEU A 683      10.263  83.680 150.608  1.00  0.96           C  
ATOM   5362  CD1 LEU A 683      11.420  84.263 149.781  1.00  0.96           C  
ATOM   5363  CD2 LEU A 683       8.982  84.480 150.344  1.00  0.96           C  
ATOM   5364  N   ASN A 684       7.869  80.123 149.227  1.00  0.96           N  
ATOM   5365  CA  ASN A 684       6.958  79.765 148.153  1.00  0.96           C  
ATOM   5366  C   ASN A 684       5.792  78.910 148.629  1.00  0.96           C  
ATOM   5367  O   ASN A 684       5.067  78.301 147.836  1.00  0.96           O  
ATOM   5368  CB  ASN A 684       7.725  79.015 147.040  1.00  0.96           C  
ATOM   5369  CG  ASN A 684       8.466  80.054 146.215  1.00  0.96           C  
ATOM   5370  OD1 ASN A 684       7.874  80.616 145.293  1.00  0.96           O  
ATOM   5371  ND2 ASN A 684       9.736  80.341 146.556  1.00  0.96           N  
ATOM   5372  N   GLY A 685       5.552  78.865 149.951  1.00  0.96           N  
ATOM   5373  CA  GLY A 685       4.346  78.281 150.511  1.00  0.96           C  
ATOM   5374  C   GLY A 685       4.290  76.784 150.492  1.00  0.96           C  
ATOM   5375  O   GLY A 685       3.248  76.203 150.211  1.00  0.96           O  
ATOM   5376  N   ALA A 686       5.414  76.123 150.783  1.00  0.99           N  
ATOM   5377  CA  ALA A 686       5.478  74.693 150.948  1.00  0.99           C  
ATOM   5378  C   ALA A 686       5.816  74.384 152.394  1.00  0.99           C  
ATOM   5379  O   ALA A 686       6.607  75.074 153.036  1.00  0.99           O  
ATOM   5380  CB  ALA A 686       6.561  74.096 150.033  1.00  0.99           C  
ATOM   5381  N   LEU A 687       5.207  73.329 152.960  1.00  0.96           N  
ATOM   5382  CA  LEU A 687       5.479  72.925 154.324  1.00  0.96           C  
ATOM   5383  C   LEU A 687       6.723  72.065 154.368  1.00  0.96           C  
ATOM   5384  O   LEU A 687       7.005  71.302 153.450  1.00  0.96           O  
ATOM   5385  CB  LEU A 687       4.278  72.179 154.952  1.00  0.96           C  
ATOM   5386  CG  LEU A 687       3.019  73.060 155.079  1.00  0.96           C  
ATOM   5387  CD1 LEU A 687       1.843  72.282 155.679  1.00  0.96           C  
ATOM   5388  CD2 LEU A 687       3.285  74.307 155.931  1.00  0.96           C  
ATOM   5389  N   THR A 688       7.532  72.180 155.435  1.00  0.97           N  
ATOM   5390  CA  THR A 688       8.829  71.508 155.493  1.00  0.97           C  
ATOM   5391  C   THR A 688       8.763  70.335 156.434  1.00  0.97           C  
ATOM   5392  O   THR A 688       8.373  70.476 157.592  1.00  0.97           O  
ATOM   5393  CB  THR A 688       9.978  72.438 155.893  1.00  0.97           C  
ATOM   5394  OG1 THR A 688      10.224  73.404 154.866  1.00  0.97           O  
ATOM   5395  CG2 THR A 688      11.293  71.670 156.101  1.00  0.97           C  
ATOM   5396  N   ILE A 689       9.163  69.142 155.947  1.00  0.96           N  
ATOM   5397  CA  ILE A 689       9.396  67.954 156.748  1.00  0.96           C  
ATOM   5398  C   ILE A 689      10.896  67.803 156.887  1.00  0.96           C  
ATOM   5399  O   ILE A 689      11.663  67.918 155.931  1.00  0.96           O  
ATOM   5400  CB  ILE A 689       8.717  66.689 156.204  1.00  0.96           C  
ATOM   5401  CG1 ILE A 689       8.959  65.466 157.121  1.00  0.96           C  
ATOM   5402  CG2 ILE A 689       9.150  66.396 154.752  1.00  0.96           C  
ATOM   5403  CD1 ILE A 689       8.037  64.278 156.831  1.00  0.96           C  
ATOM   5404  N   GLY A 690      11.399  67.626 158.120  1.00  0.97           N  
ATOM   5405  CA  GLY A 690      12.838  67.656 158.276  1.00  0.97           C  
ATOM   5406  C   GLY A 690      13.304  67.409 159.664  1.00  0.97           C  
ATOM   5407  O   GLY A 690      12.537  67.237 160.604  1.00  0.97           O  
ATOM   5408  N   THR A 691      14.625  67.389 159.816  1.00  0.95           N  
ATOM   5409  CA  THR A 691      15.313  67.177 161.072  1.00  0.95           C  
ATOM   5410  C   THR A 691      15.722  68.509 161.657  1.00  0.95           C  
ATOM   5411  O   THR A 691      15.757  69.536 160.975  1.00  0.95           O  
ATOM   5412  CB  THR A 691      16.573  66.354 160.863  1.00  0.95           C  
ATOM   5413  OG1 THR A 691      17.285  66.873 159.747  1.00  0.95           O  
ATOM   5414  CG2 THR A 691      16.172  64.910 160.532  1.00  0.95           C  
ATOM   5415  N   MET A 692      16.066  68.542 162.960  1.00  0.91           N  
ATOM   5416  CA  MET A 692      16.696  69.703 163.568  1.00  0.91           C  
ATOM   5417  C   MET A 692      18.172  69.808 163.206  1.00  0.91           C  
ATOM   5418  O   MET A 692      19.060  69.583 164.025  1.00  0.91           O  
ATOM   5419  CB  MET A 692      16.502  69.734 165.101  1.00  0.91           C  
ATOM   5420  CG  MET A 692      15.027  69.899 165.509  1.00  0.91           C  
ATOM   5421  SD  MET A 692      14.237  71.424 164.898  1.00  0.91           S  
ATOM   5422  CE  MET A 692      14.643  72.462 166.330  1.00  0.91           C  
ATOM   5423  N   ASP A 693      18.430  70.176 161.942  1.00  0.92           N  
ATOM   5424  CA  ASP A 693      19.731  70.337 161.350  1.00  0.92           C  
ATOM   5425  C   ASP A 693      19.748  71.698 160.665  1.00  0.92           C  
ATOM   5426  O   ASP A 693      18.700  72.319 160.474  1.00  0.92           O  
ATOM   5427  CB  ASP A 693      19.959  69.205 160.310  1.00  0.92           C  
ATOM   5428  CG  ASP A 693      21.422  69.036 159.963  1.00  0.92           C  
ATOM   5429  OD1 ASP A 693      21.722  68.348 158.958  1.00  0.92           O  
ATOM   5430  OD2 ASP A 693      22.280  69.560 160.716  1.00  0.92           O  
ATOM   5431  N   GLY A 694      20.944  72.200 160.292  1.00  0.95           N  
ATOM   5432  CA  GLY A 694      21.157  73.468 159.588  1.00  0.95           C  
ATOM   5433  C   GLY A 694      20.295  74.650 159.979  1.00  0.95           C  
ATOM   5434  O   GLY A 694      20.214  75.047 161.139  1.00  0.95           O  
ATOM   5435  N   ALA A 695      19.608  75.259 158.994  1.00  0.95           N  
ATOM   5436  CA  ALA A 695      18.719  76.372 159.242  1.00  0.95           C  
ATOM   5437  C   ALA A 695      17.278  75.920 159.457  1.00  0.95           C  
ATOM   5438  O   ALA A 695      16.397  76.741 159.700  1.00  0.95           O  
ATOM   5439  CB  ALA A 695      18.774  77.359 158.061  1.00  0.95           C  
ATOM   5440  N   ASN A 696      16.998  74.593 159.460  1.00  0.94           N  
ATOM   5441  CA  ASN A 696      15.683  74.044 159.784  1.00  0.94           C  
ATOM   5442  C   ASN A 696      15.292  74.381 161.217  1.00  0.94           C  
ATOM   5443  O   ASN A 696      14.137  74.673 161.516  1.00  0.94           O  
ATOM   5444  CB  ASN A 696      15.604  72.501 159.660  1.00  0.94           C  
ATOM   5445  CG  ASN A 696      15.940  71.986 158.264  1.00  0.94           C  
ATOM   5446  OD1 ASN A 696      15.951  72.698 157.257  1.00  0.94           O  
ATOM   5447  ND2 ASN A 696      16.194  70.657 158.207  1.00  0.94           N  
ATOM   5448  N   VAL A 697      16.294  74.381 162.126  1.00  0.94           N  
ATOM   5449  CA  VAL A 697      16.164  74.802 163.514  1.00  0.94           C  
ATOM   5450  C   VAL A 697      15.672  76.233 163.620  1.00  0.94           C  
ATOM   5451  O   VAL A 697      14.715  76.534 164.324  1.00  0.94           O  
ATOM   5452  CB  VAL A 697      17.517  74.716 164.227  1.00  0.94           C  
ATOM   5453  CG1 VAL A 697      17.400  75.161 165.702  1.00  0.94           C  
ATOM   5454  CG2 VAL A 697      18.037  73.271 164.148  1.00  0.94           C  
ATOM   5455  N   GLU A 698      16.288  77.148 162.852  1.00  0.92           N  
ATOM   5456  CA  GLU A 698      15.897  78.539 162.788  1.00  0.92           C  
ATOM   5457  C   GLU A 698      14.536  78.757 162.152  1.00  0.92           C  
ATOM   5458  O   GLU A 698      13.744  79.563 162.617  1.00  0.92           O  
ATOM   5459  CB  GLU A 698      16.998  79.383 162.113  1.00  0.92           C  
ATOM   5460  CG  GLU A 698      18.324  79.257 162.903  1.00  0.92           C  
ATOM   5461  CD  GLU A 698      19.317  80.365 162.609  1.00  0.92           C  
ATOM   5462  OE1 GLU A 698      18.917  81.555 162.720  1.00  0.92           O  
ATOM   5463  OE2 GLU A 698      20.502  80.056 162.324  1.00  0.92           O  
ATOM   5464  N   MET A 699      14.177  78.004 161.095  1.00  0.93           N  
ATOM   5465  CA  MET A 699      12.833  78.026 160.531  1.00  0.93           C  
ATOM   5466  C   MET A 699      11.755  77.621 161.540  1.00  0.93           C  
ATOM   5467  O   MET A 699      10.690  78.232 161.610  1.00  0.93           O  
ATOM   5468  CB  MET A 699      12.760  77.118 159.282  1.00  0.93           C  
ATOM   5469  CG  MET A 699      13.620  77.632 158.109  1.00  0.93           C  
ATOM   5470  SD  MET A 699      13.972  76.403 156.818  1.00  0.93           S  
ATOM   5471  CE  MET A 699      12.263  75.955 156.406  1.00  0.93           C  
ATOM   5472  N   ALA A 700      12.039  76.610 162.388  1.00  0.93           N  
ATOM   5473  CA  ALA A 700      11.241  76.276 163.552  1.00  0.93           C  
ATOM   5474  C   ALA A 700      11.185  77.381 164.615  1.00  0.93           C  
ATOM   5475  O   ALA A 700      10.136  77.610 165.209  1.00  0.93           O  
ATOM   5476  CB  ALA A 700      11.733  74.948 164.162  1.00  0.93           C  
ATOM   5477  N   GLU A 701      12.288  78.120 164.878  1.00  0.89           N  
ATOM   5478  CA  GLU A 701      12.254  79.293 165.749  1.00  0.89           C  
ATOM   5479  C   GLU A 701      11.334  80.406 165.244  1.00  0.89           C  
ATOM   5480  O   GLU A 701      10.480  80.888 165.986  1.00  0.89           O  
ATOM   5481  CB  GLU A 701      13.659  79.930 165.944  1.00  0.89           C  
ATOM   5482  CG  GLU A 701      14.691  79.053 166.695  1.00  0.89           C  
ATOM   5483  CD  GLU A 701      16.044  79.734 166.809  1.00  0.89           C  
ATOM   5484  OE1 GLU A 701      16.254  80.834 166.226  1.00  0.89           O  
ATOM   5485  OE2 GLU A 701      16.951  79.191 167.498  1.00  0.89           O  
ATOM   5486  N   GLU A 702      11.451  80.809 163.957  1.00  0.91           N  
ATOM   5487  CA  GLU A 702      10.626  81.868 163.389  1.00  0.91           C  
ATOM   5488  C   GLU A 702       9.151  81.508 163.272  1.00  0.91           C  
ATOM   5489  O   GLU A 702       8.260  82.309 163.553  1.00  0.91           O  
ATOM   5490  CB  GLU A 702      11.064  82.306 161.964  1.00  0.91           C  
ATOM   5491  CG  GLU A 702      12.572  82.541 161.728  1.00  0.91           C  
ATOM   5492  CD  GLU A 702      13.277  83.388 162.776  1.00  0.91           C  
ATOM   5493  OE1 GLU A 702      12.934  84.585 162.922  1.00  0.91           O  
ATOM   5494  OE2 GLU A 702      14.292  82.879 163.332  1.00  0.91           O  
ATOM   5495  N   ALA A 703       8.853  80.279 162.800  1.00  0.93           N  
ATOM   5496  CA  ALA A 703       7.503  79.907 162.436  1.00  0.93           C  
ATOM   5497  C   ALA A 703       6.802  79.043 163.464  1.00  0.93           C  
ATOM   5498  O   ALA A 703       5.613  78.776 163.317  1.00  0.93           O  
ATOM   5499  CB  ALA A 703       7.539  79.136 161.101  1.00  0.93           C  
ATOM   5500  N   GLY A 704       7.492  78.606 164.534  1.00  0.93           N  
ATOM   5501  CA  GLY A 704       6.973  77.659 165.518  1.00  0.93           C  
ATOM   5502  C   GLY A 704       7.248  76.224 165.134  1.00  0.93           C  
ATOM   5503  O   GLY A 704       7.079  75.815 163.986  1.00  0.93           O  
ATOM   5504  N   GLU A 705       7.652  75.381 166.114  1.00  0.87           N  
ATOM   5505  CA  GLU A 705       8.007  73.989 165.859  1.00  0.87           C  
ATOM   5506  C   GLU A 705       6.765  73.139 165.556  1.00  0.87           C  
ATOM   5507  O   GLU A 705       6.861  72.058 164.984  1.00  0.87           O  
ATOM   5508  CB  GLU A 705       8.892  73.357 166.992  1.00  0.87           C  
ATOM   5509  CG  GLU A 705       9.742  72.143 166.499  1.00  0.87           C  
ATOM   5510  CD  GLU A 705      10.556  71.360 167.535  1.00  0.87           C  
ATOM   5511  OE1 GLU A 705      11.607  71.840 168.033  1.00  0.87           O  
ATOM   5512  OE2 GLU A 705      10.208  70.174 167.776  1.00  0.87           O  
ATOM   5513  N   GLU A 706       5.538  73.639 165.855  1.00  0.87           N  
ATOM   5514  CA  GLU A 706       4.305  72.931 165.561  1.00  0.87           C  
ATOM   5515  C   GLU A 706       3.827  73.161 164.129  1.00  0.87           C  
ATOM   5516  O   GLU A 706       2.925  72.480 163.642  1.00  0.87           O  
ATOM   5517  CB  GLU A 706       3.196  73.265 166.611  1.00  0.87           C  
ATOM   5518  CG  GLU A 706       2.196  74.431 166.332  1.00  0.87           C  
ATOM   5519  CD  GLU A 706       2.772  75.842 166.304  1.00  0.87           C  
ATOM   5520  OE1 GLU A 706       1.962  76.786 166.046  1.00  0.87           O  
ATOM   5521  OE2 GLU A 706       4.006  76.017 166.456  1.00  0.87           O  
ATOM   5522  N   ASN A 707       4.457  74.111 163.399  1.00  0.91           N  
ATOM   5523  CA  ASN A 707       4.089  74.456 162.032  1.00  0.91           C  
ATOM   5524  C   ASN A 707       5.073  73.927 161.015  1.00  0.91           C  
ATOM   5525  O   ASN A 707       4.970  74.203 159.818  1.00  0.91           O  
ATOM   5526  CB  ASN A 707       4.016  75.981 161.847  1.00  0.91           C  
ATOM   5527  CG  ASN A 707       2.970  76.458 162.824  1.00  0.91           C  
ATOM   5528  OD1 ASN A 707       1.795  76.074 162.767  1.00  0.91           O  
ATOM   5529  ND2 ASN A 707       3.388  77.328 163.763  1.00  0.91           N  
ATOM   5530  N   LEU A 708       6.046  73.135 161.477  1.00  0.93           N  
ATOM   5531  CA  LEU A 708       6.967  72.416 160.637  1.00  0.93           C  
ATOM   5532  C   LEU A 708       6.823  70.961 161.015  1.00  0.93           C  
ATOM   5533  O   LEU A 708       6.493  70.606 162.143  1.00  0.93           O  
ATOM   5534  CB  LEU A 708       8.448  72.840 160.831  1.00  0.93           C  
ATOM   5535  CG  LEU A 708       8.914  74.042 159.981  1.00  0.93           C  
ATOM   5536  CD1 LEU A 708       8.374  75.391 160.475  1.00  0.93           C  
ATOM   5537  CD2 LEU A 708      10.449  74.085 159.934  1.00  0.93           C  
ATOM   5538  N   PHE A 709       7.087  70.050 160.070  1.00  0.93           N  
ATOM   5539  CA  PHE A 709       6.995  68.627 160.304  1.00  0.93           C  
ATOM   5540  C   PHE A 709       8.353  68.109 160.744  1.00  0.93           C  
ATOM   5541  O   PHE A 709       9.016  67.310 160.082  1.00  0.93           O  
ATOM   5542  CB  PHE A 709       6.459  67.917 159.043  1.00  0.93           C  
ATOM   5543  CG  PHE A 709       4.977  68.118 158.962  1.00  0.93           C  
ATOM   5544  CD1 PHE A 709       4.422  69.091 158.114  1.00  0.93           C  
ATOM   5545  CD2 PHE A 709       4.122  67.301 159.721  1.00  0.93           C  
ATOM   5546  CE1 PHE A 709       3.032  69.230 158.010  1.00  0.93           C  
ATOM   5547  CE2 PHE A 709       2.733  67.441 159.622  1.00  0.93           C  
ATOM   5548  CZ  PHE A 709       2.191  68.403 158.763  1.00  0.93           C  
ATOM   5549  N   ILE A 710       8.814  68.612 161.902  1.00  0.93           N  
ATOM   5550  CA  ILE A 710      10.037  68.191 162.555  1.00  0.93           C  
ATOM   5551  C   ILE A 710       9.973  66.744 163.031  1.00  0.93           C  
ATOM   5552  O   ILE A 710       8.978  66.282 163.589  1.00  0.93           O  
ATOM   5553  CB  ILE A 710      10.427  69.137 163.689  1.00  0.93           C  
ATOM   5554  CG1 ILE A 710      10.565  70.601 163.192  1.00  0.93           C  
ATOM   5555  CG2 ILE A 710      11.732  68.686 164.382  1.00  0.93           C  
ATOM   5556  CD1 ILE A 710      11.574  70.825 162.056  1.00  0.93           C  
ATOM   5557  N   PHE A 711      11.059  65.981 162.825  1.00  0.93           N  
ATOM   5558  CA  PHE A 711      11.156  64.625 163.310  1.00  0.93           C  
ATOM   5559  C   PHE A 711      12.603  64.281 163.604  1.00  0.93           C  
ATOM   5560  O   PHE A 711      13.525  65.053 163.340  1.00  0.93           O  
ATOM   5561  CB  PHE A 711      10.518  63.582 162.334  1.00  0.93           C  
ATOM   5562  CG  PHE A 711      11.313  63.387 161.066  1.00  0.93           C  
ATOM   5563  CD1 PHE A 711      12.268  62.357 160.976  1.00  0.93           C  
ATOM   5564  CD2 PHE A 711      11.170  64.272 159.989  1.00  0.93           C  
ATOM   5565  CE1 PHE A 711      13.095  62.244 159.856  1.00  0.93           C  
ATOM   5566  CE2 PHE A 711      11.981  64.145 158.857  1.00  0.93           C  
ATOM   5567  CZ  PHE A 711      12.950  63.137 158.795  1.00  0.93           C  
ATOM   5568  N   GLY A 712      12.803  63.064 164.139  1.00  0.94           N  
ATOM   5569  CA  GLY A 712      14.107  62.435 164.226  1.00  0.94           C  
ATOM   5570  C   GLY A 712      14.982  62.874 165.354  1.00  0.94           C  
ATOM   5571  O   GLY A 712      14.672  63.776 166.133  1.00  0.94           O  
ATOM   5572  N   MET A 713      16.115  62.172 165.475  1.00  0.89           N  
ATOM   5573  CA  MET A 713      17.135  62.452 166.461  1.00  0.89           C  
ATOM   5574  C   MET A 713      17.818  63.807 166.274  1.00  0.89           C  
ATOM   5575  O   MET A 713      18.132  64.246 165.166  1.00  0.89           O  
ATOM   5576  CB  MET A 713      18.139  61.280 166.560  1.00  0.89           C  
ATOM   5577  CG  MET A 713      18.789  60.844 165.242  1.00  0.89           C  
ATOM   5578  SD  MET A 713      19.948  59.469 165.482  1.00  0.89           S  
ATOM   5579  CE  MET A 713      20.114  59.230 163.699  1.00  0.89           C  
ATOM   5580  N   ARG A 714      18.037  64.532 167.387  1.00  0.83           N  
ATOM   5581  CA  ARG A 714      18.659  65.837 167.407  1.00  0.83           C  
ATOM   5582  C   ARG A 714      20.161  65.657 167.642  1.00  0.83           C  
ATOM   5583  O   ARG A 714      20.668  64.540 167.707  1.00  0.83           O  
ATOM   5584  CB  ARG A 714      17.921  66.777 168.413  1.00  0.83           C  
ATOM   5585  CG  ARG A 714      16.404  66.880 168.087  1.00  0.83           C  
ATOM   5586  CD  ARG A 714      15.557  67.828 168.958  1.00  0.83           C  
ATOM   5587  NE  ARG A 714      14.138  67.665 168.472  1.00  0.83           N  
ATOM   5588  CZ  ARG A 714      13.187  68.612 168.389  1.00  0.83           C  
ATOM   5589  NH1 ARG A 714      13.356  69.867 168.786  1.00  0.83           N  
ATOM   5590  NH2 ARG A 714      12.009  68.290 167.862  1.00  0.83           N  
ATOM   5591  N   ILE A 715      20.951  66.749 167.702  1.00  0.83           N  
ATOM   5592  CA  ILE A 715      22.415  66.687 167.673  1.00  0.83           C  
ATOM   5593  C   ILE A 715      23.055  65.839 168.783  1.00  0.83           C  
ATOM   5594  O   ILE A 715      23.904  64.982 168.524  1.00  0.83           O  
ATOM   5595  CB  ILE A 715      22.989  68.111 167.616  1.00  0.83           C  
ATOM   5596  CG1 ILE A 715      24.530  68.166 167.482  1.00  0.83           C  
ATOM   5597  CG2 ILE A 715      22.535  68.974 168.815  1.00  0.83           C  
ATOM   5598  CD1 ILE A 715      25.049  67.598 166.160  1.00  0.83           C  
ATOM   5599  N   ASP A 716      22.608  65.999 170.040  1.00  0.79           N  
ATOM   5600  CA  ASP A 716      23.023  65.220 171.187  1.00  0.79           C  
ATOM   5601  C   ASP A 716      22.623  63.748 171.100  1.00  0.79           C  
ATOM   5602  O   ASP A 716      23.397  62.852 171.443  1.00  0.79           O  
ATOM   5603  CB  ASP A 716      22.456  65.887 172.458  1.00  0.79           C  
ATOM   5604  CG  ASP A 716      22.867  67.348 172.423  1.00  0.79           C  
ATOM   5605  OD1 ASP A 716      24.050  67.643 172.731  1.00  0.79           O  
ATOM   5606  OD2 ASP A 716      22.014  68.165 171.987  1.00  0.79           O  
ATOM   5607  N   ASP A 717      21.410  63.457 170.587  1.00  0.83           N  
ATOM   5608  CA  ASP A 717      20.905  62.115 170.365  1.00  0.83           C  
ATOM   5609  C   ASP A 717      21.761  61.314 169.374  1.00  0.83           C  
ATOM   5610  O   ASP A 717      22.083  60.145 169.598  1.00  0.83           O  
ATOM   5611  CB  ASP A 717      19.465  62.169 169.808  1.00  0.83           C  
ATOM   5612  CG  ASP A 717      18.520  62.989 170.663  1.00  0.83           C  
ATOM   5613  OD1 ASP A 717      18.421  62.714 171.879  1.00  0.83           O  
ATOM   5614  OD2 ASP A 717      17.866  63.893 170.073  1.00  0.83           O  
ATOM   5615  N   VAL A 718      22.198  61.951 168.259  1.00  0.88           N  
ATOM   5616  CA  VAL A 718      23.115  61.356 167.286  1.00  0.88           C  
ATOM   5617  C   VAL A 718      24.446  60.994 167.931  1.00  0.88           C  
ATOM   5618  O   VAL A 718      24.930  59.870 167.804  1.00  0.88           O  
ATOM   5619  CB  VAL A 718      23.387  62.289 166.099  1.00  0.88           C  
ATOM   5620  CG1 VAL A 718      24.413  61.673 165.120  1.00  0.88           C  
ATOM   5621  CG2 VAL A 718      22.084  62.568 165.329  1.00  0.88           C  
ATOM   5622  N   ALA A 719      25.021  61.927 168.718  1.00  0.83           N  
ATOM   5623  CA  ALA A 719      26.250  61.730 169.460  1.00  0.83           C  
ATOM   5624  C   ALA A 719      26.158  60.619 170.504  1.00  0.83           C  
ATOM   5625  O   ALA A 719      27.075  59.817 170.680  1.00  0.83           O  
ATOM   5626  CB  ALA A 719      26.647  63.063 170.124  1.00  0.83           C  
ATOM   5627  N   ALA A 720      25.018  60.515 171.213  1.00  0.85           N  
ATOM   5628  CA  ALA A 720      24.719  59.417 172.107  1.00  0.85           C  
ATOM   5629  C   ALA A 720      24.671  58.053 171.416  1.00  0.85           C  
ATOM   5630  O   ALA A 720      25.192  57.066 171.936  1.00  0.85           O  
ATOM   5631  CB  ALA A 720      23.383  59.700 172.821  1.00  0.85           C  
ATOM   5632  N   LEU A 721      24.066  57.974 170.213  1.00  0.83           N  
ATOM   5633  CA  LEU A 721      24.049  56.780 169.386  1.00  0.83           C  
ATOM   5634  C   LEU A 721      25.422  56.378 168.854  1.00  0.83           C  
ATOM   5635  O   LEU A 721      25.783  55.204 168.903  1.00  0.83           O  
ATOM   5636  CB  LEU A 721      23.009  56.934 168.249  1.00  0.83           C  
ATOM   5637  CG  LEU A 721      22.697  55.664 167.422  1.00  0.83           C  
ATOM   5638  CD1 LEU A 721      22.376  54.440 168.296  1.00  0.83           C  
ATOM   5639  CD2 LEU A 721      21.515  55.936 166.478  1.00  0.83           C  
ATOM   5640  N   ASP A 722      26.261  57.335 168.398  1.00  0.80           N  
ATOM   5641  CA  ASP A 722      27.659  57.066 168.079  1.00  0.80           C  
ATOM   5642  C   ASP A 722      28.456  56.552 169.285  1.00  0.80           C  
ATOM   5643  O   ASP A 722      29.220  55.597 169.176  1.00  0.80           O  
ATOM   5644  CB  ASP A 722      28.346  58.322 167.480  1.00  0.80           C  
ATOM   5645  CG  ASP A 722      27.917  58.491 166.047  1.00  0.80           C  
ATOM   5646  OD1 ASP A 722      28.187  57.579 165.217  1.00  0.80           O  
ATOM   5647  OD2 ASP A 722      27.262  59.510 165.708  1.00  0.80           O  
ATOM   5648  N   LYS A 723      28.248  57.137 170.482  1.00  0.75           N  
ATOM   5649  CA  LYS A 723      28.838  56.682 171.732  1.00  0.75           C  
ATOM   5650  C   LYS A 723      28.439  55.265 172.176  1.00  0.75           C  
ATOM   5651  O   LYS A 723      29.268  54.514 172.683  1.00  0.75           O  
ATOM   5652  CB  LYS A 723      28.489  57.699 172.847  1.00  0.75           C  
ATOM   5653  CG  LYS A 723      29.252  57.493 174.167  1.00  0.75           C  
ATOM   5654  CD  LYS A 723      28.717  58.357 175.322  1.00  0.75           C  
ATOM   5655  CE  LYS A 723      27.340  57.898 175.817  1.00  0.75           C  
ATOM   5656  NZ  LYS A 723      26.899  58.730 176.959  1.00  0.75           N  
ATOM   5657  N   LYS A 724      27.156  54.857 172.014  1.00  0.75           N  
ATOM   5658  CA  LYS A 724      26.719  53.466 172.192  1.00  0.75           C  
ATOM   5659  C   LYS A 724      27.340  52.530 171.168  1.00  0.75           C  
ATOM   5660  O   LYS A 724      27.700  51.392 171.466  1.00  0.75           O  
ATOM   5661  CB  LYS A 724      25.161  53.327 172.085  1.00  0.75           C  
ATOM   5662  CG  LYS A 724      24.602  51.875 171.988  1.00  0.75           C  
ATOM   5663  CD  LYS A 724      23.056  51.796 171.927  1.00  0.75           C  
ATOM   5664  CE  LYS A 724      22.431  50.903 170.817  1.00  0.75           C  
ATOM   5665  NZ  LYS A 724      22.645  49.452 171.006  1.00  0.75           N  
ATOM   5666  N   GLY A 725      27.425  52.998 169.912  1.00  0.83           N  
ATOM   5667  CA  GLY A 725      27.677  52.166 168.755  1.00  0.83           C  
ATOM   5668  C   GLY A 725      26.389  51.957 168.007  1.00  0.83           C  
ATOM   5669  O   GLY A 725      25.387  51.471 168.531  1.00  0.83           O  
ATOM   5670  N   TYR A 726      26.390  52.320 166.716  1.00  0.83           N  
ATOM   5671  CA  TYR A 726      25.243  52.182 165.846  1.00  0.83           C  
ATOM   5672  C   TYR A 726      25.285  50.828 165.161  1.00  0.83           C  
ATOM   5673  O   TYR A 726      26.125  50.578 164.300  1.00  0.83           O  
ATOM   5674  CB  TYR A 726      25.267  53.336 164.798  1.00  0.83           C  
ATOM   5675  CG  TYR A 726      24.250  53.237 163.675  1.00  0.83           C  
ATOM   5676  CD1 TYR A 726      22.862  53.204 163.905  1.00  0.83           C  
ATOM   5677  CD2 TYR A 726      24.711  53.204 162.349  1.00  0.83           C  
ATOM   5678  CE1 TYR A 726      21.959  53.159 162.825  1.00  0.83           C  
ATOM   5679  CE2 TYR A 726      23.812  53.166 161.277  1.00  0.83           C  
ATOM   5680  CZ  TYR A 726      22.435  53.151 161.506  1.00  0.83           C  
ATOM   5681  OH  TYR A 726      21.547  53.183 160.403  1.00  0.83           O  
ATOM   5682  N   GLU A 727      24.339  49.934 165.504  1.00  0.80           N  
ATOM   5683  CA  GLU A 727      24.124  48.730 164.737  1.00  0.80           C  
ATOM   5684  C   GLU A 727      22.795  48.837 164.016  1.00  0.80           C  
ATOM   5685  O   GLU A 727      21.716  48.901 164.603  1.00  0.80           O  
ATOM   5686  CB  GLU A 727      24.194  47.435 165.575  1.00  0.80           C  
ATOM   5687  CG  GLU A 727      24.040  46.179 164.681  1.00  0.80           C  
ATOM   5688  CD  GLU A 727      24.404  44.853 165.343  1.00  0.80           C  
ATOM   5689  OE1 GLU A 727      24.054  43.820 164.711  1.00  0.80           O  
ATOM   5690  OE2 GLU A 727      25.042  44.848 166.418  1.00  0.80           O  
ATOM   5691  N   ALA A 728      22.841  48.849 162.670  1.00  0.90           N  
ATOM   5692  CA  ALA A 728      21.679  48.993 161.818  1.00  0.90           C  
ATOM   5693  C   ALA A 728      20.769  47.762 161.843  1.00  0.90           C  
ATOM   5694  O   ALA A 728      19.579  47.812 161.534  1.00  0.90           O  
ATOM   5695  CB  ALA A 728      22.195  49.258 160.395  1.00  0.90           C  
ATOM   5696  N   LYS A 729      21.323  46.613 162.276  1.00  0.79           N  
ATOM   5697  CA  LYS A 729      20.619  45.362 162.474  1.00  0.79           C  
ATOM   5698  C   LYS A 729      19.531  45.412 163.552  1.00  0.79           C  
ATOM   5699  O   LYS A 729      18.482  44.798 163.365  1.00  0.79           O  
ATOM   5700  CB  LYS A 729      21.625  44.206 162.708  1.00  0.79           C  
ATOM   5701  CG  LYS A 729      21.448  43.014 161.748  1.00  0.79           C  
ATOM   5702  CD  LYS A 729      22.436  41.857 162.017  1.00  0.79           C  
ATOM   5703  CE  LYS A 729      23.934  42.194 161.916  1.00  0.79           C  
ATOM   5704  NZ  LYS A 729      24.284  42.724 160.583  1.00  0.79           N  
ATOM   5705  N   GLU A 730      19.720  46.188 164.663  1.00  0.75           N  
ATOM   5706  CA  GLU A 730      18.709  46.372 165.713  1.00  0.75           C  
ATOM   5707  C   GLU A 730      17.395  46.916 165.129  1.00  0.75           C  
ATOM   5708  O   GLU A 730      16.302  46.424 165.405  1.00  0.75           O  
ATOM   5709  CB  GLU A 730      19.162  47.350 166.856  1.00  0.75           C  
ATOM   5710  CG  GLU A 730      20.334  46.888 167.756  1.00  0.75           C  
ATOM   5711  CD  GLU A 730      20.494  47.740 169.002  1.00  0.75           C  
ATOM   5712  OE1 GLU A 730      21.671  48.096 169.181  1.00  0.75           O  
ATOM   5713  OE2 GLU A 730      19.552  48.041 169.771  1.00  0.75           O  
ATOM   5714  N   TYR A 731      17.493  47.926 164.242  1.00  0.84           N  
ATOM   5715  CA  TYR A 731      16.377  48.542 163.539  1.00  0.84           C  
ATOM   5716  C   TYR A 731      15.658  47.665 162.513  1.00  0.84           C  
ATOM   5717  O   TYR A 731      14.433  47.698 162.420  1.00  0.84           O  
ATOM   5718  CB  TYR A 731      16.846  49.837 162.828  1.00  0.84           C  
ATOM   5719  CG  TYR A 731      17.312  50.839 163.846  1.00  0.84           C  
ATOM   5720  CD1 TYR A 731      18.679  50.992 164.140  1.00  0.84           C  
ATOM   5721  CD2 TYR A 731      16.374  51.618 164.543  1.00  0.84           C  
ATOM   5722  CE1 TYR A 731      19.097  51.905 165.118  1.00  0.84           C  
ATOM   5723  CE2 TYR A 731      16.791  52.530 165.523  1.00  0.84           C  
ATOM   5724  CZ  TYR A 731      18.154  52.675 165.805  1.00  0.84           C  
ATOM   5725  OH  TYR A 731      18.584  53.603 166.772  1.00  0.84           O  
ATOM   5726  N   TYR A 732      16.395  46.876 161.699  1.00  0.83           N  
ATOM   5727  CA  TYR A 732      15.839  46.072 160.609  1.00  0.83           C  
ATOM   5728  C   TYR A 732      14.823  45.018 161.057  1.00  0.83           C  
ATOM   5729  O   TYR A 732      13.721  44.954 160.518  1.00  0.83           O  
ATOM   5730  CB  TYR A 732      17.038  45.440 159.831  1.00  0.83           C  
ATOM   5731  CG  TYR A 732      16.703  44.344 158.838  1.00  0.83           C  
ATOM   5732  CD1 TYR A 732      16.201  44.614 157.550  1.00  0.83           C  
ATOM   5733  CD2 TYR A 732      16.943  43.009 159.199  1.00  0.83           C  
ATOM   5734  CE1 TYR A 732      15.975  43.564 156.640  1.00  0.83           C  
ATOM   5735  CE2 TYR A 732      16.716  41.966 158.295  1.00  0.83           C  
ATOM   5736  CZ  TYR A 732      16.234  42.241 157.016  1.00  0.83           C  
ATOM   5737  OH  TYR A 732      15.977  41.161 156.147  1.00  0.83           O  
ATOM   5738  N   GLU A 733      15.151  44.205 162.082  1.00  0.73           N  
ATOM   5739  CA  GLU A 733      14.233  43.213 162.625  1.00  0.73           C  
ATOM   5740  C   GLU A 733      13.090  43.834 163.420  1.00  0.73           C  
ATOM   5741  O   GLU A 733      11.954  43.366 163.398  1.00  0.73           O  
ATOM   5742  CB  GLU A 733      14.987  42.175 163.492  1.00  0.73           C  
ATOM   5743  CG  GLU A 733      15.843  41.183 162.661  1.00  0.73           C  
ATOM   5744  CD  GLU A 733      14.997  40.249 161.791  1.00  0.73           C  
ATOM   5745  OE1 GLU A 733      14.197  39.467 162.363  1.00  0.73           O  
ATOM   5746  OE2 GLU A 733      15.164  40.295 160.545  1.00  0.73           O  
ATOM   5747  N   ALA A 734      13.360  44.939 164.147  1.00  0.85           N  
ATOM   5748  CA  ALA A 734      12.368  45.647 164.934  1.00  0.85           C  
ATOM   5749  C   ALA A 734      11.211  46.247 164.134  1.00  0.85           C  
ATOM   5750  O   ALA A 734      10.071  46.291 164.596  1.00  0.85           O  
ATOM   5751  CB  ALA A 734      13.063  46.766 165.734  1.00  0.85           C  
ATOM   5752  N   LEU A 735      11.479  46.759 162.918  1.00  0.83           N  
ATOM   5753  CA  LEU A 735      10.502  47.514 162.160  1.00  0.83           C  
ATOM   5754  C   LEU A 735      10.024  46.741 160.925  1.00  0.83           C  
ATOM   5755  O   LEU A 735      10.741  46.698 159.923  1.00  0.83           O  
ATOM   5756  CB  LEU A 735      11.145  48.854 161.721  1.00  0.83           C  
ATOM   5757  CG  LEU A 735      11.556  49.764 162.901  1.00  0.83           C  
ATOM   5758  CD1 LEU A 735      12.450  50.914 162.418  1.00  0.83           C  
ATOM   5759  CD2 LEU A 735      10.340  50.310 163.666  1.00  0.83           C  
ATOM   5760  N   PRO A 736       8.822  46.149 160.879  1.00  0.84           N  
ATOM   5761  CA  PRO A 736       8.471  45.173 159.843  1.00  0.84           C  
ATOM   5762  C   PRO A 736       8.293  45.795 158.470  1.00  0.84           C  
ATOM   5763  O   PRO A 736       8.591  45.139 157.473  1.00  0.84           O  
ATOM   5764  CB  PRO A 736       7.181  44.508 160.365  1.00  0.84           C  
ATOM   5765  CG  PRO A 736       6.614  45.501 161.385  1.00  0.84           C  
ATOM   5766  CD  PRO A 736       7.874  46.110 161.994  1.00  0.84           C  
ATOM   5767  N   GLU A 737       7.820  47.056 158.375  1.00  0.83           N  
ATOM   5768  CA  GLU A 737       7.778  47.783 157.115  1.00  0.83           C  
ATOM   5769  C   GLU A 737       9.166  48.024 156.535  1.00  0.83           C  
ATOM   5770  O   GLU A 737       9.395  47.825 155.345  1.00  0.83           O  
ATOM   5771  CB  GLU A 737       7.057  49.147 157.238  1.00  0.83           C  
ATOM   5772  CG  GLU A 737       5.550  49.037 157.569  1.00  0.83           C  
ATOM   5773  CD  GLU A 737       4.825  50.348 157.301  1.00  0.83           C  
ATOM   5774  OE1 GLU A 737       5.226  51.398 157.867  1.00  0.83           O  
ATOM   5775  OE2 GLU A 737       3.852  50.343 156.504  1.00  0.83           O  
ATOM   5776  N   LEU A 738      10.147  48.402 157.389  1.00  0.87           N  
ATOM   5777  CA  LEU A 738      11.537  48.577 156.995  1.00  0.87           C  
ATOM   5778  C   LEU A 738      12.140  47.282 156.496  1.00  0.87           C  
ATOM   5779  O   LEU A 738      12.814  47.253 155.468  1.00  0.87           O  
ATOM   5780  CB  LEU A 738      12.397  49.097 158.176  1.00  0.87           C  
ATOM   5781  CG  LEU A 738      13.892  49.343 157.869  1.00  0.87           C  
ATOM   5782  CD1 LEU A 738      14.105  50.337 156.718  1.00  0.87           C  
ATOM   5783  CD2 LEU A 738      14.615  49.829 159.135  1.00  0.87           C  
ATOM   5784  N   LYS A 739      11.854  46.156 157.185  1.00  0.82           N  
ATOM   5785  CA  LYS A 739      12.308  44.852 156.753  1.00  0.82           C  
ATOM   5786  C   LYS A 739      11.832  44.486 155.353  1.00  0.82           C  
ATOM   5787  O   LYS A 739      12.633  44.105 154.506  1.00  0.82           O  
ATOM   5788  CB  LYS A 739      11.863  43.737 157.728  1.00  0.82           C  
ATOM   5789  CG  LYS A 739      12.639  42.443 157.450  1.00  0.82           C  
ATOM   5790  CD  LYS A 739      12.108  41.190 158.153  1.00  0.82           C  
ATOM   5791  CE  LYS A 739      13.027  39.976 157.956  1.00  0.82           C  
ATOM   5792  NZ  LYS A 739      13.427  39.823 156.538  1.00  0.82           N  
ATOM   5793  N   LEU A 740      10.531  44.680 155.046  1.00  0.87           N  
ATOM   5794  CA  LEU A 740       9.971  44.403 153.731  1.00  0.87           C  
ATOM   5795  C   LEU A 740      10.617  45.214 152.611  1.00  0.87           C  
ATOM   5796  O   LEU A 740      10.964  44.678 151.560  1.00  0.87           O  
ATOM   5797  CB  LEU A 740       8.441  44.655 153.750  1.00  0.87           C  
ATOM   5798  CG  LEU A 740       7.691  44.368 152.428  1.00  0.87           C  
ATOM   5799  CD1 LEU A 740       7.863  42.917 151.953  1.00  0.87           C  
ATOM   5800  CD2 LEU A 740       6.199  44.702 152.581  1.00  0.87           C  
ATOM   5801  N   VAL A 741      10.856  46.523 152.840  1.00  0.88           N  
ATOM   5802  CA  VAL A 741      11.551  47.395 151.900  1.00  0.88           C  
ATOM   5803  C   VAL A 741      12.975  46.924 151.611  1.00  0.88           C  
ATOM   5804  O   VAL A 741      13.400  46.814 150.461  1.00  0.88           O  
ATOM   5805  CB  VAL A 741      11.595  48.823 152.450  1.00  0.88           C  
ATOM   5806  CG1 VAL A 741      12.429  49.756 151.552  1.00  0.88           C  
ATOM   5807  CG2 VAL A 741      10.164  49.382 152.554  1.00  0.88           C  
ATOM   5808  N   ILE A 742      13.751  46.583 152.658  1.00  0.86           N  
ATOM   5809  CA  ILE A 742      15.110  46.075 152.521  1.00  0.86           C  
ATOM   5810  C   ILE A 742      15.169  44.693 151.879  1.00  0.86           C  
ATOM   5811  O   ILE A 742      15.998  44.453 150.999  1.00  0.86           O  
ATOM   5812  CB  ILE A 742      15.856  46.155 153.849  1.00  0.86           C  
ATOM   5813  CG1 ILE A 742      15.929  47.618 154.363  1.00  0.86           C  
ATOM   5814  CG2 ILE A 742      17.272  45.544 153.746  1.00  0.86           C  
ATOM   5815  CD1 ILE A 742      16.562  48.628 153.395  1.00  0.86           C  
ATOM   5816  N   ASP A 743      14.242  43.774 152.238  1.00  0.85           N  
ATOM   5817  CA  ASP A 743      14.097  42.469 151.613  1.00  0.85           C  
ATOM   5818  C   ASP A 743      13.838  42.594 150.104  1.00  0.85           C  
ATOM   5819  O   ASP A 743      14.451  41.899 149.295  1.00  0.85           O  
ATOM   5820  CB  ASP A 743      12.932  41.650 152.259  1.00  0.85           C  
ATOM   5821  CG  ASP A 743      13.207  41.156 153.671  1.00  0.85           C  
ATOM   5822  OD1 ASP A 743      14.303  41.409 154.233  1.00  0.85           O  
ATOM   5823  OD2 ASP A 743      12.318  40.464 154.241  1.00  0.85           O  
ATOM   5824  N   GLN A 744      12.967  43.531 149.670  1.00  0.85           N  
ATOM   5825  CA  GLN A 744      12.742  43.827 148.262  1.00  0.85           C  
ATOM   5826  C   GLN A 744      13.975  44.326 147.508  1.00  0.85           C  
ATOM   5827  O   GLN A 744      14.216  43.922 146.370  1.00  0.85           O  
ATOM   5828  CB  GLN A 744      11.608  44.872 148.105  1.00  0.85           C  
ATOM   5829  CG  GLN A 744      10.204  44.293 148.389  1.00  0.85           C  
ATOM   5830  CD  GLN A 744       9.162  45.409 148.463  1.00  0.85           C  
ATOM   5831  OE1 GLN A 744       9.364  46.435 149.112  1.00  0.85           O  
ATOM   5832  NE2 GLN A 744       8.000  45.213 147.802  1.00  0.85           N  
ATOM   5833  N   ILE A 745      14.783  45.224 148.110  1.00  0.88           N  
ATOM   5834  CA  ILE A 745      15.978  45.768 147.471  1.00  0.88           C  
ATOM   5835  C   ILE A 745      17.100  44.742 147.233  1.00  0.88           C  
ATOM   5836  O   ILE A 745      17.611  44.669 146.117  1.00  0.88           O  
ATOM   5837  CB  ILE A 745      16.483  47.023 148.195  1.00  0.88           C  
ATOM   5838  CG1 ILE A 745      15.407  48.140 148.177  1.00  0.88           C  
ATOM   5839  CG2 ILE A 745      17.780  47.553 147.538  1.00  0.88           C  
ATOM   5840  CD1 ILE A 745      15.713  49.305 149.130  1.00  0.88           C  
ATOM   5841  N   ASP A 746      17.493  43.888 148.219  1.00  0.86           N  
ATOM   5842  CA  ASP A 746      18.591  42.928 148.002  1.00  0.86           C  
ATOM   5843  C   ASP A 746      18.149  41.698 147.194  1.00  0.86           C  
ATOM   5844  O   ASP A 746      18.945  41.038 146.533  1.00  0.86           O  
ATOM   5845  CB  ASP A 746      19.263  42.490 149.346  1.00  0.86           C  
ATOM   5846  CG  ASP A 746      20.691  41.951 149.160  1.00  0.86           C  
ATOM   5847  OD1 ASP A 746      21.561  42.684 148.616  1.00  0.86           O  
ATOM   5848  OD2 ASP A 746      20.964  40.801 149.592  1.00  0.86           O  
ATOM   5849  N   ASN A 747      16.831  41.389 147.159  1.00  0.87           N  
ATOM   5850  CA  ASN A 747      16.319  40.260 146.389  1.00  0.87           C  
ATOM   5851  C   ASN A 747      15.877  40.680 144.991  1.00  0.87           C  
ATOM   5852  O   ASN A 747      15.228  39.920 144.276  1.00  0.87           O  
ATOM   5853  CB  ASN A 747      15.136  39.546 147.096  1.00  0.87           C  
ATOM   5854  CG  ASN A 747      15.637  38.756 148.301  1.00  0.87           C  
ATOM   5855  OD1 ASN A 747      16.006  37.588 148.181  1.00  0.87           O  
ATOM   5856  ND2 ASN A 747      15.627  39.377 149.498  1.00  0.87           N  
ATOM   5857  N   GLY A 748      16.239  41.897 144.535  1.00  0.91           N  
ATOM   5858  CA  GLY A 748      16.115  42.249 143.126  1.00  0.91           C  
ATOM   5859  C   GLY A 748      14.748  42.626 142.636  1.00  0.91           C  
ATOM   5860  O   GLY A 748      14.507  42.648 141.433  1.00  0.91           O  
ATOM   5861  N   PHE A 749      13.800  42.965 143.530  1.00  0.89           N  
ATOM   5862  CA  PHE A 749      12.439  43.346 143.161  1.00  0.89           C  
ATOM   5863  C   PHE A 749      12.418  44.591 142.269  1.00  0.89           C  
ATOM   5864  O   PHE A 749      11.668  44.698 141.303  1.00  0.89           O  
ATOM   5865  CB  PHE A 749      11.607  43.563 144.455  1.00  0.89           C  
ATOM   5866  CG  PHE A 749      10.135  43.744 144.194  1.00  0.89           C  
ATOM   5867  CD1 PHE A 749       9.315  42.642 143.906  1.00  0.89           C  
ATOM   5868  CD2 PHE A 749       9.560  45.024 144.243  1.00  0.89           C  
ATOM   5869  CE1 PHE A 749       7.944  42.816 143.670  1.00  0.89           C  
ATOM   5870  CE2 PHE A 749       8.191  45.203 144.013  1.00  0.89           C  
ATOM   5871  CZ  PHE A 749       7.381  44.098 143.727  1.00  0.89           C  
ATOM   5872  N   PHE A 750      13.325  45.542 142.555  1.00  0.89           N  
ATOM   5873  CA  PHE A 750      13.512  46.747 141.770  1.00  0.89           C  
ATOM   5874  C   PHE A 750      14.637  46.582 140.746  1.00  0.89           C  
ATOM   5875  O   PHE A 750      15.112  47.541 140.139  1.00  0.89           O  
ATOM   5876  CB  PHE A 750      13.784  47.959 142.700  1.00  0.89           C  
ATOM   5877  CG  PHE A 750      12.585  48.185 143.582  1.00  0.89           C  
ATOM   5878  CD1 PHE A 750      11.385  48.657 143.022  1.00  0.89           C  
ATOM   5879  CD2 PHE A 750      12.628  47.903 144.958  1.00  0.89           C  
ATOM   5880  CE1 PHE A 750      10.247  48.839 143.817  1.00  0.89           C  
ATOM   5881  CE2 PHE A 750      11.491  48.081 145.758  1.00  0.89           C  
ATOM   5882  CZ  PHE A 750      10.300  48.548 145.185  1.00  0.89           C  
ATOM   5883  N   SER A 751      15.085  45.345 140.475  1.00  0.89           N  
ATOM   5884  CA  SER A 751      16.063  45.096 139.424  1.00  0.89           C  
ATOM   5885  C   SER A 751      15.984  43.679 138.856  1.00  0.89           C  
ATOM   5886  O   SER A 751      16.988  42.969 138.897  1.00  0.89           O  
ATOM   5887  CB  SER A 751      17.526  45.398 139.876  1.00  0.89           C  
ATOM   5888  OG  SER A 751      17.902  44.694 141.059  1.00  0.89           O  
ATOM   5889  N   PRO A 752      14.881  43.189 138.259  1.00  0.87           N  
ATOM   5890  CA  PRO A 752      14.673  41.754 138.014  1.00  0.87           C  
ATOM   5891  C   PRO A 752      15.580  41.102 136.984  1.00  0.87           C  
ATOM   5892  O   PRO A 752      15.427  39.913 136.718  1.00  0.87           O  
ATOM   5893  CB  PRO A 752      13.208  41.655 137.550  1.00  0.87           C  
ATOM   5894  CG  PRO A 752      12.544  42.885 138.160  1.00  0.87           C  
ATOM   5895  CD  PRO A 752      13.636  43.941 138.030  1.00  0.87           C  
ATOM   5896  N   LYS A 753      16.473  41.859 136.325  1.00  0.78           N  
ATOM   5897  CA  LYS A 753      17.428  41.327 135.371  1.00  0.78           C  
ATOM   5898  C   LYS A 753      18.847  41.370 135.922  1.00  0.78           C  
ATOM   5899  O   LYS A 753      19.784  40.923 135.270  1.00  0.78           O  
ATOM   5900  CB  LYS A 753      17.367  42.139 134.049  1.00  0.78           C  
ATOM   5901  CG  LYS A 753      15.945  42.340 133.484  1.00  0.78           C  
ATOM   5902  CD  LYS A 753      15.192  41.025 133.210  1.00  0.78           C  
ATOM   5903  CE  LYS A 753      13.717  41.242 132.859  1.00  0.78           C  
ATOM   5904  NZ  LYS A 753      13.025  39.936 132.777  1.00  0.78           N  
ATOM   5905  N   GLN A 754      19.024  41.893 137.150  1.00  0.83           N  
ATOM   5906  CA  GLN A 754      20.302  42.039 137.828  1.00  0.83           C  
ATOM   5907  C   GLN A 754      19.997  42.065 139.326  1.00  0.83           C  
ATOM   5908  O   GLN A 754      19.946  43.156 139.899  1.00  0.83           O  
ATOM   5909  CB  GLN A 754      21.033  43.367 137.462  1.00  0.83           C  
ATOM   5910  CG  GLN A 754      21.669  43.412 136.052  1.00  0.83           C  
ATOM   5911  CD  GLN A 754      22.223  44.801 135.739  1.00  0.83           C  
ATOM   5912  OE1 GLN A 754      23.366  45.145 136.028  1.00  0.83           O  
ATOM   5913  NE2 GLN A 754      21.378  45.653 135.112  1.00  0.83           N  
ATOM   5914  N   PRO A 755      19.713  40.956 140.013  1.00  0.89           N  
ATOM   5915  CA  PRO A 755      19.134  40.986 141.357  1.00  0.89           C  
ATOM   5916  C   PRO A 755      20.013  41.643 142.400  1.00  0.89           C  
ATOM   5917  O   PRO A 755      19.509  42.326 143.285  1.00  0.89           O  
ATOM   5918  CB  PRO A 755      18.884  39.505 141.693  1.00  0.89           C  
ATOM   5919  CG  PRO A 755      18.721  38.842 140.324  1.00  0.89           C  
ATOM   5920  CD  PRO A 755      19.739  39.595 139.469  1.00  0.89           C  
ATOM   5921  N   ASP A 756      21.333  41.460 142.287  1.00  0.87           N  
ATOM   5922  CA  ASP A 756      22.343  41.881 143.219  1.00  0.87           C  
ATOM   5923  C   ASP A 756      22.926  43.248 142.862  1.00  0.87           C  
ATOM   5924  O   ASP A 756      23.910  43.701 143.440  1.00  0.87           O  
ATOM   5925  CB  ASP A 756      23.424  40.762 143.296  1.00  0.87           C  
ATOM   5926  CG  ASP A 756      23.990  40.348 141.938  1.00  0.87           C  
ATOM   5927  OD1 ASP A 756      25.238  40.306 141.837  1.00  0.87           O  
ATOM   5928  OD2 ASP A 756      23.185  40.032 141.020  1.00  0.87           O  
ATOM   5929  N   LEU A 757      22.272  43.993 141.946  1.00  0.88           N  
ATOM   5930  CA  LEU A 757      22.674  45.322 141.507  1.00  0.88           C  
ATOM   5931  C   LEU A 757      22.799  46.339 142.633  1.00  0.88           C  
ATOM   5932  O   LEU A 757      23.698  47.173 142.656  1.00  0.88           O  
ATOM   5933  CB  LEU A 757      21.636  45.841 140.480  1.00  0.88           C  
ATOM   5934  CG  LEU A 757      21.938  47.199 139.813  1.00  0.88           C  
ATOM   5935  CD1 LEU A 757      23.292  47.202 139.090  1.00  0.88           C  
ATOM   5936  CD2 LEU A 757      20.815  47.548 138.826  1.00  0.88           C  
ATOM   5937  N   PHE A 758      21.903  46.283 143.632  1.00  0.89           N  
ATOM   5938  CA  PHE A 758      21.880  47.238 144.723  1.00  0.89           C  
ATOM   5939  C   PHE A 758      22.635  46.752 145.951  1.00  0.89           C  
ATOM   5940  O   PHE A 758      22.483  47.297 147.043  1.00  0.89           O  
ATOM   5941  CB  PHE A 758      20.419  47.574 145.109  1.00  0.89           C  
ATOM   5942  CG  PHE A 758      19.699  48.210 143.948  1.00  0.89           C  
ATOM   5943  CD1 PHE A 758      20.208  49.366 143.328  1.00  0.89           C  
ATOM   5944  CD2 PHE A 758      18.501  47.657 143.469  1.00  0.89           C  
ATOM   5945  CE1 PHE A 758      19.538  49.954 142.249  1.00  0.89           C  
ATOM   5946  CE2 PHE A 758      17.822  48.250 142.396  1.00  0.89           C  
ATOM   5947  CZ  PHE A 758      18.341  49.397 141.785  1.00  0.89           C  
ATOM   5948  N   LYS A 759      23.511  45.739 145.806  1.00  0.83           N  
ATOM   5949  CA  LYS A 759      24.250  45.128 146.899  1.00  0.83           C  
ATOM   5950  C   LYS A 759      25.134  46.085 147.687  1.00  0.83           C  
ATOM   5951  O   LYS A 759      25.186  46.042 148.916  1.00  0.83           O  
ATOM   5952  CB  LYS A 759      25.110  43.983 146.337  1.00  0.83           C  
ATOM   5953  CG  LYS A 759      25.710  43.064 147.403  1.00  0.83           C  
ATOM   5954  CD  LYS A 759      26.219  41.757 146.773  1.00  0.83           C  
ATOM   5955  CE  LYS A 759      25.949  40.518 147.633  1.00  0.83           C  
ATOM   5956  NZ  LYS A 759      24.482  40.318 147.814  1.00  0.83           N  
ATOM   5957  N   ASP A 760      25.804  47.022 146.991  1.00  0.88           N  
ATOM   5958  CA  ASP A 760      26.615  48.084 147.558  1.00  0.88           C  
ATOM   5959  C   ASP A 760      25.826  48.968 148.521  1.00  0.88           C  
ATOM   5960  O   ASP A 760      26.290  49.331 149.602  1.00  0.88           O  
ATOM   5961  CB  ASP A 760      27.155  48.990 146.420  1.00  0.88           C  
ATOM   5962  CG  ASP A 760      28.011  48.236 145.415  1.00  0.88           C  
ATOM   5963  OD1 ASP A 760      28.421  48.905 144.434  1.00  0.88           O  
ATOM   5964  OD2 ASP A 760      28.251  47.019 145.594  1.00  0.88           O  
ATOM   5965  N   ILE A 761      24.566  49.291 148.152  1.00  0.90           N  
ATOM   5966  CA  ILE A 761      23.630  50.045 148.972  1.00  0.90           C  
ATOM   5967  C   ILE A 761      23.301  49.298 150.255  1.00  0.90           C  
ATOM   5968  O   ILE A 761      23.399  49.838 151.354  1.00  0.90           O  
ATOM   5969  CB  ILE A 761      22.335  50.349 148.204  1.00  0.90           C  
ATOM   5970  CG1 ILE A 761      22.658  51.020 146.842  1.00  0.90           C  
ATOM   5971  CG2 ILE A 761      21.389  51.208 149.075  1.00  0.90           C  
ATOM   5972  CD1 ILE A 761      21.424  51.501 146.069  1.00  0.90           C  
ATOM   5973  N   ILE A 762      22.973  47.997 150.147  1.00  0.86           N  
ATOM   5974  CA  ILE A 762      22.668  47.126 151.274  1.00  0.86           C  
ATOM   5975  C   ILE A 762      23.854  46.959 152.213  1.00  0.86           C  
ATOM   5976  O   ILE A 762      23.724  47.063 153.434  1.00  0.86           O  
ATOM   5977  CB  ILE A 762      22.170  45.777 150.766  1.00  0.86           C  
ATOM   5978  CG1 ILE A 762      20.908  45.949 149.882  1.00  0.86           C  
ATOM   5979  CG2 ILE A 762      21.902  44.791 151.926  1.00  0.86           C  
ATOM   5980  CD1 ILE A 762      19.686  46.526 150.609  1.00  0.86           C  
ATOM   5981  N   ASN A 763      25.068  46.765 151.656  1.00  0.81           N  
ATOM   5982  CA  ASN A 763      26.302  46.699 152.416  1.00  0.81           C  
ATOM   5983  C   ASN A 763      26.590  47.990 153.181  1.00  0.81           C  
ATOM   5984  O   ASN A 763      26.916  47.954 154.366  1.00  0.81           O  
ATOM   5985  CB  ASN A 763      27.481  46.362 151.464  1.00  0.81           C  
ATOM   5986  CG  ASN A 763      28.718  45.943 152.252  1.00  0.81           C  
ATOM   5987  OD1 ASN A 763      28.847  44.791 152.664  1.00  0.81           O  
ATOM   5988  ND2 ASN A 763      29.644  46.897 152.497  1.00  0.81           N  
ATOM   5989  N   MET A 764      26.432  49.166 152.531  1.00  0.86           N  
ATOM   5990  CA  MET A 764      26.615  50.450 153.184  1.00  0.86           C  
ATOM   5991  C   MET A 764      25.637  50.659 154.329  1.00  0.86           C  
ATOM   5992  O   MET A 764      26.045  50.968 155.445  1.00  0.86           O  
ATOM   5993  CB  MET A 764      26.502  51.606 152.152  1.00  0.86           C  
ATOM   5994  CG  MET A 764      26.937  52.999 152.670  1.00  0.86           C  
ATOM   5995  SD  MET A 764      25.695  53.926 153.632  1.00  0.86           S  
ATOM   5996  CE  MET A 764      24.758  54.565 152.217  1.00  0.86           C  
ATOM   5997  N   LEU A 765      24.332  50.397 154.106  1.00  0.89           N  
ATOM   5998  CA  LEU A 765      23.298  50.554 155.117  1.00  0.89           C  
ATOM   5999  C   LEU A 765      23.505  49.693 156.354  1.00  0.89           C  
ATOM   6000  O   LEU A 765      23.374  50.157 157.484  1.00  0.89           O  
ATOM   6001  CB  LEU A 765      21.900  50.231 154.518  1.00  0.89           C  
ATOM   6002  CG  LEU A 765      21.102  51.448 154.001  1.00  0.89           C  
ATOM   6003  CD1 LEU A 765      20.819  52.448 155.123  1.00  0.89           C  
ATOM   6004  CD2 LEU A 765      21.751  52.177 152.823  1.00  0.89           C  
ATOM   6005  N   PHE A 766      23.849  48.405 156.181  1.00  0.81           N  
ATOM   6006  CA  PHE A 766      24.120  47.540 157.312  1.00  0.81           C  
ATOM   6007  C   PHE A 766      25.432  47.793 158.046  1.00  0.81           C  
ATOM   6008  O   PHE A 766      25.473  47.628 159.266  1.00  0.81           O  
ATOM   6009  CB  PHE A 766      24.025  46.045 156.917  1.00  0.81           C  
ATOM   6010  CG  PHE A 766      22.589  45.599 156.912  1.00  0.81           C  
ATOM   6011  CD1 PHE A 766      21.950  45.250 155.713  1.00  0.81           C  
ATOM   6012  CD2 PHE A 766      21.869  45.513 158.118  1.00  0.81           C  
ATOM   6013  CE1 PHE A 766      20.618  44.817 155.713  1.00  0.81           C  
ATOM   6014  CE2 PHE A 766      20.537  45.077 158.124  1.00  0.81           C  
ATOM   6015  CZ  PHE A 766      19.915  44.726 156.920  1.00  0.81           C  
ATOM   6016  N   TYR A 767      26.536  48.130 157.338  1.00  0.82           N  
ATOM   6017  CA  TYR A 767      27.866  48.064 157.936  1.00  0.82           C  
ATOM   6018  C   TYR A 767      28.711  49.331 157.871  1.00  0.82           C  
ATOM   6019  O   TYR A 767      29.758  49.384 158.513  1.00  0.82           O  
ATOM   6020  CB  TYR A 767      28.683  46.923 157.262  1.00  0.82           C  
ATOM   6021  CG  TYR A 767      28.016  45.595 157.503  1.00  0.82           C  
ATOM   6022  CD1 TYR A 767      27.425  44.878 156.449  1.00  0.82           C  
ATOM   6023  CD2 TYR A 767      27.947  45.071 158.804  1.00  0.82           C  
ATOM   6024  CE1 TYR A 767      26.742  43.679 156.698  1.00  0.82           C  
ATOM   6025  CE2 TYR A 767      27.266  43.872 159.057  1.00  0.82           C  
ATOM   6026  CZ  TYR A 767      26.652  43.185 158.004  1.00  0.82           C  
ATOM   6027  OH  TYR A 767      25.945  41.989 158.244  1.00  0.82           O  
ATOM   6028  N   HIS A 768      28.304  50.403 157.158  1.00  0.83           N  
ATOM   6029  CA  HIS A 768      29.193  51.552 156.988  1.00  0.83           C  
ATOM   6030  C   HIS A 768      28.453  52.877 156.962  1.00  0.83           C  
ATOM   6031  O   HIS A 768      29.037  53.929 156.704  1.00  0.83           O  
ATOM   6032  CB  HIS A 768      30.025  51.425 155.685  1.00  0.83           C  
ATOM   6033  CG  HIS A 768      30.975  50.265 155.731  1.00  0.83           C  
ATOM   6034  ND1 HIS A 768      30.799  49.170 154.902  1.00  0.83           N  
ATOM   6035  CD2 HIS A 768      32.043  50.072 156.547  1.00  0.83           C  
ATOM   6036  CE1 HIS A 768      31.760  48.333 155.240  1.00  0.83           C  
ATOM   6037  NE2 HIS A 768      32.542  48.828 156.228  1.00  0.83           N  
ATOM   6038  N   ASP A 769      27.150  52.861 157.283  1.00  0.90           N  
ATOM   6039  CA  ASP A 769      26.298  54.017 157.410  1.00  0.90           C  
ATOM   6040  C   ASP A 769      26.724  54.946 158.560  1.00  0.90           C  
ATOM   6041  O   ASP A 769      26.487  54.705 159.743  1.00  0.90           O  
ATOM   6042  CB  ASP A 769      24.839  53.489 157.506  1.00  0.90           C  
ATOM   6043  CG  ASP A 769      23.806  54.574 157.687  1.00  0.90           C  
ATOM   6044  OD1 ASP A 769      24.106  55.747 157.343  1.00  0.90           O  
ATOM   6045  OD2 ASP A 769      22.705  54.273 158.227  1.00  0.90           O  
ATOM   6046  N   ARG A 770      27.366  56.080 158.207  1.00  0.84           N  
ATOM   6047  CA  ARG A 770      27.702  57.136 159.143  1.00  0.84           C  
ATOM   6048  C   ARG A 770      26.487  57.977 159.513  1.00  0.84           C  
ATOM   6049  O   ARG A 770      26.427  58.589 160.585  1.00  0.84           O  
ATOM   6050  CB  ARG A 770      28.748  58.103 158.519  1.00  0.84           C  
ATOM   6051  CG  ARG A 770      30.125  57.466 158.240  1.00  0.84           C  
ATOM   6052  CD  ARG A 770      31.166  58.448 157.671  1.00  0.84           C  
ATOM   6053  NE  ARG A 770      30.796  58.767 156.249  1.00  0.84           N  
ATOM   6054  CZ  ARG A 770      31.220  59.843 155.573  1.00  0.84           C  
ATOM   6055  NH1 ARG A 770      32.024  60.755 156.118  1.00  0.84           N  
ATOM   6056  NH2 ARG A 770      30.835  60.042 154.315  1.00  0.84           N  
ATOM   6057  N   PHE A 771      25.491  58.017 158.609  1.00  0.92           N  
ATOM   6058  CA  PHE A 771      24.455  59.028 158.568  1.00  0.92           C  
ATOM   6059  C   PHE A 771      23.135  58.498 159.083  1.00  0.92           C  
ATOM   6060  O   PHE A 771      22.181  59.248 159.289  1.00  0.92           O  
ATOM   6061  CB  PHE A 771      24.300  59.539 157.116  1.00  0.92           C  
ATOM   6062  CG  PHE A 771      25.568  60.245 156.725  1.00  0.92           C  
ATOM   6063  CD1 PHE A 771      25.953  61.440 157.359  1.00  0.92           C  
ATOM   6064  CD2 PHE A 771      26.409  59.696 155.750  1.00  0.92           C  
ATOM   6065  CE1 PHE A 771      27.161  62.070 157.026  1.00  0.92           C  
ATOM   6066  CE2 PHE A 771      27.597  60.339 155.396  1.00  0.92           C  
ATOM   6067  CZ  PHE A 771      27.980  61.524 156.031  1.00  0.92           C  
ATOM   6068  N   LYS A 772      23.080  57.198 159.386  1.00  0.92           N  
ATOM   6069  CA  LYS A 772      22.127  56.573 160.269  1.00  0.92           C  
ATOM   6070  C   LYS A 772      20.710  56.584 159.735  1.00  0.92           C  
ATOM   6071  O   LYS A 772      19.768  57.045 160.377  1.00  0.92           O  
ATOM   6072  CB  LYS A 772      22.254  57.111 161.706  1.00  0.92           C  
ATOM   6073  CG  LYS A 772      23.687  57.001 162.247  1.00  0.92           C  
ATOM   6074  CD  LYS A 772      23.831  57.594 163.649  1.00  0.92           C  
ATOM   6075  CE  LYS A 772      25.229  57.411 164.238  1.00  0.92           C  
ATOM   6076  NZ  LYS A 772      26.238  58.264 163.580  1.00  0.92           N  
ATOM   6077  N   VAL A 773      20.546  56.097 158.495  1.00  0.96           N  
ATOM   6078  CA  VAL A 773      19.313  56.118 157.721  1.00  0.96           C  
ATOM   6079  C   VAL A 773      18.194  55.315 158.372  1.00  0.96           C  
ATOM   6080  O   VAL A 773      17.047  55.753 158.450  1.00  0.96           O  
ATOM   6081  CB  VAL A 773      19.600  55.585 156.321  1.00  0.96           C  
ATOM   6082  CG1 VAL A 773      18.331  55.445 155.454  1.00  0.96           C  
ATOM   6083  CG2 VAL A 773      20.614  56.516 155.624  1.00  0.96           C  
ATOM   6084  N   PHE A 774      18.509  54.112 158.892  1.00  0.93           N  
ATOM   6085  CA  PHE A 774      17.544  53.247 159.553  1.00  0.93           C  
ATOM   6086  C   PHE A 774      17.043  53.795 160.881  1.00  0.93           C  
ATOM   6087  O   PHE A 774      15.889  53.584 161.250  1.00  0.93           O  
ATOM   6088  CB  PHE A 774      18.109  51.818 159.770  1.00  0.93           C  
ATOM   6089  CG  PHE A 774      18.281  50.999 158.511  1.00  0.93           C  
ATOM   6090  CD1 PHE A 774      18.845  49.721 158.660  1.00  0.93           C  
ATOM   6091  CD2 PHE A 774      17.883  51.405 157.220  1.00  0.93           C  
ATOM   6092  CE1 PHE A 774      19.044  48.879 157.560  1.00  0.93           C  
ATOM   6093  CE2 PHE A 774      18.077  50.565 156.116  1.00  0.93           C  
ATOM   6094  CZ  PHE A 774      18.663  49.305 156.285  1.00  0.93           C  
ATOM   6095  N   ALA A 775      17.891  54.537 161.621  1.00  0.93           N  
ATOM   6096  CA  ALA A 775      17.554  55.111 162.910  1.00  0.93           C  
ATOM   6097  C   ALA A 775      16.394  56.104 162.875  1.00  0.93           C  
ATOM   6098  O   ALA A 775      15.501  56.062 163.718  1.00  0.93           O  
ATOM   6099  CB  ALA A 775      18.806  55.777 163.514  1.00  0.93           C  
ATOM   6100  N   ASP A 776      16.344  56.982 161.853  1.00  0.93           N  
ATOM   6101  CA  ASP A 776      15.278  57.960 161.732  1.00  0.93           C  
ATOM   6102  C   ASP A 776      14.111  57.459 160.885  1.00  0.93           C  
ATOM   6103  O   ASP A 776      13.136  58.182 160.695  1.00  0.93           O  
ATOM   6104  CB  ASP A 776      15.794  59.264 161.072  1.00  0.93           C  
ATOM   6105  CG  ASP A 776      16.569  60.110 162.057  1.00  0.93           C  
ATOM   6106  OD1 ASP A 776      16.051  60.373 163.167  1.00  0.93           O  
ATOM   6107  OD2 ASP A 776      17.678  60.566 161.672  1.00  0.93           O  
ATOM   6108  N   TYR A 777      14.136  56.208 160.371  1.00  0.93           N  
ATOM   6109  CA  TYR A 777      13.078  55.682 159.513  1.00  0.93           C  
ATOM   6110  C   TYR A 777      11.707  55.657 160.198  1.00  0.93           C  
ATOM   6111  O   TYR A 777      10.713  56.104 159.629  1.00  0.93           O  
ATOM   6112  CB  TYR A 777      13.489  54.273 158.964  1.00  0.93           C  
ATOM   6113  CG  TYR A 777      12.381  53.566 158.211  1.00  0.93           C  
ATOM   6114  CD1 TYR A 777      12.176  53.741 156.831  1.00  0.93           C  
ATOM   6115  CD2 TYR A 777      11.479  52.767 158.932  1.00  0.93           C  
ATOM   6116  CE1 TYR A 777      11.064  53.154 156.199  1.00  0.93           C  
ATOM   6117  CE2 TYR A 777      10.352  52.214 158.317  1.00  0.93           C  
ATOM   6118  CZ  TYR A 777      10.142  52.416 156.954  1.00  0.93           C  
ATOM   6119  OH  TYR A 777       8.954  51.934 156.377  1.00  0.93           O  
ATOM   6120  N   GLU A 778      11.627  55.176 161.456  1.00  0.87           N  
ATOM   6121  CA  GLU A 778      10.385  55.106 162.216  1.00  0.87           C  
ATOM   6122  C   GLU A 778       9.786  56.486 162.465  1.00  0.87           C  
ATOM   6123  O   GLU A 778       8.602  56.736 162.229  1.00  0.87           O  
ATOM   6124  CB  GLU A 778      10.682  54.342 163.539  1.00  0.87           C  
ATOM   6125  CG  GLU A 778       9.489  54.012 164.494  1.00  0.87           C  
ATOM   6126  CD  GLU A 778       9.103  55.111 165.481  1.00  0.87           C  
ATOM   6127  OE1 GLU A 778       9.675  56.227 165.424  1.00  0.87           O  
ATOM   6128  OE2 GLU A 778       8.135  54.938 166.266  1.00  0.87           O  
ATOM   6129  N   ALA A 779      10.641  57.449 162.868  1.00  0.92           N  
ATOM   6130  CA  ALA A 779      10.280  58.826 163.092  1.00  0.92           C  
ATOM   6131  C   ALA A 779       9.816  59.521 161.821  1.00  0.92           C  
ATOM   6132  O   ALA A 779       8.795  60.208 161.810  1.00  0.92           O  
ATOM   6133  CB  ALA A 779      11.496  59.548 163.704  1.00  0.92           C  
ATOM   6134  N   TYR A 780      10.534  59.309 160.702  1.00  0.93           N  
ATOM   6135  CA  TYR A 780      10.182  59.831 159.398  1.00  0.93           C  
ATOM   6136  C   TYR A 780       8.853  59.324 158.867  1.00  0.93           C  
ATOM   6137  O   TYR A 780       8.019  60.118 158.445  1.00  0.93           O  
ATOM   6138  CB  TYR A 780      11.317  59.467 158.407  1.00  0.93           C  
ATOM   6139  CG  TYR A 780      11.130  59.953 156.998  1.00  0.93           C  
ATOM   6140  CD1 TYR A 780      10.842  61.291 156.695  1.00  0.93           C  
ATOM   6141  CD2 TYR A 780      11.333  59.059 155.947  1.00  0.93           C  
ATOM   6142  CE1 TYR A 780      10.795  61.733 155.368  1.00  0.93           C  
ATOM   6143  CE2 TYR A 780      11.313  59.494 154.628  1.00  0.93           C  
ATOM   6144  CZ  TYR A 780      11.006  60.814 154.341  1.00  0.93           C  
ATOM   6145  OH  TYR A 780      10.857  61.155 153.003  1.00  0.93           O  
ATOM   6146  N   VAL A 781       8.586  58.003 158.908  1.00  0.90           N  
ATOM   6147  CA  VAL A 781       7.329  57.448 158.421  1.00  0.90           C  
ATOM   6148  C   VAL A 781       6.136  57.920 159.238  1.00  0.90           C  
ATOM   6149  O   VAL A 781       5.134  58.378 158.693  1.00  0.90           O  
ATOM   6150  CB  VAL A 781       7.393  55.930 158.346  1.00  0.90           C  
ATOM   6151  CG1 VAL A 781       6.033  55.324 157.948  1.00  0.90           C  
ATOM   6152  CG2 VAL A 781       8.440  55.541 157.286  1.00  0.90           C  
ATOM   6153  N   LYS A 782       6.249  57.920 160.581  1.00  0.87           N  
ATOM   6154  CA  LYS A 782       5.224  58.474 161.452  1.00  0.87           C  
ATOM   6155  C   LYS A 782       4.972  59.962 161.243  1.00  0.87           C  
ATOM   6156  O   LYS A 782       3.834  60.431 161.279  1.00  0.87           O  
ATOM   6157  CB  LYS A 782       5.570  58.171 162.928  1.00  0.87           C  
ATOM   6158  CG  LYS A 782       5.108  56.757 163.305  1.00  0.87           C  
ATOM   6159  CD  LYS A 782       5.902  56.096 164.441  1.00  0.87           C  
ATOM   6160  CE  LYS A 782       5.965  56.828 165.792  1.00  0.87           C  
ATOM   6161  NZ  LYS A 782       7.315  57.389 166.012  1.00  0.87           N  
ATOM   6162  N   CYS A 783       6.030  60.757 160.990  1.00  0.92           N  
ATOM   6163  CA  CYS A 783       5.883  62.139 160.572  1.00  0.92           C  
ATOM   6164  C   CYS A 783       5.216  62.300 159.207  1.00  0.92           C  
ATOM   6165  O   CYS A 783       4.328  63.131 159.034  1.00  0.92           O  
ATOM   6166  CB  CYS A 783       7.242  62.874 160.602  1.00  0.92           C  
ATOM   6167  SG  CYS A 783       7.037  64.681 160.725  1.00  0.92           S  
ATOM   6168  N   GLN A 784       5.577  61.470 158.211  1.00  0.91           N  
ATOM   6169  CA  GLN A 784       4.954  61.459 156.899  1.00  0.91           C  
ATOM   6170  C   GLN A 784       3.466  61.155 156.913  1.00  0.91           C  
ATOM   6171  O   GLN A 784       2.685  61.813 156.224  1.00  0.91           O  
ATOM   6172  CB  GLN A 784       5.640  60.433 155.966  1.00  0.91           C  
ATOM   6173  CG  GLN A 784       7.010  60.891 155.421  1.00  0.91           C  
ATOM   6174  CD  GLN A 784       6.860  61.930 154.308  1.00  0.91           C  
ATOM   6175  OE1 GLN A 784       5.892  62.696 154.246  1.00  0.91           O  
ATOM   6176  NE2 GLN A 784       7.829  61.927 153.374  1.00  0.91           N  
ATOM   6177  N   ASP A 785       3.014  60.180 157.723  1.00  0.88           N  
ATOM   6178  CA  ASP A 785       1.601  59.929 157.925  1.00  0.88           C  
ATOM   6179  C   ASP A 785       0.866  61.128 158.544  1.00  0.88           C  
ATOM   6180  O   ASP A 785      -0.243  61.459 158.129  1.00  0.88           O  
ATOM   6181  CB  ASP A 785       1.382  58.611 158.705  1.00  0.88           C  
ATOM   6182  CG  ASP A 785       1.713  57.431 157.811  1.00  0.88           C  
ATOM   6183  OD1 ASP A 785       1.263  57.419 156.634  1.00  0.88           O  
ATOM   6184  OD2 ASP A 785       2.392  56.480 158.281  1.00  0.88           O  
ATOM   6185  N   LYS A 786       1.489  61.876 159.486  1.00  0.85           N  
ATOM   6186  CA  LYS A 786       0.967  63.157 159.965  1.00  0.85           C  
ATOM   6187  C   LYS A 786       0.826  64.224 158.873  1.00  0.85           C  
ATOM   6188  O   LYS A 786      -0.165  64.955 158.847  1.00  0.85           O  
ATOM   6189  CB  LYS A 786       1.826  63.768 161.107  1.00  0.85           C  
ATOM   6190  CG  LYS A 786       1.821  62.968 162.420  1.00  0.85           C  
ATOM   6191  CD  LYS A 786       2.917  63.419 163.409  1.00  0.85           C  
ATOM   6192  CE  LYS A 786       2.918  64.905 163.801  1.00  0.85           C  
ATOM   6193  NZ  LYS A 786       1.655  65.259 164.486  1.00  0.85           N  
ATOM   6194  N   VAL A 787       1.795  64.336 157.934  1.00  0.91           N  
ATOM   6195  CA  VAL A 787       1.691  65.209 156.762  1.00  0.91           C  
ATOM   6196  C   VAL A 787       0.509  64.831 155.881  1.00  0.91           C  
ATOM   6197  O   VAL A 787      -0.283  65.673 155.454  1.00  0.91           O  
ATOM   6198  CB  VAL A 787       2.939  65.163 155.878  1.00  0.91           C  
ATOM   6199  CG1 VAL A 787       2.789  66.126 154.688  1.00  0.91           C  
ATOM   6200  CG2 VAL A 787       4.189  65.581 156.665  1.00  0.91           C  
ATOM   6201  N   SER A 788       0.336  63.519 155.628  1.00  0.89           N  
ATOM   6202  CA  SER A 788      -0.777  62.970 154.867  1.00  0.89           C  
ATOM   6203  C   SER A 788      -2.127  63.274 155.498  1.00  0.89           C  
ATOM   6204  O   SER A 788      -3.060  63.666 154.805  1.00  0.89           O  
ATOM   6205  CB  SER A 788      -0.647  61.438 154.671  1.00  0.89           C  
ATOM   6206  OG  SER A 788       0.538  61.110 153.936  1.00  0.89           O  
ATOM   6207  N   GLN A 789      -2.256  63.164 156.841  1.00  0.82           N  
ATOM   6208  CA  GLN A 789      -3.455  63.587 157.556  1.00  0.82           C  
ATOM   6209  C   GLN A 789      -3.766  65.075 157.413  1.00  0.82           C  
ATOM   6210  O   GLN A 789      -4.908  65.459 157.170  1.00  0.82           O  
ATOM   6211  CB  GLN A 789      -3.382  63.263 159.075  1.00  0.82           C  
ATOM   6212  CG  GLN A 789      -3.287  61.761 159.444  1.00  0.82           C  
ATOM   6213  CD  GLN A 789      -4.435  60.946 158.851  1.00  0.82           C  
ATOM   6214  OE1 GLN A 789      -5.610  61.203 159.106  1.00  0.82           O  
ATOM   6215  NE2 GLN A 789      -4.098  59.920 158.035  1.00  0.82           N  
ATOM   6216  N   LEU A 790      -2.755  65.963 157.528  1.00  0.87           N  
ATOM   6217  CA  LEU A 790      -2.962  67.398 157.397  1.00  0.87           C  
ATOM   6218  C   LEU A 790      -3.422  67.837 156.008  1.00  0.87           C  
ATOM   6219  O   LEU A 790      -4.268  68.717 155.873  1.00  0.87           O  
ATOM   6220  CB  LEU A 790      -1.716  68.213 157.823  1.00  0.87           C  
ATOM   6221  CG  LEU A 790      -2.032  69.695 158.141  1.00  0.87           C  
ATOM   6222  CD1 LEU A 790      -2.747  69.843 159.493  1.00  0.87           C  
ATOM   6223  CD2 LEU A 790      -0.773  70.569 158.131  1.00  0.87           C  
ATOM   6224  N   TYR A 791      -2.906  67.206 154.931  1.00  0.89           N  
ATOM   6225  CA  TYR A 791      -3.268  67.514 153.549  1.00  0.89           C  
ATOM   6226  C   TYR A 791      -4.734  67.200 153.228  1.00  0.89           C  
ATOM   6227  O   TYR A 791      -5.336  67.785 152.330  1.00  0.89           O  
ATOM   6228  CB  TYR A 791      -2.302  66.760 152.591  1.00  0.89           C  
ATOM   6229  CG  TYR A 791      -2.403  67.204 151.146  1.00  0.89           C  
ATOM   6230  CD1 TYR A 791      -1.730  68.352 150.689  1.00  0.89           C  
ATOM   6231  CD2 TYR A 791      -3.168  66.464 150.228  1.00  0.89           C  
ATOM   6232  CE1 TYR A 791      -1.825  68.751 149.344  1.00  0.89           C  
ATOM   6233  CE2 TYR A 791      -3.264  66.858 148.885  1.00  0.89           C  
ATOM   6234  CZ  TYR A 791      -2.598  68.006 148.443  1.00  0.89           C  
ATOM   6235  OH  TYR A 791      -2.716  68.408 147.095  1.00  0.89           O  
ATOM   6236  N   MET A 792      -5.378  66.308 154.009  1.00  0.85           N  
ATOM   6237  CA  MET A 792      -6.805  66.054 153.905  1.00  0.85           C  
ATOM   6238  C   MET A 792      -7.666  67.171 154.491  1.00  0.85           C  
ATOM   6239  O   MET A 792      -8.875  67.209 154.274  1.00  0.85           O  
ATOM   6240  CB  MET A 792      -7.190  64.710 154.562  1.00  0.85           C  
ATOM   6241  CG  MET A 792      -6.582  63.499 153.832  1.00  0.85           C  
ATOM   6242  SD  MET A 792      -7.316  61.905 154.307  1.00  0.85           S  
ATOM   6243  CE  MET A 792      -6.499  61.766 155.919  1.00  0.85           C  
ATOM   6244  N   ASN A 793      -7.074  68.137 155.225  1.00  0.82           N  
ATOM   6245  CA  ASN A 793      -7.767  69.331 155.665  1.00  0.82           C  
ATOM   6246  C   ASN A 793      -7.163  70.561 154.967  1.00  0.82           C  
ATOM   6247  O   ASN A 793      -6.138  71.084 155.416  1.00  0.82           O  
ATOM   6248  CB  ASN A 793      -7.618  69.425 157.209  1.00  0.82           C  
ATOM   6249  CG  ASN A 793      -8.487  70.518 157.827  1.00  0.82           C  
ATOM   6250  OD1 ASN A 793      -8.603  71.640 157.330  1.00  0.82           O  
ATOM   6251  ND2 ASN A 793      -9.112  70.200 158.984  1.00  0.82           N  
ATOM   6252  N   PRO A 794      -7.775  71.113 153.910  1.00  0.84           N  
ATOM   6253  CA  PRO A 794      -7.201  72.250 153.199  1.00  0.84           C  
ATOM   6254  C   PRO A 794      -7.109  73.518 154.021  1.00  0.84           C  
ATOM   6255  O   PRO A 794      -6.175  74.292 153.817  1.00  0.84           O  
ATOM   6256  CB  PRO A 794      -8.107  72.420 151.970  1.00  0.84           C  
ATOM   6257  CG  PRO A 794      -8.555  70.990 151.667  1.00  0.84           C  
ATOM   6258  CD  PRO A 794      -8.731  70.389 153.062  1.00  0.84           C  
ATOM   6259  N   LYS A 795      -8.058  73.781 154.944  1.00  0.79           N  
ATOM   6260  CA  LYS A 795      -8.006  74.959 155.791  1.00  0.79           C  
ATOM   6261  C   LYS A 795      -6.842  74.909 156.756  1.00  0.79           C  
ATOM   6262  O   LYS A 795      -6.099  75.877 156.890  1.00  0.79           O  
ATOM   6263  CB  LYS A 795      -9.328  75.186 156.562  1.00  0.79           C  
ATOM   6264  CG  LYS A 795      -9.363  76.522 157.329  1.00  0.79           C  
ATOM   6265  CD  LYS A 795     -10.722  76.787 157.994  1.00  0.79           C  
ATOM   6266  CE  LYS A 795     -10.764  78.034 158.893  1.00  0.79           C  
ATOM   6267  NZ  LYS A 795     -10.411  79.241 158.138  1.00  0.79           N  
ATOM   6268  N   ALA A 796      -6.608  73.756 157.409  1.00  0.87           N  
ATOM   6269  CA  ALA A 796      -5.482  73.563 158.296  1.00  0.87           C  
ATOM   6270  C   ALA A 796      -4.143  73.649 157.573  1.00  0.87           C  
ATOM   6271  O   ALA A 796      -3.235  74.352 158.017  1.00  0.87           O  
ATOM   6272  CB  ALA A 796      -5.629  72.212 159.020  1.00  0.87           C  
ATOM   6273  N   TRP A 797      -4.023  72.999 156.392  1.00  0.85           N  
ATOM   6274  CA  TRP A 797      -2.824  73.060 155.573  1.00  0.85           C  
ATOM   6275  C   TRP A 797      -2.484  74.479 155.119  1.00  0.85           C  
ATOM   6276  O   TRP A 797      -1.374  74.960 155.329  1.00  0.85           O  
ATOM   6277  CB  TRP A 797      -2.994  72.128 154.338  1.00  0.85           C  
ATOM   6278  CG  TRP A 797      -1.772  71.990 153.431  1.00  0.85           C  
ATOM   6279  CD1 TRP A 797      -1.377  72.782 152.386  1.00  0.85           C  
ATOM   6280  CD2 TRP A 797      -0.789  70.946 153.540  1.00  0.85           C  
ATOM   6281  NE1 TRP A 797      -0.204  72.303 151.840  1.00  0.85           N  
ATOM   6282  CE2 TRP A 797       0.176  71.181 152.538  1.00  0.85           C  
ATOM   6283  CE3 TRP A 797      -0.679  69.861 154.402  1.00  0.85           C  
ATOM   6284  CZ2 TRP A 797       1.267  70.335 152.390  1.00  0.85           C  
ATOM   6285  CZ3 TRP A 797       0.411  68.992 154.237  1.00  0.85           C  
ATOM   6286  CH2 TRP A 797       1.374  69.227 153.244  1.00  0.85           C  
ATOM   6287  N   ASN A 798      -3.459  75.225 154.557  1.00  0.87           N  
ATOM   6288  CA  ASN A 798      -3.256  76.605 154.136  1.00  0.87           C  
ATOM   6289  C   ASN A 798      -2.983  77.559 155.296  1.00  0.87           C  
ATOM   6290  O   ASN A 798      -2.152  78.455 155.184  1.00  0.87           O  
ATOM   6291  CB  ASN A 798      -4.414  77.119 153.247  1.00  0.87           C  
ATOM   6292  CG  ASN A 798      -4.266  76.517 151.854  1.00  0.87           C  
ATOM   6293  OD1 ASN A 798      -3.441  76.966 151.060  1.00  0.87           O  
ATOM   6294  ND2 ASN A 798      -5.053  75.469 151.535  1.00  0.87           N  
ATOM   6295  N   THR A 799      -3.635  77.370 156.463  1.00  0.87           N  
ATOM   6296  CA  THR A 799      -3.336  78.135 157.683  1.00  0.87           C  
ATOM   6297  C   THR A 799      -1.895  77.951 158.141  1.00  0.87           C  
ATOM   6298  O   THR A 799      -1.192  78.908 158.469  1.00  0.87           O  
ATOM   6299  CB  THR A 799      -4.233  77.759 158.859  1.00  0.87           C  
ATOM   6300  OG1 THR A 799      -5.596  77.936 158.504  1.00  0.87           O  
ATOM   6301  CG2 THR A 799      -4.014  78.693 160.057  1.00  0.87           C  
ATOM   6302  N   MET A 800      -1.392  76.698 158.129  1.00  0.88           N  
ATOM   6303  CA  MET A 800      -0.002  76.380 158.418  1.00  0.88           C  
ATOM   6304  C   MET A 800       0.980  76.941 157.387  1.00  0.88           C  
ATOM   6305  O   MET A 800       2.030  77.486 157.736  1.00  0.88           O  
ATOM   6306  CB  MET A 800       0.186  74.850 158.578  1.00  0.88           C  
ATOM   6307  CG  MET A 800       1.516  74.461 159.255  1.00  0.88           C  
ATOM   6308  SD  MET A 800       1.738  72.679 159.544  1.00  0.88           S  
ATOM   6309  CE  MET A 800       0.631  72.571 160.980  1.00  0.88           C  
ATOM   6310  N   VAL A 801       0.638  76.866 156.080  1.00  0.93           N  
ATOM   6311  CA  VAL A 801       1.394  77.474 154.987  1.00  0.93           C  
ATOM   6312  C   VAL A 801       1.510  78.980 155.149  1.00  0.93           C  
ATOM   6313  O   VAL A 801       2.595  79.546 155.030  1.00  0.93           O  
ATOM   6314  CB  VAL A 801       0.772  77.139 153.628  1.00  0.93           C  
ATOM   6315  CG1 VAL A 801       1.330  78.013 152.487  1.00  0.93           C  
ATOM   6316  CG2 VAL A 801       1.056  75.663 153.298  1.00  0.93           C  
ATOM   6317  N   LEU A 802       0.406  79.669 155.499  1.00  0.90           N  
ATOM   6318  CA  LEU A 802       0.399  81.096 155.754  1.00  0.90           C  
ATOM   6319  C   LEU A 802       1.306  81.525 156.905  1.00  0.90           C  
ATOM   6320  O   LEU A 802       2.062  82.487 156.781  1.00  0.90           O  
ATOM   6321  CB  LEU A 802      -1.051  81.588 155.969  1.00  0.90           C  
ATOM   6322  CG  LEU A 802      -1.209  83.107 156.181  1.00  0.90           C  
ATOM   6323  CD1 LEU A 802      -0.452  83.937 155.135  1.00  0.90           C  
ATOM   6324  CD2 LEU A 802      -2.695  83.491 156.161  1.00  0.90           C  
ATOM   6325  N   LYS A 803       1.329  80.775 158.032  1.00  0.88           N  
ATOM   6326  CA  LYS A 803       2.300  81.010 159.096  1.00  0.88           C  
ATOM   6327  C   LYS A 803       3.754  80.875 158.621  1.00  0.88           C  
ATOM   6328  O   LYS A 803       4.605  81.693 158.962  1.00  0.88           O  
ATOM   6329  CB  LYS A 803       2.129  80.017 160.274  1.00  0.88           C  
ATOM   6330  CG  LYS A 803       0.870  80.147 161.158  1.00  0.88           C  
ATOM   6331  CD  LYS A 803       1.011  79.103 162.283  1.00  0.88           C  
ATOM   6332  CE  LYS A 803      -0.095  78.933 163.335  1.00  0.88           C  
ATOM   6333  NZ  LYS A 803       0.232  77.774 164.211  1.00  0.88           N  
ATOM   6334  N   ASN A 804       4.064  79.848 157.796  1.00  0.93           N  
ATOM   6335  CA  ASN A 804       5.385  79.660 157.207  1.00  0.93           C  
ATOM   6336  C   ASN A 804       5.804  80.790 156.264  1.00  0.93           C  
ATOM   6337  O   ASN A 804       6.921  81.290 156.360  1.00  0.93           O  
ATOM   6338  CB  ASN A 804       5.485  78.306 156.452  1.00  0.93           C  
ATOM   6339  CG  ASN A 804       5.796  77.163 157.414  1.00  0.93           C  
ATOM   6340  OD1 ASN A 804       6.955  76.767 157.545  1.00  0.93           O  
ATOM   6341  ND2 ASN A 804       4.767  76.605 158.087  1.00  0.93           N  
ATOM   6342  N   ILE A 805       4.918  81.264 155.359  1.00  0.95           N  
ATOM   6343  CA  ILE A 805       5.219  82.400 154.483  1.00  0.95           C  
ATOM   6344  C   ILE A 805       5.449  83.675 155.281  1.00  0.95           C  
ATOM   6345  O   ILE A 805       6.433  84.385 155.080  1.00  0.95           O  
ATOM   6346  CB  ILE A 805       4.123  82.648 153.441  1.00  0.95           C  
ATOM   6347  CG1 ILE A 805       3.968  81.414 152.522  1.00  0.95           C  
ATOM   6348  CG2 ILE A 805       4.447  83.902 152.587  1.00  0.95           C  
ATOM   6349  CD1 ILE A 805       2.734  81.488 151.616  1.00  0.95           C  
ATOM   6350  N   ALA A 806       4.577  83.963 156.267  1.00  0.92           N  
ATOM   6351  CA  ALA A 806       4.665  85.129 157.123  1.00  0.92           C  
ATOM   6352  C   ALA A 806       5.943  85.192 157.964  1.00  0.92           C  
ATOM   6353  O   ALA A 806       6.543  86.247 158.161  1.00  0.92           O  
ATOM   6354  CB  ALA A 806       3.415  85.178 158.016  1.00  0.92           C  
ATOM   6355  N   ALA A 807       6.422  84.031 158.445  1.00  0.93           N  
ATOM   6356  CA  ALA A 807       7.618  83.928 159.253  1.00  0.93           C  
ATOM   6357  C   ALA A 807       8.889  83.688 158.437  1.00  0.93           C  
ATOM   6358  O   ALA A 807       9.977  83.503 158.977  1.00  0.93           O  
ATOM   6359  CB  ALA A 807       7.421  82.755 160.222  1.00  0.93           C  
ATOM   6360  N   SER A 808       8.812  83.736 157.092  1.00  0.94           N  
ATOM   6361  CA  SER A 808       9.963  83.509 156.222  1.00  0.94           C  
ATOM   6362  C   SER A 808      10.904  84.702 156.133  1.00  0.94           C  
ATOM   6363  O   SER A 808      12.029  84.594 155.647  1.00  0.94           O  
ATOM   6364  CB  SER A 808       9.560  83.060 154.788  1.00  0.94           C  
ATOM   6365  OG  SER A 808       8.905  84.084 154.039  1.00  0.94           O  
ATOM   6366  N   GLY A 809      10.468  85.879 156.637  1.00  0.93           N  
ATOM   6367  CA  GLY A 809      11.111  87.177 156.445  1.00  0.93           C  
ATOM   6368  C   GLY A 809      12.547  87.337 156.873  1.00  0.93           C  
ATOM   6369  O   GLY A 809      13.298  88.124 156.302  1.00  0.93           O  
ATOM   6370  N   LYS A 810      13.000  86.566 157.875  1.00  0.90           N  
ATOM   6371  CA  LYS A 810      14.394  86.514 158.281  1.00  0.90           C  
ATOM   6372  C   LYS A 810      15.316  85.974 157.197  1.00  0.90           C  
ATOM   6373  O   LYS A 810      16.490  86.335 157.104  1.00  0.90           O  
ATOM   6374  CB  LYS A 810      14.532  85.623 159.531  1.00  0.90           C  
ATOM   6375  CG  LYS A 810      15.958  85.472 160.099  1.00  0.90           C  
ATOM   6376  CD  LYS A 810      15.888  84.599 161.352  1.00  0.90           C  
ATOM   6377  CE  LYS A 810      17.198  84.143 161.986  1.00  0.90           C  
ATOM   6378  NZ  LYS A 810      16.890  83.237 163.113  1.00  0.90           N  
ATOM   6379  N   PHE A 811      14.806  85.092 156.324  1.00  0.94           N  
ATOM   6380  CA  PHE A 811      15.619  84.325 155.407  1.00  0.94           C  
ATOM   6381  C   PHE A 811      15.809  85.018 154.073  1.00  0.94           C  
ATOM   6382  O   PHE A 811      16.323  84.426 153.129  1.00  0.94           O  
ATOM   6383  CB  PHE A 811      15.025  82.910 155.199  1.00  0.94           C  
ATOM   6384  CG  PHE A 811      14.973  82.209 156.530  1.00  0.94           C  
ATOM   6385  CD1 PHE A 811      16.160  81.841 157.190  1.00  0.94           C  
ATOM   6386  CD2 PHE A 811      13.743  81.982 157.165  1.00  0.94           C  
ATOM   6387  CE1 PHE A 811      16.116  81.282 158.474  1.00  0.94           C  
ATOM   6388  CE2 PHE A 811      13.694  81.426 158.448  1.00  0.94           C  
ATOM   6389  CZ  PHE A 811      14.882  81.084 159.105  1.00  0.94           C  
ATOM   6390  N   SER A 812      15.482  86.325 153.953  1.00  0.96           N  
ATOM   6391  CA  SER A 812      16.096  87.126 152.895  1.00  0.96           C  
ATOM   6392  C   SER A 812      17.606  87.261 153.079  1.00  0.96           C  
ATOM   6393  O   SER A 812      18.109  87.467 154.184  1.00  0.96           O  
ATOM   6394  CB  SER A 812      15.514  88.555 152.685  1.00  0.96           C  
ATOM   6395  OG  SER A 812      16.124  89.160 151.538  1.00  0.96           O  
ATOM   6396  N   SER A 813      18.376  87.219 151.975  1.00  0.97           N  
ATOM   6397  CA  SER A 813      19.800  87.513 151.989  1.00  0.97           C  
ATOM   6398  C   SER A 813      20.073  88.988 152.199  1.00  0.97           C  
ATOM   6399  O   SER A 813      21.177  89.364 152.579  1.00  0.97           O  
ATOM   6400  CB  SER A 813      20.562  87.026 150.727  1.00  0.97           C  
ATOM   6401  OG  SER A 813      19.882  87.346 149.516  1.00  0.97           O  
ATOM   6402  N   ASP A 814      19.063  89.871 152.039  1.00  0.93           N  
ATOM   6403  CA  ASP A 814      19.167  91.278 152.394  1.00  0.93           C  
ATOM   6404  C   ASP A 814      19.420  91.480 153.885  1.00  0.93           C  
ATOM   6405  O   ASP A 814      20.154  92.376 154.298  1.00  0.93           O  
ATOM   6406  CB  ASP A 814      17.906  92.085 152.001  1.00  0.93           C  
ATOM   6407  CG  ASP A 814      17.518  91.811 150.569  1.00  0.93           C  
ATOM   6408  OD1 ASP A 814      16.309  91.562 150.334  1.00  0.93           O  
ATOM   6409  OD2 ASP A 814      18.398  91.817 149.672  1.00  0.93           O  
ATOM   6410  N   ARG A 815      18.805  90.636 154.743  1.00  0.87           N  
ATOM   6411  CA  ARG A 815      19.078  90.606 156.169  1.00  0.87           C  
ATOM   6412  C   ARG A 815      20.496  90.130 156.458  1.00  0.87           C  
ATOM   6413  O   ARG A 815      21.238  90.776 157.194  1.00  0.87           O  
ATOM   6414  CB  ARG A 815      18.005  89.724 156.864  1.00  0.87           C  
ATOM   6415  CG  ARG A 815      18.037  89.659 158.414  1.00  0.87           C  
ATOM   6416  CD  ARG A 815      19.017  88.658 159.050  1.00  0.87           C  
ATOM   6417  NE  ARG A 815      18.662  87.313 158.504  1.00  0.87           N  
ATOM   6418  CZ  ARG A 815      19.536  86.314 158.336  1.00  0.87           C  
ATOM   6419  NH1 ARG A 815      20.732  86.298 158.897  1.00  0.87           N  
ATOM   6420  NH2 ARG A 815      19.171  85.307 157.544  1.00  0.87           N  
ATOM   6421  N   THR A 816      20.933  89.026 155.814  1.00  0.94           N  
ATOM   6422  CA  THR A 816      22.275  88.458 155.959  1.00  0.94           C  
ATOM   6423  C   THR A 816      23.375  89.419 155.530  1.00  0.94           C  
ATOM   6424  O   THR A 816      24.382  89.604 156.208  1.00  0.94           O  
ATOM   6425  CB  THR A 816      22.451  87.179 155.141  1.00  0.94           C  
ATOM   6426  OG1 THR A 816      21.353  86.300 155.307  1.00  0.94           O  
ATOM   6427  CG2 THR A 816      23.692  86.397 155.581  1.00  0.94           C  
ATOM   6428  N   ILE A 817      23.194  90.109 154.386  1.00  0.92           N  
ATOM   6429  CA  ILE A 817      24.098  91.142 153.899  1.00  0.92           C  
ATOM   6430  C   ILE A 817      24.192  92.348 154.822  1.00  0.92           C  
ATOM   6431  O   ILE A 817      25.285  92.865 155.045  1.00  0.92           O  
ATOM   6432  CB  ILE A 817      23.780  91.529 152.455  1.00  0.92           C  
ATOM   6433  CG1 ILE A 817      24.131  90.369 151.484  1.00  0.92           C  
ATOM   6434  CG2 ILE A 817      24.501  92.825 152.021  1.00  0.92           C  
ATOM   6435  CD1 ILE A 817      25.600  89.927 151.500  1.00  0.92           C  
ATOM   6436  N   LYS A 818      23.080  92.805 155.444  1.00  0.85           N  
ATOM   6437  CA  LYS A 818      23.145  93.827 156.486  1.00  0.85           C  
ATOM   6438  C   LYS A 818      23.998  93.398 157.683  1.00  0.85           C  
ATOM   6439  O   LYS A 818      24.811  94.178 158.180  1.00  0.85           O  
ATOM   6440  CB  LYS A 818      21.742  94.252 156.996  1.00  0.85           C  
ATOM   6441  CG  LYS A 818      20.938  95.132 156.019  1.00  0.85           C  
ATOM   6442  CD  LYS A 818      19.625  95.622 156.661  1.00  0.85           C  
ATOM   6443  CE  LYS A 818      18.747  96.521 155.776  1.00  0.85           C  
ATOM   6444  NZ  LYS A 818      18.059  95.728 154.729  1.00  0.85           N  
ATOM   6445  N   GLU A 819      23.883  92.132 158.141  1.00  0.86           N  
ATOM   6446  CA  GLU A 819      24.751  91.594 159.176  1.00  0.86           C  
ATOM   6447  C   GLU A 819      26.231  91.559 158.790  1.00  0.86           C  
ATOM   6448  O   GLU A 819      27.085  91.982 159.573  1.00  0.86           O  
ATOM   6449  CB  GLU A 819      24.374  90.141 159.544  1.00  0.86           C  
ATOM   6450  CG  GLU A 819      22.961  89.919 160.119  1.00  0.86           C  
ATOM   6451  CD  GLU A 819      22.662  88.432 160.270  1.00  0.86           C  
ATOM   6452  OE1 GLU A 819      21.502  88.114 160.640  1.00  0.86           O  
ATOM   6453  OE2 GLU A 819      23.539  87.581 159.973  1.00  0.86           O  
ATOM   6454  N   TYR A 820      26.579  91.073 157.571  1.00  0.92           N  
ATOM   6455  CA  TYR A 820      27.948  91.055 157.048  1.00  0.92           C  
ATOM   6456  C   TYR A 820      28.529  92.456 156.925  1.00  0.92           C  
ATOM   6457  O   TYR A 820      29.667  92.715 157.320  1.00  0.92           O  
ATOM   6458  CB  TYR A 820      28.032  90.411 155.631  1.00  0.92           C  
ATOM   6459  CG  TYR A 820      28.238  88.920 155.652  1.00  0.92           C  
ATOM   6460  CD1 TYR A 820      29.515  88.380 155.885  1.00  0.92           C  
ATOM   6461  CD2 TYR A 820      27.189  88.047 155.328  1.00  0.92           C  
ATOM   6462  CE1 TYR A 820      29.728  86.992 155.831  1.00  0.92           C  
ATOM   6463  CE2 TYR A 820      27.399  86.662 155.270  1.00  0.92           C  
ATOM   6464  CZ  TYR A 820      28.667  86.134 155.524  1.00  0.92           C  
ATOM   6465  OH  TYR A 820      28.851  84.737 155.454  1.00  0.92           O  
ATOM   6466  N   ALA A 821      27.729  93.406 156.405  1.00  0.90           N  
ATOM   6467  CA  ALA A 821      28.099  94.793 156.261  1.00  0.90           C  
ATOM   6468  C   ALA A 821      28.426  95.474 157.581  1.00  0.90           C  
ATOM   6469  O   ALA A 821      29.469  96.110 157.718  1.00  0.90           O  
ATOM   6470  CB  ALA A 821      26.934  95.530 155.570  1.00  0.90           C  
ATOM   6471  N   GLN A 822      27.563  95.299 158.596  1.00  0.81           N  
ATOM   6472  CA  GLN A 822      27.758  95.838 159.926  1.00  0.81           C  
ATOM   6473  C   GLN A 822      28.879  95.189 160.738  1.00  0.81           C  
ATOM   6474  O   GLN A 822      29.685  95.873 161.359  1.00  0.81           O  
ATOM   6475  CB  GLN A 822      26.412  95.692 160.678  1.00  0.81           C  
ATOM   6476  CG  GLN A 822      26.390  96.228 162.128  1.00  0.81           C  
ATOM   6477  CD  GLN A 822      25.031  95.935 162.765  1.00  0.81           C  
ATOM   6478  OE1 GLN A 822      24.600  94.785 162.860  1.00  0.81           O  
ATOM   6479  NE2 GLN A 822      24.321  96.996 163.209  1.00  0.81           N  
ATOM   6480  N   ASN A 823      28.965  93.841 160.768  1.00  0.85           N  
ATOM   6481  CA  ASN A 823      29.745  93.155 161.795  1.00  0.85           C  
ATOM   6482  C   ASN A 823      31.009  92.489 161.271  1.00  0.85           C  
ATOM   6483  O   ASN A 823      31.732  91.844 162.030  1.00  0.85           O  
ATOM   6484  CB  ASN A 823      28.902  92.037 162.459  1.00  0.85           C  
ATOM   6485  CG  ASN A 823      27.678  92.619 163.156  1.00  0.85           C  
ATOM   6486  OD1 ASN A 823      27.748  93.054 164.302  1.00  0.85           O  
ATOM   6487  ND2 ASN A 823      26.520  92.608 162.460  1.00  0.85           N  
ATOM   6488  N   ILE A 824      31.306  92.605 159.964  1.00  0.91           N  
ATOM   6489  CA  ILE A 824      32.491  91.991 159.375  1.00  0.91           C  
ATOM   6490  C   ILE A 824      33.160  92.994 158.453  1.00  0.91           C  
ATOM   6491  O   ILE A 824      34.323  93.351 158.643  1.00  0.91           O  
ATOM   6492  CB  ILE A 824      32.178  90.676 158.639  1.00  0.91           C  
ATOM   6493  CG1 ILE A 824      31.758  89.589 159.663  1.00  0.91           C  
ATOM   6494  CG2 ILE A 824      33.407  90.200 157.831  1.00  0.91           C  
ATOM   6495  CD1 ILE A 824      31.374  88.234 159.057  1.00  0.91           C  
ATOM   6496  N   TRP A 825      32.455  93.465 157.406  1.00  0.88           N  
ATOM   6497  CA  TRP A 825      33.016  94.360 156.408  1.00  0.88           C  
ATOM   6498  C   TRP A 825      33.245  95.794 156.869  1.00  0.88           C  
ATOM   6499  O   TRP A 825      34.260  96.396 156.515  1.00  0.88           O  
ATOM   6500  CB  TRP A 825      32.165  94.332 155.112  1.00  0.88           C  
ATOM   6501  CG  TRP A 825      32.075  92.953 154.475  1.00  0.88           C  
ATOM   6502  CD1 TRP A 825      32.985  91.932 154.535  1.00  0.88           C  
ATOM   6503  CD2 TRP A 825      30.960  92.452 153.712  1.00  0.88           C  
ATOM   6504  NE1 TRP A 825      32.498  90.819 153.898  1.00  0.88           N  
ATOM   6505  CE2 TRP A 825      31.266  91.115 153.373  1.00  0.88           C  
ATOM   6506  CE3 TRP A 825      29.758  93.036 153.316  1.00  0.88           C  
ATOM   6507  CZ2 TRP A 825      30.379  90.342 152.640  1.00  0.88           C  
ATOM   6508  CZ3 TRP A 825      28.863  92.255 152.569  1.00  0.88           C  
ATOM   6509  CH2 TRP A 825      29.171  90.926 152.234  1.00  0.88           C  
ATOM   6510  N   ASN A 826      32.309  96.366 157.658  1.00  0.84           N  
ATOM   6511  CA  ASN A 826      32.264  97.769 158.048  1.00  0.84           C  
ATOM   6512  C   ASN A 826      31.886  98.661 156.864  1.00  0.84           C  
ATOM   6513  O   ASN A 826      32.661  99.510 156.425  1.00  0.84           O  
ATOM   6514  CB  ASN A 826      33.534  98.240 158.823  1.00  0.84           C  
ATOM   6515  CG  ASN A 826      33.289  99.563 159.543  1.00  0.84           C  
ATOM   6516  OD1 ASN A 826      32.224  99.788 160.114  1.00  0.84           O  
ATOM   6517  ND2 ASN A 826      34.293 100.469 159.538  1.00  0.84           N  
ATOM   6518  N   VAL A 827      30.679  98.442 156.298  1.00  0.83           N  
ATOM   6519  CA  VAL A 827      30.153  99.205 155.172  1.00  0.83           C  
ATOM   6520  C   VAL A 827      28.679  99.515 155.405  1.00  0.83           C  
ATOM   6521  O   VAL A 827      27.995  98.826 156.160  1.00  0.83           O  
ATOM   6522  CB  VAL A 827      30.317  98.518 153.808  1.00  0.83           C  
ATOM   6523  CG1 VAL A 827      31.810  98.320 153.495  1.00  0.83           C  
ATOM   6524  CG2 VAL A 827      29.590  97.163 153.757  1.00  0.83           C  
ATOM   6525  N   GLU A 828      28.150 100.575 154.757  1.00  0.73           N  
ATOM   6526  CA  GLU A 828      26.832 101.122 155.042  1.00  0.73           C  
ATOM   6527  C   GLU A 828      25.925 101.066 153.802  1.00  0.73           C  
ATOM   6528  O   GLU A 828      26.361 101.500 152.733  1.00  0.73           O  
ATOM   6529  CB  GLU A 828      26.982 102.583 155.524  1.00  0.73           C  
ATOM   6530  CG  GLU A 828      25.696 103.204 156.120  1.00  0.73           C  
ATOM   6531  CD  GLU A 828      25.992 104.557 156.763  1.00  0.73           C  
ATOM   6532  OE1 GLU A 828      25.416 105.574 156.300  1.00  0.73           O  
ATOM   6533  OE2 GLU A 828      26.796 104.574 157.730  1.00  0.73           O  
ATOM   6534  N   PRO A 829      24.708 100.501 153.848  1.00  0.78           N  
ATOM   6535  CA  PRO A 829      23.734 100.541 152.749  1.00  0.78           C  
ATOM   6536  C   PRO A 829      23.299 101.913 152.235  1.00  0.78           C  
ATOM   6537  O   PRO A 829      23.307 102.880 152.992  1.00  0.78           O  
ATOM   6538  CB  PRO A 829      22.532  99.760 153.313  1.00  0.78           C  
ATOM   6539  CG  PRO A 829      23.169  98.756 154.273  1.00  0.78           C  
ATOM   6540  CD  PRO A 829      24.282  99.586 154.909  1.00  0.78           C  
ATOM   6541  N   SER A 830      22.879 102.003 150.956  1.00  0.69           N  
ATOM   6542  CA  SER A 830      22.384 103.227 150.328  1.00  0.69           C  
ATOM   6543  C   SER A 830      21.611 102.879 149.056  1.00  0.69           C  
ATOM   6544  O   SER A 830      21.512 101.702 148.709  1.00  0.69           O  
ATOM   6545  CB  SER A 830      23.497 104.283 150.054  1.00  0.69           C  
ATOM   6546  OG  SER A 830      24.528 103.804 149.185  1.00  0.69           O  
ATOM   6547  N   ASP A 831      20.996 103.854 148.349  1.00  0.50           N  
ATOM   6548  CA  ASP A 831      20.254 103.574 147.132  1.00  0.50           C  
ATOM   6549  C   ASP A 831      20.307 104.708 146.059  1.00  0.50           C  
ATOM   6550  O   ASP A 831      20.767 105.839 146.367  1.00  0.50           O  
ATOM   6551  CB  ASP A 831      18.805 103.041 147.405  1.00  0.50           C  
ATOM   6552  CG  ASP A 831      17.906 103.803 148.385  1.00  0.50           C  
ATOM   6553  OD1 ASP A 831      16.706 103.951 148.012  1.00  0.50           O  
ATOM   6554  OD2 ASP A 831      18.333 104.105 149.529  1.00  0.50           O  
ATOM   6555  OXT ASP A 831      19.938 104.412 144.880  1.00  0.50           O  
TER    6556      ASP A 831                                                      
ATOM   6557  N   ASN B  23      25.363 110.657 106.517  1.00  0.81           N  
ATOM   6558  CA  ASN B  23      25.952 112.033 106.706  1.00  0.81           C  
ATOM   6559  C   ASN B  23      27.005 111.984 107.809  1.00  0.81           C  
ATOM   6560  O   ASN B  23      27.153 110.938 108.430  1.00  0.81           O  
ATOM   6561  CB  ASN B  23      24.818 113.093 106.935  1.00  0.81           C  
ATOM   6562  CG  ASN B  23      23.944 112.764 108.151  1.00  0.81           C  
ATOM   6563  OD1 ASN B  23      24.473 112.359 109.182  1.00  0.81           O  
ATOM   6564  ND2 ASN B  23      22.607 112.864 108.019  1.00  0.81           N  
ATOM   6565  N   VAL B  24      27.763 113.070 108.069  1.00  0.86           N  
ATOM   6566  CA  VAL B  24      28.747 113.105 109.149  1.00  0.86           C  
ATOM   6567  C   VAL B  24      28.126 113.003 110.542  1.00  0.86           C  
ATOM   6568  O   VAL B  24      28.577 112.241 111.394  1.00  0.86           O  
ATOM   6569  CB  VAL B  24      29.592 114.371 109.049  1.00  0.86           C  
ATOM   6570  CG1 VAL B  24      30.641 114.429 110.176  1.00  0.86           C  
ATOM   6571  CG2 VAL B  24      30.325 114.380 107.693  1.00  0.86           C  
ATOM   6572  N   ALA B  25      27.029 113.747 110.798  1.00  0.84           N  
ATOM   6573  CA  ALA B  25      26.406 113.855 112.104  1.00  0.84           C  
ATOM   6574  C   ALA B  25      25.889 112.543 112.695  1.00  0.84           C  
ATOM   6575  O   ALA B  25      26.143 112.242 113.861  1.00  0.84           O  
ATOM   6576  CB  ALA B  25      25.262 114.884 112.018  1.00  0.84           C  
ATOM   6577  N   GLU B  26      25.205 111.701 111.893  1.00  0.76           N  
ATOM   6578  CA  GLU B  26      24.754 110.396 112.352  1.00  0.76           C  
ATOM   6579  C   GLU B  26      25.860 109.361 112.431  1.00  0.76           C  
ATOM   6580  O   GLU B  26      25.752 108.385 113.169  1.00  0.76           O  
ATOM   6581  CB  GLU B  26      23.603 109.824 111.486  1.00  0.76           C  
ATOM   6582  CG  GLU B  26      22.221 110.437 111.814  1.00  0.76           C  
ATOM   6583  CD  GLU B  26      21.845 110.278 113.287  1.00  0.76           C  
ATOM   6584  OE1 GLU B  26      22.058 109.184 113.882  1.00  0.76           O  
ATOM   6585  OE2 GLU B  26      21.372 111.294 113.854  1.00  0.76           O  
ATOM   6586  N   LEU B  27      26.994 109.541 111.724  1.00  0.85           N  
ATOM   6587  CA  LEU B  27      28.172 108.723 111.970  1.00  0.85           C  
ATOM   6588  C   LEU B  27      28.772 108.998 113.341  1.00  0.85           C  
ATOM   6589  O   LEU B  27      29.096 108.068 114.077  1.00  0.85           O  
ATOM   6590  CB  LEU B  27      29.234 108.882 110.861  1.00  0.85           C  
ATOM   6591  CG  LEU B  27      28.824 108.241 109.519  1.00  0.85           C  
ATOM   6592  CD1 LEU B  27      29.775 108.705 108.413  1.00  0.85           C  
ATOM   6593  CD2 LEU B  27      28.815 106.706 109.581  1.00  0.85           C  
ATOM   6594  N   LYS B  28      28.862 110.283 113.758  1.00  0.80           N  
ATOM   6595  CA  LYS B  28      29.240 110.632 115.121  1.00  0.80           C  
ATOM   6596  C   LYS B  28      28.250 110.131 116.159  1.00  0.80           C  
ATOM   6597  O   LYS B  28      28.630 109.534 117.165  1.00  0.80           O  
ATOM   6598  CB  LYS B  28      29.394 112.161 115.329  1.00  0.80           C  
ATOM   6599  CG  LYS B  28      30.353 112.804 114.324  1.00  0.80           C  
ATOM   6600  CD  LYS B  28      30.935 114.161 114.750  1.00  0.80           C  
ATOM   6601  CE  LYS B  28      29.937 115.207 115.247  1.00  0.80           C  
ATOM   6602  NZ  LYS B  28      30.669 116.457 115.543  1.00  0.80           N  
ATOM   6603  N   LYS B  29      26.936 110.316 115.910  1.00  0.79           N  
ATOM   6604  CA  LYS B  29      25.894 109.850 116.804  1.00  0.79           C  
ATOM   6605  C   LYS B  29      25.875 108.336 116.960  1.00  0.79           C  
ATOM   6606  O   LYS B  29      25.781 107.829 118.074  1.00  0.79           O  
ATOM   6607  CB  LYS B  29      24.502 110.375 116.372  1.00  0.79           C  
ATOM   6608  CG  LYS B  29      23.441 110.297 117.488  1.00  0.79           C  
ATOM   6609  CD  LYS B  29      22.038 110.752 117.041  1.00  0.79           C  
ATOM   6610  CE  LYS B  29      21.928 112.194 116.523  1.00  0.79           C  
ATOM   6611  NZ  LYS B  29      22.236 113.168 117.585  1.00  0.79           N  
ATOM   6612  N   SER B  30      26.026 107.567 115.860  1.00  0.83           N  
ATOM   6613  CA  SER B  30      26.204 106.118 115.888  1.00  0.83           C  
ATOM   6614  C   SER B  30      27.459 105.660 116.593  1.00  0.83           C  
ATOM   6615  O   SER B  30      27.409 104.713 117.376  1.00  0.83           O  
ATOM   6616  CB  SER B  30      26.186 105.474 114.481  1.00  0.83           C  
ATOM   6617  OG  SER B  30      24.866 105.506 113.928  1.00  0.83           O  
ATOM   6618  N   PHE B  31      28.601 106.349 116.389  1.00  0.87           N  
ATOM   6619  CA  PHE B  31      29.836 106.097 117.115  1.00  0.87           C  
ATOM   6620  C   PHE B  31      29.652 106.285 118.620  1.00  0.87           C  
ATOM   6621  O   PHE B  31      30.035 105.432 119.417  1.00  0.87           O  
ATOM   6622  CB  PHE B  31      30.938 107.048 116.564  1.00  0.87           C  
ATOM   6623  CG  PHE B  31      32.292 106.860 117.199  1.00  0.87           C  
ATOM   6624  CD1 PHE B  31      32.610 107.511 118.404  1.00  0.87           C  
ATOM   6625  CD2 PHE B  31      33.274 106.079 116.574  1.00  0.87           C  
ATOM   6626  CE1 PHE B  31      33.885 107.395 118.970  1.00  0.87           C  
ATOM   6627  CE2 PHE B  31      34.552 105.962 117.135  1.00  0.87           C  
ATOM   6628  CZ  PHE B  31      34.858 106.622 118.328  1.00  0.87           C  
ATOM   6629  N   ASN B  32      28.998 107.385 119.050  1.00  0.81           N  
ATOM   6630  CA  ASN B  32      28.652 107.619 120.445  1.00  0.81           C  
ATOM   6631  C   ASN B  32      27.682 106.576 120.999  1.00  0.81           C  
ATOM   6632  O   ASN B  32      27.850 106.088 122.114  1.00  0.81           O  
ATOM   6633  CB  ASN B  32      28.062 109.043 120.659  1.00  0.81           C  
ATOM   6634  CG  ASN B  32      29.006 110.171 120.238  1.00  0.81           C  
ATOM   6635  OD1 ASN B  32      28.567 111.231 119.790  1.00  0.81           O  
ATOM   6636  ND2 ASN B  32      30.335 109.978 120.401  1.00  0.81           N  
ATOM   6637  N   ARG B  33      26.664 106.176 120.207  1.00  0.77           N  
ATOM   6638  CA  ARG B  33      25.709 105.134 120.549  1.00  0.77           C  
ATOM   6639  C   ARG B  33      26.373 103.776 120.781  1.00  0.77           C  
ATOM   6640  O   ARG B  33      26.158 103.125 121.801  1.00  0.77           O  
ATOM   6641  CB  ARG B  33      24.660 105.019 119.401  1.00  0.77           C  
ATOM   6642  CG  ARG B  33      23.199 104.815 119.846  1.00  0.77           C  
ATOM   6643  CD  ARG B  33      22.192 104.651 118.688  1.00  0.77           C  
ATOM   6644  NE  ARG B  33      22.208 105.881 117.803  1.00  0.77           N  
ATOM   6645  CZ  ARG B  33      22.555 105.908 116.504  1.00  0.77           C  
ATOM   6646  NH1 ARG B  33      23.016 104.828 115.886  1.00  0.77           N  
ATOM   6647  NH2 ARG B  33      22.485 107.045 115.810  1.00  0.77           N  
ATOM   6648  N   HIS B  34      27.261 103.347 119.860  1.00  0.80           N  
ATOM   6649  CA  HIS B  34      28.063 102.143 120.015  1.00  0.80           C  
ATOM   6650  C   HIS B  34      29.075 102.220 121.146  1.00  0.80           C  
ATOM   6651  O   HIS B  34      29.244 101.268 121.901  1.00  0.80           O  
ATOM   6652  CB  HIS B  34      28.775 101.743 118.699  1.00  0.80           C  
ATOM   6653  CG  HIS B  34      27.891 100.926 117.806  1.00  0.80           C  
ATOM   6654  ND1 HIS B  34      27.468  99.699 118.281  1.00  0.80           N  
ATOM   6655  CD2 HIS B  34      27.416 101.137 116.548  1.00  0.80           C  
ATOM   6656  CE1 HIS B  34      26.739  99.188 117.306  1.00  0.80           C  
ATOM   6657  NE2 HIS B  34      26.680 100.013 116.237  1.00  0.80           N  
ATOM   6658  N   LEU B  35      29.768 103.357 121.334  1.00  0.83           N  
ATOM   6659  CA  LEU B  35      30.697 103.528 122.438  1.00  0.83           C  
ATOM   6660  C   LEU B  35      30.029 103.416 123.808  1.00  0.83           C  
ATOM   6661  O   LEU B  35      30.506 102.715 124.699  1.00  0.83           O  
ATOM   6662  CB  LEU B  35      31.398 104.897 122.291  1.00  0.83           C  
ATOM   6663  CG  LEU B  35      32.582 105.153 123.240  1.00  0.83           C  
ATOM   6664  CD1 LEU B  35      33.745 104.176 123.005  1.00  0.83           C  
ATOM   6665  CD2 LEU B  35      33.065 106.597 123.063  1.00  0.83           C  
ATOM   6666  N   HIS B  36      28.858 104.060 123.978  1.00  0.77           N  
ATOM   6667  CA  HIS B  36      28.083 103.946 125.199  1.00  0.77           C  
ATOM   6668  C   HIS B  36      27.480 102.563 125.427  1.00  0.77           C  
ATOM   6669  O   HIS B  36      27.751 101.928 126.439  1.00  0.77           O  
ATOM   6670  CB  HIS B  36      26.951 105.001 125.180  1.00  0.77           C  
ATOM   6671  CG  HIS B  36      26.130 105.072 126.430  1.00  0.77           C  
ATOM   6672  ND1 HIS B  36      26.637 105.690 127.553  1.00  0.77           N  
ATOM   6673  CD2 HIS B  36      24.876 104.616 126.671  1.00  0.77           C  
ATOM   6674  CE1 HIS B  36      25.685 105.602 128.455  1.00  0.77           C  
ATOM   6675  NE2 HIS B  36      24.593 104.960 127.975  1.00  0.77           N  
ATOM   6676  N   PHE B  37      26.680 102.019 124.483  1.00  0.77           N  
ATOM   6677  CA  PHE B  37      25.955 100.775 124.728  1.00  0.77           C  
ATOM   6678  C   PHE B  37      26.785  99.517 124.505  1.00  0.77           C  
ATOM   6679  O   PHE B  37      26.833  98.622 125.346  1.00  0.77           O  
ATOM   6680  CB  PHE B  37      24.675 100.692 123.850  1.00  0.77           C  
ATOM   6681  CG  PHE B  37      23.660 101.725 124.267  1.00  0.77           C  
ATOM   6682  CD1 PHE B  37      22.982 101.591 125.490  1.00  0.77           C  
ATOM   6683  CD2 PHE B  37      23.336 102.808 123.433  1.00  0.77           C  
ATOM   6684  CE1 PHE B  37      21.999 102.516 125.870  1.00  0.77           C  
ATOM   6685  CE2 PHE B  37      22.364 103.744 123.812  1.00  0.77           C  
ATOM   6686  CZ  PHE B  37      21.693 103.595 125.032  1.00  0.77           C  
ATOM   6687  N   THR B  38      27.478  99.420 123.356  1.00  0.76           N  
ATOM   6688  CA  THR B  38      28.239  98.235 122.957  1.00  0.76           C  
ATOM   6689  C   THR B  38      29.548  98.097 123.712  1.00  0.76           C  
ATOM   6690  O   THR B  38      29.950  97.000 124.102  1.00  0.76           O  
ATOM   6691  CB  THR B  38      28.501  98.193 121.452  1.00  0.76           C  
ATOM   6692  OG1 THR B  38      27.264  98.294 120.762  1.00  0.76           O  
ATOM   6693  CG2 THR B  38      29.139  96.868 121.010  1.00  0.76           C  
ATOM   6694  N   LEU B  39      30.268  99.215 123.948  1.00  0.78           N  
ATOM   6695  CA  LEU B  39      31.557  99.162 124.623  1.00  0.78           C  
ATOM   6696  C   LEU B  39      31.469  99.449 126.113  1.00  0.78           C  
ATOM   6697  O   LEU B  39      32.384  99.083 126.851  1.00  0.78           O  
ATOM   6698  CB  LEU B  39      32.590 100.150 124.009  1.00  0.78           C  
ATOM   6699  CG  LEU B  39      33.276  99.699 122.699  1.00  0.78           C  
ATOM   6700  CD1 LEU B  39      34.056  98.391 122.905  1.00  0.78           C  
ATOM   6701  CD2 LEU B  39      32.322  99.609 121.500  1.00  0.78           C  
ATOM   6702  N   VAL B  40      30.365 100.060 126.596  1.00  0.77           N  
ATOM   6703  CA  VAL B  40      30.173 100.451 127.992  1.00  0.77           C  
ATOM   6704  C   VAL B  40      31.204 101.494 128.433  1.00  0.77           C  
ATOM   6705  O   VAL B  40      31.862 101.384 129.470  1.00  0.77           O  
ATOM   6706  CB  VAL B  40      30.004  99.270 128.959  1.00  0.77           C  
ATOM   6707  CG1 VAL B  40      29.401  99.737 130.302  1.00  0.77           C  
ATOM   6708  CG2 VAL B  40      29.063  98.220 128.330  1.00  0.77           C  
ATOM   6709  N   LYS B  41      31.383 102.551 127.609  1.00  0.73           N  
ATOM   6710  CA  LYS B  41      32.388 103.574 127.831  1.00  0.73           C  
ATOM   6711  C   LYS B  41      31.854 104.967 127.543  1.00  0.73           C  
ATOM   6712  O   LYS B  41      30.953 105.174 126.734  1.00  0.73           O  
ATOM   6713  CB  LYS B  41      33.625 103.387 126.905  1.00  0.73           C  
ATOM   6714  CG  LYS B  41      34.459 102.119 127.141  1.00  0.73           C  
ATOM   6715  CD  LYS B  41      35.072 102.068 128.546  1.00  0.73           C  
ATOM   6716  CE  LYS B  41      35.970 100.855 128.797  1.00  0.73           C  
ATOM   6717  NZ  LYS B  41      37.353 101.066 128.334  1.00  0.73           N  
ATOM   6718  N   ASP B  42      32.447 105.976 128.207  1.00  0.73           N  
ATOM   6719  CA  ASP B  42      32.196 107.381 127.995  1.00  0.73           C  
ATOM   6720  C   ASP B  42      33.276 107.980 127.076  1.00  0.73           C  
ATOM   6721  O   ASP B  42      33.671 107.391 126.075  1.00  0.73           O  
ATOM   6722  CB  ASP B  42      32.094 108.075 129.384  1.00  0.73           C  
ATOM   6723  CG  ASP B  42      33.330 107.901 130.252  1.00  0.73           C  
ATOM   6724  OD1 ASP B  42      34.344 107.310 129.794  1.00  0.73           O  
ATOM   6725  OD2 ASP B  42      33.306 108.437 131.380  1.00  0.73           O  
ATOM   6726  N   ARG B  43      33.801 109.185 127.386  1.00  0.74           N  
ATOM   6727  CA  ARG B  43      34.997 109.700 126.735  1.00  0.74           C  
ATOM   6728  C   ARG B  43      36.162 109.812 127.707  1.00  0.74           C  
ATOM   6729  O   ARG B  43      37.252 110.216 127.312  1.00  0.74           O  
ATOM   6730  CB  ARG B  43      34.750 111.098 126.104  1.00  0.74           C  
ATOM   6731  CG  ARG B  43      33.805 111.104 124.880  1.00  0.74           C  
ATOM   6732  CD  ARG B  43      34.233 110.214 123.701  1.00  0.74           C  
ATOM   6733  NE  ARG B  43      35.625 110.588 123.275  1.00  0.74           N  
ATOM   6734  CZ  ARG B  43      35.942 111.486 122.335  1.00  0.74           C  
ATOM   6735  NH1 ARG B  43      35.037 112.260 121.750  1.00  0.74           N  
ATOM   6736  NH2 ARG B  43      37.208 111.631 121.953  1.00  0.74           N  
ATOM   6737  N   ASN B  44      35.973 109.433 128.986  1.00  0.63           N  
ATOM   6738  CA  ASN B  44      36.989 109.553 130.015  1.00  0.63           C  
ATOM   6739  C   ASN B  44      37.814 108.281 130.112  1.00  0.63           C  
ATOM   6740  O   ASN B  44      39.038 108.319 130.195  1.00  0.63           O  
ATOM   6741  CB  ASN B  44      36.352 109.815 131.403  1.00  0.63           C  
ATOM   6742  CG  ASN B  44      35.530 111.098 131.376  1.00  0.63           C  
ATOM   6743  OD1 ASN B  44      36.051 112.197 131.181  1.00  0.63           O  
ATOM   6744  ND2 ASN B  44      34.203 110.974 131.591  1.00  0.63           N  
ATOM   6745  N   VAL B  45      37.148 107.105 130.100  1.00  0.72           N  
ATOM   6746  CA  VAL B  45      37.811 105.819 130.301  1.00  0.72           C  
ATOM   6747  C   VAL B  45      37.716 104.927 129.068  1.00  0.72           C  
ATOM   6748  O   VAL B  45      38.017 103.728 129.093  1.00  0.72           O  
ATOM   6749  CB  VAL B  45      37.313 105.089 131.549  1.00  0.72           C  
ATOM   6750  CG1 VAL B  45      37.699 105.922 132.788  1.00  0.72           C  
ATOM   6751  CG2 VAL B  45      35.790 104.860 131.511  1.00  0.72           C  
ATOM   6752  N   ALA B  46      37.312 105.504 127.922  1.00  0.80           N  
ATOM   6753  CA  ALA B  46      37.401 104.875 126.620  1.00  0.80           C  
ATOM   6754  C   ALA B  46      38.828 104.810 126.079  1.00  0.80           C  
ATOM   6755  O   ALA B  46      39.535 105.813 126.000  1.00  0.80           O  
ATOM   6756  CB  ALA B  46      36.528 105.632 125.606  1.00  0.80           C  
ATOM   6757  N   THR B  47      39.285 103.609 125.680  1.00  0.80           N  
ATOM   6758  CA  THR B  47      40.600 103.401 125.086  1.00  0.80           C  
ATOM   6759  C   THR B  47      40.546 103.533 123.576  1.00  0.80           C  
ATOM   6760  O   THR B  47      39.481 103.523 122.962  1.00  0.80           O  
ATOM   6761  CB  THR B  47      41.222 102.034 125.408  1.00  0.80           C  
ATOM   6762  OG1 THR B  47      40.507 100.939 124.840  1.00  0.80           O  
ATOM   6763  CG2 THR B  47      41.270 101.807 126.924  1.00  0.80           C  
ATOM   6764  N   THR B  48      41.717 103.596 122.907  1.00  0.84           N  
ATOM   6765  CA  THR B  48      41.830 103.538 121.449  1.00  0.84           C  
ATOM   6766  C   THR B  48      41.222 102.278 120.861  1.00  0.84           C  
ATOM   6767  O   THR B  48      40.573 102.304 119.819  1.00  0.84           O  
ATOM   6768  CB  THR B  48      43.269 103.649 120.969  1.00  0.84           C  
ATOM   6769  OG1 THR B  48      43.906 104.712 121.659  1.00  0.84           O  
ATOM   6770  CG2 THR B  48      43.322 103.966 119.473  1.00  0.84           C  
ATOM   6771  N   ARG B  49      41.370 101.123 121.548  1.00  0.81           N  
ATOM   6772  CA  ARG B  49      40.707  99.888 121.163  1.00  0.81           C  
ATOM   6773  C   ARG B  49      39.180  99.943 121.278  1.00  0.81           C  
ATOM   6774  O   ARG B  49      38.478  99.479 120.381  1.00  0.81           O  
ATOM   6775  CB  ARG B  49      41.347  98.655 121.866  1.00  0.81           C  
ATOM   6776  CG  ARG B  49      40.825  97.293 121.347  1.00  0.81           C  
ATOM   6777  CD  ARG B  49      41.623  96.046 121.781  1.00  0.81           C  
ATOM   6778  NE  ARG B  49      42.773  95.816 120.828  1.00  0.81           N  
ATOM   6779  CZ  ARG B  49      44.065  95.701 121.160  1.00  0.81           C  
ATOM   6780  NH1 ARG B  49      44.518  96.035 122.365  1.00  0.81           N  
ATOM   6781  NH2 ARG B  49      44.922  95.226 120.260  1.00  0.81           N  
ATOM   6782  N   ASP B  50      38.616 100.571 122.336  1.00  0.85           N  
ATOM   6783  CA  ASP B  50      37.183 100.839 122.432  1.00  0.85           C  
ATOM   6784  C   ASP B  50      36.677 101.768 121.317  1.00  0.85           C  
ATOM   6785  O   ASP B  50      35.650 101.517 120.686  1.00  0.85           O  
ATOM   6786  CB  ASP B  50      36.807 101.478 123.794  1.00  0.85           C  
ATOM   6787  CG  ASP B  50      37.230 100.628 124.971  1.00  0.85           C  
ATOM   6788  OD1 ASP B  50      36.749  99.485 125.136  1.00  0.85           O  
ATOM   6789  OD2 ASP B  50      38.032 101.157 125.791  1.00  0.85           O  
ATOM   6790  N   TYR B  51      37.428 102.852 121.013  1.00  0.87           N  
ATOM   6791  CA  TYR B  51      37.156 103.755 119.903  1.00  0.87           C  
ATOM   6792  C   TYR B  51      37.199 103.067 118.536  1.00  0.87           C  
ATOM   6793  O   TYR B  51      36.349 103.313 117.682  1.00  0.87           O  
ATOM   6794  CB  TYR B  51      38.152 104.951 119.886  1.00  0.87           C  
ATOM   6795  CG  TYR B  51      38.017 105.909 121.047  1.00  0.87           C  
ATOM   6796  CD1 TYR B  51      36.766 106.368 121.501  1.00  0.87           C  
ATOM   6797  CD2 TYR B  51      39.177 106.442 121.638  1.00  0.87           C  
ATOM   6798  CE1 TYR B  51      36.687 107.342 122.507  1.00  0.87           C  
ATOM   6799  CE2 TYR B  51      39.097 107.383 122.674  1.00  0.87           C  
ATOM   6800  CZ  TYR B  51      37.849 107.846 123.096  1.00  0.87           C  
ATOM   6801  OH  TYR B  51      37.760 108.828 124.105  1.00  0.87           O  
ATOM   6802  N   TYR B  52      38.166 102.151 118.302  1.00  0.89           N  
ATOM   6803  CA  TYR B  52      38.210 101.306 117.114  1.00  0.89           C  
ATOM   6804  C   TYR B  52      36.944 100.455 116.961  1.00  0.89           C  
ATOM   6805  O   TYR B  52      36.324 100.455 115.900  1.00  0.89           O  
ATOM   6806  CB  TYR B  52      39.504 100.417 117.139  1.00  0.89           C  
ATOM   6807  CG  TYR B  52      39.432  99.238 116.193  1.00  0.89           C  
ATOM   6808  CD1 TYR B  52      39.442  99.434 114.803  1.00  0.89           C  
ATOM   6809  CD2 TYR B  52      39.137  97.958 116.701  1.00  0.89           C  
ATOM   6810  CE1 TYR B  52      39.092  98.386 113.940  1.00  0.89           C  
ATOM   6811  CE2 TYR B  52      38.796  96.908 115.837  1.00  0.89           C  
ATOM   6812  CZ  TYR B  52      38.750  97.135 114.458  1.00  0.89           C  
ATOM   6813  OH  TYR B  52      38.317  96.124 113.582  1.00  0.89           O  
ATOM   6814  N   PHE B  53      36.500  99.750 118.022  1.00  0.88           N  
ATOM   6815  CA  PHE B  53      35.288  98.946 117.975  1.00  0.88           C  
ATOM   6816  C   PHE B  53      34.036  99.775 117.708  1.00  0.88           C  
ATOM   6817  O   PHE B  53      33.194  99.406 116.894  1.00  0.88           O  
ATOM   6818  CB  PHE B  53      35.095  98.145 119.285  1.00  0.88           C  
ATOM   6819  CG  PHE B  53      35.970  96.921 119.355  1.00  0.88           C  
ATOM   6820  CD1 PHE B  53      35.807  95.885 118.419  1.00  0.88           C  
ATOM   6821  CD2 PHE B  53      36.883  96.742 120.408  1.00  0.88           C  
ATOM   6822  CE1 PHE B  53      36.547  94.701 118.528  1.00  0.88           C  
ATOM   6823  CE2 PHE B  53      37.622  95.556 120.522  1.00  0.88           C  
ATOM   6824  CZ  PHE B  53      37.456  94.536 119.579  1.00  0.88           C  
ATOM   6825  N   ALA B  54      33.910 100.962 118.337  1.00  0.90           N  
ATOM   6826  CA  ALA B  54      32.813 101.879 118.092  1.00  0.90           C  
ATOM   6827  C   ALA B  54      32.713 102.338 116.634  1.00  0.90           C  
ATOM   6828  O   ALA B  54      31.625 102.389 116.054  1.00  0.90           O  
ATOM   6829  CB  ALA B  54      32.951 103.093 119.033  1.00  0.90           C  
ATOM   6830  N   LEU B  55      33.858 102.638 115.983  1.00  0.91           N  
ATOM   6831  CA  LEU B  55      33.910 102.870 114.550  1.00  0.91           C  
ATOM   6832  C   LEU B  55      33.613 101.627 113.713  1.00  0.91           C  
ATOM   6833  O   LEU B  55      32.811 101.677 112.782  1.00  0.91           O  
ATOM   6834  CB  LEU B  55      35.286 103.463 114.157  1.00  0.91           C  
ATOM   6835  CG  LEU B  55      35.463 103.842 112.668  1.00  0.91           C  
ATOM   6836  CD1 LEU B  55      34.381 104.805 112.150  1.00  0.91           C  
ATOM   6837  CD2 LEU B  55      36.852 104.457 112.444  1.00  0.91           C  
ATOM   6838  N   ALA B  56      34.211 100.464 114.043  1.00  0.94           N  
ATOM   6839  CA  ALA B  56      34.044  99.226 113.303  1.00  0.94           C  
ATOM   6840  C   ALA B  56      32.613  98.701 113.268  1.00  0.94           C  
ATOM   6841  O   ALA B  56      32.088  98.375 112.203  1.00  0.94           O  
ATOM   6842  CB  ALA B  56      34.983  98.153 113.882  1.00  0.94           C  
ATOM   6843  N   HIS B  57      31.911  98.687 114.422  1.00  0.84           N  
ATOM   6844  CA  HIS B  57      30.489  98.384 114.480  1.00  0.84           C  
ATOM   6845  C   HIS B  57      29.649  99.381 113.693  1.00  0.84           C  
ATOM   6846  O   HIS B  57      28.781  98.987 112.924  1.00  0.84           O  
ATOM   6847  CB  HIS B  57      29.966  98.312 115.934  1.00  0.84           C  
ATOM   6848  CG  HIS B  57      30.256  97.009 116.616  1.00  0.84           C  
ATOM   6849  ND1 HIS B  57      31.532  96.699 117.048  1.00  0.84           N  
ATOM   6850  CD2 HIS B  57      29.404  95.991 116.905  1.00  0.84           C  
ATOM   6851  CE1 HIS B  57      31.432  95.505 117.591  1.00  0.84           C  
ATOM   6852  NE2 HIS B  57      30.166  95.028 117.532  1.00  0.84           N  
ATOM   6853  N   THR B  58      29.936 100.697 113.798  1.00  0.87           N  
ATOM   6854  CA  THR B  58      29.223 101.733 113.035  1.00  0.87           C  
ATOM   6855  C   THR B  58      29.337 101.549 111.531  1.00  0.87           C  
ATOM   6856  O   THR B  58      28.347 101.572 110.808  1.00  0.87           O  
ATOM   6857  CB  THR B  58      29.719 103.144 113.356  1.00  0.87           C  
ATOM   6858  OG1 THR B  58      29.478 103.446 114.723  1.00  0.87           O  
ATOM   6859  CG2 THR B  58      28.974 104.218 112.546  1.00  0.87           C  
ATOM   6860  N   VAL B  59      30.556 101.299 111.016  1.00  0.91           N  
ATOM   6861  CA  VAL B  59      30.808 101.037 109.602  1.00  0.91           C  
ATOM   6862  C   VAL B  59      30.127  99.767 109.107  1.00  0.91           C  
ATOM   6863  O   VAL B  59      29.541  99.733 108.024  1.00  0.91           O  
ATOM   6864  CB  VAL B  59      32.312 100.990 109.338  1.00  0.91           C  
ATOM   6865  CG1 VAL B  59      32.647 100.504 107.913  1.00  0.91           C  
ATOM   6866  CG2 VAL B  59      32.877 102.407 109.551  1.00  0.91           C  
ATOM   6867  N   ARG B  60      30.164  98.687 109.909  1.00  0.82           N  
ATOM   6868  CA  ARG B  60      29.478  97.444 109.618  1.00  0.82           C  
ATOM   6869  C   ARG B  60      27.960  97.569 109.553  1.00  0.82           C  
ATOM   6870  O   ARG B  60      27.310  97.050 108.649  1.00  0.82           O  
ATOM   6871  CB  ARG B  60      29.823  96.426 110.723  1.00  0.82           C  
ATOM   6872  CG  ARG B  60      29.279  95.005 110.482  1.00  0.82           C  
ATOM   6873  CD  ARG B  60      29.214  94.177 111.764  1.00  0.82           C  
ATOM   6874  NE  ARG B  60      28.164  94.802 112.635  1.00  0.82           N  
ATOM   6875  CZ  ARG B  60      27.624  94.197 113.695  1.00  0.82           C  
ATOM   6876  NH1 ARG B  60      28.105  93.054 114.170  1.00  0.82           N  
ATOM   6877  NH2 ARG B  60      26.576  94.773 114.270  1.00  0.82           N  
ATOM   6878  N   ASP B  61      27.339  98.282 110.503  1.00  0.85           N  
ATOM   6879  CA  ASP B  61      25.899  98.427 110.584  1.00  0.85           C  
ATOM   6880  C   ASP B  61      25.313  99.142 109.362  1.00  0.85           C  
ATOM   6881  O   ASP B  61      24.256  98.780 108.843  1.00  0.85           O  
ATOM   6882  CB  ASP B  61      25.530  99.061 111.943  1.00  0.85           C  
ATOM   6883  CG  ASP B  61      25.789  98.077 113.078  1.00  0.85           C  
ATOM   6884  OD1 ASP B  61      26.160  96.898 112.821  1.00  0.85           O  
ATOM   6885  OD2 ASP B  61      25.600  98.491 114.248  1.00  0.85           O  
ATOM   6886  N   HIS B  62      26.058 100.102 108.787  1.00  0.80           N  
ATOM   6887  CA  HIS B  62      25.727 100.727 107.516  1.00  0.80           C  
ATOM   6888  C   HIS B  62      25.727  99.797 106.290  1.00  0.80           C  
ATOM   6889  O   HIS B  62      25.154 100.154 105.257  1.00  0.80           O  
ATOM   6890  CB  HIS B  62      26.671 101.920 107.227  1.00  0.80           C  
ATOM   6891  CG  HIS B  62      26.253 103.199 107.891  1.00  0.80           C  
ATOM   6892  ND1 HIS B  62      26.199 103.285 109.264  1.00  0.80           N  
ATOM   6893  CD2 HIS B  62      25.900 104.390 107.338  1.00  0.80           C  
ATOM   6894  CE1 HIS B  62      25.821 104.513 109.527  1.00  0.80           C  
ATOM   6895  NE2 HIS B  62      25.624 105.230 108.395  1.00  0.80           N  
ATOM   6896  N   LEU B  63      26.322  98.578 106.336  1.00  0.83           N  
ATOM   6897  CA  LEU B  63      26.189  97.630 105.231  1.00  0.83           C  
ATOM   6898  C   LEU B  63      25.118  96.576 105.451  1.00  0.83           C  
ATOM   6899  O   LEU B  63      24.778  95.842 104.523  1.00  0.83           O  
ATOM   6900  CB  LEU B  63      27.528  96.969 104.790  1.00  0.83           C  
ATOM   6901  CG  LEU B  63      28.378  96.175 105.808  1.00  0.83           C  
ATOM   6902  CD1 LEU B  63      27.718  94.894 106.343  1.00  0.83           C  
ATOM   6903  CD2 LEU B  63      29.722  95.802 105.163  1.00  0.83           C  
ATOM   6904  N   VAL B  64      24.489  96.510 106.645  1.00  0.83           N  
ATOM   6905  CA  VAL B  64      23.496  95.493 106.998  1.00  0.83           C  
ATOM   6906  C   VAL B  64      22.283  95.508 106.081  1.00  0.83           C  
ATOM   6907  O   VAL B  64      21.845  94.478 105.571  1.00  0.83           O  
ATOM   6908  CB  VAL B  64      23.063  95.666 108.452  1.00  0.83           C  
ATOM   6909  CG1 VAL B  64      21.815  94.839 108.811  1.00  0.83           C  
ATOM   6910  CG2 VAL B  64      24.228  95.236 109.363  1.00  0.83           C  
ATOM   6911  N   GLY B  65      21.748  96.710 105.774  1.00  0.81           N  
ATOM   6912  CA  GLY B  65      20.612  96.857 104.866  1.00  0.81           C  
ATOM   6913  C   GLY B  65      20.877  96.440 103.437  1.00  0.81           C  
ATOM   6914  O   GLY B  65      19.967  96.041 102.721  1.00  0.81           O  
ATOM   6915  N   ARG B  66      22.141  96.517 102.983  1.00  0.80           N  
ATOM   6916  CA  ARG B  66      22.567  96.017 101.686  1.00  0.80           C  
ATOM   6917  C   ARG B  66      22.828  94.515 101.718  1.00  0.80           C  
ATOM   6918  O   ARG B  66      22.445  93.798 100.797  1.00  0.80           O  
ATOM   6919  CB  ARG B  66      23.783  96.832 101.166  1.00  0.80           C  
ATOM   6920  CG  ARG B  66      23.366  98.257 100.729  1.00  0.80           C  
ATOM   6921  CD  ARG B  66      24.285  99.405 101.185  1.00  0.80           C  
ATOM   6922  NE  ARG B  66      25.426  99.546 100.218  1.00  0.80           N  
ATOM   6923  CZ  ARG B  66      26.281 100.580 100.234  1.00  0.80           C  
ATOM   6924  NH1 ARG B  66      26.367 101.402 101.278  1.00  0.80           N  
ATOM   6925  NH2 ARG B  66      27.064 100.808  99.182  1.00  0.80           N  
ATOM   6926  N   TRP B  67      23.431  93.983 102.801  1.00  0.87           N  
ATOM   6927  CA  TRP B  67      23.697  92.562 102.979  1.00  0.87           C  
ATOM   6928  C   TRP B  67      22.447  91.691 103.022  1.00  0.87           C  
ATOM   6929  O   TRP B  67      22.355  90.684 102.318  1.00  0.87           O  
ATOM   6930  CB  TRP B  67      24.555  92.373 104.261  1.00  0.87           C  
ATOM   6931  CG  TRP B  67      25.330  91.068 104.395  1.00  0.87           C  
ATOM   6932  CD1 TRP B  67      25.603  90.105 103.460  1.00  0.87           C  
ATOM   6933  CD2 TRP B  67      26.005  90.664 105.600  1.00  0.87           C  
ATOM   6934  NE1 TRP B  67      26.412  89.129 104.001  1.00  0.87           N  
ATOM   6935  CE2 TRP B  67      26.672  89.452 105.312  1.00  0.87           C  
ATOM   6936  CE3 TRP B  67      26.084  91.246 106.864  1.00  0.87           C  
ATOM   6937  CZ2 TRP B  67      27.427  88.807 106.280  1.00  0.87           C  
ATOM   6938  CZ3 TRP B  67      26.837  90.584 107.847  1.00  0.87           C  
ATOM   6939  CH2 TRP B  67      27.498  89.379 107.559  1.00  0.87           C  
ATOM   6940  N   ILE B  68      21.413  92.106 103.790  1.00  0.82           N  
ATOM   6941  CA  ILE B  68      20.130  91.409 103.848  1.00  0.82           C  
ATOM   6942  C   ILE B  68      19.434  91.400 102.489  1.00  0.82           C  
ATOM   6943  O   ILE B  68      18.991  90.357 102.010  1.00  0.82           O  
ATOM   6944  CB  ILE B  68      19.219  91.991 104.937  1.00  0.82           C  
ATOM   6945  CG1 ILE B  68      19.876  91.803 106.329  1.00  0.82           C  
ATOM   6946  CG2 ILE B  68      17.820  91.326 104.904  1.00  0.82           C  
ATOM   6947  CD1 ILE B  68      19.148  92.532 107.466  1.00  0.82           C  
ATOM   6948  N   ARG B  69      19.392  92.554 101.785  1.00  0.76           N  
ATOM   6949  CA  ARG B  69      18.835  92.655 100.441  1.00  0.76           C  
ATOM   6950  C   ARG B  69      19.574  91.828  99.397  1.00  0.76           C  
ATOM   6951  O   ARG B  69      18.957  91.183  98.553  1.00  0.76           O  
ATOM   6952  CB  ARG B  69      18.796  94.125  99.959  1.00  0.76           C  
ATOM   6953  CG  ARG B  69      17.746  94.984 100.691  1.00  0.76           C  
ATOM   6954  CD  ARG B  69      17.797  96.455 100.267  1.00  0.76           C  
ATOM   6955  NE  ARG B  69      16.775  97.184 101.085  1.00  0.76           N  
ATOM   6956  CZ  ARG B  69      16.575  98.508 101.031  1.00  0.76           C  
ATOM   6957  NH1 ARG B  69      17.251  99.282 100.189  1.00  0.76           N  
ATOM   6958  NH2 ARG B  69      15.676  99.070 101.837  1.00  0.76           N  
ATOM   6959  N   THR B  70      20.921  91.809  99.438  1.00  0.83           N  
ATOM   6960  CA  THR B  70      21.751  91.048  98.501  1.00  0.83           C  
ATOM   6961  C   THR B  70      21.469  89.559  98.562  1.00  0.83           C  
ATOM   6962  O   THR B  70      21.194  88.908  97.556  1.00  0.83           O  
ATOM   6963  CB  THR B  70      23.241  91.242  98.764  1.00  0.83           C  
ATOM   6964  OG1 THR B  70      23.596  92.613  98.659  1.00  0.83           O  
ATOM   6965  CG2 THR B  70      24.077  90.521  97.704  1.00  0.83           C  
ATOM   6966  N   GLN B  71      21.449  88.982  99.780  1.00  0.80           N  
ATOM   6967  CA  GLN B  71      21.135  87.578  99.973  1.00  0.80           C  
ATOM   6968  C   GLN B  71      19.679  87.224  99.680  1.00  0.80           C  
ATOM   6969  O   GLN B  71      19.388  86.167  99.121  1.00  0.80           O  
ATOM   6970  CB  GLN B  71      21.576  87.098 101.377  1.00  0.80           C  
ATOM   6971  CG  GLN B  71      23.097  87.261 101.636  1.00  0.80           C  
ATOM   6972  CD  GLN B  71      23.936  86.553 100.567  1.00  0.80           C  
ATOM   6973  OE1 GLN B  71      23.687  85.399 100.197  1.00  0.80           O  
ATOM   6974  NE2 GLN B  71      24.957  87.263 100.035  1.00  0.80           N  
ATOM   6975  N   GLN B  72      18.732  88.127 100.012  1.00  0.74           N  
ATOM   6976  CA  GLN B  72      17.322  88.024  99.663  1.00  0.74           C  
ATOM   6977  C   GLN B  72      17.076  87.983  98.157  1.00  0.74           C  
ATOM   6978  O   GLN B  72      16.361  87.123  97.656  1.00  0.74           O  
ATOM   6979  CB  GLN B  72      16.598  89.237 100.286  1.00  0.74           C  
ATOM   6980  CG  GLN B  72      15.063  89.282 100.139  1.00  0.74           C  
ATOM   6981  CD  GLN B  72      14.531  90.596 100.721  1.00  0.74           C  
ATOM   6982  OE1 GLN B  72      13.973  91.443 100.027  1.00  0.74           O  
ATOM   6983  NE2 GLN B  72      14.758  90.800 102.045  1.00  0.74           N  
ATOM   6984  N   HIS B  73      17.747  88.857  97.376  1.00  0.74           N  
ATOM   6985  CA  HIS B  73      17.723  88.849  95.916  1.00  0.74           C  
ATOM   6986  C   HIS B  73      18.231  87.539  95.322  1.00  0.74           C  
ATOM   6987  O   HIS B  73      17.630  86.954  94.420  1.00  0.74           O  
ATOM   6988  CB  HIS B  73      18.588  90.025  95.396  1.00  0.74           C  
ATOM   6989  CG  HIS B  73      18.770  90.121  93.910  1.00  0.74           C  
ATOM   6990  ND1 HIS B  73      17.685  90.330  93.079  1.00  0.74           N  
ATOM   6991  CD2 HIS B  73      19.922  90.111  93.190  1.00  0.74           C  
ATOM   6992  CE1 HIS B  73      18.202  90.449  91.872  1.00  0.74           C  
ATOM   6993  NE2 HIS B  73      19.550  90.324  91.881  1.00  0.74           N  
ATOM   6994  N   TYR B  74      19.341  86.998  95.864  1.00  0.80           N  
ATOM   6995  CA  TYR B  74      19.853  85.694  95.483  1.00  0.80           C  
ATOM   6996  C   TYR B  74      18.903  84.539  95.802  1.00  0.80           C  
ATOM   6997  O   TYR B  74      18.821  83.557  95.062  1.00  0.80           O  
ATOM   6998  CB  TYR B  74      21.231  85.402  96.137  1.00  0.80           C  
ATOM   6999  CG  TYR B  74      22.328  86.375  95.777  1.00  0.80           C  
ATOM   7000  CD1 TYR B  74      22.306  87.218  94.645  1.00  0.80           C  
ATOM   7001  CD2 TYR B  74      23.456  86.409  96.615  1.00  0.80           C  
ATOM   7002  CE1 TYR B  74      23.370  88.095  94.389  1.00  0.80           C  
ATOM   7003  CE2 TYR B  74      24.524  87.276  96.352  1.00  0.80           C  
ATOM   7004  CZ  TYR B  74      24.469  88.130  95.247  1.00  0.80           C  
ATOM   7005  OH  TYR B  74      25.524  89.020  94.980  1.00  0.80           O  
ATOM   7006  N   TYR B  75      18.183  84.577  96.940  1.00  0.79           N  
ATOM   7007  CA  TYR B  75      17.113  83.634  97.235  1.00  0.79           C  
ATOM   7008  C   TYR B  75      15.932  83.773  96.272  1.00  0.79           C  
ATOM   7009  O   TYR B  75      15.490  82.800  95.663  1.00  0.79           O  
ATOM   7010  CB  TYR B  75      16.661  83.845  98.714  1.00  0.79           C  
ATOM   7011  CG  TYR B  75      15.437  83.049  99.104  1.00  0.79           C  
ATOM   7012  CD1 TYR B  75      15.475  81.647  99.199  1.00  0.79           C  
ATOM   7013  CD2 TYR B  75      14.221  83.715  99.334  1.00  0.79           C  
ATOM   7014  CE1 TYR B  75      14.314  80.926  99.521  1.00  0.79           C  
ATOM   7015  CE2 TYR B  75      13.064  82.997  99.661  1.00  0.79           C  
ATOM   7016  CZ  TYR B  75      13.113  81.604  99.756  1.00  0.79           C  
ATOM   7017  OH  TYR B  75      11.947  80.891 100.093  1.00  0.79           O  
ATOM   7018  N   ASP B  76      15.410  84.998  96.089  1.00  0.76           N  
ATOM   7019  CA  ASP B  76      14.202  85.224  95.334  1.00  0.76           C  
ATOM   7020  C   ASP B  76      14.310  85.043  93.827  1.00  0.76           C  
ATOM   7021  O   ASP B  76      13.373  84.531  93.206  1.00  0.76           O  
ATOM   7022  CB  ASP B  76      13.550  86.573  95.729  1.00  0.76           C  
ATOM   7023  CG  ASP B  76      12.443  86.284  96.726  1.00  0.76           C  
ATOM   7024  OD1 ASP B  76      11.437  85.671  96.267  1.00  0.76           O  
ATOM   7025  OD2 ASP B  76      12.593  86.595  97.926  1.00  0.76           O  
ATOM   7026  N   LYS B  77      15.432  85.440  93.197  1.00  0.73           N  
ATOM   7027  CA  LYS B  77      15.581  85.340  91.756  1.00  0.73           C  
ATOM   7028  C   LYS B  77      16.395  84.138  91.307  1.00  0.73           C  
ATOM   7029  O   LYS B  77      16.489  83.889  90.109  1.00  0.73           O  
ATOM   7030  CB  LYS B  77      16.266  86.625  91.219  1.00  0.73           C  
ATOM   7031  CG  LYS B  77      15.422  87.903  91.380  1.00  0.73           C  
ATOM   7032  CD  LYS B  77      14.158  87.906  90.503  1.00  0.73           C  
ATOM   7033  CE  LYS B  77      13.363  89.210  90.601  1.00  0.73           C  
ATOM   7034  NZ  LYS B  77      12.175  89.135  89.721  1.00  0.73           N  
ATOM   7035  N   CYS B  78      16.982  83.361  92.243  1.00  0.81           N  
ATOM   7036  CA  CYS B  78      17.830  82.201  91.962  1.00  0.81           C  
ATOM   7037  C   CYS B  78      18.886  82.334  90.851  1.00  0.81           C  
ATOM   7038  O   CYS B  78      18.918  81.490  89.952  1.00  0.81           O  
ATOM   7039  CB  CYS B  78      17.001  80.908  91.732  1.00  0.81           C  
ATOM   7040  SG  CYS B  78      16.037  80.399  93.191  1.00  0.81           S  
ATOM   7041  N   PRO B  79      19.796  83.311  90.827  1.00  0.84           N  
ATOM   7042  CA  PRO B  79      20.924  83.278  89.908  1.00  0.84           C  
ATOM   7043  C   PRO B  79      21.878  82.142  90.244  1.00  0.84           C  
ATOM   7044  O   PRO B  79      21.944  81.701  91.395  1.00  0.84           O  
ATOM   7045  CB  PRO B  79      21.583  84.650  90.118  1.00  0.84           C  
ATOM   7046  CG  PRO B  79      21.346  84.942  91.602  1.00  0.84           C  
ATOM   7047  CD  PRO B  79      19.959  84.344  91.852  1.00  0.84           C  
ATOM   7048  N   LYS B  80      22.626  81.635  89.243  1.00  0.84           N  
ATOM   7049  CA  LYS B  80      23.652  80.640  89.475  1.00  0.84           C  
ATOM   7050  C   LYS B  80      24.760  81.147  90.392  1.00  0.84           C  
ATOM   7051  O   LYS B  80      25.300  82.239  90.222  1.00  0.84           O  
ATOM   7052  CB  LYS B  80      24.239  80.110  88.146  1.00  0.84           C  
ATOM   7053  CG  LYS B  80      25.364  79.083  88.343  1.00  0.84           C  
ATOM   7054  CD  LYS B  80      25.833  78.427  87.041  1.00  0.84           C  
ATOM   7055  CE  LYS B  80      26.848  77.325  87.336  1.00  0.84           C  
ATOM   7056  NZ  LYS B  80      27.226  76.608  86.103  1.00  0.84           N  
ATOM   7057  N   ARG B  81      25.102  80.346  91.416  1.00  0.83           N  
ATOM   7058  CA  ARG B  81      26.002  80.750  92.463  1.00  0.83           C  
ATOM   7059  C   ARG B  81      27.414  80.266  92.236  1.00  0.83           C  
ATOM   7060  O   ARG B  81      27.663  79.183  91.704  1.00  0.83           O  
ATOM   7061  CB  ARG B  81      25.511  80.224  93.825  1.00  0.83           C  
ATOM   7062  CG  ARG B  81      24.211  80.906  94.282  1.00  0.83           C  
ATOM   7063  CD  ARG B  81      23.664  80.274  95.559  1.00  0.83           C  
ATOM   7064  NE  ARG B  81      22.670  81.202  96.182  1.00  0.83           N  
ATOM   7065  CZ  ARG B  81      21.381  81.272  95.822  1.00  0.83           C  
ATOM   7066  NH1 ARG B  81      20.901  80.684  94.732  1.00  0.83           N  
ATOM   7067  NH2 ARG B  81      20.550  81.978  96.582  1.00  0.83           N  
ATOM   7068  N   VAL B  82      28.380  81.083  92.682  1.00  0.93           N  
ATOM   7069  CA  VAL B  82      29.791  80.777  92.598  1.00  0.93           C  
ATOM   7070  C   VAL B  82      30.294  80.527  93.999  1.00  0.93           C  
ATOM   7071  O   VAL B  82      30.230  81.379  94.883  1.00  0.93           O  
ATOM   7072  CB  VAL B  82      30.603  81.901  91.969  1.00  0.93           C  
ATOM   7073  CG1 VAL B  82      32.091  81.504  91.888  1.00  0.93           C  
ATOM   7074  CG2 VAL B  82      30.055  82.187  90.558  1.00  0.93           C  
ATOM   7075  N   TYR B  83      30.817  79.325  94.249  1.00  0.95           N  
ATOM   7076  CA  TYR B  83      31.337  78.958  95.541  1.00  0.95           C  
ATOM   7077  C   TYR B  83      32.837  78.855  95.434  1.00  0.95           C  
ATOM   7078  O   TYR B  83      33.384  77.993  94.747  1.00  0.95           O  
ATOM   7079  CB  TYR B  83      30.750  77.606  95.988  1.00  0.95           C  
ATOM   7080  CG  TYR B  83      29.276  77.756  96.229  1.00  0.95           C  
ATOM   7081  CD1 TYR B  83      28.843  78.422  97.377  1.00  0.95           C  
ATOM   7082  CD2 TYR B  83      28.318  77.235  95.347  1.00  0.95           C  
ATOM   7083  CE1 TYR B  83      27.480  78.527  97.682  1.00  0.95           C  
ATOM   7084  CE2 TYR B  83      26.950  77.305  95.660  1.00  0.95           C  
ATOM   7085  CZ  TYR B  83      26.536  77.924  96.847  1.00  0.95           C  
ATOM   7086  OH  TYR B  83      25.184  77.867  97.247  1.00  0.95           O  
ATOM   7087  N   TYR B  84      33.559  79.757  96.116  1.00  0.96           N  
ATOM   7088  CA  TYR B  84      35.003  79.764  96.083  1.00  0.96           C  
ATOM   7089  C   TYR B  84      35.502  79.041  97.320  1.00  0.96           C  
ATOM   7090  O   TYR B  84      35.412  79.546  98.438  1.00  0.96           O  
ATOM   7091  CB  TYR B  84      35.530  81.218  96.011  1.00  0.96           C  
ATOM   7092  CG  TYR B  84      36.926  81.229  95.464  1.00  0.96           C  
ATOM   7093  CD1 TYR B  84      37.130  81.225  94.074  1.00  0.96           C  
ATOM   7094  CD2 TYR B  84      38.038  81.201  96.321  1.00  0.96           C  
ATOM   7095  CE1 TYR B  84      38.428  81.213  93.548  1.00  0.96           C  
ATOM   7096  CE2 TYR B  84      39.337  81.191  95.793  1.00  0.96           C  
ATOM   7097  CZ  TYR B  84      39.528  81.219  94.408  1.00  0.96           C  
ATOM   7098  OH  TYR B  84      40.826  81.291  93.875  1.00  0.96           O  
ATOM   7099  N   LEU B  85      36.016  77.813  97.140  1.00  0.96           N  
ATOM   7100  CA  LEU B  85      36.320  76.920  98.235  1.00  0.96           C  
ATOM   7101  C   LEU B  85      37.822  76.845  98.423  1.00  0.96           C  
ATOM   7102  O   LEU B  85      38.577  76.484  97.518  1.00  0.96           O  
ATOM   7103  CB  LEU B  85      35.710  75.528  97.940  1.00  0.96           C  
ATOM   7104  CG  LEU B  85      35.947  74.433  99.001  1.00  0.96           C  
ATOM   7105  CD1 LEU B  85      35.504  74.838 100.413  1.00  0.96           C  
ATOM   7106  CD2 LEU B  85      35.235  73.135  98.587  1.00  0.96           C  
ATOM   7107  N   SER B  86      38.303  77.222  99.622  1.00  0.95           N  
ATOM   7108  CA  SER B  86      39.728  77.298  99.873  1.00  0.95           C  
ATOM   7109  C   SER B  86      40.045  77.002 101.317  1.00  0.95           C  
ATOM   7110  O   SER B  86      39.189  76.987 102.198  1.00  0.95           O  
ATOM   7111  CB  SER B  86      40.341  78.682  99.507  1.00  0.95           C  
ATOM   7112  OG  SER B  86      41.773  78.632  99.504  1.00  0.95           O  
ATOM   7113  N   LEU B  87      41.335  76.761 101.581  1.00  0.95           N  
ATOM   7114  CA  LEU B  87      41.888  76.609 102.905  1.00  0.95           C  
ATOM   7115  C   LEU B  87      42.542  77.926 103.313  1.00  0.95           C  
ATOM   7116  O   LEU B  87      43.018  78.055 104.440  1.00  0.95           O  
ATOM   7117  CB  LEU B  87      42.944  75.466 102.918  1.00  0.95           C  
ATOM   7118  CG  LEU B  87      42.384  74.028 103.079  1.00  0.95           C  
ATOM   7119  CD1 LEU B  87      41.837  73.791 104.493  1.00  0.95           C  
ATOM   7120  CD2 LEU B  87      41.327  73.636 102.035  1.00  0.95           C  
ATOM   7121  N   GLU B  88      42.547  78.949 102.426  1.00  0.93           N  
ATOM   7122  CA  GLU B  88      43.178  80.226 102.694  1.00  0.93           C  
ATOM   7123  C   GLU B  88      42.361  81.416 102.202  1.00  0.93           C  
ATOM   7124  O   GLU B  88      41.900  81.464 101.064  1.00  0.93           O  
ATOM   7125  CB  GLU B  88      44.548  80.355 101.989  1.00  0.93           C  
ATOM   7126  CG  GLU B  88      45.609  79.312 102.391  1.00  0.93           C  
ATOM   7127  CD  GLU B  88      47.002  79.682 101.901  1.00  0.93           C  
ATOM   7128  OE1 GLU B  88      47.903  78.826 102.077  1.00  0.93           O  
ATOM   7129  OE2 GLU B  88      47.225  80.830 101.420  1.00  0.93           O  
ATOM   7130  N   PHE B  89      42.219  82.449 103.055  1.00  0.93           N  
ATOM   7131  CA  PHE B  89      41.666  83.742 102.686  1.00  0.93           C  
ATOM   7132  C   PHE B  89      42.496  84.813 103.368  1.00  0.93           C  
ATOM   7133  O   PHE B  89      42.265  85.183 104.517  1.00  0.93           O  
ATOM   7134  CB  PHE B  89      40.186  83.918 103.125  1.00  0.93           C  
ATOM   7135  CG  PHE B  89      39.279  83.155 102.206  1.00  0.93           C  
ATOM   7136  CD1 PHE B  89      38.910  81.834 102.501  1.00  0.93           C  
ATOM   7137  CD2 PHE B  89      38.808  83.747 101.022  1.00  0.93           C  
ATOM   7138  CE1 PHE B  89      38.105  81.110 101.616  1.00  0.93           C  
ATOM   7139  CE2 PHE B  89      37.988  83.028 100.142  1.00  0.93           C  
ATOM   7140  CZ  PHE B  89      37.639  81.705 100.438  1.00  0.93           C  
ATOM   7141  N   TYR B  90      43.509  85.368 102.676  1.00  0.91           N  
ATOM   7142  CA  TYR B  90      44.454  86.303 103.266  1.00  0.91           C  
ATOM   7143  C   TYR B  90      43.910  87.728 103.219  1.00  0.91           C  
ATOM   7144  O   TYR B  90      44.430  88.613 102.534  1.00  0.91           O  
ATOM   7145  CB  TYR B  90      45.830  86.183 102.555  1.00  0.91           C  
ATOM   7146  CG  TYR B  90      47.049  86.554 103.366  1.00  0.91           C  
ATOM   7147  CD1 TYR B  90      47.024  87.079 104.676  1.00  0.91           C  
ATOM   7148  CD2 TYR B  90      48.295  86.296 102.770  1.00  0.91           C  
ATOM   7149  CE1 TYR B  90      48.223  87.321 105.366  1.00  0.91           C  
ATOM   7150  CE2 TYR B  90      49.490  86.532 103.461  1.00  0.91           C  
ATOM   7151  CZ  TYR B  90      49.450  87.039 104.762  1.00  0.91           C  
ATOM   7152  OH  TYR B  90      50.648  87.244 105.470  1.00  0.91           O  
ATOM   7153  N   MET B  91      42.792  87.964 103.928  1.00  0.92           N  
ATOM   7154  CA  MET B  91      42.019  89.188 103.874  1.00  0.92           C  
ATOM   7155  C   MET B  91      42.773  90.427 104.327  1.00  0.92           C  
ATOM   7156  O   MET B  91      42.729  91.453 103.648  1.00  0.92           O  
ATOM   7157  CB  MET B  91      40.713  89.053 104.696  1.00  0.92           C  
ATOM   7158  CG  MET B  91      39.808  87.883 104.259  1.00  0.92           C  
ATOM   7159  SD  MET B  91      39.236  87.959 102.534  1.00  0.92           S  
ATOM   7160  CE  MET B  91      37.919  89.183 102.787  1.00  0.92           C  
ATOM   7161  N   GLY B  92      43.527  90.341 105.448  1.00  0.95           N  
ATOM   7162  CA  GLY B  92      44.084  91.511 106.126  1.00  0.95           C  
ATOM   7163  C   GLY B  92      43.036  92.317 106.853  1.00  0.95           C  
ATOM   7164  O   GLY B  92      41.952  91.828 107.149  1.00  0.95           O  
ATOM   7165  N   ARG B  93      43.347  93.579 107.197  1.00  0.90           N  
ATOM   7166  CA  ARG B  93      42.396  94.514 107.787  1.00  0.90           C  
ATOM   7167  C   ARG B  93      41.176  94.802 106.918  1.00  0.90           C  
ATOM   7168  O   ARG B  93      41.285  94.866 105.691  1.00  0.90           O  
ATOM   7169  CB  ARG B  93      43.094  95.857 108.058  1.00  0.90           C  
ATOM   7170  CG  ARG B  93      44.153  95.772 109.162  1.00  0.90           C  
ATOM   7171  CD  ARG B  93      44.699  97.160 109.467  1.00  0.90           C  
ATOM   7172  NE  ARG B  93      45.714  96.986 110.540  1.00  0.90           N  
ATOM   7173  CZ  ARG B  93      46.771  97.782 110.697  1.00  0.90           C  
ATOM   7174  NH1 ARG B  93      47.003  98.767 109.836  1.00  0.90           N  
ATOM   7175  NH2 ARG B  93      47.566  97.638 111.751  1.00  0.90           N  
ATOM   7176  N   THR B  94      39.979  94.983 107.512  1.00  0.94           N  
ATOM   7177  CA  THR B  94      38.746  95.172 106.752  1.00  0.94           C  
ATOM   7178  C   THR B  94      38.178  96.572 106.889  1.00  0.94           C  
ATOM   7179  O   THR B  94      37.421  96.990 106.011  1.00  0.94           O  
ATOM   7180  CB  THR B  94      37.671  94.074 106.985  1.00  0.94           C  
ATOM   7181  OG1 THR B  94      36.465  94.492 107.613  1.00  0.94           O  
ATOM   7182  CG2 THR B  94      38.218  92.902 107.815  1.00  0.94           C  
ATOM   7183  N   LEU B  95      38.536  97.359 107.935  1.00  0.92           N  
ATOM   7184  CA  LEU B  95      37.877  98.633 108.219  1.00  0.92           C  
ATOM   7185  C   LEU B  95      37.952  99.654 107.093  1.00  0.92           C  
ATOM   7186  O   LEU B  95      36.925 100.053 106.540  1.00  0.92           O  
ATOM   7187  CB  LEU B  95      38.431  99.240 109.537  1.00  0.92           C  
ATOM   7188  CG  LEU B  95      37.820 100.583 110.003  1.00  0.92           C  
ATOM   7189  CD1 LEU B  95      36.285 100.587 110.052  1.00  0.92           C  
ATOM   7190  CD2 LEU B  95      38.366 100.957 111.388  1.00  0.92           C  
ATOM   7191  N   GLN B  96      39.167 100.018 106.638  1.00  0.90           N  
ATOM   7192  CA  GLN B  96      39.348 100.971 105.559  1.00  0.90           C  
ATOM   7193  C   GLN B  96      38.774 100.509 104.227  1.00  0.90           C  
ATOM   7194  O   GLN B  96      38.113 101.255 103.509  1.00  0.90           O  
ATOM   7195  CB  GLN B  96      40.832 101.360 105.391  1.00  0.90           C  
ATOM   7196  CG  GLN B  96      40.976 102.779 104.799  1.00  0.90           C  
ATOM   7197  CD  GLN B  96      42.433 103.160 104.550  1.00  0.90           C  
ATOM   7198  OE1 GLN B  96      43.373 102.388 104.738  1.00  0.90           O  
ATOM   7199  NE2 GLN B  96      42.618 104.398 104.036  1.00  0.90           N  
ATOM   7200  N   ASN B  97      38.959  99.214 103.887  1.00  0.93           N  
ATOM   7201  CA  ASN B  97      38.433  98.600 102.675  1.00  0.93           C  
ATOM   7202  C   ASN B  97      36.910  98.638 102.638  1.00  0.93           C  
ATOM   7203  O   ASN B  97      36.313  98.961 101.614  1.00  0.93           O  
ATOM   7204  CB  ASN B  97      38.956  97.135 102.574  1.00  0.93           C  
ATOM   7205  CG  ASN B  97      38.996  96.502 101.173  1.00  0.93           C  
ATOM   7206  OD1 ASN B  97      39.800  95.580 100.982  1.00  0.93           O  
ATOM   7207  ND2 ASN B  97      38.162  96.936 100.209  1.00  0.93           N  
ATOM   7208  N   THR B  98      36.249  98.347 103.775  1.00  0.93           N  
ATOM   7209  CA  THR B  98      34.803  98.478 103.928  1.00  0.93           C  
ATOM   7210  C   THR B  98      34.341  99.917 103.801  1.00  0.93           C  
ATOM   7211  O   THR B  98      33.403 100.215 103.066  1.00  0.93           O  
ATOM   7212  CB  THR B  98      34.301  97.896 105.245  1.00  0.93           C  
ATOM   7213  OG1 THR B  98      34.600  96.509 105.300  1.00  0.93           O  
ATOM   7214  CG2 THR B  98      32.774  97.997 105.351  1.00  0.93           C  
ATOM   7215  N   MET B  99      35.024 100.881 104.455  1.00  0.89           N  
ATOM   7216  CA  MET B  99      34.701 102.294 104.320  1.00  0.89           C  
ATOM   7217  C   MET B  99      34.849 102.839 102.902  1.00  0.89           C  
ATOM   7218  O   MET B  99      33.982 103.569 102.424  1.00  0.89           O  
ATOM   7219  CB  MET B  99      35.540 103.168 105.282  1.00  0.89           C  
ATOM   7220  CG  MET B  99      35.202 102.945 106.767  1.00  0.89           C  
ATOM   7221  SD  MET B  99      35.877 104.191 107.907  1.00  0.89           S  
ATOM   7222  CE  MET B  99      37.639 103.984 107.536  1.00  0.89           C  
ATOM   7223  N   ILE B 100      35.931 102.488 102.176  1.00  0.90           N  
ATOM   7224  CA  ILE B 100      36.112 102.859 100.775  1.00  0.90           C  
ATOM   7225  C   ILE B 100      35.065 102.234  99.860  1.00  0.90           C  
ATOM   7226  O   ILE B 100      34.411 102.937  99.091  1.00  0.90           O  
ATOM   7227  CB  ILE B 100      37.527 102.511 100.299  1.00  0.90           C  
ATOM   7228  CG1 ILE B 100      38.554 103.396 101.043  1.00  0.90           C  
ATOM   7229  CG2 ILE B 100      37.673 102.678  98.766  1.00  0.90           C  
ATOM   7230  CD1 ILE B 100      40.008 102.947 100.857  1.00  0.90           C  
ATOM   7231  N   ASN B 101      34.821 100.908  99.959  1.00  0.90           N  
ATOM   7232  CA  ASN B 101      33.888 100.203  99.087  1.00  0.90           C  
ATOM   7233  C   ASN B 101      32.438 100.653  99.248  1.00  0.90           C  
ATOM   7234  O   ASN B 101      31.704 100.790  98.269  1.00  0.90           O  
ATOM   7235  CB  ASN B 101      34.000  98.658  99.223  1.00  0.90           C  
ATOM   7236  CG  ASN B 101      35.303  98.138  98.605  1.00  0.90           C  
ATOM   7237  OD1 ASN B 101      36.266  98.870  98.376  1.00  0.90           O  
ATOM   7238  ND2 ASN B 101      35.336  96.817  98.315  1.00  0.90           N  
ATOM   7239  N   LEU B 102      31.997 100.943 100.491  1.00  0.87           N  
ATOM   7240  CA  LEU B 102      30.654 101.436 100.745  1.00  0.87           C  
ATOM   7241  C   LEU B 102      30.436 102.894 100.363  1.00  0.87           C  
ATOM   7242  O   LEU B 102      29.282 103.318 100.262  1.00  0.87           O  
ATOM   7243  CB  LEU B 102      30.280 101.318 102.244  1.00  0.87           C  
ATOM   7244  CG  LEU B 102      30.191  99.886 102.801  1.00  0.87           C  
ATOM   7245  CD1 LEU B 102      29.911  99.964 104.310  1.00  0.87           C  
ATOM   7246  CD2 LEU B 102      29.138  99.024 102.087  1.00  0.87           C  
ATOM   7247  N   GLY B 103      31.525 103.674 100.155  1.00  0.88           N  
ATOM   7248  CA  GLY B 103      31.475 105.108  99.871  1.00  0.88           C  
ATOM   7249  C   GLY B 103      31.456 105.977 101.098  1.00  0.88           C  
ATOM   7250  O   GLY B 103      31.009 107.119 101.063  1.00  0.88           O  
ATOM   7251  N   LEU B 104      31.925 105.453 102.241  1.00  0.87           N  
ATOM   7252  CA  LEU B 104      31.722 106.077 103.535  1.00  0.87           C  
ATOM   7253  C   LEU B 104      32.954 106.748 104.116  1.00  0.87           C  
ATOM   7254  O   LEU B 104      32.819 107.522 105.063  1.00  0.87           O  
ATOM   7255  CB  LEU B 104      31.227 105.003 104.543  1.00  0.87           C  
ATOM   7256  CG  LEU B 104      29.725 105.098 104.876  1.00  0.87           C  
ATOM   7257  CD1 LEU B 104      28.826 104.976 103.635  1.00  0.87           C  
ATOM   7258  CD2 LEU B 104      29.359 104.027 105.912  1.00  0.87           C  
ATOM   7259  N   GLN B 105      34.174 106.511 103.574  1.00  0.83           N  
ATOM   7260  CA  GLN B 105      35.420 106.920 104.225  1.00  0.83           C  
ATOM   7261  C   GLN B 105      35.506 108.401 104.550  1.00  0.83           C  
ATOM   7262  O   GLN B 105      35.668 108.766 105.705  1.00  0.83           O  
ATOM   7263  CB  GLN B 105      36.663 106.523 103.384  1.00  0.83           C  
ATOM   7264  CG  GLN B 105      38.003 106.692 104.152  1.00  0.83           C  
ATOM   7265  CD  GLN B 105      39.222 106.604 103.233  1.00  0.83           C  
ATOM   7266  OE1 GLN B 105      39.921 105.594 103.142  1.00  0.83           O  
ATOM   7267  NE2 GLN B 105      39.487 107.717 102.510  1.00  0.83           N  
ATOM   7268  N   ASN B 106      35.259 109.286 103.565  1.00  0.81           N  
ATOM   7269  CA  ASN B 106      35.385 110.729 103.713  1.00  0.81           C  
ATOM   7270  C   ASN B 106      34.497 111.297 104.824  1.00  0.81           C  
ATOM   7271  O   ASN B 106      34.879 112.182 105.585  1.00  0.81           O  
ATOM   7272  CB  ASN B 106      34.998 111.461 102.390  1.00  0.81           C  
ATOM   7273  CG  ASN B 106      35.706 110.926 101.142  1.00  0.81           C  
ATOM   7274  OD1 ASN B 106      36.387 109.905 101.104  1.00  0.81           O  
ATOM   7275  ND2 ASN B 106      35.479 111.638 100.011  1.00  0.81           N  
ATOM   7276  N   ALA B 107      33.260 110.772 104.937  1.00  0.88           N  
ATOM   7277  CA  ALA B 107      32.336 111.103 105.998  1.00  0.88           C  
ATOM   7278  C   ALA B 107      32.777 110.584 107.367  1.00  0.88           C  
ATOM   7279  O   ALA B 107      32.649 111.275 108.376  1.00  0.88           O  
ATOM   7280  CB  ALA B 107      30.942 110.561 105.628  1.00  0.88           C  
ATOM   7281  N   CYS B 108      33.318 109.349 107.429  1.00  0.88           N  
ATOM   7282  CA  CYS B 108      33.909 108.777 108.629  1.00  0.88           C  
ATOM   7283  C   CYS B 108      35.147 109.517 109.111  1.00  0.88           C  
ATOM   7284  O   CYS B 108      35.276 109.770 110.308  1.00  0.88           O  
ATOM   7285  CB  CYS B 108      34.279 107.285 108.445  1.00  0.88           C  
ATOM   7286  SG  CYS B 108      32.815 106.221 108.206  1.00  0.88           S  
ATOM   7287  N   ASP B 109      36.060 109.923 108.201  1.00  0.85           N  
ATOM   7288  CA  ASP B 109      37.261 110.689 108.506  1.00  0.85           C  
ATOM   7289  C   ASP B 109      36.924 111.989 109.231  1.00  0.85           C  
ATOM   7290  O   ASP B 109      37.449 112.305 110.299  1.00  0.85           O  
ATOM   7291  CB  ASP B 109      37.995 111.089 107.188  1.00  0.85           C  
ATOM   7292  CG  ASP B 109      38.432 109.900 106.348  1.00  0.85           C  
ATOM   7293  OD1 ASP B 109      38.564 110.086 105.108  1.00  0.85           O  
ATOM   7294  OD2 ASP B 109      38.642 108.807 106.924  1.00  0.85           O  
ATOM   7295  N   GLU B 110      35.952 112.732 108.668  1.00  0.82           N  
ATOM   7296  CA  GLU B 110      35.407 113.964 109.201  1.00  0.82           C  
ATOM   7297  C   GLU B 110      34.674 113.761 110.529  1.00  0.82           C  
ATOM   7298  O   GLU B 110      34.868 114.487 111.503  1.00  0.82           O  
ATOM   7299  CB  GLU B 110      34.520 114.603 108.101  1.00  0.82           C  
ATOM   7300  CG  GLU B 110      34.719 116.127 107.916  1.00  0.82           C  
ATOM   7301  CD  GLU B 110      33.900 116.953 108.887  1.00  0.82           C  
ATOM   7302  OE1 GLU B 110      32.647 116.898 108.791  1.00  0.82           O  
ATOM   7303  OE2 GLU B 110      34.498 117.672 109.728  1.00  0.82           O  
ATOM   7304  N   ALA B 111      33.864 112.687 110.642  1.00  0.90           N  
ATOM   7305  CA  ALA B 111      33.189 112.314 111.871  1.00  0.90           C  
ATOM   7306  C   ALA B 111      34.122 111.995 113.039  1.00  0.90           C  
ATOM   7307  O   ALA B 111      33.918 112.474 114.153  1.00  0.90           O  
ATOM   7308  CB  ALA B 111      32.272 111.102 111.599  1.00  0.90           C  
ATOM   7309  N   ILE B 112      35.190 111.209 112.799  1.00  0.86           N  
ATOM   7310  CA  ILE B 112      36.238 110.905 113.769  1.00  0.86           C  
ATOM   7311  C   ILE B 112      37.040 112.146 114.154  1.00  0.86           C  
ATOM   7312  O   ILE B 112      37.299 112.399 115.333  1.00  0.86           O  
ATOM   7313  CB  ILE B 112      37.119 109.766 113.247  1.00  0.86           C  
ATOM   7314  CG1 ILE B 112      36.314 108.442 113.148  1.00  0.86           C  
ATOM   7315  CG2 ILE B 112      38.387 109.555 114.102  1.00  0.86           C  
ATOM   7316  CD1 ILE B 112      35.783 107.898 114.483  1.00  0.86           C  
ATOM   7317  N   TYR B 113      37.380 113.007 113.170  1.00  0.86           N  
ATOM   7318  CA  TYR B 113      38.029 114.291 113.392  1.00  0.86           C  
ATOM   7319  C   TYR B 113      37.204 115.217 114.296  1.00  0.86           C  
ATOM   7320  O   TYR B 113      37.705 115.762 115.279  1.00  0.86           O  
ATOM   7321  CB  TYR B 113      38.303 114.943 112.006  1.00  0.86           C  
ATOM   7322  CG  TYR B 113      38.967 116.289 112.098  1.00  0.86           C  
ATOM   7323  CD1 TYR B 113      40.301 116.405 112.521  1.00  0.86           C  
ATOM   7324  CD2 TYR B 113      38.242 117.452 111.785  1.00  0.86           C  
ATOM   7325  CE1 TYR B 113      40.899 117.668 112.638  1.00  0.86           C  
ATOM   7326  CE2 TYR B 113      38.838 118.715 111.907  1.00  0.86           C  
ATOM   7327  CZ  TYR B 113      40.165 118.820 112.336  1.00  0.86           C  
ATOM   7328  OH  TYR B 113      40.763 120.088 112.469  1.00  0.86           O  
ATOM   7329  N   GLN B 114      35.880 115.335 114.065  1.00  0.83           N  
ATOM   7330  CA  GLN B 114      35.019 116.158 114.898  1.00  0.83           C  
ATOM   7331  C   GLN B 114      34.544 115.449 116.170  1.00  0.83           C  
ATOM   7332  O   GLN B 114      33.558 115.857 116.797  1.00  0.83           O  
ATOM   7333  CB  GLN B 114      33.724 116.568 114.171  1.00  0.83           C  
ATOM   7334  CG  GLN B 114      33.832 117.422 112.897  1.00  0.83           C  
ATOM   7335  CD  GLN B 114      32.408 117.794 112.471  1.00  0.83           C  
ATOM   7336  OE1 GLN B 114      31.449 117.607 113.237  1.00  0.83           O  
ATOM   7337  NE2 GLN B 114      32.250 118.319 111.247  1.00  0.83           N  
ATOM   7338  N   LEU B 115      35.236 114.374 116.583  1.00  0.85           N  
ATOM   7339  CA  LEU B 115      35.137 113.801 117.908  1.00  0.85           C  
ATOM   7340  C   LEU B 115      36.463 113.935 118.638  1.00  0.85           C  
ATOM   7341  O   LEU B 115      36.587 113.509 119.791  1.00  0.85           O  
ATOM   7342  CB  LEU B 115      34.748 112.307 117.820  1.00  0.85           C  
ATOM   7343  CG  LEU B 115      33.276 112.084 117.423  1.00  0.85           C  
ATOM   7344  CD1 LEU B 115      33.058 110.630 116.997  1.00  0.85           C  
ATOM   7345  CD2 LEU B 115      32.307 112.469 118.552  1.00  0.85           C  
ATOM   7346  N   GLY B 116      37.479 114.568 118.009  1.00  0.86           N  
ATOM   7347  CA  GLY B 116      38.788 114.787 118.615  1.00  0.86           C  
ATOM   7348  C   GLY B 116      39.639 113.550 118.685  1.00  0.86           C  
ATOM   7349  O   GLY B 116      40.274 113.289 119.702  1.00  0.86           O  
ATOM   7350  N   LEU B 117      39.650 112.741 117.613  1.00  0.82           N  
ATOM   7351  CA  LEU B 117      40.403 111.505 117.555  1.00  0.82           C  
ATOM   7352  C   LEU B 117      41.134 111.432 116.226  1.00  0.82           C  
ATOM   7353  O   LEU B 117      40.706 112.026 115.238  1.00  0.82           O  
ATOM   7354  CB  LEU B 117      39.446 110.285 117.639  1.00  0.82           C  
ATOM   7355  CG  LEU B 117      38.683 110.138 118.969  1.00  0.82           C  
ATOM   7356  CD1 LEU B 117      37.620 109.035 118.860  1.00  0.82           C  
ATOM   7357  CD2 LEU B 117      39.633 109.846 120.137  1.00  0.82           C  
ATOM   7358  N   ASP B 118      42.253 110.679 116.163  1.00  0.82           N  
ATOM   7359  CA  ASP B 118      42.933 110.393 114.917  1.00  0.82           C  
ATOM   7360  C   ASP B 118      42.406 109.076 114.355  1.00  0.82           C  
ATOM   7361  O   ASP B 118      42.244 108.093 115.074  1.00  0.82           O  
ATOM   7362  CB  ASP B 118      44.469 110.317 115.109  1.00  0.82           C  
ATOM   7363  CG  ASP B 118      45.103 110.063 113.750  1.00  0.82           C  
ATOM   7364  OD1 ASP B 118      44.915 110.918 112.851  1.00  0.82           O  
ATOM   7365  OD2 ASP B 118      45.631 108.937 113.570  1.00  0.82           O  
ATOM   7366  N   ILE B 119      42.113 109.029 113.041  1.00  0.82           N  
ATOM   7367  CA  ILE B 119      41.646 107.814 112.398  1.00  0.82           C  
ATOM   7368  C   ILE B 119      42.740 106.782 112.132  1.00  0.82           C  
ATOM   7369  O   ILE B 119      42.500 105.589 112.313  1.00  0.82           O  
ATOM   7370  CB  ILE B 119      40.743 108.089 111.198  1.00  0.82           C  
ATOM   7371  CG1 ILE B 119      39.865 106.853 110.879  1.00  0.82           C  
ATOM   7372  CG2 ILE B 119      41.547 108.576 109.974  1.00  0.82           C  
ATOM   7373  CD1 ILE B 119      38.649 107.177 110.004  1.00  0.82           C  
ATOM   7374  N   GLU B 120      43.988 107.182 111.768  1.00  0.77           N  
ATOM   7375  CA  GLU B 120      45.079 106.242 111.506  1.00  0.77           C  
ATOM   7376  C   GLU B 120      45.467 105.468 112.763  1.00  0.77           C  
ATOM   7377  O   GLU B 120      45.676 104.254 112.730  1.00  0.77           O  
ATOM   7378  CB  GLU B 120      46.318 106.909 110.832  1.00  0.77           C  
ATOM   7379  CG  GLU B 120      47.389 105.884 110.349  1.00  0.77           C  
ATOM   7380  CD  GLU B 120      48.494 106.451 109.463  1.00  0.77           C  
ATOM   7381  OE1 GLU B 120      49.566 106.875 109.968  1.00  0.77           O  
ATOM   7382  OE2 GLU B 120      48.368 106.400 108.209  1.00  0.77           O  
ATOM   7383  N   GLU B 121      45.470 106.142 113.936  1.00  0.79           N  
ATOM   7384  CA  GLU B 121      45.606 105.490 115.231  1.00  0.79           C  
ATOM   7385  C   GLU B 121      44.521 104.443 115.504  1.00  0.79           C  
ATOM   7386  O   GLU B 121      44.814 103.326 115.932  1.00  0.79           O  
ATOM   7387  CB  GLU B 121      45.611 106.516 116.395  1.00  0.79           C  
ATOM   7388  CG  GLU B 121      46.182 105.928 117.715  1.00  0.79           C  
ATOM   7389  CD  GLU B 121      45.857 106.752 118.962  1.00  0.79           C  
ATOM   7390  OE1 GLU B 121      46.152 107.971 118.975  1.00  0.79           O  
ATOM   7391  OE2 GLU B 121      45.320 106.146 119.931  1.00  0.79           O  
ATOM   7392  N   LEU B 122      43.231 104.737 115.205  1.00  0.88           N  
ATOM   7393  CA  LEU B 122      42.163 103.746 115.311  1.00  0.88           C  
ATOM   7394  C   LEU B 122      42.331 102.570 114.355  1.00  0.88           C  
ATOM   7395  O   LEU B 122      42.153 101.416 114.735  1.00  0.88           O  
ATOM   7396  CB  LEU B 122      40.734 104.316 115.066  1.00  0.88           C  
ATOM   7397  CG  LEU B 122      40.288 105.494 115.957  1.00  0.88           C  
ATOM   7398  CD1 LEU B 122      38.776 105.732 115.817  1.00  0.88           C  
ATOM   7399  CD2 LEU B 122      40.668 105.324 117.432  1.00  0.88           C  
ATOM   7400  N   GLU B 123      42.691 102.824 113.084  1.00  0.88           N  
ATOM   7401  CA  GLU B 123      42.860 101.787 112.081  1.00  0.88           C  
ATOM   7402  C   GLU B 123      44.059 100.876 112.298  1.00  0.88           C  
ATOM   7403  O   GLU B 123      44.020  99.694 111.955  1.00  0.88           O  
ATOM   7404  CB  GLU B 123      42.856 102.375 110.656  1.00  0.88           C  
ATOM   7405  CG  GLU B 123      41.492 103.029 110.334  1.00  0.88           C  
ATOM   7406  CD  GLU B 123      41.228 103.135 108.838  1.00  0.88           C  
ATOM   7407  OE1 GLU B 123      40.312 102.407 108.373  1.00  0.88           O  
ATOM   7408  OE2 GLU B 123      41.924 103.923 108.156  1.00  0.88           O  
ATOM   7409  N   GLU B 124      45.147 101.362 112.932  1.00  0.86           N  
ATOM   7410  CA  GLU B 124      46.263 100.504 113.298  1.00  0.86           C  
ATOM   7411  C   GLU B 124      45.951  99.524 114.433  1.00  0.86           C  
ATOM   7412  O   GLU B 124      46.626  98.504 114.562  1.00  0.86           O  
ATOM   7413  CB  GLU B 124      47.559 101.297 113.613  1.00  0.86           C  
ATOM   7414  CG  GLU B 124      48.315 101.842 112.368  1.00  0.86           C  
ATOM   7415  CD  GLU B 124      48.761 100.755 111.411  1.00  0.86           C  
ATOM   7416  OE1 GLU B 124      49.286  99.696 111.835  1.00  0.86           O  
ATOM   7417  OE2 GLU B 124      48.534 100.889 110.178  1.00  0.86           O  
ATOM   7418  N   ILE B 125      44.886  99.760 115.235  1.00  0.89           N  
ATOM   7419  CA  ILE B 125      44.366  98.801 116.213  1.00  0.89           C  
ATOM   7420  C   ILE B 125      43.846  97.519 115.573  1.00  0.89           C  
ATOM   7421  O   ILE B 125      43.921  96.448 116.170  1.00  0.89           O  
ATOM   7422  CB  ILE B 125      43.261  99.395 117.098  1.00  0.89           C  
ATOM   7423  CG1 ILE B 125      43.750 100.623 117.902  1.00  0.89           C  
ATOM   7424  CG2 ILE B 125      42.651  98.339 118.052  1.00  0.89           C  
ATOM   7425  CD1 ILE B 125      44.800 100.321 118.981  1.00  0.89           C  
ATOM   7426  N   GLU B 126      43.276  97.574 114.350  1.00  0.90           N  
ATOM   7427  CA  GLU B 126      42.764  96.381 113.694  1.00  0.90           C  
ATOM   7428  C   GLU B 126      43.843  95.333 113.409  1.00  0.90           C  
ATOM   7429  O   GLU B 126      44.716  95.512 112.558  1.00  0.90           O  
ATOM   7430  CB  GLU B 126      41.994  96.725 112.391  1.00  0.90           C  
ATOM   7431  CG  GLU B 126      41.194  95.530 111.804  1.00  0.90           C  
ATOM   7432  CD  GLU B 126      40.345  95.872 110.584  1.00  0.90           C  
ATOM   7433  OE1 GLU B 126      40.578  96.905 109.913  1.00  0.90           O  
ATOM   7434  OE2 GLU B 126      39.454  95.052 110.240  1.00  0.90           O  
ATOM   7435  N   GLU B 127      43.813  94.199 114.136  1.00  0.89           N  
ATOM   7436  CA  GLU B 127      44.667  93.052 113.905  1.00  0.89           C  
ATOM   7437  C   GLU B 127      44.449  92.489 112.484  1.00  0.89           C  
ATOM   7438  O   GLU B 127      43.316  92.413 112.009  1.00  0.89           O  
ATOM   7439  CB  GLU B 127      44.422  91.942 114.981  1.00  0.89           C  
ATOM   7440  CG  GLU B 127      43.799  92.382 116.355  1.00  0.89           C  
ATOM   7441  CD  GLU B 127      44.633  93.222 117.334  1.00  0.89           C  
ATOM   7442  OE1 GLU B 127      44.012  93.726 118.320  1.00  0.89           O  
ATOM   7443  OE2 GLU B 127      45.868  93.345 117.174  1.00  0.89           O  
ATOM   7444  N   ASP B 128      45.504  92.099 111.728  1.00  0.92           N  
ATOM   7445  CA  ASP B 128      45.312  91.497 110.413  1.00  0.92           C  
ATOM   7446  C   ASP B 128      44.527  90.178 110.454  1.00  0.92           C  
ATOM   7447  O   ASP B 128      44.819  89.274 111.232  1.00  0.92           O  
ATOM   7448  CB  ASP B 128      46.659  91.182 109.691  1.00  0.92           C  
ATOM   7449  CG  ASP B 128      47.405  92.402 109.203  1.00  0.92           C  
ATOM   7450  OD1 ASP B 128      47.445  92.631 107.965  1.00  0.92           O  
ATOM   7451  OD2 ASP B 128      48.041  93.096 110.038  1.00  0.92           O  
ATOM   7452  N   ALA B 129      43.544  89.993 109.546  1.00  0.94           N  
ATOM   7453  CA  ALA B 129      42.966  88.687 109.290  1.00  0.94           C  
ATOM   7454  C   ALA B 129      43.922  87.836 108.450  1.00  0.94           C  
ATOM   7455  O   ALA B 129      43.821  87.738 107.223  1.00  0.94           O  
ATOM   7456  CB  ALA B 129      41.588  88.828 108.620  1.00  0.94           C  
ATOM   7457  N   GLY B 130      44.921  87.230 109.125  1.00  0.86           N  
ATOM   7458  CA  GLY B 130      46.055  86.520 108.546  1.00  0.86           C  
ATOM   7459  C   GLY B 130      45.790  85.103 108.119  1.00  0.86           C  
ATOM   7460  O   GLY B 130      46.627  84.224 108.294  1.00  0.86           O  
ATOM   7461  N   LEU B 131      44.617  84.813 107.538  1.00  0.91           N  
ATOM   7462  CA  LEU B 131      44.186  83.451 107.269  1.00  0.91           C  
ATOM   7463  C   LEU B 131      44.664  82.912 105.923  1.00  0.91           C  
ATOM   7464  O   LEU B 131      43.946  82.182 105.245  1.00  0.91           O  
ATOM   7465  CB  LEU B 131      42.641  83.324 107.354  1.00  0.91           C  
ATOM   7466  CG  LEU B 131      41.991  83.943 108.609  1.00  0.91           C  
ATOM   7467  CD1 LEU B 131      40.474  83.708 108.580  1.00  0.91           C  
ATOM   7468  CD2 LEU B 131      42.576  83.400 109.920  1.00  0.91           C  
ATOM   7469  N   GLY B 132      45.897  83.247 105.494  1.00  0.92           N  
ATOM   7470  CA  GLY B 132      46.480  82.716 104.270  1.00  0.92           C  
ATOM   7471  C   GLY B 132      47.976  82.799 104.309  1.00  0.92           C  
ATOM   7472  O   GLY B 132      48.550  83.605 105.034  1.00  0.92           O  
ATOM   7473  N   ASN B 133      48.663  81.945 103.532  1.00  0.85           N  
ATOM   7474  CA  ASN B 133      50.109  81.864 103.518  1.00  0.85           C  
ATOM   7475  C   ASN B 133      50.783  82.937 102.698  1.00  0.85           C  
ATOM   7476  O   ASN B 133      51.822  83.475 103.087  1.00  0.85           O  
ATOM   7477  CB  ASN B 133      50.558  80.504 102.933  1.00  0.85           C  
ATOM   7478  CG  ASN B 133      50.615  79.519 104.082  1.00  0.85           C  
ATOM   7479  OD1 ASN B 133      51.529  79.659 104.904  1.00  0.85           O  
ATOM   7480  ND2 ASN B 133      49.668  78.568 104.161  1.00  0.85           N  
ATOM   7481  N   GLY B 134      50.242  83.223 101.508  1.00  0.92           N  
ATOM   7482  CA  GLY B 134      50.971  84.019 100.540  1.00  0.92           C  
ATOM   7483  C   GLY B 134      50.117  84.367  99.366  1.00  0.92           C  
ATOM   7484  O   GLY B 134      49.065  84.990  99.492  1.00  0.92           O  
ATOM   7485  N   GLY B 135      50.561  83.986  98.152  1.00  0.93           N  
ATOM   7486  CA  GLY B 135      49.855  84.340  96.923  1.00  0.93           C  
ATOM   7487  C   GLY B 135      48.516  83.670  96.759  1.00  0.93           C  
ATOM   7488  O   GLY B 135      47.579  84.280  96.252  1.00  0.93           O  
ATOM   7489  N   LEU B 136      48.400  82.408  97.218  1.00  0.90           N  
ATOM   7490  CA  LEU B 136      47.208  81.581  97.122  1.00  0.90           C  
ATOM   7491  C   LEU B 136      45.985  82.173  97.818  1.00  0.90           C  
ATOM   7492  O   LEU B 136      44.983  82.511  97.183  1.00  0.90           O  
ATOM   7493  CB  LEU B 136      47.562  80.203  97.741  1.00  0.90           C  
ATOM   7494  CG  LEU B 136      46.443  79.141  97.756  1.00  0.90           C  
ATOM   7495  CD1 LEU B 136      45.970  78.773  96.346  1.00  0.90           C  
ATOM   7496  CD2 LEU B 136      46.935  77.882  98.483  1.00  0.90           C  
ATOM   7497  N   GLY B 137      46.069  82.414  99.144  1.00  0.94           N  
ATOM   7498  CA  GLY B 137      44.989  83.050  99.883  1.00  0.94           C  
ATOM   7499  C   GLY B 137      44.778  84.505  99.593  1.00  0.94           C  
ATOM   7500  O   GLY B 137      43.688  85.039  99.796  1.00  0.94           O  
ATOM   7501  N   ARG B 138      45.813  85.225  99.125  1.00  0.89           N  
ATOM   7502  CA  ARG B 138      45.658  86.618  98.754  1.00  0.89           C  
ATOM   7503  C   ARG B 138      44.916  86.798  97.444  1.00  0.89           C  
ATOM   7504  O   ARG B 138      44.158  87.757  97.290  1.00  0.89           O  
ATOM   7505  CB  ARG B 138      47.006  87.370  98.746  1.00  0.89           C  
ATOM   7506  CG  ARG B 138      46.902  88.912  98.673  1.00  0.89           C  
ATOM   7507  CD  ARG B 138      46.055  89.558  99.786  1.00  0.89           C  
ATOM   7508  NE  ARG B 138      44.714  89.924  99.214  1.00  0.89           N  
ATOM   7509  CZ  ARG B 138      43.847  90.723  99.858  1.00  0.89           C  
ATOM   7510  NH1 ARG B 138      44.042  91.040 101.133  1.00  0.89           N  
ATOM   7511  NH2 ARG B 138      42.759  91.162  99.232  1.00  0.89           N  
ATOM   7512  N   LEU B 139      45.082  85.857  96.491  1.00  0.95           N  
ATOM   7513  CA  LEU B 139      44.287  85.784  95.279  1.00  0.95           C  
ATOM   7514  C   LEU B 139      42.812  85.567  95.583  1.00  0.95           C  
ATOM   7515  O   LEU B 139      41.950  86.282  95.079  1.00  0.95           O  
ATOM   7516  CB  LEU B 139      44.797  84.629  94.387  1.00  0.95           C  
ATOM   7517  CG  LEU B 139      44.170  84.578  92.981  1.00  0.95           C  
ATOM   7518  CD1 LEU B 139      44.632  85.759  92.114  1.00  0.95           C  
ATOM   7519  CD2 LEU B 139      44.510  83.250  92.294  1.00  0.95           C  
ATOM   7520  N   ALA B 140      42.501  84.630  96.508  1.00  0.97           N  
ATOM   7521  CA  ALA B 140      41.154  84.372  96.983  1.00  0.97           C  
ATOM   7522  C   ALA B 140      40.495  85.596  97.612  1.00  0.97           C  
ATOM   7523  O   ALA B 140      39.367  85.965  97.293  1.00  0.97           O  
ATOM   7524  CB  ALA B 140      41.218  83.235  98.023  1.00  0.97           C  
ATOM   7525  N   ALA B 141      41.236  86.307  98.477  1.00  0.96           N  
ATOM   7526  CA  ALA B 141      40.828  87.561  99.065  1.00  0.96           C  
ATOM   7527  C   ALA B 141      40.631  88.718  98.075  1.00  0.96           C  
ATOM   7528  O   ALA B 141      39.733  89.541  98.234  1.00  0.96           O  
ATOM   7529  CB  ALA B 141      41.856  87.915 100.150  1.00  0.96           C  
ATOM   7530  N   CYS B 142      41.470  88.839  97.020  1.00  0.96           N  
ATOM   7531  CA  CYS B 142      41.233  89.774  95.918  1.00  0.96           C  
ATOM   7532  C   CYS B 142      39.984  89.440  95.116  1.00  0.96           C  
ATOM   7533  O   CYS B 142      39.183  90.313  94.789  1.00  0.96           O  
ATOM   7534  CB  CYS B 142      42.431  89.828  94.933  1.00  0.96           C  
ATOM   7535  SG  CYS B 142      43.918  90.576  95.683  1.00  0.96           S  
ATOM   7536  N   PHE B 143      39.775  88.144  94.817  1.00  0.96           N  
ATOM   7537  CA  PHE B 143      38.636  87.648  94.070  1.00  0.96           C  
ATOM   7538  C   PHE B 143      37.301  87.943  94.732  1.00  0.96           C  
ATOM   7539  O   PHE B 143      36.346  88.296  94.047  1.00  0.96           O  
ATOM   7540  CB  PHE B 143      38.764  86.123  93.798  1.00  0.96           C  
ATOM   7541  CG  PHE B 143      39.737  85.748  92.698  1.00  0.96           C  
ATOM   7542  CD1 PHE B 143      40.528  86.659  91.966  1.00  0.96           C  
ATOM   7543  CD2 PHE B 143      39.810  84.389  92.358  1.00  0.96           C  
ATOM   7544  CE1 PHE B 143      41.354  86.216  90.924  1.00  0.96           C  
ATOM   7545  CE2 PHE B 143      40.637  83.937  91.324  1.00  0.96           C  
ATOM   7546  CZ  PHE B 143      41.411  84.855  90.605  1.00  0.96           C  
ATOM   7547  N   LEU B 144      37.188  87.854  96.075  1.00  0.95           N  
ATOM   7548  CA  LEU B 144      35.960  88.215  96.774  1.00  0.95           C  
ATOM   7549  C   LEU B 144      35.513  89.668  96.558  1.00  0.95           C  
ATOM   7550  O   LEU B 144      34.341  89.918  96.269  1.00  0.95           O  
ATOM   7551  CB  LEU B 144      36.075  87.954  98.300  1.00  0.95           C  
ATOM   7552  CG  LEU B 144      36.260  86.482  98.730  1.00  0.95           C  
ATOM   7553  CD1 LEU B 144      36.296  86.397 100.262  1.00  0.95           C  
ATOM   7554  CD2 LEU B 144      35.168  85.549  98.188  1.00  0.95           C  
ATOM   7555  N   ASP B 145      36.446  90.649  96.630  1.00  0.94           N  
ATOM   7556  CA  ASP B 145      36.200  92.062  96.355  1.00  0.94           C  
ATOM   7557  C   ASP B 145      35.730  92.276  94.912  1.00  0.94           C  
ATOM   7558  O   ASP B 145      34.731  92.948  94.647  1.00  0.94           O  
ATOM   7559  CB  ASP B 145      37.515  92.839  96.688  1.00  0.94           C  
ATOM   7560  CG  ASP B 145      37.494  94.334  96.395  1.00  0.94           C  
ATOM   7561  OD1 ASP B 145      37.487  95.151  97.346  1.00  0.94           O  
ATOM   7562  OD2 ASP B 145      37.589  94.690  95.188  1.00  0.94           O  
ATOM   7563  N   SER B 146      36.408  91.638  93.939  1.00  0.95           N  
ATOM   7564  CA  SER B 146      36.007  91.662  92.539  1.00  0.95           C  
ATOM   7565  C   SER B 146      34.668  91.021  92.245  1.00  0.95           C  
ATOM   7566  O   SER B 146      33.844  91.596  91.543  1.00  0.95           O  
ATOM   7567  CB  SER B 146      37.053  90.993  91.631  1.00  0.95           C  
ATOM   7568  OG  SER B 146      38.212  91.814  91.575  1.00  0.95           O  
ATOM   7569  N   MET B 147      34.368  89.830  92.799  1.00  0.93           N  
ATOM   7570  CA  MET B 147      33.075  89.186  92.624  1.00  0.93           C  
ATOM   7571  C   MET B 147      31.912  89.977  93.212  1.00  0.93           C  
ATOM   7572  O   MET B 147      30.858  90.083  92.591  1.00  0.93           O  
ATOM   7573  CB  MET B 147      33.070  87.736  93.169  1.00  0.93           C  
ATOM   7574  CG  MET B 147      33.945  86.779  92.331  1.00  0.93           C  
ATOM   7575  SD  MET B 147      33.821  85.014  92.753  1.00  0.93           S  
ATOM   7576  CE  MET B 147      34.603  85.106  94.386  1.00  0.93           C  
ATOM   7577  N   ALA B 148      32.080  90.592  94.402  1.00  0.95           N  
ATOM   7578  CA  ALA B 148      31.111  91.520  94.960  1.00  0.95           C  
ATOM   7579  C   ALA B 148      30.929  92.799  94.135  1.00  0.95           C  
ATOM   7580  O   ALA B 148      29.814  93.252  93.882  1.00  0.95           O  
ATOM   7581  CB  ALA B 148      31.526  91.860  96.403  1.00  0.95           C  
ATOM   7582  N   THR B 149      32.035  93.392  93.644  1.00  0.92           N  
ATOM   7583  CA  THR B 149      32.044  94.571  92.769  1.00  0.92           C  
ATOM   7584  C   THR B 149      31.345  94.336  91.441  1.00  0.92           C  
ATOM   7585  O   THR B 149      30.653  95.208  90.918  1.00  0.92           O  
ATOM   7586  CB  THR B 149      33.451  95.106  92.533  1.00  0.92           C  
ATOM   7587  OG1 THR B 149      34.013  95.487  93.782  1.00  0.92           O  
ATOM   7588  CG2 THR B 149      33.457  96.372  91.661  1.00  0.92           C  
ATOM   7589  N   LEU B 150      31.472  93.120  90.879  1.00  0.90           N  
ATOM   7590  CA  LEU B 150      30.847  92.725  89.626  1.00  0.90           C  
ATOM   7591  C   LEU B 150      29.479  92.083  89.846  1.00  0.90           C  
ATOM   7592  O   LEU B 150      28.841  91.628  88.900  1.00  0.90           O  
ATOM   7593  CB  LEU B 150      31.759  91.699  88.899  1.00  0.90           C  
ATOM   7594  CG  LEU B 150      32.882  92.293  88.015  1.00  0.90           C  
ATOM   7595  CD1 LEU B 150      33.679  93.445  88.647  1.00  0.90           C  
ATOM   7596  CD2 LEU B 150      33.852  91.172  87.630  1.00  0.90           C  
ATOM   7597  N   GLY B 151      28.988  92.035  91.104  1.00  0.91           N  
ATOM   7598  CA  GLY B 151      27.609  91.668  91.417  1.00  0.91           C  
ATOM   7599  C   GLY B 151      27.280  90.205  91.348  1.00  0.91           C  
ATOM   7600  O   GLY B 151      26.122  89.811  91.427  1.00  0.91           O  
ATOM   7601  N   LEU B 152      28.294  89.345  91.177  1.00  0.91           N  
ATOM   7602  CA  LEU B 152      28.114  87.912  91.102  1.00  0.91           C  
ATOM   7603  C   LEU B 152      27.610  87.308  92.403  1.00  0.91           C  
ATOM   7604  O   LEU B 152      28.017  87.711  93.493  1.00  0.91           O  
ATOM   7605  CB  LEU B 152      29.425  87.199  90.689  1.00  0.91           C  
ATOM   7606  CG  LEU B 152      29.963  87.609  89.303  1.00  0.91           C  
ATOM   7607  CD1 LEU B 152      31.306  86.919  89.032  1.00  0.91           C  
ATOM   7608  CD2 LEU B 152      28.972  87.279  88.179  1.00  0.91           C  
ATOM   7609  N   ALA B 153      26.736  86.280  92.310  1.00  0.92           N  
ATOM   7610  CA  ALA B 153      26.208  85.549  93.445  1.00  0.92           C  
ATOM   7611  C   ALA B 153      27.243  84.620  94.067  1.00  0.92           C  
ATOM   7612  O   ALA B 153      27.186  83.395  93.969  1.00  0.92           O  
ATOM   7613  CB  ALA B 153      24.941  84.778  93.027  1.00  0.92           C  
ATOM   7614  N   ALA B 154      28.255  85.222  94.707  1.00  0.95           N  
ATOM   7615  CA  ALA B 154      29.476  84.560  95.065  1.00  0.95           C  
ATOM   7616  C   ALA B 154      29.673  84.467  96.561  1.00  0.95           C  
ATOM   7617  O   ALA B 154      29.482  85.419  97.317  1.00  0.95           O  
ATOM   7618  CB  ALA B 154      30.666  85.298  94.438  1.00  0.95           C  
ATOM   7619  N   TYR B 155      30.074  83.271  97.009  1.00  0.94           N  
ATOM   7620  CA  TYR B 155      30.265  82.956  98.401  1.00  0.94           C  
ATOM   7621  C   TYR B 155      31.680  82.440  98.581  1.00  0.94           C  
ATOM   7622  O   TYR B 155      32.132  81.545  97.864  1.00  0.94           O  
ATOM   7623  CB  TYR B 155      29.292  81.847  98.877  1.00  0.94           C  
ATOM   7624  CG  TYR B 155      27.841  82.238  98.762  1.00  0.94           C  
ATOM   7625  CD1 TYR B 155      27.121  82.638  99.901  1.00  0.94           C  
ATOM   7626  CD2 TYR B 155      27.168  82.169  97.529  1.00  0.94           C  
ATOM   7627  CE1 TYR B 155      25.759  82.964  99.808  1.00  0.94           C  
ATOM   7628  CE2 TYR B 155      25.815  82.518  97.431  1.00  0.94           C  
ATOM   7629  CZ  TYR B 155      25.103  82.900  98.571  1.00  0.94           C  
ATOM   7630  OH  TYR B 155      23.739  83.255  98.472  1.00  0.94           O  
ATOM   7631  N   GLY B 156      32.430  82.987  99.557  1.00  0.98           N  
ATOM   7632  CA  GLY B 156      33.722  82.425  99.939  1.00  0.98           C  
ATOM   7633  C   GLY B 156      33.527  81.403 101.019  1.00  0.98           C  
ATOM   7634  O   GLY B 156      32.777  81.647 101.957  1.00  0.98           O  
ATOM   7635  N   TYR B 157      34.195  80.244 100.929  1.00  0.96           N  
ATOM   7636  CA  TYR B 157      34.064  79.189 101.915  1.00  0.96           C  
ATOM   7637  C   TYR B 157      35.423  78.735 102.402  1.00  0.96           C  
ATOM   7638  O   TYR B 157      36.254  78.258 101.627  1.00  0.96           O  
ATOM   7639  CB  TYR B 157      33.324  77.973 101.319  1.00  0.96           C  
ATOM   7640  CG  TYR B 157      31.848  78.126 101.520  1.00  0.96           C  
ATOM   7641  CD1 TYR B 157      31.032  78.754 100.567  1.00  0.96           C  
ATOM   7642  CD2 TYR B 157      31.259  77.593 102.677  1.00  0.96           C  
ATOM   7643  CE1 TYR B 157      29.643  78.790 100.753  1.00  0.96           C  
ATOM   7644  CE2 TYR B 157      29.868  77.583 102.835  1.00  0.96           C  
ATOM   7645  CZ  TYR B 157      29.063  78.173 101.859  1.00  0.96           C  
ATOM   7646  OH  TYR B 157      27.664  78.151 101.962  1.00  0.96           O  
ATOM   7647  N   GLY B 158      35.675  78.878 103.721  1.00  0.99           N  
ATOM   7648  CA  GLY B 158      36.953  78.514 104.322  1.00  0.99           C  
ATOM   7649  C   GLY B 158      36.846  78.102 105.766  1.00  0.99           C  
ATOM   7650  O   GLY B 158      35.777  77.794 106.288  1.00  0.99           O  
ATOM   7651  N   ILE B 159      37.987  78.111 106.477  1.00  0.97           N  
ATOM   7652  CA  ILE B 159      38.072  77.740 107.882  1.00  0.97           C  
ATOM   7653  C   ILE B 159      38.335  78.989 108.695  1.00  0.97           C  
ATOM   7654  O   ILE B 159      39.183  79.816 108.364  1.00  0.97           O  
ATOM   7655  CB  ILE B 159      39.174  76.715 108.161  1.00  0.97           C  
ATOM   7656  CG1 ILE B 159      38.926  75.442 107.324  1.00  0.97           C  
ATOM   7657  CG2 ILE B 159      39.243  76.371 109.671  1.00  0.97           C  
ATOM   7658  CD1 ILE B 159      40.010  74.374 107.490  1.00  0.97           C  
ATOM   7659  N   ARG B 160      37.600  79.162 109.809  1.00  0.90           N  
ATOM   7660  CA  ARG B 160      37.866  80.209 110.770  1.00  0.90           C  
ATOM   7661  C   ARG B 160      38.973  79.764 111.705  1.00  0.90           C  
ATOM   7662  O   ARG B 160      38.725  79.262 112.800  1.00  0.90           O  
ATOM   7663  CB  ARG B 160      36.584  80.552 111.563  1.00  0.90           C  
ATOM   7664  CG  ARG B 160      36.712  81.768 112.500  1.00  0.90           C  
ATOM   7665  CD  ARG B 160      35.343  82.227 113.003  1.00  0.90           C  
ATOM   7666  NE  ARG B 160      35.532  83.214 114.105  1.00  0.90           N  
ATOM   7667  CZ  ARG B 160      35.525  82.880 115.401  1.00  0.90           C  
ATOM   7668  NH1 ARG B 160      35.717  81.627 115.807  1.00  0.90           N  
ATOM   7669  NH2 ARG B 160      35.297  83.817 116.311  1.00  0.90           N  
ATOM   7670  N   TYR B 161      40.242  79.899 111.266  1.00  0.92           N  
ATOM   7671  CA  TYR B 161      41.382  79.581 112.104  1.00  0.92           C  
ATOM   7672  C   TYR B 161      41.473  80.486 113.323  1.00  0.92           C  
ATOM   7673  O   TYR B 161      41.346  81.705 113.223  1.00  0.92           O  
ATOM   7674  CB  TYR B 161      42.750  79.632 111.377  1.00  0.92           C  
ATOM   7675  CG  TYR B 161      42.768  78.792 110.134  1.00  0.92           C  
ATOM   7676  CD1 TYR B 161      42.850  77.391 110.210  1.00  0.92           C  
ATOM   7677  CD2 TYR B 161      42.769  79.407 108.872  1.00  0.92           C  
ATOM   7678  CE1 TYR B 161      42.957  76.623 109.040  1.00  0.92           C  
ATOM   7679  CE2 TYR B 161      42.867  78.641 107.704  1.00  0.92           C  
ATOM   7680  CZ  TYR B 161      42.977  77.250 107.790  1.00  0.92           C  
ATOM   7681  OH  TYR B 161      43.124  76.484 106.618  1.00  0.92           O  
ATOM   7682  N   GLU B 162      41.715  79.900 114.508  1.00  0.87           N  
ATOM   7683  CA  GLU B 162      41.958  80.641 115.734  1.00  0.87           C  
ATOM   7684  C   GLU B 162      43.261  81.438 115.672  1.00  0.87           C  
ATOM   7685  O   GLU B 162      43.332  82.587 116.102  1.00  0.87           O  
ATOM   7686  CB  GLU B 162      41.917  79.671 116.937  1.00  0.87           C  
ATOM   7687  CG  GLU B 162      41.720  80.334 118.320  1.00  0.87           C  
ATOM   7688  CD  GLU B 162      41.665  79.266 119.401  1.00  0.87           C  
ATOM   7689  OE1 GLU B 162      40.758  78.398 119.342  1.00  0.87           O  
ATOM   7690  OE2 GLU B 162      42.562  79.247 120.278  1.00  0.87           O  
ATOM   7691  N   TYR B 163      44.309  80.835 115.069  1.00  0.87           N  
ATOM   7692  CA  TYR B 163      45.592  81.464 114.808  1.00  0.87           C  
ATOM   7693  C   TYR B 163      45.904  81.395 113.316  1.00  0.87           C  
ATOM   7694  O   TYR B 163      45.844  80.325 112.703  1.00  0.87           O  
ATOM   7695  CB  TYR B 163      46.748  80.770 115.592  1.00  0.87           C  
ATOM   7696  CG  TYR B 163      46.381  80.683 117.050  1.00  0.87           C  
ATOM   7697  CD1 TYR B 163      45.823  79.504 117.565  1.00  0.87           C  
ATOM   7698  CD2 TYR B 163      46.451  81.808 117.881  1.00  0.87           C  
ATOM   7699  CE1 TYR B 163      45.271  79.475 118.849  1.00  0.87           C  
ATOM   7700  CE2 TYR B 163      45.877  81.791 119.158  1.00  0.87           C  
ATOM   7701  CZ  TYR B 163      45.264  80.633 119.630  1.00  0.87           C  
ATOM   7702  OH  TYR B 163      44.621  80.641 120.883  1.00  0.87           O  
ATOM   7703  N   GLY B 164      46.244  82.537 112.681  1.00  0.90           N  
ATOM   7704  CA  GLY B 164      46.619  82.599 111.273  1.00  0.90           C  
ATOM   7705  C   GLY B 164      48.094  82.394 111.033  1.00  0.90           C  
ATOM   7706  O   GLY B 164      48.780  81.635 111.718  1.00  0.90           O  
ATOM   7707  N   ILE B 165      48.639  83.059 109.995  1.00  0.83           N  
ATOM   7708  CA  ILE B 165      50.057  83.003 109.672  1.00  0.83           C  
ATOM   7709  C   ILE B 165      50.925  83.767 110.679  1.00  0.83           C  
ATOM   7710  O   ILE B 165      51.027  84.994 110.658  1.00  0.83           O  
ATOM   7711  CB  ILE B 165      50.343  83.385 108.212  1.00  0.83           C  
ATOM   7712  CG1 ILE B 165      51.807  83.122 107.784  1.00  0.83           C  
ATOM   7713  CG2 ILE B 165      49.926  84.836 107.884  1.00  0.83           C  
ATOM   7714  CD1 ILE B 165      52.188  81.639 107.772  1.00  0.83           C  
ATOM   7715  N   PHE B 166      51.597  83.010 111.581  1.00  0.87           N  
ATOM   7716  CA  PHE B 166      52.416  83.423 112.721  1.00  0.87           C  
ATOM   7717  C   PHE B 166      53.029  84.823 112.752  1.00  0.87           C  
ATOM   7718  O   PHE B 166      53.495  85.372 111.753  1.00  0.87           O  
ATOM   7719  CB  PHE B 166      53.521  82.373 113.035  1.00  0.87           C  
ATOM   7720  CG  PHE B 166      54.557  82.287 111.945  1.00  0.87           C  
ATOM   7721  CD1 PHE B 166      54.436  81.350 110.906  1.00  0.87           C  
ATOM   7722  CD2 PHE B 166      55.662  83.156 111.958  1.00  0.87           C  
ATOM   7723  CE1 PHE B 166      55.397  81.293 109.888  1.00  0.87           C  
ATOM   7724  CE2 PHE B 166      56.617  83.110 110.939  1.00  0.87           C  
ATOM   7725  CZ  PHE B 166      56.484  82.174 109.911  1.00  0.87           C  
ATOM   7726  N   ASN B 167      53.086  85.456 113.937  1.00  0.86           N  
ATOM   7727  CA  ASN B 167      53.726  86.750 114.062  1.00  0.86           C  
ATOM   7728  C   ASN B 167      55.236  86.555 114.091  1.00  0.86           C  
ATOM   7729  O   ASN B 167      55.808  85.948 114.991  1.00  0.86           O  
ATOM   7730  CB  ASN B 167      53.220  87.547 115.294  1.00  0.86           C  
ATOM   7731  CG  ASN B 167      51.717  87.851 115.255  1.00  0.86           C  
ATOM   7732  OD1 ASN B 167      51.130  88.166 116.288  1.00  0.86           O  
ATOM   7733  ND2 ASN B 167      51.086  87.777 114.063  1.00  0.86           N  
ATOM   7734  N   GLN B 168      55.920  87.038 113.041  1.00  0.85           N  
ATOM   7735  CA  GLN B 168      57.335  86.804 112.853  1.00  0.85           C  
ATOM   7736  C   GLN B 168      58.146  87.838 113.596  1.00  0.85           C  
ATOM   7737  O   GLN B 168      57.885  89.035 113.487  1.00  0.85           O  
ATOM   7738  CB  GLN B 168      57.676  86.901 111.347  1.00  0.85           C  
ATOM   7739  CG  GLN B 168      59.169  86.730 110.969  1.00  0.85           C  
ATOM   7740  CD  GLN B 168      59.394  87.105 109.504  1.00  0.85           C  
ATOM   7741  OE1 GLN B 168      58.811  88.071 109.006  1.00  0.85           O  
ATOM   7742  NE2 GLN B 168      60.237  86.334 108.787  1.00  0.85           N  
ATOM   7743  N   LYS B 169      59.154  87.386 114.359  1.00  0.85           N  
ATOM   7744  CA  LYS B 169      60.126  88.262 114.968  1.00  0.85           C  
ATOM   7745  C   LYS B 169      61.522  87.821 114.585  1.00  0.85           C  
ATOM   7746  O   LYS B 169      61.804  86.631 114.463  1.00  0.85           O  
ATOM   7747  CB  LYS B 169      60.020  88.242 116.508  1.00  0.85           C  
ATOM   7748  CG  LYS B 169      58.640  88.639 117.061  1.00  0.85           C  
ATOM   7749  CD  LYS B 169      58.203  90.090 116.770  1.00  0.85           C  
ATOM   7750  CE  LYS B 169      56.715  90.367 117.041  1.00  0.85           C  
ATOM   7751  NZ  LYS B 169      56.393  90.181 118.459  1.00  0.85           N  
ATOM   7752  N   ILE B 170      62.445  88.775 114.392  1.00  0.87           N  
ATOM   7753  CA  ILE B 170      63.857  88.485 114.206  1.00  0.87           C  
ATOM   7754  C   ILE B 170      64.576  88.602 115.536  1.00  0.87           C  
ATOM   7755  O   ILE B 170      64.593  89.646 116.186  1.00  0.87           O  
ATOM   7756  CB  ILE B 170      64.502  89.379 113.151  1.00  0.87           C  
ATOM   7757  CG1 ILE B 170      63.954  89.042 111.741  1.00  0.87           C  
ATOM   7758  CG2 ILE B 170      66.043  89.276 113.176  1.00  0.87           C  
ATOM   7759  CD1 ILE B 170      64.346  87.666 111.188  1.00  0.87           C  
ATOM   7760  N   ARG B 171      65.195  87.507 116.009  1.00  0.80           N  
ATOM   7761  CA  ARG B 171      65.991  87.513 117.221  1.00  0.80           C  
ATOM   7762  C   ARG B 171      67.338  86.921 116.881  1.00  0.80           C  
ATOM   7763  O   ARG B 171      67.429  85.863 116.264  1.00  0.80           O  
ATOM   7764  CB  ARG B 171      65.293  86.761 118.383  1.00  0.80           C  
ATOM   7765  CG  ARG B 171      63.926  87.375 118.776  1.00  0.80           C  
ATOM   7766  CD  ARG B 171      64.017  88.806 119.327  1.00  0.80           C  
ATOM   7767  NE  ARG B 171      62.618  89.346 119.455  1.00  0.80           N  
ATOM   7768  CZ  ARG B 171      62.122  90.377 118.751  1.00  0.80           C  
ATOM   7769  NH1 ARG B 171      62.720  90.888 117.680  1.00  0.80           N  
ATOM   7770  NH2 ARG B 171      60.963  90.912 119.132  1.00  0.80           N  
ATOM   7771  N   ASP B 172      68.422  87.673 117.169  1.00  0.86           N  
ATOM   7772  CA  ASP B 172      69.805  87.328 116.866  1.00  0.86           C  
ATOM   7773  C   ASP B 172      70.063  87.067 115.375  1.00  0.86           C  
ATOM   7774  O   ASP B 172      70.978  86.361 114.942  1.00  0.86           O  
ATOM   7775  CB  ASP B 172      70.299  86.225 117.829  1.00  0.86           C  
ATOM   7776  CG  ASP B 172      69.952  86.686 119.236  1.00  0.86           C  
ATOM   7777  OD1 ASP B 172      70.362  87.825 119.578  1.00  0.86           O  
ATOM   7778  OD2 ASP B 172      69.210  85.954 119.933  1.00  0.86           O  
ATOM   7779  N   GLY B 173      69.239  87.712 114.525  1.00  0.91           N  
ATOM   7780  CA  GLY B 173      69.203  87.537 113.082  1.00  0.91           C  
ATOM   7781  C   GLY B 173      68.391  86.363 112.582  1.00  0.91           C  
ATOM   7782  O   GLY B 173      68.338  86.126 111.379  1.00  0.91           O  
ATOM   7783  N   TRP B 174      67.721  85.608 113.470  1.00  0.88           N  
ATOM   7784  CA  TRP B 174      66.982  84.406 113.127  1.00  0.88           C  
ATOM   7785  C   TRP B 174      65.480  84.612 113.265  1.00  0.88           C  
ATOM   7786  O   TRP B 174      65.010  85.337 114.137  1.00  0.88           O  
ATOM   7787  CB  TRP B 174      67.339  83.242 114.086  1.00  0.88           C  
ATOM   7788  CG  TRP B 174      68.798  82.832 114.114  1.00  0.88           C  
ATOM   7789  CD1 TRP B 174      69.772  83.202 115.000  1.00  0.88           C  
ATOM   7790  CD2 TRP B 174      69.379  81.830 113.264  1.00  0.88           C  
ATOM   7791  NE1 TRP B 174      70.930  82.489 114.764  1.00  0.88           N  
ATOM   7792  CE2 TRP B 174      70.703  81.629 113.713  1.00  0.88           C  
ATOM   7793  CE3 TRP B 174      68.857  81.092 112.204  1.00  0.88           C  
ATOM   7794  CZ2 TRP B 174      71.519  80.676 113.119  1.00  0.88           C  
ATOM   7795  CZ3 TRP B 174      69.685  80.137 111.599  1.00  0.88           C  
ATOM   7796  CH2 TRP B 174      70.997  79.927 112.052  1.00  0.88           C  
ATOM   7797  N   GLN B 175      64.675  83.960 112.397  1.00  0.86           N  
ATOM   7798  CA  GLN B 175      63.224  83.925 112.525  1.00  0.86           C  
ATOM   7799  C   GLN B 175      62.721  83.164 113.754  1.00  0.86           C  
ATOM   7800  O   GLN B 175      63.028  81.988 113.944  1.00  0.86           O  
ATOM   7801  CB  GLN B 175      62.569  83.327 111.247  1.00  0.86           C  
ATOM   7802  CG  GLN B 175      61.039  83.082 111.351  1.00  0.86           C  
ATOM   7803  CD  GLN B 175      60.415  82.711 110.002  1.00  0.86           C  
ATOM   7804  OE1 GLN B 175      60.442  83.485 109.041  1.00  0.86           O  
ATOM   7805  NE2 GLN B 175      59.813  81.507 109.915  1.00  0.86           N  
ATOM   7806  N   VAL B 176      61.891  83.840 114.573  1.00  0.84           N  
ATOM   7807  CA  VAL B 176      61.160  83.291 115.701  1.00  0.84           C  
ATOM   7808  C   VAL B 176      59.672  83.443 115.407  1.00  0.84           C  
ATOM   7809  O   VAL B 176      59.224  84.469 114.885  1.00  0.84           O  
ATOM   7810  CB  VAL B 176      61.514  84.009 117.007  1.00  0.84           C  
ATOM   7811  CG1 VAL B 176      60.666  83.506 118.195  1.00  0.84           C  
ATOM   7812  CG2 VAL B 176      63.011  83.790 117.302  1.00  0.84           C  
ATOM   7813  N   GLU B 177      58.877  82.393 115.697  1.00  0.82           N  
ATOM   7814  CA  GLU B 177      57.460  82.335 115.410  1.00  0.82           C  
ATOM   7815  C   GLU B 177      56.572  82.518 116.649  1.00  0.82           C  
ATOM   7816  O   GLU B 177      56.376  81.591 117.432  1.00  0.82           O  
ATOM   7817  CB  GLU B 177      57.141  80.949 114.782  1.00  0.82           C  
ATOM   7818  CG  GLU B 177      57.720  80.736 113.358  1.00  0.82           C  
ATOM   7819  CD  GLU B 177      59.081  80.070 113.215  1.00  0.82           C  
ATOM   7820  OE1 GLU B 177      59.774  79.669 114.177  1.00  0.82           O  
ATOM   7821  OE2 GLU B 177      59.485  79.912 112.032  1.00  0.82           O  
ATOM   7822  N   GLU B 178      55.942  83.704 116.825  1.00  0.81           N  
ATOM   7823  CA  GLU B 178      54.948  83.933 117.869  1.00  0.81           C  
ATOM   7824  C   GLU B 178      53.545  83.565 117.386  1.00  0.81           C  
ATOM   7825  O   GLU B 178      53.212  83.664 116.202  1.00  0.81           O  
ATOM   7826  CB  GLU B 178      54.890  85.412 118.320  1.00  0.81           C  
ATOM   7827  CG  GLU B 178      56.134  85.921 119.083  1.00  0.81           C  
ATOM   7828  CD  GLU B 178      56.048  87.412 119.323  1.00  0.81           C  
ATOM   7829  OE1 GLU B 178      57.059  88.029 119.762  1.00  0.81           O  
ATOM   7830  OE2 GLU B 178      55.007  88.046 118.983  1.00  0.81           O  
ATOM   7831  N   ALA B 179      52.649  83.127 118.294  1.00  0.85           N  
ATOM   7832  CA  ALA B 179      51.275  82.803 117.937  1.00  0.85           C  
ATOM   7833  C   ALA B 179      50.394  84.006 117.549  1.00  0.85           C  
ATOM   7834  O   ALA B 179      50.218  84.944 118.324  1.00  0.85           O  
ATOM   7835  CB  ALA B 179      50.607  82.024 119.087  1.00  0.85           C  
ATOM   7836  N   ASP B 180      49.795  83.965 116.335  1.00  0.86           N  
ATOM   7837  CA  ASP B 180      48.939  84.983 115.740  1.00  0.86           C  
ATOM   7838  C   ASP B 180      47.546  85.056 116.389  1.00  0.86           C  
ATOM   7839  O   ASP B 180      46.550  84.564 115.863  1.00  0.86           O  
ATOM   7840  CB  ASP B 180      48.869  84.657 114.221  1.00  0.86           C  
ATOM   7841  CG  ASP B 180      48.135  85.709 113.407  1.00  0.86           C  
ATOM   7842  OD1 ASP B 180      48.572  86.885 113.452  1.00  0.86           O  
ATOM   7843  OD2 ASP B 180      47.157  85.335 112.713  1.00  0.86           O  
ATOM   7844  N   ASP B 181      47.447  85.642 117.597  1.00  0.84           N  
ATOM   7845  CA  ASP B 181      46.254  85.658 118.429  1.00  0.84           C  
ATOM   7846  C   ASP B 181      45.237  86.732 117.994  1.00  0.84           C  
ATOM   7847  O   ASP B 181      44.833  87.610 118.756  1.00  0.84           O  
ATOM   7848  CB  ASP B 181      46.749  85.831 119.896  1.00  0.84           C  
ATOM   7849  CG  ASP B 181      45.859  85.195 120.944  1.00  0.84           C  
ATOM   7850  OD1 ASP B 181      44.618  85.209 120.837  1.00  0.84           O  
ATOM   7851  OD2 ASP B 181      46.431  84.723 121.967  1.00  0.84           O  
ATOM   7852  N   TRP B 182      44.798  86.689 116.717  1.00  0.87           N  
ATOM   7853  CA  TRP B 182      43.965  87.707 116.090  1.00  0.87           C  
ATOM   7854  C   TRP B 182      42.559  87.830 116.683  1.00  0.87           C  
ATOM   7855  O   TRP B 182      41.964  88.904 116.722  1.00  0.87           O  
ATOM   7856  CB  TRP B 182      43.937  87.542 114.540  1.00  0.87           C  
ATOM   7857  CG  TRP B 182      43.073  86.422 113.971  1.00  0.87           C  
ATOM   7858  CD1 TRP B 182      43.258  85.068 114.023  1.00  0.87           C  
ATOM   7859  CD2 TRP B 182      41.836  86.636 113.263  1.00  0.87           C  
ATOM   7860  NE1 TRP B 182      42.203  84.420 113.412  1.00  0.87           N  
ATOM   7861  CE2 TRP B 182      41.324  85.362 112.935  1.00  0.87           C  
ATOM   7862  CE3 TRP B 182      41.151  87.798 112.910  1.00  0.87           C  
ATOM   7863  CZ2 TRP B 182      40.122  85.229 112.254  1.00  0.87           C  
ATOM   7864  CZ3 TRP B 182      39.937  87.663 112.217  1.00  0.87           C  
ATOM   7865  CH2 TRP B 182      39.429  86.395 111.892  1.00  0.87           C  
ATOM   7866  N   LEU B 183      42.000  86.722 117.213  1.00  0.86           N  
ATOM   7867  CA  LEU B 183      40.672  86.706 117.801  1.00  0.86           C  
ATOM   7868  C   LEU B 183      40.687  86.983 119.300  1.00  0.86           C  
ATOM   7869  O   LEU B 183      39.658  86.869 119.968  1.00  0.86           O  
ATOM   7870  CB  LEU B 183      39.981  85.335 117.578  1.00  0.86           C  
ATOM   7871  CG  LEU B 183      39.638  85.019 116.109  1.00  0.86           C  
ATOM   7872  CD1 LEU B 183      39.119  83.581 115.984  1.00  0.86           C  
ATOM   7873  CD2 LEU B 183      38.607  85.994 115.519  1.00  0.86           C  
ATOM   7874  N   ARG B 184      41.833  87.404 119.881  1.00  0.78           N  
ATOM   7875  CA  ARG B 184      42.019  87.566 121.316  1.00  0.78           C  
ATOM   7876  C   ARG B 184      40.987  88.438 122.015  1.00  0.78           C  
ATOM   7877  O   ARG B 184      40.465  88.071 123.073  1.00  0.78           O  
ATOM   7878  CB  ARG B 184      43.413  88.188 121.581  1.00  0.78           C  
ATOM   7879  CG  ARG B 184      43.741  88.458 123.063  1.00  0.78           C  
ATOM   7880  CD  ARG B 184      45.222  88.760 123.324  1.00  0.78           C  
ATOM   7881  NE  ARG B 184      45.936  87.441 123.318  1.00  0.78           N  
ATOM   7882  CZ  ARG B 184      46.825  87.033 124.233  1.00  0.78           C  
ATOM   7883  NH1 ARG B 184      47.416  87.869 125.073  1.00  0.78           N  
ATOM   7884  NH2 ARG B 184      47.140  85.746 124.267  1.00  0.78           N  
ATOM   7885  N   TYR B 185      40.664  89.596 121.406  1.00  0.82           N  
ATOM   7886  CA  TYR B 185      39.763  90.590 121.955  1.00  0.82           C  
ATOM   7887  C   TYR B 185      38.433  90.636 121.214  1.00  0.82           C  
ATOM   7888  O   TYR B 185      37.582  91.470 121.522  1.00  0.82           O  
ATOM   7889  CB  TYR B 185      40.416  91.999 121.889  1.00  0.82           C  
ATOM   7890  CG  TYR B 185      41.689  92.038 122.696  1.00  0.82           C  
ATOM   7891  CD1 TYR B 185      42.922  92.301 122.073  1.00  0.82           C  
ATOM   7892  CD2 TYR B 185      41.666  91.802 124.083  1.00  0.82           C  
ATOM   7893  CE1 TYR B 185      44.107  92.324 122.822  1.00  0.82           C  
ATOM   7894  CE2 TYR B 185      42.851  91.831 124.835  1.00  0.82           C  
ATOM   7895  CZ  TYR B 185      44.069  92.094 124.201  1.00  0.82           C  
ATOM   7896  OH  TYR B 185      45.265  92.111 124.942  1.00  0.82           O  
ATOM   7897  N   GLY B 186      38.203  89.710 120.256  1.00  0.85           N  
ATOM   7898  CA  GLY B 186      36.985  89.665 119.449  1.00  0.85           C  
ATOM   7899  C   GLY B 186      37.080  90.343 118.100  1.00  0.85           C  
ATOM   7900  O   GLY B 186      37.839  91.281 117.882  1.00  0.85           O  
ATOM   7901  N   ASN B 187      36.260  89.866 117.145  1.00  0.88           N  
ATOM   7902  CA  ASN B 187      36.210  90.327 115.772  1.00  0.88           C  
ATOM   7903  C   ASN B 187      34.840  90.990 115.577  1.00  0.88           C  
ATOM   7904  O   ASN B 187      33.841  90.356 115.914  1.00  0.88           O  
ATOM   7905  CB  ASN B 187      36.375  89.079 114.854  1.00  0.88           C  
ATOM   7906  CG  ASN B 187      36.312  89.363 113.356  1.00  0.88           C  
ATOM   7907  OD1 ASN B 187      36.283  90.505 112.894  1.00  0.88           O  
ATOM   7908  ND2 ASN B 187      36.265  88.280 112.546  1.00  0.88           N  
ATOM   7909  N   PRO B 188      34.687  92.217 115.075  1.00  0.90           N  
ATOM   7910  CA  PRO B 188      33.379  92.867 115.051  1.00  0.90           C  
ATOM   7911  C   PRO B 188      32.665  92.573 113.745  1.00  0.90           C  
ATOM   7912  O   PRO B 188      31.442  92.704 113.680  1.00  0.90           O  
ATOM   7913  CB  PRO B 188      33.732  94.361 115.171  1.00  0.90           C  
ATOM   7914  CG  PRO B 188      35.111  94.491 114.512  1.00  0.90           C  
ATOM   7915  CD  PRO B 188      35.789  93.162 114.851  1.00  0.90           C  
ATOM   7916  N   TRP B 189      33.421  92.240 112.681  1.00  0.87           N  
ATOM   7917  CA  TRP B 189      32.922  92.040 111.335  1.00  0.87           C  
ATOM   7918  C   TRP B 189      32.096  90.781 111.160  1.00  0.87           C  
ATOM   7919  O   TRP B 189      31.064  90.788 110.493  1.00  0.87           O  
ATOM   7920  CB  TRP B 189      34.105  92.008 110.332  1.00  0.87           C  
ATOM   7921  CG  TRP B 189      35.007  93.224 110.424  1.00  0.87           C  
ATOM   7922  CD1 TRP B 189      36.313  93.296 110.825  1.00  0.87           C  
ATOM   7923  CD2 TRP B 189      34.596  94.572 110.133  1.00  0.87           C  
ATOM   7924  NE1 TRP B 189      36.747  94.603 110.804  1.00  0.87           N  
ATOM   7925  CE2 TRP B 189      35.695  95.406 110.427  1.00  0.87           C  
ATOM   7926  CE3 TRP B 189      33.399  95.102 109.651  1.00  0.87           C  
ATOM   7927  CZ2 TRP B 189      35.602  96.780 110.284  1.00  0.87           C  
ATOM   7928  CZ3 TRP B 189      33.325  96.491 109.465  1.00  0.87           C  
ATOM   7929  CH2 TRP B 189      34.404  97.321 109.795  1.00  0.87           C  
ATOM   7930  N   GLU B 190      32.561  89.664 111.749  1.00  0.88           N  
ATOM   7931  CA  GLU B 190      31.901  88.378 111.689  1.00  0.88           C  
ATOM   7932  C   GLU B 190      30.567  88.315 112.427  1.00  0.88           C  
ATOM   7933  O   GLU B 190      30.353  88.930 113.472  1.00  0.88           O  
ATOM   7934  CB  GLU B 190      32.841  87.244 112.176  1.00  0.88           C  
ATOM   7935  CG  GLU B 190      33.128  87.251 113.702  1.00  0.88           C  
ATOM   7936  CD  GLU B 190      34.212  86.276 114.140  1.00  0.88           C  
ATOM   7937  OE1 GLU B 190      34.981  85.754 113.292  1.00  0.88           O  
ATOM   7938  OE2 GLU B 190      34.329  86.040 115.368  1.00  0.88           O  
ATOM   7939  N   LYS B 191      29.618  87.530 111.895  1.00  0.83           N  
ATOM   7940  CA  LYS B 191      28.409  87.182 112.601  1.00  0.83           C  
ATOM   7941  C   LYS B 191      28.288  85.674 112.655  1.00  0.83           C  
ATOM   7942  O   LYS B 191      28.199  84.986 111.640  1.00  0.83           O  
ATOM   7943  CB  LYS B 191      27.154  87.796 111.928  1.00  0.83           C  
ATOM   7944  CG  LYS B 191      25.798  87.375 112.535  1.00  0.83           C  
ATOM   7945  CD  LYS B 191      25.633  87.735 114.024  1.00  0.83           C  
ATOM   7946  CE  LYS B 191      24.260  87.368 114.604  1.00  0.83           C  
ATOM   7947  NZ  LYS B 191      24.115  85.913 114.826  1.00  0.83           N  
ATOM   7948  N   SER B 192      28.259  85.110 113.878  1.00  0.87           N  
ATOM   7949  CA  SER B 192      27.985  83.702 114.118  1.00  0.87           C  
ATOM   7950  C   SER B 192      26.631  83.257 113.591  1.00  0.87           C  
ATOM   7951  O   SER B 192      25.645  84.001 113.635  1.00  0.87           O  
ATOM   7952  CB  SER B 192      28.057  83.343 115.630  1.00  0.87           C  
ATOM   7953  OG  SER B 192      27.133  84.118 116.407  1.00  0.87           O  
ATOM   7954  N   ARG B 193      26.543  82.021 113.072  1.00  0.83           N  
ATOM   7955  CA  ARG B 193      25.308  81.480 112.542  1.00  0.83           C  
ATOM   7956  C   ARG B 193      24.918  80.199 113.270  1.00  0.83           C  
ATOM   7957  O   ARG B 193      25.296  79.104 112.845  1.00  0.83           O  
ATOM   7958  CB  ARG B 193      25.493  81.176 111.039  1.00  0.83           C  
ATOM   7959  CG  ARG B 193      25.853  82.402 110.180  1.00  0.83           C  
ATOM   7960  CD  ARG B 193      24.878  83.578 110.265  1.00  0.83           C  
ATOM   7961  NE  ARG B 193      23.514  83.084 109.877  1.00  0.83           N  
ATOM   7962  CZ  ARG B 193      22.828  83.580 108.842  1.00  0.83           C  
ATOM   7963  NH1 ARG B 193      23.414  84.249 107.855  1.00  0.83           N  
ATOM   7964  NH2 ARG B 193      21.516  83.381 108.787  1.00  0.83           N  
ATOM   7965  N   PRO B 194      24.143  80.263 114.360  1.00  0.78           N  
ATOM   7966  CA  PRO B 194      23.701  79.080 115.089  1.00  0.78           C  
ATOM   7967  C   PRO B 194      22.785  78.184 114.288  1.00  0.78           C  
ATOM   7968  O   PRO B 194      22.711  76.995 114.588  1.00  0.78           O  
ATOM   7969  CB  PRO B 194      22.963  79.646 116.319  1.00  0.78           C  
ATOM   7970  CG  PRO B 194      23.583  81.027 116.524  1.00  0.78           C  
ATOM   7971  CD  PRO B 194      23.812  81.491 115.088  1.00  0.78           C  
ATOM   7972  N   GLU B 195      22.041  78.734 113.307  1.00  0.78           N  
ATOM   7973  CA  GLU B 195      21.009  78.004 112.601  1.00  0.78           C  
ATOM   7974  C   GLU B 195      21.553  77.140 111.475  1.00  0.78           C  
ATOM   7975  O   GLU B 195      20.885  76.240 110.969  1.00  0.78           O  
ATOM   7976  CB  GLU B 195      19.921  78.972 112.060  1.00  0.78           C  
ATOM   7977  CG  GLU B 195      20.292  79.866 110.842  1.00  0.78           C  
ATOM   7978  CD  GLU B 195      21.043  81.150 111.158  1.00  0.78           C  
ATOM   7979  OE1 GLU B 195      20.455  82.239 110.905  1.00  0.78           O  
ATOM   7980  OE2 GLU B 195      22.229  81.121 111.570  1.00  0.78           O  
ATOM   7981  N   PHE B 196      22.815  77.375 111.072  1.00  0.81           N  
ATOM   7982  CA  PHE B 196      23.420  76.691 109.949  1.00  0.81           C  
ATOM   7983  C   PHE B 196      24.533  75.750 110.377  1.00  0.81           C  
ATOM   7984  O   PHE B 196      25.302  75.270 109.543  1.00  0.81           O  
ATOM   7985  CB  PHE B 196      23.943  77.714 108.904  1.00  0.81           C  
ATOM   7986  CG  PHE B 196      22.818  78.360 108.134  1.00  0.81           C  
ATOM   7987  CD1 PHE B 196      21.816  77.589 107.516  1.00  0.81           C  
ATOM   7988  CD2 PHE B 196      22.782  79.755 107.978  1.00  0.81           C  
ATOM   7989  CE1 PHE B 196      20.799  78.194 106.769  1.00  0.81           C  
ATOM   7990  CE2 PHE B 196      21.786  80.361 107.202  1.00  0.81           C  
ATOM   7991  CZ  PHE B 196      20.787  79.582 106.606  1.00  0.81           C  
ATOM   7992  N   MET B 197      24.610  75.408 111.676  1.00  0.84           N  
ATOM   7993  CA  MET B 197      25.528  74.415 112.217  1.00  0.84           C  
ATOM   7994  C   MET B 197      25.374  73.025 111.572  1.00  0.84           C  
ATOM   7995  O   MET B 197      24.287  72.655 111.120  1.00  0.84           O  
ATOM   7996  CB  MET B 197      25.370  74.361 113.760  1.00  0.84           C  
ATOM   7997  CG  MET B 197      26.589  73.821 114.534  1.00  0.84           C  
ATOM   7998  SD  MET B 197      26.348  73.844 116.339  1.00  0.84           S  
ATOM   7999  CE  MET B 197      28.108  73.912 116.780  1.00  0.84           C  
ATOM   8000  N   LEU B 198      26.472  72.245 111.451  1.00  0.91           N  
ATOM   8001  CA  LEU B 198      26.458  70.965 110.749  1.00  0.91           C  
ATOM   8002  C   LEU B 198      27.395  69.948 111.396  1.00  0.91           C  
ATOM   8003  O   LEU B 198      28.411  70.347 111.966  1.00  0.91           O  
ATOM   8004  CB  LEU B 198      26.950  71.121 109.287  1.00  0.91           C  
ATOM   8005  CG  LEU B 198      25.920  71.733 108.326  1.00  0.91           C  
ATOM   8006  CD1 LEU B 198      26.628  72.156 107.039  1.00  0.91           C  
ATOM   8007  CD2 LEU B 198      24.779  70.752 108.017  1.00  0.91           C  
ATOM   8008  N   PRO B 199      27.131  68.642 111.348  1.00  0.93           N  
ATOM   8009  CA  PRO B 199      28.104  67.622 111.715  1.00  0.93           C  
ATOM   8010  C   PRO B 199      29.096  67.308 110.596  1.00  0.93           C  
ATOM   8011  O   PRO B 199      28.747  67.299 109.416  1.00  0.93           O  
ATOM   8012  CB  PRO B 199      27.212  66.407 112.014  1.00  0.93           C  
ATOM   8013  CG  PRO B 199      26.055  66.538 111.017  1.00  0.93           C  
ATOM   8014  CD  PRO B 199      25.860  68.054 110.907  1.00  0.93           C  
ATOM   8015  N   VAL B 200      30.357  67.025 110.961  1.00  0.93           N  
ATOM   8016  CA  VAL B 200      31.380  66.463 110.098  1.00  0.93           C  
ATOM   8017  C   VAL B 200      31.810  65.147 110.732  1.00  0.93           C  
ATOM   8018  O   VAL B 200      31.911  65.036 111.952  1.00  0.93           O  
ATOM   8019  CB  VAL B 200      32.581  67.394 109.933  1.00  0.93           C  
ATOM   8020  CG1 VAL B 200      33.676  66.746 109.061  1.00  0.93           C  
ATOM   8021  CG2 VAL B 200      32.105  68.712 109.287  1.00  0.93           C  
ATOM   8022  N   HIS B 201      32.047  64.099 109.916  1.00  0.91           N  
ATOM   8023  CA  HIS B 201      32.323  62.749 110.380  1.00  0.91           C  
ATOM   8024  C   HIS B 201      33.747  62.338 110.059  1.00  0.91           C  
ATOM   8025  O   HIS B 201      34.232  62.560 108.955  1.00  0.91           O  
ATOM   8026  CB  HIS B 201      31.395  61.735 109.676  1.00  0.91           C  
ATOM   8027  CG  HIS B 201      29.965  61.910 110.074  1.00  0.91           C  
ATOM   8028  ND1 HIS B 201      29.470  61.168 111.128  1.00  0.91           N  
ATOM   8029  CD2 HIS B 201      29.007  62.745 109.593  1.00  0.91           C  
ATOM   8030  CE1 HIS B 201      28.220  61.563 111.269  1.00  0.91           C  
ATOM   8031  NE2 HIS B 201      27.888  62.518 110.366  1.00  0.91           N  
ATOM   8032  N   PHE B 202      34.447  61.716 111.022  1.00  0.92           N  
ATOM   8033  CA  PHE B 202      35.812  61.253 110.849  1.00  0.92           C  
ATOM   8034  C   PHE B 202      35.955  59.832 111.359  1.00  0.92           C  
ATOM   8035  O   PHE B 202      35.174  59.371 112.194  1.00  0.92           O  
ATOM   8036  CB  PHE B 202      36.805  62.112 111.675  1.00  0.92           C  
ATOM   8037  CG  PHE B 202      36.922  63.495 111.111  1.00  0.92           C  
ATOM   8038  CD1 PHE B 202      37.724  63.719 109.983  1.00  0.92           C  
ATOM   8039  CD2 PHE B 202      36.264  64.584 111.709  1.00  0.92           C  
ATOM   8040  CE1 PHE B 202      37.892  65.011 109.476  1.00  0.92           C  
ATOM   8041  CE2 PHE B 202      36.426  65.879 111.200  1.00  0.92           C  
ATOM   8042  CZ  PHE B 202      37.245  66.093 110.084  1.00  0.92           C  
ATOM   8043  N   TYR B 203      37.001  59.120 110.885  1.00  0.90           N  
ATOM   8044  CA  TYR B 203      37.331  57.751 111.251  1.00  0.90           C  
ATOM   8045  C   TYR B 203      36.224  56.762 110.912  1.00  0.90           C  
ATOM   8046  O   TYR B 203      35.707  56.759 109.799  1.00  0.90           O  
ATOM   8047  CB  TYR B 203      37.816  57.619 112.725  1.00  0.90           C  
ATOM   8048  CG  TYR B 203      39.003  58.503 112.995  1.00  0.90           C  
ATOM   8049  CD1 TYR B 203      38.910  59.585 113.885  1.00  0.90           C  
ATOM   8050  CD2 TYR B 203      40.243  58.223 112.403  1.00  0.90           C  
ATOM   8051  CE1 TYR B 203      40.045  60.342 114.214  1.00  0.90           C  
ATOM   8052  CE2 TYR B 203      41.369  59.003 112.696  1.00  0.90           C  
ATOM   8053  CZ  TYR B 203      41.277  60.037 113.626  1.00  0.90           C  
ATOM   8054  OH  TYR B 203      42.437  60.748 113.988  1.00  0.90           O  
ATOM   8055  N   GLY B 204      35.836  55.877 111.853  1.00  0.91           N  
ATOM   8056  CA  GLY B 204      34.861  54.824 111.596  1.00  0.91           C  
ATOM   8057  C   GLY B 204      35.258  53.789 110.573  1.00  0.91           C  
ATOM   8058  O   GLY B 204      36.422  53.631 110.214  1.00  0.91           O  
ATOM   8059  N   LYS B 205      34.275  53.006 110.108  1.00  0.85           N  
ATOM   8060  CA  LYS B 205      34.489  51.949 109.143  1.00  0.85           C  
ATOM   8061  C   LYS B 205      33.334  51.878 108.171  1.00  0.85           C  
ATOM   8062  O   LYS B 205      32.254  52.426 108.383  1.00  0.85           O  
ATOM   8063  CB  LYS B 205      34.689  50.568 109.821  1.00  0.85           C  
ATOM   8064  CG  LYS B 205      36.148  50.335 110.240  1.00  0.85           C  
ATOM   8065  CD  LYS B 205      36.345  49.010 110.987  1.00  0.85           C  
ATOM   8066  CE  LYS B 205      37.816  48.746 111.310  1.00  0.85           C  
ATOM   8067  NZ  LYS B 205      37.938  47.517 112.122  1.00  0.85           N  
ATOM   8068  N   VAL B 206      33.559  51.202 107.033  1.00  0.88           N  
ATOM   8069  CA  VAL B 206      32.554  51.021 106.008  1.00  0.88           C  
ATOM   8070  C   VAL B 206      31.782  49.744 106.266  1.00  0.88           C  
ATOM   8071  O   VAL B 206      32.348  48.694 106.571  1.00  0.88           O  
ATOM   8072  CB  VAL B 206      33.173  51.010 104.616  1.00  0.88           C  
ATOM   8073  CG1 VAL B 206      32.113  50.771 103.529  1.00  0.88           C  
ATOM   8074  CG2 VAL B 206      33.832  52.379 104.371  1.00  0.88           C  
ATOM   8075  N   GLU B 207      30.448  49.818 106.145  1.00  0.84           N  
ATOM   8076  CA  GLU B 207      29.566  48.679 106.225  1.00  0.84           C  
ATOM   8077  C   GLU B 207      28.991  48.499 104.833  1.00  0.84           C  
ATOM   8078  O   GLU B 207      28.514  49.450 104.221  1.00  0.84           O  
ATOM   8079  CB  GLU B 207      28.414  48.955 107.224  1.00  0.84           C  
ATOM   8080  CG  GLU B 207      27.384  47.806 107.397  1.00  0.84           C  
ATOM   8081  CD  GLU B 207      25.948  48.336 107.388  1.00  0.84           C  
ATOM   8082  OE1 GLU B 207      25.390  48.404 106.260  1.00  0.84           O  
ATOM   8083  OE2 GLU B 207      25.349  48.703 108.426  1.00  0.84           O  
ATOM   8084  N   HIS B 208      29.038  47.275 104.278  1.00  0.84           N  
ATOM   8085  CA  HIS B 208      28.391  46.973 103.014  1.00  0.84           C  
ATOM   8086  C   HIS B 208      27.285  45.980 103.288  1.00  0.84           C  
ATOM   8087  O   HIS B 208      27.543  44.818 103.593  1.00  0.84           O  
ATOM   8088  CB  HIS B 208      29.367  46.349 101.989  1.00  0.84           C  
ATOM   8089  CG  HIS B 208      30.383  47.320 101.478  1.00  0.84           C  
ATOM   8090  ND1 HIS B 208      29.989  48.271 100.554  1.00  0.84           N  
ATOM   8091  CD2 HIS B 208      31.708  47.444 101.755  1.00  0.84           C  
ATOM   8092  CE1 HIS B 208      31.091  48.952 100.287  1.00  0.84           C  
ATOM   8093  NE2 HIS B 208      32.151  48.495 100.986  1.00  0.84           N  
ATOM   8094  N   THR B 209      26.014  46.412 103.188  1.00  0.76           N  
ATOM   8095  CA  THR B 209      24.859  45.542 103.394  1.00  0.76           C  
ATOM   8096  C   THR B 209      23.937  45.625 102.204  1.00  0.76           C  
ATOM   8097  O   THR B 209      24.149  46.348 101.236  1.00  0.76           O  
ATOM   8098  CB  THR B 209      24.030  45.801 104.660  1.00  0.76           C  
ATOM   8099  OG1 THR B 209      23.653  47.166 104.791  1.00  0.76           O  
ATOM   8100  CG2 THR B 209      24.824  45.377 105.901  1.00  0.76           C  
ATOM   8101  N   ASN B 210      22.834  44.862 102.269  1.00  0.69           N  
ATOM   8102  CA  ASN B 210      21.742  44.826 101.315  1.00  0.69           C  
ATOM   8103  C   ASN B 210      20.937  46.127 101.269  1.00  0.69           C  
ATOM   8104  O   ASN B 210      20.163  46.365 100.350  1.00  0.69           O  
ATOM   8105  CB  ASN B 210      20.831  43.593 101.606  1.00  0.69           C  
ATOM   8106  CG  ASN B 210      20.431  43.454 103.079  1.00  0.69           C  
ATOM   8107  OD1 ASN B 210      20.682  44.304 103.932  1.00  0.69           O  
ATOM   8108  ND2 ASN B 210      19.818  42.296 103.415  1.00  0.69           N  
ATOM   8109  N   THR B 211      21.161  47.028 102.247  1.00  0.69           N  
ATOM   8110  CA  THR B 211      20.606  48.382 102.275  1.00  0.69           C  
ATOM   8111  C   THR B 211      21.559  49.392 101.650  1.00  0.69           C  
ATOM   8112  O   THR B 211      21.322  50.603 101.645  1.00  0.69           O  
ATOM   8113  CB  THR B 211      20.235  48.840 103.683  1.00  0.69           C  
ATOM   8114  OG1 THR B 211      21.322  48.829 104.607  1.00  0.69           O  
ATOM   8115  CG2 THR B 211      19.156  47.899 104.233  1.00  0.69           C  
ATOM   8116  N   GLY B 212      22.655  48.886 101.048  1.00  0.75           N  
ATOM   8117  CA  GLY B 212      23.706  49.652 100.403  1.00  0.75           C  
ATOM   8118  C   GLY B 212      24.874  49.915 101.309  1.00  0.75           C  
ATOM   8119  O   GLY B 212      24.865  49.602 102.496  1.00  0.75           O  
ATOM   8120  N   THR B 213      25.945  50.499 100.743  1.00  0.87           N  
ATOM   8121  CA  THR B 213      27.114  50.949 101.490  1.00  0.87           C  
ATOM   8122  C   THR B 213      26.796  52.034 102.507  1.00  0.87           C  
ATOM   8123  O   THR B 213      26.026  52.959 102.247  1.00  0.87           O  
ATOM   8124  CB  THR B 213      28.240  51.438 100.587  1.00  0.87           C  
ATOM   8125  OG1 THR B 213      28.459  50.509  99.534  1.00  0.87           O  
ATOM   8126  CG2 THR B 213      29.561  51.569 101.354  1.00  0.87           C  
ATOM   8127  N   LYS B 214      27.396  51.937 103.704  1.00  0.84           N  
ATOM   8128  CA  LYS B 214      27.285  52.918 104.758  1.00  0.84           C  
ATOM   8129  C   LYS B 214      28.650  53.185 105.347  1.00  0.84           C  
ATOM   8130  O   LYS B 214      29.610  52.443 105.162  1.00  0.84           O  
ATOM   8131  CB  LYS B 214      26.419  52.429 105.943  1.00  0.84           C  
ATOM   8132  CG  LYS B 214      24.943  52.191 105.626  1.00  0.84           C  
ATOM   8133  CD  LYS B 214      24.255  51.533 106.834  1.00  0.84           C  
ATOM   8134  CE  LYS B 214      23.047  50.686 106.423  1.00  0.84           C  
ATOM   8135  NZ  LYS B 214      23.097  49.344 107.034  1.00  0.84           N  
ATOM   8136  N   TRP B 215      28.744  54.271 106.125  1.00  0.83           N  
ATOM   8137  CA  TRP B 215      29.908  54.623 106.897  1.00  0.83           C  
ATOM   8138  C   TRP B 215      29.424  54.718 108.336  1.00  0.83           C  
ATOM   8139  O   TRP B 215      28.469  55.439 108.621  1.00  0.83           O  
ATOM   8140  CB  TRP B 215      30.447  55.969 106.359  1.00  0.83           C  
ATOM   8141  CG  TRP B 215      31.759  56.494 106.911  1.00  0.83           C  
ATOM   8142  CD1 TRP B 215      32.736  55.888 107.653  1.00  0.83           C  
ATOM   8143  CD2 TRP B 215      32.196  57.840 106.677  1.00  0.83           C  
ATOM   8144  NE1 TRP B 215      33.762  56.775 107.883  1.00  0.83           N  
ATOM   8145  CE2 TRP B 215      33.456  57.979 107.304  1.00  0.83           C  
ATOM   8146  CE3 TRP B 215      31.608  58.906 106.002  1.00  0.83           C  
ATOM   8147  CZ2 TRP B 215      34.139  59.184 107.270  1.00  0.83           C  
ATOM   8148  CZ3 TRP B 215      32.298  60.124 105.972  1.00  0.83           C  
ATOM   8149  CH2 TRP B 215      33.550  60.262 106.594  1.00  0.83           C  
ATOM   8150  N   ILE B 216      30.024  53.939 109.253  1.00  0.87           N  
ATOM   8151  CA  ILE B 216      29.541  53.756 110.614  1.00  0.87           C  
ATOM   8152  C   ILE B 216      30.702  53.903 111.581  1.00  0.87           C  
ATOM   8153  O   ILE B 216      31.852  54.023 111.165  1.00  0.87           O  
ATOM   8154  CB  ILE B 216      28.828  52.417 110.841  1.00  0.87           C  
ATOM   8155  CG1 ILE B 216      29.712  51.200 110.476  1.00  0.87           C  
ATOM   8156  CG2 ILE B 216      27.501  52.424 110.046  1.00  0.87           C  
ATOM   8157  CD1 ILE B 216      29.113  49.870 110.952  1.00  0.87           C  
ATOM   8158  N   ASP B 217      30.409  53.963 112.899  1.00  0.80           N  
ATOM   8159  CA  ASP B 217      31.363  54.063 113.998  1.00  0.80           C  
ATOM   8160  C   ASP B 217      32.210  55.338 113.992  1.00  0.80           C  
ATOM   8161  O   ASP B 217      33.338  55.399 114.483  1.00  0.80           O  
ATOM   8162  CB  ASP B 217      32.224  52.778 114.112  1.00  0.80           C  
ATOM   8163  CG  ASP B 217      31.347  51.542 114.233  1.00  0.80           C  
ATOM   8164  OD1 ASP B 217      30.165  51.682 114.645  1.00  0.80           O  
ATOM   8165  OD2 ASP B 217      31.867  50.445 113.907  1.00  0.80           O  
ATOM   8166  N   THR B 218      31.654  56.430 113.444  1.00  0.83           N  
ATOM   8167  CA  THR B 218      32.347  57.691 113.240  1.00  0.83           C  
ATOM   8168  C   THR B 218      32.530  58.523 114.496  1.00  0.83           C  
ATOM   8169  O   THR B 218      31.761  58.472 115.462  1.00  0.83           O  
ATOM   8170  CB  THR B 218      31.684  58.570 112.184  1.00  0.83           C  
ATOM   8171  OG1 THR B 218      30.312  58.796 112.489  1.00  0.83           O  
ATOM   8172  CG2 THR B 218      31.748  57.852 110.827  1.00  0.83           C  
ATOM   8173  N   GLN B 219      33.581  59.366 114.504  1.00  0.81           N  
ATOM   8174  CA  GLN B 219      33.710  60.469 115.433  1.00  0.81           C  
ATOM   8175  C   GLN B 219      33.122  61.706 114.784  1.00  0.81           C  
ATOM   8176  O   GLN B 219      33.428  62.028 113.640  1.00  0.81           O  
ATOM   8177  CB  GLN B 219      35.177  60.757 115.837  1.00  0.81           C  
ATOM   8178  CG  GLN B 219      35.790  59.630 116.701  1.00  0.81           C  
ATOM   8179  CD  GLN B 219      37.171  59.993 117.250  1.00  0.81           C  
ATOM   8180  OE1 GLN B 219      38.182  59.383 116.913  1.00  0.81           O  
ATOM   8181  NE2 GLN B 219      37.227  61.006 118.143  1.00  0.81           N  
ATOM   8182  N   VAL B 220      32.244  62.419 115.510  1.00  0.87           N  
ATOM   8183  CA  VAL B 220      31.545  63.578 114.990  1.00  0.87           C  
ATOM   8184  C   VAL B 220      32.191  64.835 115.539  1.00  0.87           C  
ATOM   8185  O   VAL B 220      32.458  64.946 116.735  1.00  0.87           O  
ATOM   8186  CB  VAL B 220      30.058  63.554 115.346  1.00  0.87           C  
ATOM   8187  CG1 VAL B 220      29.329  64.805 114.808  1.00  0.87           C  
ATOM   8188  CG2 VAL B 220      29.423  62.287 114.739  1.00  0.87           C  
ATOM   8189  N   VAL B 221      32.461  65.814 114.661  1.00  0.89           N  
ATOM   8190  CA  VAL B 221      32.919  67.145 115.017  1.00  0.89           C  
ATOM   8191  C   VAL B 221      31.868  68.090 114.477  1.00  0.89           C  
ATOM   8192  O   VAL B 221      31.379  67.909 113.365  1.00  0.89           O  
ATOM   8193  CB  VAL B 221      34.285  67.476 114.416  1.00  0.89           C  
ATOM   8194  CG1 VAL B 221      34.718  68.913 114.774  1.00  0.89           C  
ATOM   8195  CG2 VAL B 221      35.322  66.464 114.945  1.00  0.89           C  
ATOM   8196  N   LEU B 222      31.443  69.114 115.240  1.00  0.87           N  
ATOM   8197  CA  LEU B 222      30.459  70.059 114.753  1.00  0.87           C  
ATOM   8198  C   LEU B 222      31.134  71.253 114.107  1.00  0.87           C  
ATOM   8199  O   LEU B 222      32.129  71.783 114.601  1.00  0.87           O  
ATOM   8200  CB  LEU B 222      29.518  70.576 115.865  1.00  0.87           C  
ATOM   8201  CG  LEU B 222      28.689  69.491 116.578  1.00  0.87           C  
ATOM   8202  CD1 LEU B 222      27.823  70.139 117.668  1.00  0.87           C  
ATOM   8203  CD2 LEU B 222      27.802  68.692 115.610  1.00  0.87           C  
ATOM   8204  N   ALA B 223      30.580  71.709 112.975  1.00  0.94           N  
ATOM   8205  CA  ALA B 223      31.045  72.858 112.245  1.00  0.94           C  
ATOM   8206  C   ALA B 223      30.079  74.015 112.453  1.00  0.94           C  
ATOM   8207  O   ALA B 223      28.905  73.954 112.086  1.00  0.94           O  
ATOM   8208  CB  ALA B 223      31.153  72.506 110.748  1.00  0.94           C  
ATOM   8209  N   LEU B 224      30.563  75.107 113.071  1.00  0.91           N  
ATOM   8210  CA  LEU B 224      29.793  76.296 113.377  1.00  0.91           C  
ATOM   8211  C   LEU B 224      30.167  77.398 112.387  1.00  0.91           C  
ATOM   8212  O   LEU B 224      31.320  77.838 112.400  1.00  0.91           O  
ATOM   8213  CB  LEU B 224      30.112  76.750 114.823  1.00  0.91           C  
ATOM   8214  CG  LEU B 224      29.330  77.971 115.358  1.00  0.91           C  
ATOM   8215  CD1 LEU B 224      27.806  77.776 115.321  1.00  0.91           C  
ATOM   8216  CD2 LEU B 224      29.776  78.276 116.797  1.00  0.91           C  
ATOM   8217  N   PRO B 225      29.299  77.855 111.487  1.00  0.96           N  
ATOM   8218  CA  PRO B 225      29.654  78.868 110.509  1.00  0.96           C  
ATOM   8219  C   PRO B 225      29.598  80.271 111.074  1.00  0.96           C  
ATOM   8220  O   PRO B 225      28.755  80.597 111.911  1.00  0.96           O  
ATOM   8221  CB  PRO B 225      28.648  78.678 109.363  1.00  0.96           C  
ATOM   8222  CG  PRO B 225      27.444  77.953 109.972  1.00  0.96           C  
ATOM   8223  CD  PRO B 225      27.968  77.297 111.252  1.00  0.96           C  
ATOM   8224  N   TYR B 226      30.523  81.120 110.609  1.00  0.93           N  
ATOM   8225  CA  TYR B 226      30.544  82.537 110.870  1.00  0.93           C  
ATOM   8226  C   TYR B 226      30.518  83.224 109.517  1.00  0.93           C  
ATOM   8227  O   TYR B 226      31.326  82.913 108.643  1.00  0.93           O  
ATOM   8228  CB  TYR B 226      31.836  82.965 111.619  1.00  0.93           C  
ATOM   8229  CG  TYR B 226      31.826  82.556 113.072  1.00  0.93           C  
ATOM   8230  CD1 TYR B 226      31.789  83.544 114.071  1.00  0.93           C  
ATOM   8231  CD2 TYR B 226      31.923  81.208 113.465  1.00  0.93           C  
ATOM   8232  CE1 TYR B 226      31.844  83.196 115.428  1.00  0.93           C  
ATOM   8233  CE2 TYR B 226      31.950  80.855 114.822  1.00  0.93           C  
ATOM   8234  CZ  TYR B 226      31.915  81.852 115.802  1.00  0.93           C  
ATOM   8235  OH  TYR B 226      31.964  81.508 117.166  1.00  0.93           O  
ATOM   8236  N   ASP B 227      29.577  84.166 109.319  1.00  0.92           N  
ATOM   8237  CA  ASP B 227      29.418  84.908 108.085  1.00  0.92           C  
ATOM   8238  C   ASP B 227      30.085  86.273 108.227  1.00  0.92           C  
ATOM   8239  O   ASP B 227      29.803  87.032 109.153  1.00  0.92           O  
ATOM   8240  CB  ASP B 227      27.912  85.127 107.757  1.00  0.92           C  
ATOM   8241  CG  ASP B 227      27.220  83.877 107.258  1.00  0.92           C  
ATOM   8242  OD1 ASP B 227      25.958  83.862 107.249  1.00  0.92           O  
ATOM   8243  OD2 ASP B 227      27.882  82.897 106.842  1.00  0.92           O  
ATOM   8244  N   THR B 228      30.984  86.621 107.291  1.00  0.94           N  
ATOM   8245  CA  THR B 228      31.708  87.890 107.264  1.00  0.94           C  
ATOM   8246  C   THR B 228      31.309  88.622 105.992  1.00  0.94           C  
ATOM   8247  O   THR B 228      31.329  88.001 104.924  1.00  0.94           O  
ATOM   8248  CB  THR B 228      33.222  87.690 107.257  1.00  0.94           C  
ATOM   8249  OG1 THR B 228      33.631  87.126 108.495  1.00  0.94           O  
ATOM   8250  CG2 THR B 228      34.006  89.006 107.119  1.00  0.94           C  
ATOM   8251  N   PRO B 229      30.916  89.897 106.006  1.00  0.95           N  
ATOM   8252  CA  PRO B 229      30.430  90.585 104.815  1.00  0.95           C  
ATOM   8253  C   PRO B 229      31.547  90.970 103.857  1.00  0.95           C  
ATOM   8254  O   PRO B 229      32.633  91.359 104.282  1.00  0.95           O  
ATOM   8255  CB  PRO B 229      29.747  91.839 105.389  1.00  0.95           C  
ATOM   8256  CG  PRO B 229      30.537  92.147 106.662  1.00  0.95           C  
ATOM   8257  CD  PRO B 229      30.859  90.754 107.197  1.00  0.95           C  
ATOM   8258  N   VAL B 230      31.292  90.874 102.541  1.00  0.96           N  
ATOM   8259  CA  VAL B 230      32.209  91.304 101.501  1.00  0.96           C  
ATOM   8260  C   VAL B 230      31.544  92.427 100.703  1.00  0.96           C  
ATOM   8261  O   VAL B 230      30.637  92.142  99.917  1.00  0.96           O  
ATOM   8262  CB  VAL B 230      32.542  90.165 100.543  1.00  0.96           C  
ATOM   8263  CG1 VAL B 230      33.548  90.641  99.477  1.00  0.96           C  
ATOM   8264  CG2 VAL B 230      33.122  88.971 101.329  1.00  0.96           C  
ATOM   8265  N   PRO B 231      31.926  93.695 100.824  1.00  0.96           N  
ATOM   8266  CA  PRO B 231      31.177  94.782 100.199  1.00  0.96           C  
ATOM   8267  C   PRO B 231      31.750  95.129  98.835  1.00  0.96           C  
ATOM   8268  O   PRO B 231      32.938  95.420  98.718  1.00  0.96           O  
ATOM   8269  CB  PRO B 231      31.345  95.951 101.188  1.00  0.96           C  
ATOM   8270  CG  PRO B 231      32.703  95.698 101.849  1.00  0.96           C  
ATOM   8271  CD  PRO B 231      32.766  94.174 101.929  1.00  0.96           C  
ATOM   8272  N   GLY B 232      30.927  95.100  97.766  1.00  0.94           N  
ATOM   8273  CA  GLY B 232      31.328  95.576  96.445  1.00  0.94           C  
ATOM   8274  C   GLY B 232      31.648  97.049  96.379  1.00  0.94           C  
ATOM   8275  O   GLY B 232      31.096  97.863  97.115  1.00  0.94           O  
ATOM   8276  N   TYR B 233      32.548  97.453  95.461  1.00  0.89           N  
ATOM   8277  CA  TYR B 233      32.871  98.855  95.274  1.00  0.89           C  
ATOM   8278  C   TYR B 233      31.737  99.635  94.624  1.00  0.89           C  
ATOM   8279  O   TYR B 233      31.446  99.479  93.436  1.00  0.89           O  
ATOM   8280  CB  TYR B 233      34.165  99.017  94.433  1.00  0.89           C  
ATOM   8281  CG  TYR B 233      34.604 100.461  94.333  1.00  0.89           C  
ATOM   8282  CD1 TYR B 233      35.195 101.100  95.433  1.00  0.89           C  
ATOM   8283  CD2 TYR B 233      34.388 101.199  93.155  1.00  0.89           C  
ATOM   8284  CE1 TYR B 233      35.563 102.450  95.361  1.00  0.89           C  
ATOM   8285  CE2 TYR B 233      34.737 102.557  93.086  1.00  0.89           C  
ATOM   8286  CZ  TYR B 233      35.334 103.178  94.191  1.00  0.89           C  
ATOM   8287  OH  TYR B 233      35.731 104.527  94.136  1.00  0.89           O  
ATOM   8288  N   MET B 234      31.097 100.539  95.394  1.00  0.86           N  
ATOM   8289  CA  MET B 234      30.111 101.486  94.906  1.00  0.86           C  
ATOM   8290  C   MET B 234      28.963 100.841  94.137  1.00  0.86           C  
ATOM   8291  O   MET B 234      28.683 101.164  92.979  1.00  0.86           O  
ATOM   8292  CB  MET B 234      30.761 102.671  94.143  1.00  0.86           C  
ATOM   8293  CG  MET B 234      31.801 103.442  94.982  1.00  0.86           C  
ATOM   8294  SD  MET B 234      31.141 104.210  96.488  1.00  0.86           S  
ATOM   8295  CE  MET B 234      30.381 105.649  95.685  1.00  0.86           C  
ATOM   8296  N   ASN B 235      28.304  99.868  94.785  1.00  0.86           N  
ATOM   8297  CA  ASN B 235      27.104  99.218  94.314  1.00  0.86           C  
ATOM   8298  C   ASN B 235      26.244  98.856  95.526  1.00  0.86           C  
ATOM   8299  O   ASN B 235      26.472  99.315  96.654  1.00  0.86           O  
ATOM   8300  CB  ASN B 235      27.394  98.027  93.339  1.00  0.86           C  
ATOM   8301  CG  ASN B 235      28.138  96.856  93.981  1.00  0.86           C  
ATOM   8302  OD1 ASN B 235      28.302  96.769  95.196  1.00  0.86           O  
ATOM   8303  ND2 ASN B 235      28.576  95.895  93.138  1.00  0.86           N  
ATOM   8304  N   ASN B 236      25.205  98.032  95.306  1.00  0.74           N  
ATOM   8305  CA  ASN B 236      24.288  97.610  96.345  1.00  0.74           C  
ATOM   8306  C   ASN B 236      24.676  96.257  96.931  1.00  0.74           C  
ATOM   8307  O   ASN B 236      23.997  95.749  97.820  1.00  0.74           O  
ATOM   8308  CB  ASN B 236      22.866  97.485  95.745  1.00  0.74           C  
ATOM   8309  CG  ASN B 236      22.373  98.873  95.365  1.00  0.74           C  
ATOM   8310  OD1 ASN B 236      22.132  99.705  96.242  1.00  0.74           O  
ATOM   8311  ND2 ASN B 236      22.219  99.150  94.050  1.00  0.74           N  
ATOM   8312  N   THR B 237      25.785  95.660  96.460  1.00  0.89           N  
ATOM   8313  CA  THR B 237      26.058  94.237  96.617  1.00  0.89           C  
ATOM   8314  C   THR B 237      26.982  93.963  97.772  1.00  0.89           C  
ATOM   8315  O   THR B 237      28.142  94.377  97.794  1.00  0.89           O  
ATOM   8316  CB  THR B 237      26.697  93.626  95.375  1.00  0.89           C  
ATOM   8317  OG1 THR B 237      25.876  93.908  94.251  1.00  0.89           O  
ATOM   8318  CG2 THR B 237      26.803  92.097  95.480  1.00  0.89           C  
ATOM   8319  N   VAL B 238      26.494  93.215  98.776  1.00  0.92           N  
ATOM   8320  CA  VAL B 238      27.328  92.724  99.857  1.00  0.92           C  
ATOM   8321  C   VAL B 238      27.226  91.208  99.883  1.00  0.92           C  
ATOM   8322  O   VAL B 238      26.196  90.615 100.205  1.00  0.92           O  
ATOM   8323  CB  VAL B 238      26.975  93.331 101.207  1.00  0.92           C  
ATOM   8324  CG1 VAL B 238      27.929  92.819 102.304  1.00  0.92           C  
ATOM   8325  CG2 VAL B 238      27.052  94.869 101.123  1.00  0.92           C  
ATOM   8326  N   ASN B 239      28.330  90.537  99.514  1.00  0.93           N  
ATOM   8327  CA  ASN B 239      28.432  89.094  99.446  1.00  0.93           C  
ATOM   8328  C   ASN B 239      28.910  88.538 100.776  1.00  0.93           C  
ATOM   8329  O   ASN B 239      29.215  89.276 101.709  1.00  0.93           O  
ATOM   8330  CB  ASN B 239      29.371  88.660  98.287  1.00  0.93           C  
ATOM   8331  CG  ASN B 239      28.622  88.737  96.961  1.00  0.93           C  
ATOM   8332  OD1 ASN B 239      27.399  88.870  96.901  1.00  0.93           O  
ATOM   8333  ND2 ASN B 239      29.367  88.610  95.842  1.00  0.93           N  
ATOM   8334  N   THR B 240      28.958  87.201 100.910  1.00  0.95           N  
ATOM   8335  CA  THR B 240      29.260  86.556 102.184  1.00  0.95           C  
ATOM   8336  C   THR B 240      30.501  85.709 102.061  1.00  0.95           C  
ATOM   8337  O   THR B 240      30.625  84.866 101.173  1.00  0.95           O  
ATOM   8338  CB  THR B 240      28.130  85.654 102.673  1.00  0.95           C  
ATOM   8339  OG1 THR B 240      26.956  86.423 102.887  1.00  0.95           O  
ATOM   8340  CG2 THR B 240      28.452  84.997 104.023  1.00  0.95           C  
ATOM   8341  N   MET B 241      31.459  85.887 102.987  1.00  0.94           N  
ATOM   8342  CA  MET B 241      32.514  84.924 103.217  1.00  0.94           C  
ATOM   8343  C   MET B 241      32.127  84.126 104.448  1.00  0.94           C  
ATOM   8344  O   MET B 241      31.944  84.680 105.529  1.00  0.94           O  
ATOM   8345  CB  MET B 241      33.877  85.620 103.435  1.00  0.94           C  
ATOM   8346  CG  MET B 241      35.046  84.644 103.686  1.00  0.94           C  
ATOM   8347  SD  MET B 241      36.672  85.435 103.882  1.00  0.94           S  
ATOM   8348  CE  MET B 241      36.291  86.349 105.403  1.00  0.94           C  
ATOM   8349  N   ARG B 242      31.962  82.801 104.304  1.00  0.92           N  
ATOM   8350  CA  ARG B 242      31.513  81.924 105.359  1.00  0.92           C  
ATOM   8351  C   ARG B 242      32.675  81.071 105.825  1.00  0.92           C  
ATOM   8352  O   ARG B 242      33.300  80.329 105.066  1.00  0.92           O  
ATOM   8353  CB  ARG B 242      30.334  81.041 104.881  1.00  0.92           C  
ATOM   8354  CG  ARG B 242      29.835  80.024 105.930  1.00  0.92           C  
ATOM   8355  CD  ARG B 242      28.463  79.413 105.615  1.00  0.92           C  
ATOM   8356  NE  ARG B 242      27.445  80.471 105.884  1.00  0.92           N  
ATOM   8357  CZ  ARG B 242      26.153  80.245 106.128  1.00  0.92           C  
ATOM   8358  NH1 ARG B 242      25.572  79.069 105.914  1.00  0.92           N  
ATOM   8359  NH2 ARG B 242      25.417  81.245 106.605  1.00  0.92           N  
ATOM   8360  N   LEU B 243      33.015  81.185 107.118  1.00  0.96           N  
ATOM   8361  CA  LEU B 243      34.165  80.517 107.680  1.00  0.96           C  
ATOM   8362  C   LEU B 243      33.724  79.569 108.781  1.00  0.96           C  
ATOM   8363  O   LEU B 243      33.035  79.950 109.727  1.00  0.96           O  
ATOM   8364  CB  LEU B 243      35.183  81.536 108.243  1.00  0.96           C  
ATOM   8365  CG  LEU B 243      35.776  82.534 107.226  1.00  0.96           C  
ATOM   8366  CD1 LEU B 243      36.736  83.490 107.947  1.00  0.96           C  
ATOM   8367  CD2 LEU B 243      36.517  81.837 106.075  1.00  0.96           C  
ATOM   8368  N   TRP B 244      34.108  78.282 108.679  1.00  0.93           N  
ATOM   8369  CA  TRP B 244      33.688  77.256 109.619  1.00  0.93           C  
ATOM   8370  C   TRP B 244      34.620  77.152 110.822  1.00  0.93           C  
ATOM   8371  O   TRP B 244      35.842  77.131 110.687  1.00  0.93           O  
ATOM   8372  CB  TRP B 244      33.618  75.863 108.941  1.00  0.93           C  
ATOM   8373  CG  TRP B 244      32.710  75.793 107.725  1.00  0.93           C  
ATOM   8374  CD1 TRP B 244      33.056  75.834 106.402  1.00  0.93           C  
ATOM   8375  CD2 TRP B 244      31.282  75.619 107.763  1.00  0.93           C  
ATOM   8376  NE1 TRP B 244      31.939  75.694 105.609  1.00  0.93           N  
ATOM   8377  CE2 TRP B 244      30.838  75.584 106.423  1.00  0.93           C  
ATOM   8378  CE3 TRP B 244      30.388  75.468 108.821  1.00  0.93           C  
ATOM   8379  CZ2 TRP B 244      29.494  75.436 106.123  1.00  0.93           C  
ATOM   8380  CZ3 TRP B 244      29.038  75.245 108.508  1.00  0.93           C  
ATOM   8381  CH2 TRP B 244      28.591  75.269 107.181  1.00  0.93           C  
ATOM   8382  N   SER B 245      34.051  77.074 112.040  1.00  0.94           N  
ATOM   8383  CA  SER B 245      34.787  76.916 113.290  1.00  0.94           C  
ATOM   8384  C   SER B 245      34.380  75.608 113.943  1.00  0.94           C  
ATOM   8385  O   SER B 245      33.200  75.264 113.960  1.00  0.94           O  
ATOM   8386  CB  SER B 245      34.451  78.063 114.279  1.00  0.94           C  
ATOM   8387  OG  SER B 245      35.388  78.168 115.353  1.00  0.94           O  
ATOM   8388  N   ALA B 246      35.331  74.821 114.478  1.00  0.92           N  
ATOM   8389  CA  ALA B 246      35.047  73.508 115.028  1.00  0.92           C  
ATOM   8390  C   ALA B 246      34.657  73.525 116.507  1.00  0.92           C  
ATOM   8391  O   ALA B 246      35.175  74.304 117.305  1.00  0.92           O  
ATOM   8392  CB  ALA B 246      36.271  72.591 114.825  1.00  0.92           C  
ATOM   8393  N   ARG B 247      33.724  72.634 116.908  1.00  0.80           N  
ATOM   8394  CA  ARG B 247      33.389  72.384 118.302  1.00  0.80           C  
ATOM   8395  C   ARG B 247      33.071  70.909 118.472  1.00  0.80           C  
ATOM   8396  O   ARG B 247      32.505  70.258 117.596  1.00  0.80           O  
ATOM   8397  CB  ARG B 247      32.155  73.186 118.824  1.00  0.80           C  
ATOM   8398  CG  ARG B 247      32.380  74.705 118.994  1.00  0.80           C  
ATOM   8399  CD  ARG B 247      33.416  75.112 120.059  1.00  0.80           C  
ATOM   8400  NE  ARG B 247      32.813  74.984 121.433  1.00  0.80           N  
ATOM   8401  CZ  ARG B 247      33.462  75.457 122.502  1.00  0.80           C  
ATOM   8402  NH1 ARG B 247      34.772  75.670 122.504  1.00  0.80           N  
ATOM   8403  NH2 ARG B 247      32.830  75.707 123.643  1.00  0.80           N  
ATOM   8404  N   ALA B 248      33.437  70.314 119.624  1.00  0.84           N  
ATOM   8405  CA  ALA B 248      32.992  68.979 119.975  1.00  0.84           C  
ATOM   8406  C   ALA B 248      31.473  68.901 120.257  1.00  0.84           C  
ATOM   8407  O   ALA B 248      30.949  69.791 120.935  1.00  0.84           O  
ATOM   8408  CB  ALA B 248      33.793  68.471 121.188  1.00  0.84           C  
ATOM   8409  N   PRO B 249      30.709  67.903 119.803  1.00  0.82           N  
ATOM   8410  CA  PRO B 249      29.288  67.761 120.123  1.00  0.82           C  
ATOM   8411  C   PRO B 249      29.019  67.497 121.594  1.00  0.82           C  
ATOM   8412  O   PRO B 249      29.948  67.289 122.375  1.00  0.82           O  
ATOM   8413  CB  PRO B 249      28.816  66.602 119.227  1.00  0.82           C  
ATOM   8414  CG  PRO B 249      30.067  65.758 118.990  1.00  0.82           C  
ATOM   8415  CD  PRO B 249      31.197  66.790 118.985  1.00  0.82           C  
ATOM   8416  N   ASN B 250      27.740  67.525 122.012  1.00  0.72           N  
ATOM   8417  CA  ASN B 250      27.318  67.278 123.386  1.00  0.72           C  
ATOM   8418  C   ASN B 250      27.642  65.844 123.799  1.00  0.72           C  
ATOM   8419  O   ASN B 250      28.236  65.567 124.843  1.00  0.72           O  
ATOM   8420  CB  ASN B 250      25.781  67.467 123.529  1.00  0.72           C  
ATOM   8421  CG  ASN B 250      25.301  68.875 123.184  1.00  0.72           C  
ATOM   8422  OD1 ASN B 250      25.987  69.739 122.627  1.00  0.72           O  
ATOM   8423  ND2 ASN B 250      24.016  69.128 123.525  1.00  0.72           N  
ATOM   8424  N   ASP B 251      27.321  64.937 122.862  1.00  0.69           N  
ATOM   8425  CA  ASP B 251      27.354  63.494 122.837  1.00  0.69           C  
ATOM   8426  C   ASP B 251      28.757  62.939 122.993  1.00  0.69           C  
ATOM   8427  O   ASP B 251      28.975  61.795 123.392  1.00  0.69           O  
ATOM   8428  CB  ASP B 251      26.809  63.026 121.453  1.00  0.69           C  
ATOM   8429  CG  ASP B 251      25.637  63.875 120.968  1.00  0.69           C  
ATOM   8430  OD1 ASP B 251      25.887  65.074 120.649  1.00  0.69           O  
ATOM   8431  OD2 ASP B 251      24.508  63.343 120.911  1.00  0.69           O  
ATOM   8432  N   PHE B 252      29.762  63.784 122.682  1.00  0.62           N  
ATOM   8433  CA  PHE B 252      31.171  63.503 122.846  1.00  0.62           C  
ATOM   8434  C   PHE B 252      31.485  63.189 124.299  1.00  0.62           C  
ATOM   8435  O   PHE B 252      32.098  62.176 124.590  1.00  0.62           O  
ATOM   8436  CB  PHE B 252      31.984  64.729 122.342  1.00  0.62           C  
ATOM   8437  CG  PHE B 252      33.421  64.414 122.024  1.00  0.62           C  
ATOM   8438  CD1 PHE B 252      34.453  65.009 122.762  1.00  0.62           C  
ATOM   8439  CD2 PHE B 252      33.755  63.543 120.972  1.00  0.62           C  
ATOM   8440  CE1 PHE B 252      35.794  64.723 122.483  1.00  0.62           C  
ATOM   8441  CE2 PHE B 252      35.097  63.242 120.696  1.00  0.62           C  
ATOM   8442  CZ  PHE B 252      36.117  63.831 121.455  1.00  0.62           C  
ATOM   8443  N   ASN B 253      30.948  63.974 125.258  1.00  0.55           N  
ATOM   8444  CA  ASN B 253      31.264  63.827 126.670  1.00  0.55           C  
ATOM   8445  C   ASN B 253      30.838  62.487 127.282  1.00  0.55           C  
ATOM   8446  O   ASN B 253      31.511  61.936 128.151  1.00  0.55           O  
ATOM   8447  CB  ASN B 253      30.731  65.065 127.435  1.00  0.55           C  
ATOM   8448  CG  ASN B 253      31.545  65.433 128.676  1.00  0.55           C  
ATOM   8449  OD1 ASN B 253      30.984  65.809 129.704  1.00  0.55           O  
ATOM   8450  ND2 ASN B 253      32.894  65.424 128.567  1.00  0.55           N  
ATOM   8451  N   LEU B 254      29.734  61.895 126.778  1.00  0.48           N  
ATOM   8452  CA  LEU B 254      29.337  60.526 127.067  1.00  0.48           C  
ATOM   8453  C   LEU B 254      30.365  59.507 126.574  1.00  0.48           C  
ATOM   8454  O   LEU B 254      30.738  58.569 127.275  1.00  0.48           O  
ATOM   8455  CB  LEU B 254      27.954  60.280 126.408  1.00  0.48           C  
ATOM   8456  CG  LEU B 254      27.129  59.071 126.909  1.00  0.48           C  
ATOM   8457  CD1 LEU B 254      25.718  59.145 126.308  1.00  0.48           C  
ATOM   8458  CD2 LEU B 254      27.730  57.696 126.586  1.00  0.48           C  
ATOM   8459  N   ARG B 255      30.903  59.685 125.351  1.00  0.49           N  
ATOM   8460  CA  ARG B 255      31.991  58.870 124.842  1.00  0.49           C  
ATOM   8461  C   ARG B 255      33.271  59.039 125.651  1.00  0.49           C  
ATOM   8462  O   ARG B 255      33.928  58.056 125.989  1.00  0.49           O  
ATOM   8463  CB  ARG B 255      32.301  59.184 123.357  1.00  0.49           C  
ATOM   8464  CG  ARG B 255      31.112  59.030 122.386  1.00  0.49           C  
ATOM   8465  CD  ARG B 255      31.547  59.314 120.945  1.00  0.49           C  
ATOM   8466  NE  ARG B 255      30.375  59.068 120.037  1.00  0.49           N  
ATOM   8467  CZ  ARG B 255      30.489  58.824 118.723  1.00  0.49           C  
ATOM   8468  NH1 ARG B 255      29.404  58.748 117.956  1.00  0.49           N  
ATOM   8469  NH2 ARG B 255      31.673  58.646 118.147  1.00  0.49           N  
ATOM   8470  N   ASP B 256      33.611  60.288 126.019  1.00  0.50           N  
ATOM   8471  CA  ASP B 256      34.791  60.663 126.768  1.00  0.50           C  
ATOM   8472  C   ASP B 256      34.858  60.029 128.151  1.00  0.50           C  
ATOM   8473  O   ASP B 256      35.934  59.768 128.676  1.00  0.50           O  
ATOM   8474  CB  ASP B 256      34.876  62.189 126.942  1.00  0.50           C  
ATOM   8475  CG  ASP B 256      34.813  62.952 125.639  1.00  0.50           C  
ATOM   8476  OD1 ASP B 256      34.369  64.134 125.700  1.00  0.50           O  
ATOM   8477  OD2 ASP B 256      35.166  62.367 124.586  1.00  0.50           O  
ATOM   8478  N   PHE B 257      33.702  59.681 128.763  1.00  0.43           N  
ATOM   8479  CA  PHE B 257      33.623  58.920 130.008  1.00  0.43           C  
ATOM   8480  C   PHE B 257      34.427  57.618 129.925  1.00  0.43           C  
ATOM   8481  O   PHE B 257      35.105  57.216 130.868  1.00  0.43           O  
ATOM   8482  CB  PHE B 257      32.125  58.638 130.353  1.00  0.43           C  
ATOM   8483  CG  PHE B 257      31.931  57.794 131.593  1.00  0.43           C  
ATOM   8484  CD1 PHE B 257      31.722  56.409 131.466  1.00  0.43           C  
ATOM   8485  CD2 PHE B 257      31.979  58.357 132.880  1.00  0.43           C  
ATOM   8486  CE1 PHE B 257      31.580  55.599 132.598  1.00  0.43           C  
ATOM   8487  CE2 PHE B 257      31.840  57.548 134.018  1.00  0.43           C  
ATOM   8488  CZ  PHE B 257      31.644  56.167 133.876  1.00  0.43           C  
ATOM   8489  N   ASN B 258      34.435  56.976 128.741  1.00  0.45           N  
ATOM   8490  CA  ASN B 258      35.175  55.755 128.499  1.00  0.45           C  
ATOM   8491  C   ASN B 258      36.689  55.955 128.397  1.00  0.45           C  
ATOM   8492  O   ASN B 258      37.436  54.980 128.436  1.00  0.45           O  
ATOM   8493  CB  ASN B 258      34.689  55.059 127.204  1.00  0.45           C  
ATOM   8494  CG  ASN B 258      33.196  54.773 127.302  1.00  0.45           C  
ATOM   8495  OD1 ASN B 258      32.700  54.205 128.273  1.00  0.45           O  
ATOM   8496  ND2 ASN B 258      32.440  55.168 126.252  1.00  0.45           N  
ATOM   8497  N   VAL B 259      37.197  57.205 128.268  1.00  0.39           N  
ATOM   8498  CA  VAL B 259      38.634  57.466 128.238  1.00  0.39           C  
ATOM   8499  C   VAL B 259      39.197  57.701 129.639  1.00  0.39           C  
ATOM   8500  O   VAL B 259      40.404  57.621 129.867  1.00  0.39           O  
ATOM   8501  CB  VAL B 259      38.978  58.609 127.272  1.00  0.39           C  
ATOM   8502  CG1 VAL B 259      39.113  59.992 127.948  1.00  0.39           C  
ATOM   8503  CG2 VAL B 259      40.284  58.260 126.534  1.00  0.39           C  
ATOM   8504  N   GLY B 260      38.309  57.917 130.637  1.00  0.50           N  
ATOM   8505  CA  GLY B 260      38.668  58.140 132.035  1.00  0.50           C  
ATOM   8506  C   GLY B 260      38.604  59.588 132.465  1.00  0.50           C  
ATOM   8507  O   GLY B 260      38.987  60.492 131.736  1.00  0.50           O  
ATOM   8508  N   ASP B 261      38.121  59.816 133.707  1.00  0.52           N  
ATOM   8509  CA  ASP B 261      37.879  61.097 134.356  1.00  0.52           C  
ATOM   8510  C   ASP B 261      37.028  62.148 133.641  1.00  0.52           C  
ATOM   8511  O   ASP B 261      37.284  62.593 132.527  1.00  0.52           O  
ATOM   8512  CB  ASP B 261      39.188  61.743 134.888  1.00  0.52           C  
ATOM   8513  CG  ASP B 261      39.511  61.246 136.285  1.00  0.52           C  
ATOM   8514  OD1 ASP B 261      39.028  60.156 136.673  1.00  0.52           O  
ATOM   8515  OD2 ASP B 261      40.203  62.005 137.013  1.00  0.52           O  
ATOM   8516  N   TYR B 262      36.000  62.673 134.348  1.00  0.45           N  
ATOM   8517  CA  TYR B 262      35.140  63.742 133.853  1.00  0.45           C  
ATOM   8518  C   TYR B 262      35.923  65.015 133.518  1.00  0.45           C  
ATOM   8519  O   TYR B 262      35.679  65.662 132.503  1.00  0.45           O  
ATOM   8520  CB  TYR B 262      33.990  64.020 134.875  1.00  0.45           C  
ATOM   8521  CG  TYR B 262      33.226  65.295 134.583  1.00  0.45           C  
ATOM   8522  CD1 TYR B 262      32.266  65.363 133.561  1.00  0.45           C  
ATOM   8523  CD2 TYR B 262      33.572  66.472 135.270  1.00  0.45           C  
ATOM   8524  CE1 TYR B 262      31.675  66.592 133.224  1.00  0.45           C  
ATOM   8525  CE2 TYR B 262      32.986  67.700 134.934  1.00  0.45           C  
ATOM   8526  CZ  TYR B 262      32.041  67.761 133.907  1.00  0.45           C  
ATOM   8527  OH  TYR B 262      31.480  69.005 133.549  1.00  0.45           O  
ATOM   8528  N   ILE B 263      36.902  65.405 134.357  1.00  0.53           N  
ATOM   8529  CA  ILE B 263      37.714  66.581 134.087  1.00  0.53           C  
ATOM   8530  C   ILE B 263      38.537  66.431 132.817  1.00  0.53           C  
ATOM   8531  O   ILE B 263      38.517  67.316 131.966  1.00  0.53           O  
ATOM   8532  CB  ILE B 263      38.601  66.928 135.277  1.00  0.53           C  
ATOM   8533  CG1 ILE B 263      37.754  67.196 136.548  1.00  0.53           C  
ATOM   8534  CG2 ILE B 263      39.502  68.140 134.942  1.00  0.53           C  
ATOM   8535  CD1 ILE B 263      36.799  68.395 136.447  1.00  0.53           C  
ATOM   8536  N   GLN B 264      39.206  65.271 132.617  1.00  0.58           N  
ATOM   8537  CA  GLN B 264      39.970  64.979 131.412  1.00  0.58           C  
ATOM   8538  C   GLN B 264      39.098  64.958 130.168  1.00  0.58           C  
ATOM   8539  O   GLN B 264      39.412  65.584 129.162  1.00  0.58           O  
ATOM   8540  CB  GLN B 264      40.719  63.630 131.543  1.00  0.58           C  
ATOM   8541  CG  GLN B 264      41.712  63.337 130.389  1.00  0.58           C  
ATOM   8542  CD  GLN B 264      42.820  64.389 130.324  1.00  0.58           C  
ATOM   8543  OE1 GLN B 264      43.436  64.734 131.338  1.00  0.58           O  
ATOM   8544  NE2 GLN B 264      43.094  64.935 129.121  1.00  0.58           N  
ATOM   8545  N   ALA B 265      37.913  64.330 130.267  1.00  0.63           N  
ATOM   8546  CA  ALA B 265      36.901  64.305 129.238  1.00  0.63           C  
ATOM   8547  C   ALA B 265      36.449  65.684 128.752  1.00  0.63           C  
ATOM   8548  O   ALA B 265      36.310  65.946 127.561  1.00  0.63           O  
ATOM   8549  CB  ALA B 265      35.697  63.555 129.840  1.00  0.63           C  
ATOM   8550  N   VAL B 266      36.235  66.648 129.667  1.00  0.62           N  
ATOM   8551  CA  VAL B 266      35.977  68.027 129.274  1.00  0.62           C  
ATOM   8552  C   VAL B 266      37.173  68.710 128.599  1.00  0.62           C  
ATOM   8553  O   VAL B 266      36.994  69.474 127.650  1.00  0.62           O  
ATOM   8554  CB  VAL B 266      35.378  68.862 130.400  1.00  0.62           C  
ATOM   8555  CG1 VAL B 266      35.059  70.287 129.909  1.00  0.62           C  
ATOM   8556  CG2 VAL B 266      34.065  68.197 130.864  1.00  0.62           C  
ATOM   8557  N   LEU B 267      38.428  68.448 129.028  1.00  0.65           N  
ATOM   8558  CA  LEU B 267      39.618  68.945 128.338  1.00  0.65           C  
ATOM   8559  C   LEU B 267      39.804  68.378 126.928  1.00  0.65           C  
ATOM   8560  O   LEU B 267      40.097  69.109 125.981  1.00  0.65           O  
ATOM   8561  CB  LEU B 267      40.923  68.685 129.136  1.00  0.65           C  
ATOM   8562  CG  LEU B 267      40.936  69.183 130.598  1.00  0.65           C  
ATOM   8563  CD1 LEU B 267      42.346  69.041 131.190  1.00  0.65           C  
ATOM   8564  CD2 LEU B 267      40.402  70.612 130.783  1.00  0.65           C  
ATOM   8565  N   ASP B 268      39.582  67.061 126.739  1.00  0.64           N  
ATOM   8566  CA  ASP B 268      39.817  66.345 125.492  1.00  0.64           C  
ATOM   8567  C   ASP B 268      38.868  66.742 124.361  1.00  0.64           C  
ATOM   8568  O   ASP B 268      39.118  66.486 123.183  1.00  0.64           O  
ATOM   8569  CB  ASP B 268      39.803  64.816 125.745  1.00  0.64           C  
ATOM   8570  CG  ASP B 268      41.064  64.381 126.477  1.00  0.64           C  
ATOM   8571  OD1 ASP B 268      42.025  65.188 126.572  1.00  0.64           O  
ATOM   8572  OD2 ASP B 268      41.102  63.218 126.946  1.00  0.64           O  
ATOM   8573  N   ARG B 269      37.806  67.513 124.674  1.00  0.72           N  
ATOM   8574  CA  ARG B 269      37.004  68.254 123.711  1.00  0.72           C  
ATOM   8575  C   ARG B 269      37.823  69.167 122.800  1.00  0.72           C  
ATOM   8576  O   ARG B 269      37.485  69.363 121.631  1.00  0.72           O  
ATOM   8577  CB  ARG B 269      35.953  69.123 124.438  1.00  0.72           C  
ATOM   8578  CG  ARG B 269      34.898  68.279 125.175  1.00  0.72           C  
ATOM   8579  CD  ARG B 269      33.886  69.094 125.989  1.00  0.72           C  
ATOM   8580  NE  ARG B 269      33.122  70.014 125.077  1.00  0.72           N  
ATOM   8581  CZ  ARG B 269      32.141  69.657 124.240  1.00  0.72           C  
ATOM   8582  NH1 ARG B 269      31.789  68.386 124.090  1.00  0.72           N  
ATOM   8583  NH2 ARG B 269      31.535  70.594 123.517  1.00  0.72           N  
ATOM   8584  N   ASN B 270      38.964  69.696 123.301  1.00  0.78           N  
ATOM   8585  CA  ASN B 270      39.917  70.472 122.527  1.00  0.78           C  
ATOM   8586  C   ASN B 270      40.485  69.718 121.324  1.00  0.78           C  
ATOM   8587  O   ASN B 270      40.807  70.327 120.310  1.00  0.78           O  
ATOM   8588  CB  ASN B 270      41.104  70.980 123.393  1.00  0.78           C  
ATOM   8589  CG  ASN B 270      40.715  71.963 124.500  1.00  0.78           C  
ATOM   8590  OD1 ASN B 270      41.410  72.049 125.518  1.00  0.78           O  
ATOM   8591  ND2 ASN B 270      39.643  72.764 124.318  1.00  0.78           N  
ATOM   8592  N   LEU B 271      40.596  68.372 121.362  1.00  0.77           N  
ATOM   8593  CA  LEU B 271      41.075  67.577 120.238  1.00  0.77           C  
ATOM   8594  C   LEU B 271      40.227  67.716 118.972  1.00  0.77           C  
ATOM   8595  O   LEU B 271      40.757  67.805 117.866  1.00  0.77           O  
ATOM   8596  CB  LEU B 271      41.155  66.077 120.619  1.00  0.77           C  
ATOM   8597  CG  LEU B 271      42.166  65.750 121.739  1.00  0.77           C  
ATOM   8598  CD1 LEU B 271      41.959  64.312 122.236  1.00  0.77           C  
ATOM   8599  CD2 LEU B 271      43.622  65.950 121.289  1.00  0.77           C  
ATOM   8600  N   ALA B 272      38.885  67.770 119.110  1.00  0.83           N  
ATOM   8601  CA  ALA B 272      37.966  68.048 118.018  1.00  0.83           C  
ATOM   8602  C   ALA B 272      38.096  69.467 117.464  1.00  0.83           C  
ATOM   8603  O   ALA B 272      38.127  69.696 116.256  1.00  0.83           O  
ATOM   8604  CB  ALA B 272      36.528  67.824 118.522  1.00  0.83           C  
ATOM   8605  N   GLU B 273      38.220  70.457 118.367  1.00  0.83           N  
ATOM   8606  CA  GLU B 273      38.427  71.861 118.059  1.00  0.83           C  
ATOM   8607  C   GLU B 273      39.725  72.147 117.332  1.00  0.83           C  
ATOM   8608  O   GLU B 273      39.805  73.038 116.488  1.00  0.83           O  
ATOM   8609  CB  GLU B 273      38.472  72.674 119.356  1.00  0.83           C  
ATOM   8610  CG  GLU B 273      37.176  72.611 120.178  1.00  0.83           C  
ATOM   8611  CD  GLU B 273      37.356  73.323 121.504  1.00  0.83           C  
ATOM   8612  OE1 GLU B 273      36.304  73.572 122.142  1.00  0.83           O  
ATOM   8613  OE2 GLU B 273      38.519  73.616 121.900  1.00  0.83           O  
ATOM   8614  N   ASN B 274      40.788  71.371 117.643  1.00  0.86           N  
ATOM   8615  CA  ASN B 274      42.138  71.547 117.138  1.00  0.86           C  
ATOM   8616  C   ASN B 274      42.276  71.477 115.625  1.00  0.86           C  
ATOM   8617  O   ASN B 274      43.263  71.950 115.066  1.00  0.86           O  
ATOM   8618  CB  ASN B 274      43.141  70.593 117.841  1.00  0.86           C  
ATOM   8619  CG  ASN B 274      43.456  71.138 119.233  1.00  0.86           C  
ATOM   8620  OD1 ASN B 274      43.160  72.289 119.561  1.00  0.86           O  
ATOM   8621  ND2 ASN B 274      44.127  70.325 120.078  1.00  0.86           N  
ATOM   8622  N   ILE B 275      41.245  70.975 114.920  1.00  0.90           N  
ATOM   8623  CA  ILE B 275      41.094  71.085 113.480  1.00  0.90           C  
ATOM   8624  C   ILE B 275      41.046  72.545 113.011  1.00  0.90           C  
ATOM   8625  O   ILE B 275      41.747  72.931 112.080  1.00  0.90           O  
ATOM   8626  CB  ILE B 275      39.852  70.311 113.032  1.00  0.90           C  
ATOM   8627  CG1 ILE B 275      39.977  68.822 113.453  1.00  0.90           C  
ATOM   8628  CG2 ILE B 275      39.662  70.444 111.504  1.00  0.90           C  
ATOM   8629  CD1 ILE B 275      38.729  67.982 113.153  1.00  0.90           C  
ATOM   8630  N   SER B 276      40.291  73.442 113.680  1.00  0.92           N  
ATOM   8631  CA  SER B 276      40.228  74.850 113.284  1.00  0.92           C  
ATOM   8632  C   SER B 276      41.137  75.727 114.122  1.00  0.92           C  
ATOM   8633  O   SER B 276      41.038  76.949 114.092  1.00  0.92           O  
ATOM   8634  CB  SER B 276      38.792  75.457 113.297  1.00  0.92           C  
ATOM   8635  OG  SER B 276      38.184  75.459 114.591  1.00  0.92           O  
ATOM   8636  N   ARG B 277      42.061  75.152 114.913  1.00  0.83           N  
ATOM   8637  CA  ARG B 277      42.946  75.949 115.746  1.00  0.83           C  
ATOM   8638  C   ARG B 277      43.977  76.774 114.978  1.00  0.83           C  
ATOM   8639  O   ARG B 277      44.164  77.951 115.261  1.00  0.83           O  
ATOM   8640  CB  ARG B 277      43.641  75.055 116.803  1.00  0.83           C  
ATOM   8641  CG  ARG B 277      44.185  75.773 118.060  1.00  0.83           C  
ATOM   8642  CD  ARG B 277      43.098  76.222 119.054  1.00  0.83           C  
ATOM   8643  NE  ARG B 277      42.542  75.010 119.733  1.00  0.83           N  
ATOM   8644  CZ  ARG B 277      41.405  75.005 120.442  1.00  0.83           C  
ATOM   8645  NH1 ARG B 277      40.592  76.044 120.541  1.00  0.83           N  
ATOM   8646  NH2 ARG B 277      41.072  73.883 121.072  1.00  0.83           N  
ATOM   8647  N   VAL B 278      44.667  76.218 113.962  1.00  0.90           N  
ATOM   8648  CA  VAL B 278      45.800  76.925 113.371  1.00  0.90           C  
ATOM   8649  C   VAL B 278      45.960  76.670 111.882  1.00  0.90           C  
ATOM   8650  O   VAL B 278      45.800  75.555 111.388  1.00  0.90           O  
ATOM   8651  CB  VAL B 278      47.097  76.621 114.130  1.00  0.90           C  
ATOM   8652  CG1 VAL B 278      47.465  75.123 114.080  1.00  0.90           C  
ATOM   8653  CG2 VAL B 278      48.266  77.501 113.639  1.00  0.90           C  
ATOM   8654  N   LEU B 279      46.273  77.732 111.108  1.00  0.90           N  
ATOM   8655  CA  LEU B 279      46.696  77.625 109.722  1.00  0.90           C  
ATOM   8656  C   LEU B 279      48.035  76.902 109.563  1.00  0.90           C  
ATOM   8657  O   LEU B 279      49.032  77.233 110.206  1.00  0.90           O  
ATOM   8658  CB  LEU B 279      46.805  79.043 109.102  1.00  0.90           C  
ATOM   8659  CG  LEU B 279      47.322  79.126 107.646  1.00  0.90           C  
ATOM   8660  CD1 LEU B 279      46.386  78.457 106.628  1.00  0.90           C  
ATOM   8661  CD2 LEU B 279      47.552  80.590 107.256  1.00  0.90           C  
ATOM   8662  N   TYR B 280      48.112  75.895 108.665  1.00  0.87           N  
ATOM   8663  CA  TYR B 280      49.379  75.283 108.295  1.00  0.87           C  
ATOM   8664  C   TYR B 280      50.272  76.259 107.509  1.00  0.87           C  
ATOM   8665  O   TYR B 280      49.809  76.800 106.503  1.00  0.87           O  
ATOM   8666  CB  TYR B 280      49.177  73.983 107.469  1.00  0.87           C  
ATOM   8667  CG  TYR B 280      49.132  72.791 108.387  1.00  0.87           C  
ATOM   8668  CD1 TYR B 280      50.217  71.899 108.423  1.00  0.87           C  
ATOM   8669  CD2 TYR B 280      48.048  72.576 109.255  1.00  0.87           C  
ATOM   8670  CE1 TYR B 280      50.213  70.806 109.297  1.00  0.87           C  
ATOM   8671  CE2 TYR B 280      48.048  71.489 110.142  1.00  0.87           C  
ATOM   8672  CZ  TYR B 280      49.131  70.603 110.157  1.00  0.87           C  
ATOM   8673  OH  TYR B 280      49.141  69.526 111.061  1.00  0.87           O  
ATOM   8674  N   PRO B 281      51.531  76.533 107.850  1.00  0.88           N  
ATOM   8675  CA  PRO B 281      52.142  77.800 107.441  1.00  0.88           C  
ATOM   8676  C   PRO B 281      53.097  77.562 106.283  1.00  0.88           C  
ATOM   8677  O   PRO B 281      54.163  78.182 106.208  1.00  0.88           O  
ATOM   8678  CB  PRO B 281      52.919  78.199 108.706  1.00  0.88           C  
ATOM   8679  CG  PRO B 281      53.395  76.858 109.257  1.00  0.88           C  
ATOM   8680  CD  PRO B 281      52.167  75.989 109.057  1.00  0.88           C  
ATOM   8681  N   ASN B 282      52.691  76.715 105.325  1.00  0.84           N  
ATOM   8682  CA  ASN B 282      53.531  76.254 104.243  1.00  0.84           C  
ATOM   8683  C   ASN B 282      53.102  76.854 102.912  1.00  0.84           C  
ATOM   8684  O   ASN B 282      52.082  76.488 102.337  1.00  0.84           O  
ATOM   8685  CB  ASN B 282      53.455  74.712 104.130  1.00  0.84           C  
ATOM   8686  CG  ASN B 282      53.981  74.083 105.418  1.00  0.84           C  
ATOM   8687  OD1 ASN B 282      55.053  74.446 105.903  1.00  0.84           O  
ATOM   8688  ND2 ASN B 282      53.209  73.123 105.971  1.00  0.84           N  
ATOM   8689  N   ASP B 283      53.918  77.774 102.363  1.00  0.82           N  
ATOM   8690  CA  ASP B 283      53.768  78.281 101.016  1.00  0.82           C  
ATOM   8691  C   ASP B 283      54.538  77.340 100.089  1.00  0.82           C  
ATOM   8692  O   ASP B 283      55.721  77.088 100.304  1.00  0.82           O  
ATOM   8693  CB  ASP B 283      54.303  79.744 100.974  1.00  0.82           C  
ATOM   8694  CG  ASP B 283      54.176  80.414  99.614  1.00  0.82           C  
ATOM   8695  OD1 ASP B 283      54.881  79.954  98.678  1.00  0.82           O  
ATOM   8696  OD2 ASP B 283      53.418  81.408  99.494  1.00  0.82           O  
ATOM   8697  N   ASN B 284      53.865  76.767  99.063  1.00  0.78           N  
ATOM   8698  CA  ASN B 284      54.460  75.886  98.061  1.00  0.78           C  
ATOM   8699  C   ASN B 284      55.230  74.690  98.620  1.00  0.78           C  
ATOM   8700  O   ASN B 284      56.304  74.336  98.142  1.00  0.78           O  
ATOM   8701  CB  ASN B 284      55.349  76.666  97.055  1.00  0.78           C  
ATOM   8702  CG  ASN B 284      54.491  77.430  96.064  1.00  0.78           C  
ATOM   8703  OD1 ASN B 284      54.227  76.937  94.965  1.00  0.78           O  
ATOM   8704  ND2 ASN B 284      54.080  78.668  96.412  1.00  0.78           N  
ATOM   8705  N   PHE B 285      54.673  74.013  99.636  1.00  0.81           N  
ATOM   8706  CA  PHE B 285      55.285  72.827 100.182  1.00  0.81           C  
ATOM   8707  C   PHE B 285      54.176  71.923 100.688  1.00  0.81           C  
ATOM   8708  O   PHE B 285      53.273  72.368 101.396  1.00  0.81           O  
ATOM   8709  CB  PHE B 285      56.275  73.221 101.314  1.00  0.81           C  
ATOM   8710  CG  PHE B 285      56.989  72.034 101.894  1.00  0.81           C  
ATOM   8711  CD1 PHE B 285      57.937  71.338 101.128  1.00  0.81           C  
ATOM   8712  CD2 PHE B 285      56.702  71.595 103.197  1.00  0.81           C  
ATOM   8713  CE1 PHE B 285      58.588  70.216 101.655  1.00  0.81           C  
ATOM   8714  CE2 PHE B 285      57.350  70.472 103.726  1.00  0.81           C  
ATOM   8715  CZ  PHE B 285      58.292  69.781 102.954  1.00  0.81           C  
ATOM   8716  N   PHE B 286      54.215  70.626 100.335  1.00  0.82           N  
ATOM   8717  CA  PHE B 286      53.255  69.653 100.809  1.00  0.82           C  
ATOM   8718  C   PHE B 286      53.755  69.014 102.099  1.00  0.82           C  
ATOM   8719  O   PHE B 286      54.776  68.330 102.136  1.00  0.82           O  
ATOM   8720  CB  PHE B 286      52.980  68.578  99.716  1.00  0.82           C  
ATOM   8721  CG  PHE B 286      52.127  67.428 100.205  1.00  0.82           C  
ATOM   8722  CD1 PHE B 286      50.895  67.645 100.847  1.00  0.82           C  
ATOM   8723  CD2 PHE B 286      52.587  66.110 100.058  1.00  0.82           C  
ATOM   8724  CE1 PHE B 286      50.130  66.569 101.310  1.00  0.82           C  
ATOM   8725  CE2 PHE B 286      51.841  65.033 100.548  1.00  0.82           C  
ATOM   8726  CZ  PHE B 286      50.604  65.261 101.166  1.00  0.82           C  
ATOM   8727  N   GLU B 287      52.993  69.193 103.192  1.00  0.78           N  
ATOM   8728  CA  GLU B 287      53.306  68.580 104.460  1.00  0.78           C  
ATOM   8729  C   GLU B 287      52.220  67.587 104.839  1.00  0.78           C  
ATOM   8730  O   GLU B 287      51.081  67.934 105.153  1.00  0.78           O  
ATOM   8731  CB  GLU B 287      53.452  69.640 105.565  1.00  0.78           C  
ATOM   8732  CG  GLU B 287      54.034  69.053 106.868  1.00  0.78           C  
ATOM   8733  CD  GLU B 287      53.912  70.001 108.051  1.00  0.78           C  
ATOM   8734  OE1 GLU B 287      53.523  71.179 107.882  1.00  0.78           O  
ATOM   8735  OE2 GLU B 287      54.191  69.502 109.172  1.00  0.78           O  
ATOM   8736  N   GLY B 288      52.554  66.281 104.820  1.00  0.86           N  
ATOM   8737  CA  GLY B 288      51.590  65.221 105.087  1.00  0.86           C  
ATOM   8738  C   GLY B 288      51.347  64.940 106.550  1.00  0.86           C  
ATOM   8739  O   GLY B 288      51.867  63.976 107.102  1.00  0.86           O  
ATOM   8740  N   LYS B 289      50.506  65.756 107.207  1.00  0.83           N  
ATOM   8741  CA  LYS B 289      50.099  65.560 108.589  1.00  0.83           C  
ATOM   8742  C   LYS B 289      48.606  65.251 108.665  1.00  0.83           C  
ATOM   8743  O   LYS B 289      47.791  65.858 107.976  1.00  0.83           O  
ATOM   8744  CB  LYS B 289      50.353  66.831 109.443  1.00  0.83           C  
ATOM   8745  CG  LYS B 289      51.827  67.204 109.696  1.00  0.83           C  
ATOM   8746  CD  LYS B 289      52.579  66.238 110.629  1.00  0.83           C  
ATOM   8747  CE  LYS B 289      53.707  66.891 111.453  1.00  0.83           C  
ATOM   8748  NZ  LYS B 289      54.764  67.467 110.602  1.00  0.83           N  
ATOM   8749  N   GLU B 290      48.188  64.307 109.544  1.00  0.88           N  
ATOM   8750  CA  GLU B 290      46.792  63.888 109.683  1.00  0.88           C  
ATOM   8751  C   GLU B 290      45.835  65.032 110.032  1.00  0.88           C  
ATOM   8752  O   GLU B 290      44.718  65.125 109.528  1.00  0.88           O  
ATOM   8753  CB  GLU B 290      46.646  62.782 110.762  1.00  0.88           C  
ATOM   8754  CG  GLU B 290      45.269  62.060 110.722  1.00  0.88           C  
ATOM   8755  CD  GLU B 290      44.840  61.545 112.083  1.00  0.88           C  
ATOM   8756  OE1 GLU B 290      44.856  62.357 113.042  1.00  0.88           O  
ATOM   8757  OE2 GLU B 290      44.408  60.365 112.209  1.00  0.88           O  
ATOM   8758  N   LEU B 291      46.277  65.970 110.893  1.00  0.91           N  
ATOM   8759  CA  LEU B 291      45.531  67.163 111.244  1.00  0.91           C  
ATOM   8760  C   LEU B 291      45.237  68.092 110.066  1.00  0.91           C  
ATOM   8761  O   LEU B 291      44.134  68.616 109.949  1.00  0.91           O  
ATOM   8762  CB  LEU B 291      46.255  67.920 112.380  1.00  0.91           C  
ATOM   8763  CG  LEU B 291      45.481  69.121 112.963  1.00  0.91           C  
ATOM   8764  CD1 LEU B 291      44.157  68.689 113.611  1.00  0.91           C  
ATOM   8765  CD2 LEU B 291      46.336  69.878 113.988  1.00  0.91           C  
ATOM   8766  N   ARG B 292      46.187  68.286 109.128  1.00  0.87           N  
ATOM   8767  CA  ARG B 292      45.944  69.011 107.888  1.00  0.87           C  
ATOM   8768  C   ARG B 292      44.892  68.333 107.006  1.00  0.87           C  
ATOM   8769  O   ARG B 292      43.974  68.988 106.521  1.00  0.87           O  
ATOM   8770  CB  ARG B 292      47.282  69.208 107.132  1.00  0.87           C  
ATOM   8771  CG  ARG B 292      47.180  69.727 105.682  1.00  0.87           C  
ATOM   8772  CD  ARG B 292      46.538  71.106 105.472  1.00  0.87           C  
ATOM   8773  NE  ARG B 292      46.459  71.220 103.985  1.00  0.87           N  
ATOM   8774  CZ  ARG B 292      46.468  72.323 103.239  1.00  0.87           C  
ATOM   8775  NH1 ARG B 292      46.328  73.541 103.753  1.00  0.87           N  
ATOM   8776  NH2 ARG B 292      46.575  72.221 101.921  1.00  0.87           N  
ATOM   8777  N   LEU B 293      44.937  66.992 106.853  1.00  0.94           N  
ATOM   8778  CA  LEU B 293      43.923  66.224 106.133  1.00  0.94           C  
ATOM   8779  C   LEU B 293      42.526  66.360 106.752  1.00  0.94           C  
ATOM   8780  O   LEU B 293      41.505  66.476 106.071  1.00  0.94           O  
ATOM   8781  CB  LEU B 293      44.349  64.733 106.070  1.00  0.94           C  
ATOM   8782  CG  LEU B 293      43.486  63.819 105.172  1.00  0.94           C  
ATOM   8783  CD1 LEU B 293      43.534  64.242 103.698  1.00  0.94           C  
ATOM   8784  CD2 LEU B 293      43.943  62.357 105.306  1.00  0.94           C  
ATOM   8785  N   LYS B 294      42.448  66.415 108.101  1.00  0.93           N  
ATOM   8786  CA  LYS B 294      41.230  66.758 108.818  1.00  0.93           C  
ATOM   8787  C   LYS B 294      40.688  68.143 108.485  1.00  0.93           C  
ATOM   8788  O   LYS B 294      39.482  68.303 108.321  1.00  0.93           O  
ATOM   8789  CB  LYS B 294      41.411  66.658 110.352  1.00  0.93           C  
ATOM   8790  CG  LYS B 294      41.549  65.217 110.854  1.00  0.93           C  
ATOM   8791  CD  LYS B 294      42.025  65.139 112.313  1.00  0.93           C  
ATOM   8792  CE  LYS B 294      41.917  63.717 112.860  1.00  0.93           C  
ATOM   8793  NZ  LYS B 294      42.759  63.518 114.054  1.00  0.93           N  
ATOM   8794  N   GLN B 295      41.552  69.172 108.345  1.00  0.93           N  
ATOM   8795  CA  GLN B 295      41.157  70.507 107.913  1.00  0.93           C  
ATOM   8796  C   GLN B 295      40.559  70.537 106.520  1.00  0.93           C  
ATOM   8797  O   GLN B 295      39.506  71.134 106.295  1.00  0.93           O  
ATOM   8798  CB  GLN B 295      42.360  71.483 107.926  1.00  0.93           C  
ATOM   8799  CG  GLN B 295      42.900  71.707 109.347  1.00  0.93           C  
ATOM   8800  CD  GLN B 295      44.063  72.697 109.386  1.00  0.93           C  
ATOM   8801  OE1 GLN B 295      44.855  72.837 108.453  1.00  0.93           O  
ATOM   8802  NE2 GLN B 295      44.168  73.400 110.537  1.00  0.93           N  
ATOM   8803  N   GLU B 296      41.200  69.837 105.565  1.00  0.94           N  
ATOM   8804  CA  GLU B 296      40.746  69.705 104.194  1.00  0.94           C  
ATOM   8805  C   GLU B 296      39.379  69.049 104.096  1.00  0.94           C  
ATOM   8806  O   GLU B 296      38.478  69.538 103.417  1.00  0.94           O  
ATOM   8807  CB  GLU B 296      41.776  68.872 103.401  1.00  0.94           C  
ATOM   8808  CG  GLU B 296      43.157  69.561 103.302  1.00  0.94           C  
ATOM   8809  CD  GLU B 296      44.257  68.637 102.787  1.00  0.94           C  
ATOM   8810  OE1 GLU B 296      43.981  67.478 102.389  1.00  0.94           O  
ATOM   8811  OE2 GLU B 296      45.426  69.099 102.845  1.00  0.94           O  
ATOM   8812  N   TYR B 297      39.155  67.948 104.838  1.00  0.96           N  
ATOM   8813  CA  TYR B 297      37.844  67.336 104.938  1.00  0.96           C  
ATOM   8814  C   TYR B 297      36.797  68.189 105.664  1.00  0.96           C  
ATOM   8815  O   TYR B 297      35.652  68.280 105.226  1.00  0.96           O  
ATOM   8816  CB  TYR B 297      37.955  65.937 105.587  1.00  0.96           C  
ATOM   8817  CG  TYR B 297      36.666  65.183 105.398  1.00  0.96           C  
ATOM   8818  CD1 TYR B 297      36.268  64.789 104.110  1.00  0.96           C  
ATOM   8819  CD2 TYR B 297      35.801  64.950 106.479  1.00  0.96           C  
ATOM   8820  CE1 TYR B 297      35.027  64.171 103.909  1.00  0.96           C  
ATOM   8821  CE2 TYR B 297      34.569  64.317 106.278  1.00  0.96           C  
ATOM   8822  CZ  TYR B 297      34.184  63.914 104.999  1.00  0.96           C  
ATOM   8823  OH  TYR B 297      32.922  63.286 104.855  1.00  0.96           O  
ATOM   8824  N   PHE B 298      37.160  68.850 106.783  1.00  0.96           N  
ATOM   8825  CA  PHE B 298      36.255  69.660 107.587  1.00  0.96           C  
ATOM   8826  C   PHE B 298      35.617  70.800 106.802  1.00  0.96           C  
ATOM   8827  O   PHE B 298      34.398  70.976 106.818  1.00  0.96           O  
ATOM   8828  CB  PHE B 298      37.051  70.198 108.813  1.00  0.96           C  
ATOM   8829  CG  PHE B 298      36.262  71.091 109.732  1.00  0.96           C  
ATOM   8830  CD1 PHE B 298      35.289  70.562 110.595  1.00  0.96           C  
ATOM   8831  CD2 PHE B 298      36.502  72.475 109.734  1.00  0.96           C  
ATOM   8832  CE1 PHE B 298      34.555  71.407 111.438  1.00  0.96           C  
ATOM   8833  CE2 PHE B 298      35.772  73.323 110.574  1.00  0.96           C  
ATOM   8834  CZ  PHE B 298      34.792  72.788 111.419  1.00  0.96           C  
ATOM   8835  N   VAL B 299      36.426  71.562 106.038  1.00  0.97           N  
ATOM   8836  CA  VAL B 299      35.910  72.609 105.173  1.00  0.97           C  
ATOM   8837  C   VAL B 299      35.050  72.068 104.041  1.00  0.97           C  
ATOM   8838  O   VAL B 299      33.983  72.605 103.752  1.00  0.97           O  
ATOM   8839  CB  VAL B 299      37.012  73.545 104.684  1.00  0.97           C  
ATOM   8840  CG1 VAL B 299      37.982  72.869 103.701  1.00  0.97           C  
ATOM   8841  CG2 VAL B 299      36.405  74.824 104.078  1.00  0.97           C  
ATOM   8842  N   VAL B 300      35.453  70.953 103.399  1.00  0.97           N  
ATOM   8843  CA  VAL B 300      34.703  70.302 102.338  1.00  0.97           C  
ATOM   8844  C   VAL B 300      33.340  69.780 102.776  1.00  0.97           C  
ATOM   8845  O   VAL B 300      32.318  70.097 102.164  1.00  0.97           O  
ATOM   8846  CB  VAL B 300      35.561  69.162 101.790  1.00  0.97           C  
ATOM   8847  CG1 VAL B 300      34.746  68.080 101.060  1.00  0.97           C  
ATOM   8848  CG2 VAL B 300      36.621  69.762 100.847  1.00  0.97           C  
ATOM   8849  N   ALA B 301      33.285  68.996 103.871  1.00  0.97           N  
ATOM   8850  CA  ALA B 301      32.080  68.336 104.331  1.00  0.97           C  
ATOM   8851  C   ALA B 301      31.017  69.300 104.822  1.00  0.97           C  
ATOM   8852  O   ALA B 301      29.834  69.176 104.506  1.00  0.97           O  
ATOM   8853  CB  ALA B 301      32.448  67.338 105.444  1.00  0.97           C  
ATOM   8854  N   ALA B 302      31.422  70.324 105.596  1.00  0.97           N  
ATOM   8855  CA  ALA B 302      30.534  71.380 106.023  1.00  0.97           C  
ATOM   8856  C   ALA B 302      30.028  72.236 104.862  1.00  0.97           C  
ATOM   8857  O   ALA B 302      28.835  72.514 104.738  1.00  0.97           O  
ATOM   8858  CB  ALA B 302      31.274  72.240 107.059  1.00  0.97           C  
ATOM   8859  N   THR B 303      30.928  72.628 103.935  1.00  0.96           N  
ATOM   8860  CA  THR B 303      30.575  73.431 102.764  1.00  0.96           C  
ATOM   8861  C   THR B 303      29.608  72.747 101.827  1.00  0.96           C  
ATOM   8862  O   THR B 303      28.588  73.322 101.458  1.00  0.96           O  
ATOM   8863  CB  THR B 303      31.794  73.844 101.953  1.00  0.96           C  
ATOM   8864  OG1 THR B 303      32.628  74.654 102.766  1.00  0.96           O  
ATOM   8865  CG2 THR B 303      31.419  74.673 100.716  1.00  0.96           C  
ATOM   8866  N   LEU B 304      29.853  71.476 101.446  1.00  0.95           N  
ATOM   8867  CA  LEU B 304      28.972  70.756 100.539  1.00  0.95           C  
ATOM   8868  C   LEU B 304      27.580  70.519 101.093  1.00  0.95           C  
ATOM   8869  O   LEU B 304      26.587  70.707 100.393  1.00  0.95           O  
ATOM   8870  CB  LEU B 304      29.595  69.423 100.070  1.00  0.95           C  
ATOM   8871  CG  LEU B 304      30.727  69.608  99.038  1.00  0.95           C  
ATOM   8872  CD1 LEU B 304      31.447  68.279  98.805  1.00  0.95           C  
ATOM   8873  CD2 LEU B 304      30.217  70.153  97.695  1.00  0.95           C  
ATOM   8874  N   GLN B 305      27.459  70.170 102.389  1.00  0.91           N  
ATOM   8875  CA  GLN B 305      26.175  70.094 103.060  1.00  0.91           C  
ATOM   8876  C   GLN B 305      25.427  71.430 103.078  1.00  0.91           C  
ATOM   8877  O   GLN B 305      24.230  71.475 102.808  1.00  0.91           O  
ATOM   8878  CB  GLN B 305      26.367  69.594 104.508  1.00  0.91           C  
ATOM   8879  CG  GLN B 305      26.690  68.087 104.626  1.00  0.91           C  
ATOM   8880  CD  GLN B 305      26.916  67.698 106.090  1.00  0.91           C  
ATOM   8881  OE1 GLN B 305      26.038  67.152 106.757  1.00  0.91           O  
ATOM   8882  NE2 GLN B 305      28.129  67.996 106.607  1.00  0.91           N  
ATOM   8883  N   ASP B 306      26.112  72.563 103.349  1.00  0.90           N  
ATOM   8884  CA  ASP B 306      25.523  73.892 103.292  1.00  0.90           C  
ATOM   8885  C   ASP B 306      25.064  74.304 101.883  1.00  0.90           C  
ATOM   8886  O   ASP B 306      23.978  74.856 101.706  1.00  0.90           O  
ATOM   8887  CB  ASP B 306      26.519  74.907 103.915  1.00  0.90           C  
ATOM   8888  CG  ASP B 306      25.852  76.195 104.335  1.00  0.90           C  
ATOM   8889  OD1 ASP B 306      24.805  76.143 105.028  1.00  0.90           O  
ATOM   8890  OD2 ASP B 306      26.379  77.293 104.008  1.00  0.90           O  
ATOM   8891  N   ILE B 307      25.862  74.006 100.833  1.00  0.92           N  
ATOM   8892  CA  ILE B 307      25.492  74.217  99.434  1.00  0.92           C  
ATOM   8893  C   ILE B 307      24.275  73.398  99.014  1.00  0.92           C  
ATOM   8894  O   ILE B 307      23.336  73.919  98.411  1.00  0.92           O  
ATOM   8895  CB  ILE B 307      26.669  73.913  98.498  1.00  0.92           C  
ATOM   8896  CG1 ILE B 307      27.799  74.944  98.734  1.00  0.92           C  
ATOM   8897  CG2 ILE B 307      26.235  73.914  97.011  1.00  0.92           C  
ATOM   8898  CD1 ILE B 307      29.090  74.633  97.968  1.00  0.92           C  
ATOM   8899  N   ILE B 308      24.236  72.094  99.358  1.00  0.89           N  
ATOM   8900  CA  ILE B 308      23.106  71.211  99.090  1.00  0.89           C  
ATOM   8901  C   ILE B 308      21.861  71.619  99.869  1.00  0.89           C  
ATOM   8902  O   ILE B 308      20.759  71.648  99.325  1.00  0.89           O  
ATOM   8903  CB  ILE B 308      23.489  69.747  99.295  1.00  0.89           C  
ATOM   8904  CG1 ILE B 308      24.525  69.352  98.211  1.00  0.89           C  
ATOM   8905  CG2 ILE B 308      22.250  68.824  99.237  1.00  0.89           C  
ATOM   8906  CD1 ILE B 308      25.177  67.988  98.447  1.00  0.89           C  
ATOM   8907  N   ARG B 309      22.008  72.020 101.148  1.00  0.81           N  
ATOM   8908  CA  ARG B 309      20.941  72.588 101.958  1.00  0.81           C  
ATOM   8909  C   ARG B 309      20.350  73.857 101.354  1.00  0.81           C  
ATOM   8910  O   ARG B 309      19.135  74.016 101.282  1.00  0.81           O  
ATOM   8911  CB  ARG B 309      21.487  72.866 103.386  1.00  0.81           C  
ATOM   8912  CG  ARG B 309      20.516  73.551 104.371  1.00  0.81           C  
ATOM   8913  CD  ARG B 309      20.937  73.460 105.848  1.00  0.81           C  
ATOM   8914  NE  ARG B 309      22.267  74.136 106.011  1.00  0.81           N  
ATOM   8915  CZ  ARG B 309      23.033  74.054 107.107  1.00  0.81           C  
ATOM   8916  NH1 ARG B 309      22.633  73.449 108.221  1.00  0.81           N  
ATOM   8917  NH2 ARG B 309      24.224  74.639 107.091  1.00  0.81           N  
ATOM   8918  N   ARG B 310      21.197  74.772 100.846  1.00  0.80           N  
ATOM   8919  CA  ARG B 310      20.764  75.950 100.117  1.00  0.80           C  
ATOM   8920  C   ARG B 310      20.059  75.651  98.799  1.00  0.80           C  
ATOM   8921  O   ARG B 310      19.068  76.289  98.459  1.00  0.80           O  
ATOM   8922  CB  ARG B 310      21.969  76.886  99.884  1.00  0.80           C  
ATOM   8923  CG  ARG B 310      21.581  78.320  99.459  1.00  0.80           C  
ATOM   8924  CD  ARG B 310      22.742  79.323  99.435  1.00  0.80           C  
ATOM   8925  NE  ARG B 310      23.255  79.440 100.840  1.00  0.80           N  
ATOM   8926  CZ  ARG B 310      24.384  78.875 101.295  1.00  0.80           C  
ATOM   8927  NH1 ARG B 310      25.286  78.338 100.487  1.00  0.80           N  
ATOM   8928  NH2 ARG B 310      24.588  78.827 102.610  1.00  0.80           N  
ATOM   8929  N   PHE B 311      20.543  74.659  98.023  1.00  0.84           N  
ATOM   8930  CA  PHE B 311      19.883  74.184  96.816  1.00  0.84           C  
ATOM   8931  C   PHE B 311      18.507  73.567  97.086  1.00  0.84           C  
ATOM   8932  O   PHE B 311      17.526  73.900  96.425  1.00  0.84           O  
ATOM   8933  CB  PHE B 311      20.819  73.163  96.107  1.00  0.84           C  
ATOM   8934  CG  PHE B 311      20.231  72.613  94.833  1.00  0.84           C  
ATOM   8935  CD1 PHE B 311      20.180  73.396  93.668  1.00  0.84           C  
ATOM   8936  CD2 PHE B 311      19.716  71.305  94.800  1.00  0.84           C  
ATOM   8937  CE1 PHE B 311      19.626  72.880  92.489  1.00  0.84           C  
ATOM   8938  CE2 PHE B 311      19.168  70.784  93.622  1.00  0.84           C  
ATOM   8939  CZ  PHE B 311      19.125  71.572  92.466  1.00  0.84           C  
ATOM   8940  N   LYS B 312      18.383  72.691  98.103  1.00  0.75           N  
ATOM   8941  CA  LYS B 312      17.137  72.001  98.408  1.00  0.75           C  
ATOM   8942  C   LYS B 312      16.116  72.892  99.114  1.00  0.75           C  
ATOM   8943  O   LYS B 312      14.938  72.555  99.184  1.00  0.75           O  
ATOM   8944  CB  LYS B 312      17.401  70.705  99.230  1.00  0.75           C  
ATOM   8945  CG  LYS B 312      18.193  69.643  98.439  1.00  0.75           C  
ATOM   8946  CD  LYS B 312      18.539  68.355  99.223  1.00  0.75           C  
ATOM   8947  CE  LYS B 312      17.355  67.408  99.478  1.00  0.75           C  
ATOM   8948  NZ  LYS B 312      17.811  66.096  99.976  1.00  0.75           N  
ATOM   8949  N   ALA B 313      16.544  74.066  99.617  1.00  0.77           N  
ATOM   8950  CA  ALA B 313      15.679  75.096 100.158  1.00  0.77           C  
ATOM   8951  C   ALA B 313      15.448  76.237  99.165  1.00  0.77           C  
ATOM   8952  O   ALA B 313      14.916  77.290  99.510  1.00  0.77           O  
ATOM   8953  CB  ALA B 313      16.331  75.661 101.436  1.00  0.77           C  
ATOM   8954  N   SER B 314      15.859  76.063  97.894  1.00  0.73           N  
ATOM   8955  CA  SER B 314      15.683  77.065  96.853  1.00  0.73           C  
ATOM   8956  C   SER B 314      14.392  76.876  96.074  1.00  0.73           C  
ATOM   8957  O   SER B 314      13.576  76.001  96.347  1.00  0.73           O  
ATOM   8958  CB  SER B 314      16.899  77.154  95.880  1.00  0.73           C  
ATOM   8959  OG  SER B 314      16.958  76.079  94.938  1.00  0.73           O  
ATOM   8960  N   LYS B 315      14.179  77.711  95.038  1.00  0.65           N  
ATOM   8961  CA  LYS B 315      13.064  77.554  94.122  1.00  0.65           C  
ATOM   8962  C   LYS B 315      13.473  76.725  92.908  1.00  0.65           C  
ATOM   8963  O   LYS B 315      12.694  76.575  91.970  1.00  0.65           O  
ATOM   8964  CB  LYS B 315      12.572  78.940  93.629  1.00  0.65           C  
ATOM   8965  CG  LYS B 315      12.212  79.913  94.763  1.00  0.65           C  
ATOM   8966  CD  LYS B 315      11.830  81.300  94.226  1.00  0.65           C  
ATOM   8967  CE  LYS B 315      11.557  82.314  95.339  1.00  0.65           C  
ATOM   8968  NZ  LYS B 315      11.222  83.610  94.731  1.00  0.65           N  
ATOM   8969  N   PHE B 316      14.706  76.162  92.933  1.00  0.58           N  
ATOM   8970  CA  PHE B 316      15.327  75.377  91.879  1.00  0.58           C  
ATOM   8971  C   PHE B 316      15.778  76.187  90.668  1.00  0.58           C  
ATOM   8972  O   PHE B 316      15.294  77.276  90.369  1.00  0.58           O  
ATOM   8973  CB  PHE B 316      14.541  74.102  91.456  1.00  0.58           C  
ATOM   8974  CG  PHE B 316      14.405  73.165  92.625  1.00  0.58           C  
ATOM   8975  CD1 PHE B 316      15.421  72.240  92.919  1.00  0.58           C  
ATOM   8976  CD2 PHE B 316      13.273  73.217  93.456  1.00  0.58           C  
ATOM   8977  CE1 PHE B 316      15.315  71.391  94.029  1.00  0.58           C  
ATOM   8978  CE2 PHE B 316      13.165  72.375  94.570  1.00  0.58           C  
ATOM   8979  CZ  PHE B 316      14.187  71.461  94.857  1.00  0.58           C  
ATOM   8980  N   GLY B 317      16.800  75.673  89.946  1.00  0.49           N  
ATOM   8981  CA  GLY B 317      17.190  76.225  88.653  1.00  0.49           C  
ATOM   8982  C   GLY B 317      16.400  75.591  87.538  1.00  0.49           C  
ATOM   8983  O   GLY B 317      15.633  74.655  87.743  1.00  0.49           O  
ATOM   8984  N   SER B 318      16.591  76.053  86.287  1.00  0.42           N  
ATOM   8985  CA  SER B 318      15.947  75.418  85.141  1.00  0.42           C  
ATOM   8986  C   SER B 318      16.475  74.018  84.852  1.00  0.42           C  
ATOM   8987  O   SER B 318      17.675  73.771  84.886  1.00  0.42           O  
ATOM   8988  CB  SER B 318      16.061  76.244  83.833  1.00  0.42           C  
ATOM   8989  OG  SER B 318      15.097  75.832  82.853  1.00  0.42           O  
ATOM   8990  N   THR B 319      15.577  73.075  84.530  1.00  0.49           N  
ATOM   8991  CA  THR B 319      15.933  71.734  84.091  1.00  0.49           C  
ATOM   8992  C   THR B 319      14.721  71.204  83.356  1.00  0.49           C  
ATOM   8993  O   THR B 319      13.622  71.749  83.492  1.00  0.49           O  
ATOM   8994  CB  THR B 319      16.360  70.779  85.211  1.00  0.49           C  
ATOM   8995  OG1 THR B 319      16.661  69.487  84.701  1.00  0.49           O  
ATOM   8996  CG2 THR B 319      15.268  70.631  86.282  1.00  0.49           C  
ATOM   8997  N   ARG B 320      14.881  70.164  82.519  1.00  0.40           N  
ATOM   8998  CA  ARG B 320      13.786  69.474  81.873  1.00  0.40           C  
ATOM   8999  C   ARG B 320      14.116  67.990  81.802  1.00  0.40           C  
ATOM   9000  O   ARG B 320      15.109  67.592  81.199  1.00  0.40           O  
ATOM   9001  CB  ARG B 320      13.529  69.987  80.423  1.00  0.40           C  
ATOM   9002  CG  ARG B 320      13.016  71.441  80.303  1.00  0.40           C  
ATOM   9003  CD  ARG B 320      11.639  71.680  80.940  1.00  0.40           C  
ATOM   9004  NE  ARG B 320      11.252  73.112  80.698  1.00  0.40           N  
ATOM   9005  CZ  ARG B 320      11.639  74.150  81.455  1.00  0.40           C  
ATOM   9006  NH1 ARG B 320      11.205  75.372  81.148  1.00  0.40           N  
ATOM   9007  NH2 ARG B 320      12.439  74.016  82.506  1.00  0.40           N  
ATOM   9008  N   GLY B 321      13.258  67.123  82.383  1.00  0.48           N  
ATOM   9009  CA  GLY B 321      13.429  65.674  82.308  1.00  0.48           C  
ATOM   9010  C   GLY B 321      14.344  65.091  83.353  1.00  0.48           C  
ATOM   9011  O   GLY B 321      14.403  65.562  84.483  1.00  0.48           O  
ATOM   9012  N   ALA B 322      15.050  64.008  82.968  1.00  0.47           N  
ATOM   9013  CA  ALA B 322      15.875  63.177  83.824  1.00  0.47           C  
ATOM   9014  C   ALA B 322      15.193  62.541  85.042  1.00  0.47           C  
ATOM   9015  O   ALA B 322      13.973  62.440  85.135  1.00  0.47           O  
ATOM   9016  CB  ALA B 322      17.186  63.901  84.178  1.00  0.47           C  
ATOM   9017  N   GLY B 323      16.011  61.974  85.955  1.00  0.46           N  
ATOM   9018  CA  GLY B 323      15.554  61.109  87.041  1.00  0.46           C  
ATOM   9019  C   GLY B 323      15.812  61.640  88.420  1.00  0.46           C  
ATOM   9020  O   GLY B 323      15.802  60.878  89.381  1.00  0.46           O  
ATOM   9021  N   THR B 324      16.107  62.940  88.579  1.00  0.57           N  
ATOM   9022  CA  THR B 324      16.484  63.461  89.887  1.00  0.57           C  
ATOM   9023  C   THR B 324      16.251  64.951  89.955  1.00  0.57           C  
ATOM   9024  O   THR B 324      16.139  65.653  88.956  1.00  0.57           O  
ATOM   9025  CB  THR B 324      17.925  63.113  90.307  1.00  0.57           C  
ATOM   9026  OG1 THR B 324      18.292  63.624  91.586  1.00  0.57           O  
ATOM   9027  CG2 THR B 324      18.961  63.634  89.308  1.00  0.57           C  
ATOM   9028  N   VAL B 325      16.181  65.480  91.189  1.00  0.74           N  
ATOM   9029  CA  VAL B 325      16.001  66.886  91.486  1.00  0.74           C  
ATOM   9030  C   VAL B 325      17.321  67.635  91.376  1.00  0.74           C  
ATOM   9031  O   VAL B 325      17.372  68.863  91.353  1.00  0.74           O  
ATOM   9032  CB  VAL B 325      15.389  67.087  92.871  1.00  0.74           C  
ATOM   9033  CG1 VAL B 325      13.983  66.452  92.882  1.00  0.74           C  
ATOM   9034  CG2 VAL B 325      16.270  66.480  93.985  1.00  0.74           C  
ATOM   9035  N   PHE B 326      18.443  66.897  91.261  1.00  0.81           N  
ATOM   9036  CA  PHE B 326      19.772  67.469  91.205  1.00  0.81           C  
ATOM   9037  C   PHE B 326      20.257  67.749  89.789  1.00  0.81           C  
ATOM   9038  O   PHE B 326      21.370  68.232  89.612  1.00  0.81           O  
ATOM   9039  CB  PHE B 326      20.805  66.537  91.885  1.00  0.81           C  
ATOM   9040  CG  PHE B 326      20.661  66.593  93.374  1.00  0.81           C  
ATOM   9041  CD1 PHE B 326      20.003  65.574  94.074  1.00  0.81           C  
ATOM   9042  CD2 PHE B 326      21.231  67.657  94.094  1.00  0.81           C  
ATOM   9043  CE1 PHE B 326      19.937  65.601  95.469  1.00  0.81           C  
ATOM   9044  CE2 PHE B 326      21.170  67.688  95.493  1.00  0.81           C  
ATOM   9045  CZ  PHE B 326      20.529  66.651  96.181  1.00  0.81           C  
ATOM   9046  N   ASP B 327      19.442  67.547  88.733  1.00  0.76           N  
ATOM   9047  CA  ASP B 327      19.795  67.957  87.379  1.00  0.76           C  
ATOM   9048  C   ASP B 327      20.013  69.467  87.246  1.00  0.76           C  
ATOM   9049  O   ASP B 327      20.869  69.925  86.499  1.00  0.76           O  
ATOM   9050  CB  ASP B 327      18.747  67.450  86.359  1.00  0.76           C  
ATOM   9051  CG  ASP B 327      19.161  66.082  85.869  1.00  0.76           C  
ATOM   9052  OD1 ASP B 327      19.006  65.086  86.616  1.00  0.76           O  
ATOM   9053  OD2 ASP B 327      19.710  66.009  84.738  1.00  0.76           O  
ATOM   9054  N   ALA B 328      19.298  70.288  88.043  1.00  0.80           N  
ATOM   9055  CA  ALA B 328      19.489  71.725  88.033  1.00  0.80           C  
ATOM   9056  C   ALA B 328      20.586  72.172  89.002  1.00  0.80           C  
ATOM   9057  O   ALA B 328      20.832  73.364  89.176  1.00  0.80           O  
ATOM   9058  CB  ALA B 328      18.164  72.416  88.419  1.00  0.80           C  
ATOM   9059  N   PHE B 329      21.300  71.223  89.653  1.00  0.84           N  
ATOM   9060  CA  PHE B 329      22.420  71.520  90.535  1.00  0.84           C  
ATOM   9061  C   PHE B 329      23.606  72.162  89.813  1.00  0.84           C  
ATOM   9062  O   PHE B 329      24.036  73.210  90.293  1.00  0.84           O  
ATOM   9063  CB  PHE B 329      22.830  70.257  91.350  1.00  0.84           C  
ATOM   9064  CG  PHE B 329      23.791  70.521  92.477  1.00  0.84           C  
ATOM   9065  CD1 PHE B 329      23.313  70.951  93.724  1.00  0.84           C  
ATOM   9066  CD2 PHE B 329      25.163  70.266  92.327  1.00  0.84           C  
ATOM   9067  CE1 PHE B 329      24.181  71.100  94.813  1.00  0.84           C  
ATOM   9068  CE2 PHE B 329      26.036  70.413  93.413  1.00  0.84           C  
ATOM   9069  CZ  PHE B 329      25.545  70.824  94.658  1.00  0.84           C  
ATOM   9070  N   PRO B 330      24.147  71.727  88.664  1.00  0.89           N  
ATOM   9071  CA  PRO B 330      25.334  72.360  88.095  1.00  0.89           C  
ATOM   9072  C   PRO B 330      25.047  73.705  87.480  1.00  0.89           C  
ATOM   9073  O   PRO B 330      25.992  74.401  87.126  1.00  0.89           O  
ATOM   9074  CB  PRO B 330      25.810  71.380  87.015  1.00  0.89           C  
ATOM   9075  CG  PRO B 330      25.240  70.036  87.459  1.00  0.89           C  
ATOM   9076  CD  PRO B 330      23.878  70.445  88.006  1.00  0.89           C  
ATOM   9077  N   ASP B 331      23.765  74.084  87.340  1.00  0.83           N  
ATOM   9078  CA  ASP B 331      23.344  75.358  86.800  1.00  0.83           C  
ATOM   9079  C   ASP B 331      22.708  76.226  87.884  1.00  0.83           C  
ATOM   9080  O   ASP B 331      22.178  77.309  87.640  1.00  0.83           O  
ATOM   9081  CB  ASP B 331      22.465  75.109  85.557  1.00  0.83           C  
ATOM   9082  CG  ASP B 331      23.420  74.623  84.473  1.00  0.83           C  
ATOM   9083  OD1 ASP B 331      24.366  75.403  84.158  1.00  0.83           O  
ATOM   9084  OD2 ASP B 331      23.258  73.472  83.999  1.00  0.83           O  
ATOM   9085  N   GLN B 332      22.845  75.805  89.156  1.00  0.83           N  
ATOM   9086  CA  GLN B 332      22.715  76.682  90.306  1.00  0.83           C  
ATOM   9087  C   GLN B 332      24.013  76.774  91.086  1.00  0.83           C  
ATOM   9088  O   GLN B 332      24.195  77.693  91.882  1.00  0.83           O  
ATOM   9089  CB  GLN B 332      21.610  76.176  91.265  1.00  0.83           C  
ATOM   9090  CG  GLN B 332      20.193  76.583  90.815  1.00  0.83           C  
ATOM   9091  CD  GLN B 332      19.999  78.096  90.949  1.00  0.83           C  
ATOM   9092  OE1 GLN B 332      19.903  78.632  92.057  1.00  0.83           O  
ATOM   9093  NE2 GLN B 332      19.959  78.805  89.800  1.00  0.83           N  
ATOM   9094  N   VAL B 333      24.957  75.842  90.863  1.00  0.91           N  
ATOM   9095  CA  VAL B 333      26.158  75.692  91.661  1.00  0.91           C  
ATOM   9096  C   VAL B 333      27.378  75.570  90.761  1.00  0.91           C  
ATOM   9097  O   VAL B 333      27.465  74.686  89.915  1.00  0.91           O  
ATOM   9098  CB  VAL B 333      26.059  74.428  92.526  1.00  0.91           C  
ATOM   9099  CG1 VAL B 333      27.309  74.211  93.396  1.00  0.91           C  
ATOM   9100  CG2 VAL B 333      24.807  74.504  93.425  1.00  0.91           C  
ATOM   9101  N   ALA B 334      28.383  76.448  90.939  1.00  0.95           N  
ATOM   9102  CA  ALA B 334      29.734  76.205  90.473  1.00  0.95           C  
ATOM   9103  C   ALA B 334      30.640  76.242  91.688  1.00  0.95           C  
ATOM   9104  O   ALA B 334      30.536  77.149  92.513  1.00  0.95           O  
ATOM   9105  CB  ALA B 334      30.202  77.276  89.463  1.00  0.95           C  
ATOM   9106  N   ILE B 335      31.540  75.253  91.849  1.00  0.96           N  
ATOM   9107  CA  ILE B 335      32.470  75.222  92.969  1.00  0.96           C  
ATOM   9108  C   ILE B 335      33.884  75.271  92.430  1.00  0.96           C  
ATOM   9109  O   ILE B 335      34.351  74.368  91.736  1.00  0.96           O  
ATOM   9110  CB  ILE B 335      32.307  74.011  93.890  1.00  0.96           C  
ATOM   9111  CG1 ILE B 335      30.846  73.884  94.383  1.00  0.96           C  
ATOM   9112  CG2 ILE B 335      33.286  74.143  95.084  1.00  0.96           C  
ATOM   9113  CD1 ILE B 335      30.555  72.598  95.165  1.00  0.96           C  
ATOM   9114  N   GLN B 336      34.620  76.349  92.756  1.00  0.95           N  
ATOM   9115  CA  GLN B 336      36.000  76.500  92.352  1.00  0.95           C  
ATOM   9116  C   GLN B 336      36.915  75.956  93.433  1.00  0.95           C  
ATOM   9117  O   GLN B 336      36.919  76.426  94.572  1.00  0.95           O  
ATOM   9118  CB  GLN B 336      36.358  77.982  92.067  1.00  0.95           C  
ATOM   9119  CG  GLN B 336      37.717  78.186  91.345  1.00  0.95           C  
ATOM   9120  CD  GLN B 336      37.673  77.680  89.900  1.00  0.95           C  
ATOM   9121  OE1 GLN B 336      36.658  77.795  89.214  1.00  0.95           O  
ATOM   9122  NE2 GLN B 336      38.802  77.140  89.397  1.00  0.95           N  
ATOM   9123  N   LEU B 337      37.723  74.941  93.084  1.00  0.96           N  
ATOM   9124  CA  LEU B 337      38.741  74.378  93.943  1.00  0.96           C  
ATOM   9125  C   LEU B 337      39.984  75.239  93.834  1.00  0.96           C  
ATOM   9126  O   LEU B 337      40.609  75.369  92.777  1.00  0.96           O  
ATOM   9127  CB  LEU B 337      39.098  72.917  93.545  1.00  0.96           C  
ATOM   9128  CG  LEU B 337      38.142  71.788  94.018  1.00  0.96           C  
ATOM   9129  CD1 LEU B 337      36.789  72.250  94.583  1.00  0.96           C  
ATOM   9130  CD2 LEU B 337      37.920  70.781  92.879  1.00  0.96           C  
ATOM   9131  N   ASN B 338      40.366  75.873  94.956  1.00  0.94           N  
ATOM   9132  CA  ASN B 338      41.554  76.685  95.030  1.00  0.94           C  
ATOM   9133  C   ASN B 338      42.733  75.786  95.396  1.00  0.94           C  
ATOM   9134  O   ASN B 338      42.860  75.337  96.534  1.00  0.94           O  
ATOM   9135  CB  ASN B 338      41.287  77.814  96.063  1.00  0.94           C  
ATOM   9136  CG  ASN B 338      42.288  78.961  96.067  1.00  0.94           C  
ATOM   9137  OD1 ASN B 338      42.546  79.581  97.098  1.00  0.94           O  
ATOM   9138  ND2 ASN B 338      42.827  79.325  94.885  1.00  0.94           N  
ATOM   9139  N   ASP B 339      43.589  75.484  94.392  1.00  0.91           N  
ATOM   9140  CA  ASP B 339      44.610  74.452  94.423  1.00  0.91           C  
ATOM   9141  C   ASP B 339      44.061  73.057  94.743  1.00  0.91           C  
ATOM   9142  O   ASP B 339      42.872  72.784  94.570  1.00  0.91           O  
ATOM   9143  CB  ASP B 339      45.823  74.905  95.278  1.00  0.91           C  
ATOM   9144  CG  ASP B 339      47.132  74.478  94.642  1.00  0.91           C  
ATOM   9145  OD1 ASP B 339      47.921  73.817  95.353  1.00  0.91           O  
ATOM   9146  OD2 ASP B 339      47.352  74.818  93.447  1.00  0.91           O  
ATOM   9147  N   THR B 340      44.900  72.098  95.177  1.00  0.92           N  
ATOM   9148  CA  THR B 340      44.427  70.726  95.392  1.00  0.92           C  
ATOM   9149  C   THR B 340      43.855  70.516  96.775  1.00  0.92           C  
ATOM   9150  O   THR B 340      43.281  69.471  97.071  1.00  0.92           O  
ATOM   9151  CB  THR B 340      45.496  69.663  95.201  1.00  0.92           C  
ATOM   9152  OG1 THR B 340      46.693  69.980  95.891  1.00  0.92           O  
ATOM   9153  CG2 THR B 340      45.844  69.581  93.714  1.00  0.92           C  
ATOM   9154  N   HIS B 341      43.947  71.538  97.637  1.00  0.93           N  
ATOM   9155  CA  HIS B 341      43.598  71.480  99.044  1.00  0.93           C  
ATOM   9156  C   HIS B 341      42.138  71.106  99.331  1.00  0.93           C  
ATOM   9157  O   HIS B 341      41.897  70.420 100.320  1.00  0.93           O  
ATOM   9158  CB  HIS B 341      43.994  72.786  99.780  1.00  0.93           C  
ATOM   9159  CG  HIS B 341      45.371  73.337  99.499  1.00  0.93           C  
ATOM   9160  ND1 HIS B 341      45.773  74.444 100.236  1.00  0.93           N  
ATOM   9161  CD2 HIS B 341      46.309  73.041  98.559  1.00  0.93           C  
ATOM   9162  CE1 HIS B 341      46.936  74.800  99.712  1.00  0.93           C  
ATOM   9163  NE2 HIS B 341      47.302  73.983  98.697  1.00  0.93           N  
ATOM   9164  N   PRO B 342      41.107  71.455  98.552  1.00  0.98           N  
ATOM   9165  CA  PRO B 342      39.769  70.943  98.828  1.00  0.98           C  
ATOM   9166  C   PRO B 342      39.389  69.897  97.792  1.00  0.98           C  
ATOM   9167  O   PRO B 342      38.203  69.727  97.512  1.00  0.98           O  
ATOM   9168  CB  PRO B 342      38.919  72.209  98.689  1.00  0.98           C  
ATOM   9169  CG  PRO B 342      39.579  72.983  97.547  1.00  0.98           C  
ATOM   9170  CD  PRO B 342      41.064  72.687  97.747  1.00  0.98           C  
ATOM   9171  N   ALA B 343      40.350  69.107  97.262  1.00  0.97           N  
ATOM   9172  CA  ALA B 343      40.105  68.051  96.287  1.00  0.97           C  
ATOM   9173  C   ALA B 343      39.172  66.947  96.771  1.00  0.97           C  
ATOM   9174  O   ALA B 343      38.475  66.306  95.985  1.00  0.97           O  
ATOM   9175  CB  ALA B 343      41.433  67.402  95.867  1.00  0.97           C  
ATOM   9176  N   LEU B 344      39.090  66.738  98.102  1.00  0.96           N  
ATOM   9177  CA  LEU B 344      38.160  65.822  98.741  1.00  0.96           C  
ATOM   9178  C   LEU B 344      36.687  66.159  98.509  1.00  0.96           C  
ATOM   9179  O   LEU B 344      35.809  65.332  98.747  1.00  0.96           O  
ATOM   9180  CB  LEU B 344      38.422  65.760 100.266  1.00  0.96           C  
ATOM   9181  CG  LEU B 344      39.757  65.092 100.652  1.00  0.96           C  
ATOM   9182  CD1 LEU B 344      40.054  65.324 102.139  1.00  0.96           C  
ATOM   9183  CD2 LEU B 344      39.756  63.583 100.352  1.00  0.96           C  
ATOM   9184  N   ALA B 345      36.371  67.360  97.980  1.00  0.97           N  
ATOM   9185  CA  ALA B 345      35.040  67.737  97.556  1.00  0.97           C  
ATOM   9186  C   ALA B 345      34.460  66.849  96.460  1.00  0.97           C  
ATOM   9187  O   ALA B 345      33.279  66.511  96.484  1.00  0.97           O  
ATOM   9188  CB  ALA B 345      35.050  69.212  97.111  1.00  0.97           C  
ATOM   9189  N   ILE B 346      35.289  66.416  95.492  1.00  0.95           N  
ATOM   9190  CA  ILE B 346      34.893  65.504  94.424  1.00  0.95           C  
ATOM   9191  C   ILE B 346      34.428  64.128  94.929  1.00  0.95           C  
ATOM   9192  O   ILE B 346      33.333  63.716  94.539  1.00  0.95           O  
ATOM   9193  CB  ILE B 346      36.015  65.420  93.385  1.00  0.95           C  
ATOM   9194  CG1 ILE B 346      36.154  66.782  92.665  1.00  0.95           C  
ATOM   9195  CG2 ILE B 346      35.786  64.283  92.361  1.00  0.95           C  
ATOM   9196  CD1 ILE B 346      37.545  67.011  92.072  1.00  0.95           C  
ATOM   9197  N   PRO B 347      35.099  63.384  95.821  1.00  0.98           N  
ATOM   9198  CA  PRO B 347      34.532  62.154  96.358  1.00  0.98           C  
ATOM   9199  C   PRO B 347      33.455  62.414  97.396  1.00  0.98           C  
ATOM   9200  O   PRO B 347      32.576  61.567  97.528  1.00  0.98           O  
ATOM   9201  CB  PRO B 347      35.738  61.388  96.936  1.00  0.98           C  
ATOM   9202  CG  PRO B 347      36.790  62.466  97.195  1.00  0.98           C  
ATOM   9203  CD  PRO B 347      36.542  63.451  96.054  1.00  0.98           C  
ATOM   9204  N   GLU B 348      33.477  63.529  98.157  1.00  0.94           N  
ATOM   9205  CA  GLU B 348      32.404  63.851  99.095  1.00  0.94           C  
ATOM   9206  C   GLU B 348      31.072  64.154  98.421  1.00  0.94           C  
ATOM   9207  O   GLU B 348      30.024  63.665  98.838  1.00  0.94           O  
ATOM   9208  CB  GLU B 348      32.807  64.994 100.065  1.00  0.94           C  
ATOM   9209  CG  GLU B 348      31.731  65.435 101.108  1.00  0.94           C  
ATOM   9210  CD  GLU B 348      31.278  64.368 102.095  1.00  0.94           C  
ATOM   9211  OE1 GLU B 348      31.699  63.192 101.985  1.00  0.94           O  
ATOM   9212  OE2 GLU B 348      30.479  64.684 103.016  1.00  0.94           O  
ATOM   9213  N   LEU B 349      31.060  64.916  97.307  1.00  0.95           N  
ATOM   9214  CA  LEU B 349      29.850  65.143  96.530  1.00  0.95           C  
ATOM   9215  C   LEU B 349      29.279  63.850  95.950  1.00  0.95           C  
ATOM   9216  O   LEU B 349      28.079  63.592  96.027  1.00  0.95           O  
ATOM   9217  CB  LEU B 349      30.093  66.197  95.422  1.00  0.95           C  
ATOM   9218  CG  LEU B 349      28.827  66.659  94.665  1.00  0.95           C  
ATOM   9219  CD1 LEU B 349      27.750  67.236  95.597  1.00  0.95           C  
ATOM   9220  CD2 LEU B 349      29.175  67.690  93.582  1.00  0.95           C  
ATOM   9221  N   MET B 350      30.154  62.952  95.445  1.00  0.92           N  
ATOM   9222  CA  MET B 350      29.780  61.596  95.073  1.00  0.92           C  
ATOM   9223  C   MET B 350      29.224  60.775  96.226  1.00  0.92           C  
ATOM   9224  O   MET B 350      28.224  60.081  96.070  1.00  0.92           O  
ATOM   9225  CB  MET B 350      30.982  60.832  94.462  1.00  0.92           C  
ATOM   9226  CG  MET B 350      31.351  61.319  93.053  1.00  0.92           C  
ATOM   9227  SD  MET B 350      30.019  61.073  91.845  1.00  0.92           S  
ATOM   9228  CE  MET B 350      30.153  59.281  91.621  1.00  0.92           C  
ATOM   9229  N   ARG B 351      29.825  60.855  97.429  1.00  0.89           N  
ATOM   9230  CA  ARG B 351      29.315  60.199  98.619  1.00  0.89           C  
ATOM   9231  C   ARG B 351      27.927  60.680  99.028  1.00  0.89           C  
ATOM   9232  O   ARG B 351      27.039  59.890  99.336  1.00  0.89           O  
ATOM   9233  CB  ARG B 351      30.283  60.407  99.807  1.00  0.89           C  
ATOM   9234  CG  ARG B 351      30.016  59.431 100.969  1.00  0.89           C  
ATOM   9235  CD  ARG B 351      30.838  59.699 102.231  1.00  0.89           C  
ATOM   9236  NE  ARG B 351      30.433  61.038 102.767  1.00  0.89           N  
ATOM   9237  CZ  ARG B 351      29.314  61.316 103.441  1.00  0.89           C  
ATOM   9238  NH1 ARG B 351      28.458  60.359 103.785  1.00  0.89           N  
ATOM   9239  NH2 ARG B 351      29.043  62.579 103.754  1.00  0.89           N  
ATOM   9240  N   ILE B 352      27.672  62.003  99.009  1.00  0.92           N  
ATOM   9241  CA  ILE B 352      26.344  62.543  99.271  1.00  0.92           C  
ATOM   9242  C   ILE B 352      25.334  62.129  98.201  1.00  0.92           C  
ATOM   9243  O   ILE B 352      24.238  61.664  98.513  1.00  0.92           O  
ATOM   9244  CB  ILE B 352      26.368  64.059  99.465  1.00  0.92           C  
ATOM   9245  CG1 ILE B 352      27.301  64.439 100.645  1.00  0.92           C  
ATOM   9246  CG2 ILE B 352      24.930  64.572  99.722  1.00  0.92           C  
ATOM   9247  CD1 ILE B 352      27.622  65.938 100.724  1.00  0.92           C  
ATOM   9248  N   PHE B 353      25.691  62.219  96.903  1.00  0.90           N  
ATOM   9249  CA  PHE B 353      24.823  61.775  95.825  1.00  0.90           C  
ATOM   9250  C   PHE B 353      24.510  60.281  95.827  1.00  0.90           C  
ATOM   9251  O   PHE B 353      23.354  59.892  95.696  1.00  0.90           O  
ATOM   9252  CB  PHE B 353      25.446  62.117  94.439  1.00  0.90           C  
ATOM   9253  CG  PHE B 353      25.404  63.576  94.041  1.00  0.90           C  
ATOM   9254  CD1 PHE B 353      26.281  63.998  93.025  1.00  0.90           C  
ATOM   9255  CD2 PHE B 353      24.488  64.513  94.565  1.00  0.90           C  
ATOM   9256  CE1 PHE B 353      26.246  65.311  92.538  1.00  0.90           C  
ATOM   9257  CE2 PHE B 353      24.459  65.829  94.086  1.00  0.90           C  
ATOM   9258  CZ  PHE B 353      25.332  66.228  93.069  1.00  0.90           C  
ATOM   9259  N   VAL B 354      25.513  59.396  95.981  1.00  0.86           N  
ATOM   9260  CA  VAL B 354      25.304  57.957  95.875  1.00  0.86           C  
ATOM   9261  C   VAL B 354      24.842  57.336  97.188  1.00  0.86           C  
ATOM   9262  O   VAL B 354      23.832  56.632  97.245  1.00  0.86           O  
ATOM   9263  CB  VAL B 354      26.568  57.257  95.365  1.00  0.86           C  
ATOM   9264  CG1 VAL B 354      26.353  55.734  95.247  1.00  0.86           C  
ATOM   9265  CG2 VAL B 354      26.934  57.830  93.977  1.00  0.86           C  
ATOM   9266  N   ASP B 355      25.550  57.587  98.309  1.00  0.88           N  
ATOM   9267  CA  ASP B 355      25.259  56.925  99.569  1.00  0.88           C  
ATOM   9268  C   ASP B 355      24.000  57.466 100.236  1.00  0.88           C  
ATOM   9269  O   ASP B 355      23.190  56.697 100.759  1.00  0.88           O  
ATOM   9270  CB  ASP B 355      26.438  57.013 100.583  1.00  0.88           C  
ATOM   9271  CG  ASP B 355      27.719  56.379 100.077  1.00  0.88           C  
ATOM   9272  OD1 ASP B 355      27.744  55.779  98.976  1.00  0.88           O  
ATOM   9273  OD2 ASP B 355      28.738  56.463 100.813  1.00  0.88           O  
ATOM   9274  N   ILE B 356      23.813  58.804 100.237  1.00  0.85           N  
ATOM   9275  CA  ILE B 356      22.741  59.462 100.976  1.00  0.85           C  
ATOM   9276  C   ILE B 356      21.513  59.692 100.111  1.00  0.85           C  
ATOM   9277  O   ILE B 356      20.431  59.200 100.425  1.00  0.85           O  
ATOM   9278  CB  ILE B 356      23.204  60.783 101.600  1.00  0.85           C  
ATOM   9279  CG1 ILE B 356      24.472  60.558 102.465  1.00  0.85           C  
ATOM   9280  CG2 ILE B 356      22.049  61.400 102.427  1.00  0.85           C  
ATOM   9281  CD1 ILE B 356      25.022  61.847 103.089  1.00  0.85           C  
ATOM   9282  N   GLU B 357      21.648  60.403  98.970  1.00  0.80           N  
ATOM   9283  CA  GLU B 357      20.505  60.830  98.167  1.00  0.80           C  
ATOM   9284  C   GLU B 357      20.155  59.789  97.095  1.00  0.80           C  
ATOM   9285  O   GLU B 357      19.208  59.950  96.329  1.00  0.80           O  
ATOM   9286  CB  GLU B 357      20.799  62.196  97.480  1.00  0.80           C  
ATOM   9287  CG  GLU B 357      21.131  63.396  98.422  1.00  0.80           C  
ATOM   9288  CD  GLU B 357      19.944  64.137  99.029  1.00  0.80           C  
ATOM   9289  OE1 GLU B 357      20.007  64.532 100.224  1.00  0.80           O  
ATOM   9290  OE2 GLU B 357      18.957  64.447  98.306  1.00  0.80           O  
ATOM   9291  N   LYS B 358      20.907  58.666  97.066  1.00  0.77           N  
ATOM   9292  CA  LYS B 358      20.637  57.439  96.327  1.00  0.77           C  
ATOM   9293  C   LYS B 358      20.628  57.544  94.807  1.00  0.77           C  
ATOM   9294  O   LYS B 358      19.812  56.935  94.117  1.00  0.77           O  
ATOM   9295  CB  LYS B 358      19.378  56.692  96.854  1.00  0.77           C  
ATOM   9296  CG  LYS B 358      19.415  56.333  98.353  1.00  0.77           C  
ATOM   9297  CD  LYS B 358      20.583  55.404  98.734  1.00  0.77           C  
ATOM   9298  CE  LYS B 358      20.552  54.960 100.200  1.00  0.77           C  
ATOM   9299  NZ  LYS B 358      21.848  54.345 100.563  1.00  0.77           N  
ATOM   9300  N   LEU B 359      21.593  58.280  94.232  1.00  0.80           N  
ATOM   9301  CA  LEU B 359      21.725  58.425  92.797  1.00  0.80           C  
ATOM   9302  C   LEU B 359      22.633  57.369  92.170  1.00  0.80           C  
ATOM   9303  O   LEU B 359      23.595  56.920  92.797  1.00  0.80           O  
ATOM   9304  CB  LEU B 359      22.245  59.840  92.429  1.00  0.80           C  
ATOM   9305  CG  LEU B 359      21.300  60.977  92.871  1.00  0.80           C  
ATOM   9306  CD1 LEU B 359      21.913  62.350  92.549  1.00  0.80           C  
ATOM   9307  CD2 LEU B 359      19.904  60.850  92.244  1.00  0.80           C  
ATOM   9308  N   PRO B 360      22.397  56.933  90.928  1.00  0.81           N  
ATOM   9309  CA  PRO B 360      23.294  56.018  90.237  1.00  0.81           C  
ATOM   9310  C   PRO B 360      24.591  56.706  89.843  1.00  0.81           C  
ATOM   9311  O   PRO B 360      24.606  57.902  89.545  1.00  0.81           O  
ATOM   9312  CB  PRO B 360      22.478  55.560  89.014  1.00  0.81           C  
ATOM   9313  CG  PRO B 360      21.540  56.734  88.724  1.00  0.81           C  
ATOM   9314  CD  PRO B 360      21.216  57.258  90.122  1.00  0.81           C  
ATOM   9315  N   TRP B 361      25.706  55.947  89.849  1.00  0.83           N  
ATOM   9316  CA  TRP B 361      27.066  56.443  89.719  1.00  0.83           C  
ATOM   9317  C   TRP B 361      27.325  57.285  88.474  1.00  0.83           C  
ATOM   9318  O   TRP B 361      27.959  58.332  88.546  1.00  0.83           O  
ATOM   9319  CB  TRP B 361      28.038  55.226  89.739  1.00  0.83           C  
ATOM   9320  CG  TRP B 361      29.523  55.557  89.653  1.00  0.83           C  
ATOM   9321  CD1 TRP B 361      30.294  55.758  88.538  1.00  0.83           C  
ATOM   9322  CD2 TRP B 361      30.371  55.809  90.785  1.00  0.83           C  
ATOM   9323  NE1 TRP B 361      31.576  56.106  88.900  1.00  0.83           N  
ATOM   9324  CE2 TRP B 361      31.641  56.150  90.275  1.00  0.83           C  
ATOM   9325  CE3 TRP B 361      30.127  55.780  92.158  1.00  0.83           C  
ATOM   9326  CZ2 TRP B 361      32.684  56.477  91.126  1.00  0.83           C  
ATOM   9327  CZ3 TRP B 361      31.186  56.107  93.019  1.00  0.83           C  
ATOM   9328  CH2 TRP B 361      32.446  56.454  92.509  1.00  0.83           C  
ATOM   9329  N   SER B 362      26.821  56.867  87.297  1.00  0.84           N  
ATOM   9330  CA  SER B 362      27.006  57.582  86.040  1.00  0.84           C  
ATOM   9331  C   SER B 362      26.416  58.980  86.044  1.00  0.84           C  
ATOM   9332  O   SER B 362      27.067  59.948  85.655  1.00  0.84           O  
ATOM   9333  CB  SER B 362      26.378  56.787  84.863  1.00  0.84           C  
ATOM   9334  OG  SER B 362      25.058  56.338  85.191  1.00  0.84           O  
ATOM   9335  N   LYS B 363      25.175  59.125  86.540  1.00  0.77           N  
ATOM   9336  CA  LYS B 363      24.528  60.409  86.694  1.00  0.77           C  
ATOM   9337  C   LYS B 363      25.166  61.279  87.767  1.00  0.77           C  
ATOM   9338  O   LYS B 363      25.404  62.468  87.568  1.00  0.77           O  
ATOM   9339  CB  LYS B 363      23.020  60.215  86.976  1.00  0.77           C  
ATOM   9340  CG  LYS B 363      22.200  61.517  86.961  1.00  0.77           C  
ATOM   9341  CD  LYS B 363      22.332  62.298  85.639  1.00  0.77           C  
ATOM   9342  CE  LYS B 363      21.464  63.554  85.602  1.00  0.77           C  
ATOM   9343  NZ  LYS B 363      21.679  64.316  84.361  1.00  0.77           N  
ATOM   9344  N   ALA B 364      25.520  60.691  88.927  1.00  0.89           N  
ATOM   9345  CA  ALA B 364      26.217  61.385  89.992  1.00  0.89           C  
ATOM   9346  C   ALA B 364      27.575  61.936  89.551  1.00  0.89           C  
ATOM   9347  O   ALA B 364      27.940  63.073  89.857  1.00  0.89           O  
ATOM   9348  CB  ALA B 364      26.384  60.414  91.176  1.00  0.89           C  
ATOM   9349  N   TRP B 365      28.336  61.143  88.769  1.00  0.85           N  
ATOM   9350  CA  TRP B 365      29.583  61.547  88.150  1.00  0.85           C  
ATOM   9351  C   TRP B 365      29.415  62.671  87.129  1.00  0.85           C  
ATOM   9352  O   TRP B 365      30.199  63.620  87.107  1.00  0.85           O  
ATOM   9353  CB  TRP B 365      30.296  60.305  87.544  1.00  0.85           C  
ATOM   9354  CG  TRP B 365      31.733  60.515  87.083  1.00  0.85           C  
ATOM   9355  CD1 TRP B 365      32.260  60.353  85.831  1.00  0.85           C  
ATOM   9356  CD2 TRP B 365      32.807  60.994  87.915  1.00  0.85           C  
ATOM   9357  NE1 TRP B 365      33.584  60.740  85.816  1.00  0.85           N  
ATOM   9358  CE2 TRP B 365      33.938  61.137  87.084  1.00  0.85           C  
ATOM   9359  CE3 TRP B 365      32.868  61.319  89.268  1.00  0.85           C  
ATOM   9360  CZ2 TRP B 365      35.136  61.627  87.588  1.00  0.85           C  
ATOM   9361  CZ3 TRP B 365      34.075  61.817  89.777  1.00  0.85           C  
ATOM   9362  CH2 TRP B 365      35.195  61.971  88.948  1.00  0.85           C  
ATOM   9363  N   GLU B 366      28.360  62.639  86.283  1.00  0.85           N  
ATOM   9364  CA  GLU B 366      28.049  63.723  85.356  1.00  0.85           C  
ATOM   9365  C   GLU B 366      27.797  65.062  86.057  1.00  0.85           C  
ATOM   9366  O   GLU B 366      28.394  66.089  85.726  1.00  0.85           O  
ATOM   9367  CB  GLU B 366      26.794  63.385  84.508  1.00  0.85           C  
ATOM   9368  CG  GLU B 366      26.579  64.369  83.323  1.00  0.85           C  
ATOM   9369  CD  GLU B 366      25.131  64.757  83.034  1.00  0.85           C  
ATOM   9370  OE1 GLU B 366      24.232  64.468  83.862  1.00  0.85           O  
ATOM   9371  OE2 GLU B 366      24.922  65.424  81.988  1.00  0.85           O  
ATOM   9372  N   LEU B 367      26.950  65.050  87.108  1.00  0.87           N  
ATOM   9373  CA  LEU B 367      26.636  66.195  87.945  1.00  0.87           C  
ATOM   9374  C   LEU B 367      27.843  66.711  88.705  1.00  0.87           C  
ATOM   9375  O   LEU B 367      28.060  67.914  88.806  1.00  0.87           O  
ATOM   9376  CB  LEU B 367      25.490  65.859  88.930  1.00  0.87           C  
ATOM   9377  CG  LEU B 367      24.158  65.471  88.252  1.00  0.87           C  
ATOM   9378  CD1 LEU B 367      23.158  64.990  89.312  1.00  0.87           C  
ATOM   9379  CD2 LEU B 367      23.548  66.623  87.442  1.00  0.87           C  
ATOM   9380  N   THR B 368      28.694  65.808  89.224  1.00  0.93           N  
ATOM   9381  CA  THR B 368      29.951  66.148  89.890  1.00  0.93           C  
ATOM   9382  C   THR B 368      30.926  66.858  88.973  1.00  0.93           C  
ATOM   9383  O   THR B 368      31.415  67.939  89.293  1.00  0.93           O  
ATOM   9384  CB  THR B 368      30.619  64.898  90.450  1.00  0.93           C  
ATOM   9385  OG1 THR B 368      29.775  64.315  91.435  1.00  0.93           O  
ATOM   9386  CG2 THR B 368      31.965  65.206  91.122  1.00  0.93           C  
ATOM   9387  N   GLN B 369      31.161  66.319  87.758  1.00  0.90           N  
ATOM   9388  CA  GLN B 369      32.063  66.907  86.780  1.00  0.90           C  
ATOM   9389  C   GLN B 369      31.658  68.299  86.326  1.00  0.90           C  
ATOM   9390  O   GLN B 369      32.499  69.174  86.180  1.00  0.90           O  
ATOM   9391  CB  GLN B 369      32.205  65.992  85.543  1.00  0.90           C  
ATOM   9392  CG  GLN B 369      33.033  64.712  85.816  1.00  0.90           C  
ATOM   9393  CD  GLN B 369      32.905  63.729  84.654  1.00  0.90           C  
ATOM   9394  OE1 GLN B 369      33.843  63.399  83.929  1.00  0.90           O  
ATOM   9395  NE2 GLN B 369      31.664  63.223  84.468  1.00  0.90           N  
ATOM   9396  N   LYS B 370      30.353  68.561  86.119  1.00  0.90           N  
ATOM   9397  CA  LYS B 370      29.880  69.880  85.722  1.00  0.90           C  
ATOM   9398  C   LYS B 370      29.882  70.906  86.860  1.00  0.90           C  
ATOM   9399  O   LYS B 370      29.764  72.108  86.630  1.00  0.90           O  
ATOM   9400  CB  LYS B 370      28.416  69.781  85.233  1.00  0.90           C  
ATOM   9401  CG  LYS B 370      28.161  68.995  83.939  1.00  0.90           C  
ATOM   9402  CD  LYS B 370      26.644  68.781  83.793  1.00  0.90           C  
ATOM   9403  CE  LYS B 370      26.178  68.067  82.525  1.00  0.90           C  
ATOM   9404  NZ  LYS B 370      26.227  68.957  81.349  1.00  0.90           N  
ATOM   9405  N   THR B 371      29.964  70.445  88.124  1.00  0.94           N  
ATOM   9406  CA  THR B 371      29.968  71.309  89.305  1.00  0.94           C  
ATOM   9407  C   THR B 371      31.328  71.912  89.589  1.00  0.94           C  
ATOM   9408  O   THR B 371      31.448  73.083  89.958  1.00  0.94           O  
ATOM   9409  CB  THR B 371      29.529  70.578  90.569  1.00  0.94           C  
ATOM   9410  OG1 THR B 371      28.210  70.077  90.410  1.00  0.94           O  
ATOM   9411  CG2 THR B 371      29.435  71.539  91.760  1.00  0.94           C  
ATOM   9412  N   PHE B 372      32.398  71.106  89.463  1.00  0.95           N  
ATOM   9413  CA  PHE B 372      33.722  71.465  89.937  1.00  0.95           C  
ATOM   9414  C   PHE B 372      34.645  72.033  88.872  1.00  0.95           C  
ATOM   9415  O   PHE B 372      34.705  71.580  87.732  1.00  0.95           O  
ATOM   9416  CB  PHE B 372      34.443  70.249  90.574  1.00  0.95           C  
ATOM   9417  CG  PHE B 372      33.829  69.894  91.896  1.00  0.95           C  
ATOM   9418  CD1 PHE B 372      33.167  68.672  92.082  1.00  0.95           C  
ATOM   9419  CD2 PHE B 372      33.942  70.776  92.981  1.00  0.95           C  
ATOM   9420  CE1 PHE B 372      32.618  68.343  93.327  1.00  0.95           C  
ATOM   9421  CE2 PHE B 372      33.384  70.455  94.225  1.00  0.95           C  
ATOM   9422  CZ  PHE B 372      32.714  69.240  94.395  1.00  0.95           C  
ATOM   9423  N   ALA B 373      35.448  73.037  89.266  1.00  0.97           N  
ATOM   9424  CA  ALA B 373      36.509  73.570  88.445  1.00  0.97           C  
ATOM   9425  C   ALA B 373      37.763  73.759  89.285  1.00  0.97           C  
ATOM   9426  O   ALA B 373      37.697  74.009  90.486  1.00  0.97           O  
ATOM   9427  CB  ALA B 373      36.069  74.888  87.792  1.00  0.97           C  
ATOM   9428  N   TYR B 374      38.953  73.604  88.673  1.00  0.93           N  
ATOM   9429  CA  TYR B 374      40.213  73.481  89.388  1.00  0.93           C  
ATOM   9430  C   TYR B 374      41.214  74.549  88.959  1.00  0.93           C  
ATOM   9431  O   TYR B 374      41.577  74.662  87.789  1.00  0.93           O  
ATOM   9432  CB  TYR B 374      40.760  72.046  89.117  1.00  0.93           C  
ATOM   9433  CG  TYR B 374      42.167  71.754  89.589  1.00  0.93           C  
ATOM   9434  CD1 TYR B 374      42.628  72.108  90.870  1.00  0.93           C  
ATOM   9435  CD2 TYR B 374      43.033  71.052  88.730  1.00  0.93           C  
ATOM   9436  CE1 TYR B 374      43.935  71.784  91.263  1.00  0.93           C  
ATOM   9437  CE2 TYR B 374      44.340  70.740  89.119  1.00  0.93           C  
ATOM   9438  CZ  TYR B 374      44.788  71.108  90.387  1.00  0.93           C  
ATOM   9439  OH  TYR B 374      46.097  70.793  90.786  1.00  0.93           O  
ATOM   9440  N   THR B 375      41.723  75.341  89.927  1.00  0.93           N  
ATOM   9441  CA  THR B 375      42.793  76.306  89.679  1.00  0.93           C  
ATOM   9442  C   THR B 375      44.096  75.749  90.206  1.00  0.93           C  
ATOM   9443  O   THR B 375      44.234  75.545  91.407  1.00  0.93           O  
ATOM   9444  CB  THR B 375      42.612  77.643  90.388  1.00  0.93           C  
ATOM   9445  OG1 THR B 375      41.347  78.217  90.120  1.00  0.93           O  
ATOM   9446  CG2 THR B 375      43.661  78.659  89.918  1.00  0.93           C  
ATOM   9447  N   ASN B 376      45.091  75.508  89.332  1.00  0.91           N  
ATOM   9448  CA  ASN B 376      46.350  74.867  89.680  1.00  0.91           C  
ATOM   9449  C   ASN B 376      47.455  75.911  89.869  1.00  0.91           C  
ATOM   9450  O   ASN B 376      47.870  76.551  88.903  1.00  0.91           O  
ATOM   9451  CB  ASN B 376      46.694  73.900  88.502  1.00  0.91           C  
ATOM   9452  CG  ASN B 376      47.888  72.979  88.746  1.00  0.91           C  
ATOM   9453  OD1 ASN B 376      47.730  71.774  88.944  1.00  0.91           O  
ATOM   9454  ND2 ASN B 376      49.114  73.541  88.695  1.00  0.91           N  
ATOM   9455  N   HIS B 377      48.004  76.094  91.089  1.00  0.88           N  
ATOM   9456  CA  HIS B 377      48.900  77.212  91.379  1.00  0.88           C  
ATOM   9457  C   HIS B 377      50.383  76.896  91.352  1.00  0.88           C  
ATOM   9458  O   HIS B 377      51.198  77.789  91.560  1.00  0.88           O  
ATOM   9459  CB  HIS B 377      48.602  77.784  92.779  1.00  0.88           C  
ATOM   9460  CG  HIS B 377      47.267  78.439  92.808  1.00  0.88           C  
ATOM   9461  ND1 HIS B 377      47.160  79.775  92.471  1.00  0.88           N  
ATOM   9462  CD2 HIS B 377      46.040  77.903  93.014  1.00  0.88           C  
ATOM   9463  CE1 HIS B 377      45.870  80.025  92.484  1.00  0.88           C  
ATOM   9464  NE2 HIS B 377      45.147  78.928  92.805  1.00  0.88           N  
ATOM   9465  N   THR B 378      50.809  75.649  91.083  1.00  0.87           N  
ATOM   9466  CA  THR B 378      52.239  75.345  91.134  1.00  0.87           C  
ATOM   9467  C   THR B 378      52.577  74.134  90.293  1.00  0.87           C  
ATOM   9468  O   THR B 378      51.714  73.329  89.950  1.00  0.87           O  
ATOM   9469  CB  THR B 378      52.747  75.171  92.567  1.00  0.87           C  
ATOM   9470  OG1 THR B 378      54.168  75.134  92.654  1.00  0.87           O  
ATOM   9471  CG2 THR B 378      52.176  73.905  93.222  1.00  0.87           C  
ATOM   9472  N   VAL B 379      53.856  74.007  89.891  1.00  0.84           N  
ATOM   9473  CA  VAL B 379      54.369  72.872  89.135  1.00  0.84           C  
ATOM   9474  C   VAL B 379      55.520  72.203  89.871  1.00  0.84           C  
ATOM   9475  O   VAL B 379      56.163  71.293  89.352  1.00  0.84           O  
ATOM   9476  CB  VAL B 379      54.841  73.261  87.731  1.00  0.84           C  
ATOM   9477  CG1 VAL B 379      53.626  73.689  86.886  1.00  0.84           C  
ATOM   9478  CG2 VAL B 379      55.901  74.382  87.775  1.00  0.84           C  
ATOM   9479  N   LEU B 380      55.817  72.623  91.118  1.00  0.81           N  
ATOM   9480  CA  LEU B 380      56.954  72.107  91.861  1.00  0.81           C  
ATOM   9481  C   LEU B 380      56.655  70.745  92.503  1.00  0.81           C  
ATOM   9482  O   LEU B 380      55.669  70.657  93.238  1.00  0.81           O  
ATOM   9483  CB  LEU B 380      57.392  73.100  92.963  1.00  0.81           C  
ATOM   9484  CG  LEU B 380      57.888  74.467  92.446  1.00  0.81           C  
ATOM   9485  CD1 LEU B 380      58.161  75.402  93.632  1.00  0.81           C  
ATOM   9486  CD2 LEU B 380      59.156  74.343  91.586  1.00  0.81           C  
ATOM   9487  N   PRO B 381      57.420  69.659  92.307  1.00  0.83           N  
ATOM   9488  CA  PRO B 381      57.097  68.329  92.834  1.00  0.83           C  
ATOM   9489  C   PRO B 381      56.954  68.236  94.341  1.00  0.83           C  
ATOM   9490  O   PRO B 381      56.208  67.382  94.820  1.00  0.83           O  
ATOM   9491  CB  PRO B 381      58.247  67.443  92.331  1.00  0.83           C  
ATOM   9492  CG  PRO B 381      58.644  68.096  91.007  1.00  0.83           C  
ATOM   9493  CD  PRO B 381      58.493  69.586  91.311  1.00  0.83           C  
ATOM   9494  N   GLU B 382      57.659  69.089  95.105  1.00  0.81           N  
ATOM   9495  CA  GLU B 382      57.557  69.181  96.547  1.00  0.81           C  
ATOM   9496  C   GLU B 382      56.277  69.861  97.026  1.00  0.81           C  
ATOM   9497  O   GLU B 382      55.913  69.777  98.198  1.00  0.81           O  
ATOM   9498  CB  GLU B 382      58.768  69.967  97.117  1.00  0.81           C  
ATOM   9499  CG  GLU B 382      58.948  71.404  96.552  1.00  0.81           C  
ATOM   9500  CD  GLU B 382      59.917  71.499  95.385  1.00  0.81           C  
ATOM   9501  OE1 GLU B 382      59.808  70.729  94.395  1.00  0.81           O  
ATOM   9502  OE2 GLU B 382      60.842  72.345  95.456  1.00  0.81           O  
ATOM   9503  N   ALA B 383      55.553  70.553  96.127  1.00  0.85           N  
ATOM   9504  CA  ALA B 383      54.378  71.320  96.465  1.00  0.85           C  
ATOM   9505  C   ALA B 383      53.083  70.641  96.044  1.00  0.85           C  
ATOM   9506  O   ALA B 383      51.996  71.123  96.350  1.00  0.85           O  
ATOM   9507  CB  ALA B 383      54.488  72.679  95.754  1.00  0.85           C  
ATOM   9508  N   LEU B 384      53.155  69.484  95.358  1.00  0.85           N  
ATOM   9509  CA  LEU B 384      51.974  68.781  94.886  1.00  0.85           C  
ATOM   9510  C   LEU B 384      51.464  67.805  95.931  1.00  0.85           C  
ATOM   9511  O   LEU B 384      52.173  66.887  96.347  1.00  0.85           O  
ATOM   9512  CB  LEU B 384      52.259  67.992  93.581  1.00  0.85           C  
ATOM   9513  CG  LEU B 384      52.741  68.857  92.397  1.00  0.85           C  
ATOM   9514  CD1 LEU B 384      53.050  67.976  91.177  1.00  0.85           C  
ATOM   9515  CD2 LEU B 384      51.738  69.956  92.013  1.00  0.85           C  
ATOM   9516  N   GLU B 385      50.207  67.977  96.390  1.00  0.87           N  
ATOM   9517  CA  GLU B 385      49.628  67.149  97.429  1.00  0.87           C  
ATOM   9518  C   GLU B 385      49.395  65.700  97.017  1.00  0.87           C  
ATOM   9519  O   GLU B 385      48.757  65.382  96.011  1.00  0.87           O  
ATOM   9520  CB  GLU B 385      48.355  67.783  98.029  1.00  0.87           C  
ATOM   9521  CG  GLU B 385      48.600  69.231  98.523  1.00  0.87           C  
ATOM   9522  CD  GLU B 385      47.367  69.852  99.158  1.00  0.87           C  
ATOM   9523  OE1 GLU B 385      46.311  69.856  98.478  1.00  0.87           O  
ATOM   9524  OE2 GLU B 385      47.490  70.391 100.288  1.00  0.87           O  
ATOM   9525  N   ARG B 386      49.973  64.776  97.807  1.00  0.85           N  
ATOM   9526  CA  ARG B 386      50.109  63.373  97.469  1.00  0.85           C  
ATOM   9527  C   ARG B 386      49.968  62.567  98.750  1.00  0.85           C  
ATOM   9528  O   ARG B 386      50.952  62.138  99.361  1.00  0.85           O  
ATOM   9529  CB  ARG B 386      51.489  63.084  96.819  1.00  0.85           C  
ATOM   9530  CG  ARG B 386      51.649  63.677  95.401  1.00  0.85           C  
ATOM   9531  CD  ARG B 386      53.100  63.792  94.923  1.00  0.85           C  
ATOM   9532  NE  ARG B 386      53.617  62.397  94.813  1.00  0.85           N  
ATOM   9533  CZ  ARG B 386      54.846  61.972  95.125  1.00  0.85           C  
ATOM   9534  NH1 ARG B 386      55.800  62.797  95.536  1.00  0.85           N  
ATOM   9535  NH2 ARG B 386      55.099  60.673  95.013  1.00  0.85           N  
ATOM   9536  N   TRP B 387      48.723  62.395  99.231  1.00  0.89           N  
ATOM   9537  CA  TRP B 387      48.411  61.775 100.508  1.00  0.89           C  
ATOM   9538  C   TRP B 387      48.619  60.256 100.526  1.00  0.89           C  
ATOM   9539  O   TRP B 387      48.089  59.595  99.635  1.00  0.89           O  
ATOM   9540  CB  TRP B 387      46.952  62.086 100.925  1.00  0.89           C  
ATOM   9541  CG  TRP B 387      46.729  63.535 101.320  1.00  0.89           C  
ATOM   9542  CD1 TRP B 387      46.053  64.536 100.674  1.00  0.89           C  
ATOM   9543  CD2 TRP B 387      47.198  64.100 102.556  1.00  0.89           C  
ATOM   9544  NE1 TRP B 387      46.101  65.697 101.416  1.00  0.89           N  
ATOM   9545  CE2 TRP B 387      46.806  65.453 102.562  1.00  0.89           C  
ATOM   9546  CE3 TRP B 387      47.883  63.546 103.637  1.00  0.89           C  
ATOM   9547  CZ2 TRP B 387      47.109  66.277 103.630  1.00  0.89           C  
ATOM   9548  CZ3 TRP B 387      48.161  64.377 104.733  1.00  0.89           C  
ATOM   9549  CH2 TRP B 387      47.798  65.732 104.719  1.00  0.89           C  
ATOM   9550  N   PRO B 388      49.350  59.634 101.466  1.00  0.93           N  
ATOM   9551  CA  PRO B 388      49.366  58.181 101.672  1.00  0.93           C  
ATOM   9552  C   PRO B 388      48.004  57.519 101.750  1.00  0.93           C  
ATOM   9553  O   PRO B 388      47.133  58.032 102.454  1.00  0.93           O  
ATOM   9554  CB  PRO B 388      50.154  57.982 102.977  1.00  0.93           C  
ATOM   9555  CG  PRO B 388      51.042  59.223 103.058  1.00  0.93           C  
ATOM   9556  CD  PRO B 388      50.134  60.315 102.495  1.00  0.93           C  
ATOM   9557  N   VAL B 389      47.800  56.370 101.073  1.00  0.90           N  
ATOM   9558  CA  VAL B 389      46.521  55.665 101.072  1.00  0.90           C  
ATOM   9559  C   VAL B 389      46.103  55.200 102.456  1.00  0.90           C  
ATOM   9560  O   VAL B 389      44.940  55.318 102.828  1.00  0.90           O  
ATOM   9561  CB  VAL B 389      46.443  54.506 100.079  1.00  0.90           C  
ATOM   9562  CG1 VAL B 389      46.646  55.053  98.652  1.00  0.90           C  
ATOM   9563  CG2 VAL B 389      47.463  53.398 100.404  1.00  0.90           C  
ATOM   9564  N   ASP B 390      47.063  54.733 103.273  1.00  0.87           N  
ATOM   9565  CA  ASP B 390      46.919  54.213 104.616  1.00  0.87           C  
ATOM   9566  C   ASP B 390      46.314  55.242 105.569  1.00  0.87           C  
ATOM   9567  O   ASP B 390      45.416  54.977 106.368  1.00  0.87           O  
ATOM   9568  CB  ASP B 390      48.331  53.809 105.153  1.00  0.87           C  
ATOM   9569  CG  ASP B 390      49.247  53.262 104.060  1.00  0.87           C  
ATOM   9570  OD1 ASP B 390      49.538  52.046 104.071  1.00  0.87           O  
ATOM   9571  OD2 ASP B 390      49.668  54.089 103.202  1.00  0.87           O  
ATOM   9572  N   LEU B 391      46.801  56.495 105.466  1.00  0.89           N  
ATOM   9573  CA  LEU B 391      46.313  57.626 106.227  1.00  0.89           C  
ATOM   9574  C   LEU B 391      44.889  58.011 105.852  1.00  0.89           C  
ATOM   9575  O   LEU B 391      44.038  58.245 106.712  1.00  0.89           O  
ATOM   9576  CB  LEU B 391      47.258  58.836 106.022  1.00  0.89           C  
ATOM   9577  CG  LEU B 391      47.085  59.969 107.053  1.00  0.89           C  
ATOM   9578  CD1 LEU B 391      47.593  59.546 108.440  1.00  0.89           C  
ATOM   9579  CD2 LEU B 391      47.818  61.233 106.587  1.00  0.89           C  
ATOM   9580  N   VAL B 392      44.593  58.039 104.535  1.00  0.91           N  
ATOM   9581  CA  VAL B 392      43.260  58.280 104.004  1.00  0.91           C  
ATOM   9582  C   VAL B 392      42.288  57.170 104.374  1.00  0.91           C  
ATOM   9583  O   VAL B 392      41.172  57.450 104.794  1.00  0.91           O  
ATOM   9584  CB  VAL B 392      43.274  58.519 102.496  1.00  0.91           C  
ATOM   9585  CG1 VAL B 392      41.853  58.821 101.972  1.00  0.91           C  
ATOM   9586  CG2 VAL B 392      44.187  59.725 102.196  1.00  0.91           C  
ATOM   9587  N   GLU B 393      42.692  55.884 104.293  1.00  0.87           N  
ATOM   9588  CA  GLU B 393      41.880  54.746 104.701  1.00  0.87           C  
ATOM   9589  C   GLU B 393      41.507  54.781 106.169  1.00  0.87           C  
ATOM   9590  O   GLU B 393      40.360  54.580 106.554  1.00  0.87           O  
ATOM   9591  CB  GLU B 393      42.610  53.408 104.421  1.00  0.87           C  
ATOM   9592  CG  GLU B 393      41.658  52.185 104.435  1.00  0.87           C  
ATOM   9593  CD  GLU B 393      42.280  50.942 103.799  1.00  0.87           C  
ATOM   9594  OE1 GLU B 393      42.430  49.928 104.526  1.00  0.87           O  
ATOM   9595  OE2 GLU B 393      42.571  50.992 102.574  1.00  0.87           O  
ATOM   9596  N   LYS B 394      42.481  55.099 107.041  1.00  0.88           N  
ATOM   9597  CA  LYS B 394      42.237  55.243 108.458  1.00  0.88           C  
ATOM   9598  C   LYS B 394      41.327  56.418 108.822  1.00  0.88           C  
ATOM   9599  O   LYS B 394      40.437  56.285 109.658  1.00  0.88           O  
ATOM   9600  CB  LYS B 394      43.600  55.307 109.198  1.00  0.88           C  
ATOM   9601  CG  LYS B 394      43.523  55.005 110.706  1.00  0.88           C  
ATOM   9602  CD  LYS B 394      43.592  56.245 111.616  1.00  0.88           C  
ATOM   9603  CE  LYS B 394      44.997  56.855 111.720  1.00  0.88           C  
ATOM   9604  NZ  LYS B 394      45.049  57.896 112.767  1.00  0.88           N  
ATOM   9605  N   LEU B 395      41.519  57.607 108.212  1.00  0.92           N  
ATOM   9606  CA  LEU B 395      40.696  58.776 108.494  1.00  0.92           C  
ATOM   9607  C   LEU B 395      39.335  58.814 107.797  1.00  0.92           C  
ATOM   9608  O   LEU B 395      38.341  59.245 108.383  1.00  0.92           O  
ATOM   9609  CB  LEU B 395      41.470  60.073 108.149  1.00  0.92           C  
ATOM   9610  CG  LEU B 395      40.809  61.372 108.666  1.00  0.92           C  
ATOM   9611  CD1 LEU B 395      40.788  61.438 110.199  1.00  0.92           C  
ATOM   9612  CD2 LEU B 395      41.510  62.608 108.090  1.00  0.92           C  
ATOM   9613  N   LEU B 396      39.269  58.398 106.519  1.00  0.93           N  
ATOM   9614  CA  LEU B 396      38.138  58.608 105.629  1.00  0.93           C  
ATOM   9615  C   LEU B 396      37.900  57.379 104.740  1.00  0.93           C  
ATOM   9616  O   LEU B 396      38.051  57.473 103.516  1.00  0.93           O  
ATOM   9617  CB  LEU B 396      38.411  59.808 104.677  1.00  0.93           C  
ATOM   9618  CG  LEU B 396      38.602  61.182 105.347  1.00  0.93           C  
ATOM   9619  CD1 LEU B 396      39.017  62.220 104.295  1.00  0.93           C  
ATOM   9620  CD2 LEU B 396      37.335  61.645 106.078  1.00  0.93           C  
ATOM   9621  N   PRO B 397      37.541  56.200 105.256  1.00  0.93           N  
ATOM   9622  CA  PRO B 397      37.603  54.951 104.498  1.00  0.93           C  
ATOM   9623  C   PRO B 397      36.648  54.909 103.323  1.00  0.93           C  
ATOM   9624  O   PRO B 397      36.999  54.371 102.276  1.00  0.93           O  
ATOM   9625  CB  PRO B 397      37.286  53.864 105.543  1.00  0.93           C  
ATOM   9626  CG  PRO B 397      36.519  54.596 106.650  1.00  0.93           C  
ATOM   9627  CD  PRO B 397      37.181  55.973 106.658  1.00  0.93           C  
ATOM   9628  N   ARG B 398      35.435  55.482 103.451  1.00  0.87           N  
ATOM   9629  CA  ARG B 398      34.467  55.519 102.370  1.00  0.87           C  
ATOM   9630  C   ARG B 398      34.934  56.340 101.173  1.00  0.87           C  
ATOM   9631  O   ARG B 398      34.787  55.949 100.016  1.00  0.87           O  
ATOM   9632  CB  ARG B 398      33.097  56.030 102.885  1.00  0.87           C  
ATOM   9633  CG  ARG B 398      31.966  55.988 101.832  1.00  0.87           C  
ATOM   9634  CD  ARG B 398      31.789  54.618 101.163  1.00  0.87           C  
ATOM   9635  NE  ARG B 398      30.714  54.756 100.135  1.00  0.87           N  
ATOM   9636  CZ  ARG B 398      30.687  54.068  98.987  1.00  0.87           C  
ATOM   9637  NH1 ARG B 398      31.583  53.134  98.680  1.00  0.87           N  
ATOM   9638  NH2 ARG B 398      29.704  54.295  98.123  1.00  0.87           N  
ATOM   9639  N   HIS B 399      35.567  57.498 101.422  1.00  0.93           N  
ATOM   9640  CA  HIS B 399      36.167  58.327 100.398  1.00  0.93           C  
ATOM   9641  C   HIS B 399      37.275  57.640  99.636  1.00  0.93           C  
ATOM   9642  O   HIS B 399      37.385  57.807  98.425  1.00  0.93           O  
ATOM   9643  CB  HIS B 399      36.699  59.643 100.984  1.00  0.93           C  
ATOM   9644  CG  HIS B 399      35.588  60.405 101.614  1.00  0.93           C  
ATOM   9645  ND1 HIS B 399      35.188  60.100 102.900  1.00  0.93           N  
ATOM   9646  CD2 HIS B 399      34.787  61.358 101.078  1.00  0.93           C  
ATOM   9647  CE1 HIS B 399      34.157  60.887 103.127  1.00  0.93           C  
ATOM   9648  NE2 HIS B 399      33.871  61.658 102.054  1.00  0.93           N  
ATOM   9649  N   LEU B 400      38.107  56.818 100.306  1.00  0.92           N  
ATOM   9650  CA  LEU B 400      39.101  56.008  99.623  1.00  0.92           C  
ATOM   9651  C   LEU B 400      38.505  54.995  98.645  1.00  0.92           C  
ATOM   9652  O   LEU B 400      38.981  54.866  97.518  1.00  0.92           O  
ATOM   9653  CB  LEU B 400      40.033  55.293 100.621  1.00  0.92           C  
ATOM   9654  CG  LEU B 400      41.224  54.575  99.952  1.00  0.92           C  
ATOM   9655  CD1 LEU B 400      42.154  55.522  99.183  1.00  0.92           C  
ATOM   9656  CD2 LEU B 400      42.047  53.839 101.002  1.00  0.92           C  
ATOM   9657  N   GLU B 401      37.394  54.309  99.011  1.00  0.88           N  
ATOM   9658  CA  GLU B 401      36.663  53.442  98.092  1.00  0.88           C  
ATOM   9659  C   GLU B 401      36.155  54.190  96.867  1.00  0.88           C  
ATOM   9660  O   GLU B 401      36.301  53.743  95.731  1.00  0.88           O  
ATOM   9661  CB  GLU B 401      35.397  52.822  98.735  1.00  0.88           C  
ATOM   9662  CG  GLU B 401      35.612  51.945  99.987  1.00  0.88           C  
ATOM   9663  CD  GLU B 401      34.295  51.304 100.403  1.00  0.88           C  
ATOM   9664  OE1 GLU B 401      33.253  52.015 100.378  1.00  0.88           O  
ATOM   9665  OE2 GLU B 401      34.294  50.092 100.727  1.00  0.88           O  
ATOM   9666  N   ILE B 402      35.580  55.390  97.079  1.00  0.92           N  
ATOM   9667  CA  ILE B 402      35.113  56.278  96.023  1.00  0.92           C  
ATOM   9668  C   ILE B 402      36.251  56.733  95.111  1.00  0.92           C  
ATOM   9669  O   ILE B 402      36.123  56.697  93.891  1.00  0.92           O  
ATOM   9670  CB  ILE B 402      34.331  57.446  96.624  1.00  0.92           C  
ATOM   9671  CG1 ILE B 402      33.052  56.899  97.306  1.00  0.92           C  
ATOM   9672  CG2 ILE B 402      33.964  58.508  95.561  1.00  0.92           C  
ATOM   9673  CD1 ILE B 402      32.326  57.930  98.174  1.00  0.92           C  
ATOM   9674  N   ILE B 403      37.426  57.108  95.661  1.00  0.93           N  
ATOM   9675  CA  ILE B 403      38.628  57.427  94.889  1.00  0.93           C  
ATOM   9676  C   ILE B 403      39.141  56.241  94.075  1.00  0.93           C  
ATOM   9677  O   ILE B 403      39.479  56.391  92.900  1.00  0.93           O  
ATOM   9678  CB  ILE B 403      39.730  58.018  95.776  1.00  0.93           C  
ATOM   9679  CG1 ILE B 403      39.285  59.407  96.298  1.00  0.93           C  
ATOM   9680  CG2 ILE B 403      41.075  58.134  95.017  1.00  0.93           C  
ATOM   9681  CD1 ILE B 403      40.155  59.945  97.442  1.00  0.93           C  
ATOM   9682  N   TYR B 404      39.164  55.014  94.644  1.00  0.90           N  
ATOM   9683  CA  TYR B 404      39.475  53.802  93.895  1.00  0.90           C  
ATOM   9684  C   TYR B 404      38.497  53.540  92.747  1.00  0.90           C  
ATOM   9685  O   TYR B 404      38.916  53.241  91.631  1.00  0.90           O  
ATOM   9686  CB  TYR B 404      39.495  52.539  94.809  1.00  0.90           C  
ATOM   9687  CG  TYR B 404      40.645  52.462  95.791  1.00  0.90           C  
ATOM   9688  CD1 TYR B 404      41.950  52.896  95.483  1.00  0.90           C  
ATOM   9689  CD2 TYR B 404      40.429  51.825  97.028  1.00  0.90           C  
ATOM   9690  CE1 TYR B 404      43.002  52.704  96.393  1.00  0.90           C  
ATOM   9691  CE2 TYR B 404      41.481  51.626  97.934  1.00  0.90           C  
ATOM   9692  CZ  TYR B 404      42.767  52.070  97.617  1.00  0.90           C  
ATOM   9693  OH  TYR B 404      43.828  51.877  98.526  1.00  0.90           O  
ATOM   9694  N   GLU B 405      37.179  53.703  92.977  1.00  0.88           N  
ATOM   9695  CA  GLU B 405      36.139  53.600  91.960  1.00  0.88           C  
ATOM   9696  C   GLU B 405      36.267  54.636  90.837  1.00  0.88           C  
ATOM   9697  O   GLU B 405      36.188  54.321  89.651  1.00  0.88           O  
ATOM   9698  CB  GLU B 405      34.741  53.698  92.637  1.00  0.88           C  
ATOM   9699  CG  GLU B 405      33.923  52.382  92.635  1.00  0.88           C  
ATOM   9700  CD  GLU B 405      33.328  52.102  91.276  1.00  0.88           C  
ATOM   9701  OE1 GLU B 405      34.103  51.973  90.293  1.00  0.88           O  
ATOM   9702  OE2 GLU B 405      32.076  52.040  91.139  1.00  0.88           O  
ATOM   9703  N   ILE B 406      36.543  55.918  91.173  1.00  0.92           N  
ATOM   9704  CA  ILE B 406      36.829  56.965  90.188  1.00  0.92           C  
ATOM   9705  C   ILE B 406      38.070  56.628  89.369  1.00  0.92           C  
ATOM   9706  O   ILE B 406      38.081  56.764  88.143  1.00  0.92           O  
ATOM   9707  CB  ILE B 406      36.982  58.355  90.824  1.00  0.92           C  
ATOM   9708  CG1 ILE B 406      35.664  58.814  91.496  1.00  0.92           C  
ATOM   9709  CG2 ILE B 406      37.395  59.401  89.761  1.00  0.92           C  
ATOM   9710  CD1 ILE B 406      35.848  60.003  92.449  1.00  0.92           C  
ATOM   9711  N   ASN B 407      39.142  56.125  90.025  1.00  0.90           N  
ATOM   9712  CA  ASN B 407      40.347  55.679  89.348  1.00  0.90           C  
ATOM   9713  C   ASN B 407      40.078  54.538  88.376  1.00  0.90           C  
ATOM   9714  O   ASN B 407      40.510  54.591  87.230  1.00  0.90           O  
ATOM   9715  CB  ASN B 407      41.428  55.243  90.382  1.00  0.90           C  
ATOM   9716  CG  ASN B 407      42.805  55.164  89.730  1.00  0.90           C  
ATOM   9717  OD1 ASN B 407      43.137  55.968  88.859  1.00  0.90           O  
ATOM   9718  ND2 ASN B 407      43.658  54.213  90.167  1.00  0.90           N  
ATOM   9719  N   GLN B 408      39.307  53.512  88.791  1.00  0.87           N  
ATOM   9720  CA  GLN B 408      39.025  52.350  87.967  1.00  0.87           C  
ATOM   9721  C   GLN B 408      38.325  52.693  86.660  1.00  0.87           C  
ATOM   9722  O   GLN B 408      38.808  52.378  85.579  1.00  0.87           O  
ATOM   9723  CB  GLN B 408      38.143  51.354  88.762  1.00  0.87           C  
ATOM   9724  CG  GLN B 408      38.199  49.910  88.214  1.00  0.87           C  
ATOM   9725  CD  GLN B 408      39.426  49.181  88.764  1.00  0.87           C  
ATOM   9726  OE1 GLN B 408      40.584  49.520  88.528  1.00  0.87           O  
ATOM   9727  NE2 GLN B 408      39.168  48.141  89.595  1.00  0.87           N  
ATOM   9728  N   LYS B 409      37.228  53.475  86.738  1.00  0.88           N  
ATOM   9729  CA  LYS B 409      36.435  53.901  85.595  1.00  0.88           C  
ATOM   9730  C   LYS B 409      37.218  54.771  84.617  1.00  0.88           C  
ATOM   9731  O   LYS B 409      37.084  54.688  83.396  1.00  0.88           O  
ATOM   9732  CB  LYS B 409      35.200  54.691  86.104  1.00  0.88           C  
ATOM   9733  CG  LYS B 409      34.287  53.882  87.045  1.00  0.88           C  
ATOM   9734  CD  LYS B 409      33.375  52.871  86.327  1.00  0.88           C  
ATOM   9735  CE  LYS B 409      32.720  51.837  87.256  1.00  0.88           C  
ATOM   9736  NZ  LYS B 409      32.278  52.451  88.512  1.00  0.88           N  
ATOM   9737  N   HIS B 410      38.086  55.649  85.155  1.00  0.87           N  
ATOM   9738  CA  HIS B 410      39.046  56.413  84.382  1.00  0.87           C  
ATOM   9739  C   HIS B 410      40.089  55.538  83.684  1.00  0.87           C  
ATOM   9740  O   HIS B 410      40.363  55.724  82.499  1.00  0.87           O  
ATOM   9741  CB  HIS B 410      39.707  57.446  85.320  1.00  0.87           C  
ATOM   9742  CG  HIS B 410      40.866  58.213  84.775  1.00  0.87           C  
ATOM   9743  ND1 HIS B 410      40.753  59.075  83.691  1.00  0.87           N  
ATOM   9744  CD2 HIS B 410      42.121  58.244  85.282  1.00  0.87           C  
ATOM   9745  CE1 HIS B 410      41.960  59.610  83.575  1.00  0.87           C  
ATOM   9746  NE2 HIS B 410      42.817  59.141  84.512  1.00  0.87           N  
ATOM   9747  N   LEU B 411      40.661  54.531  84.374  1.00  0.85           N  
ATOM   9748  CA  LEU B 411      41.567  53.557  83.785  1.00  0.85           C  
ATOM   9749  C   LEU B 411      40.930  52.661  82.728  1.00  0.85           C  
ATOM   9750  O   LEU B 411      41.525  52.468  81.669  1.00  0.85           O  
ATOM   9751  CB  LEU B 411      42.278  52.701  84.861  1.00  0.85           C  
ATOM   9752  CG  LEU B 411      43.251  53.492  85.766  1.00  0.85           C  
ATOM   9753  CD1 LEU B 411      43.833  52.580  86.855  1.00  0.85           C  
ATOM   9754  CD2 LEU B 411      44.390  54.158  84.982  1.00  0.85           C  
ATOM   9755  N   ASP B 412      39.690  52.156  82.933  1.00  0.83           N  
ATOM   9756  CA  ASP B 412      38.941  51.377  81.951  1.00  0.83           C  
ATOM   9757  C   ASP B 412      38.769  52.138  80.632  1.00  0.83           C  
ATOM   9758  O   ASP B 412      38.970  51.617  79.532  1.00  0.83           O  
ATOM   9759  CB  ASP B 412      37.514  51.046  82.473  1.00  0.83           C  
ATOM   9760  CG  ASP B 412      37.521  50.132  83.688  1.00  0.83           C  
ATOM   9761  OD1 ASP B 412      38.307  49.154  83.688  1.00  0.83           O  
ATOM   9762  OD2 ASP B 412      36.685  50.382  84.598  1.00  0.83           O  
ATOM   9763  N   ARG B 413      38.454  53.446  80.734  1.00  0.76           N  
ATOM   9764  CA  ARG B 413      38.382  54.373  79.619  1.00  0.76           C  
ATOM   9765  C   ARG B 413      39.704  54.517  78.860  1.00  0.76           C  
ATOM   9766  O   ARG B 413      39.736  54.505  77.631  1.00  0.76           O  
ATOM   9767  CB  ARG B 413      37.917  55.756  80.162  1.00  0.76           C  
ATOM   9768  CG  ARG B 413      37.749  56.868  79.106  1.00  0.76           C  
ATOM   9769  CD  ARG B 413      37.244  58.217  79.654  1.00  0.76           C  
ATOM   9770  NE  ARG B 413      38.315  58.834  80.520  1.00  0.76           N  
ATOM   9771  CZ  ARG B 413      38.488  60.154  80.707  1.00  0.76           C  
ATOM   9772  NH1 ARG B 413      39.347  60.585  81.628  1.00  0.76           N  
ATOM   9773  NH2 ARG B 413      37.821  61.072  80.009  1.00  0.76           N  
ATOM   9774  N   ILE B 414      40.843  54.631  79.574  1.00  0.81           N  
ATOM   9775  CA  ILE B 414      42.175  54.686  78.978  1.00  0.81           C  
ATOM   9776  C   ILE B 414      42.573  53.377  78.304  1.00  0.81           C  
ATOM   9777  O   ILE B 414      43.116  53.395  77.202  1.00  0.81           O  
ATOM   9778  CB  ILE B 414      43.237  55.130  79.982  1.00  0.81           C  
ATOM   9779  CG1 ILE B 414      42.902  56.536  80.529  1.00  0.81           C  
ATOM   9780  CG2 ILE B 414      44.644  55.156  79.333  1.00  0.81           C  
ATOM   9781  CD1 ILE B 414      43.619  56.835  81.847  1.00  0.81           C  
ATOM   9782  N   VAL B 415      42.275  52.207  78.916  1.00  0.78           N  
ATOM   9783  CA  VAL B 415      42.517  50.886  78.330  1.00  0.78           C  
ATOM   9784  C   VAL B 415      41.773  50.699  77.016  1.00  0.78           C  
ATOM   9785  O   VAL B 415      42.329  50.199  76.043  1.00  0.78           O  
ATOM   9786  CB  VAL B 415      42.145  49.749  79.290  1.00  0.78           C  
ATOM   9787  CG1 VAL B 415      42.250  48.362  78.615  1.00  0.78           C  
ATOM   9788  CG2 VAL B 415      43.094  49.771  80.501  1.00  0.78           C  
ATOM   9789  N   ALA B 416      40.500  51.137  76.938  1.00  0.78           N  
ATOM   9790  CA  ALA B 416      39.731  51.115  75.710  1.00  0.78           C  
ATOM   9791  C   ALA B 416      40.316  51.970  74.581  1.00  0.78           C  
ATOM   9792  O   ALA B 416      40.394  51.536  73.433  1.00  0.78           O  
ATOM   9793  CB  ALA B 416      38.293  51.574  76.027  1.00  0.78           C  
ATOM   9794  N   LEU B 417      40.760  53.206  74.887  1.00  0.77           N  
ATOM   9795  CA  LEU B 417      41.418  54.079  73.926  1.00  0.77           C  
ATOM   9796  C   LEU B 417      42.814  53.627  73.508  1.00  0.77           C  
ATOM   9797  O   LEU B 417      43.173  53.657  72.332  1.00  0.77           O  
ATOM   9798  CB  LEU B 417      41.518  55.518  74.490  1.00  0.77           C  
ATOM   9799  CG  LEU B 417      40.160  56.217  74.708  1.00  0.77           C  
ATOM   9800  CD1 LEU B 417      40.367  57.539  75.462  1.00  0.77           C  
ATOM   9801  CD2 LEU B 417      39.420  56.471  73.385  1.00  0.77           C  
ATOM   9802  N   PHE B 418      43.650  53.186  74.468  1.00  0.76           N  
ATOM   9803  CA  PHE B 418      45.046  52.874  74.219  1.00  0.76           C  
ATOM   9804  C   PHE B 418      45.440  51.501  74.759  1.00  0.76           C  
ATOM   9805  O   PHE B 418      46.146  51.449  75.768  1.00  0.76           O  
ATOM   9806  CB  PHE B 418      45.972  53.923  74.902  1.00  0.76           C  
ATOM   9807  CG  PHE B 418      45.733  55.297  74.347  1.00  0.76           C  
ATOM   9808  CD1 PHE B 418      45.042  56.261  75.100  1.00  0.76           C  
ATOM   9809  CD2 PHE B 418      46.189  55.633  73.062  1.00  0.76           C  
ATOM   9810  CE1 PHE B 418      44.805  57.537  74.574  1.00  0.76           C  
ATOM   9811  CE2 PHE B 418      45.956  56.909  72.535  1.00  0.76           C  
ATOM   9812  CZ  PHE B 418      45.265  57.863  73.293  1.00  0.76           C  
ATOM   9813  N   PRO B 419      45.112  50.357  74.138  1.00  0.79           N  
ATOM   9814  CA  PRO B 419      45.355  49.041  74.741  1.00  0.79           C  
ATOM   9815  C   PRO B 419      46.818  48.646  74.893  1.00  0.79           C  
ATOM   9816  O   PRO B 419      47.092  47.562  75.396  1.00  0.79           O  
ATOM   9817  CB  PRO B 419      44.652  48.057  73.783  1.00  0.79           C  
ATOM   9818  CG  PRO B 419      43.526  48.877  73.157  1.00  0.79           C  
ATOM   9819  CD  PRO B 419      44.133  50.275  73.044  1.00  0.79           C  
ATOM   9820  N   LYS B 420      47.769  49.458  74.391  1.00  0.71           N  
ATOM   9821  CA  LYS B 420      49.172  49.095  74.318  1.00  0.71           C  
ATOM   9822  C   LYS B 420      50.120  50.080  75.011  1.00  0.71           C  
ATOM   9823  O   LYS B 420      51.319  49.817  75.066  1.00  0.71           O  
ATOM   9824  CB  LYS B 420      49.555  48.934  72.819  1.00  0.71           C  
ATOM   9825  CG  LYS B 420      48.986  47.642  72.194  1.00  0.71           C  
ATOM   9826  CD  LYS B 420      48.755  47.717  70.673  1.00  0.71           C  
ATOM   9827  CE  LYS B 420      47.457  48.448  70.303  1.00  0.71           C  
ATOM   9828  NZ  LYS B 420      47.254  48.446  68.834  1.00  0.71           N  
ATOM   9829  N   ASP B 421      49.645  51.204  75.607  1.00  0.76           N  
ATOM   9830  CA  ASP B 421      50.507  52.052  76.435  1.00  0.76           C  
ATOM   9831  C   ASP B 421      50.270  51.673  77.896  1.00  0.76           C  
ATOM   9832  O   ASP B 421      49.380  52.179  78.581  1.00  0.76           O  
ATOM   9833  CB  ASP B 421      50.333  53.583  76.151  1.00  0.76           C  
ATOM   9834  CG  ASP B 421      51.338  54.483  76.883  1.00  0.76           C  
ATOM   9835  OD1 ASP B 421      51.379  55.711  76.587  1.00  0.76           O  
ATOM   9836  OD2 ASP B 421      52.027  53.999  77.819  1.00  0.76           O  
ATOM   9837  N   VAL B 422      51.093  50.737  78.405  1.00  0.80           N  
ATOM   9838  CA  VAL B 422      51.006  50.254  79.772  1.00  0.80           C  
ATOM   9839  C   VAL B 422      51.552  51.247  80.784  1.00  0.80           C  
ATOM   9840  O   VAL B 422      51.164  51.236  81.952  1.00  0.80           O  
ATOM   9841  CB  VAL B 422      51.703  48.906  79.951  1.00  0.80           C  
ATOM   9842  CG1 VAL B 422      50.925  47.835  79.163  1.00  0.80           C  
ATOM   9843  CG2 VAL B 422      53.178  48.953  79.497  1.00  0.80           C  
ATOM   9844  N   ASP B 423      52.441  52.170  80.359  1.00  0.83           N  
ATOM   9845  CA  ASP B 423      52.948  53.220  81.213  1.00  0.83           C  
ATOM   9846  C   ASP B 423      51.860  54.265  81.457  1.00  0.83           C  
ATOM   9847  O   ASP B 423      51.659  54.712  82.583  1.00  0.83           O  
ATOM   9848  CB  ASP B 423      54.251  53.813  80.624  1.00  0.83           C  
ATOM   9849  CG  ASP B 423      54.893  54.746  81.628  1.00  0.83           C  
ATOM   9850  OD1 ASP B 423      54.858  55.983  81.414  1.00  0.83           O  
ATOM   9851  OD2 ASP B 423      55.393  54.241  82.665  1.00  0.83           O  
ATOM   9852  N   ARG B 424      51.068  54.624  80.422  1.00  0.80           N  
ATOM   9853  CA  ARG B 424      49.982  55.597  80.513  1.00  0.80           C  
ATOM   9854  C   ARG B 424      48.944  55.277  81.564  1.00  0.80           C  
ATOM   9855  O   ARG B 424      48.415  56.163  82.230  1.00  0.80           O  
ATOM   9856  CB  ARG B 424      49.295  55.778  79.148  1.00  0.80           C  
ATOM   9857  CG  ARG B 424      48.401  57.016  78.966  1.00  0.80           C  
ATOM   9858  CD  ARG B 424      48.153  57.289  77.476  1.00  0.80           C  
ATOM   9859  NE  ARG B 424      47.456  58.611  77.365  1.00  0.80           N  
ATOM   9860  CZ  ARG B 424      47.696  59.506  76.403  1.00  0.80           C  
ATOM   9861  NH1 ARG B 424      48.623  59.358  75.466  1.00  0.80           N  
ATOM   9862  NH2 ARG B 424      47.035  60.657  76.373  1.00  0.80           N  
ATOM   9863  N   LEU B 425      48.671  53.979  81.777  1.00  0.85           N  
ATOM   9864  CA  LEU B 425      47.820  53.503  82.846  1.00  0.85           C  
ATOM   9865  C   LEU B 425      48.310  53.864  84.247  1.00  0.85           C  
ATOM   9866  O   LEU B 425      47.535  54.332  85.072  1.00  0.85           O  
ATOM   9867  CB  LEU B 425      47.653  51.970  82.730  1.00  0.85           C  
ATOM   9868  CG  LEU B 425      47.068  51.501  81.381  1.00  0.85           C  
ATOM   9869  CD1 LEU B 425      47.019  49.968  81.325  1.00  0.85           C  
ATOM   9870  CD2 LEU B 425      45.674  52.087  81.116  1.00  0.85           C  
ATOM   9871  N   ARG B 426      49.615  53.714  84.565  1.00  0.78           N  
ATOM   9872  CA  ARG B 426      50.144  54.244  85.818  1.00  0.78           C  
ATOM   9873  C   ARG B 426      50.303  55.768  85.799  1.00  0.78           C  
ATOM   9874  O   ARG B 426      50.015  56.448  86.777  1.00  0.78           O  
ATOM   9875  CB  ARG B 426      51.436  53.525  86.299  1.00  0.78           C  
ATOM   9876  CG  ARG B 426      52.714  53.815  85.495  1.00  0.78           C  
ATOM   9877  CD  ARG B 426      53.982  53.216  86.110  1.00  0.78           C  
ATOM   9878  NE  ARG B 426      55.111  53.806  85.328  1.00  0.78           N  
ATOM   9879  CZ  ARG B 426      55.767  54.911  85.698  1.00  0.78           C  
ATOM   9880  NH1 ARG B 426      55.809  55.363  86.944  1.00  0.78           N  
ATOM   9881  NH2 ARG B 426      56.362  55.599  84.724  1.00  0.78           N  
ATOM   9882  N   ARG B 427      50.729  56.347  84.657  1.00  0.85           N  
ATOM   9883  CA  ARG B 427      51.002  57.762  84.448  1.00  0.85           C  
ATOM   9884  C   ARG B 427      49.786  58.669  84.651  1.00  0.85           C  
ATOM   9885  O   ARG B 427      49.901  59.792  85.138  1.00  0.85           O  
ATOM   9886  CB  ARG B 427      51.615  57.920  83.030  1.00  0.85           C  
ATOM   9887  CG  ARG B 427      52.442  59.188  82.746  1.00  0.85           C  
ATOM   9888  CD  ARG B 427      53.384  59.038  81.529  1.00  0.85           C  
ATOM   9889  NE  ARG B 427      52.562  58.983  80.270  1.00  0.85           N  
ATOM   9890  CZ  ARG B 427      52.565  58.000  79.354  1.00  0.85           C  
ATOM   9891  NH1 ARG B 427      53.257  56.876  79.474  1.00  0.85           N  
ATOM   9892  NH2 ARG B 427      51.823  58.126  78.254  1.00  0.85           N  
ATOM   9893  N   MET B 428      48.581  58.183  84.290  1.00  0.90           N  
ATOM   9894  CA  MET B 428      47.321  58.876  84.500  1.00  0.90           C  
ATOM   9895  C   MET B 428      46.509  58.332  85.677  1.00  0.90           C  
ATOM   9896  O   MET B 428      45.361  58.735  85.872  1.00  0.90           O  
ATOM   9897  CB  MET B 428      46.437  58.744  83.234  1.00  0.90           C  
ATOM   9898  CG  MET B 428      47.050  59.366  81.966  1.00  0.90           C  
ATOM   9899  SD  MET B 428      45.966  59.287  80.501  1.00  0.90           S  
ATOM   9900  CE  MET B 428      44.755  60.504  81.080  1.00  0.90           C  
ATOM   9901  N   SER B 429      47.059  57.388  86.470  1.00  0.91           N  
ATOM   9902  CA  SER B 429      46.412  56.836  87.661  1.00  0.91           C  
ATOM   9903  C   SER B 429      46.256  57.845  88.785  1.00  0.91           C  
ATOM   9904  O   SER B 429      47.162  58.605  89.104  1.00  0.91           O  
ATOM   9905  CB  SER B 429      47.197  55.622  88.247  1.00  0.91           C  
ATOM   9906  OG  SER B 429      46.575  55.004  89.384  1.00  0.91           O  
ATOM   9907  N   LEU B 430      45.115  57.811  89.503  1.00  0.92           N  
ATOM   9908  CA  LEU B 430      44.924  58.626  90.691  1.00  0.92           C  
ATOM   9909  C   LEU B 430      45.713  58.090  91.877  1.00  0.92           C  
ATOM   9910  O   LEU B 430      45.900  58.778  92.878  1.00  0.92           O  
ATOM   9911  CB  LEU B 430      43.442  58.689  91.144  1.00  0.92           C  
ATOM   9912  CG  LEU B 430      42.404  59.053  90.065  1.00  0.92           C  
ATOM   9913  CD1 LEU B 430      41.050  59.306  90.740  1.00  0.92           C  
ATOM   9914  CD2 LEU B 430      42.807  60.267  89.224  1.00  0.92           C  
ATOM   9915  N   ILE B 431      46.186  56.834  91.787  1.00  0.91           N  
ATOM   9916  CA  ILE B 431      46.964  56.177  92.819  1.00  0.91           C  
ATOM   9917  C   ILE B 431      48.362  55.934  92.284  1.00  0.91           C  
ATOM   9918  O   ILE B 431      48.554  55.210  91.305  1.00  0.91           O  
ATOM   9919  CB  ILE B 431      46.367  54.838  93.262  1.00  0.91           C  
ATOM   9920  CG1 ILE B 431      44.874  54.961  93.663  1.00  0.91           C  
ATOM   9921  CG2 ILE B 431      47.212  54.231  94.409  1.00  0.91           C  
ATOM   9922  CD1 ILE B 431      44.598  55.889  94.853  1.00  0.91           C  
ATOM   9923  N   GLU B 432      49.370  56.532  92.944  1.00  0.86           N  
ATOM   9924  CA  GLU B 432      50.777  56.248  92.759  1.00  0.86           C  
ATOM   9925  C   GLU B 432      51.075  54.969  93.531  1.00  0.86           C  
ATOM   9926  O   GLU B 432      50.725  54.863  94.707  1.00  0.86           O  
ATOM   9927  CB  GLU B 432      51.641  57.408  93.320  1.00  0.86           C  
ATOM   9928  CG  GLU B 432      51.298  58.802  92.727  1.00  0.86           C  
ATOM   9929  CD  GLU B 432      51.987  59.938  93.462  1.00  0.86           C  
ATOM   9930  OE1 GLU B 432      52.775  59.682  94.412  1.00  0.86           O  
ATOM   9931  OE2 GLU B 432      51.752  61.124  93.109  1.00  0.86           O  
ATOM   9932  N   GLU B 433      51.668  53.948  92.886  1.00  0.76           N  
ATOM   9933  CA  GLU B 433      51.696  52.592  93.423  1.00  0.76           C  
ATOM   9934  C   GLU B 433      53.109  52.220  93.857  1.00  0.76           C  
ATOM   9935  O   GLU B 433      53.344  51.290  94.632  1.00  0.76           O  
ATOM   9936  CB  GLU B 433      51.174  51.652  92.301  1.00  0.76           C  
ATOM   9937  CG  GLU B 433      50.942  50.157  92.649  1.00  0.76           C  
ATOM   9938  CD  GLU B 433      49.732  49.848  93.521  1.00  0.76           C  
ATOM   9939  OE1 GLU B 433      49.104  50.736  94.147  1.00  0.76           O  
ATOM   9940  OE2 GLU B 433      49.443  48.629  93.677  1.00  0.76           O  
ATOM   9941  N   GLU B 434      54.099  53.000  93.388  1.00  0.68           N  
ATOM   9942  CA  GLU B 434      55.517  52.858  93.611  1.00  0.68           C  
ATOM   9943  C   GLU B 434      55.980  52.954  95.071  1.00  0.68           C  
ATOM   9944  O   GLU B 434      56.325  54.014  95.594  1.00  0.68           O  
ATOM   9945  CB  GLU B 434      56.272  53.922  92.766  1.00  0.68           C  
ATOM   9946  CG  GLU B 434      56.231  53.724  91.219  1.00  0.68           C  
ATOM   9947  CD  GLU B 434      54.967  54.154  90.463  1.00  0.68           C  
ATOM   9948  OE1 GLU B 434      55.067  54.202  89.204  1.00  0.68           O  
ATOM   9949  OE2 GLU B 434      53.913  54.437  91.086  1.00  0.68           O  
ATOM   9950  N   GLY B 435      56.070  51.799  95.766  1.00  0.73           N  
ATOM   9951  CA  GLY B 435      56.699  51.688  97.082  1.00  0.73           C  
ATOM   9952  C   GLY B 435      55.818  52.069  98.241  1.00  0.73           C  
ATOM   9953  O   GLY B 435      55.355  51.224  98.999  1.00  0.73           O  
ATOM   9954  N   SER B 436      55.580  53.377  98.419  1.00  0.82           N  
ATOM   9955  CA  SER B 436      54.675  53.908  99.426  1.00  0.82           C  
ATOM   9956  C   SER B 436      53.538  54.504  98.642  1.00  0.82           C  
ATOM   9957  O   SER B 436      53.721  55.492  97.939  1.00  0.82           O  
ATOM   9958  CB  SER B 436      55.347  55.000 100.314  1.00  0.82           C  
ATOM   9959  OG  SER B 436      54.439  55.678 101.193  1.00  0.82           O  
ATOM   9960  N   LYS B 437      52.354  53.868  98.698  1.00  0.86           N  
ATOM   9961  CA  LYS B 437      51.217  54.222  97.875  1.00  0.86           C  
ATOM   9962  C   LYS B 437      50.552  55.539  98.239  1.00  0.86           C  
ATOM   9963  O   LYS B 437      50.321  55.841  99.409  1.00  0.86           O  
ATOM   9964  CB  LYS B 437      50.150  53.115  97.904  1.00  0.86           C  
ATOM   9965  CG  LYS B 437      50.681  51.728  97.531  1.00  0.86           C  
ATOM   9966  CD  LYS B 437      49.508  50.758  97.357  1.00  0.86           C  
ATOM   9967  CE  LYS B 437      49.941  49.367  96.904  1.00  0.86           C  
ATOM   9968  NZ  LYS B 437      48.826  48.705  96.205  1.00  0.86           N  
ATOM   9969  N   ARG B 438      50.202  56.365  97.233  1.00  0.86           N  
ATOM   9970  CA  ARG B 438      49.738  57.718  97.486  1.00  0.86           C  
ATOM   9971  C   ARG B 438      48.656  58.116  96.513  1.00  0.86           C  
ATOM   9972  O   ARG B 438      48.639  57.706  95.358  1.00  0.86           O  
ATOM   9973  CB  ARG B 438      50.873  58.775  97.381  1.00  0.86           C  
ATOM   9974  CG  ARG B 438      52.158  58.356  98.117  1.00  0.86           C  
ATOM   9975  CD  ARG B 438      53.299  59.362  98.053  1.00  0.86           C  
ATOM   9976  NE  ARG B 438      53.057  60.364  99.139  1.00  0.86           N  
ATOM   9977  CZ  ARG B 438      53.598  60.311 100.361  1.00  0.86           C  
ATOM   9978  NH1 ARG B 438      54.324  59.279 100.775  1.00  0.86           N  
ATOM   9979  NH2 ARG B 438      53.369  61.328 101.190  1.00  0.86           N  
ATOM   9980  N   ILE B 439      47.708  58.951  96.963  1.00  0.93           N  
ATOM   9981  CA  ILE B 439      46.670  59.494  96.110  1.00  0.93           C  
ATOM   9982  C   ILE B 439      47.156  60.798  95.511  1.00  0.93           C  
ATOM   9983  O   ILE B 439      47.505  61.735  96.228  1.00  0.93           O  
ATOM   9984  CB  ILE B 439      45.362  59.756  96.848  1.00  0.93           C  
ATOM   9985  CG1 ILE B 439      44.981  58.551  97.738  1.00  0.93           C  
ATOM   9986  CG2 ILE B 439      44.266  60.080  95.804  1.00  0.93           C  
ATOM   9987  CD1 ILE B 439      43.670  58.757  98.498  1.00  0.93           C  
ATOM   9988  N   ASN B 440      47.177  60.903  94.170  1.00  0.93           N  
ATOM   9989  CA  ASN B 440      47.573  62.110  93.481  1.00  0.93           C  
ATOM   9990  C   ASN B 440      46.363  63.036  93.364  1.00  0.93           C  
ATOM   9991  O   ASN B 440      45.456  62.845  92.552  1.00  0.93           O  
ATOM   9992  CB  ASN B 440      48.185  61.765  92.098  1.00  0.93           C  
ATOM   9993  CG  ASN B 440      48.897  62.979  91.512  1.00  0.93           C  
ATOM   9994  OD1 ASN B 440      48.263  63.946  91.077  1.00  0.93           O  
ATOM   9995  ND2 ASN B 440      50.249  62.964  91.542  1.00  0.93           N  
ATOM   9996  N   MET B 441      46.313  64.076  94.219  1.00  0.94           N  
ATOM   9997  CA  MET B 441      45.154  64.940  94.337  1.00  0.94           C  
ATOM   9998  C   MET B 441      44.931  65.830  93.122  1.00  0.94           C  
ATOM   9999  O   MET B 441      43.798  66.144  92.766  1.00  0.94           O  
ATOM  10000  CB  MET B 441      45.214  65.776  95.635  1.00  0.94           C  
ATOM  10001  CG  MET B 441      45.474  64.942  96.910  1.00  0.94           C  
ATOM  10002  SD  MET B 441      44.385  63.502  97.175  1.00  0.94           S  
ATOM  10003  CE  MET B 441      42.946  64.398  97.817  1.00  0.94           C  
ATOM  10004  N   ALA B 442      46.012  66.221  92.414  1.00  0.95           N  
ATOM  10005  CA  ALA B 442      45.927  66.962  91.170  1.00  0.95           C  
ATOM  10006  C   ALA B 442      45.229  66.185  90.059  1.00  0.95           C  
ATOM  10007  O   ALA B 442      44.338  66.697  89.385  1.00  0.95           O  
ATOM  10008  CB  ALA B 442      47.341  67.376  90.720  1.00  0.95           C  
ATOM  10009  N   HIS B 443      45.565  64.888  89.884  1.00  0.92           N  
ATOM  10010  CA  HIS B 443      44.865  64.006  88.959  1.00  0.92           C  
ATOM  10011  C   HIS B 443      43.397  63.803  89.320  1.00  0.92           C  
ATOM  10012  O   HIS B 443      42.530  63.810  88.446  1.00  0.92           O  
ATOM  10013  CB  HIS B 443      45.552  62.632  88.836  1.00  0.92           C  
ATOM  10014  CG  HIS B 443      46.900  62.672  88.184  1.00  0.92           C  
ATOM  10015  ND1 HIS B 443      47.454  61.471  87.816  1.00  0.92           N  
ATOM  10016  CD2 HIS B 443      47.741  63.692  87.868  1.00  0.92           C  
ATOM  10017  CE1 HIS B 443      48.622  61.763  87.288  1.00  0.92           C  
ATOM  10018  NE2 HIS B 443      48.848  63.100  87.292  1.00  0.92           N  
ATOM  10019  N   LEU B 444      43.078  63.667  90.629  1.00  0.95           N  
ATOM  10020  CA  LEU B 444      41.711  63.586  91.134  1.00  0.95           C  
ATOM  10021  C   LEU B 444      40.888  64.825  90.784  1.00  0.95           C  
ATOM  10022  O   LEU B 444      39.750  64.727  90.322  1.00  0.95           O  
ATOM  10023  CB  LEU B 444      41.720  63.361  92.671  1.00  0.95           C  
ATOM  10024  CG  LEU B 444      40.342  63.293  93.373  1.00  0.95           C  
ATOM  10025  CD1 LEU B 444      39.464  62.139  92.865  1.00  0.95           C  
ATOM  10026  CD2 LEU B 444      40.535  63.180  94.893  1.00  0.95           C  
ATOM  10027  N   CYS B 445      41.476  66.031  90.926  1.00  0.96           N  
ATOM  10028  CA  CYS B 445      40.867  67.266  90.465  1.00  0.96           C  
ATOM  10029  C   CYS B 445      40.613  67.317  88.964  1.00  0.96           C  
ATOM  10030  O   CYS B 445      39.536  67.719  88.535  1.00  0.96           O  
ATOM  10031  CB  CYS B 445      41.710  68.507  90.839  1.00  0.96           C  
ATOM  10032  SG  CYS B 445      41.745  68.843  92.624  1.00  0.96           S  
ATOM  10033  N   ILE B 446      41.575  66.892  88.120  1.00  0.94           N  
ATOM  10034  CA  ILE B 446      41.437  66.892  86.663  1.00  0.94           C  
ATOM  10035  C   ILE B 446      40.317  65.986  86.155  1.00  0.94           C  
ATOM  10036  O   ILE B 446      39.530  66.368  85.284  1.00  0.94           O  
ATOM  10037  CB  ILE B 446      42.762  66.526  85.991  1.00  0.94           C  
ATOM  10038  CG1 ILE B 446      43.835  67.599  86.296  1.00  0.94           C  
ATOM  10039  CG2 ILE B 446      42.601  66.370  84.459  1.00  0.94           C  
ATOM  10040  CD1 ILE B 446      45.265  67.097  86.073  1.00  0.94           C  
ATOM  10041  N   VAL B 447      40.188  64.755  86.693  1.00  0.93           N  
ATOM  10042  CA  VAL B 447      39.081  63.874  86.337  1.00  0.93           C  
ATOM  10043  C   VAL B 447      37.728  64.364  86.838  1.00  0.93           C  
ATOM  10044  O   VAL B 447      36.732  64.278  86.129  1.00  0.93           O  
ATOM  10045  CB  VAL B 447      39.307  62.403  86.689  1.00  0.93           C  
ATOM  10046  CG1 VAL B 447      40.587  61.918  85.981  1.00  0.93           C  
ATOM  10047  CG2 VAL B 447      39.409  62.162  88.205  1.00  0.93           C  
ATOM  10048  N   GLY B 448      37.661  64.916  88.070  1.00  0.95           N  
ATOM  10049  CA  GLY B 448      36.414  65.356  88.692  1.00  0.95           C  
ATOM  10050  C   GLY B 448      35.903  66.721  88.326  1.00  0.95           C  
ATOM  10051  O   GLY B 448      34.858  67.124  88.824  1.00  0.95           O  
ATOM  10052  N   SER B 449      36.628  67.474  87.484  1.00  0.95           N  
ATOM  10053  CA  SER B 449      36.299  68.854  87.139  1.00  0.95           C  
ATOM  10054  C   SER B 449      36.108  69.010  85.650  1.00  0.95           C  
ATOM  10055  O   SER B 449      36.847  68.415  84.867  1.00  0.95           O  
ATOM  10056  CB  SER B 449      37.441  69.844  87.488  1.00  0.95           C  
ATOM  10057  OG  SER B 449      37.774  69.783  88.872  1.00  0.95           O  
ATOM  10058  N   HIS B 450      35.134  69.827  85.187  1.00  0.92           N  
ATOM  10059  CA  HIS B 450      35.000  70.163  83.774  1.00  0.92           C  
ATOM  10060  C   HIS B 450      36.112  71.057  83.259  1.00  0.92           C  
ATOM  10061  O   HIS B 450      36.569  70.898  82.129  1.00  0.92           O  
ATOM  10062  CB  HIS B 450      33.633  70.791  83.390  1.00  0.92           C  
ATOM  10063  CG  HIS B 450      33.354  72.165  83.923  1.00  0.92           C  
ATOM  10064  ND1 HIS B 450      33.015  72.289  85.245  1.00  0.92           N  
ATOM  10065  CD2 HIS B 450      33.305  73.379  83.310  1.00  0.92           C  
ATOM  10066  CE1 HIS B 450      32.759  73.565  85.428  1.00  0.92           C  
ATOM  10067  NE2 HIS B 450      32.920  74.277  84.286  1.00  0.92           N  
ATOM  10068  N   ALA B 451      36.565  72.022  84.082  1.00  0.95           N  
ATOM  10069  CA  ALA B 451      37.589  72.977  83.712  1.00  0.95           C  
ATOM  10070  C   ALA B 451      38.798  72.925  84.639  1.00  0.95           C  
ATOM  10071  O   ALA B 451      38.680  72.849  85.863  1.00  0.95           O  
ATOM  10072  CB  ALA B 451      37.000  74.399  83.722  1.00  0.95           C  
ATOM  10073  N   VAL B 452      40.008  72.973  84.052  1.00  0.95           N  
ATOM  10074  CA  VAL B 452      41.274  73.023  84.762  1.00  0.95           C  
ATOM  10075  C   VAL B 452      42.026  74.237  84.256  1.00  0.95           C  
ATOM  10076  O   VAL B 452      42.242  74.392  83.054  1.00  0.95           O  
ATOM  10077  CB  VAL B 452      42.125  71.778  84.512  1.00  0.95           C  
ATOM  10078  CG1 VAL B 452      43.509  71.907  85.186  1.00  0.95           C  
ATOM  10079  CG2 VAL B 452      41.372  70.543  85.046  1.00  0.95           C  
ATOM  10080  N   ASN B 453      42.447  75.162  85.142  1.00  0.92           N  
ATOM  10081  CA  ASN B 453      43.141  76.352  84.692  1.00  0.92           C  
ATOM  10082  C   ASN B 453      44.447  76.641  85.411  1.00  0.92           C  
ATOM  10083  O   ASN B 453      44.619  76.408  86.608  1.00  0.92           O  
ATOM  10084  CB  ASN B 453      42.209  77.593  84.639  1.00  0.92           C  
ATOM  10085  CG  ASN B 453      41.842  78.146  86.012  1.00  0.92           C  
ATOM  10086  OD1 ASN B 453      40.876  77.743  86.658  1.00  0.92           O  
ATOM  10087  ND2 ASN B 453      42.622  79.154  86.461  1.00  0.92           N  
ATOM  10088  N   GLY B 454      45.408  77.204  84.651  1.00  0.94           N  
ATOM  10089  CA  GLY B 454      46.572  77.876  85.212  1.00  0.94           C  
ATOM  10090  C   GLY B 454      46.304  79.343  85.450  1.00  0.94           C  
ATOM  10091  O   GLY B 454      45.260  79.875  85.069  1.00  0.94           O  
ATOM  10092  N   VAL B 455      47.277  80.025  86.082  1.00  0.94           N  
ATOM  10093  CA  VAL B 455      47.154  81.372  86.616  1.00  0.94           C  
ATOM  10094  C   VAL B 455      48.027  82.404  85.902  1.00  0.94           C  
ATOM  10095  O   VAL B 455      48.050  83.580  86.271  1.00  0.94           O  
ATOM  10096  CB  VAL B 455      47.509  81.357  88.101  1.00  0.94           C  
ATOM  10097  CG1 VAL B 455      46.329  80.755  88.886  1.00  0.94           C  
ATOM  10098  CG2 VAL B 455      48.794  80.548  88.378  1.00  0.94           C  
ATOM  10099  N   ALA B 456      48.744  81.998  84.838  1.00  0.95           N  
ATOM  10100  CA  ALA B 456      49.454  82.877  83.928  1.00  0.95           C  
ATOM  10101  C   ALA B 456      49.706  82.069  82.674  1.00  0.95           C  
ATOM  10102  O   ALA B 456      49.698  80.839  82.738  1.00  0.95           O  
ATOM  10103  CB  ALA B 456      50.803  83.384  84.477  1.00  0.95           C  
ATOM  10104  N   LYS B 457      49.921  82.702  81.500  1.00  0.88           N  
ATOM  10105  CA  LYS B 457      50.040  81.973  80.240  1.00  0.88           C  
ATOM  10106  C   LYS B 457      51.181  80.961  80.162  1.00  0.88           C  
ATOM  10107  O   LYS B 457      50.982  79.831  79.719  1.00  0.88           O  
ATOM  10108  CB  LYS B 457      50.165  82.933  79.034  1.00  0.88           C  
ATOM  10109  CG  LYS B 457      48.831  83.568  78.608  1.00  0.88           C  
ATOM  10110  CD  LYS B 457      48.967  84.383  77.309  1.00  0.88           C  
ATOM  10111  CE  LYS B 457      49.720  85.699  77.517  1.00  0.88           C  
ATOM  10112  NZ  LYS B 457      50.067  86.344  76.247  1.00  0.88           N  
ATOM  10113  N   ILE B 458      52.398  81.315  80.625  1.00  0.87           N  
ATOM  10114  CA  ILE B 458      53.544  80.408  80.636  1.00  0.87           C  
ATOM  10115  C   ILE B 458      53.325  79.179  81.520  1.00  0.87           C  
ATOM  10116  O   ILE B 458      53.604  78.045  81.143  1.00  0.87           O  
ATOM  10117  CB  ILE B 458      54.836  81.151  80.985  1.00  0.87           C  
ATOM  10118  CG1 ILE B 458      56.071  80.227  80.851  1.00  0.87           C  
ATOM  10119  CG2 ILE B 458      54.755  81.823  82.374  1.00  0.87           C  
ATOM  10120  CD1 ILE B 458      57.405  80.971  80.974  1.00  0.87           C  
ATOM  10121  N   HIS B 459      52.732  79.375  82.712  1.00  0.88           N  
ATOM  10122  CA  HIS B 459      52.307  78.314  83.606  1.00  0.88           C  
ATOM  10123  C   HIS B 459      51.194  77.454  83.015  1.00  0.88           C  
ATOM  10124  O   HIS B 459      51.209  76.233  83.127  1.00  0.88           O  
ATOM  10125  CB  HIS B 459      51.872  78.939  84.944  1.00  0.88           C  
ATOM  10126  CG  HIS B 459      51.368  77.985  85.974  1.00  0.88           C  
ATOM  10127  ND1 HIS B 459      52.228  77.139  86.640  1.00  0.88           N  
ATOM  10128  CD2 HIS B 459      50.113  77.855  86.461  1.00  0.88           C  
ATOM  10129  CE1 HIS B 459      51.478  76.514  87.526  1.00  0.88           C  
ATOM  10130  NE2 HIS B 459      50.187  76.915  87.459  1.00  0.88           N  
ATOM  10131  N   SER B 460      50.210  78.061  82.318  1.00  0.91           N  
ATOM  10132  CA  SER B 460      49.163  77.336  81.601  1.00  0.91           C  
ATOM  10133  C   SER B 460      49.675  76.405  80.521  1.00  0.91           C  
ATOM  10134  O   SER B 460      49.143  75.306  80.380  1.00  0.91           O  
ATOM  10135  CB  SER B 460      48.102  78.257  80.952  1.00  0.91           C  
ATOM  10136  OG  SER B 460      47.155  78.692  81.928  1.00  0.91           O  
ATOM  10137  N   ASP B 461      50.724  76.788  79.755  1.00  0.85           N  
ATOM  10138  CA  ASP B 461      51.433  75.872  78.869  1.00  0.85           C  
ATOM  10139  C   ASP B 461      52.030  74.699  79.652  1.00  0.85           C  
ATOM  10140  O   ASP B 461      51.755  73.542  79.357  1.00  0.85           O  
ATOM  10141  CB  ASP B 461      52.544  76.648  78.088  1.00  0.85           C  
ATOM  10142  CG  ASP B 461      53.513  75.720  77.360  1.00  0.85           C  
ATOM  10143  OD1 ASP B 461      53.055  74.917  76.511  1.00  0.85           O  
ATOM  10144  OD2 ASP B 461      54.725  75.732  77.715  1.00  0.85           O  
ATOM  10145  N   ILE B 462      52.798  74.963  80.724  1.00  0.84           N  
ATOM  10146  CA  ILE B 462      53.480  73.926  81.488  1.00  0.84           C  
ATOM  10147  C   ILE B 462      52.517  72.938  82.143  1.00  0.84           C  
ATOM  10148  O   ILE B 462      52.719  71.725  82.097  1.00  0.84           O  
ATOM  10149  CB  ILE B 462      54.489  74.536  82.462  1.00  0.84           C  
ATOM  10150  CG1 ILE B 462      55.540  75.364  81.676  1.00  0.84           C  
ATOM  10151  CG2 ILE B 462      55.192  73.433  83.284  1.00  0.84           C  
ATOM  10152  CD1 ILE B 462      56.416  76.259  82.562  1.00  0.84           C  
ATOM  10153  N   VAL B 463      51.397  73.426  82.704  1.00  0.85           N  
ATOM  10154  CA  VAL B 463      50.293  72.599  83.174  1.00  0.85           C  
ATOM  10155  C   VAL B 463      49.647  71.777  82.051  1.00  0.85           C  
ATOM  10156  O   VAL B 463      49.433  70.573  82.197  1.00  0.85           O  
ATOM  10157  CB  VAL B 463      49.263  73.492  83.881  1.00  0.85           C  
ATOM  10158  CG1 VAL B 463      47.958  72.761  84.262  1.00  0.85           C  
ATOM  10159  CG2 VAL B 463      49.904  74.052  85.168  1.00  0.85           C  
ATOM  10160  N   LYS B 464      49.343  72.386  80.883  1.00  0.77           N  
ATOM  10161  CA  LYS B 464      48.668  71.708  79.787  1.00  0.77           C  
ATOM  10162  C   LYS B 464      49.519  70.768  78.941  1.00  0.77           C  
ATOM  10163  O   LYS B 464      49.099  69.654  78.639  1.00  0.77           O  
ATOM  10164  CB  LYS B 464      48.006  72.752  78.844  1.00  0.77           C  
ATOM  10165  CG  LYS B 464      47.147  72.145  77.718  1.00  0.77           C  
ATOM  10166  CD  LYS B 464      46.202  73.166  77.054  1.00  0.77           C  
ATOM  10167  CE  LYS B 464      45.160  72.493  76.147  1.00  0.77           C  
ATOM  10168  NZ  LYS B 464      43.973  73.354  75.945  1.00  0.77           N  
ATOM  10169  N   THR B 465      50.722  71.184  78.508  1.00  0.75           N  
ATOM  10170  CA  THR B 465      51.462  70.504  77.444  1.00  0.75           C  
ATOM  10171  C   THR B 465      52.564  69.627  77.985  1.00  0.75           C  
ATOM  10172  O   THR B 465      53.151  68.827  77.259  1.00  0.75           O  
ATOM  10173  CB  THR B 465      52.110  71.483  76.451  1.00  0.75           C  
ATOM  10174  OG1 THR B 465      53.098  72.313  77.055  1.00  0.75           O  
ATOM  10175  CG2 THR B 465      51.038  72.406  75.854  1.00  0.75           C  
ATOM  10176  N   LYS B 466      52.866  69.745  79.290  1.00  0.81           N  
ATOM  10177  CA  LYS B 466      54.022  69.109  79.890  1.00  0.81           C  
ATOM  10178  C   LYS B 466      53.592  68.289  81.094  1.00  0.81           C  
ATOM  10179  O   LYS B 466      53.580  67.062  81.030  1.00  0.81           O  
ATOM  10180  CB  LYS B 466      55.110  70.178  80.210  1.00  0.81           C  
ATOM  10181  CG  LYS B 466      55.728  70.774  78.923  1.00  0.81           C  
ATOM  10182  CD  LYS B 466      56.329  72.187  79.068  1.00  0.81           C  
ATOM  10183  CE  LYS B 466      56.664  72.810  77.698  1.00  0.81           C  
ATOM  10184  NZ  LYS B 466      56.881  74.272  77.781  1.00  0.81           N  
ATOM  10185  N   VAL B 467      53.207  68.923  82.222  1.00  0.86           N  
ATOM  10186  CA  VAL B 467      52.901  68.233  83.476  1.00  0.86           C  
ATOM  10187  C   VAL B 467      51.717  67.269  83.396  1.00  0.86           C  
ATOM  10188  O   VAL B 467      51.789  66.136  83.867  1.00  0.86           O  
ATOM  10189  CB  VAL B 467      52.684  69.237  84.611  1.00  0.86           C  
ATOM  10190  CG1 VAL B 467      52.395  68.525  85.948  1.00  0.86           C  
ATOM  10191  CG2 VAL B 467      53.952  70.098  84.776  1.00  0.86           C  
ATOM  10192  N   PHE B 468      50.598  67.676  82.762  1.00  0.89           N  
ATOM  10193  CA  PHE B 468      49.403  66.849  82.671  1.00  0.89           C  
ATOM  10194  C   PHE B 468      49.079  66.506  81.229  1.00  0.89           C  
ATOM  10195  O   PHE B 468      47.918  66.323  80.864  1.00  0.89           O  
ATOM  10196  CB  PHE B 468      48.177  67.520  83.336  1.00  0.89           C  
ATOM  10197  CG  PHE B 468      48.463  67.818  84.783  1.00  0.89           C  
ATOM  10198  CD1 PHE B 468      48.481  69.147  85.225  1.00  0.89           C  
ATOM  10199  CD2 PHE B 468      48.718  66.790  85.709  1.00  0.89           C  
ATOM  10200  CE1 PHE B 468      48.749  69.457  86.564  1.00  0.89           C  
ATOM  10201  CE2 PHE B 468      48.994  67.094  87.050  1.00  0.89           C  
ATOM  10202  CZ  PHE B 468      49.007  68.428  87.477  1.00  0.89           C  
ATOM  10203  N   LYS B 469      50.112  66.385  80.370  1.00  0.88           N  
ATOM  10204  CA  LYS B 469      49.989  66.192  78.931  1.00  0.88           C  
ATOM  10205  C   LYS B 469      49.105  65.023  78.507  1.00  0.88           C  
ATOM  10206  O   LYS B 469      48.231  65.151  77.654  1.00  0.88           O  
ATOM  10207  CB  LYS B 469      51.401  65.951  78.349  1.00  0.88           C  
ATOM  10208  CG  LYS B 469      51.457  65.871  76.812  1.00  0.88           C  
ATOM  10209  CD  LYS B 469      52.827  65.397  76.294  1.00  0.88           C  
ATOM  10210  CE  LYS B 469      53.135  63.915  76.577  1.00  0.88           C  
ATOM  10211  NZ  LYS B 469      52.317  63.013  75.742  1.00  0.88           N  
ATOM  10212  N   ASP B 470      49.258  63.843  79.137  1.00  0.90           N  
ATOM  10213  CA  ASP B 470      48.441  62.684  78.845  1.00  0.90           C  
ATOM  10214  C   ASP B 470      46.940  62.893  79.103  1.00  0.90           C  
ATOM  10215  O   ASP B 470      46.103  62.324  78.404  1.00  0.90           O  
ATOM  10216  CB  ASP B 470      48.970  61.467  79.633  1.00  0.90           C  
ATOM  10217  CG  ASP B 470      50.330  61.060  79.112  1.00  0.90           C  
ATOM  10218  OD1 ASP B 470      50.403  60.370  78.063  1.00  0.90           O  
ATOM  10219  OD2 ASP B 470      51.346  61.371  79.778  1.00  0.90           O  
ATOM  10220  N   PHE B 471      46.560  63.721  80.101  1.00  0.90           N  
ATOM  10221  CA  PHE B 471      45.186  64.155  80.317  1.00  0.90           C  
ATOM  10222  C   PHE B 471      44.681  65.118  79.251  1.00  0.90           C  
ATOM  10223  O   PHE B 471      43.556  64.998  78.771  1.00  0.90           O  
ATOM  10224  CB  PHE B 471      45.001  64.855  81.691  1.00  0.90           C  
ATOM  10225  CG  PHE B 471      45.182  63.890  82.826  1.00  0.90           C  
ATOM  10226  CD1 PHE B 471      46.460  63.615  83.341  1.00  0.90           C  
ATOM  10227  CD2 PHE B 471      44.064  63.264  83.404  1.00  0.90           C  
ATOM  10228  CE1 PHE B 471      46.619  62.718  84.404  1.00  0.90           C  
ATOM  10229  CE2 PHE B 471      44.219  62.381  84.479  1.00  0.90           C  
ATOM  10230  CZ  PHE B 471      45.498  62.104  84.974  1.00  0.90           C  
ATOM  10231  N   SER B 472      45.502  66.108  78.844  1.00  0.89           N  
ATOM  10232  CA  SER B 472      45.083  67.149  77.912  1.00  0.89           C  
ATOM  10233  C   SER B 472      44.907  66.660  76.485  1.00  0.89           C  
ATOM  10234  O   SER B 472      44.108  67.207  75.732  1.00  0.89           O  
ATOM  10235  CB  SER B 472      46.019  68.387  77.947  1.00  0.89           C  
ATOM  10236  OG  SER B 472      47.307  68.114  77.398  1.00  0.89           O  
ATOM  10237  N   GLU B 473      45.608  65.577  76.100  1.00  0.80           N  
ATOM  10238  CA  GLU B 473      45.366  64.831  74.875  1.00  0.80           C  
ATOM  10239  C   GLU B 473      43.974  64.196  74.815  1.00  0.80           C  
ATOM  10240  O   GLU B 473      43.310  64.225  73.782  1.00  0.80           O  
ATOM  10241  CB  GLU B 473      46.431  63.716  74.730  1.00  0.80           C  
ATOM  10242  CG  GLU B 473      47.861  64.249  74.468  1.00  0.80           C  
ATOM  10243  CD  GLU B 473      48.944  63.189  74.585  1.00  0.80           C  
ATOM  10244  OE1 GLU B 473      48.635  61.980  74.753  1.00  0.80           O  
ATOM  10245  OE2 GLU B 473      50.137  63.581  74.539  1.00  0.80           O  
ATOM  10246  N   LEU B 474      43.487  63.606  75.932  1.00  0.79           N  
ATOM  10247  CA  LEU B 474      42.126  63.088  76.032  1.00  0.79           C  
ATOM  10248  C   LEU B 474      41.065  64.183  76.033  1.00  0.79           C  
ATOM  10249  O   LEU B 474      40.016  64.040  75.410  1.00  0.79           O  
ATOM  10250  CB  LEU B 474      41.900  62.207  77.299  1.00  0.79           C  
ATOM  10251  CG  LEU B 474      42.257  60.713  77.138  1.00  0.79           C  
ATOM  10252  CD1 LEU B 474      43.764  60.467  77.058  1.00  0.79           C  
ATOM  10253  CD2 LEU B 474      41.659  59.894  78.294  1.00  0.79           C  
ATOM  10254  N   GLU B 475      41.301  65.289  76.765  1.00  0.83           N  
ATOM  10255  CA  GLU B 475      40.308  66.330  76.970  1.00  0.83           C  
ATOM  10256  C   GLU B 475      40.918  67.710  76.681  1.00  0.83           C  
ATOM  10257  O   GLU B 475      41.383  68.376  77.613  1.00  0.83           O  
ATOM  10258  CB  GLU B 475      39.778  66.247  78.435  1.00  0.83           C  
ATOM  10259  CG  GLU B 475      39.051  64.903  78.742  1.00  0.83           C  
ATOM  10260  CD  GLU B 475      38.657  64.695  80.198  1.00  0.83           C  
ATOM  10261  OE1 GLU B 475      39.537  64.691  81.099  1.00  0.83           O  
ATOM  10262  OE2 GLU B 475      37.447  64.508  80.474  1.00  0.83           O  
ATOM  10263  N   PRO B 476      40.946  68.214  75.435  1.00  0.89           N  
ATOM  10264  CA  PRO B 476      41.750  69.388  75.087  1.00  0.89           C  
ATOM  10265  C   PRO B 476      41.227  70.682  75.662  1.00  0.89           C  
ATOM  10266  O   PRO B 476      42.019  71.521  76.097  1.00  0.89           O  
ATOM  10267  CB  PRO B 476      41.715  69.431  73.548  1.00  0.89           C  
ATOM  10268  CG  PRO B 476      41.531  67.966  73.155  1.00  0.89           C  
ATOM  10269  CD  PRO B 476      40.566  67.465  74.228  1.00  0.89           C  
ATOM  10270  N   ASP B 477      39.904  70.878  75.638  1.00  0.82           N  
ATOM  10271  CA  ASP B 477      39.214  72.107  75.973  1.00  0.82           C  
ATOM  10272  C   ASP B 477      39.122  72.337  77.478  1.00  0.82           C  
ATOM  10273  O   ASP B 477      38.940  73.453  77.961  1.00  0.82           O  
ATOM  10274  CB  ASP B 477      37.802  72.040  75.342  1.00  0.82           C  
ATOM  10275  CG  ASP B 477      37.939  71.598  73.894  1.00  0.82           C  
ATOM  10276  OD1 ASP B 477      38.049  72.480  73.012  1.00  0.82           O  
ATOM  10277  OD2 ASP B 477      38.023  70.356  73.691  1.00  0.82           O  
ATOM  10278  N   LYS B 478      39.320  71.258  78.263  1.00  0.88           N  
ATOM  10279  CA  LYS B 478      39.345  71.266  79.714  1.00  0.88           C  
ATOM  10280  C   LYS B 478      40.452  72.143  80.285  1.00  0.88           C  
ATOM  10281  O   LYS B 478      40.257  72.879  81.251  1.00  0.88           O  
ATOM  10282  CB  LYS B 478      39.507  69.804  80.212  1.00  0.88           C  
ATOM  10283  CG  LYS B 478      39.665  69.645  81.735  1.00  0.88           C  
ATOM  10284  CD  LYS B 478      39.565  68.189  82.229  1.00  0.88           C  
ATOM  10285  CE  LYS B 478      38.161  67.579  82.102  1.00  0.88           C  
ATOM  10286  NZ  LYS B 478      38.115  66.266  82.777  1.00  0.88           N  
ATOM  10287  N   PHE B 479      41.648  72.089  79.673  1.00  0.87           N  
ATOM  10288  CA  PHE B 479      42.828  72.786  80.147  1.00  0.87           C  
ATOM  10289  C   PHE B 479      42.960  74.180  79.546  1.00  0.87           C  
ATOM  10290  O   PHE B 479      43.142  74.346  78.336  1.00  0.87           O  
ATOM  10291  CB  PHE B 479      44.104  71.988  79.796  1.00  0.87           C  
ATOM  10292  CG  PHE B 479      44.262  70.804  80.699  1.00  0.87           C  
ATOM  10293  CD1 PHE B 479      43.606  69.589  80.435  1.00  0.87           C  
ATOM  10294  CD2 PHE B 479      45.103  70.898  81.818  1.00  0.87           C  
ATOM  10295  CE1 PHE B 479      43.789  68.487  81.278  1.00  0.87           C  
ATOM  10296  CE2 PHE B 479      45.292  69.798  82.661  1.00  0.87           C  
ATOM  10297  CZ  PHE B 479      44.637  68.592  82.388  1.00  0.87           C  
ATOM  10298  N   GLN B 480      42.915  75.224  80.395  1.00  0.85           N  
ATOM  10299  CA  GLN B 480      42.839  76.601  79.947  1.00  0.85           C  
ATOM  10300  C   GLN B 480      43.624  77.582  80.829  1.00  0.85           C  
ATOM  10301  O   GLN B 480      44.373  77.228  81.742  1.00  0.85           O  
ATOM  10302  CB  GLN B 480      41.356  77.030  79.744  1.00  0.85           C  
ATOM  10303  CG  GLN B 480      40.430  76.791  80.961  1.00  0.85           C  
ATOM  10304  CD  GLN B 480      39.081  77.486  80.758  1.00  0.85           C  
ATOM  10305  OE1 GLN B 480      39.024  78.721  80.779  1.00  0.85           O  
ATOM  10306  NE2 GLN B 480      37.989  76.719  80.561  1.00  0.85           N  
ATOM  10307  N   ASN B 481      43.538  78.884  80.498  1.00  0.90           N  
ATOM  10308  CA  ASN B 481      44.277  79.959  81.129  1.00  0.90           C  
ATOM  10309  C   ASN B 481      43.301  80.935  81.760  1.00  0.90           C  
ATOM  10310  O   ASN B 481      42.291  81.284  81.155  1.00  0.90           O  
ATOM  10311  CB  ASN B 481      45.157  80.650  80.042  1.00  0.90           C  
ATOM  10312  CG  ASN B 481      45.825  81.951  80.483  1.00  0.90           C  
ATOM  10313  OD1 ASN B 481      45.617  82.986  79.854  1.00  0.90           O  
ATOM  10314  ND2 ASN B 481      46.617  81.913  81.572  1.00  0.90           N  
ATOM  10315  N   LYS B 482      43.580  81.375  83.002  1.00  0.92           N  
ATOM  10316  CA  LYS B 482      42.936  82.528  83.605  1.00  0.92           C  
ATOM  10317  C   LYS B 482      44.005  83.314  84.328  1.00  0.92           C  
ATOM  10318  O   LYS B 482      44.315  83.040  85.485  1.00  0.92           O  
ATOM  10319  CB  LYS B 482      41.863  82.124  84.651  1.00  0.92           C  
ATOM  10320  CG  LYS B 482      40.661  81.379  84.062  1.00  0.92           C  
ATOM  10321  CD  LYS B 482      39.758  82.338  83.281  1.00  0.92           C  
ATOM  10322  CE  LYS B 482      38.862  81.663  82.250  1.00  0.92           C  
ATOM  10323  NZ  LYS B 482      39.630  81.309  81.047  1.00  0.92           N  
ATOM  10324  N   THR B 483      44.638  84.299  83.662  1.00  0.95           N  
ATOM  10325  CA  THR B 483      45.744  85.040  84.267  1.00  0.95           C  
ATOM  10326  C   THR B 483      45.315  85.891  85.448  1.00  0.95           C  
ATOM  10327  O   THR B 483      44.373  86.681  85.358  1.00  0.95           O  
ATOM  10328  CB  THR B 483      46.574  85.840  83.270  1.00  0.95           C  
ATOM  10329  OG1 THR B 483      47.155  84.922  82.354  1.00  0.95           O  
ATOM  10330  CG2 THR B 483      47.730  86.598  83.949  1.00  0.95           C  
ATOM  10331  N   ASN B 484      45.994  85.721  86.606  1.00  0.95           N  
ATOM  10332  CA  ASN B 484      45.786  86.447  87.854  1.00  0.95           C  
ATOM  10333  C   ASN B 484      45.593  87.959  87.765  1.00  0.95           C  
ATOM  10334  O   ASN B 484      45.910  88.628  86.780  1.00  0.95           O  
ATOM  10335  CB  ASN B 484      46.922  86.177  88.881  1.00  0.95           C  
ATOM  10336  CG  ASN B 484      46.794  84.791  89.493  1.00  0.95           C  
ATOM  10337  OD1 ASN B 484      45.814  84.072  89.302  1.00  0.95           O  
ATOM  10338  ND2 ASN B 484      47.807  84.412  90.305  1.00  0.95           N  
ATOM  10339  N   GLY B 485      45.053  88.528  88.854  1.00  0.98           N  
ATOM  10340  CA  GLY B 485      44.929  89.957  89.005  1.00  0.98           C  
ATOM  10341  C   GLY B 485      44.858  90.302  90.460  1.00  0.98           C  
ATOM  10342  O   GLY B 485      44.841  89.430  91.328  1.00  0.98           O  
ATOM  10343  N   ILE B 486      44.781  91.604  90.752  1.00  0.96           N  
ATOM  10344  CA  ILE B 486      44.691  92.159  92.086  1.00  0.96           C  
ATOM  10345  C   ILE B 486      43.559  93.167  92.125  1.00  0.96           C  
ATOM  10346  O   ILE B 486      43.201  93.767  91.116  1.00  0.96           O  
ATOM  10347  CB  ILE B 486      45.985  92.864  92.486  1.00  0.96           C  
ATOM  10348  CG1 ILE B 486      46.481  93.801  91.356  1.00  0.96           C  
ATOM  10349  CG2 ILE B 486      47.030  91.780  92.828  1.00  0.96           C  
ATOM  10350  CD1 ILE B 486      47.574  94.769  91.801  1.00  0.96           C  
ATOM  10351  N   THR B 487      42.936  93.395  93.298  1.00  0.96           N  
ATOM  10352  CA  THR B 487      41.901  94.424  93.406  1.00  0.96           C  
ATOM  10353  C   THR B 487      42.514  95.829  93.461  1.00  0.96           C  
ATOM  10354  O   THR B 487      43.367  96.082  94.318  1.00  0.96           O  
ATOM  10355  CB  THR B 487      40.897  94.220  94.550  1.00  0.96           C  
ATOM  10356  OG1 THR B 487      40.073  95.365  94.746  1.00  0.96           O  
ATOM  10357  CG2 THR B 487      41.590  93.938  95.889  1.00  0.96           C  
ATOM  10358  N   PRO B 488      42.127  96.797  92.623  1.00  0.97           N  
ATOM  10359  CA  PRO B 488      42.629  98.162  92.718  1.00  0.97           C  
ATOM  10360  C   PRO B 488      41.988  98.914  93.871  1.00  0.97           C  
ATOM  10361  O   PRO B 488      42.437 100.014  94.187  1.00  0.97           O  
ATOM  10362  CB  PRO B 488      42.254  98.775  91.358  1.00  0.97           C  
ATOM  10363  CG  PRO B 488      40.986  98.028  90.939  1.00  0.97           C  
ATOM  10364  CD  PRO B 488      41.240  96.615  91.467  1.00  0.97           C  
ATOM  10365  N   ARG B 489      40.941  98.379  94.535  1.00  0.90           N  
ATOM  10366  CA  ARG B 489      40.389  99.015  95.721  1.00  0.90           C  
ATOM  10367  C   ARG B 489      41.363  98.942  96.884  1.00  0.90           C  
ATOM  10368  O   ARG B 489      41.692  99.947  97.507  1.00  0.90           O  
ATOM  10369  CB  ARG B 489      39.036  98.387  96.138  1.00  0.90           C  
ATOM  10370  CG  ARG B 489      37.820  98.908  95.342  1.00  0.90           C  
ATOM  10371  CD  ARG B 489      37.753  98.595  93.841  1.00  0.90           C  
ATOM  10372  NE  ARG B 489      37.559  97.128  93.683  1.00  0.90           N  
ATOM  10373  CZ  ARG B 489      37.432  96.502  92.506  1.00  0.90           C  
ATOM  10374  NH1 ARG B 489      37.423  97.134  91.339  1.00  0.90           N  
ATOM  10375  NH2 ARG B 489      37.341  95.179  92.518  1.00  0.90           N  
ATOM  10376  N   ARG B 490      41.919  97.748  97.161  1.00  0.92           N  
ATOM  10377  CA  ARG B 490      42.964  97.624  98.159  1.00  0.92           C  
ATOM  10378  C   ARG B 490      44.328  98.052  97.643  1.00  0.92           C  
ATOM  10379  O   ARG B 490      45.057  98.793  98.297  1.00  0.92           O  
ATOM  10380  CB  ARG B 490      43.036  96.187  98.718  1.00  0.92           C  
ATOM  10381  CG  ARG B 490      44.019  96.055  99.900  1.00  0.92           C  
ATOM  10382  CD  ARG B 490      43.977  94.707 100.616  1.00  0.92           C  
ATOM  10383  NE  ARG B 490      42.634  94.596 101.275  1.00  0.92           N  
ATOM  10384  CZ  ARG B 490      42.443  94.558 102.600  1.00  0.92           C  
ATOM  10385  NH1 ARG B 490      43.402  94.718 103.497  1.00  0.92           N  
ATOM  10386  NH2 ARG B 490      41.199  94.414 103.044  1.00  0.92           N  
ATOM  10387  N   TRP B 491      44.706  97.620  96.423  1.00  0.93           N  
ATOM  10388  CA  TRP B 491      46.080  97.722  95.964  1.00  0.93           C  
ATOM  10389  C   TRP B 491      46.329  98.936  95.086  1.00  0.93           C  
ATOM  10390  O   TRP B 491      47.358  99.038  94.424  1.00  0.93           O  
ATOM  10391  CB  TRP B 491      46.536  96.412  95.274  1.00  0.93           C  
ATOM  10392  CG  TRP B 491      46.412  95.202  96.189  1.00  0.93           C  
ATOM  10393  CD1 TRP B 491      45.507  94.179  96.139  1.00  0.93           C  
ATOM  10394  CD2 TRP B 491      47.182  95.003  97.389  1.00  0.93           C  
ATOM  10395  NE1 TRP B 491      45.662  93.344  97.228  1.00  0.93           N  
ATOM  10396  CE2 TRP B 491      46.669  93.848  98.020  1.00  0.93           C  
ATOM  10397  CE3 TRP B 491      48.221  95.735  97.962  1.00  0.93           C  
ATOM  10398  CZ2 TRP B 491      47.180  93.416  99.237  1.00  0.93           C  
ATOM  10399  CZ3 TRP B 491      48.734  95.296  99.190  1.00  0.93           C  
ATOM  10400  CH2 TRP B 491      48.216  94.158  99.825  1.00  0.93           C  
ATOM  10401  N   LEU B 492      45.409  99.915  95.124  1.00  0.95           N  
ATOM  10402  CA  LEU B 492      45.685 101.266  94.680  1.00  0.95           C  
ATOM  10403  C   LEU B 492      44.999 102.252  95.609  1.00  0.95           C  
ATOM  10404  O   LEU B 492      45.670 103.024  96.287  1.00  0.95           O  
ATOM  10405  CB  LEU B 492      45.275 101.505  93.203  1.00  0.95           C  
ATOM  10406  CG  LEU B 492      45.471 102.947  92.679  1.00  0.95           C  
ATOM  10407  CD1 LEU B 492      46.928 103.425  92.778  1.00  0.95           C  
ATOM  10408  CD2 LEU B 492      44.981 103.058  91.230  1.00  0.95           C  
ATOM  10409  N   LEU B 493      43.647 102.264  95.692  1.00  0.92           N  
ATOM  10410  CA  LEU B 493      42.932 103.302  96.434  1.00  0.92           C  
ATOM  10411  C   LEU B 493      43.217 103.360  97.932  1.00  0.92           C  
ATOM  10412  O   LEU B 493      43.456 104.432  98.483  1.00  0.92           O  
ATOM  10413  CB  LEU B 493      41.391 103.181  96.287  1.00  0.92           C  
ATOM  10414  CG  LEU B 493      40.824 103.167  94.854  1.00  0.92           C  
ATOM  10415  CD1 LEU B 493      39.292 103.209  94.935  1.00  0.92           C  
ATOM  10416  CD2 LEU B 493      41.324 104.333  93.992  1.00  0.92           C  
ATOM  10417  N   LEU B 494      43.195 102.203  98.623  1.00  0.92           N  
ATOM  10418  CA  LEU B 494      43.467 102.110 100.048  1.00  0.92           C  
ATOM  10419  C   LEU B 494      44.922 102.367 100.402  1.00  0.92           C  
ATOM  10420  O   LEU B 494      45.240 103.217 101.230  1.00  0.92           O  
ATOM  10421  CB  LEU B 494      43.037 100.687 100.492  1.00  0.92           C  
ATOM  10422  CG  LEU B 494      42.975 100.370 102.001  1.00  0.92           C  
ATOM  10423  CD1 LEU B 494      42.071  99.149 102.219  1.00  0.92           C  
ATOM  10424  CD2 LEU B 494      44.341 100.084 102.642  1.00  0.92           C  
ATOM  10425  N   CYS B 495      45.859 101.649  99.748  1.00  0.95           N  
ATOM  10426  CA  CYS B 495      47.273 101.747 100.062  1.00  0.95           C  
ATOM  10427  C   CYS B 495      47.932 103.050  99.637  1.00  0.95           C  
ATOM  10428  O   CYS B 495      48.825 103.563 100.307  1.00  0.95           O  
ATOM  10429  CB  CYS B 495      48.062 100.530  99.506  1.00  0.95           C  
ATOM  10430  SG  CYS B 495      48.093 100.379  97.686  1.00  0.95           S  
ATOM  10431  N   ASN B 496      47.513 103.616  98.492  1.00  0.92           N  
ATOM  10432  CA  ASN B 496      48.213 104.705  97.851  1.00  0.92           C  
ATOM  10433  C   ASN B 496      47.237 105.802  97.436  1.00  0.92           C  
ATOM  10434  O   ASN B 496      47.049 106.040  96.236  1.00  0.92           O  
ATOM  10435  CB  ASN B 496      48.948 104.113  96.628  1.00  0.92           C  
ATOM  10436  CG  ASN B 496      50.068 105.004  96.115  1.00  0.92           C  
ATOM  10437  OD1 ASN B 496      50.195 106.194  96.410  1.00  0.92           O  
ATOM  10438  ND2 ASN B 496      50.939 104.385  95.285  1.00  0.92           N  
ATOM  10439  N   PRO B 497      46.590 106.508  98.372  1.00  0.92           N  
ATOM  10440  CA  PRO B 497      45.543 107.469  98.056  1.00  0.92           C  
ATOM  10441  C   PRO B 497      46.053 108.611  97.205  1.00  0.92           C  
ATOM  10442  O   PRO B 497      45.318 109.061  96.334  1.00  0.92           O  
ATOM  10443  CB  PRO B 497      45.021 107.933  99.428  1.00  0.92           C  
ATOM  10444  CG  PRO B 497      46.184 107.673 100.390  1.00  0.92           C  
ATOM  10445  CD  PRO B 497      46.809 106.402  99.819  1.00  0.92           C  
ATOM  10446  N   GLY B 498      47.312 109.061  97.397  1.00  0.89           N  
ATOM  10447  CA  GLY B 498      47.890 110.145  96.609  1.00  0.89           C  
ATOM  10448  C   GLY B 498      48.131 109.796  95.161  1.00  0.89           C  
ATOM  10449  O   GLY B 498      47.951 110.626  94.278  1.00  0.89           O  
ATOM  10450  N   LEU B 499      48.518 108.541  94.838  1.00  0.91           N  
ATOM  10451  CA  LEU B 499      48.602 108.109  93.448  1.00  0.91           C  
ATOM  10452  C   LEU B 499      47.233 107.994  92.808  1.00  0.91           C  
ATOM  10453  O   LEU B 499      47.023 108.417  91.674  1.00  0.91           O  
ATOM  10454  CB  LEU B 499      49.380 106.783  93.282  1.00  0.91           C  
ATOM  10455  CG  LEU B 499      49.705 106.379  91.824  1.00  0.91           C  
ATOM  10456  CD1 LEU B 499      50.596 107.412  91.115  1.00  0.91           C  
ATOM  10457  CD2 LEU B 499      50.375 104.998  91.781  1.00  0.91           C  
ATOM  10458  N   ALA B 500      46.241 107.466  93.552  1.00  0.91           N  
ATOM  10459  CA  ALA B 500      44.862 107.417  93.112  1.00  0.91           C  
ATOM  10460  C   ALA B 500      44.270 108.801  92.835  1.00  0.91           C  
ATOM  10461  O   ALA B 500      43.664 109.032  91.794  1.00  0.91           O  
ATOM  10462  CB  ALA B 500      44.030 106.691  94.187  1.00  0.91           C  
ATOM  10463  N   GLU B 501      44.513 109.770  93.736  1.00  0.83           N  
ATOM  10464  CA  GLU B 501      44.146 111.170  93.608  1.00  0.83           C  
ATOM  10465  C   GLU B 501      44.777 111.844  92.392  1.00  0.83           C  
ATOM  10466  O   GLU B 501      44.097 112.485  91.590  1.00  0.83           O  
ATOM  10467  CB  GLU B 501      44.588 111.849  94.924  1.00  0.83           C  
ATOM  10468  CG  GLU B 501      44.090 113.287  95.191  1.00  0.83           C  
ATOM  10469  CD  GLU B 501      44.411 113.717  96.627  1.00  0.83           C  
ATOM  10470  OE1 GLU B 501      43.808 114.726  97.075  1.00  0.83           O  
ATOM  10471  OE2 GLU B 501      45.233 113.033  97.293  1.00  0.83           O  
ATOM  10472  N   LEU B 502      46.092 111.617  92.166  1.00  0.86           N  
ATOM  10473  CA  LEU B 502      46.831 112.085  91.001  1.00  0.86           C  
ATOM  10474  C   LEU B 502      46.276 111.525  89.683  1.00  0.86           C  
ATOM  10475  O   LEU B 502      46.059 112.247  88.711  1.00  0.86           O  
ATOM  10476  CB  LEU B 502      48.325 111.672  91.176  1.00  0.86           C  
ATOM  10477  CG  LEU B 502      49.431 112.478  90.446  1.00  0.86           C  
ATOM  10478  CD1 LEU B 502      50.491 111.532  89.857  1.00  0.86           C  
ATOM  10479  CD2 LEU B 502      48.947 113.470  89.383  1.00  0.86           C  
ATOM  10480  N   ILE B 503      45.974 110.209  89.622  1.00  0.86           N  
ATOM  10481  CA  ILE B 503      45.327 109.586  88.469  1.00  0.86           C  
ATOM  10482  C   ILE B 503      43.919 110.136  88.239  1.00  0.86           C  
ATOM  10483  O   ILE B 503      43.557 110.495  87.118  1.00  0.86           O  
ATOM  10484  CB  ILE B 503      45.320 108.057  88.597  1.00  0.86           C  
ATOM  10485  CG1 ILE B 503      46.772 107.517  88.553  1.00  0.86           C  
ATOM  10486  CG2 ILE B 503      44.477 107.397  87.481  1.00  0.86           C  
ATOM  10487  CD1 ILE B 503      46.890 106.034  88.929  1.00  0.86           C  
ATOM  10488  N   ALA B 504      43.113 110.281  89.311  1.00  0.88           N  
ATOM  10489  CA  ALA B 504      41.757 110.791  89.262  1.00  0.88           C  
ATOM  10490  C   ALA B 504      41.636 112.208  88.713  1.00  0.88           C  
ATOM  10491  O   ALA B 504      40.751 112.490  87.905  1.00  0.88           O  
ATOM  10492  CB  ALA B 504      41.117 110.707  90.661  1.00  0.88           C  
ATOM  10493  N   GLU B 505      42.557 113.129  89.081  1.00  0.81           N  
ATOM  10494  CA  GLU B 505      42.624 114.449  88.469  1.00  0.81           C  
ATOM  10495  C   GLU B 505      42.856 114.416  86.966  1.00  0.81           C  
ATOM  10496  O   GLU B 505      42.225 115.136  86.196  1.00  0.81           O  
ATOM  10497  CB  GLU B 505      43.853 115.254  88.962  1.00  0.81           C  
ATOM  10498  CG  GLU B 505      43.833 115.823  90.395  1.00  0.81           C  
ATOM  10499  CD  GLU B 505      45.037 116.748  90.585  1.00  0.81           C  
ATOM  10500  OE1 GLU B 505      45.104 117.423  91.636  1.00  0.81           O  
ATOM  10501  OE2 GLU B 505      45.895 116.806  89.658  1.00  0.81           O  
ATOM  10502  N   LYS B 506      43.822 113.596  86.515  1.00  0.83           N  
ATOM  10503  CA  LYS B 506      44.371 113.768  85.190  1.00  0.83           C  
ATOM  10504  C   LYS B 506      43.671 112.925  84.137  1.00  0.83           C  
ATOM  10505  O   LYS B 506      43.803 113.204  82.947  1.00  0.83           O  
ATOM  10506  CB  LYS B 506      45.892 113.465  85.206  1.00  0.83           C  
ATOM  10507  CG  LYS B 506      46.733 114.343  86.166  1.00  0.83           C  
ATOM  10508  CD  LYS B 506      46.579 115.865  85.966  1.00  0.83           C  
ATOM  10509  CE  LYS B 506      47.699 116.738  86.568  1.00  0.83           C  
ATOM  10510  NZ  LYS B 506      47.892 116.518  88.010  1.00  0.83           N  
ATOM  10511  N   ILE B 507      42.867 111.905  84.521  1.00  0.82           N  
ATOM  10512  CA  ILE B 507      42.120 111.127  83.534  1.00  0.82           C  
ATOM  10513  C   ILE B 507      40.681 110.826  83.923  1.00  0.82           C  
ATOM  10514  O   ILE B 507      39.995 110.136  83.167  1.00  0.82           O  
ATOM  10515  CB  ILE B 507      42.783 109.789  83.175  1.00  0.82           C  
ATOM  10516  CG1 ILE B 507      42.957 108.845  84.386  1.00  0.82           C  
ATOM  10517  CG2 ILE B 507      44.127 110.061  82.474  1.00  0.82           C  
ATOM  10518  CD1 ILE B 507      43.164 107.382  83.979  1.00  0.82           C  
ATOM  10519  N   GLY B 508      40.168 111.355  85.056  1.00  0.83           N  
ATOM  10520  CA  GLY B 508      38.856 110.988  85.596  1.00  0.83           C  
ATOM  10521  C   GLY B 508      38.905 109.793  86.518  1.00  0.83           C  
ATOM  10522  O   GLY B 508      39.931 109.136  86.668  1.00  0.83           O  
ATOM  10523  N   GLU B 509      37.778 109.481  87.190  1.00  0.77           N  
ATOM  10524  CA  GLU B 509      37.720 108.481  88.246  1.00  0.77           C  
ATOM  10525  C   GLU B 509      37.184 107.135  87.771  1.00  0.77           C  
ATOM  10526  O   GLU B 509      37.043 106.182  88.539  1.00  0.77           O  
ATOM  10527  CB  GLU B 509      36.882 108.993  89.443  1.00  0.77           C  
ATOM  10528  CG  GLU B 509      35.386 109.259  89.147  1.00  0.77           C  
ATOM  10529  CD  GLU B 509      34.668 109.731  90.409  1.00  0.77           C  
ATOM  10530  OE1 GLU B 509      34.997 110.849  90.883  1.00  0.77           O  
ATOM  10531  OE2 GLU B 509      33.790 108.977  90.904  1.00  0.77           O  
ATOM  10532  N   ASP B 510      36.948 106.995  86.450  1.00  0.78           N  
ATOM  10533  CA  ASP B 510      36.359 105.851  85.771  1.00  0.78           C  
ATOM  10534  C   ASP B 510      37.121 104.548  86.016  1.00  0.78           C  
ATOM  10535  O   ASP B 510      36.569 103.447  86.087  1.00  0.78           O  
ATOM  10536  CB  ASP B 510      36.337 106.095  84.231  1.00  0.78           C  
ATOM  10537  CG  ASP B 510      36.099 107.551  83.857  1.00  0.78           C  
ATOM  10538  OD1 ASP B 510      37.063 108.345  84.037  1.00  0.78           O  
ATOM  10539  OD2 ASP B 510      34.997 107.871  83.361  1.00  0.78           O  
ATOM  10540  N   TYR B 511      38.455 104.690  86.164  1.00  0.88           N  
ATOM  10541  CA  TYR B 511      39.446 103.637  86.213  1.00  0.88           C  
ATOM  10542  C   TYR B 511      39.246 102.581  87.304  1.00  0.88           C  
ATOM  10543  O   TYR B 511      39.746 101.465  87.218  1.00  0.88           O  
ATOM  10544  CB  TYR B 511      40.892 104.219  86.228  1.00  0.88           C  
ATOM  10545  CG  TYR B 511      41.230 104.877  87.539  1.00  0.88           C  
ATOM  10546  CD1 TYR B 511      40.912 106.223  87.772  1.00  0.88           C  
ATOM  10547  CD2 TYR B 511      41.811 104.125  88.573  1.00  0.88           C  
ATOM  10548  CE1 TYR B 511      41.133 106.798  89.032  1.00  0.88           C  
ATOM  10549  CE2 TYR B 511      42.022 104.695  89.835  1.00  0.88           C  
ATOM  10550  CZ  TYR B 511      41.673 106.028  90.063  1.00  0.88           C  
ATOM  10551  OH  TYR B 511      41.841 106.583  91.342  1.00  0.88           O  
ATOM  10552  N   VAL B 512      38.512 102.905  88.383  1.00  0.87           N  
ATOM  10553  CA  VAL B 512      38.249 101.972  89.467  1.00  0.87           C  
ATOM  10554  C   VAL B 512      37.351 100.792  89.075  1.00  0.87           C  
ATOM  10555  O   VAL B 512      37.476  99.697  89.629  1.00  0.87           O  
ATOM  10556  CB  VAL B 512      37.694 102.674  90.700  1.00  0.87           C  
ATOM  10557  CG1 VAL B 512      37.772 101.716  91.905  1.00  0.87           C  
ATOM  10558  CG2 VAL B 512      38.520 103.942  90.999  1.00  0.87           C  
ATOM  10559  N   LYS B 513      36.415 100.981  88.113  1.00  0.77           N  
ATOM  10560  CA  LYS B 513      35.540  99.905  87.651  1.00  0.77           C  
ATOM  10561  C   LYS B 513      35.921  99.372  86.269  1.00  0.77           C  
ATOM  10562  O   LYS B 513      35.496  98.284  85.873  1.00  0.77           O  
ATOM  10563  CB  LYS B 513      34.054 100.359  87.650  1.00  0.77           C  
ATOM  10564  CG  LYS B 513      33.493 100.572  89.070  1.00  0.77           C  
ATOM  10565  CD  LYS B 513      31.957 100.713  89.112  1.00  0.77           C  
ATOM  10566  CE  LYS B 513      31.407 100.697  90.547  1.00  0.77           C  
ATOM  10567  NZ  LYS B 513      29.925 100.693  90.586  1.00  0.77           N  
ATOM  10568  N   ASP B 514      36.781 100.090  85.523  1.00  0.82           N  
ATOM  10569  CA  ASP B 514      37.491  99.532  84.391  1.00  0.82           C  
ATOM  10570  C   ASP B 514      38.927 100.020  84.467  1.00  0.82           C  
ATOM  10571  O   ASP B 514      39.227 101.182  84.215  1.00  0.82           O  
ATOM  10572  CB  ASP B 514      36.840  99.952  83.045  1.00  0.82           C  
ATOM  10573  CG  ASP B 514      37.616  99.453  81.836  1.00  0.82           C  
ATOM  10574  OD1 ASP B 514      37.369  99.988  80.732  1.00  0.82           O  
ATOM  10575  OD2 ASP B 514      38.518  98.585  81.990  1.00  0.82           O  
ATOM  10576  N   LEU B 515      39.887  99.122  84.741  1.00  0.90           N  
ATOM  10577  CA  LEU B 515      41.259  99.538  84.947  1.00  0.90           C  
ATOM  10578  C   LEU B 515      42.000  99.668  83.618  1.00  0.90           C  
ATOM  10579  O   LEU B 515      43.120 100.171  83.552  1.00  0.90           O  
ATOM  10580  CB  LEU B 515      41.959  98.569  85.939  1.00  0.90           C  
ATOM  10581  CG  LEU B 515      43.189  99.148  86.679  1.00  0.90           C  
ATOM  10582  CD1 LEU B 515      42.798 100.250  87.676  1.00  0.90           C  
ATOM  10583  CD2 LEU B 515      43.983  98.055  87.414  1.00  0.90           C  
ATOM  10584  N   SER B 516      41.360  99.312  82.475  1.00  0.89           N  
ATOM  10585  CA  SER B 516      41.949  99.506  81.150  1.00  0.89           C  
ATOM  10586  C   SER B 516      42.059 100.983  80.778  1.00  0.89           C  
ATOM  10587  O   SER B 516      42.912 101.403  79.992  1.00  0.89           O  
ATOM  10588  CB  SER B 516      41.190  98.721  80.043  1.00  0.89           C  
ATOM  10589  OG  SER B 516      39.953  99.324  79.665  1.00  0.89           O  
ATOM  10590  N   GLN B 517      41.242 101.823  81.446  1.00  0.84           N  
ATOM  10591  CA  GLN B 517      41.203 103.265  81.327  1.00  0.84           C  
ATOM  10592  C   GLN B 517      42.467 103.977  81.807  1.00  0.84           C  
ATOM  10593  O   GLN B 517      42.643 105.168  81.557  1.00  0.84           O  
ATOM  10594  CB  GLN B 517      39.979 103.827  82.096  1.00  0.84           C  
ATOM  10595  CG  GLN B 517      38.619 103.234  81.649  1.00  0.84           C  
ATOM  10596  CD  GLN B 517      38.359 103.460  80.159  1.00  0.84           C  
ATOM  10597  OE1 GLN B 517      38.523 104.576  79.656  1.00  0.84           O  
ATOM  10598  NE2 GLN B 517      37.959 102.392  79.435  1.00  0.84           N  
ATOM  10599  N   LEU B 518      43.417 103.269  82.463  1.00  0.89           N  
ATOM  10600  CA  LEU B 518      44.722 103.812  82.823  1.00  0.89           C  
ATOM  10601  C   LEU B 518      45.597 104.122  81.611  1.00  0.89           C  
ATOM  10602  O   LEU B 518      46.503 104.947  81.678  1.00  0.89           O  
ATOM  10603  CB  LEU B 518      45.508 102.855  83.750  1.00  0.89           C  
ATOM  10604  CG  LEU B 518      44.903 102.652  85.153  1.00  0.89           C  
ATOM  10605  CD1 LEU B 518      45.784 101.677  85.941  1.00  0.89           C  
ATOM  10606  CD2 LEU B 518      44.773 103.967  85.935  1.00  0.89           C  
ATOM  10607  N   THR B 519      45.290 103.533  80.439  1.00  0.86           N  
ATOM  10608  CA  THR B 519      45.908 103.849  79.147  1.00  0.86           C  
ATOM  10609  C   THR B 519      45.783 105.317  78.759  1.00  0.86           C  
ATOM  10610  O   THR B 519      46.656 105.894  78.117  1.00  0.86           O  
ATOM  10611  CB  THR B 519      45.360 103.003  78.006  1.00  0.86           C  
ATOM  10612  OG1 THR B 519      43.937 103.015  77.970  1.00  0.86           O  
ATOM  10613  CG2 THR B 519      45.810 101.547  78.191  1.00  0.86           C  
ATOM  10614  N   LYS B 520      44.720 106.006  79.225  1.00  0.79           N  
ATOM  10615  CA  LYS B 520      44.518 107.437  79.049  1.00  0.79           C  
ATOM  10616  C   LYS B 520      45.586 108.306  79.731  1.00  0.79           C  
ATOM  10617  O   LYS B 520      45.687 109.502  79.467  1.00  0.79           O  
ATOM  10618  CB  LYS B 520      43.087 107.825  79.533  1.00  0.79           C  
ATOM  10619  CG  LYS B 520      41.993 107.290  78.586  1.00  0.79           C  
ATOM  10620  CD  LYS B 520      40.660 106.839  79.226  1.00  0.79           C  
ATOM  10621  CE  LYS B 520      39.652 107.910  79.684  1.00  0.79           C  
ATOM  10622  NZ  LYS B 520      39.884 108.317  81.087  1.00  0.79           N  
ATOM  10623  N   LEU B 521      46.454 107.723  80.592  1.00  0.83           N  
ATOM  10624  CA  LEU B 521      47.617 108.401  81.143  1.00  0.83           C  
ATOM  10625  C   LEU B 521      48.755 108.559  80.132  1.00  0.83           C  
ATOM  10626  O   LEU B 521      49.642 109.392  80.315  1.00  0.83           O  
ATOM  10627  CB  LEU B 521      48.176 107.650  82.378  1.00  0.83           C  
ATOM  10628  CG  LEU B 521      47.244 107.628  83.606  1.00  0.83           C  
ATOM  10629  CD1 LEU B 521      47.716 106.567  84.612  1.00  0.83           C  
ATOM  10630  CD2 LEU B 521      47.166 109.002  84.289  1.00  0.83           C  
ATOM  10631  N   HIS B 522      48.746 107.818  78.997  1.00  0.79           N  
ATOM  10632  CA  HIS B 522      49.776 107.919  77.964  1.00  0.79           C  
ATOM  10633  C   HIS B 522      49.811 109.275  77.265  1.00  0.79           C  
ATOM  10634  O   HIS B 522      50.821 109.666  76.688  1.00  0.79           O  
ATOM  10635  CB  HIS B 522      49.628 106.816  76.888  1.00  0.79           C  
ATOM  10636  CG  HIS B 522      50.029 105.444  77.351  1.00  0.79           C  
ATOM  10637  ND1 HIS B 522      49.372 104.348  76.831  1.00  0.79           N  
ATOM  10638  CD2 HIS B 522      51.085 105.038  78.108  1.00  0.79           C  
ATOM  10639  CE1 HIS B 522      50.026 103.300  77.280  1.00  0.79           C  
ATOM  10640  NE2 HIS B 522      51.076 103.658  78.058  1.00  0.79           N  
ATOM  10641  N   SER B 523      48.733 110.075  77.373  1.00  0.77           N  
ATOM  10642  CA  SER B 523      48.679 111.472  76.957  1.00  0.77           C  
ATOM  10643  C   SER B 523      49.730 112.353  77.615  1.00  0.77           C  
ATOM  10644  O   SER B 523      50.204 113.326  77.037  1.00  0.77           O  
ATOM  10645  CB  SER B 523      47.307 112.099  77.304  1.00  0.77           C  
ATOM  10646  OG  SER B 523      46.261 111.351  76.686  1.00  0.77           O  
ATOM  10647  N   PHE B 524      50.134 112.020  78.856  1.00  0.80           N  
ATOM  10648  CA  PHE B 524      51.020 112.835  79.666  1.00  0.80           C  
ATOM  10649  C   PHE B 524      52.483 112.419  79.543  1.00  0.80           C  
ATOM  10650  O   PHE B 524      53.331 112.882  80.299  1.00  0.80           O  
ATOM  10651  CB  PHE B 524      50.606 112.767  81.160  1.00  0.80           C  
ATOM  10652  CG  PHE B 524      49.231 113.350  81.341  1.00  0.80           C  
ATOM  10653  CD1 PHE B 524      48.095 112.524  81.322  1.00  0.80           C  
ATOM  10654  CD2 PHE B 524      49.063 114.735  81.507  1.00  0.80           C  
ATOM  10655  CE1 PHE B 524      46.812 113.070  81.438  1.00  0.80           C  
ATOM  10656  CE2 PHE B 524      47.780 115.286  81.633  1.00  0.80           C  
ATOM  10657  CZ  PHE B 524      46.655 114.454  81.590  1.00  0.80           C  
ATOM  10658  N   LEU B 525      52.846 111.564  78.559  1.00  0.75           N  
ATOM  10659  CA  LEU B 525      54.208 111.063  78.370  1.00  0.75           C  
ATOM  10660  C   LEU B 525      55.275 112.135  78.179  1.00  0.75           C  
ATOM  10661  O   LEU B 525      56.397 112.008  78.663  1.00  0.75           O  
ATOM  10662  CB  LEU B 525      54.273 110.080  77.169  1.00  0.75           C  
ATOM  10663  CG  LEU B 525      53.836 108.637  77.499  1.00  0.75           C  
ATOM  10664  CD1 LEU B 525      53.588 107.844  76.206  1.00  0.75           C  
ATOM  10665  CD2 LEU B 525      54.876 107.906  78.361  1.00  0.75           C  
ATOM  10666  N   GLY B 526      54.959 113.233  77.463  1.00  0.76           N  
ATOM  10667  CA  GLY B 526      55.913 114.321  77.274  1.00  0.76           C  
ATOM  10668  C   GLY B 526      56.014 115.309  78.413  1.00  0.76           C  
ATOM  10669  O   GLY B 526      56.895 116.164  78.399  1.00  0.76           O  
ATOM  10670  N   ASP B 527      55.125 115.232  79.423  1.00  0.75           N  
ATOM  10671  CA  ASP B 527      54.921 116.310  80.372  1.00  0.75           C  
ATOM  10672  C   ASP B 527      55.816 116.219  81.609  1.00  0.75           C  
ATOM  10673  O   ASP B 527      55.707 115.332  82.453  1.00  0.75           O  
ATOM  10674  CB  ASP B 527      53.419 116.377  80.767  1.00  0.75           C  
ATOM  10675  CG  ASP B 527      53.145 117.483  81.770  1.00  0.75           C  
ATOM  10676  OD1 ASP B 527      52.287 117.264  82.658  1.00  0.75           O  
ATOM  10677  OD2 ASP B 527      53.864 118.516  81.730  1.00  0.75           O  
ATOM  10678  N   ASP B 528      56.687 117.226  81.785  1.00  0.77           N  
ATOM  10679  CA  ASP B 528      57.498 117.381  82.969  1.00  0.77           C  
ATOM  10680  C   ASP B 528      56.728 117.901  84.175  1.00  0.77           C  
ATOM  10681  O   ASP B 528      57.241 117.843  85.293  1.00  0.77           O  
ATOM  10682  CB  ASP B 528      58.704 118.305  82.679  1.00  0.77           C  
ATOM  10683  CG  ASP B 528      59.643 117.538  81.790  1.00  0.77           C  
ATOM  10684  OD1 ASP B 528      59.810 117.895  80.600  1.00  0.77           O  
ATOM  10685  OD2 ASP B 528      60.184 116.497  82.253  1.00  0.77           O  
ATOM  10686  N   VAL B 529      55.486 118.422  84.036  1.00  0.82           N  
ATOM  10687  CA  VAL B 529      54.654 118.667  85.208  1.00  0.82           C  
ATOM  10688  C   VAL B 529      54.190 117.354  85.821  1.00  0.82           C  
ATOM  10689  O   VAL B 529      54.508 117.076  86.977  1.00  0.82           O  
ATOM  10690  CB  VAL B 529      53.464 119.576  84.921  1.00  0.82           C  
ATOM  10691  CG1 VAL B 529      52.683 119.881  86.217  1.00  0.82           C  
ATOM  10692  CG2 VAL B 529      53.962 120.886  84.278  1.00  0.82           C  
ATOM  10693  N   PHE B 530      53.545 116.469  85.032  1.00  0.80           N  
ATOM  10694  CA  PHE B 530      53.071 115.170  85.483  1.00  0.80           C  
ATOM  10695  C   PHE B 530      54.174 114.244  85.997  1.00  0.80           C  
ATOM  10696  O   PHE B 530      54.045 113.626  87.053  1.00  0.80           O  
ATOM  10697  CB  PHE B 530      52.266 114.484  84.343  1.00  0.80           C  
ATOM  10698  CG  PHE B 530      51.653 113.185  84.798  1.00  0.80           C  
ATOM  10699  CD1 PHE B 530      50.493 113.175  85.585  1.00  0.80           C  
ATOM  10700  CD2 PHE B 530      52.306 111.972  84.531  1.00  0.80           C  
ATOM  10701  CE1 PHE B 530      49.988 111.972  86.097  1.00  0.80           C  
ATOM  10702  CE2 PHE B 530      51.814 110.772  85.054  1.00  0.80           C  
ATOM  10703  CZ  PHE B 530      50.650 110.767  85.831  1.00  0.80           C  
ATOM  10704  N   LEU B 531      55.324 114.140  85.299  1.00  0.84           N  
ATOM  10705  CA  LEU B 531      56.438 113.316  85.757  1.00  0.84           C  
ATOM  10706  C   LEU B 531      56.996 113.766  87.110  1.00  0.84           C  
ATOM  10707  O   LEU B 531      57.367 112.963  87.964  1.00  0.84           O  
ATOM  10708  CB  LEU B 531      57.569 113.284  84.702  1.00  0.84           C  
ATOM  10709  CG  LEU B 531      57.166 112.652  83.350  1.00  0.84           C  
ATOM  10710  CD1 LEU B 531      58.291 112.845  82.323  1.00  0.84           C  
ATOM  10711  CD2 LEU B 531      56.787 111.171  83.450  1.00  0.84           C  
ATOM  10712  N   ARG B 532      57.036 115.089  87.343  1.00  0.77           N  
ATOM  10713  CA  ARG B 532      57.386 115.690  88.614  1.00  0.77           C  
ATOM  10714  C   ARG B 532      56.361 115.453  89.727  1.00  0.77           C  
ATOM  10715  O   ARG B 532      56.734 115.175  90.867  1.00  0.77           O  
ATOM  10716  CB  ARG B 532      57.662 117.185  88.361  1.00  0.77           C  
ATOM  10717  CG  ARG B 532      58.324 117.969  89.510  1.00  0.77           C  
ATOM  10718  CD  ARG B 532      59.162 119.161  89.017  1.00  0.77           C  
ATOM  10719  NE  ARG B 532      58.271 119.989  88.130  1.00  0.77           N  
ATOM  10720  CZ  ARG B 532      58.564 120.353  86.872  1.00  0.77           C  
ATOM  10721  NH1 ARG B 532      59.791 120.252  86.373  1.00  0.77           N  
ATOM  10722  NH2 ARG B 532      57.596 120.824  86.088  1.00  0.77           N  
ATOM  10723  N   GLU B 533      55.041 115.510  89.426  1.00  0.82           N  
ATOM  10724  CA  GLU B 533      53.976 115.112  90.346  1.00  0.82           C  
ATOM  10725  C   GLU B 533      54.064 113.641  90.746  1.00  0.82           C  
ATOM  10726  O   GLU B 533      53.955 113.282  91.917  1.00  0.82           O  
ATOM  10727  CB  GLU B 533      52.574 115.309  89.714  1.00  0.82           C  
ATOM  10728  CG  GLU B 533      52.186 116.769  89.390  1.00  0.82           C  
ATOM  10729  CD  GLU B 533      50.867 116.829  88.642  1.00  0.82           C  
ATOM  10730  OE1 GLU B 533      50.066 117.758  88.915  1.00  0.82           O  
ATOM  10731  OE2 GLU B 533      50.588 115.945  87.792  1.00  0.82           O  
ATOM  10732  N   LEU B 534      54.312 112.754  89.762  1.00  0.87           N  
ATOM  10733  CA  LEU B 534      54.477 111.320  89.934  1.00  0.87           C  
ATOM  10734  C   LEU B 534      55.644 110.955  90.851  1.00  0.87           C  
ATOM  10735  O   LEU B 534      55.516 110.149  91.776  1.00  0.87           O  
ATOM  10736  CB  LEU B 534      54.677 110.706  88.524  1.00  0.87           C  
ATOM  10737  CG  LEU B 534      54.630 109.171  88.418  1.00  0.87           C  
ATOM  10738  CD1 LEU B 534      53.259 108.621  88.833  1.00  0.87           C  
ATOM  10739  CD2 LEU B 534      54.961 108.749  86.977  1.00  0.87           C  
ATOM  10740  N   ALA B 535      56.799 111.622  90.655  1.00  0.88           N  
ATOM  10741  CA  ALA B 535      57.959 111.541  91.517  1.00  0.88           C  
ATOM  10742  C   ALA B 535      57.706 112.034  92.942  1.00  0.88           C  
ATOM  10743  O   ALA B 535      58.143 111.426  93.920  1.00  0.88           O  
ATOM  10744  CB  ALA B 535      59.096 112.366  90.885  1.00  0.88           C  
ATOM  10745  N   LYS B 536      56.965 113.152  93.096  1.00  0.85           N  
ATOM  10746  CA  LYS B 536      56.578 113.695  94.386  1.00  0.85           C  
ATOM  10747  C   LYS B 536      55.705 112.752  95.207  1.00  0.85           C  
ATOM  10748  O   LYS B 536      55.995 112.500  96.375  1.00  0.85           O  
ATOM  10749  CB  LYS B 536      55.865 115.055  94.179  1.00  0.85           C  
ATOM  10750  CG  LYS B 536      55.343 115.705  95.470  1.00  0.85           C  
ATOM  10751  CD  LYS B 536      54.774 117.112  95.236  1.00  0.85           C  
ATOM  10752  CE  LYS B 536      53.880 117.631  96.371  1.00  0.85           C  
ATOM  10753  NZ  LYS B 536      54.598 117.625  97.650  1.00  0.85           N  
ATOM  10754  N   VAL B 537      54.673 112.137  94.588  1.00  0.90           N  
ATOM  10755  CA  VAL B 537      53.808 111.141  95.216  1.00  0.90           C  
ATOM  10756  C   VAL B 537      54.586 109.915  95.678  1.00  0.90           C  
ATOM  10757  O   VAL B 537      54.395 109.399  96.781  1.00  0.90           O  
ATOM  10758  CB  VAL B 537      52.691 110.721  94.259  1.00  0.90           C  
ATOM  10759  CG1 VAL B 537      51.901 109.504  94.781  1.00  0.90           C  
ATOM  10760  CG2 VAL B 537      51.724 111.907  94.077  1.00  0.90           C  
ATOM  10761  N   LYS B 538      55.538 109.428  94.854  1.00  0.90           N  
ATOM  10762  CA  LYS B 538      56.440 108.359  95.245  1.00  0.90           C  
ATOM  10763  C   LYS B 538      57.294 108.721  96.458  1.00  0.90           C  
ATOM  10764  O   LYS B 538      57.383 107.958  97.419  1.00  0.90           O  
ATOM  10765  CB  LYS B 538      57.348 107.985  94.043  1.00  0.90           C  
ATOM  10766  CG  LYS B 538      58.358 106.847  94.290  1.00  0.90           C  
ATOM  10767  CD  LYS B 538      57.741 105.494  94.693  1.00  0.90           C  
ATOM  10768  CE  LYS B 538      56.818 104.894  93.627  1.00  0.90           C  
ATOM  10769  NZ  LYS B 538      56.304 103.589  94.076  1.00  0.90           N  
ATOM  10770  N   GLN B 539      57.887 109.930  96.473  1.00  0.86           N  
ATOM  10771  CA  GLN B 539      58.684 110.427  97.580  1.00  0.86           C  
ATOM  10772  C   GLN B 539      57.914 110.621  98.885  1.00  0.86           C  
ATOM  10773  O   GLN B 539      58.393 110.286  99.965  1.00  0.86           O  
ATOM  10774  CB  GLN B 539      59.401 111.739  97.179  1.00  0.86           C  
ATOM  10775  CG  GLN B 539      60.513 112.178  98.164  1.00  0.86           C  
ATOM  10776  CD  GLN B 539      61.627 111.134  98.305  1.00  0.86           C  
ATOM  10777  OE1 GLN B 539      61.587 110.254  99.164  1.00  0.86           O  
ATOM  10778  NE2 GLN B 539      62.668 111.231  97.448  1.00  0.86           N  
ATOM  10779  N   GLU B 540      56.677 111.142  98.831  1.00  0.85           N  
ATOM  10780  CA  GLU B 540      55.812 111.286  99.989  1.00  0.85           C  
ATOM  10781  C   GLU B 540      55.429 109.950 100.638  1.00  0.85           C  
ATOM  10782  O   GLU B 540      55.454 109.808 101.863  1.00  0.85           O  
ATOM  10783  CB  GLU B 540      54.631 112.212  99.626  1.00  0.85           C  
ATOM  10784  CG  GLU B 540      55.170 113.653  99.459  1.00  0.85           C  
ATOM  10785  CD  GLU B 540      54.197 114.712  98.959  1.00  0.85           C  
ATOM  10786  OE1 GLU B 540      53.512 114.543  97.925  1.00  0.85           O  
ATOM  10787  OE2 GLU B 540      54.261 115.830  99.545  1.00  0.85           O  
ATOM  10788  N   ASN B 541      55.162 108.896  99.831  1.00  0.88           N  
ATOM  10789  CA  ASN B 541      55.070 107.520 100.318  1.00  0.88           C  
ATOM  10790  C   ASN B 541      56.373 106.986 100.928  1.00  0.88           C  
ATOM  10791  O   ASN B 541      56.362 106.360 101.989  1.00  0.88           O  
ATOM  10792  CB  ASN B 541      54.627 106.546  99.195  1.00  0.88           C  
ATOM  10793  CG  ASN B 541      53.168 106.796  98.830  1.00  0.88           C  
ATOM  10794  OD1 ASN B 541      52.313 106.961  99.699  1.00  0.88           O  
ATOM  10795  ND2 ASN B 541      52.854 106.765  97.516  1.00  0.88           N  
ATOM  10796  N   LYS B 542      57.541 107.246 100.294  1.00  0.88           N  
ATOM  10797  CA  LYS B 542      58.852 106.892 100.830  1.00  0.88           C  
ATOM  10798  C   LYS B 542      59.154 107.555 102.165  1.00  0.88           C  
ATOM  10799  O   LYS B 542      59.572 106.891 103.107  1.00  0.88           O  
ATOM  10800  CB  LYS B 542      59.988 107.221  99.823  1.00  0.88           C  
ATOM  10801  CG  LYS B 542      59.979 106.292  98.602  1.00  0.88           C  
ATOM  10802  CD  LYS B 542      60.886 106.719  97.431  1.00  0.88           C  
ATOM  10803  CE  LYS B 542      62.384 106.737  97.753  1.00  0.88           C  
ATOM  10804  NZ  LYS B 542      63.172 106.673  96.508  1.00  0.88           N  
ATOM  10805  N   LEU B 543      58.878 108.863 102.319  1.00  0.86           N  
ATOM  10806  CA  LEU B 543      59.011 109.582 103.575  1.00  0.86           C  
ATOM  10807  C   LEU B 543      58.132 109.053 104.700  1.00  0.86           C  
ATOM  10808  O   LEU B 543      58.578 108.953 105.844  1.00  0.86           O  
ATOM  10809  CB  LEU B 543      58.747 111.094 103.367  1.00  0.86           C  
ATOM  10810  CG  LEU B 543      60.010 111.878 102.957  1.00  0.86           C  
ATOM  10811  CD1 LEU B 543      59.633 113.249 102.378  1.00  0.86           C  
ATOM  10812  CD2 LEU B 543      60.969 112.055 104.147  1.00  0.86           C  
ATOM  10813  N   LYS B 544      56.865 108.676 104.426  1.00  0.79           N  
ATOM  10814  CA  LYS B 544      56.017 108.028 105.419  1.00  0.79           C  
ATOM  10815  C   LYS B 544      56.548 106.658 105.849  1.00  0.79           C  
ATOM  10816  O   LYS B 544      56.575 106.326 107.034  1.00  0.79           O  
ATOM  10817  CB  LYS B 544      54.546 107.933 104.932  1.00  0.79           C  
ATOM  10818  CG  LYS B 544      53.515 107.762 106.071  1.00  0.79           C  
ATOM  10819  CD  LYS B 544      52.063 107.779 105.549  1.00  0.79           C  
ATOM  10820  CE  LYS B 544      50.956 108.018 106.596  1.00  0.79           C  
ATOM  10821  NZ  LYS B 544      50.876 106.931 107.584  1.00  0.79           N  
ATOM  10822  N   PHE B 545      57.028 105.839 104.889  1.00  0.86           N  
ATOM  10823  CA  PHE B 545      57.659 104.558 105.165  1.00  0.86           C  
ATOM  10824  C   PHE B 545      59.014 104.649 105.887  1.00  0.86           C  
ATOM  10825  O   PHE B 545      59.295 103.869 106.794  1.00  0.86           O  
ATOM  10826  CB  PHE B 545      57.746 103.703 103.870  1.00  0.86           C  
ATOM  10827  CG  PHE B 545      57.922 102.244 104.210  1.00  0.86           C  
ATOM  10828  CD1 PHE B 545      56.908 101.553 104.897  1.00  0.86           C  
ATOM  10829  CD2 PHE B 545      59.114 101.570 103.901  1.00  0.86           C  
ATOM  10830  CE1 PHE B 545      57.095 100.226 105.305  1.00  0.86           C  
ATOM  10831  CE2 PHE B 545      59.300 100.240 104.300  1.00  0.86           C  
ATOM  10832  CZ  PHE B 545      58.298  99.573 105.013  1.00  0.86           C  
ATOM  10833  N   SER B 546      59.881 105.628 105.547  1.00  0.83           N  
ATOM  10834  CA  SER B 546      61.176 105.860 106.196  1.00  0.83           C  
ATOM  10835  C   SER B 546      61.078 106.097 107.684  1.00  0.83           C  
ATOM  10836  O   SER B 546      61.904 105.615 108.453  1.00  0.83           O  
ATOM  10837  CB  SER B 546      61.928 107.097 105.641  1.00  0.83           C  
ATOM  10838  OG  SER B 546      62.362 106.858 104.307  1.00  0.83           O  
ATOM  10839  N   GLN B 547      60.040 106.829 108.133  1.00  0.74           N  
ATOM  10840  CA  GLN B 547      59.757 107.047 109.542  1.00  0.74           C  
ATOM  10841  C   GLN B 547      59.493 105.755 110.304  1.00  0.74           C  
ATOM  10842  O   GLN B 547      60.014 105.559 111.395  1.00  0.74           O  
ATOM  10843  CB  GLN B 547      58.552 108.005 109.687  1.00  0.74           C  
ATOM  10844  CG  GLN B 547      58.892 109.439 109.225  1.00  0.74           C  
ATOM  10845  CD  GLN B 547      57.638 110.304 109.109  1.00  0.74           C  
ATOM  10846  OE1 GLN B 547      57.033 110.730 110.091  1.00  0.74           O  
ATOM  10847  NE2 GLN B 547      57.226 110.584 107.852  1.00  0.74           N  
ATOM  10848  N   PHE B 548      58.727 104.815 109.708  1.00  0.78           N  
ATOM  10849  CA  PHE B 548      58.541 103.470 110.232  1.00  0.78           C  
ATOM  10850  C   PHE B 548      59.854 102.680 110.272  1.00  0.78           C  
ATOM  10851  O   PHE B 548      60.200 102.049 111.263  1.00  0.78           O  
ATOM  10852  CB  PHE B 548      57.466 102.749 109.363  1.00  0.78           C  
ATOM  10853  CG  PHE B 548      57.072 101.399 109.900  1.00  0.78           C  
ATOM  10854  CD1 PHE B 548      56.338 101.294 111.092  1.00  0.78           C  
ATOM  10855  CD2 PHE B 548      57.454 100.224 109.228  1.00  0.78           C  
ATOM  10856  CE1 PHE B 548      55.994 100.038 111.608  1.00  0.78           C  
ATOM  10857  CE2 PHE B 548      57.115  98.966 109.743  1.00  0.78           C  
ATOM  10858  CZ  PHE B 548      56.380  98.874 110.932  1.00  0.78           C  
ATOM  10859  N   LEU B 549      60.676 102.737 109.206  1.00  0.80           N  
ATOM  10860  CA  LEU B 549      61.965 102.062 109.193  1.00  0.80           C  
ATOM  10861  C   LEU B 549      62.939 102.528 110.271  1.00  0.80           C  
ATOM  10862  O   LEU B 549      63.612 101.703 110.884  1.00  0.80           O  
ATOM  10863  CB  LEU B 549      62.657 102.181 107.812  1.00  0.80           C  
ATOM  10864  CG  LEU B 549      61.947 101.434 106.663  1.00  0.80           C  
ATOM  10865  CD1 LEU B 549      62.658 101.725 105.332  1.00  0.80           C  
ATOM  10866  CD2 LEU B 549      61.888  99.918 106.916  1.00  0.80           C  
ATOM  10867  N   GLU B 550      63.025 103.845 110.543  1.00  0.73           N  
ATOM  10868  CA  GLU B 550      63.903 104.375 111.573  1.00  0.73           C  
ATOM  10869  C   GLU B 550      63.374 104.218 113.002  1.00  0.73           C  
ATOM  10870  O   GLU B 550      64.152 104.296 113.952  1.00  0.73           O  
ATOM  10871  CB  GLU B 550      64.267 105.857 111.286  1.00  0.73           C  
ATOM  10872  CG  GLU B 550      65.103 106.024 109.989  1.00  0.73           C  
ATOM  10873  CD  GLU B 550      65.672 107.414 109.779  1.00  0.73           C  
ATOM  10874  OE1 GLU B 550      65.400 108.368 110.550  1.00  0.73           O  
ATOM  10875  OE2 GLU B 550      66.461 107.586 108.807  1.00  0.73           O  
ATOM  10876  N   THR B 551      62.059 103.967 113.231  1.00  0.74           N  
ATOM  10877  CA  THR B 551      61.593 103.569 114.567  1.00  0.74           C  
ATOM  10878  C   THR B 551      61.855 102.114 114.871  1.00  0.74           C  
ATOM  10879  O   THR B 551      62.370 101.785 115.938  1.00  0.74           O  
ATOM  10880  CB  THR B 551      60.119 103.839 114.892  1.00  0.74           C  
ATOM  10881  OG1 THR B 551      59.200 103.236 113.983  1.00  0.74           O  
ATOM  10882  CG2 THR B 551      59.901 105.361 114.854  1.00  0.74           C  
ATOM  10883  N   GLU B 552      61.513 101.207 113.936  1.00  0.71           N  
ATOM  10884  CA  GLU B 552      61.646  99.775 114.133  1.00  0.71           C  
ATOM  10885  C   GLU B 552      63.093  99.293 114.130  1.00  0.71           C  
ATOM  10886  O   GLU B 552      63.492  98.423 114.903  1.00  0.71           O  
ATOM  10887  CB  GLU B 552      60.842  98.988 113.068  1.00  0.71           C  
ATOM  10888  CG  GLU B 552      59.345  99.383 112.957  1.00  0.71           C  
ATOM  10889  CD  GLU B 552      58.565  99.348 114.272  1.00  0.71           C  
ATOM  10890  OE1 GLU B 552      58.393 100.453 114.861  1.00  0.71           O  
ATOM  10891  OE2 GLU B 552      58.103  98.245 114.661  1.00  0.71           O  
ATOM  10892  N   TYR B 553      63.932  99.854 113.237  1.00  0.71           N  
ATOM  10893  CA  TYR B 553      65.292  99.397 113.029  1.00  0.71           C  
ATOM  10894  C   TYR B 553      66.266 100.517 113.323  1.00  0.71           C  
ATOM  10895  O   TYR B 553      66.076 101.659 112.915  1.00  0.71           O  
ATOM  10896  CB  TYR B 553      65.522  98.937 111.560  1.00  0.71           C  
ATOM  10897  CG  TYR B 553      64.515  97.884 111.194  1.00  0.71           C  
ATOM  10898  CD1 TYR B 553      63.484  98.159 110.276  1.00  0.71           C  
ATOM  10899  CD2 TYR B 553      64.538  96.638 111.841  1.00  0.71           C  
ATOM  10900  CE1 TYR B 553      62.473  97.216 110.040  1.00  0.71           C  
ATOM  10901  CE2 TYR B 553      63.520  95.702 111.617  1.00  0.71           C  
ATOM  10902  CZ  TYR B 553      62.486  95.997 110.726  1.00  0.71           C  
ATOM  10903  OH  TYR B 553      61.429  95.083 110.587  1.00  0.71           O  
ATOM  10904  N   LYS B 554      67.386 100.231 114.028  1.00  0.66           N  
ATOM  10905  CA  LYS B 554      68.426 101.231 114.224  1.00  0.66           C  
ATOM  10906  C   LYS B 554      69.271 101.434 112.965  1.00  0.66           C  
ATOM  10907  O   LYS B 554      70.378 100.917 112.816  1.00  0.66           O  
ATOM  10908  CB  LYS B 554      69.347 100.940 115.433  1.00  0.66           C  
ATOM  10909  CG  LYS B 554      70.136 102.193 115.863  1.00  0.66           C  
ATOM  10910  CD  LYS B 554      71.529 101.869 116.421  1.00  0.66           C  
ATOM  10911  CE  LYS B 554      72.330 103.135 116.738  1.00  0.66           C  
ATOM  10912  NZ  LYS B 554      73.733 102.792 117.058  1.00  0.66           N  
ATOM  10913  N   VAL B 555      68.734 102.213 112.021  1.00  0.72           N  
ATOM  10914  CA  VAL B 555      69.307 102.474 110.725  1.00  0.72           C  
ATOM  10915  C   VAL B 555      69.184 103.966 110.498  1.00  0.72           C  
ATOM  10916  O   VAL B 555      68.464 104.658 111.212  1.00  0.72           O  
ATOM  10917  CB  VAL B 555      68.585 101.656 109.645  1.00  0.72           C  
ATOM  10918  CG1 VAL B 555      67.118 102.114 109.478  1.00  0.72           C  
ATOM  10919  CG2 VAL B 555      69.344 101.658 108.300  1.00  0.72           C  
ATOM  10920  N   LYS B 556      69.900 104.520 109.506  1.00  0.72           N  
ATOM  10921  CA  LYS B 556      69.625 105.857 109.036  1.00  0.72           C  
ATOM  10922  C   LYS B 556      69.334 105.740 107.559  1.00  0.72           C  
ATOM  10923  O   LYS B 556      70.147 105.216 106.795  1.00  0.72           O  
ATOM  10924  CB  LYS B 556      70.802 106.838 109.304  1.00  0.72           C  
ATOM  10925  CG  LYS B 556      70.508 108.299 108.910  1.00  0.72           C  
ATOM  10926  CD  LYS B 556      69.389 108.934 109.760  1.00  0.72           C  
ATOM  10927  CE  LYS B 556      68.579 110.000 109.010  1.00  0.72           C  
ATOM  10928  NZ  LYS B 556      67.210 110.054 109.547  1.00  0.72           N  
ATOM  10929  N   ILE B 557      68.139 106.183 107.134  1.00  0.84           N  
ATOM  10930  CA  ILE B 557      67.667 106.036 105.773  1.00  0.84           C  
ATOM  10931  C   ILE B 557      68.042 107.272 104.976  1.00  0.84           C  
ATOM  10932  O   ILE B 557      67.942 108.412 105.430  1.00  0.84           O  
ATOM  10933  CB  ILE B 557      66.163 105.762 105.715  1.00  0.84           C  
ATOM  10934  CG1 ILE B 557      65.780 104.492 106.523  1.00  0.84           C  
ATOM  10935  CG2 ILE B 557      65.658 105.648 104.258  1.00  0.84           C  
ATOM  10936  CD1 ILE B 557      66.388 103.179 106.008  1.00  0.84           C  
ATOM  10937  N   ASN B 558      68.528 107.063 103.739  1.00  0.85           N  
ATOM  10938  CA  ASN B 558      68.893 108.126 102.833  1.00  0.85           C  
ATOM  10939  C   ASN B 558      67.657 108.499 101.997  1.00  0.85           C  
ATOM  10940  O   ASN B 558      67.159 107.632 101.283  1.00  0.85           O  
ATOM  10941  CB  ASN B 558      70.059 107.600 101.952  1.00  0.85           C  
ATOM  10942  CG  ASN B 558      70.670 108.689 101.082  1.00  0.85           C  
ATOM  10943  OD1 ASN B 558      70.204 109.827 101.040  1.00  0.85           O  
ATOM  10944  ND2 ASN B 558      71.762 108.337 100.367  1.00  0.85           N  
ATOM  10945  N   PRO B 559      67.095 109.707 102.010  1.00  0.79           N  
ATOM  10946  CA  PRO B 559      65.818 109.984 101.349  1.00  0.79           C  
ATOM  10947  C   PRO B 559      65.950 110.098  99.838  1.00  0.79           C  
ATOM  10948  O   PRO B 559      64.936 110.163  99.146  1.00  0.79           O  
ATOM  10949  CB  PRO B 559      65.369 111.310 101.988  1.00  0.79           C  
ATOM  10950  CG  PRO B 559      66.674 111.997 102.397  1.00  0.79           C  
ATOM  10951  CD  PRO B 559      67.542 110.823 102.845  1.00  0.79           C  
ATOM  10952  N   SER B 560      67.172 110.129  99.277  1.00  0.85           N  
ATOM  10953  CA  SER B 560      67.350 110.154  97.832  1.00  0.85           C  
ATOM  10954  C   SER B 560      67.595 108.769  97.266  1.00  0.85           C  
ATOM  10955  O   SER B 560      67.607 108.581  96.048  1.00  0.85           O  
ATOM  10956  CB  SER B 560      68.534 111.071  97.423  1.00  0.85           C  
ATOM  10957  OG  SER B 560      69.767 110.643  98.006  1.00  0.85           O  
ATOM  10958  N   SER B 561      67.756 107.745  98.131  1.00  0.93           N  
ATOM  10959  CA  SER B 561      68.036 106.384  97.706  1.00  0.93           C  
ATOM  10960  C   SER B 561      66.934 105.718  96.913  1.00  0.93           C  
ATOM  10961  O   SER B 561      65.743 105.988  97.076  1.00  0.93           O  
ATOM  10962  CB  SER B 561      68.483 105.422  98.842  1.00  0.93           C  
ATOM  10963  OG  SER B 561      67.427 105.111  99.748  1.00  0.93           O  
ATOM  10964  N   MET B 562      67.327 104.804  96.011  1.00  0.93           N  
ATOM  10965  CA  MET B 562      66.422 103.867  95.386  1.00  0.93           C  
ATOM  10966  C   MET B 562      65.938 102.851  96.415  1.00  0.93           C  
ATOM  10967  O   MET B 562      66.734 102.182  97.076  1.00  0.93           O  
ATOM  10968  CB  MET B 562      67.156 103.126  94.243  1.00  0.93           C  
ATOM  10969  CG  MET B 562      66.277 102.196  93.383  1.00  0.93           C  
ATOM  10970  SD  MET B 562      67.215 100.926  92.477  1.00  0.93           S  
ATOM  10971  CE  MET B 562      68.335 102.014  91.554  1.00  0.93           C  
ATOM  10972  N   PHE B 563      64.616 102.709  96.592  1.00  0.95           N  
ATOM  10973  CA  PHE B 563      64.037 101.713  97.466  1.00  0.95           C  
ATOM  10974  C   PHE B 563      63.877 100.435  96.668  1.00  0.95           C  
ATOM  10975  O   PHE B 563      63.059 100.325  95.752  1.00  0.95           O  
ATOM  10976  CB  PHE B 563      62.679 102.164  98.073  1.00  0.95           C  
ATOM  10977  CG  PHE B 563      62.821 103.052  99.292  1.00  0.95           C  
ATOM  10978  CD1 PHE B 563      63.959 103.838  99.575  1.00  0.95           C  
ATOM  10979  CD2 PHE B 563      61.738 103.103 100.188  1.00  0.95           C  
ATOM  10980  CE1 PHE B 563      64.009 104.645 100.718  1.00  0.95           C  
ATOM  10981  CE2 PHE B 563      61.786 103.904 101.336  1.00  0.95           C  
ATOM  10982  CZ  PHE B 563      62.924 104.672 101.598  1.00  0.95           C  
ATOM  10983  N   ASP B 564      64.714  99.453  97.019  1.00  0.98           N  
ATOM  10984  CA  ASP B 564      64.983  98.251  96.278  1.00  0.98           C  
ATOM  10985  C   ASP B 564      64.377  97.110  97.080  1.00  0.98           C  
ATOM  10986  O   ASP B 564      64.821  96.807  98.186  1.00  0.98           O  
ATOM  10987  CB  ASP B 564      66.532  98.231  96.191  1.00  0.98           C  
ATOM  10988  CG  ASP B 564      67.114  97.103  95.377  1.00  0.98           C  
ATOM  10989  OD1 ASP B 564      66.346  96.273  94.850  1.00  0.98           O  
ATOM  10990  OD2 ASP B 564      68.368  97.103  95.238  1.00  0.98           O  
ATOM  10991  N   VAL B 565      63.258  96.524  96.604  1.00  0.98           N  
ATOM  10992  CA  VAL B 565      62.379  95.780  97.493  1.00  0.98           C  
ATOM  10993  C   VAL B 565      62.001  94.415  96.955  1.00  0.98           C  
ATOM  10994  O   VAL B 565      61.414  94.263  95.881  1.00  0.98           O  
ATOM  10995  CB  VAL B 565      61.105  96.555  97.844  1.00  0.98           C  
ATOM  10996  CG1 VAL B 565      60.281  95.809  98.913  1.00  0.98           C  
ATOM  10997  CG2 VAL B 565      61.476  97.955  98.375  1.00  0.98           C  
ATOM  10998  N   GLN B 566      62.275  93.366  97.759  1.00  0.96           N  
ATOM  10999  CA  GLN B 566      61.721  92.050  97.539  1.00  0.96           C  
ATOM  11000  C   GLN B 566      60.914  91.621  98.750  1.00  0.96           C  
ATOM  11001  O   GLN B 566      61.460  91.227  99.779  1.00  0.96           O  
ATOM  11002  CB  GLN B 566      62.820  90.992  97.272  1.00  0.96           C  
ATOM  11003  CG  GLN B 566      62.204  89.693  96.700  1.00  0.96           C  
ATOM  11004  CD  GLN B 566      63.189  88.584  96.332  1.00  0.96           C  
ATOM  11005  OE1 GLN B 566      62.774  87.425  96.251  1.00  0.96           O  
ATOM  11006  NE2 GLN B 566      64.476  88.908  96.094  1.00  0.96           N  
ATOM  11007  N   VAL B 567      59.569  91.652  98.657  1.00  0.97           N  
ATOM  11008  CA  VAL B 567      58.719  91.183  99.742  1.00  0.97           C  
ATOM  11009  C   VAL B 567      57.769  90.088  99.263  1.00  0.97           C  
ATOM  11010  O   VAL B 567      56.750  90.311  98.603  1.00  0.97           O  
ATOM  11011  CB  VAL B 567      57.999  92.305 100.491  1.00  0.97           C  
ATOM  11012  CG1 VAL B 567      59.013  93.086 101.351  1.00  0.97           C  
ATOM  11013  CG2 VAL B 567      57.273  93.272  99.541  1.00  0.97           C  
ATOM  11014  N   LYS B 568      58.110  88.833  99.611  1.00  0.91           N  
ATOM  11015  CA  LYS B 568      57.386  87.630  99.250  1.00  0.91           C  
ATOM  11016  C   LYS B 568      57.889  86.530 100.177  1.00  0.91           C  
ATOM  11017  O   LYS B 568      58.908  86.705 100.838  1.00  0.91           O  
ATOM  11018  CB  LYS B 568      57.516  87.251  97.738  1.00  0.91           C  
ATOM  11019  CG  LYS B 568      58.956  87.158  97.194  1.00  0.91           C  
ATOM  11020  CD  LYS B 568      59.061  86.668  95.729  1.00  0.91           C  
ATOM  11021  CE  LYS B 568      58.556  87.631  94.650  1.00  0.91           C  
ATOM  11022  NZ  LYS B 568      58.576  86.978  93.316  1.00  0.91           N  
ATOM  11023  N   ARG B 569      57.192  85.372 100.299  1.00  0.89           N  
ATOM  11024  CA  ARG B 569      57.620  84.282 101.178  1.00  0.89           C  
ATOM  11025  C   ARG B 569      59.014  83.744 100.849  1.00  0.89           C  
ATOM  11026  O   ARG B 569      59.419  83.690  99.688  1.00  0.89           O  
ATOM  11027  CB  ARG B 569      56.608  83.103 101.174  1.00  0.89           C  
ATOM  11028  CG  ARG B 569      55.206  83.426 101.747  1.00  0.89           C  
ATOM  11029  CD  ARG B 569      55.130  83.681 103.260  1.00  0.89           C  
ATOM  11030  NE  ARG B 569      55.592  82.450 103.988  1.00  0.89           N  
ATOM  11031  CZ  ARG B 569      54.800  81.485 104.481  1.00  0.89           C  
ATOM  11032  NH1 ARG B 569      53.483  81.530 104.359  1.00  0.89           N  
ATOM  11033  NH2 ARG B 569      55.351  80.458 105.127  1.00  0.89           N  
ATOM  11034  N   ILE B 570      59.806  83.367 101.876  1.00  0.95           N  
ATOM  11035  CA  ILE B 570      61.202  82.993 101.682  1.00  0.95           C  
ATOM  11036  C   ILE B 570      61.328  81.608 101.075  1.00  0.95           C  
ATOM  11037  O   ILE B 570      60.823  80.628 101.620  1.00  0.95           O  
ATOM  11038  CB  ILE B 570      62.039  83.095 102.955  1.00  0.95           C  
ATOM  11039  CG1 ILE B 570      61.832  84.447 103.683  1.00  0.95           C  
ATOM  11040  CG2 ILE B 570      63.535  82.868 102.633  1.00  0.95           C  
ATOM  11041  CD1 ILE B 570      62.174  85.701 102.868  1.00  0.95           C  
ATOM  11042  N   HIS B 571      61.992  81.504  99.907  1.00  0.92           N  
ATOM  11043  CA  HIS B 571      62.066  80.258  99.175  1.00  0.92           C  
ATOM  11044  C   HIS B 571      63.319  80.192  98.340  1.00  0.92           C  
ATOM  11045  O   HIS B 571      63.801  81.192  97.811  1.00  0.92           O  
ATOM  11046  CB  HIS B 571      60.909  80.126  98.159  1.00  0.92           C  
ATOM  11047  CG  HIS B 571      59.645  79.557  98.694  1.00  0.92           C  
ATOM  11048  ND1 HIS B 571      59.504  78.183  98.717  1.00  0.92           N  
ATOM  11049  CD2 HIS B 571      58.471  80.163  99.003  1.00  0.92           C  
ATOM  11050  CE1 HIS B 571      58.239  77.979  99.041  1.00  0.92           C  
ATOM  11051  NE2 HIS B 571      57.572  79.146  99.216  1.00  0.92           N  
ATOM  11052  N   GLU B 572      63.832  78.969  98.121  1.00  0.93           N  
ATOM  11053  CA  GLU B 572      64.925  78.714  97.202  1.00  0.93           C  
ATOM  11054  C   GLU B 572      64.597  79.097  95.761  1.00  0.93           C  
ATOM  11055  O   GLU B 572      65.374  79.771  95.090  1.00  0.93           O  
ATOM  11056  CB  GLU B 572      65.293  77.220  97.262  1.00  0.93           C  
ATOM  11057  CG  GLU B 572      65.776  76.759  98.656  1.00  0.93           C  
ATOM  11058  CD  GLU B 572      65.967  75.243  98.704  1.00  0.93           C  
ATOM  11059  OE1 GLU B 572      66.398  74.658  97.678  1.00  0.93           O  
ATOM  11060  OE2 GLU B 572      65.676  74.671  99.786  1.00  0.93           O  
ATOM  11061  N   TYR B 573      63.387  78.733  95.275  1.00  0.90           N  
ATOM  11062  CA  TYR B 573      62.908  79.072  93.942  1.00  0.90           C  
ATOM  11063  C   TYR B 573      62.705  80.567  93.690  1.00  0.90           C  
ATOM  11064  O   TYR B 573      62.975  81.087  92.609  1.00  0.90           O  
ATOM  11065  CB  TYR B 573      61.665  78.211  93.550  1.00  0.90           C  
ATOM  11066  CG  TYR B 573      60.306  78.725  93.959  1.00  0.90           C  
ATOM  11067  CD1 TYR B 573      59.648  79.632  93.114  1.00  0.90           C  
ATOM  11068  CD2 TYR B 573      59.629  78.243  95.094  1.00  0.90           C  
ATOM  11069  CE1 TYR B 573      58.333  80.026  93.371  1.00  0.90           C  
ATOM  11070  CE2 TYR B 573      58.299  78.626  95.344  1.00  0.90           C  
ATOM  11071  CZ  TYR B 573      57.648  79.498  94.464  1.00  0.90           C  
ATOM  11072  OH  TYR B 573      56.301  79.867  94.643  1.00  0.90           O  
ATOM  11073  N   LYS B 574      62.217  81.303  94.712  1.00  0.92           N  
ATOM  11074  CA  LYS B 574      61.964  82.730  94.622  1.00  0.92           C  
ATOM  11075  C   LYS B 574      63.243  83.549  94.704  1.00  0.92           C  
ATOM  11076  O   LYS B 574      63.286  84.678  94.221  1.00  0.92           O  
ATOM  11077  CB  LYS B 574      60.963  83.177  95.716  1.00  0.92           C  
ATOM  11078  CG  LYS B 574      59.559  82.575  95.512  1.00  0.92           C  
ATOM  11079  CD  LYS B 574      58.564  82.983  96.614  1.00  0.92           C  
ATOM  11080  CE  LYS B 574      57.117  82.483  96.469  1.00  0.92           C  
ATOM  11081  NZ  LYS B 574      56.639  82.625  95.087  1.00  0.92           N  
ATOM  11082  N   ARG B 575      64.322  82.947  95.251  1.00  0.92           N  
ATOM  11083  CA  ARG B 575      65.692  83.403  95.120  1.00  0.92           C  
ATOM  11084  C   ARG B 575      66.056  84.675  95.882  1.00  0.92           C  
ATOM  11085  O   ARG B 575      66.862  85.482  95.420  1.00  0.92           O  
ATOM  11086  CB  ARG B 575      66.136  83.509  93.636  1.00  0.92           C  
ATOM  11087  CG  ARG B 575      66.296  82.173  92.880  1.00  0.92           C  
ATOM  11088  CD  ARG B 575      66.088  82.402  91.380  1.00  0.92           C  
ATOM  11089  NE  ARG B 575      67.091  81.660  90.557  1.00  0.92           N  
ATOM  11090  CZ  ARG B 575      67.369  82.017  89.299  1.00  0.92           C  
ATOM  11091  NH1 ARG B 575      66.850  83.082  88.698  1.00  0.92           N  
ATOM  11092  NH2 ARG B 575      68.201  81.294  88.561  1.00  0.92           N  
ATOM  11093  N   GLN B 576      65.598  84.839  97.146  1.00  0.94           N  
ATOM  11094  CA  GLN B 576      66.087  85.898  98.033  1.00  0.94           C  
ATOM  11095  C   GLN B 576      67.601  85.823  98.251  1.00  0.94           C  
ATOM  11096  O   GLN B 576      68.293  86.824  98.424  1.00  0.94           O  
ATOM  11097  CB  GLN B 576      65.387  85.889  99.418  1.00  0.94           C  
ATOM  11098  CG  GLN B 576      63.898  86.313  99.393  1.00  0.94           C  
ATOM  11099  CD  GLN B 576      62.927  85.180  99.057  1.00  0.94           C  
ATOM  11100  OE1 GLN B 576      63.283  84.023  98.825  1.00  0.94           O  
ATOM  11101  NE2 GLN B 576      61.618  85.517  99.100  1.00  0.94           N  
ATOM  11102  N   LEU B 577      68.154  84.598  98.180  1.00  0.94           N  
ATOM  11103  CA  LEU B 577      69.573  84.310  98.181  1.00  0.94           C  
ATOM  11104  C   LEU B 577      70.354  84.972  97.040  1.00  0.94           C  
ATOM  11105  O   LEU B 577      71.425  85.528  97.263  1.00  0.94           O  
ATOM  11106  CB  LEU B 577      69.738  82.771  98.126  1.00  0.94           C  
ATOM  11107  CG  LEU B 577      71.172  82.222  98.264  1.00  0.94           C  
ATOM  11108  CD1 LEU B 577      71.874  82.716  99.536  1.00  0.94           C  
ATOM  11109  CD2 LEU B 577      71.129  80.687  98.258  1.00  0.94           C  
ATOM  11110  N   LEU B 578      69.825  84.983  95.794  1.00  0.95           N  
ATOM  11111  CA  LEU B 578      70.452  85.622  94.638  1.00  0.95           C  
ATOM  11112  C   LEU B 578      70.553  87.143  94.815  1.00  0.95           C  
ATOM  11113  O   LEU B 578      71.589  87.765  94.582  1.00  0.95           O  
ATOM  11114  CB  LEU B 578      69.634  85.258  93.365  1.00  0.95           C  
ATOM  11115  CG  LEU B 578      70.335  85.254  91.978  1.00  0.95           C  
ATOM  11116  CD1 LEU B 578      69.393  85.818  90.901  1.00  0.95           C  
ATOM  11117  CD2 LEU B 578      71.696  85.958  91.905  1.00  0.95           C  
ATOM  11118  N   ASN B 579      69.468  87.763  95.327  1.00  0.97           N  
ATOM  11119  CA  ASN B 579      69.389  89.167  95.705  1.00  0.97           C  
ATOM  11120  C   ASN B 579      70.401  89.513  96.803  1.00  0.97           C  
ATOM  11121  O   ASN B 579      71.122  90.504  96.717  1.00  0.97           O  
ATOM  11122  CB  ASN B 579      67.909  89.433  96.099  1.00  0.97           C  
ATOM  11123  CG  ASN B 579      67.490  90.870  96.418  1.00  0.97           C  
ATOM  11124  OD1 ASN B 579      66.570  91.036  97.221  1.00  0.97           O  
ATOM  11125  ND2 ASN B 579      68.099  91.891  95.787  1.00  0.97           N  
ATOM  11126  N   CYS B 580      70.552  88.640  97.821  1.00  0.96           N  
ATOM  11127  CA  CYS B 580      71.586  88.760  98.842  1.00  0.96           C  
ATOM  11128  C   CYS B 580      73.015  88.728  98.289  1.00  0.96           C  
ATOM  11129  O   CYS B 580      73.859  89.520  98.704  1.00  0.96           O  
ATOM  11130  CB  CYS B 580      71.403  87.674  99.939  1.00  0.96           C  
ATOM  11131  SG  CYS B 580      72.362  88.006 101.465  1.00  0.96           S  
ATOM  11132  N   LEU B 581      73.323  87.860  97.291  1.00  0.94           N  
ATOM  11133  CA  LEU B 581      74.627  87.857  96.630  1.00  0.94           C  
ATOM  11134  C   LEU B 581      74.960  89.195  95.973  1.00  0.94           C  
ATOM  11135  O   LEU B 581      76.056  89.722  96.140  1.00  0.94           O  
ATOM  11136  CB  LEU B 581      74.760  86.768  95.524  1.00  0.94           C  
ATOM  11137  CG  LEU B 581      74.565  85.299  95.958  1.00  0.94           C  
ATOM  11138  CD1 LEU B 581      74.771  84.365  94.753  1.00  0.94           C  
ATOM  11139  CD2 LEU B 581      75.492  84.871  97.104  1.00  0.94           C  
ATOM  11140  N   HIS B 582      73.993  89.814  95.258  1.00  0.94           N  
ATOM  11141  CA  HIS B 582      74.156  91.135  94.656  1.00  0.94           C  
ATOM  11142  C   HIS B 582      74.403  92.252  95.664  1.00  0.94           C  
ATOM  11143  O   HIS B 582      75.226  93.134  95.428  1.00  0.94           O  
ATOM  11144  CB  HIS B 582      72.961  91.509  93.752  1.00  0.94           C  
ATOM  11145  CG  HIS B 582      73.058  92.879  93.142  1.00  0.94           C  
ATOM  11146  ND1 HIS B 582      72.090  93.806  93.454  1.00  0.94           N  
ATOM  11147  CD2 HIS B 582      74.000  93.438  92.337  1.00  0.94           C  
ATOM  11148  CE1 HIS B 582      72.451  94.911  92.839  1.00  0.94           C  
ATOM  11149  NE2 HIS B 582      73.603  94.745  92.144  1.00  0.94           N  
ATOM  11150  N   VAL B 583      73.737  92.226  96.837  1.00  0.96           N  
ATOM  11151  CA  VAL B 583      73.993  93.154  97.936  1.00  0.96           C  
ATOM  11152  C   VAL B 583      75.434  93.083  98.433  1.00  0.96           C  
ATOM  11153  O   VAL B 583      76.092  94.105  98.639  1.00  0.96           O  
ATOM  11154  CB  VAL B 583      73.022  92.907  99.088  1.00  0.96           C  
ATOM  11155  CG1 VAL B 583      73.372  93.745 100.334  1.00  0.96           C  
ATOM  11156  CG2 VAL B 583      71.602  93.270  98.617  1.00  0.96           C  
ATOM  11157  N   ILE B 584      75.987  91.862  98.579  1.00  0.94           N  
ATOM  11158  CA  ILE B 584      77.393  91.641  98.889  1.00  0.94           C  
ATOM  11159  C   ILE B 584      78.315  92.159  97.779  1.00  0.94           C  
ATOM  11160  O   ILE B 584      79.319  92.821  98.042  1.00  0.94           O  
ATOM  11161  CB  ILE B 584      77.677  90.176  99.211  1.00  0.94           C  
ATOM  11162  CG1 ILE B 584      76.801  89.685 100.391  1.00  0.94           C  
ATOM  11163  CG2 ILE B 584      79.171  90.005  99.557  1.00  0.94           C  
ATOM  11164  CD1 ILE B 584      76.782  88.158 100.535  1.00  0.94           C  
ATOM  11165  N   THR B 585      77.973  91.937  96.491  1.00  0.93           N  
ATOM  11166  CA  THR B 585      78.704  92.501  95.350  1.00  0.93           C  
ATOM  11167  C   THR B 585      78.735  94.019  95.348  1.00  0.93           C  
ATOM  11168  O   THR B 585      79.787  94.630  95.168  1.00  0.93           O  
ATOM  11169  CB  THR B 585      78.163  92.057  93.995  1.00  0.93           C  
ATOM  11170  OG1 THR B 585      77.981  90.654  94.006  1.00  0.93           O  
ATOM  11171  CG2 THR B 585      79.157  92.365  92.867  1.00  0.93           C  
ATOM  11172  N   MET B 586      77.591  94.689  95.619  1.00  0.92           N  
ATOM  11173  CA  MET B 586      77.533  96.135  95.787  1.00  0.92           C  
ATOM  11174  C   MET B 586      78.389  96.642  96.940  1.00  0.92           C  
ATOM  11175  O   MET B 586      79.125  97.614  96.785  1.00  0.92           O  
ATOM  11176  CB  MET B 586      76.083  96.645  95.979  1.00  0.92           C  
ATOM  11177  CG  MET B 586      75.219  96.521  94.710  1.00  0.92           C  
ATOM  11178  SD  MET B 586      73.635  97.420  94.781  1.00  0.92           S  
ATOM  11179  CE  MET B 586      72.819  96.350  96.000  1.00  0.92           C  
ATOM  11180  N   TYR B 587      78.367  95.955  98.102  1.00  0.93           N  
ATOM  11181  CA  TYR B 587      79.241  96.239  99.230  1.00  0.93           C  
ATOM  11182  C   TYR B 587      80.725  96.144  98.857  1.00  0.93           C  
ATOM  11183  O   TYR B 587      81.490  97.076  99.092  1.00  0.93           O  
ATOM  11184  CB  TYR B 587      78.868  95.257 100.386  1.00  0.93           C  
ATOM  11185  CG  TYR B 587      79.817  95.283 101.557  1.00  0.93           C  
ATOM  11186  CD1 TYR B 587      79.792  96.338 102.481  1.00  0.93           C  
ATOM  11187  CD2 TYR B 587      80.770  94.261 101.713  1.00  0.93           C  
ATOM  11188  CE1 TYR B 587      80.713  96.381 103.538  1.00  0.93           C  
ATOM  11189  CE2 TYR B 587      81.691  94.300 102.769  1.00  0.93           C  
ATOM  11190  CZ  TYR B 587      81.665  95.365 103.675  1.00  0.93           C  
ATOM  11191  OH  TYR B 587      82.617  95.431 104.710  1.00  0.93           O  
ATOM  11192  N   ASN B 588      81.153  95.054  98.192  1.00  0.90           N  
ATOM  11193  CA  ASN B 588      82.531  94.869  97.758  1.00  0.90           C  
ATOM  11194  C   ASN B 588      83.008  95.921  96.764  1.00  0.90           C  
ATOM  11195  O   ASN B 588      84.123  96.429  96.871  1.00  0.90           O  
ATOM  11196  CB  ASN B 588      82.736  93.459  97.155  1.00  0.90           C  
ATOM  11197  CG  ASN B 588      82.641  92.427  98.271  1.00  0.90           C  
ATOM  11198  OD1 ASN B 588      83.009  92.685  99.419  1.00  0.90           O  
ATOM  11199  ND2 ASN B 588      82.176  91.205  97.932  1.00  0.90           N  
ATOM  11200  N   ARG B 589      82.157  96.315  95.796  1.00  0.86           N  
ATOM  11201  CA  ARG B 589      82.445  97.404  94.876  1.00  0.86           C  
ATOM  11202  C   ARG B 589      82.659  98.754  95.571  1.00  0.86           C  
ATOM  11203  O   ARG B 589      83.590  99.486  95.237  1.00  0.86           O  
ATOM  11204  CB  ARG B 589      81.298  97.540  93.844  1.00  0.86           C  
ATOM  11205  CG  ARG B 589      81.229  96.395  92.809  1.00  0.86           C  
ATOM  11206  CD  ARG B 589      79.925  96.442  92.002  1.00  0.86           C  
ATOM  11207  NE  ARG B 589      80.003  95.458  90.877  1.00  0.86           N  
ATOM  11208  CZ  ARG B 589      79.300  95.572  89.743  1.00  0.86           C  
ATOM  11209  NH1 ARG B 589      78.408  96.540  89.571  1.00  0.86           N  
ATOM  11210  NH2 ARG B 589      79.468  94.701  88.756  1.00  0.86           N  
ATOM  11211  N   ILE B 590      81.822  99.099  96.576  1.00  0.88           N  
ATOM  11212  CA  ILE B 590      81.986 100.296  97.400  1.00  0.88           C  
ATOM  11213  C   ILE B 590      83.258 100.266  98.236  1.00  0.88           C  
ATOM  11214  O   ILE B 590      83.983 101.255  98.323  1.00  0.88           O  
ATOM  11215  CB  ILE B 590      80.786 100.513  98.329  1.00  0.88           C  
ATOM  11216  CG1 ILE B 590      79.501 100.791  97.515  1.00  0.88           C  
ATOM  11217  CG2 ILE B 590      81.055 101.677  99.315  1.00  0.88           C  
ATOM  11218  CD1 ILE B 590      78.223 100.689  98.357  1.00  0.88           C  
ATOM  11219  N   LYS B 591      83.572  99.124  98.879  1.00  0.86           N  
ATOM  11220  CA  LYS B 591      84.788  98.965  99.660  1.00  0.86           C  
ATOM  11221  C   LYS B 591      86.060  99.057  98.825  1.00  0.86           C  
ATOM  11222  O   LYS B 591      87.048  99.639  99.267  1.00  0.86           O  
ATOM  11223  CB  LYS B 591      84.782  97.639 100.467  1.00  0.86           C  
ATOM  11224  CG  LYS B 591      83.653  97.525 101.512  1.00  0.86           C  
ATOM  11225  CD  LYS B 591      83.719  98.499 102.704  1.00  0.86           C  
ATOM  11226  CE  LYS B 591      84.878  98.229 103.666  1.00  0.86           C  
ATOM  11227  NZ  LYS B 591      84.718  99.050 104.872  1.00  0.86           N  
ATOM  11228  N   LYS B 592      86.064  98.488  97.601  1.00  0.84           N  
ATOM  11229  CA  LYS B 592      87.174  98.600  96.671  1.00  0.84           C  
ATOM  11230  C   LYS B 592      87.447 100.015  96.163  1.00  0.84           C  
ATOM  11231  O   LYS B 592      88.594 100.460  96.156  1.00  0.84           O  
ATOM  11232  CB  LYS B 592      86.905  97.706  95.433  1.00  0.84           C  
ATOM  11233  CG  LYS B 592      88.051  97.694  94.404  1.00  0.84           C  
ATOM  11234  CD  LYS B 592      87.613  97.130  93.045  1.00  0.84           C  
ATOM  11235  CE  LYS B 592      88.585  97.453  91.904  1.00  0.84           C  
ATOM  11236  NZ  LYS B 592      88.580  98.895  91.608  1.00  0.84           N  
ATOM  11237  N   ASP B 593      86.400 100.752  95.727  1.00  0.82           N  
ATOM  11238  CA  ASP B 593      86.552 102.066  95.119  1.00  0.82           C  
ATOM  11239  C   ASP B 593      85.793 103.158  95.919  1.00  0.82           C  
ATOM  11240  O   ASP B 593      84.792 103.662  95.404  1.00  0.82           O  
ATOM  11241  CB  ASP B 593      86.044 102.049  93.632  1.00  0.82           C  
ATOM  11242  CG  ASP B 593      86.836 101.168  92.683  1.00  0.82           C  
ATOM  11243  OD1 ASP B 593      88.072 101.066  92.871  1.00  0.82           O  
ATOM  11244  OD2 ASP B 593      86.265 100.604  91.692  1.00  0.82           O  
ATOM  11245  N   PRO B 594      86.152 103.622  97.135  1.00  0.83           N  
ATOM  11246  CA  PRO B 594      85.220 104.344  98.017  1.00  0.83           C  
ATOM  11247  C   PRO B 594      84.715 105.699  97.559  1.00  0.83           C  
ATOM  11248  O   PRO B 594      83.669 106.148  98.037  1.00  0.83           O  
ATOM  11249  CB  PRO B 594      86.004 104.519  99.323  1.00  0.83           C  
ATOM  11250  CG  PRO B 594      86.915 103.298  99.358  1.00  0.83           C  
ATOM  11251  CD  PRO B 594      87.317 103.143  97.891  1.00  0.83           C  
ATOM  11252  N   LYS B 595      85.479 106.394  96.699  1.00  0.72           N  
ATOM  11253  CA  LYS B 595      85.158 107.721  96.201  1.00  0.72           C  
ATOM  11254  C   LYS B 595      84.595 107.665  94.792  1.00  0.72           C  
ATOM  11255  O   LYS B 595      84.335 108.690  94.170  1.00  0.72           O  
ATOM  11256  CB  LYS B 595      86.421 108.620  96.210  1.00  0.72           C  
ATOM  11257  CG  LYS B 595      86.841 109.038  97.629  1.00  0.72           C  
ATOM  11258  CD  LYS B 595      88.064 109.975  97.658  1.00  0.72           C  
ATOM  11259  CE  LYS B 595      89.395 109.260  97.400  1.00  0.72           C  
ATOM  11260  NZ  LYS B 595      90.518 110.223  97.477  1.00  0.72           N  
ATOM  11261  N   LYS B 596      84.379 106.454  94.251  1.00  0.74           N  
ATOM  11262  CA  LYS B 596      83.681 106.254  93.001  1.00  0.74           C  
ATOM  11263  C   LYS B 596      82.200 106.580  93.102  1.00  0.74           C  
ATOM  11264  O   LYS B 596      81.571 106.432  94.151  1.00  0.74           O  
ATOM  11265  CB  LYS B 596      83.885 104.795  92.564  1.00  0.74           C  
ATOM  11266  CG  LYS B 596      83.447 104.386  91.151  1.00  0.74           C  
ATOM  11267  CD  LYS B 596      83.862 102.922  90.956  1.00  0.74           C  
ATOM  11268  CE  LYS B 596      83.693 102.335  89.564  1.00  0.74           C  
ATOM  11269  NZ  LYS B 596      84.228 100.954  89.617  1.00  0.74           N  
ATOM  11270  N   LEU B 597      81.600 107.043  91.988  1.00  0.77           N  
ATOM  11271  CA  LEU B 597      80.171 107.250  91.887  1.00  0.77           C  
ATOM  11272  C   LEU B 597      79.388 105.955  92.104  1.00  0.77           C  
ATOM  11273  O   LEU B 597      79.677 104.911  91.520  1.00  0.77           O  
ATOM  11274  CB  LEU B 597      79.849 107.910  90.518  1.00  0.77           C  
ATOM  11275  CG  LEU B 597      78.444 108.530  90.315  1.00  0.77           C  
ATOM  11276  CD1 LEU B 597      77.343 107.505  90.003  1.00  0.77           C  
ATOM  11277  CD2 LEU B 597      78.021 109.457  91.465  1.00  0.77           C  
ATOM  11278  N   PHE B 598      78.369 106.013  92.976  1.00  0.86           N  
ATOM  11279  CA  PHE B 598      77.532 104.892  93.315  1.00  0.86           C  
ATOM  11280  C   PHE B 598      76.141 105.467  93.474  1.00  0.86           C  
ATOM  11281  O   PHE B 598      75.962 106.557  94.014  1.00  0.86           O  
ATOM  11282  CB  PHE B 598      78.019 104.218  94.629  1.00  0.86           C  
ATOM  11283  CG  PHE B 598      77.231 102.977  94.957  1.00  0.86           C  
ATOM  11284  CD1 PHE B 598      76.102 103.050  95.790  1.00  0.86           C  
ATOM  11285  CD2 PHE B 598      77.593 101.736  94.409  1.00  0.86           C  
ATOM  11286  CE1 PHE B 598      75.339 101.908  96.061  1.00  0.86           C  
ATOM  11287  CE2 PHE B 598      76.837 100.588  94.685  1.00  0.86           C  
ATOM  11288  CZ  PHE B 598      75.706 100.677  95.507  1.00  0.86           C  
ATOM  11289  N   VAL B 599      75.118 104.753  92.976  1.00  0.91           N  
ATOM  11290  CA  VAL B 599      73.747 105.221  92.993  1.00  0.91           C  
ATOM  11291  C   VAL B 599      73.079 104.668  94.244  1.00  0.91           C  
ATOM  11292  O   VAL B 599      73.000 103.444  94.370  1.00  0.91           O  
ATOM  11293  CB  VAL B 599      72.998 104.768  91.749  1.00  0.91           C  
ATOM  11294  CG1 VAL B 599      71.550 105.297  91.763  1.00  0.91           C  
ATOM  11295  CG2 VAL B 599      73.750 105.304  90.515  1.00  0.91           C  
ATOM  11296  N   PRO B 600      72.624 105.466  95.211  1.00  0.95           N  
ATOM  11297  CA  PRO B 600      72.388 104.968  96.558  1.00  0.95           C  
ATOM  11298  C   PRO B 600      71.147 104.104  96.653  1.00  0.95           C  
ATOM  11299  O   PRO B 600      70.134 104.403  96.020  1.00  0.95           O  
ATOM  11300  CB  PRO B 600      72.274 106.241  97.418  1.00  0.95           C  
ATOM  11301  CG  PRO B 600      71.860 107.336  96.431  1.00  0.95           C  
ATOM  11302  CD  PRO B 600      72.596 106.929  95.157  1.00  0.95           C  
ATOM  11303  N   ARG B 601      71.202 103.018  97.445  1.00  0.91           N  
ATOM  11304  CA  ARG B 601      70.105 102.079  97.560  1.00  0.91           C  
ATOM  11305  C   ARG B 601      69.753 101.771  99.008  1.00  0.91           C  
ATOM  11306  O   ARG B 601      70.613 101.616  99.873  1.00  0.91           O  
ATOM  11307  CB  ARG B 601      70.388 100.727  96.860  1.00  0.91           C  
ATOM  11308  CG  ARG B 601      70.598 100.793  95.333  1.00  0.91           C  
ATOM  11309  CD  ARG B 601      70.239  99.447  94.696  1.00  0.91           C  
ATOM  11310  NE  ARG B 601      70.507  99.486  93.225  1.00  0.91           N  
ATOM  11311  CZ  ARG B 601      70.070  98.514  92.413  1.00  0.91           C  
ATOM  11312  NH1 ARG B 601      69.396  97.456  92.848  1.00  0.91           N  
ATOM  11313  NH2 ARG B 601      70.321  98.575  91.108  1.00  0.91           N  
ATOM  11314  N   THR B 602      68.444 101.626  99.285  1.00  0.95           N  
ATOM  11315  CA  THR B 602      67.953 101.021 100.518  1.00  0.95           C  
ATOM  11316  C   THR B 602      67.353  99.702 100.105  1.00  0.95           C  
ATOM  11317  O   THR B 602      66.310  99.667  99.454  1.00  0.95           O  
ATOM  11318  CB  THR B 602      66.857 101.808 101.233  1.00  0.95           C  
ATOM  11319  OG1 THR B 602      67.337 103.082 101.639  1.00  0.95           O  
ATOM  11320  CG2 THR B 602      66.413 101.096 102.522  1.00  0.95           C  
ATOM  11321  N   VAL B 603      68.007  98.579 100.456  1.00  0.96           N  
ATOM  11322  CA  VAL B 603      67.586  97.254 100.030  1.00  0.96           C  
ATOM  11323  C   VAL B 603      66.738  96.623 101.113  1.00  0.96           C  
ATOM  11324  O   VAL B 603      67.166  96.460 102.253  1.00  0.96           O  
ATOM  11325  CB  VAL B 603      68.748  96.335  99.669  1.00  0.96           C  
ATOM  11326  CG1 VAL B 603      68.204  95.022  99.067  1.00  0.96           C  
ATOM  11327  CG2 VAL B 603      69.654  97.039  98.639  1.00  0.96           C  
ATOM  11328  N   ILE B 604      65.484  96.276 100.789  1.00  0.95           N  
ATOM  11329  CA  ILE B 604      64.510  95.778 101.739  1.00  0.95           C  
ATOM  11330  C   ILE B 604      64.081  94.391 101.303  1.00  0.95           C  
ATOM  11331  O   ILE B 604      63.420  94.206 100.281  1.00  0.95           O  
ATOM  11332  CB  ILE B 604      63.289  96.695 101.847  1.00  0.95           C  
ATOM  11333  CG1 ILE B 604      63.721  98.152 102.156  1.00  0.95           C  
ATOM  11334  CG2 ILE B 604      62.323  96.146 102.924  1.00  0.95           C  
ATOM  11335  CD1 ILE B 604      62.574  99.168 102.104  1.00  0.95           C  
ATOM  11336  N   ILE B 605      64.430  93.359 102.091  1.00  0.97           N  
ATOM  11337  CA  ILE B 605      64.032  91.990 101.804  1.00  0.97           C  
ATOM  11338  C   ILE B 605      63.146  91.552 102.949  1.00  0.97           C  
ATOM  11339  O   ILE B 605      63.503  91.679 104.114  1.00  0.97           O  
ATOM  11340  CB  ILE B 605      65.206  91.025 101.632  1.00  0.97           C  
ATOM  11341  CG1 ILE B 605      66.200  91.562 100.571  1.00  0.97           C  
ATOM  11342  CG2 ILE B 605      64.651  89.639 101.222  1.00  0.97           C  
ATOM  11343  CD1 ILE B 605      67.469  90.715 100.401  1.00  0.97           C  
ATOM  11344  N   GLY B 606      61.927  91.061 102.680  1.00  0.98           N  
ATOM  11345  CA  GLY B 606      61.025  90.682 103.760  1.00  0.98           C  
ATOM  11346  C   GLY B 606      60.192  89.505 103.392  1.00  0.98           C  
ATOM  11347  O   GLY B 606      59.867  89.278 102.230  1.00  0.98           O  
ATOM  11348  N   GLY B 607      59.792  88.711 104.393  1.00  0.98           N  
ATOM  11349  CA  GLY B 607      59.023  87.517 104.116  1.00  0.98           C  
ATOM  11350  C   GLY B 607      59.164  86.516 105.208  1.00  0.98           C  
ATOM  11351  O   GLY B 607      60.140  86.492 105.948  1.00  0.98           O  
ATOM  11352  N   LYS B 608      58.166  85.633 105.333  1.00  0.92           N  
ATOM  11353  CA  LYS B 608      58.163  84.579 106.322  1.00  0.92           C  
ATOM  11354  C   LYS B 608      58.659  83.278 105.707  1.00  0.92           C  
ATOM  11355  O   LYS B 608      58.208  82.861 104.638  1.00  0.92           O  
ATOM  11356  CB  LYS B 608      56.736  84.405 106.904  1.00  0.92           C  
ATOM  11357  CG  LYS B 608      56.239  85.658 107.645  1.00  0.92           C  
ATOM  11358  CD  LYS B 608      54.818  85.520 108.223  1.00  0.92           C  
ATOM  11359  CE  LYS B 608      54.393  86.791 108.969  1.00  0.92           C  
ATOM  11360  NZ  LYS B 608      53.012  86.718 109.488  1.00  0.92           N  
ATOM  11361  N   ALA B 609      59.606  82.585 106.364  1.00  0.94           N  
ATOM  11362  CA  ALA B 609      59.953  81.218 106.023  1.00  0.94           C  
ATOM  11363  C   ALA B 609      58.910  80.273 106.610  1.00  0.94           C  
ATOM  11364  O   ALA B 609      58.235  80.607 107.578  1.00  0.94           O  
ATOM  11365  CB  ALA B 609      61.355  80.865 106.559  1.00  0.94           C  
ATOM  11366  N   ALA B 610      58.696  79.067 106.045  1.00  0.91           N  
ATOM  11367  CA  ALA B 610      57.936  78.054 106.764  1.00  0.91           C  
ATOM  11368  C   ALA B 610      58.738  77.520 107.973  1.00  0.91           C  
ATOM  11369  O   ALA B 610      59.961  77.430 107.849  1.00  0.91           O  
ATOM  11370  CB  ALA B 610      57.469  76.927 105.825  1.00  0.91           C  
ATOM  11371  N   PRO B 611      58.195  77.168 109.142  1.00  0.89           N  
ATOM  11372  CA  PRO B 611      58.999  76.991 110.354  1.00  0.89           C  
ATOM  11373  C   PRO B 611      60.034  75.884 110.325  1.00  0.89           C  
ATOM  11374  O   PRO B 611      61.079  76.042 110.960  1.00  0.89           O  
ATOM  11375  CB  PRO B 611      57.962  76.765 111.458  1.00  0.89           C  
ATOM  11376  CG  PRO B 611      56.787  77.617 110.987  1.00  0.89           C  
ATOM  11377  CD  PRO B 611      56.789  77.379 109.480  1.00  0.89           C  
ATOM  11378  N   GLY B 612      59.752  74.767 109.619  1.00  0.85           N  
ATOM  11379  CA  GLY B 612      60.677  73.652 109.415  1.00  0.85           C  
ATOM  11380  C   GLY B 612      61.546  73.782 108.188  1.00  0.85           C  
ATOM  11381  O   GLY B 612      62.387  72.933 107.907  1.00  0.85           O  
ATOM  11382  N   TYR B 613      61.366  74.854 107.396  1.00  0.88           N  
ATOM  11383  CA  TYR B 613      62.079  75.085 106.152  1.00  0.88           C  
ATOM  11384  C   TYR B 613      63.458  75.659 106.448  1.00  0.88           C  
ATOM  11385  O   TYR B 613      63.697  76.865 106.387  1.00  0.88           O  
ATOM  11386  CB  TYR B 613      61.211  76.025 105.276  1.00  0.88           C  
ATOM  11387  CG  TYR B 613      61.530  76.203 103.811  1.00  0.88           C  
ATOM  11388  CD1 TYR B 613      62.617  75.642 103.107  1.00  0.88           C  
ATOM  11389  CD2 TYR B 613      60.621  77.009 103.107  1.00  0.88           C  
ATOM  11390  CE1 TYR B 613      62.776  75.894 101.729  1.00  0.88           C  
ATOM  11391  CE2 TYR B 613      60.777  77.255 101.742  1.00  0.88           C  
ATOM  11392  CZ  TYR B 613      61.848  76.694 101.047  1.00  0.88           C  
ATOM  11393  OH  TYR B 613      61.951  76.937  99.660  1.00  0.88           O  
ATOM  11394  N   HIS B 614      64.407  74.763 106.795  1.00  0.88           N  
ATOM  11395  CA  HIS B 614      65.743  75.097 107.266  1.00  0.88           C  
ATOM  11396  C   HIS B 614      66.520  75.991 106.317  1.00  0.88           C  
ATOM  11397  O   HIS B 614      67.034  77.030 106.713  1.00  0.88           O  
ATOM  11398  CB  HIS B 614      66.544  73.791 107.506  1.00  0.88           C  
ATOM  11399  CG  HIS B 614      67.964  73.996 107.930  1.00  0.88           C  
ATOM  11400  ND1 HIS B 614      68.225  74.666 109.106  1.00  0.88           N  
ATOM  11401  CD2 HIS B 614      69.122  73.652 107.309  1.00  0.88           C  
ATOM  11402  CE1 HIS B 614      69.544  74.714 109.180  1.00  0.88           C  
ATOM  11403  NE2 HIS B 614      70.132  74.115 108.118  1.00  0.88           N  
ATOM  11404  N   MET B 615      66.543  75.665 105.011  1.00  0.91           N  
ATOM  11405  CA  MET B 615      67.243  76.450 104.011  1.00  0.91           C  
ATOM  11406  C   MET B 615      66.733  77.889 103.896  1.00  0.91           C  
ATOM  11407  O   MET B 615      67.508  78.842 103.841  1.00  0.91           O  
ATOM  11408  CB  MET B 615      67.179  75.707 102.657  1.00  0.91           C  
ATOM  11409  CG  MET B 615      68.086  76.287 101.557  1.00  0.91           C  
ATOM  11410  SD  MET B 615      69.859  76.272 101.957  1.00  0.91           S  
ATOM  11411  CE  MET B 615      70.058  78.019 101.533  1.00  0.91           C  
ATOM  11412  N   ALA B 616      65.402  78.097 103.948  1.00  0.95           N  
ATOM  11413  CA  ALA B 616      64.797  79.412 104.028  1.00  0.95           C  
ATOM  11414  C   ALA B 616      65.155  80.192 105.297  1.00  0.95           C  
ATOM  11415  O   ALA B 616      65.458  81.382 105.244  1.00  0.95           O  
ATOM  11416  CB  ALA B 616      63.271  79.274 103.897  1.00  0.95           C  
ATOM  11417  N   LYS B 617      65.180  79.534 106.477  1.00  0.91           N  
ATOM  11418  CA  LYS B 617      65.672  80.130 107.715  1.00  0.91           C  
ATOM  11419  C   LYS B 617      67.151  80.514 107.664  1.00  0.91           C  
ATOM  11420  O   LYS B 617      67.538  81.586 108.131  1.00  0.91           O  
ATOM  11421  CB  LYS B 617      65.369  79.240 108.951  1.00  0.91           C  
ATOM  11422  CG  LYS B 617      63.881  79.290 109.336  1.00  0.91           C  
ATOM  11423  CD  LYS B 617      63.536  78.619 110.681  1.00  0.91           C  
ATOM  11424  CE  LYS B 617      62.225  79.181 111.247  1.00  0.91           C  
ATOM  11425  NZ  LYS B 617      61.724  78.458 112.437  1.00  0.91           N  
ATOM  11426  N   MET B 618      68.010  79.679 107.045  1.00  0.92           N  
ATOM  11427  CA  MET B 618      69.397  80.016 106.761  1.00  0.92           C  
ATOM  11428  C   MET B 618      69.557  81.231 105.846  1.00  0.92           C  
ATOM  11429  O   MET B 618      70.422  82.074 106.076  1.00  0.92           O  
ATOM  11430  CB  MET B 618      70.184  78.814 106.175  1.00  0.92           C  
ATOM  11431  CG  MET B 618      70.298  77.596 107.119  1.00  0.92           C  
ATOM  11432  SD  MET B 618      70.866  77.964 108.806  1.00  0.92           S  
ATOM  11433  CE  MET B 618      72.579  78.356 108.372  1.00  0.92           C  
ATOM  11434  N   ILE B 619      68.703  81.387 104.807  1.00  0.95           N  
ATOM  11435  CA  ILE B 619      68.656  82.584 103.963  1.00  0.95           C  
ATOM  11436  C   ILE B 619      68.320  83.843 104.760  1.00  0.95           C  
ATOM  11437  O   ILE B 619      68.985  84.868 104.608  1.00  0.95           O  
ATOM  11438  CB  ILE B 619      67.698  82.422 102.774  1.00  0.95           C  
ATOM  11439  CG1 ILE B 619      68.241  81.353 101.798  1.00  0.95           C  
ATOM  11440  CG2 ILE B 619      67.487  83.761 102.025  1.00  0.95           C  
ATOM  11441  CD1 ILE B 619      67.210  80.866 100.770  1.00  0.95           C  
ATOM  11442  N   ILE B 620      67.331  83.792 105.683  1.00  0.95           N  
ATOM  11443  CA  ILE B 620      67.014  84.907 106.581  1.00  0.95           C  
ATOM  11444  C   ILE B 620      68.199  85.288 107.457  1.00  0.95           C  
ATOM  11445  O   ILE B 620      68.551  86.462 107.579  1.00  0.95           O  
ATOM  11446  CB  ILE B 620      65.802  84.610 107.474  1.00  0.95           C  
ATOM  11447  CG1 ILE B 620      64.541  84.409 106.602  1.00  0.95           C  
ATOM  11448  CG2 ILE B 620      65.581  85.751 108.500  1.00  0.95           C  
ATOM  11449  CD1 ILE B 620      63.299  83.988 107.398  1.00  0.95           C  
ATOM  11450  N   LYS B 621      68.891  84.292 108.049  1.00  0.92           N  
ATOM  11451  CA  LYS B 621      70.091  84.534 108.828  1.00  0.92           C  
ATOM  11452  C   LYS B 621      71.251  85.114 108.018  1.00  0.92           C  
ATOM  11453  O   LYS B 621      71.998  85.970 108.494  1.00  0.92           O  
ATOM  11454  CB  LYS B 621      70.536  83.271 109.609  1.00  0.92           C  
ATOM  11455  CG  LYS B 621      71.749  83.468 110.547  1.00  0.92           C  
ATOM  11456  CD  LYS B 621      71.583  84.621 111.560  1.00  0.92           C  
ATOM  11457  CE  LYS B 621      72.847  84.908 112.379  1.00  0.92           C  
ATOM  11458  NZ  LYS B 621      72.810  86.293 112.903  1.00  0.92           N  
ATOM  11459  N   LEU B 622      71.440  84.682 106.756  1.00  0.94           N  
ATOM  11460  CA  LEU B 622      72.424  85.268 105.857  1.00  0.94           C  
ATOM  11461  C   LEU B 622      72.141  86.744 105.556  1.00  0.94           C  
ATOM  11462  O   LEU B 622      73.020  87.596 105.672  1.00  0.94           O  
ATOM  11463  CB  LEU B 622      72.478  84.467 104.525  1.00  0.94           C  
ATOM  11464  CG  LEU B 622      73.858  84.337 103.825  1.00  0.94           C  
ATOM  11465  CD1 LEU B 622      73.650  84.123 102.317  1.00  0.94           C  
ATOM  11466  CD2 LEU B 622      74.833  85.504 104.043  1.00  0.94           C  
ATOM  11467  N   ILE B 623      70.877  87.097 105.226  1.00  0.94           N  
ATOM  11468  CA  ILE B 623      70.464  88.468 104.933  1.00  0.94           C  
ATOM  11469  C   ILE B 623      70.627  89.402 106.120  1.00  0.94           C  
ATOM  11470  O   ILE B 623      71.158  90.503 105.981  1.00  0.94           O  
ATOM  11471  CB  ILE B 623      69.021  88.537 104.426  1.00  0.94           C  
ATOM  11472  CG1 ILE B 623      68.873  87.768 103.094  1.00  0.94           C  
ATOM  11473  CG2 ILE B 623      68.583  90.011 104.225  1.00  0.94           C  
ATOM  11474  CD1 ILE B 623      67.414  87.450 102.750  1.00  0.94           C  
ATOM  11475  N   THR B 624      70.216  88.983 107.337  1.00  0.93           N  
ATOM  11476  CA  THR B 624      70.401  89.790 108.545  1.00  0.93           C  
ATOM  11477  C   THR B 624      71.859  90.035 108.863  1.00  0.93           C  
ATOM  11478  O   THR B 624      72.272  91.164 109.090  1.00  0.93           O  
ATOM  11479  CB  THR B 624      69.736  89.212 109.792  1.00  0.93           C  
ATOM  11480  OG1 THR B 624      70.113  87.861 110.025  1.00  0.93           O  
ATOM  11481  CG2 THR B 624      68.213  89.228 109.611  1.00  0.93           C  
ATOM  11482  N   SER B 625      72.694  88.987 108.797  1.00  0.93           N  
ATOM  11483  CA  SER B 625      74.118  89.075 109.091  1.00  0.93           C  
ATOM  11484  C   SER B 625      74.902  89.920 108.091  1.00  0.93           C  
ATOM  11485  O   SER B 625      75.818  90.660 108.448  1.00  0.93           O  
ATOM  11486  CB  SER B 625      74.771  87.677 109.213  1.00  0.93           C  
ATOM  11487  OG  SER B 625      74.007  86.813 110.062  1.00  0.93           O  
ATOM  11488  N   VAL B 626      74.543  89.864 106.786  1.00  0.94           N  
ATOM  11489  CA  VAL B 626      75.017  90.812 105.776  1.00  0.94           C  
ATOM  11490  C   VAL B 626      74.571  92.234 106.083  1.00  0.94           C  
ATOM  11491  O   VAL B 626      75.360  93.176 106.005  1.00  0.94           O  
ATOM  11492  CB  VAL B 626      74.568  90.415 104.368  1.00  0.94           C  
ATOM  11493  CG1 VAL B 626      74.853  91.516 103.320  1.00  0.94           C  
ATOM  11494  CG2 VAL B 626      75.322  89.137 103.965  1.00  0.94           C  
ATOM  11495  N   ALA B 627      73.301  92.431 106.491  1.00  0.92           N  
ATOM  11496  CA  ALA B 627      72.769  93.721 106.875  1.00  0.92           C  
ATOM  11497  C   ALA B 627      73.489  94.356 108.057  1.00  0.92           C  
ATOM  11498  O   ALA B 627      73.820  95.539 108.009  1.00  0.92           O  
ATOM  11499  CB  ALA B 627      71.259  93.614 107.166  1.00  0.92           C  
ATOM  11500  N   ASP B 628      73.819  93.578 109.108  1.00  0.87           N  
ATOM  11501  CA  ASP B 628      74.597  94.040 110.244  1.00  0.87           C  
ATOM  11502  C   ASP B 628      75.972  94.589 109.838  1.00  0.87           C  
ATOM  11503  O   ASP B 628      76.388  95.662 110.279  1.00  0.87           O  
ATOM  11504  CB  ASP B 628      74.793  92.891 111.272  1.00  0.87           C  
ATOM  11505  CG  ASP B 628      73.470  92.431 111.866  1.00  0.87           C  
ATOM  11506  OD1 ASP B 628      72.636  93.315 112.188  1.00  0.87           O  
ATOM  11507  OD2 ASP B 628      73.301  91.193 112.036  1.00  0.87           O  
ATOM  11508  N   VAL B 629      76.694  93.890 108.936  1.00  0.90           N  
ATOM  11509  CA  VAL B 629      77.955  94.370 108.379  1.00  0.90           C  
ATOM  11510  C   VAL B 629      77.801  95.603 107.485  1.00  0.90           C  
ATOM  11511  O   VAL B 629      78.487  96.607 107.668  1.00  0.90           O  
ATOM  11512  CB  VAL B 629      78.670  93.250 107.617  1.00  0.90           C  
ATOM  11513  CG1 VAL B 629      79.975  93.743 106.955  1.00  0.90           C  
ATOM  11514  CG2 VAL B 629      78.999  92.114 108.607  1.00  0.90           C  
ATOM  11515  N   VAL B 630      76.862  95.592 106.513  1.00  0.91           N  
ATOM  11516  CA  VAL B 630      76.670  96.701 105.577  1.00  0.91           C  
ATOM  11517  C   VAL B 630      76.162  97.974 106.245  1.00  0.91           C  
ATOM  11518  O   VAL B 630      76.649  99.074 105.990  1.00  0.91           O  
ATOM  11519  CB  VAL B 630      75.746  96.317 104.418  1.00  0.91           C  
ATOM  11520  CG1 VAL B 630      75.519  97.509 103.463  1.00  0.91           C  
ATOM  11521  CG2 VAL B 630      76.382  95.162 103.619  1.00  0.91           C  
ATOM  11522  N   ASN B 631      75.174  97.865 107.158  1.00  0.86           N  
ATOM  11523  CA  ASN B 631      74.565  99.009 107.814  1.00  0.86           C  
ATOM  11524  C   ASN B 631      75.522  99.818 108.672  1.00  0.86           C  
ATOM  11525  O   ASN B 631      75.400 101.043 108.729  1.00  0.86           O  
ATOM  11526  CB  ASN B 631      73.354  98.604 108.693  1.00  0.86           C  
ATOM  11527  CG  ASN B 631      72.178  98.219 107.805  1.00  0.86           C  
ATOM  11528  OD1 ASN B 631      72.002  98.741 106.701  1.00  0.86           O  
ATOM  11529  ND2 ASN B 631      71.315  97.313 108.307  1.00  0.86           N  
ATOM  11530  N   ASN B 632      76.477  99.157 109.350  1.00  0.85           N  
ATOM  11531  CA  ASN B 632      77.358  99.799 110.307  1.00  0.85           C  
ATOM  11532  C   ASN B 632      78.722 100.164 109.724  1.00  0.85           C  
ATOM  11533  O   ASN B 632      79.551 100.748 110.419  1.00  0.85           O  
ATOM  11534  CB  ASN B 632      77.560  98.863 111.527  1.00  0.85           C  
ATOM  11535  CG  ASN B 632      76.249  98.722 112.297  1.00  0.85           C  
ATOM  11536  OD1 ASN B 632      75.795  99.656 112.961  1.00  0.85           O  
ATOM  11537  ND2 ASN B 632      75.615  97.531 112.225  1.00  0.85           N  
ATOM  11538  N   ASP B 633      79.002  99.870 108.435  1.00  0.87           N  
ATOM  11539  CA  ASP B 633      80.267 100.234 107.827  1.00  0.87           C  
ATOM  11540  C   ASP B 633      80.400 101.750 107.553  1.00  0.87           C  
ATOM  11541  O   ASP B 633      79.538 102.337 106.887  1.00  0.87           O  
ATOM  11542  CB  ASP B 633      80.510  99.419 106.537  1.00  0.87           C  
ATOM  11543  CG  ASP B 633      81.949  99.550 106.110  1.00  0.87           C  
ATOM  11544  OD1 ASP B 633      82.746  98.642 106.449  1.00  0.87           O  
ATOM  11545  OD2 ASP B 633      82.337 100.552 105.450  1.00  0.87           O  
ATOM  11546  N   PRO B 634      81.455 102.437 108.000  1.00  0.88           N  
ATOM  11547  CA  PRO B 634      81.534 103.885 107.868  1.00  0.88           C  
ATOM  11548  C   PRO B 634      82.000 104.298 106.484  1.00  0.88           C  
ATOM  11549  O   PRO B 634      81.807 105.453 106.116  1.00  0.88           O  
ATOM  11550  CB  PRO B 634      82.551 104.287 108.951  1.00  0.88           C  
ATOM  11551  CG  PRO B 634      83.460 103.063 109.098  1.00  0.88           C  
ATOM  11552  CD  PRO B 634      82.484 101.907 108.904  1.00  0.88           C  
ATOM  11553  N   MET B 635      82.628 103.399 105.702  1.00  0.84           N  
ATOM  11554  CA  MET B 635      83.078 103.698 104.354  1.00  0.84           C  
ATOM  11555  C   MET B 635      81.920 103.633 103.367  1.00  0.84           C  
ATOM  11556  O   MET B 635      81.801 104.412 102.415  1.00  0.84           O  
ATOM  11557  CB  MET B 635      84.186 102.695 103.946  1.00  0.84           C  
ATOM  11558  CG  MET B 635      84.988 103.129 102.709  1.00  0.84           C  
ATOM  11559  SD  MET B 635      85.987 104.627 102.982  1.00  0.84           S  
ATOM  11560  CE  MET B 635      87.335 103.828 103.898  1.00  0.84           C  
ATOM  11561  N   VAL B 636      81.008 102.667 103.600  1.00  0.88           N  
ATOM  11562  CA  VAL B 636      79.729 102.577 102.916  1.00  0.88           C  
ATOM  11563  C   VAL B 636      78.818 103.744 103.262  1.00  0.88           C  
ATOM  11564  O   VAL B 636      78.245 104.389 102.381  1.00  0.88           O  
ATOM  11565  CB  VAL B 636      79.036 101.256 103.226  1.00  0.88           C  
ATOM  11566  CG1 VAL B 636      77.679 101.146 102.502  1.00  0.88           C  
ATOM  11567  CG2 VAL B 636      79.955 100.101 102.786  1.00  0.88           C  
ATOM  11568  N   GLY B 637      78.706 104.088 104.564  1.00  0.86           N  
ATOM  11569  CA  GLY B 637      77.951 105.243 105.043  1.00  0.86           C  
ATOM  11570  C   GLY B 637      76.501 105.283 104.619  1.00  0.86           C  
ATOM  11571  O   GLY B 637      75.684 104.477 105.057  1.00  0.86           O  
ATOM  11572  N   SER B 638      76.138 106.249 103.759  1.00  0.89           N  
ATOM  11573  CA  SER B 638      74.788 106.450 103.250  1.00  0.89           C  
ATOM  11574  C   SER B 638      74.596 105.925 101.834  1.00  0.89           C  
ATOM  11575  O   SER B 638      73.516 106.070 101.260  1.00  0.89           O  
ATOM  11576  CB  SER B 638      74.437 107.962 103.245  1.00  0.89           C  
ATOM  11577  OG  SER B 638      75.445 108.720 102.568  1.00  0.89           O  
ATOM  11578  N   LYS B 639      75.628 105.288 101.232  1.00  0.89           N  
ATOM  11579  CA  LYS B 639      75.540 104.698  99.904  1.00  0.89           C  
ATOM  11580  C   LYS B 639      74.610 103.488  99.822  1.00  0.89           C  
ATOM  11581  O   LYS B 639      73.843 103.334  98.875  1.00  0.89           O  
ATOM  11582  CB  LYS B 639      76.931 104.246  99.389  1.00  0.89           C  
ATOM  11583  CG  LYS B 639      77.959 105.369  99.140  1.00  0.89           C  
ATOM  11584  CD  LYS B 639      79.226 104.763  98.508  1.00  0.89           C  
ATOM  11585  CE  LYS B 639      80.350 105.726  98.096  1.00  0.89           C  
ATOM  11586  NZ  LYS B 639      81.187 106.131  99.252  1.00  0.89           N  
ATOM  11587  N   LEU B 640      74.667 102.585 100.815  1.00  0.93           N  
ATOM  11588  CA  LEU B 640      73.902 101.356 100.787  1.00  0.93           C  
ATOM  11589  C   LEU B 640      73.439 101.030 102.193  1.00  0.93           C  
ATOM  11590  O   LEU B 640      74.230 101.048 103.135  1.00  0.93           O  
ATOM  11591  CB  LEU B 640      74.779 100.205 100.223  1.00  0.93           C  
ATOM  11592  CG  LEU B 640      74.110  98.822 100.073  1.00  0.93           C  
ATOM  11593  CD1 LEU B 640      72.940  98.848  99.083  1.00  0.93           C  
ATOM  11594  CD2 LEU B 640      75.148  97.782  99.619  1.00  0.93           C  
ATOM  11595  N   LYS B 641      72.137 100.728 102.369  1.00  0.89           N  
ATOM  11596  CA  LYS B 641      71.594 100.210 103.613  1.00  0.89           C  
ATOM  11597  C   LYS B 641      70.762  98.986 103.295  1.00  0.89           C  
ATOM  11598  O   LYS B 641      70.189  98.871 102.213  1.00  0.89           O  
ATOM  11599  CB  LYS B 641      70.704 101.226 104.383  1.00  0.89           C  
ATOM  11600  CG  LYS B 641      71.449 102.442 104.965  1.00  0.89           C  
ATOM  11601  CD  LYS B 641      72.589 102.064 105.930  1.00  0.89           C  
ATOM  11602  CE  LYS B 641      73.169 103.266 106.681  1.00  0.89           C  
ATOM  11603  NZ  LYS B 641      74.575 103.021 107.065  1.00  0.89           N  
ATOM  11604  N   VAL B 642      70.702  98.023 104.234  1.00  0.92           N  
ATOM  11605  CA  VAL B 642      70.036  96.745 104.031  1.00  0.92           C  
ATOM  11606  C   VAL B 642      69.099  96.477 105.197  1.00  0.92           C  
ATOM  11607  O   VAL B 642      69.496  96.508 106.359  1.00  0.92           O  
ATOM  11608  CB  VAL B 642      71.023  95.585 103.915  1.00  0.92           C  
ATOM  11609  CG1 VAL B 642      70.287  94.283 103.529  1.00  0.92           C  
ATOM  11610  CG2 VAL B 642      72.101  95.907 102.862  1.00  0.92           C  
ATOM  11611  N   ILE B 643      67.812  96.210 104.925  1.00  0.91           N  
ATOM  11612  CA  ILE B 643      66.805  95.949 105.940  1.00  0.91           C  
ATOM  11613  C   ILE B 643      66.183  94.589 105.686  1.00  0.91           C  
ATOM  11614  O   ILE B 643      65.763  94.273 104.573  1.00  0.91           O  
ATOM  11615  CB  ILE B 643      65.718  97.031 105.943  1.00  0.91           C  
ATOM  11616  CG1 ILE B 643      66.292  98.420 106.327  1.00  0.91           C  
ATOM  11617  CG2 ILE B 643      64.529  96.662 106.863  1.00  0.91           C  
ATOM  11618  CD1 ILE B 643      66.858  98.503 107.752  1.00  0.91           C  
ATOM  11619  N   PHE B 644      66.080  93.743 106.737  1.00  0.93           N  
ATOM  11620  CA  PHE B 644      65.193  92.595 106.707  1.00  0.93           C  
ATOM  11621  C   PHE B 644      63.864  93.043 107.304  1.00  0.93           C  
ATOM  11622  O   PHE B 644      63.822  93.555 108.420  1.00  0.93           O  
ATOM  11623  CB  PHE B 644      65.753  91.361 107.466  1.00  0.93           C  
ATOM  11624  CG  PHE B 644      64.909  90.146 107.156  1.00  0.93           C  
ATOM  11625  CD1 PHE B 644      65.151  89.394 105.995  1.00  0.93           C  
ATOM  11626  CD2 PHE B 644      63.812  89.807 107.967  1.00  0.93           C  
ATOM  11627  CE1 PHE B 644      64.315  88.325 105.646  1.00  0.93           C  
ATOM  11628  CE2 PHE B 644      62.969  88.743 107.620  1.00  0.93           C  
ATOM  11629  CZ  PHE B 644      63.224  88.000 106.461  1.00  0.93           C  
ATOM  11630  N   LEU B 645      62.751  92.899 106.563  1.00  0.92           N  
ATOM  11631  CA  LEU B 645      61.475  93.465 106.969  1.00  0.92           C  
ATOM  11632  C   LEU B 645      60.638  92.457 107.764  1.00  0.92           C  
ATOM  11633  O   LEU B 645      60.092  91.496 107.216  1.00  0.92           O  
ATOM  11634  CB  LEU B 645      60.686  93.969 105.727  1.00  0.92           C  
ATOM  11635  CG  LEU B 645      59.988  95.345 105.859  1.00  0.92           C  
ATOM  11636  CD1 LEU B 645      58.865  95.449 104.812  1.00  0.92           C  
ATOM  11637  CD2 LEU B 645      59.441  95.650 107.262  1.00  0.92           C  
ATOM  11638  N   GLU B 646      60.534  92.652 109.095  1.00  0.89           N  
ATOM  11639  CA  GLU B 646      59.793  91.783 109.997  1.00  0.89           C  
ATOM  11640  C   GLU B 646      58.278  91.755 109.797  1.00  0.89           C  
ATOM  11641  O   GLU B 646      57.609  92.775 109.647  1.00  0.89           O  
ATOM  11642  CB  GLU B 646      60.080  92.093 111.494  1.00  0.89           C  
ATOM  11643  CG  GLU B 646      61.562  91.878 111.884  1.00  0.89           C  
ATOM  11644  CD  GLU B 646      61.853  92.024 113.380  1.00  0.89           C  
ATOM  11645  OE1 GLU B 646      61.305  91.238 114.200  1.00  0.89           O  
ATOM  11646  OE2 GLU B 646      62.693  92.890 113.719  1.00  0.89           O  
ATOM  11647  N   ASN B 647      57.691  90.541 109.843  1.00  0.90           N  
ATOM  11648  CA  ASN B 647      56.263  90.294 109.927  1.00  0.90           C  
ATOM  11649  C   ASN B 647      55.466  90.774 108.720  1.00  0.90           C  
ATOM  11650  O   ASN B 647      54.400  91.384 108.848  1.00  0.90           O  
ATOM  11651  CB  ASN B 647      55.685  90.773 111.292  1.00  0.90           C  
ATOM  11652  CG  ASN B 647      54.390  90.055 111.661  1.00  0.90           C  
ATOM  11653  OD1 ASN B 647      54.071  88.968 111.170  1.00  0.90           O  
ATOM  11654  ND2 ASN B 647      53.606  90.670 112.575  1.00  0.90           N  
ATOM  11655  N   TYR B 648      55.978  90.450 107.511  1.00  0.92           N  
ATOM  11656  CA  TYR B 648      55.330  90.690 106.233  1.00  0.92           C  
ATOM  11657  C   TYR B 648      53.959  90.022 106.121  1.00  0.92           C  
ATOM  11658  O   TYR B 648      53.791  88.816 106.310  1.00  0.92           O  
ATOM  11659  CB  TYR B 648      56.269  90.278 105.065  1.00  0.92           C  
ATOM  11660  CG  TYR B 648      55.697  90.588 103.701  1.00  0.92           C  
ATOM  11661  CD1 TYR B 648      55.334  91.898 103.339  1.00  0.92           C  
ATOM  11662  CD2 TYR B 648      55.527  89.554 102.765  1.00  0.92           C  
ATOM  11663  CE1 TYR B 648      54.816  92.165 102.061  1.00  0.92           C  
ATOM  11664  CE2 TYR B 648      55.021  89.823 101.487  1.00  0.92           C  
ATOM  11665  CZ  TYR B 648      54.676  91.128 101.131  1.00  0.92           C  
ATOM  11666  OH  TYR B 648      54.320  91.398  99.795  1.00  0.92           O  
ATOM  11667  N   ARG B 649      52.944  90.852 105.847  1.00  0.88           N  
ATOM  11668  CA  ARG B 649      51.551  90.497 105.870  1.00  0.88           C  
ATOM  11669  C   ARG B 649      50.826  91.624 105.173  1.00  0.88           C  
ATOM  11670  O   ARG B 649      51.455  92.607 104.782  1.00  0.88           O  
ATOM  11671  CB  ARG B 649      51.029  90.308 107.313  1.00  0.88           C  
ATOM  11672  CG  ARG B 649      51.034  91.609 108.131  1.00  0.88           C  
ATOM  11673  CD  ARG B 649      50.974  91.382 109.638  1.00  0.88           C  
ATOM  11674  NE  ARG B 649      50.709  92.718 110.232  1.00  0.88           N  
ATOM  11675  CZ  ARG B 649      51.618  93.680 110.432  1.00  0.88           C  
ATOM  11676  NH1 ARG B 649      52.925  93.473 110.292  1.00  0.88           N  
ATOM  11677  NH2 ARG B 649      51.184  94.898 110.745  1.00  0.88           N  
ATOM  11678  N   VAL B 650      49.495  91.525 104.991  1.00  0.94           N  
ATOM  11679  CA  VAL B 650      48.712  92.459 104.194  1.00  0.94           C  
ATOM  11680  C   VAL B 650      48.809  93.917 104.645  1.00  0.94           C  
ATOM  11681  O   VAL B 650      49.132  94.779 103.830  1.00  0.94           O  
ATOM  11682  CB  VAL B 650      47.255  92.013 104.133  1.00  0.94           C  
ATOM  11683  CG1 VAL B 650      46.422  92.943 103.230  1.00  0.94           C  
ATOM  11684  CG2 VAL B 650      47.177  90.571 103.590  1.00  0.94           C  
ATOM  11685  N   SER B 651      48.657  94.232 105.953  1.00  0.93           N  
ATOM  11686  CA  SER B 651      48.708  95.618 106.429  1.00  0.93           C  
ATOM  11687  C   SER B 651      50.090  96.259 106.416  1.00  0.93           C  
ATOM  11688  O   SER B 651      50.242  97.468 106.622  1.00  0.93           O  
ATOM  11689  CB  SER B 651      48.094  95.806 107.842  1.00  0.93           C  
ATOM  11690  OG  SER B 651      48.900  95.252 108.885  1.00  0.93           O  
ATOM  11691  N   LEU B 652      51.146  95.454 106.180  1.00  0.93           N  
ATOM  11692  CA  LEU B 652      52.500  95.936 105.988  1.00  0.93           C  
ATOM  11693  C   LEU B 652      52.863  95.987 104.509  1.00  0.93           C  
ATOM  11694  O   LEU B 652      53.601  96.867 104.069  1.00  0.93           O  
ATOM  11695  CB  LEU B 652      53.483  95.023 106.755  1.00  0.93           C  
ATOM  11696  CG  LEU B 652      54.957  95.480 106.762  1.00  0.93           C  
ATOM  11697  CD1 LEU B 652      55.143  96.907 107.303  1.00  0.93           C  
ATOM  11698  CD2 LEU B 652      55.790  94.500 107.593  1.00  0.93           C  
ATOM  11699  N   ALA B 653      52.275  95.099 103.678  1.00  0.97           N  
ATOM  11700  CA  ALA B 653      52.346  95.146 102.229  1.00  0.97           C  
ATOM  11701  C   ALA B 653      51.725  96.415 101.668  1.00  0.97           C  
ATOM  11702  O   ALA B 653      52.284  97.068 100.791  1.00  0.97           O  
ATOM  11703  CB  ALA B 653      51.651  93.905 101.636  1.00  0.97           C  
ATOM  11704  N   GLU B 654      50.577  96.830 102.238  1.00  0.93           N  
ATOM  11705  CA  GLU B 654      49.925  98.100 101.977  1.00  0.93           C  
ATOM  11706  C   GLU B 654      50.825  99.306 102.248  1.00  0.93           C  
ATOM  11707  O   GLU B 654      50.784 100.299 101.534  1.00  0.93           O  
ATOM  11708  CB  GLU B 654      48.631  98.190 102.826  1.00  0.93           C  
ATOM  11709  CG  GLU B 654      47.524  97.215 102.340  1.00  0.93           C  
ATOM  11710  CD  GLU B 654      46.419  96.945 103.360  1.00  0.93           C  
ATOM  11711  OE1 GLU B 654      45.467  96.212 102.971  1.00  0.93           O  
ATOM  11712  OE2 GLU B 654      46.499  97.406 104.524  1.00  0.93           O  
ATOM  11713  N   LYS B 655      51.688  99.250 103.280  1.00  0.91           N  
ATOM  11714  CA  LYS B 655      52.637 100.314 103.566  1.00  0.91           C  
ATOM  11715  C   LYS B 655      53.880 100.336 102.673  1.00  0.91           C  
ATOM  11716  O   LYS B 655      54.271 101.387 102.173  1.00  0.91           O  
ATOM  11717  CB  LYS B 655      53.086 100.211 105.043  1.00  0.91           C  
ATOM  11718  CG  LYS B 655      51.930 100.433 106.031  1.00  0.91           C  
ATOM  11719  CD  LYS B 655      52.331 100.119 107.481  1.00  0.91           C  
ATOM  11720  CE  LYS B 655      51.276 100.502 108.527  1.00  0.91           C  
ATOM  11721  NZ  LYS B 655      49.969  99.878 108.240  1.00  0.91           N  
ATOM  11722  N   VAL B 656      54.554  99.183 102.458  1.00  0.94           N  
ATOM  11723  CA  VAL B 656      55.804  99.140 101.697  1.00  0.94           C  
ATOM  11724  C   VAL B 656      55.646  99.333 100.190  1.00  0.94           C  
ATOM  11725  O   VAL B 656      56.417 100.053  99.557  1.00  0.94           O  
ATOM  11726  CB  VAL B 656      56.655  97.909 102.038  1.00  0.94           C  
ATOM  11727  CG1 VAL B 656      56.016  96.592 101.563  1.00  0.94           C  
ATOM  11728  CG2 VAL B 656      58.083  98.069 101.474  1.00  0.94           C  
ATOM  11729  N   ILE B 657      54.619  98.722  99.562  1.00  0.96           N  
ATOM  11730  CA  ILE B 657      54.439  98.712  98.111  1.00  0.96           C  
ATOM  11731  C   ILE B 657      54.285 100.097  97.456  1.00  0.96           C  
ATOM  11732  O   ILE B 657      54.915 100.319  96.416  1.00  0.96           O  
ATOM  11733  CB  ILE B 657      53.342  97.718  97.705  1.00  0.96           C  
ATOM  11734  CG1 ILE B 657      53.782  96.275  98.070  1.00  0.96           C  
ATOM  11735  CG2 ILE B 657      53.005  97.833  96.202  1.00  0.96           C  
ATOM  11736  CD1 ILE B 657      52.680  95.222  97.909  1.00  0.96           C  
ATOM  11737  N   PRO B 658      53.549 101.084  97.977  1.00  0.97           N  
ATOM  11738  CA  PRO B 658      53.563 102.453  97.463  1.00  0.97           C  
ATOM  11739  C   PRO B 658      54.921 103.133  97.472  1.00  0.97           C  
ATOM  11740  O   PRO B 658      55.202 103.924  96.570  1.00  0.97           O  
ATOM  11741  CB  PRO B 658      52.564 103.187  98.368  1.00  0.97           C  
ATOM  11742  CG  PRO B 658      51.558 102.100  98.731  1.00  0.97           C  
ATOM  11743  CD  PRO B 658      52.454 100.885  98.929  1.00  0.97           C  
ATOM  11744  N   ALA B 659      55.763 102.865  98.485  1.00  0.95           N  
ATOM  11745  CA  ALA B 659      57.079 103.448  98.646  1.00  0.95           C  
ATOM  11746  C   ALA B 659      58.130 102.915  97.675  1.00  0.95           C  
ATOM  11747  O   ALA B 659      59.014 103.643  97.242  1.00  0.95           O  
ATOM  11748  CB  ALA B 659      57.541 103.255 100.102  1.00  0.95           C  
ATOM  11749  N   THR B 660      58.064 101.626  97.302  1.00  0.97           N  
ATOM  11750  CA  THR B 660      59.039 100.951  96.440  1.00  0.97           C  
ATOM  11751  C   THR B 660      59.325 101.604  95.094  1.00  0.97           C  
ATOM  11752  O   THR B 660      58.404 101.906  94.334  1.00  0.97           O  
ATOM  11753  CB  THR B 660      58.577  99.532  96.147  1.00  0.97           C  
ATOM  11754  OG1 THR B 660      58.498  98.812  97.362  1.00  0.97           O  
ATOM  11755  CG2 THR B 660      59.542  98.747  95.255  1.00  0.97           C  
ATOM  11756  N   ASP B 661      60.618 101.802  94.748  1.00  0.96           N  
ATOM  11757  CA  ASP B 661      61.050 102.217  93.423  1.00  0.96           C  
ATOM  11758  C   ASP B 661      61.331 101.009  92.524  1.00  0.96           C  
ATOM  11759  O   ASP B 661      60.922 100.972  91.364  1.00  0.96           O  
ATOM  11760  CB  ASP B 661      62.347 103.060  93.498  1.00  0.96           C  
ATOM  11761  CG  ASP B 661      62.174 104.279  94.374  1.00  0.96           C  
ATOM  11762  OD1 ASP B 661      61.403 105.204  94.038  1.00  0.96           O  
ATOM  11763  OD2 ASP B 661      62.881 104.335  95.412  1.00  0.96           O  
ATOM  11764  N   LEU B 662      62.037  99.980  93.048  1.00  0.97           N  
ATOM  11765  CA  LEU B 662      62.443  98.804  92.291  1.00  0.97           C  
ATOM  11766  C   LEU B 662      61.861  97.521  92.877  1.00  0.97           C  
ATOM  11767  O   LEU B 662      61.946  97.244  94.071  1.00  0.97           O  
ATOM  11768  CB  LEU B 662      63.985  98.679  92.226  1.00  0.97           C  
ATOM  11769  CG  LEU B 662      64.520  97.536  91.334  1.00  0.97           C  
ATOM  11770  CD1 LEU B 662      64.184  97.752  89.851  1.00  0.97           C  
ATOM  11771  CD2 LEU B 662      66.032  97.361  91.532  1.00  0.97           C  
ATOM  11772  N   SER B 663      61.230  96.711  92.009  1.00  0.98           N  
ATOM  11773  CA  SER B 663      60.522  95.480  92.325  1.00  0.98           C  
ATOM  11774  C   SER B 663      61.317  94.272  91.869  1.00  0.98           C  
ATOM  11775  O   SER B 663      61.496  94.041  90.674  1.00  0.98           O  
ATOM  11776  CB  SER B 663      59.155  95.504  91.578  1.00  0.98           C  
ATOM  11777  OG  SER B 663      58.456  94.255  91.493  1.00  0.98           O  
ATOM  11778  N   GLU B 664      61.791  93.458  92.830  1.00  0.96           N  
ATOM  11779  CA  GLU B 664      62.576  92.263  92.580  1.00  0.96           C  
ATOM  11780  C   GLU B 664      61.716  91.022  92.353  1.00  0.96           C  
ATOM  11781  O   GLU B 664      61.033  90.522  93.250  1.00  0.96           O  
ATOM  11782  CB  GLU B 664      63.474  92.008  93.806  1.00  0.96           C  
ATOM  11783  CG  GLU B 664      64.747  92.883  93.861  1.00  0.96           C  
ATOM  11784  CD  GLU B 664      65.833  92.362  92.938  1.00  0.96           C  
ATOM  11785  OE1 GLU B 664      66.206  91.174  93.108  1.00  0.96           O  
ATOM  11786  OE2 GLU B 664      66.336  93.110  92.070  1.00  0.96           O  
ATOM  11787  N   GLN B 665      61.738  90.467  91.124  1.00  0.95           N  
ATOM  11788  CA  GLN B 665      60.899  89.344  90.731  1.00  0.95           C  
ATOM  11789  C   GLN B 665      61.720  88.295  89.999  1.00  0.95           C  
ATOM  11790  O   GLN B 665      61.489  87.967  88.839  1.00  0.95           O  
ATOM  11791  CB  GLN B 665      59.723  89.810  89.837  1.00  0.95           C  
ATOM  11792  CG  GLN B 665      58.864  90.933  90.462  1.00  0.95           C  
ATOM  11793  CD  GLN B 665      58.224  90.532  91.792  1.00  0.95           C  
ATOM  11794  OE1 GLN B 665      57.905  89.368  92.066  1.00  0.95           O  
ATOM  11795  NE2 GLN B 665      58.004  91.547  92.660  1.00  0.95           N  
ATOM  11796  N   ILE B 666      62.742  87.760  90.683  1.00  0.96           N  
ATOM  11797  CA  ILE B 666      63.890  87.118  90.063  1.00  0.96           C  
ATOM  11798  C   ILE B 666      63.900  85.588  90.054  1.00  0.96           C  
ATOM  11799  O   ILE B 666      64.950  84.967  89.870  1.00  0.96           O  
ATOM  11800  CB  ILE B 666      65.142  87.628  90.761  1.00  0.96           C  
ATOM  11801  CG1 ILE B 666      65.158  87.298  92.273  1.00  0.96           C  
ATOM  11802  CG2 ILE B 666      65.221  89.154  90.531  1.00  0.96           C  
ATOM  11803  CD1 ILE B 666      66.475  87.700  92.939  1.00  0.96           C  
ATOM  11804  N   SER B 667      62.740  84.931  90.251  1.00  0.96           N  
ATOM  11805  CA  SER B 667      62.544  83.478  90.240  1.00  0.96           C  
ATOM  11806  C   SER B 667      63.145  82.692  89.074  1.00  0.96           C  
ATOM  11807  O   SER B 667      63.488  83.223  88.023  1.00  0.96           O  
ATOM  11808  CB  SER B 667      61.049  83.108  90.354  1.00  0.96           C  
ATOM  11809  OG  SER B 667      60.285  83.826  89.388  1.00  0.96           O  
ATOM  11810  N   THR B 668      63.334  81.367  89.210  1.00  0.94           N  
ATOM  11811  CA  THR B 668      63.853  80.558  88.103  1.00  0.94           C  
ATOM  11812  C   THR B 668      62.781  80.350  87.058  1.00  0.94           C  
ATOM  11813  O   THR B 668      61.697  79.894  87.395  1.00  0.94           O  
ATOM  11814  CB  THR B 668      64.339  79.177  88.519  1.00  0.94           C  
ATOM  11815  OG1 THR B 668      65.053  79.255  89.737  1.00  0.94           O  
ATOM  11816  CG2 THR B 668      65.296  78.588  87.471  1.00  0.94           C  
ATOM  11817  N   ALA B 669      63.022  80.682  85.772  1.00  0.93           N  
ATOM  11818  CA  ALA B 669      61.989  80.630  84.749  1.00  0.93           C  
ATOM  11819  C   ALA B 669      61.242  79.300  84.620  1.00  0.93           C  
ATOM  11820  O   ALA B 669      61.802  78.278  84.223  1.00  0.93           O  
ATOM  11821  CB  ALA B 669      62.565  81.053  83.388  1.00  0.93           C  
ATOM  11822  N   GLY B 670      59.946  79.306  85.003  1.00  0.90           N  
ATOM  11823  CA  GLY B 670      59.133  78.114  85.157  1.00  0.90           C  
ATOM  11824  C   GLY B 670      58.791  77.781  86.587  1.00  0.90           C  
ATOM  11825  O   GLY B 670      58.398  76.647  86.848  1.00  0.90           O  
ATOM  11826  N   THR B 671      58.939  78.706  87.567  1.00  0.90           N  
ATOM  11827  CA  THR B 671      58.744  78.332  88.977  1.00  0.90           C  
ATOM  11828  C   THR B 671      57.859  79.270  89.790  1.00  0.90           C  
ATOM  11829  O   THR B 671      57.140  78.804  90.674  1.00  0.90           O  
ATOM  11830  CB  THR B 671      60.046  78.130  89.758  1.00  0.90           C  
ATOM  11831  OG1 THR B 671      60.820  79.318  89.835  1.00  0.90           O  
ATOM  11832  CG2 THR B 671      60.927  77.034  89.128  1.00  0.90           C  
ATOM  11833  N   GLU B 672      57.795  80.592  89.511  1.00  0.88           N  
ATOM  11834  CA  GLU B 672      56.781  81.458  90.105  1.00  0.88           C  
ATOM  11835  C   GLU B 672      55.610  81.444  89.143  1.00  0.88           C  
ATOM  11836  O   GLU B 672      55.643  82.032  88.069  1.00  0.88           O  
ATOM  11837  CB  GLU B 672      57.314  82.905  90.348  1.00  0.88           C  
ATOM  11838  CG  GLU B 672      56.342  83.968  90.954  1.00  0.88           C  
ATOM  11839  CD  GLU B 672      56.357  84.115  92.470  1.00  0.88           C  
ATOM  11840  OE1 GLU B 672      57.382  84.547  93.079  1.00  0.88           O  
ATOM  11841  OE2 GLU B 672      55.307  83.820  93.099  1.00  0.88           O  
ATOM  11842  N   ALA B 673      54.514  80.739  89.496  1.00  0.93           N  
ATOM  11843  CA  ALA B 673      53.464  80.363  88.561  1.00  0.93           C  
ATOM  11844  C   ALA B 673      52.667  81.525  87.980  1.00  0.93           C  
ATOM  11845  O   ALA B 673      51.980  81.397  86.969  1.00  0.93           O  
ATOM  11846  CB  ALA B 673      52.497  79.412  89.282  1.00  0.93           C  
ATOM  11847  N   SER B 674      52.778  82.705  88.609  1.00  0.95           N  
ATOM  11848  CA  SER B 674      52.150  83.926  88.151  1.00  0.95           C  
ATOM  11849  C   SER B 674      52.662  85.060  89.004  1.00  0.95           C  
ATOM  11850  O   SER B 674      53.204  86.053  88.517  1.00  0.95           O  
ATOM  11851  CB  SER B 674      50.606  83.868  88.284  1.00  0.95           C  
ATOM  11852  OG  SER B 674      49.962  84.968  87.646  1.00  0.95           O  
ATOM  11853  N   GLY B 675      52.568  84.873  90.338  1.00  0.94           N  
ATOM  11854  CA  GLY B 675      52.774  85.919  91.326  1.00  0.94           C  
ATOM  11855  C   GLY B 675      51.593  86.855  91.424  1.00  0.94           C  
ATOM  11856  O   GLY B 675      50.734  86.919  90.550  1.00  0.94           O  
ATOM  11857  N   THR B 676      51.503  87.615  92.530  1.00  0.93           N  
ATOM  11858  CA  THR B 676      50.555  88.729  92.610  1.00  0.93           C  
ATOM  11859  C   THR B 676      51.217  89.962  93.187  1.00  0.93           C  
ATOM  11860  O   THR B 676      50.608  91.023  93.271  1.00  0.93           O  
ATOM  11861  CB  THR B 676      49.286  88.453  93.430  1.00  0.93           C  
ATOM  11862  OG1 THR B 676      49.557  88.049  94.768  1.00  0.93           O  
ATOM  11863  CG2 THR B 676      48.473  87.323  92.783  1.00  0.93           C  
ATOM  11864  N   GLY B 677      52.508  89.888  93.587  1.00  0.97           N  
ATOM  11865  CA  GLY B 677      53.227  91.033  94.151  1.00  0.97           C  
ATOM  11866  C   GLY B 677      53.750  91.958  93.093  1.00  0.97           C  
ATOM  11867  O   GLY B 677      53.740  93.174  93.241  1.00  0.97           O  
ATOM  11868  N   ASN B 678      54.166  91.369  91.964  1.00  0.95           N  
ATOM  11869  CA  ASN B 678      54.671  92.010  90.766  1.00  0.95           C  
ATOM  11870  C   ASN B 678      53.665  92.981  90.154  1.00  0.95           C  
ATOM  11871  O   ASN B 678      53.991  94.117  89.811  1.00  0.95           O  
ATOM  11872  CB  ASN B 678      55.137  90.914  89.747  1.00  0.95           C  
ATOM  11873  CG  ASN B 678      54.145  89.765  89.503  1.00  0.95           C  
ATOM  11874  OD1 ASN B 678      53.095  89.649  90.139  1.00  0.95           O  
ATOM  11875  ND2 ASN B 678      54.522  88.839  88.594  1.00  0.95           N  
ATOM  11876  N   MET B 679      52.390  92.561  90.095  1.00  0.95           N  
ATOM  11877  CA  MET B 679      51.257  93.363  89.681  1.00  0.95           C  
ATOM  11878  C   MET B 679      51.017  94.591  90.556  1.00  0.95           C  
ATOM  11879  O   MET B 679      50.777  95.692  90.064  1.00  0.95           O  
ATOM  11880  CB  MET B 679      49.989  92.477  89.714  1.00  0.95           C  
ATOM  11881  CG  MET B 679      50.102  91.224  88.826  1.00  0.95           C  
ATOM  11882  SD  MET B 679      48.659  90.133  88.940  1.00  0.95           S  
ATOM  11883  CE  MET B 679      49.398  88.909  87.826  1.00  0.95           C  
ATOM  11884  N   LYS B 680      51.109  94.438  91.896  1.00  0.95           N  
ATOM  11885  CA  LYS B 680      50.926  95.524  92.849  1.00  0.95           C  
ATOM  11886  C   LYS B 680      51.986  96.598  92.720  1.00  0.95           C  
ATOM  11887  O   LYS B 680      51.691  97.790  92.729  1.00  0.95           O  
ATOM  11888  CB  LYS B 680      50.955  95.009  94.307  1.00  0.95           C  
ATOM  11889  CG  LYS B 680      49.878  93.971  94.639  1.00  0.95           C  
ATOM  11890  CD  LYS B 680      50.182  93.270  95.969  1.00  0.95           C  
ATOM  11891  CE  LYS B 680      49.313  92.039  96.216  1.00  0.95           C  
ATOM  11892  NZ  LYS B 680      49.826  91.321  97.400  1.00  0.95           N  
ATOM  11893  N   PHE B 681      53.257  96.191  92.561  1.00  0.95           N  
ATOM  11894  CA  PHE B 681      54.364  97.093  92.313  1.00  0.95           C  
ATOM  11895  C   PHE B 681      54.222  97.880  91.020  1.00  0.95           C  
ATOM  11896  O   PHE B 681      54.455  99.086  90.994  1.00  0.95           O  
ATOM  11897  CB  PHE B 681      55.686  96.296  92.259  1.00  0.95           C  
ATOM  11898  CG  PHE B 681      56.120  95.838  93.624  1.00  0.95           C  
ATOM  11899  CD1 PHE B 681      56.322  96.759  94.665  1.00  0.95           C  
ATOM  11900  CD2 PHE B 681      56.390  94.481  93.863  1.00  0.95           C  
ATOM  11901  CE1 PHE B 681      56.757  96.324  95.921  1.00  0.95           C  
ATOM  11902  CE2 PHE B 681      56.844  94.044  95.112  1.00  0.95           C  
ATOM  11903  CZ  PHE B 681      57.026  94.971  96.142  1.00  0.95           C  
ATOM  11904  N   MET B 682      53.785  97.223  89.928  1.00  0.95           N  
ATOM  11905  CA  MET B 682      53.514  97.858  88.648  1.00  0.95           C  
ATOM  11906  C   MET B 682      52.425  98.929  88.728  1.00  0.95           C  
ATOM  11907  O   MET B 682      52.584 100.047  88.241  1.00  0.95           O  
ATOM  11908  CB  MET B 682      53.080  96.754  87.656  1.00  0.95           C  
ATOM  11909  CG  MET B 682      53.012  97.179  86.179  1.00  0.95           C  
ATOM  11910  SD  MET B 682      52.241  95.903  85.140  1.00  0.95           S  
ATOM  11911  CE  MET B 682      52.745  96.615  83.552  1.00  0.95           C  
ATOM  11912  N   LEU B 683      51.307  98.619  89.421  1.00  0.96           N  
ATOM  11913  CA  LEU B 683      50.209  99.540  89.681  1.00  0.96           C  
ATOM  11914  C   LEU B 683      50.625 100.748  90.528  1.00  0.96           C  
ATOM  11915  O   LEU B 683      50.228 101.886  90.297  1.00  0.96           O  
ATOM  11916  CB  LEU B 683      49.035  98.786  90.368  1.00  0.96           C  
ATOM  11917  CG  LEU B 683      47.636  99.061  89.771  1.00  0.96           C  
ATOM  11918  CD1 LEU B 683      46.553  98.368  90.614  1.00  0.96           C  
ATOM  11919  CD2 LEU B 683      47.310 100.554  89.635  1.00  0.96           C  
ATOM  11920  N   ASN B 684      51.494 100.517  91.534  1.00  0.96           N  
ATOM  11921  CA  ASN B 684      51.942 101.522  92.484  1.00  0.96           C  
ATOM  11922  C   ASN B 684      53.219 102.221  92.038  1.00  0.96           C  
ATOM  11923  O   ASN B 684      53.891 102.907  92.814  1.00  0.96           O  
ATOM  11924  CB  ASN B 684      52.161 100.879  93.872  1.00  0.96           C  
ATOM  11925  CG  ASN B 684      50.796 100.693  94.516  1.00  0.96           C  
ATOM  11926  OD1 ASN B 684      50.296 101.628  95.140  1.00  0.96           O  
ATOM  11927  ND2 ASN B 684      50.173  99.513  94.340  1.00  0.96           N  
ATOM  11928  N   GLY B 685      53.574 102.095  90.749  1.00  0.96           N  
ATOM  11929  CA  GLY B 685      54.611 102.903  90.134  1.00  0.96           C  
ATOM  11930  C   GLY B 685      56.016 102.542  90.503  1.00  0.96           C  
ATOM  11931  O   GLY B 685      56.855 103.415  90.692  1.00  0.96           O  
ATOM  11932  N   ALA B 686      56.310 101.243  90.616  1.00  0.99           N  
ATOM  11933  CA  ALA B 686      57.658 100.747  90.744  1.00  0.99           C  
ATOM  11934  C   ALA B 686      58.058 100.075  89.443  1.00  0.99           C  
ATOM  11935  O   ALA B 686      57.225  99.554  88.702  1.00  0.99           O  
ATOM  11936  CB  ALA B 686      57.742  99.726  91.892  1.00  0.99           C  
ATOM  11937  N   LEU B 687      59.363 100.067  89.127  1.00  0.96           N  
ATOM  11938  CA  LEU B 687      59.875  99.364  87.969  1.00  0.96           C  
ATOM  11939  C   LEU B 687      60.248  97.953  88.359  1.00  0.96           C  
ATOM  11940  O   LEU B 687      60.695  97.695  89.472  1.00  0.96           O  
ATOM  11941  CB  LEU B 687      61.087 100.090  87.338  1.00  0.96           C  
ATOM  11942  CG  LEU B 687      60.727 101.475  86.765  1.00  0.96           C  
ATOM  11943  CD1 LEU B 687      61.955 102.169  86.166  1.00  0.96           C  
ATOM  11944  CD2 LEU B 687      59.629 101.382  85.698  1.00  0.96           C  
ATOM  11945  N   THR B 688      60.049  96.980  87.454  1.00  0.97           N  
ATOM  11946  CA  THR B 688      60.236  95.568  87.782  1.00  0.97           C  
ATOM  11947  C   THR B 688      61.489  95.048  87.136  1.00  0.97           C  
ATOM  11948  O   THR B 688      61.678  95.164  85.926  1.00  0.97           O  
ATOM  11949  CB  THR B 688      59.049  94.691  87.381  1.00  0.97           C  
ATOM  11950  OG1 THR B 688      57.919  94.995  88.196  1.00  0.97           O  
ATOM  11951  CG2 THR B 688      59.327  93.196  87.595  1.00  0.97           C  
ATOM  11952  N   ILE B 689      62.370  94.435  87.950  1.00  0.96           N  
ATOM  11953  CA  ILE B 689      63.524  93.683  87.502  1.00  0.96           C  
ATOM  11954  C   ILE B 689      63.217  92.226  87.764  1.00  0.96           C  
ATOM  11955  O   ILE B 689      62.732  91.824  88.822  1.00  0.96           O  
ATOM  11956  CB  ILE B 689      64.841  94.133  88.142  1.00  0.96           C  
ATOM  11957  CG1 ILE B 689      66.049  93.314  87.621  1.00  0.96           C  
ATOM  11958  CG2 ILE B 689      64.745  94.088  89.677  1.00  0.96           C  
ATOM  11959  CD1 ILE B 689      67.413  93.875  88.034  1.00  0.96           C  
ATOM  11960  N   GLY B 690      63.403  91.363  86.756  1.00  0.98           N  
ATOM  11961  CA  GLY B 690      62.940  90.005  86.929  1.00  0.98           C  
ATOM  11962  C   GLY B 690      63.293  89.125  85.791  1.00  0.98           C  
ATOM  11963  O   GLY B 690      63.788  89.549  84.753  1.00  0.98           O  
ATOM  11964  N   THR B 691      63.021  87.837  85.972  1.00  0.95           N  
ATOM  11965  CA  THR B 691      63.210  86.819  84.963  1.00  0.95           C  
ATOM  11966  C   THR B 691      61.959  86.694  84.135  1.00  0.95           C  
ATOM  11967  O   THR B 691      60.880  87.165  84.505  1.00  0.95           O  
ATOM  11968  CB  THR B 691      63.502  85.473  85.589  1.00  0.95           C  
ATOM  11969  OG1 THR B 691      62.587  85.252  86.653  1.00  0.95           O  
ATOM  11970  CG2 THR B 691      64.915  85.513  86.186  1.00  0.95           C  
ATOM  11971  N   MET B 692      62.063  86.049  82.959  1.00  0.92           N  
ATOM  11972  CA  MET B 692      60.914  85.806  82.109  1.00  0.92           C  
ATOM  11973  C   MET B 692      60.088  84.607  82.581  1.00  0.92           C  
ATOM  11974  O   MET B 692      60.011  83.565  81.933  1.00  0.92           O  
ATOM  11975  CB  MET B 692      61.356  85.727  80.627  1.00  0.92           C  
ATOM  11976  CG  MET B 692      60.320  86.260  79.618  1.00  0.92           C  
ATOM  11977  SD  MET B 692      59.774  87.963  79.977  1.00  0.92           S  
ATOM  11978  CE  MET B 692      59.443  88.435  78.261  1.00  0.92           C  
ATOM  11979  N   ASP B 693      59.460  84.772  83.759  1.00  0.93           N  
ATOM  11980  CA  ASP B 693      58.732  83.774  84.506  1.00  0.93           C  
ATOM  11981  C   ASP B 693      57.341  84.318  84.817  1.00  0.93           C  
ATOM  11982  O   ASP B 693      57.078  85.513  84.671  1.00  0.93           O  
ATOM  11983  CB  ASP B 693      59.501  83.488  85.831  1.00  0.93           C  
ATOM  11984  CG  ASP B 693      59.053  82.209  86.512  1.00  0.93           C  
ATOM  11985  OD1 ASP B 693      59.405  81.998  87.699  1.00  0.93           O  
ATOM  11986  OD2 ASP B 693      58.377  81.390  85.841  1.00  0.93           O  
ATOM  11987  N   GLY B 694      56.412  83.442  85.251  1.00  0.95           N  
ATOM  11988  CA  GLY B 694      55.049  83.772  85.677  1.00  0.95           C  
ATOM  11989  C   GLY B 694      54.294  84.820  84.896  1.00  0.95           C  
ATOM  11990  O   GLY B 694      54.135  84.745  83.680  1.00  0.95           O  
ATOM  11991  N   ALA B 695      53.793  85.857  85.594  1.00  0.95           N  
ATOM  11992  CA  ALA B 695      53.091  86.945  84.954  1.00  0.95           C  
ATOM  11993  C   ALA B 695      54.029  88.091  84.598  1.00  0.95           C  
ATOM  11994  O   ALA B 695      53.605  89.080  84.006  1.00  0.95           O  
ATOM  11995  CB  ALA B 695      51.975  87.463  85.877  1.00  0.95           C  
ATOM  11996  N   ASN B 696      55.352  87.962  84.865  1.00  0.94           N  
ATOM  11997  CA  ASN B 696      56.360  88.923  84.426  1.00  0.94           C  
ATOM  11998  C   ASN B 696      56.406  88.992  82.906  1.00  0.94           C  
ATOM  11999  O   ASN B 696      56.578  90.058  82.318  1.00  0.94           O  
ATOM  12000  CB  ASN B 696      57.803  88.591  84.895  1.00  0.94           C  
ATOM  12001  CG  ASN B 696      57.938  88.456  86.409  1.00  0.94           C  
ATOM  12002  OD1 ASN B 696      57.107  88.885  87.213  1.00  0.94           O  
ATOM  12003  ND2 ASN B 696      59.081  87.848  86.811  1.00  0.94           N  
ATOM  12004  N   VAL B 697      56.205  87.828  82.246  1.00  0.94           N  
ATOM  12005  CA  VAL B 697      56.088  87.699  80.800  1.00  0.94           C  
ATOM  12006  C   VAL B 697      54.953  88.536  80.245  1.00  0.94           C  
ATOM  12007  O   VAL B 697      55.119  89.312  79.311  1.00  0.94           O  
ATOM  12008  CB  VAL B 697      55.830  86.247  80.387  1.00  0.94           C  
ATOM  12009  CG1 VAL B 697      56.010  86.098  78.863  1.00  0.94           C  
ATOM  12010  CG2 VAL B 697      56.788  85.305  81.136  1.00  0.94           C  
ATOM  12011  N   GLU B 698      53.767  88.442  80.870  1.00  0.92           N  
ATOM  12012  CA  GLU B 698      52.609  89.227  80.505  1.00  0.92           C  
ATOM  12013  C   GLU B 698      52.764  90.707  80.796  1.00  0.92           C  
ATOM  12014  O   GLU B 698      52.384  91.548  79.996  1.00  0.92           O  
ATOM  12015  CB  GLU B 698      51.335  88.638  81.142  1.00  0.92           C  
ATOM  12016  CG  GLU B 698      51.126  87.186  80.650  1.00  0.92           C  
ATOM  12017  CD  GLU B 698      49.717  86.669  80.863  1.00  0.92           C  
ATOM  12018  OE1 GLU B 698      48.761  87.375  80.447  1.00  0.92           O  
ATOM  12019  OE2 GLU B 698      49.567  85.537  81.393  1.00  0.92           O  
ATOM  12020  N   MET B 699      53.386  91.094  81.925  1.00  0.93           N  
ATOM  12021  CA  MET B 699      53.717  92.486  82.202  1.00  0.93           C  
ATOM  12022  C   MET B 699      54.639  93.100  81.146  1.00  0.93           C  
ATOM  12023  O   MET B 699      54.446  94.237  80.720  1.00  0.93           O  
ATOM  12024  CB  MET B 699      54.353  92.610  83.605  1.00  0.93           C  
ATOM  12025  CG  MET B 699      53.367  92.278  84.743  1.00  0.93           C  
ATOM  12026  SD  MET B 699      54.138  91.930  86.351  1.00  0.93           S  
ATOM  12027  CE  MET B 699      55.111  93.452  86.516  1.00  0.93           C  
ATOM  12028  N   ALA B 700      55.632  92.327  80.658  1.00  0.93           N  
ATOM  12029  CA  ALA B 700      56.425  92.665  79.493  1.00  0.93           C  
ATOM  12030  C   ALA B 700      55.625  92.758  78.186  1.00  0.93           C  
ATOM  12031  O   ALA B 700      55.866  93.645  77.374  1.00  0.93           O  
ATOM  12032  CB  ALA B 700      57.585  91.662  79.350  1.00  0.93           C  
ATOM  12033  N   GLU B 701      54.636  91.872  77.937  1.00  0.89           N  
ATOM  12034  CA  GLU B 701      53.734  92.011  76.797  1.00  0.89           C  
ATOM  12035  C   GLU B 701      52.889  93.291  76.830  1.00  0.89           C  
ATOM  12036  O   GLU B 701      52.852  94.035  75.852  1.00  0.89           O  
ATOM  12037  CB  GLU B 701      52.739  90.822  76.705  1.00  0.89           C  
ATOM  12038  CG  GLU B 701      53.337  89.434  76.364  1.00  0.89           C  
ATOM  12039  CD  GLU B 701      52.272  88.358  76.415  1.00  0.89           C  
ATOM  12040  OE1 GLU B 701      51.129  88.613  76.885  1.00  0.89           O  
ATOM  12041  OE2 GLU B 701      52.543  87.209  75.969  1.00  0.89           O  
ATOM  12042  N   GLU B 702      52.223  93.604  77.968  1.00  0.90           N  
ATOM  12043  CA  GLU B 702      51.382  94.789  78.096  1.00  0.90           C  
ATOM  12044  C   GLU B 702      52.152  96.107  78.042  1.00  0.90           C  
ATOM  12045  O   GLU B 702      51.725  97.081  77.424  1.00  0.90           O  
ATOM  12046  CB  GLU B 702      50.550  94.813  79.411  1.00  0.90           C  
ATOM  12047  CG  GLU B 702      49.744  93.538  79.766  1.00  0.90           C  
ATOM  12048  CD  GLU B 702      48.841  92.977  78.674  1.00  0.90           C  
ATOM  12049  OE1 GLU B 702      47.911  93.687  78.226  1.00  0.90           O  
ATOM  12050  OE2 GLU B 702      48.974  91.747  78.408  1.00  0.90           O  
ATOM  12051  N   ALA B 703      53.314  96.185  78.726  1.00  0.93           N  
ATOM  12052  CA  ALA B 703      54.029  97.435  78.896  1.00  0.93           C  
ATOM  12053  C   ALA B 703      55.245  97.585  77.998  1.00  0.93           C  
ATOM  12054  O   ALA B 703      55.870  98.643  77.991  1.00  0.93           O  
ATOM  12055  CB  ALA B 703      54.486  97.540  80.366  1.00  0.93           C  
ATOM  12056  N   GLY B 704      55.599  96.556  77.205  1.00  0.93           N  
ATOM  12057  CA  GLY B 704      56.820  96.511  76.402  1.00  0.93           C  
ATOM  12058  C   GLY B 704      57.971  95.892  77.157  1.00  0.93           C  
ATOM  12059  O   GLY B 704      58.218  96.199  78.324  1.00  0.93           O  
ATOM  12060  N   GLU B 705      58.753  95.005  76.493  1.00  0.87           N  
ATOM  12061  CA  GLU B 705      59.865  94.297  77.122  1.00  0.87           C  
ATOM  12062  C   GLU B 705      61.017  95.252  77.441  1.00  0.87           C  
ATOM  12063  O   GLU B 705      61.817  95.005  78.340  1.00  0.87           O  
ATOM  12064  CB  GLU B 705      60.359  93.058  76.289  1.00  0.87           C  
ATOM  12065  CG  GLU B 705      61.198  92.038  77.128  1.00  0.87           C  
ATOM  12066  CD  GLU B 705      61.832  90.843  76.403  1.00  0.87           C  
ATOM  12067  OE1 GLU B 705      61.126  89.914  75.931  1.00  0.87           O  
ATOM  12068  OE2 GLU B 705      63.088  90.752  76.422  1.00  0.87           O  
ATOM  12069  N   GLU B 706      61.084  96.426  76.767  1.00  0.87           N  
ATOM  12070  CA  GLU B 706      62.107  97.426  76.994  1.00  0.87           C  
ATOM  12071  C   GLU B 706      61.799  98.338  78.177  1.00  0.87           C  
ATOM  12072  O   GLU B 706      62.661  99.076  78.651  1.00  0.87           O  
ATOM  12073  CB  GLU B 706      62.362  98.256  75.700  1.00  0.87           C  
ATOM  12074  CG  GLU B 706      61.475  99.507  75.420  1.00  0.87           C  
ATOM  12075  CD  GLU B 706      59.990  99.285  75.155  1.00  0.87           C  
ATOM  12076  OE1 GLU B 706      59.313 100.340  74.950  1.00  0.87           O  
ATOM  12077  OE2 GLU B 706      59.497  98.129  75.207  1.00  0.87           O  
ATOM  12078  N   ASN B 707      60.557  98.288  78.710  1.00  0.91           N  
ATOM  12079  CA  ASN B 707      60.139  99.109  79.839  1.00  0.91           C  
ATOM  12080  C   ASN B 707      60.115  98.323  81.135  1.00  0.91           C  
ATOM  12081  O   ASN B 707      59.650  98.806  82.169  1.00  0.91           O  
ATOM  12082  CB  ASN B 707      58.738  99.707  79.617  1.00  0.91           C  
ATOM  12083  CG  ASN B 707      58.818 100.568  78.378  1.00  0.91           C  
ATOM  12084  OD1 ASN B 707      59.560 101.554  78.292  1.00  0.91           O  
ATOM  12085  ND2 ASN B 707      57.996 100.215  77.369  1.00  0.91           N  
ATOM  12086  N   LEU B 708      60.644  97.093  81.102  1.00  0.93           N  
ATOM  12087  CA  LEU B 708      60.864  96.265  82.262  1.00  0.93           C  
ATOM  12088  C   LEU B 708      62.323  95.860  82.215  1.00  0.93           C  
ATOM  12089  O   LEU B 708      62.969  95.859  81.171  1.00  0.93           O  
ATOM  12090  CB  LEU B 708      59.999  94.972  82.277  1.00  0.93           C  
ATOM  12091  CG  LEU B 708      58.594  95.114  82.902  1.00  0.93           C  
ATOM  12092  CD1 LEU B 708      57.592  95.845  81.999  1.00  0.93           C  
ATOM  12093  CD2 LEU B 708      58.045  93.726  83.267  1.00  0.93           C  
ATOM  12094  N   PHE B 709      62.897  95.479  83.364  1.00  0.93           N  
ATOM  12095  CA  PHE B 709      64.285  95.078  83.449  1.00  0.93           C  
ATOM  12096  C   PHE B 709      64.354  93.559  83.447  1.00  0.93           C  
ATOM  12097  O   PHE B 709      64.751  92.906  84.412  1.00  0.93           O  
ATOM  12098  CB  PHE B 709      64.932  95.699  84.707  1.00  0.93           C  
ATOM  12099  CG  PHE B 709      65.244  97.145  84.460  1.00  0.93           C  
ATOM  12100  CD1 PHE B 709      64.387  98.160  84.918  1.00  0.93           C  
ATOM  12101  CD2 PHE B 709      66.431  97.497  83.796  1.00  0.93           C  
ATOM  12102  CE1 PHE B 709      64.723  99.508  84.732  1.00  0.93           C  
ATOM  12103  CE2 PHE B 709      66.768  98.843  83.609  1.00  0.93           C  
ATOM  12104  CZ  PHE B 709      65.915  99.847  84.080  1.00  0.93           C  
ATOM  12105  N   ILE B 710      63.920  92.952  82.325  1.00  0.93           N  
ATOM  12106  CA  ILE B 710      64.007  91.521  82.083  1.00  0.93           C  
ATOM  12107  C   ILE B 710      65.455  91.049  81.966  1.00  0.93           C  
ATOM  12108  O   ILE B 710      66.289  91.674  81.313  1.00  0.93           O  
ATOM  12109  CB  ILE B 710      63.184  91.088  80.866  1.00  0.93           C  
ATOM  12110  CG1 ILE B 710      61.716  91.590  80.948  1.00  0.93           C  
ATOM  12111  CG2 ILE B 710      63.215  89.551  80.685  1.00  0.93           C  
ATOM  12112  CD1 ILE B 710      60.930  91.115  82.180  1.00  0.93           C  
ATOM  12113  N   PHE B 711      65.799  89.913  82.599  1.00  0.93           N  
ATOM  12114  CA  PHE B 711      67.125  89.341  82.496  1.00  0.93           C  
ATOM  12115  C   PHE B 711      67.055  87.829  82.611  1.00  0.93           C  
ATOM  12116  O   PHE B 711      66.004  87.250  82.885  1.00  0.93           O  
ATOM  12117  CB  PHE B 711      68.126  89.932  83.545  1.00  0.93           C  
ATOM  12118  CG  PHE B 711      67.849  89.483  84.962  1.00  0.93           C  
ATOM  12119  CD1 PHE B 711      68.509  88.357  85.490  1.00  0.93           C  
ATOM  12120  CD2 PHE B 711      66.883  90.128  85.746  1.00  0.93           C  
ATOM  12121  CE1 PHE B 711      68.172  87.855  86.750  1.00  0.93           C  
ATOM  12122  CE2 PHE B 711      66.562  89.641  87.019  1.00  0.93           C  
ATOM  12123  CZ  PHE B 711      67.197  88.498  87.515  1.00  0.93           C  
ATOM  12124  N   GLY B 712      68.217  87.169  82.431  1.00  0.95           N  
ATOM  12125  CA  GLY B 712      68.388  85.770  82.789  1.00  0.95           C  
ATOM  12126  C   GLY B 712      67.827  84.777  81.821  1.00  0.95           C  
ATOM  12127  O   GLY B 712      67.319  85.110  80.750  1.00  0.95           O  
ATOM  12128  N   MET B 713      67.955  83.497  82.197  1.00  0.90           N  
ATOM  12129  CA  MET B 713      67.435  82.368  81.460  1.00  0.90           C  
ATOM  12130  C   MET B 713      65.926  82.421  81.254  1.00  0.90           C  
ATOM  12131  O   MET B 713      65.150  82.716  82.164  1.00  0.90           O  
ATOM  12132  CB  MET B 713      67.759  81.054  82.211  1.00  0.90           C  
ATOM  12133  CG  MET B 713      69.265  80.747  82.300  1.00  0.90           C  
ATOM  12134  SD  MET B 713      69.653  79.169  83.122  1.00  0.90           S  
ATOM  12135  CE  MET B 713      69.215  79.730  84.791  1.00  0.90           C  
ATOM  12136  N   ARG B 714      65.457  82.101  80.038  1.00  0.84           N  
ATOM  12137  CA  ARG B 714      64.064  81.846  79.765  1.00  0.84           C  
ATOM  12138  C   ARG B 714      63.820  80.346  79.964  1.00  0.84           C  
ATOM  12139  O   ARG B 714      64.719  79.595  80.341  1.00  0.84           O  
ATOM  12140  CB  ARG B 714      63.641  82.446  78.390  1.00  0.84           C  
ATOM  12141  CG  ARG B 714      63.995  83.958  78.318  1.00  0.84           C  
ATOM  12142  CD  ARG B 714      63.403  84.773  77.152  1.00  0.84           C  
ATOM  12143  NE  ARG B 714      63.942  86.169  77.333  1.00  0.84           N  
ATOM  12144  CZ  ARG B 714      63.399  87.332  76.932  1.00  0.84           C  
ATOM  12145  NH1 ARG B 714      62.291  87.433  76.210  1.00  0.84           N  
ATOM  12146  NH2 ARG B 714      64.008  88.464  77.277  1.00  0.84           N  
ATOM  12147  N   ILE B 715      62.574  79.854  79.801  1.00  0.84           N  
ATOM  12148  CA  ILE B 715      62.197  78.479  80.140  1.00  0.84           C  
ATOM  12149  C   ILE B 715      63.014  77.399  79.417  1.00  0.84           C  
ATOM  12150  O   ILE B 715      63.501  76.442  80.023  1.00  0.84           O  
ATOM  12151  CB  ILE B 715      60.681  78.290  79.956  1.00  0.84           C  
ATOM  12152  CG1 ILE B 715      60.163  76.873  80.310  1.00  0.84           C  
ATOM  12153  CG2 ILE B 715      60.214  78.680  78.534  1.00  0.84           C  
ATOM  12154  CD1 ILE B 715      60.374  76.486  81.775  1.00  0.84           C  
ATOM  12155  N   ASP B 716      63.244  77.569  78.106  1.00  0.81           N  
ATOM  12156  CA  ASP B 716      64.034  76.703  77.258  1.00  0.81           C  
ATOM  12157  C   ASP B 716      65.516  76.663  77.640  1.00  0.81           C  
ATOM  12158  O   ASP B 716      66.140  75.601  77.654  1.00  0.81           O  
ATOM  12159  CB  ASP B 716      63.819  77.147  75.794  1.00  0.81           C  
ATOM  12160  CG  ASP B 716      62.321  77.278  75.580  1.00  0.81           C  
ATOM  12161  OD1 ASP B 716      61.636  76.233  75.452  1.00  0.81           O  
ATOM  12162  OD2 ASP B 716      61.841  78.440  75.671  1.00  0.81           O  
ATOM  12163  N   ASP B 717      66.105  77.820  78.020  1.00  0.86           N  
ATOM  12164  CA  ASP B 717      67.475  77.933  78.496  1.00  0.86           C  
ATOM  12165  C   ASP B 717      67.730  77.114  79.762  1.00  0.86           C  
ATOM  12166  O   ASP B 717      68.731  76.405  79.887  1.00  0.86           O  
ATOM  12167  CB  ASP B 717      67.828  79.406  78.820  1.00  0.86           C  
ATOM  12168  CG  ASP B 717      67.549  80.320  77.645  1.00  0.86           C  
ATOM  12169  OD1 ASP B 717      68.141  80.096  76.565  1.00  0.86           O  
ATOM  12170  OD2 ASP B 717      66.741  81.267  77.831  1.00  0.86           O  
ATOM  12171  N   VAL B 718      66.781  77.156  80.727  1.00  0.88           N  
ATOM  12172  CA  VAL B 718      66.821  76.355  81.946  1.00  0.88           C  
ATOM  12173  C   VAL B 718      66.808  74.864  81.635  1.00  0.88           C  
ATOM  12174  O   VAL B 718      67.648  74.109  82.123  1.00  0.88           O  
ATOM  12175  CB  VAL B 718      65.643  76.687  82.867  1.00  0.88           C  
ATOM  12176  CG1 VAL B 718      65.625  75.782  84.116  1.00  0.88           C  
ATOM  12177  CG2 VAL B 718      65.732  78.159  83.313  1.00  0.88           C  
ATOM  12178  N   ALA B 719      65.895  74.431  80.741  1.00  0.84           N  
ATOM  12179  CA  ALA B 719      65.771  73.059  80.287  1.00  0.84           C  
ATOM  12180  C   ALA B 719      67.008  72.543  79.551  1.00  0.84           C  
ATOM  12181  O   ALA B 719      67.461  71.416  79.752  1.00  0.84           O  
ATOM  12182  CB  ALA B 719      64.527  72.948  79.382  1.00  0.84           C  
ATOM  12183  N   ALA B 720      67.619  73.381  78.691  1.00  0.85           N  
ATOM  12184  CA  ALA B 720      68.883  73.098  78.045  1.00  0.85           C  
ATOM  12185  C   ALA B 720      70.039  72.911  79.027  1.00  0.85           C  
ATOM  12186  O   ALA B 720      70.849  71.992  78.886  1.00  0.85           O  
ATOM  12187  CB  ALA B 720      69.207  74.236  77.057  1.00  0.85           C  
ATOM  12188  N   LEU B 721      70.122  73.764  80.068  1.00  0.83           N  
ATOM  12189  CA  LEU B 721      71.097  73.645  81.137  1.00  0.83           C  
ATOM  12190  C   LEU B 721      70.923  72.401  82.003  1.00  0.83           C  
ATOM  12191  O   LEU B 721      71.903  71.736  82.330  1.00  0.83           O  
ATOM  12192  CB  LEU B 721      71.130  74.935  81.992  1.00  0.83           C  
ATOM  12193  CG  LEU B 721      72.320  75.062  82.973  1.00  0.83           C  
ATOM  12194  CD1 LEU B 721      73.683  74.864  82.287  1.00  0.83           C  
ATOM  12195  CD2 LEU B 721      72.295  76.440  83.650  1.00  0.83           C  
ATOM  12196  N   ASP B 722      69.676  72.009  82.353  1.00  0.78           N  
ATOM  12197  CA  ASP B 722      69.405  70.723  82.987  1.00  0.78           C  
ATOM  12198  C   ASP B 722      69.823  69.530  82.122  1.00  0.78           C  
ATOM  12199  O   ASP B 722      70.444  68.590  82.611  1.00  0.78           O  
ATOM  12200  CB  ASP B 722      67.908  70.586  83.380  1.00  0.78           C  
ATOM  12201  CG  ASP B 722      67.618  71.426  84.599  1.00  0.78           C  
ATOM  12202  OD1 ASP B 722      68.324  71.257  85.633  1.00  0.78           O  
ATOM  12203  OD2 ASP B 722      66.711  72.297  84.564  1.00  0.78           O  
ATOM  12204  N   LYS B 723      69.549  69.559  80.798  1.00  0.75           N  
ATOM  12205  CA  LYS B 723      69.996  68.531  79.866  1.00  0.75           C  
ATOM  12206  C   LYS B 723      71.517  68.406  79.718  1.00  0.75           C  
ATOM  12207  O   LYS B 723      72.052  67.306  79.601  1.00  0.75           O  
ATOM  12208  CB  LYS B 723      69.363  68.740  78.467  1.00  0.75           C  
ATOM  12209  CG  LYS B 723      69.485  67.498  77.562  1.00  0.75           C  
ATOM  12210  CD  LYS B 723      69.023  67.722  76.113  1.00  0.75           C  
ATOM  12211  CE  LYS B 723      70.001  68.583  75.307  1.00  0.75           C  
ATOM  12212  NZ  LYS B 723      69.555  68.677  73.899  1.00  0.75           N  
ATOM  12213  N   LYS B 724      72.261  69.535  79.707  1.00  0.76           N  
ATOM  12214  CA  LYS B 724      73.721  69.537  79.792  1.00  0.76           C  
ATOM  12215  C   LYS B 724      74.230  68.968  81.108  1.00  0.76           C  
ATOM  12216  O   LYS B 724      75.244  68.274  81.168  1.00  0.76           O  
ATOM  12217  CB  LYS B 724      74.276  70.993  79.665  1.00  0.76           C  
ATOM  12218  CG  LYS B 724      75.792  71.153  79.945  1.00  0.76           C  
ATOM  12219  CD  LYS B 724      76.280  72.615  79.924  1.00  0.76           C  
ATOM  12220  CE  LYS B 724      77.653  72.852  80.587  1.00  0.76           C  
ATOM  12221  NZ  LYS B 724      77.610  72.531  82.026  1.00  0.76           N  
ATOM  12222  N   GLY B 725      73.549  69.326  82.207  1.00  0.84           N  
ATOM  12223  CA  GLY B 725      74.063  69.197  83.552  1.00  0.84           C  
ATOM  12224  C   GLY B 725      74.505  70.551  84.033  1.00  0.84           C  
ATOM  12225  O   GLY B 725      75.468  71.149  83.544  1.00  0.84           O  
ATOM  12226  N   TYR B 726      73.792  71.078  85.041  1.00  0.85           N  
ATOM  12227  CA  TYR B 726      74.180  72.269  85.763  1.00  0.85           C  
ATOM  12228  C   TYR B 726      75.362  71.962  86.672  1.00  0.85           C  
ATOM  12229  O   TYR B 726      75.238  71.207  87.633  1.00  0.85           O  
ATOM  12230  CB  TYR B 726      72.963  72.781  86.589  1.00  0.85           C  
ATOM  12231  CG  TYR B 726      73.243  73.973  87.483  1.00  0.85           C  
ATOM  12232  CD1 TYR B 726      73.766  75.185  86.993  1.00  0.85           C  
ATOM  12233  CD2 TYR B 726      72.946  73.875  88.852  1.00  0.85           C  
ATOM  12234  CE1 TYR B 726      73.961  76.280  87.856  1.00  0.85           C  
ATOM  12235  CE2 TYR B 726      73.140  74.965  89.706  1.00  0.85           C  
ATOM  12236  CZ  TYR B 726      73.632  76.175  89.214  1.00  0.85           C  
ATOM  12237  OH  TYR B 726      73.719  77.288  90.082  1.00  0.85           O  
ATOM  12238  N   GLU B 727      76.532  72.566  86.400  1.00  0.82           N  
ATOM  12239  CA  GLU B 727      77.644  72.503  87.315  1.00  0.82           C  
ATOM  12240  C   GLU B 727      77.864  73.905  87.843  1.00  0.82           C  
ATOM  12241  O   GLU B 727      78.204  74.841  87.125  1.00  0.82           O  
ATOM  12242  CB  GLU B 727      78.934  71.946  86.674  1.00  0.82           C  
ATOM  12243  CG  GLU B 727      79.900  71.372  87.737  1.00  0.82           C  
ATOM  12244  CD  GLU B 727      81.328  71.225  87.240  1.00  0.82           C  
ATOM  12245  OE1 GLU B 727      81.953  72.268  86.920  1.00  0.82           O  
ATOM  12246  OE2 GLU B 727      81.893  70.105  87.303  1.00  0.82           O  
ATOM  12247  N   ALA B 728      77.618  74.105  89.148  1.00  0.90           N  
ATOM  12248  CA  ALA B 728      77.700  75.401  89.784  1.00  0.90           C  
ATOM  12249  C   ALA B 728      79.101  76.004  89.786  1.00  0.90           C  
ATOM  12250  O   ALA B 728      79.289  77.211  89.631  1.00  0.90           O  
ATOM  12251  CB  ALA B 728      77.185  75.251  91.217  1.00  0.90           C  
ATOM  12252  N   LYS B 729      80.138  75.159  89.956  1.00  0.80           N  
ATOM  12253  CA  LYS B 729      81.511  75.614  90.026  1.00  0.80           C  
ATOM  12254  C   LYS B 729      82.037  76.297  88.763  1.00  0.80           C  
ATOM  12255  O   LYS B 729      82.801  77.245  88.904  1.00  0.80           O  
ATOM  12256  CB  LYS B 729      82.488  74.562  90.599  1.00  0.80           C  
ATOM  12257  CG  LYS B 729      82.664  73.318  89.737  1.00  0.80           C  
ATOM  12258  CD  LYS B 729      83.831  72.439  90.220  1.00  0.80           C  
ATOM  12259  CE  LYS B 729      84.169  71.284  89.273  1.00  0.80           C  
ATOM  12260  NZ  LYS B 729      84.358  71.814  87.906  1.00  0.80           N  
ATOM  12261  N   GLU B 730      81.579  75.932  87.529  1.00  0.79           N  
ATOM  12262  CA  GLU B 730      81.893  76.632  86.275  1.00  0.79           C  
ATOM  12263  C   GLU B 730      81.756  78.154  86.394  1.00  0.79           C  
ATOM  12264  O   GLU B 730      82.658  78.925  86.072  1.00  0.79           O  
ATOM  12265  CB  GLU B 730      80.925  76.200  85.119  1.00  0.79           C  
ATOM  12266  CG  GLU B 730      81.114  74.769  84.545  1.00  0.79           C  
ATOM  12267  CD  GLU B 730      80.057  74.388  83.502  1.00  0.79           C  
ATOM  12268  OE1 GLU B 730      79.280  73.430  83.758  1.00  0.79           O  
ATOM  12269  OE2 GLU B 730      79.984  75.004  82.409  1.00  0.79           O  
ATOM  12270  N   TYR B 731      80.611  78.615  86.930  1.00  0.84           N  
ATOM  12271  CA  TYR B 731      80.316  80.010  87.200  1.00  0.84           C  
ATOM  12272  C   TYR B 731      81.190  80.632  88.287  1.00  0.84           C  
ATOM  12273  O   TYR B 731      81.685  81.747  88.144  1.00  0.84           O  
ATOM  12274  CB  TYR B 731      78.830  80.156  87.618  1.00  0.84           C  
ATOM  12275  CG  TYR B 731      77.922  79.588  86.561  1.00  0.84           C  
ATOM  12276  CD1 TYR B 731      77.406  78.285  86.682  1.00  0.84           C  
ATOM  12277  CD2 TYR B 731      77.596  80.345  85.423  1.00  0.84           C  
ATOM  12278  CE1 TYR B 731      76.594  77.744  85.677  1.00  0.84           C  
ATOM  12279  CE2 TYR B 731      76.778  79.806  84.419  1.00  0.84           C  
ATOM  12280  CZ  TYR B 731      76.275  78.506  84.550  1.00  0.84           C  
ATOM  12281  OH  TYR B 731      75.444  77.964  83.551  1.00  0.84           O  
ATOM  12282  N   TYR B 732      81.410  79.918  89.409  1.00  0.83           N  
ATOM  12283  CA  TYR B 732      82.249  80.365  90.515  1.00  0.83           C  
ATOM  12284  C   TYR B 732      83.721  80.526  90.130  1.00  0.83           C  
ATOM  12285  O   TYR B 732      84.364  81.510  90.488  1.00  0.83           O  
ATOM  12286  CB  TYR B 732      82.075  79.351  91.682  1.00  0.83           C  
ATOM  12287  CG  TYR B 732      83.074  79.480  92.806  1.00  0.83           C  
ATOM  12288  CD1 TYR B 732      82.917  80.420  93.830  1.00  0.83           C  
ATOM  12289  CD2 TYR B 732      84.163  78.604  92.863  1.00  0.83           C  
ATOM  12290  CE1 TYR B 732      83.791  80.436  94.927  1.00  0.83           C  
ATOM  12291  CE2 TYR B 732      85.035  78.608  93.950  1.00  0.83           C  
ATOM  12292  CZ  TYR B 732      84.862  79.536  94.974  1.00  0.83           C  
ATOM  12293  OH  TYR B 732      85.854  79.605  95.969  1.00  0.83           O  
ATOM  12294  N   GLU B 733      84.280  79.550  89.393  1.00  0.78           N  
ATOM  12295  CA  GLU B 733      85.634  79.577  88.882  1.00  0.78           C  
ATOM  12296  C   GLU B 733      85.829  80.658  87.814  1.00  0.78           C  
ATOM  12297  O   GLU B 733      86.827  81.375  87.814  1.00  0.78           O  
ATOM  12298  CB  GLU B 733      86.032  78.160  88.370  1.00  0.78           C  
ATOM  12299  CG  GLU B 733      86.042  77.073  89.491  1.00  0.78           C  
ATOM  12300  CD  GLU B 733      86.370  75.652  89.009  1.00  0.78           C  
ATOM  12301  OE1 GLU B 733      85.432  74.867  88.691  1.00  0.78           O  
ATOM  12302  OE2 GLU B 733      87.577  75.307  89.014  1.00  0.78           O  
ATOM  12303  N   ALA B 734      84.862  80.822  86.884  1.00  0.86           N  
ATOM  12304  CA  ALA B 734      84.894  81.850  85.858  1.00  0.86           C  
ATOM  12305  C   ALA B 734      84.710  83.305  86.307  1.00  0.86           C  
ATOM  12306  O   ALA B 734      85.379  84.204  85.802  1.00  0.86           O  
ATOM  12307  CB  ALA B 734      83.822  81.530  84.797  1.00  0.86           C  
ATOM  12308  N   LEU B 735      83.769  83.600  87.230  1.00  0.85           N  
ATOM  12309  CA  LEU B 735      83.356  84.971  87.500  1.00  0.85           C  
ATOM  12310  C   LEU B 735      83.963  85.530  88.793  1.00  0.85           C  
ATOM  12311  O   LEU B 735      83.514  85.154  89.879  1.00  0.85           O  
ATOM  12312  CB  LEU B 735      81.810  85.063  87.618  1.00  0.85           C  
ATOM  12313  CG  LEU B 735      81.034  84.678  86.339  1.00  0.85           C  
ATOM  12314  CD1 LEU B 735      79.529  84.603  86.635  1.00  0.85           C  
ATOM  12315  CD2 LEU B 735      81.289  85.653  85.179  1.00  0.85           C  
ATOM  12316  N   PRO B 736      84.934  86.454  88.790  1.00  0.85           N  
ATOM  12317  CA  PRO B 736      85.663  86.828  90.002  1.00  0.85           C  
ATOM  12318  C   PRO B 736      84.824  87.607  91.000  1.00  0.85           C  
ATOM  12319  O   PRO B 736      85.067  87.477  92.199  1.00  0.85           O  
ATOM  12320  CB  PRO B 736      86.876  87.627  89.488  1.00  0.85           C  
ATOM  12321  CG  PRO B 736      86.459  88.118  88.099  1.00  0.85           C  
ATOM  12322  CD  PRO B 736      85.589  86.972  87.587  1.00  0.85           C  
ATOM  12323  N   GLU B 737      83.825  88.408  90.558  1.00  0.83           N  
ATOM  12324  CA  GLU B 737      82.884  89.049  91.469  1.00  0.83           C  
ATOM  12325  C   GLU B 737      82.065  88.035  92.256  1.00  0.83           C  
ATOM  12326  O   GLU B 737      81.896  88.159  93.466  1.00  0.83           O  
ATOM  12327  CB  GLU B 737      81.907  90.027  90.761  1.00  0.83           C  
ATOM  12328  CG  GLU B 737      82.579  91.293  90.174  1.00  0.83           C  
ATOM  12329  CD  GLU B 737      81.575  92.434  90.013  1.00  0.83           C  
ATOM  12330  OE1 GLU B 737      80.605  92.300  89.226  1.00  0.83           O  
ATOM  12331  OE2 GLU B 737      81.751  93.469  90.705  1.00  0.83           O  
ATOM  12332  N   LEU B 738      81.583  86.963  91.586  1.00  0.87           N  
ATOM  12333  CA  LEU B 738      80.882  85.867  92.233  1.00  0.87           C  
ATOM  12334  C   LEU B 738      81.770  85.115  93.207  1.00  0.87           C  
ATOM  12335  O   LEU B 738      81.366  84.806  94.327  1.00  0.87           O  
ATOM  12336  CB  LEU B 738      80.324  84.867  91.189  1.00  0.87           C  
ATOM  12337  CG  LEU B 738      79.498  83.691  91.758  1.00  0.87           C  
ATOM  12338  CD1 LEU B 738      78.326  84.148  92.640  1.00  0.87           C  
ATOM  12339  CD2 LEU B 738      78.981  82.816  90.609  1.00  0.87           C  
ATOM  12340  N   LYS B 739      83.035  84.841  92.818  1.00  0.82           N  
ATOM  12341  CA  LYS B 739      83.972  84.147  93.677  1.00  0.82           C  
ATOM  12342  C   LYS B 739      84.232  84.856  94.998  1.00  0.82           C  
ATOM  12343  O   LYS B 739      84.166  84.238  96.055  1.00  0.82           O  
ATOM  12344  CB  LYS B 739      85.332  83.893  92.982  1.00  0.82           C  
ATOM  12345  CG  LYS B 739      86.169  82.901  93.805  1.00  0.82           C  
ATOM  12346  CD  LYS B 739      87.586  82.624  93.295  1.00  0.82           C  
ATOM  12347  CE  LYS B 739      88.235  81.417  93.991  1.00  0.82           C  
ATOM  12348  NZ  LYS B 739      88.078  81.480  95.457  1.00  0.82           N  
ATOM  12349  N   LEU B 740      84.461  86.187  94.978  1.00  0.87           N  
ATOM  12350  CA  LEU B 740      84.704  86.966  96.183  1.00  0.87           C  
ATOM  12351  C   LEU B 740      83.546  86.922  97.175  1.00  0.87           C  
ATOM  12352  O   LEU B 740      83.745  86.730  98.373  1.00  0.87           O  
ATOM  12353  CB  LEU B 740      85.020  88.437  95.810  1.00  0.87           C  
ATOM  12354  CG  LEU B 740      85.379  89.366  96.994  1.00  0.87           C  
ATOM  12355  CD1 LEU B 740      86.606  88.873  97.779  1.00  0.87           C  
ATOM  12356  CD2 LEU B 740      85.613  90.801  96.496  1.00  0.87           C  
ATOM  12357  N   VAL B 741      82.294  87.034  96.682  1.00  0.88           N  
ATOM  12358  CA  VAL B 741      81.089  86.915  97.493  1.00  0.88           C  
ATOM  12359  C   VAL B 741      80.978  85.555  98.173  1.00  0.88           C  
ATOM  12360  O   VAL B 741      80.754  85.446  99.379  1.00  0.88           O  
ATOM  12361  CB  VAL B 741      79.858  87.125  96.608  1.00  0.88           C  
ATOM  12362  CG1 VAL B 741      78.546  86.885  97.380  1.00  0.88           C  
ATOM  12363  CG2 VAL B 741      79.865  88.558  96.047  1.00  0.88           C  
ATOM  12364  N   ILE B 742      81.183  84.464  97.412  1.00  0.86           N  
ATOM  12365  CA  ILE B 742      81.131  83.100  97.919  1.00  0.86           C  
ATOM  12366  C   ILE B 742      82.264  82.776  98.887  1.00  0.86           C  
ATOM  12367  O   ILE B 742      82.030  82.193  99.948  1.00  0.86           O  
ATOM  12368  CB  ILE B 742      81.017  82.111  96.763  1.00  0.86           C  
ATOM  12369  CG1 ILE B 742      79.734  82.367  95.926  1.00  0.86           C  
ATOM  12370  CG2 ILE B 742      81.060  80.647  97.252  1.00  0.86           C  
ATOM  12371  CD1 ILE B 742      78.411  82.315  96.706  1.00  0.86           C  
ATOM  12372  N   ASP B 743      83.508  83.219  98.596  1.00  0.86           N  
ATOM  12373  CA  ASP B 743      84.644  83.099  99.495  1.00  0.86           C  
ATOM  12374  C   ASP B 743      84.396  83.814 100.830  1.00  0.86           C  
ATOM  12375  O   ASP B 743      84.692  83.295 101.904  1.00  0.86           O  
ATOM  12376  CB  ASP B 743      85.923  83.715  98.856  1.00  0.86           C  
ATOM  12377  CG  ASP B 743      86.516  82.930  97.702  1.00  0.86           C  
ATOM  12378  OD1 ASP B 743      85.983  81.870  97.283  1.00  0.86           O  
ATOM  12379  OD2 ASP B 743      87.590  83.364  97.195  1.00  0.86           O  
ATOM  12380  N   GLN B 744      83.810  85.029 100.816  1.00  0.84           N  
ATOM  12381  CA  GLN B 744      83.435  85.736 102.030  1.00  0.84           C  
ATOM  12382  C   GLN B 744      82.411  85.009 102.893  1.00  0.84           C  
ATOM  12383  O   GLN B 744      82.547  84.958 104.116  1.00  0.84           O  
ATOM  12384  CB  GLN B 744      82.871  87.134 101.692  1.00  0.84           C  
ATOM  12385  CG  GLN B 744      83.961  88.151 101.296  1.00  0.84           C  
ATOM  12386  CD  GLN B 744      83.313  89.439 100.797  1.00  0.84           C  
ATOM  12387  OE1 GLN B 744      82.288  89.426 100.113  1.00  0.84           O  
ATOM  12388  NE2 GLN B 744      83.923  90.598 101.128  1.00  0.84           N  
ATOM  12389  N   ILE B 745      81.363  84.419 102.284  1.00  0.86           N  
ATOM  12390  CA  ILE B 745      80.340  83.679 103.011  1.00  0.86           C  
ATOM  12391  C   ILE B 745      80.887  82.436 103.716  1.00  0.86           C  
ATOM  12392  O   ILE B 745      80.632  82.249 104.904  1.00  0.86           O  
ATOM  12393  CB  ILE B 745      79.159  83.334 102.095  1.00  0.86           C  
ATOM  12394  CG1 ILE B 745      78.455  84.623 101.601  1.00  0.86           C  
ATOM  12395  CG2 ILE B 745      78.137  82.429 102.822  1.00  0.86           C  
ATOM  12396  CD1 ILE B 745      77.495  84.380 100.428  1.00  0.86           C  
ATOM  12397  N   ASP B 746      81.697  81.586 103.043  1.00  0.84           N  
ATOM  12398  CA  ASP B 746      82.159  80.343 103.650  1.00  0.84           C  
ATOM  12399  C   ASP B 746      83.378  80.518 104.564  1.00  0.84           C  
ATOM  12400  O   ASP B 746      83.645  79.699 105.439  1.00  0.84           O  
ATOM  12401  CB  ASP B 746      82.424  79.290 102.542  1.00  0.84           C  
ATOM  12402  CG  ASP B 746      82.271  77.893 103.106  1.00  0.84           C  
ATOM  12403  OD1 ASP B 746      81.186  77.598 103.679  1.00  0.84           O  
ATOM  12404  OD2 ASP B 746      83.218  77.076 103.014  1.00  0.84           O  
ATOM  12405  N   ASN B 747      84.111  81.649 104.453  1.00  0.85           N  
ATOM  12406  CA  ASN B 747      85.200  81.938 105.379  1.00  0.85           C  
ATOM  12407  C   ASN B 747      84.685  82.651 106.625  1.00  0.85           C  
ATOM  12408  O   ASN B 747      85.445  82.929 107.550  1.00  0.85           O  
ATOM  12409  CB  ASN B 747      86.272  82.868 104.746  1.00  0.85           C  
ATOM  12410  CG  ASN B 747      87.195  82.096 103.808  1.00  0.85           C  
ATOM  12411  OD1 ASN B 747      87.794  81.086 104.172  1.00  0.85           O  
ATOM  12412  ND2 ASN B 747      87.375  82.622 102.574  1.00  0.85           N  
ATOM  12413  N   GLY B 748      83.374  82.963 106.701  1.00  0.89           N  
ATOM  12414  CA  GLY B 748      82.801  83.545 107.906  1.00  0.89           C  
ATOM  12415  C   GLY B 748      82.954  85.032 108.033  1.00  0.89           C  
ATOM  12416  O   GLY B 748      82.893  85.575 109.130  1.00  0.89           O  
ATOM  12417  N   PHE B 749      83.122  85.764 106.913  1.00  0.88           N  
ATOM  12418  CA  PHE B 749      83.235  87.221 106.899  1.00  0.88           C  
ATOM  12419  C   PHE B 749      81.981  87.887 107.465  1.00  0.88           C  
ATOM  12420  O   PHE B 749      82.029  88.871 108.199  1.00  0.88           O  
ATOM  12421  CB  PHE B 749      83.505  87.692 105.443  1.00  0.88           C  
ATOM  12422  CG  PHE B 749      83.892  89.143 105.353  1.00  0.88           C  
ATOM  12423  CD1 PHE B 749      85.227  89.539 105.534  1.00  0.88           C  
ATOM  12424  CD2 PHE B 749      82.922  90.121 105.084  1.00  0.88           C  
ATOM  12425  CE1 PHE B 749      85.586  90.891 105.453  1.00  0.88           C  
ATOM  12426  CE2 PHE B 749      83.274  91.474 105.002  1.00  0.88           C  
ATOM  12427  CZ  PHE B 749      84.609  91.860 105.186  1.00  0.88           C  
ATOM  12428  N   PHE B 750      80.812  87.295 107.166  1.00  0.89           N  
ATOM  12429  CA  PHE B 750      79.526  87.735 107.670  1.00  0.89           C  
ATOM  12430  C   PHE B 750      79.125  86.974 108.927  1.00  0.89           C  
ATOM  12431  O   PHE B 750      77.987  87.051 109.378  1.00  0.89           O  
ATOM  12432  CB  PHE B 750      78.427  87.564 106.589  1.00  0.89           C  
ATOM  12433  CG  PHE B 750      78.784  88.403 105.395  1.00  0.89           C  
ATOM  12434  CD1 PHE B 750      78.724  89.803 105.485  1.00  0.89           C  
ATOM  12435  CD2 PHE B 750      79.226  87.814 104.198  1.00  0.89           C  
ATOM  12436  CE1 PHE B 750      79.118  90.606 104.409  1.00  0.89           C  
ATOM  12437  CE2 PHE B 750      79.624  88.613 103.118  1.00  0.89           C  
ATOM  12438  CZ  PHE B 750      79.579  90.009 103.230  1.00  0.89           C  
ATOM  12439  N   SER B 751      80.051  86.234 109.565  1.00  0.87           N  
ATOM  12440  CA  SER B 751      79.754  85.544 110.812  1.00  0.87           C  
ATOM  12441  C   SER B 751      80.992  85.245 111.658  1.00  0.87           C  
ATOM  12442  O   SER B 751      81.207  84.076 111.975  1.00  0.87           O  
ATOM  12443  CB  SER B 751      78.951  84.221 110.590  1.00  0.87           C  
ATOM  12444  OG  SER B 751      79.607  83.301 109.713  1.00  0.87           O  
ATOM  12445  N   PRO B 752      81.827  86.195 112.124  1.00  0.85           N  
ATOM  12446  CA  PRO B 752      83.133  85.895 112.735  1.00  0.85           C  
ATOM  12447  C   PRO B 752      83.101  85.033 113.985  1.00  0.85           C  
ATOM  12448  O   PRO B 752      84.105  84.425 114.339  1.00  0.85           O  
ATOM  12449  CB  PRO B 752      83.736  87.276 113.046  1.00  0.85           C  
ATOM  12450  CG  PRO B 752      83.084  88.198 112.018  1.00  0.85           C  
ATOM  12451  CD  PRO B 752      81.667  87.640 111.909  1.00  0.85           C  
ATOM  12452  N   LYS B 753      81.966  84.996 114.705  1.00  0.76           N  
ATOM  12453  CA  LYS B 753      81.789  84.167 115.881  1.00  0.76           C  
ATOM  12454  C   LYS B 753      81.484  82.713 115.538  1.00  0.76           C  
ATOM  12455  O   LYS B 753      81.572  81.832 116.387  1.00  0.76           O  
ATOM  12456  CB  LYS B 753      80.609  84.708 116.732  1.00  0.76           C  
ATOM  12457  CG  LYS B 753      80.742  86.178 117.172  1.00  0.76           C  
ATOM  12458  CD  LYS B 753      81.919  86.427 118.133  1.00  0.76           C  
ATOM  12459  CE  LYS B 753      81.977  87.872 118.642  1.00  0.76           C  
ATOM  12460  NZ  LYS B 753      83.106  88.038 119.586  1.00  0.76           N  
ATOM  12461  N   GLN B 754      81.107  82.433 114.278  1.00  0.81           N  
ATOM  12462  CA  GLN B 754      80.683  81.125 113.821  1.00  0.81           C  
ATOM  12463  C   GLN B 754      81.056  80.989 112.347  1.00  0.81           C  
ATOM  12464  O   GLN B 754      80.176  81.161 111.500  1.00  0.81           O  
ATOM  12465  CB  GLN B 754      79.140  80.949 113.941  1.00  0.81           C  
ATOM  12466  CG  GLN B 754      78.599  80.839 115.385  1.00  0.81           C  
ATOM  12467  CD  GLN B 754      77.072  80.856 115.390  1.00  0.81           C  
ATOM  12468  OE1 GLN B 754      76.401  79.854 115.156  1.00  0.81           O  
ATOM  12469  NE2 GLN B 754      76.484  82.045 115.659  1.00  0.81           N  
ATOM  12470  N   PRO B 755      82.301  80.714 111.940  1.00  0.88           N  
ATOM  12471  CA  PRO B 755      82.682  80.772 110.528  1.00  0.88           C  
ATOM  12472  C   PRO B 755      81.958  79.787 109.636  1.00  0.88           C  
ATOM  12473  O   PRO B 755      81.715  80.087 108.474  1.00  0.88           O  
ATOM  12474  CB  PRO B 755      84.195  80.513 110.535  1.00  0.88           C  
ATOM  12475  CG  PRO B 755      84.644  81.071 111.885  1.00  0.88           C  
ATOM  12476  CD  PRO B 755      83.483  80.705 112.812  1.00  0.88           C  
ATOM  12477  N   ASP B 756      81.592  78.610 110.173  1.00  0.85           N  
ATOM  12478  CA  ASP B 756      81.061  77.505 109.405  1.00  0.85           C  
ATOM  12479  C   ASP B 756      79.529  77.543 109.343  1.00  0.85           C  
ATOM  12480  O   ASP B 756      78.864  76.636 108.851  1.00  0.85           O  
ATOM  12481  CB  ASP B 756      81.569  76.201 110.085  1.00  0.85           C  
ATOM  12482  CG  ASP B 756      81.862  75.099 109.083  1.00  0.85           C  
ATOM  12483  OD1 ASP B 756      81.793  75.367 107.857  1.00  0.85           O  
ATOM  12484  OD2 ASP B 756      82.214  73.984 109.535  1.00  0.85           O  
ATOM  12485  N   LEU B 757      78.917  78.651 109.818  1.00  0.88           N  
ATOM  12486  CA  LEU B 757      77.478  78.831 109.932  1.00  0.88           C  
ATOM  12487  C   LEU B 757      76.723  78.683 108.621  1.00  0.88           C  
ATOM  12488  O   LEU B 757      75.638  78.116 108.561  1.00  0.88           O  
ATOM  12489  CB  LEU B 757      77.193  80.239 110.519  1.00  0.88           C  
ATOM  12490  CG  LEU B 757      75.711  80.589 110.780  1.00  0.88           C  
ATOM  12491  CD1 LEU B 757      75.044  79.600 111.745  1.00  0.88           C  
ATOM  12492  CD2 LEU B 757      75.595  82.020 111.326  1.00  0.88           C  
ATOM  12493  N   PHE B 758      77.291  79.185 107.514  1.00  0.90           N  
ATOM  12494  CA  PHE B 758      76.610  79.211 106.237  1.00  0.90           C  
ATOM  12495  C   PHE B 758      77.006  78.057 105.329  1.00  0.90           C  
ATOM  12496  O   PHE B 758      76.675  78.059 104.144  1.00  0.90           O  
ATOM  12497  CB  PHE B 758      76.874  80.559 105.523  1.00  0.90           C  
ATOM  12498  CG  PHE B 758      76.366  81.710 106.355  1.00  0.90           C  
ATOM  12499  CD1 PHE B 758      75.022  81.764 106.769  1.00  0.90           C  
ATOM  12500  CD2 PHE B 758      77.232  82.749 106.737  1.00  0.90           C  
ATOM  12501  CE1 PHE B 758      74.555  82.826 107.552  1.00  0.90           C  
ATOM  12502  CE2 PHE B 758      76.766  83.819 107.512  1.00  0.90           C  
ATOM  12503  CZ  PHE B 758      75.428  83.856 107.922  1.00  0.90           C  
ATOM  12504  N   LYS B 759      77.676  77.009 105.858  1.00  0.84           N  
ATOM  12505  CA  LYS B 759      78.157  75.873 105.081  1.00  0.84           C  
ATOM  12506  C   LYS B 759      77.050  75.121 104.339  1.00  0.84           C  
ATOM  12507  O   LYS B 759      77.217  74.732 103.183  1.00  0.84           O  
ATOM  12508  CB  LYS B 759      78.968  74.913 105.986  1.00  0.84           C  
ATOM  12509  CG  LYS B 759      79.694  73.752 105.272  1.00  0.84           C  
ATOM  12510  CD  LYS B 759      80.736  74.145 104.201  1.00  0.84           C  
ATOM  12511  CE  LYS B 759      82.149  74.495 104.707  1.00  0.84           C  
ATOM  12512  NZ  LYS B 759      82.201  75.818 105.340  1.00  0.84           N  
ATOM  12513  N   ASP B 760      75.855  74.976 104.951  1.00  0.88           N  
ATOM  12514  CA  ASP B 760      74.656  74.419 104.340  1.00  0.88           C  
ATOM  12515  C   ASP B 760      74.244  75.138 103.055  1.00  0.88           C  
ATOM  12516  O   ASP B 760      73.931  74.521 102.036  1.00  0.88           O  
ATOM  12517  CB  ASP B 760      73.457  74.560 105.316  1.00  0.88           C  
ATOM  12518  CG  ASP B 760      73.639  73.780 106.605  1.00  0.88           C  
ATOM  12519  OD1 ASP B 760      72.730  73.916 107.463  1.00  0.88           O  
ATOM  12520  OD2 ASP B 760      74.653  73.060 106.751  1.00  0.88           O  
ATOM  12521  N   ILE B 761      74.286  76.490 103.072  1.00  0.90           N  
ATOM  12522  CA  ILE B 761      73.975  77.350 101.938  1.00  0.90           C  
ATOM  12523  C   ILE B 761      74.944  77.107 100.797  1.00  0.90           C  
ATOM  12524  O   ILE B 761      74.557  76.916  99.647  1.00  0.90           O  
ATOM  12525  CB  ILE B 761      74.024  78.834 102.332  1.00  0.90           C  
ATOM  12526  CG1 ILE B 761      73.129  79.096 103.571  1.00  0.90           C  
ATOM  12527  CG2 ILE B 761      73.641  79.730 101.127  1.00  0.90           C  
ATOM  12528  CD1 ILE B 761      72.994  80.578 103.944  1.00  0.90           C  
ATOM  12529  N   ILE B 762      76.247  77.050 101.123  1.00  0.86           N  
ATOM  12530  CA  ILE B 762      77.328  76.783 100.191  1.00  0.86           C  
ATOM  12531  C   ILE B 762      77.236  75.389  99.593  1.00  0.86           C  
ATOM  12532  O   ILE B 762      77.316  75.215  98.378  1.00  0.86           O  
ATOM  12533  CB  ILE B 762      78.665  77.008 100.889  1.00  0.86           C  
ATOM  12534  CG1 ILE B 762      78.767  78.463 101.418  1.00  0.86           C  
ATOM  12535  CG2 ILE B 762      79.861  76.657  99.976  1.00  0.86           C  
ATOM  12536  CD1 ILE B 762      78.732  79.552 100.339  1.00  0.86           C  
ATOM  12537  N   ASN B 763      76.981  74.354 100.419  1.00  0.82           N  
ATOM  12538  CA  ASN B 763      76.806  72.988  99.957  1.00  0.82           C  
ATOM  12539  C   ASN B 763      75.617  72.838  99.012  1.00  0.82           C  
ATOM  12540  O   ASN B 763      75.720  72.191  97.972  1.00  0.82           O  
ATOM  12541  CB  ASN B 763      76.674  72.025 101.167  1.00  0.82           C  
ATOM  12542  CG  ASN B 763      77.054  70.603 100.771  1.00  0.82           C  
ATOM  12543  OD1 ASN B 763      78.229  70.238 100.785  1.00  0.82           O  
ATOM  12544  ND2 ASN B 763      76.061  69.766 100.395  1.00  0.82           N  
ATOM  12545  N   MET B 764      74.471  73.485  99.326  1.00  0.86           N  
ATOM  12546  CA  MET B 764      73.336  73.538  98.421  1.00  0.86           C  
ATOM  12547  C   MET B 764      73.670  74.218  97.101  1.00  0.86           C  
ATOM  12548  O   MET B 764      73.445  73.645  96.039  1.00  0.86           O  
ATOM  12549  CB  MET B 764      72.137  74.248  99.106  1.00  0.86           C  
ATOM  12550  CG  MET B 764      70.806  74.229  98.314  1.00  0.86           C  
ATOM  12551  SD  MET B 764      70.624  75.482  96.998  1.00  0.86           S  
ATOM  12552  CE  MET B 764      70.302  76.903  98.074  1.00  0.86           C  
ATOM  12553  N   LEU B 765      74.301  75.412  97.130  1.00  0.88           N  
ATOM  12554  CA  LEU B 765      74.662  76.158  95.934  1.00  0.88           C  
ATOM  12555  C   LEU B 765      75.609  75.417  95.004  1.00  0.88           C  
ATOM  12556  O   LEU B 765      75.413  75.394  93.793  1.00  0.88           O  
ATOM  12557  CB  LEU B 765      75.318  77.508  96.315  1.00  0.88           C  
ATOM  12558  CG  LEU B 765      74.333  78.571  96.840  1.00  0.88           C  
ATOM  12559  CD1 LEU B 765      75.102  79.733  97.489  1.00  0.88           C  
ATOM  12560  CD2 LEU B 765      73.429  79.090  95.714  1.00  0.88           C  
ATOM  12561  N   PHE B 766      76.659  74.773  95.544  1.00  0.81           N  
ATOM  12562  CA  PHE B 766      77.563  73.973  94.740  1.00  0.81           C  
ATOM  12563  C   PHE B 766      76.980  72.675  94.183  1.00  0.81           C  
ATOM  12564  O   PHE B 766      77.292  72.309  93.050  1.00  0.81           O  
ATOM  12565  CB  PHE B 766      78.894  73.687  95.481  1.00  0.81           C  
ATOM  12566  CG  PHE B 766      79.819  74.867  95.336  1.00  0.81           C  
ATOM  12567  CD1 PHE B 766      79.898  75.849  96.333  1.00  0.81           C  
ATOM  12568  CD2 PHE B 766      80.620  75.003  94.188  1.00  0.81           C  
ATOM  12569  CE1 PHE B 766      80.764  76.940  96.203  1.00  0.81           C  
ATOM  12570  CE2 PHE B 766      81.496  76.090  94.054  1.00  0.81           C  
ATOM  12571  CZ  PHE B 766      81.567  77.056  95.065  1.00  0.81           C  
ATOM  12572  N   TYR B 767      76.159  71.929  94.959  1.00  0.81           N  
ATOM  12573  CA  TYR B 767      75.859  70.543  94.611  1.00  0.81           C  
ATOM  12574  C   TYR B 767      74.385  70.170  94.509  1.00  0.81           C  
ATOM  12575  O   TYR B 767      74.066  69.135  93.928  1.00  0.81           O  
ATOM  12576  CB  TYR B 767      76.480  69.596  95.675  1.00  0.81           C  
ATOM  12577  CG  TYR B 767      77.972  69.777  95.746  1.00  0.81           C  
ATOM  12578  CD1 TYR B 767      78.578  70.282  96.909  1.00  0.81           C  
ATOM  12579  CD2 TYR B 767      78.779  69.461  94.640  1.00  0.81           C  
ATOM  12580  CE1 TYR B 767      79.965  70.480  96.961  1.00  0.81           C  
ATOM  12581  CE2 TYR B 767      80.166  69.660  94.689  1.00  0.81           C  
ATOM  12582  CZ  TYR B 767      80.756  70.172  95.850  1.00  0.81           C  
ATOM  12583  OH  TYR B 767      82.148  70.380  95.898  1.00  0.81           O  
ATOM  12584  N   HIS B 768      73.437  70.964  95.049  1.00  0.82           N  
ATOM  12585  CA  HIS B 768      72.039  70.538  95.101  1.00  0.82           C  
ATOM  12586  C   HIS B 768      71.060  71.577  94.585  1.00  0.82           C  
ATOM  12587  O   HIS B 768      69.850  71.351  94.580  1.00  0.82           O  
ATOM  12588  CB  HIS B 768      71.647  70.146  96.545  1.00  0.82           C  
ATOM  12589  CG  HIS B 768      72.456  68.983  97.035  1.00  0.82           C  
ATOM  12590  ND1 HIS B 768      73.449  69.156  97.984  1.00  0.82           N  
ATOM  12591  CD2 HIS B 768      72.422  67.691  96.619  1.00  0.82           C  
ATOM  12592  CE1 HIS B 768      73.999  67.965  98.120  1.00  0.82           C  
ATOM  12593  NE2 HIS B 768      73.416  67.042  97.318  1.00  0.82           N  
ATOM  12594  N   ASP B 769      71.560  72.726  94.104  1.00  0.90           N  
ATOM  12595  CA  ASP B 769      70.795  73.808  93.531  1.00  0.90           C  
ATOM  12596  C   ASP B 769      70.036  73.405  92.254  1.00  0.90           C  
ATOM  12597  O   ASP B 769      70.584  73.265  91.162  1.00  0.90           O  
ATOM  12598  CB  ASP B 769      71.777  75.005  93.351  1.00  0.90           C  
ATOM  12599  CG  ASP B 769      71.167  76.221  92.695  1.00  0.90           C  
ATOM  12600  OD1 ASP B 769      69.919  76.359  92.746  1.00  0.90           O  
ATOM  12601  OD2 ASP B 769      71.924  77.022  92.077  1.00  0.90           O  
ATOM  12602  N   ARG B 770      68.702  73.235  92.374  1.00  0.82           N  
ATOM  12603  CA  ARG B 770      67.815  73.045  91.239  1.00  0.82           C  
ATOM  12604  C   ARG B 770      67.507  74.357  90.535  1.00  0.82           C  
ATOM  12605  O   ARG B 770      67.136  74.377  89.357  1.00  0.82           O  
ATOM  12606  CB  ARG B 770      66.448  72.470  91.708  1.00  0.82           C  
ATOM  12607  CG  ARG B 770      66.449  70.948  91.958  1.00  0.82           C  
ATOM  12608  CD  ARG B 770      65.065  70.391  92.326  1.00  0.82           C  
ATOM  12609  NE  ARG B 770      64.746  70.896  93.699  1.00  0.82           N  
ATOM  12610  CZ  ARG B 770      63.511  71.133  94.162  1.00  0.82           C  
ATOM  12611  NH1 ARG B 770      62.416  70.815  93.479  1.00  0.82           N  
ATOM  12612  NH2 ARG B 770      63.358  71.718  95.344  1.00  0.82           N  
ATOM  12613  N   PHE B 771      67.651  75.481  91.257  1.00  0.92           N  
ATOM  12614  CA  PHE B 771      67.041  76.750  90.924  1.00  0.92           C  
ATOM  12615  C   PHE B 771      68.051  77.695  90.310  1.00  0.92           C  
ATOM  12616  O   PHE B 771      67.709  78.769  89.815  1.00  0.92           O  
ATOM  12617  CB  PHE B 771      66.409  77.366  92.197  1.00  0.92           C  
ATOM  12618  CG  PHE B 771      65.308  76.459  92.683  1.00  0.92           C  
ATOM  12619  CD1 PHE B 771      64.170  76.221  91.890  1.00  0.92           C  
ATOM  12620  CD2 PHE B 771      65.409  75.823  93.930  1.00  0.92           C  
ATOM  12621  CE1 PHE B 771      63.154  75.365  92.338  1.00  0.92           C  
ATOM  12622  CE2 PHE B 771      64.386  74.987  94.392  1.00  0.92           C  
ATOM  12623  CZ  PHE B 771      63.255  74.759  93.597  1.00  0.92           C  
ATOM  12624  N   LYS B 772      69.317  77.266  90.251  1.00  0.92           N  
ATOM  12625  CA  LYS B 772      70.349  77.744  89.363  1.00  0.92           C  
ATOM  12626  C   LYS B 772      70.768  79.167  89.653  1.00  0.92           C  
ATOM  12627  O   LYS B 772      70.769  80.038  88.784  1.00  0.92           O  
ATOM  12628  CB  LYS B 772      69.982  77.501  87.884  1.00  0.92           C  
ATOM  12629  CG  LYS B 772      69.728  76.017  87.585  1.00  0.92           C  
ATOM  12630  CD  LYS B 772      69.099  75.807  86.205  1.00  0.92           C  
ATOM  12631  CE  LYS B 772      68.959  74.334  85.827  1.00  0.92           C  
ATOM  12632  NZ  LYS B 772      67.885  73.665  86.587  1.00  0.92           N  
ATOM  12633  N   VAL B 773      71.104  79.440  90.923  1.00  0.96           N  
ATOM  12634  CA  VAL B 773      71.412  80.758  91.460  1.00  0.96           C  
ATOM  12635  C   VAL B 773      72.627  81.390  90.799  1.00  0.96           C  
ATOM  12636  O   VAL B 773      72.639  82.574  90.462  1.00  0.96           O  
ATOM  12637  CB  VAL B 773      71.611  80.670  92.973  1.00  0.96           C  
ATOM  12638  CG1 VAL B 773      72.001  82.032  93.585  1.00  0.96           C  
ATOM  12639  CG2 VAL B 773      70.304  80.161  93.616  1.00  0.96           C  
ATOM  12640  N   PHE B 774      73.690  80.599  90.562  1.00  0.92           N  
ATOM  12641  CA  PHE B 774      74.910  81.099  89.956  1.00  0.92           C  
ATOM  12642  C   PHE B 774      74.790  81.330  88.454  1.00  0.92           C  
ATOM  12643  O   PHE B 774      75.499  82.162  87.891  1.00  0.92           O  
ATOM  12644  CB  PHE B 774      76.087  80.125  90.222  1.00  0.92           C  
ATOM  12645  CG  PHE B 774      76.523  80.015  91.666  1.00  0.92           C  
ATOM  12646  CD1 PHE B 774      77.487  79.039  91.966  1.00  0.92           C  
ATOM  12647  CD2 PHE B 774      76.073  80.849  92.710  1.00  0.92           C  
ATOM  12648  CE1 PHE B 774      77.989  78.881  93.262  1.00  0.92           C  
ATOM  12649  CE2 PHE B 774      76.567  80.692  94.010  1.00  0.92           C  
ATOM  12650  CZ  PHE B 774      77.528  79.713  94.287  1.00  0.92           C  
ATOM  12651  N   ALA B 775      73.860  80.630  87.771  1.00  0.94           N  
ATOM  12652  CA  ALA B 775      73.647  80.748  86.340  1.00  0.94           C  
ATOM  12653  C   ALA B 775      73.153  82.119  85.884  1.00  0.94           C  
ATOM  12654  O   ALA B 775      73.645  82.676  84.905  1.00  0.94           O  
ATOM  12655  CB  ALA B 775      72.675  79.650  85.872  1.00  0.94           C  
ATOM  12656  N   ASP B 776      72.205  82.731  86.624  1.00  0.93           N  
ATOM  12657  CA  ASP B 776      71.659  84.026  86.252  1.00  0.93           C  
ATOM  12658  C   ASP B 776      72.430  85.177  86.891  1.00  0.93           C  
ATOM  12659  O   ASP B 776      72.096  86.343  86.685  1.00  0.93           O  
ATOM  12660  CB  ASP B 776      70.179  84.163  86.701  1.00  0.93           C  
ATOM  12661  CG  ASP B 776      69.249  83.364  85.816  1.00  0.93           C  
ATOM  12662  OD1 ASP B 776      69.389  83.429  84.575  1.00  0.93           O  
ATOM  12663  OD2 ASP B 776      68.333  82.712  86.383  1.00  0.93           O  
ATOM  12664  N   TYR B 777      73.501  84.900  87.669  1.00  0.92           N  
ATOM  12665  CA  TYR B 777      74.219  85.912  88.430  1.00  0.92           C  
ATOM  12666  C   TYR B 777      74.820  87.032  87.571  1.00  0.92           C  
ATOM  12667  O   TYR B 777      74.626  88.209  87.869  1.00  0.92           O  
ATOM  12668  CB  TYR B 777      75.297  85.217  89.324  1.00  0.92           C  
ATOM  12669  CG  TYR B 777      76.192  86.200  90.042  1.00  0.92           C  
ATOM  12670  CD1 TYR B 777      75.808  86.816  91.246  1.00  0.92           C  
ATOM  12671  CD2 TYR B 777      77.398  86.586  89.433  1.00  0.92           C  
ATOM  12672  CE1 TYR B 777      76.611  87.820  91.814  1.00  0.92           C  
ATOM  12673  CE2 TYR B 777      78.183  87.605  89.980  1.00  0.92           C  
ATOM  12674  CZ  TYR B 777      77.785  88.223  91.165  1.00  0.92           C  
ATOM  12675  OH  TYR B 777      78.553  89.294  91.653  1.00  0.92           O  
ATOM  12676  N   GLU B 778      75.526  86.714  86.463  1.00  0.86           N  
ATOM  12677  CA  GLU B 778      76.127  87.743  85.623  1.00  0.86           C  
ATOM  12678  C   GLU B 778      75.085  88.639  84.955  1.00  0.86           C  
ATOM  12679  O   GLU B 778      75.181  89.868  84.952  1.00  0.86           O  
ATOM  12680  CB  GLU B 778      77.043  87.134  84.532  1.00  0.86           C  
ATOM  12681  CG  GLU B 778      77.990  88.196  83.917  1.00  0.86           C  
ATOM  12682  CD  GLU B 778      78.235  88.083  82.404  1.00  0.86           C  
ATOM  12683  OE1 GLU B 778      77.661  87.238  81.697  1.00  0.86           O  
ATOM  12684  OE2 GLU B 778      78.942  88.999  81.912  1.00  0.86           O  
ATOM  12685  N   ALA B 779      74.007  88.019  84.431  1.00  0.93           N  
ATOM  12686  CA  ALA B 779      72.877  88.696  83.834  1.00  0.93           C  
ATOM  12687  C   ALA B 779      72.156  89.601  84.822  1.00  0.93           C  
ATOM  12688  O   ALA B 779      71.830  90.746  84.515  1.00  0.93           O  
ATOM  12689  CB  ALA B 779      71.903  87.638  83.274  1.00  0.93           C  
ATOM  12690  N   TYR B 780      71.936  89.121  86.060  1.00  0.93           N  
ATOM  12691  CA  TYR B 780      71.346  89.902  87.126  1.00  0.93           C  
ATOM  12692  C   TYR B 780      72.153  91.130  87.526  1.00  0.93           C  
ATOM  12693  O   TYR B 780      71.603  92.225  87.598  1.00  0.93           O  
ATOM  12694  CB  TYR B 780      71.162  88.977  88.352  1.00  0.93           C  
ATOM  12695  CG  TYR B 780      70.498  89.613  89.537  1.00  0.93           C  
ATOM  12696  CD1 TYR B 780      69.317  90.367  89.441  1.00  0.93           C  
ATOM  12697  CD2 TYR B 780      71.054  89.391  90.798  1.00  0.93           C  
ATOM  12698  CE1 TYR B 780      68.683  90.848  90.590  1.00  0.93           C  
ATOM  12699  CE2 TYR B 780      70.423  89.852  91.948  1.00  0.93           C  
ATOM  12700  CZ  TYR B 780      69.266  90.609  91.830  1.00  0.93           C  
ATOM  12701  OH  TYR B 780      68.750  91.196  92.972  1.00  0.93           O  
ATOM  12702  N   VAL B 781      73.477  91.008  87.759  1.00  0.91           N  
ATOM  12703  CA  VAL B 781      74.299  92.148  88.154  1.00  0.91           C  
ATOM  12704  C   VAL B 781      74.385  93.206  87.061  1.00  0.91           C  
ATOM  12705  O   VAL B 781      74.179  94.390  87.310  1.00  0.91           O  
ATOM  12706  CB  VAL B 781      75.687  91.712  88.608  1.00  0.91           C  
ATOM  12707  CG1 VAL B 781      76.548  92.928  89.004  1.00  0.91           C  
ATOM  12708  CG2 VAL B 781      75.544  90.782  89.829  1.00  0.91           C  
ATOM  12709  N   LYS B 782      74.599  92.796  85.793  1.00  0.88           N  
ATOM  12710  CA  LYS B 782      74.612  93.710  84.660  1.00  0.88           C  
ATOM  12711  C   LYS B 782      73.270  94.404  84.437  1.00  0.88           C  
ATOM  12712  O   LYS B 782      73.208  95.591  84.118  1.00  0.88           O  
ATOM  12713  CB  LYS B 782      75.092  92.980  83.378  1.00  0.88           C  
ATOM  12714  CG  LYS B 782      76.576  92.585  83.482  1.00  0.88           C  
ATOM  12715  CD  LYS B 782      77.022  91.474  82.514  1.00  0.88           C  
ATOM  12716  CE  LYS B 782      77.398  91.897  81.088  1.00  0.88           C  
ATOM  12717  NZ  LYS B 782      77.838  90.708  80.326  1.00  0.88           N  
ATOM  12718  N   CYS B 783      72.141  93.689  84.633  1.00  0.92           N  
ATOM  12719  CA  CYS B 783      70.817  94.293  84.646  1.00  0.92           C  
ATOM  12720  C   CYS B 783      70.611  95.277  85.797  1.00  0.92           C  
ATOM  12721  O   CYS B 783      70.088  96.371  85.602  1.00  0.92           O  
ATOM  12722  CB  CYS B 783      69.708  93.212  84.656  1.00  0.92           C  
ATOM  12723  SG  CYS B 783      68.092  93.854  84.105  1.00  0.92           S  
ATOM  12724  N   GLN B 784      71.071  94.947  87.020  1.00  0.90           N  
ATOM  12725  CA  GLN B 784      71.036  95.843  88.166  1.00  0.90           C  
ATOM  12726  C   GLN B 784      71.814  97.135  87.969  1.00  0.90           C  
ATOM  12727  O   GLN B 784      71.339  98.215  88.322  1.00  0.90           O  
ATOM  12728  CB  GLN B 784      71.590  95.152  89.435  1.00  0.90           C  
ATOM  12729  CG  GLN B 784      70.627  94.133  90.084  1.00  0.90           C  
ATOM  12730  CD  GLN B 784      69.490  94.816  90.847  1.00  0.90           C  
ATOM  12731  OE1 GLN B 784      69.110  95.959  90.566  1.00  0.90           O  
ATOM  12732  NE2 GLN B 784      68.948  94.105  91.856  1.00  0.90           N  
ATOM  12733  N   ASP B 785      73.014  97.070  87.367  1.00  0.88           N  
ATOM  12734  CA  ASP B 785      73.785  98.239  86.995  1.00  0.88           C  
ATOM  12735  C   ASP B 785      73.039  99.131  85.989  1.00  0.88           C  
ATOM  12736  O   ASP B 785      73.023 100.354  86.124  1.00  0.88           O  
ATOM  12737  CB  ASP B 785      75.190  97.809  86.503  1.00  0.88           C  
ATOM  12738  CG  ASP B 785      76.020  97.255  87.652  1.00  0.88           C  
ATOM  12739  OD1 ASP B 785      75.820  97.675  88.823  1.00  0.88           O  
ATOM  12740  OD2 ASP B 785      76.935  96.428  87.389  1.00  0.88           O  
ATOM  12741  N   LYS B 786      72.312  98.548  85.008  1.00  0.85           N  
ATOM  12742  CA  LYS B 786      71.397  99.286  84.140  1.00  0.85           C  
ATOM  12743  C   LYS B 786      70.248  99.987  84.872  1.00  0.85           C  
ATOM  12744  O   LYS B 786      69.882 101.113  84.532  1.00  0.85           O  
ATOM  12745  CB  LYS B 786      70.774  98.391  83.038  1.00  0.85           C  
ATOM  12746  CG  LYS B 786      71.785  97.868  82.005  1.00  0.85           C  
ATOM  12747  CD  LYS B 786      71.191  96.789  81.076  1.00  0.85           C  
ATOM  12748  CE  LYS B 786      69.936  97.199  80.296  1.00  0.85           C  
ATOM  12749  NZ  LYS B 786      70.228  98.384  79.462  1.00  0.85           N  
ATOM  12750  N   VAL B 787      69.648  99.357  85.907  1.00  0.91           N  
ATOM  12751  CA  VAL B 787      68.655  99.998  86.773  1.00  0.91           C  
ATOM  12752  C   VAL B 787      69.241 101.205  87.495  1.00  0.91           C  
ATOM  12753  O   VAL B 787      68.653 102.286  87.553  1.00  0.91           O  
ATOM  12754  CB  VAL B 787      68.099  99.050  87.835  1.00  0.91           C  
ATOM  12755  CG1 VAL B 787      67.037  99.762  88.691  1.00  0.91           C  
ATOM  12756  CG2 VAL B 787      67.435  97.830  87.181  1.00  0.91           C  
ATOM  12757  N   SER B 788      70.470 101.051  88.024  1.00  0.88           N  
ATOM  12758  CA  SER B 788      71.234 102.115  88.658  1.00  0.88           C  
ATOM  12759  C   SER B 788      71.531 103.272  87.713  1.00  0.88           C  
ATOM  12760  O   SER B 788      71.395 104.432  88.091  1.00  0.88           O  
ATOM  12761  CB  SER B 788      72.563 101.590  89.261  1.00  0.88           C  
ATOM  12762  OG  SER B 788      72.318 100.581  90.249  1.00  0.88           O  
ATOM  12763  N   GLN B 789      71.882 102.997  86.434  1.00  0.82           N  
ATOM  12764  CA  GLN B 789      72.014 104.022  85.404  1.00  0.82           C  
ATOM  12765  C   GLN B 789      70.734 104.813  85.156  1.00  0.82           C  
ATOM  12766  O   GLN B 789      70.757 106.040  85.073  1.00  0.82           O  
ATOM  12767  CB  GL