CNRS Nantes University UFIP UFIP
home |  start a new run |  job status |  references&downloads |  examples |  help  

Should you encounter any unexpected behaviour,
please let us know.


***  job2  ***

elNémo ID: 21111011410728102

Job options:

ID        	=	 21111011410728102
JOBID     	=	 job2
USERID    	=	 unknown
PRIVAT    	=	 0

NMODES    	=	 5
DQMIN     	=	 -100
DQMAX     	=	 100
DQSTEP    	=	 20
DOGRAPHS  	=	 on

DOPROJMODS	=	 0
DORMSD    	=	 0

NRBL      	=	 0
CUTOFF    	=	 0
CAONLY    	=	 0


Input data for this run:

HEADER job2

data_1BL8
# 
_entry.id   1BL8 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.351 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1BL8         pdb_00001bl8 10.2210/pdb1bl8/pdb 
RCSB  RCSB008416   ?            ?                   
WWPDB D_1000008416 ?            ?                   
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1BL8 
_pdbx_database_status.recvd_initial_deposition_date   1998-07-23 
_pdbx_database_status.deposit_site                    BNL 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Doyle, D.A.'     1 
'Cabral, J.M.'    2 
'Pfuetzner, R.A.' 3 
'Kuo, A.'         4 
'Gulbis, J.M.'    5 
'Cohen, S.L.'     6 
'Chait, B.T.'     7 
'Mackinnon, R.'   8 
# 
_citation.id                        primary 
_citation.title                     'The structure of the potassium channel: molecular basis of K+ conduction and selectivity.' 
_citation.journal_abbrev            Science 
_citation.journal_volume            280 
_citation.page_first                69 
_citation.page_last                 77 
_citation.year                      1998 
_citation.journal_id_ASTM           SCIEAS 
_citation.country                   US 
_citation.journal_id_ISSN           0036-8075 
_citation.journal_id_CSD            0038 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   9525859 
_citation.pdbx_database_id_DOI      10.1126/science.280.5360.69 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Doyle, D.A.'       1 ? 
primary 'Morais Cabral, J.' 2 ? 
primary 'Pfuetzner, R.A.'   3 ? 
primary 'Kuo, A.'           4 ? 
primary 'Gulbis, J.M.'      5 ? 
primary 'Cohen, S.L.'       6 ? 
primary 'Chait, B.T.'       7 ? 
primary 'MacKinnon, R.'     8 ? 
# 
_cell.entry_id           1BL8 
_cell.length_a           128.780 
_cell.length_b           68.930 
_cell.length_c           112.040 
_cell.angle_alpha        90.00 
_cell.angle_beta         124.63 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1BL8 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'PROTEIN (POTASSIUM CHANNEL PROTEIN)' 10252.959 4 ? L90C ? ? 
2 non-polymer syn 'POTASSIUM ION'                       39.098    3 ? ?    ? ? 
3 water       nat water                                 18.015    1 ? ?    ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;ALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITS
FGLVTAALATWFVGREQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;ALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITS
FGLVTAALATWFVGREQ
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  ALA n 
1 2  LEU n 
1 3  HIS n 
1 4  TRP n 
1 5  ARG n 
1 6  ALA n 
1 7  ALA n 
1 8  GLY n 
1 9  ALA n 
1 10 ALA n 
1 11 THR n 
1 12 VAL n 
1 13 LEU n 
1 14 LEU n 
1 15 VAL n 
1 16 ILE n 
1 17 VAL n 
1 18 LEU n 
1 19 LEU n 
1 20 ALA n 
1 21 GLY n 
1 22 SER n 
1 23 TYR n 
1 24 LEU n 
1 25 ALA n 
1 26 VAL n 
1 27 LEU n 
1 28 ALA n 
1 29 GLU n 
1 30 ARG n 
1 31 GLY n 
1 32 ALA n 
1 33 PRO n 
1 34 GLY n 
1 35 ALA n 
1 36 GLN n 
1 37 LEU n 
1 38 ILE n 
1 39 THR n 
1 40 TYR n 
1 41 PRO n 
1 42 ARG n 
1 43 ALA n 
1 44 LEU n 
1 45 TRP n 
1 46 TRP n 
1 47 SER n 
1 48 VAL n 
1 49 GLU n 
1 50 THR n 
1 51 ALA n 
1 52 THR n 
1 53 THR n 
1 54 VAL n 
1 55 GLY n 
1 56 TYR n 
1 57 GLY n 
1 58 ASP n 
1 59 LEU n 
1 60 TYR n 
1 61 PRO n 
1 62 VAL n 
1 63 THR n 
1 64 LEU n 
1 65 TRP n 
1 66 GLY n 
1 67 ARG n 
1 68 CYS n 
1 69 VAL n 
1 70 ALA n 
1 71 VAL n 
1 72 VAL n 
1 73 VAL n 
1 74 MET n 
1 75 VAL n 
1 76 ALA n 
1 77 GLY n 
1 78 ILE n 
1 79 THR n 
1 80 SER n 
1 81 PHE n 
1 82 GLY n 
1 83 LEU n 
1 84 VAL n 
1 85 THR n 
1 86 ALA n 
1 87 ALA n 
1 88 LEU n 
1 89 ALA n 
1 90 THR n 
1 91 TRP n 
1 92 PHE n 
1 93 VAL n 
1 94 GLY n 
1 95 ARG n 
1 96 GLU n 
1 97 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Streptomyces 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Streptomyces lividans' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1916 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 KCSA 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'XL-1 BLUE' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PQE60 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    KCSA_STRLI 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P0A334 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1BL8 A 1 ? 97 ? P0A334 23 ? 119 ? 23 119 
2 1 1BL8 B 1 ? 97 ? P0A334 23 ? 119 ? 23 119 
3 1 1BL8 C 1 ? 97 ? P0A334 23 ? 119 ? 23 119 
4 1 1BL8 D 1 ? 97 ? P0A334 23 ? 119 ? 23 119 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1BL8 CYS A 68 ? UNP P0A334 LEU 90 'engineered mutation' 90 1 
2 1BL8 CYS B 68 ? UNP P0A334 LEU 90 'engineered mutation' 90 2 
3 1BL8 CYS C 68 ? UNP P0A334 LEU 90 'engineered mutation' 90 3 
4 1BL8 CYS D 68 ? UNP P0A334 LEU 90 'engineered mutation' 90 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
K   non-polymer         . 'POTASSIUM ION' ? 'K 1'            39.098  
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1BL8 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   6 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.99 
_exptl_crystal.density_percent_sol   75.34 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    
'ONE-TO-MIXTURE OF PROTEIN SOLUTION AND RESERVOIR (200 MM CACL2, 100 MM HEPES PH 7.5, 48% PEG 400).' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'PRINCETON 2K' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.908 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'CHESS BEAMLINE A1' 
_diffrn_source.pdbx_synchrotron_site       CHESS 
_diffrn_source.pdbx_synchrotron_beamline   A1 
_diffrn_source.pdbx_wavelength             0.908 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1BL8 
_reflns.observed_criterion_sigma_I   2 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30.0 
_reflns.d_resolution_high            3.2 
_reflns.number_obs                   12603 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         93.3 
_reflns.pdbx_Rmerge_I_obs            0.086 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        90 
_reflns.pdbx_redundancy              6.1 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             3.2 
_reflns_shell.d_res_low              3.3 
_reflns_shell.percent_possible_all   66.6 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        2.3 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1BL8 
_refine.ls_number_reflns_obs                     12054 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             10.0 
_refine.ls_d_res_high                            3.2 
_refine.ls_percent_reflns_obs                    93.3 
_refine.ls_R_factor_obs                          0.28 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.28 
_refine.ls_R_factor_R_free                       0.29 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.4 
_refine.ls_number_reflns_R_free                  1252 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MIR 
_refine.pdbx_isotropic_thermal_model             GROUP 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            SHELL 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2820 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         3 
_refine_hist.number_atoms_solvent             1 
_refine_hist.number_atoms_total               2824 
_refine_hist.d_res_high                       3.2 
_refine_hist.d_res_low                        10.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.006 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.1   ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      23.73 ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      0.53  ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_restr_ncs.dom_id              1 
_refine_ls_restr_ncs.ncs_model_details   RESTRAINTS 
_refine_ls_restr_ncs.rms_dev_position    ? 
_refine_ls_restr_ncs.weight_position     ? 
_refine_ls_restr_ncs.rms_dev_B_iso       ? 
_refine_ls_restr_ncs.weight_B_iso        ? 
_refine_ls_restr_ncs.pdbx_type           . 
_refine_ls_restr_ncs.pdbx_auth_asym_id   . 
_refine_ls_restr_ncs.pdbx_ens_id         1 
_refine_ls_restr_ncs.pdbx_refine_id      'X-RAY DIFFRACTION' 
_refine_ls_restr_ncs.pdbx_ordinal        1 
_refine_ls_restr_ncs.pdbx_number         ? 
# 
loop_
_struct_ncs_oper.id 
_struct_ncs_oper.code 
_struct_ncs_oper.details 
_struct_ncs_oper.matrix[1][1] 
_struct_ncs_oper.matrix[1][2] 
_struct_ncs_oper.matrix[1][3] 
_struct_ncs_oper.matrix[2][1] 
_struct_ncs_oper.matrix[2][2] 
_struct_ncs_oper.matrix[2][3] 
_struct_ncs_oper.matrix[3][1] 
_struct_ncs_oper.matrix[3][2] 
_struct_ncs_oper.matrix[3][3] 
_struct_ncs_oper.vector[1] 
_struct_ncs_oper.vector[2] 
_struct_ncs_oper.vector[3] 
1 given ? 0.126600  0.928780  0.348340 -0.931190 -0.009730 0.364390  0.341830 -0.370510 0.863640 31.41247  86.76519  -12.10887 
2 given ? -0.736910 -0.010340 0.675910 0.004580  -0.999940 -0.010300 0.675980 -0.004490 0.736910 112.17546 53.01701  -43.35083 
3 given ? 0.137220  -0.931030 0.338160 0.929330  0.002860  -0.369240 0.342800 0.364930  0.865630 80.28391  -33.25713 -31.77395 
# 
_struct_ncs_dom.id            1 
_struct_ncs_dom.details       ? 
_struct_ncs_dom.pdbx_ens_id   1 
# 
_struct_ncs_ens.id            1 
_struct_ncs_ens.details       ? 
_struct_ncs_ens.point_group   ? 
# 
_struct.entry_id                  1BL8 
_struct.title                     'POTASSIUM CHANNEL (KCSA) FROM STREPTOMYCES LIVIDANS' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1BL8 
_struct_keywords.pdbx_keywords   'MEMBRANE PROTEIN' 
_struct_keywords.text            'POTASSIUM CHANNEL, INTEGRAL MEMBRANE PROTEIN, MEMBRANE PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 3 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ARG A 5  ? GLU A 29 ? ARG A 27 GLU A 51  1 ? 25 
HELX_P HELX_P2  2  TYR A 40 ? THR A 52 ? TYR A 62 THR A 74  1 ? 13 
HELX_P HELX_P3  3  LEU A 64 ? THR A 90 ? LEU A 86 THR A 112 1 ? 27 
HELX_P HELX_P4  4  ARG B 5  ? GLU B 29 ? ARG B 27 GLU B 51  1 ? 25 
HELX_P HELX_P5  5  TYR B 40 ? THR B 52 ? TYR B 62 THR B 74  1 ? 13 
HELX_P HELX_P6  6  LEU B 64 ? THR B 90 ? LEU B 86 THR B 112 1 ? 27 
HELX_P HELX_P7  7  ARG C 5  ? GLU C 29 ? ARG C 27 GLU C 51  1 ? 25 
HELX_P HELX_P8  8  TYR C 40 ? THR C 52 ? TYR C 62 THR C 74  1 ? 13 
HELX_P HELX_P9  9  LEU C 64 ? THR C 90 ? LEU C 86 THR C 112 1 ? 27 
HELX_P HELX_P10 10 ARG D 5  ? GLU D 29 ? ARG D 27 GLU D 51  1 ? 25 
HELX_P HELX_P11 11 TYR D 40 ? THR D 52 ? TYR D 62 THR D 74  1 ? 13 
HELX_P HELX_P12 12 LEU D 64 ? THR D 90 ? LEU D 86 THR D 112 1 ? 27 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1  metalc ? ? A THR 53 O   ? ? ? 1_555 F K   .  K   ? ? A THR 75  A K   402 1_555 ? ? ? ? ? ? ? 3.400 ? ? 
metalc2  metalc ? ? A THR 53 O   ? ? ? 1_555 G K   .  K   ? ? A THR 75  A K   403 1_555 ? ? ? ? ? ? ? 3.070 ? ? 
metalc3  metalc ? ? A THR 53 OG1 ? ? ? 1_555 G K   .  K   ? ? A THR 75  A K   403 1_555 ? ? ? ? ? ? ? 3.187 ? ? 
metalc4  metalc ? ? A VAL 54 O   ? ? ? 1_555 F K   .  K   ? ? A VAL 76  A K   402 1_555 ? ? ? ? ? ? ? 3.432 ? ? 
metalc5  metalc ? ? A GLY 55 O   ? ? ? 1_555 E K   .  K   ? ? A GLY 77  A K   401 1_555 ? ? ? ? ? ? ? 3.135 ? ? 
metalc6  metalc ? ? A TYR 56 O   ? ? ? 1_555 E K   .  K   ? ? A TYR 78  A K   401 1_555 ? ? ? ? ? ? ? 3.081 ? ? 
metalc7  metalc ? ? E K   .  K   ? ? ? 1_555 B GLY 55 O   ? ? A K   401 B GLY 77  1_555 ? ? ? ? ? ? ? 3.120 ? ? 
metalc8  metalc ? ? E K   .  K   ? ? ? 1_555 B TYR 56 O   ? ? A K   401 B TYR 78  1_555 ? ? ? ? ? ? ? 3.066 ? ? 
metalc9  metalc ? ? E K   .  K   ? ? ? 1_555 H HOH .  O   ? ? A K   401 B HOH 500 1_555 ? ? ? ? ? ? ? 3.412 ? ? 
metalc10 metalc ? ? E K   .  K   ? ? ? 1_555 C GLY 55 O   ? ? A K   401 C GLY 77  1_555 ? ? ? ? ? ? ? 3.149 ? ? 
metalc11 metalc ? ? E K   .  K   ? ? ? 1_555 C TYR 56 O   ? ? A K   401 C TYR 78  1_555 ? ? ? ? ? ? ? 3.208 ? ? 
metalc12 metalc ? ? E K   .  K   ? ? ? 1_555 D GLY 55 O   ? ? A K   401 D GLY 77  1_555 ? ? ? ? ? ? ? 3.150 ? ? 
metalc13 metalc ? ? E K   .  K   ? ? ? 1_555 D TYR 56 O   ? ? A K   401 D TYR 78  1_555 ? ? ? ? ? ? ? 3.081 ? ? 
metalc14 metalc ? ? F K   .  K   ? ? ? 1_555 G K   .  K   ? ? A K   402 A K   403 1_555 ? ? ? ? ? ? ? 3.296 ? ? 
metalc15 metalc ? ? F K   .  K   ? ? ? 1_555 B THR 53 O   ? ? A K   402 B THR 75  1_555 ? ? ? ? ? ? ? 3.381 ? ? 
metalc16 metalc ? ? F K   .  K   ? ? ? 1_555 B VAL 54 O   ? ? A K   402 B VAL 76  1_555 ? ? ? ? ? ? ? 3.402 ? ? 
metalc17 metalc ? ? F K   .  K   ? ? ? 1_555 C THR 53 O   ? ? A K   402 C THR 75  1_555 ? ? ? ? ? ? ? 3.350 ? ? 
metalc18 metalc ? ? F K   .  K   ? ? ? 1_555 C VAL 54 O   ? ? A K   402 C VAL 76  1_555 ? ? ? ? ? ? ? 3.472 ? ? 
metalc19 metalc ? ? F K   .  K   ? ? ? 1_555 D THR 53 O   ? ? A K   402 D THR 75  1_555 ? ? ? ? ? ? ? 3.392 ? ? 
metalc20 metalc ? ? F K   .  K   ? ? ? 1_555 D VAL 54 O   ? ? A K   402 D VAL 76  1_555 ? ? ? ? ? ? ? 3.409 ? ? 
metalc21 metalc ? ? G K   .  K   ? ? ? 1_555 B THR 53 O   ? ? A K   403 B THR 75  1_555 ? ? ? ? ? ? ? 2.933 ? ? 
metalc22 metalc ? ? G K   .  K   ? ? ? 1_555 B THR 53 OG1 ? ? A K   403 B THR 75  1_555 ? ? ? ? ? ? ? 3.028 ? ? 
metalc23 metalc ? ? G K   .  K   ? ? ? 1_555 C THR 53 O   ? ? A K   403 C THR 75  1_555 ? ? ? ? ? ? ? 3.039 ? ? 
metalc24 metalc ? ? G K   .  K   ? ? ? 1_555 C THR 53 OG1 ? ? A K   403 C THR 75  1_555 ? ? ? ? ? ? ? 3.002 ? ? 
metalc25 metalc ? ? G K   .  K   ? ? ? 1_555 D THR 53 O   ? ? A K   403 D THR 75  1_555 ? ? ? ? ? ? ? 3.135 ? ? 
metalc26 metalc ? ? G K   .  K   ? ? ? 1_555 D THR 53 OG1 ? ? A K   403 D THR 75  1_555 ? ? ? ? ? ? ? 3.187 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
SEL Author   ? ? ?   ? 4 'FILTER TO SELECT FOR POTASSIUM IONS OVER OTHER MONOVALENT CATIONS.' 
AC1 Software A K 401 ? 8 'BINDING SITE FOR RESIDUE K A 401'                                   
AC2 Software A K 402 ? 9 'BINDING SITE FOR RESIDUE K A 402'                                   
AC3 Software A K 403 ? 5 'BINDING SITE FOR RESIDUE K A 403'                                   
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  SEL 4 VAL A 54 ? VAL A 76  . ? 1_555 ? 
2  SEL 4 GLY A 55 ? GLY A 77  . ? 1_555 ? 
3  SEL 4 TYR A 56 ? TYR A 78  . ? 1_555 ? 
4  SEL 4 GLY A 57 ? GLY A 79  . ? 1_555 ? 
5  AC1 8 GLY A 55 ? GLY A 77  . ? 1_555 ? 
6  AC1 8 TYR A 56 ? TYR A 78  . ? 1_555 ? 
7  AC1 8 GLY B 55 ? GLY B 77  . ? 1_555 ? 
8  AC1 8 TYR B 56 ? TYR B 78  . ? 1_555 ? 
9  AC1 8 GLY C 55 ? GLY C 77  . ? 1_555 ? 
10 AC1 8 TYR C 56 ? TYR C 78  . ? 1_555 ? 
11 AC1 8 GLY D 55 ? GLY D 77  . ? 1_555 ? 
12 AC1 8 TYR D 56 ? TYR D 78  . ? 1_555 ? 
13 AC2 9 THR A 53 ? THR A 75  . ? 1_555 ? 
14 AC2 9 VAL A 54 ? VAL A 76  . ? 1_555 ? 
15 AC2 9 K   G .  ? K   A 403 . ? 1_555 ? 
16 AC2 9 THR B 53 ? THR B 75  . ? 1_555 ? 
17 AC2 9 VAL B 54 ? VAL B 76  . ? 1_555 ? 
18 AC2 9 THR C 53 ? THR C 75  . ? 1_555 ? 
19 AC2 9 VAL C 54 ? VAL C 76  . ? 1_555 ? 
20 AC2 9 THR D 53 ? THR D 75  . ? 1_555 ? 
21 AC2 9 VAL D 54 ? VAL D 76  . ? 1_555 ? 
22 AC3 5 THR A 53 ? THR A 75  . ? 1_555 ? 
23 AC3 5 K   F .  ? K   A 402 . ? 1_555 ? 
24 AC3 5 THR B 53 ? THR B 75  . ? 1_555 ? 
25 AC3 5 THR C 53 ? THR C 75  . ? 1_555 ? 
26 AC3 5 THR D 53 ? THR D 75  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1BL8 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1BL8 
_atom_sites.fract_transf_matrix[1][1]   0.007765 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.005363 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014507 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010847 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
K 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ALA A 1 1  ? 65.191 22.037 48.576 1.00 181.62 ? 23  ALA A N   1 
ATOM   2    C CA  . ALA A 1 1  ? 66.434 22.838 48.377 1.00 181.62 ? 23  ALA A CA  1 
ATOM   3    C C   . ALA A 1 1  ? 66.148 24.075 47.534 1.00 181.62 ? 23  ALA A C   1 
ATOM   4    O O   . ALA A 1 1  ? 65.327 24.916 47.902 1.00 181.62 ? 23  ALA A O   1 
ATOM   5    C CB  . ALA A 1 1  ? 67.503 21.981 47.702 1.00 74.09  ? 23  ALA A CB  1 
ATOM   6    N N   . LEU A 1 2  ? 66.837 24.176 46.401 1.00 163.39 ? 24  LEU A N   1 
ATOM   7    C CA  . LEU A 1 2  ? 66.669 25.296 45.483 1.00 163.39 ? 24  LEU A CA  1 
ATOM   8    C C   . LEU A 1 2  ? 67.329 24.975 44.149 1.00 163.39 ? 24  LEU A C   1 
ATOM   9    O O   . LEU A 1 2  ? 66.655 24.735 43.152 1.00 163.39 ? 24  LEU A O   1 
ATOM   10   C CB  . LEU A 1 2  ? 67.293 26.565 46.068 1.00 126.45 ? 24  LEU A CB  1 
ATOM   11   C CG  . LEU A 1 2  ? 67.140 27.827 45.215 1.00 126.45 ? 24  LEU A CG  1 
ATOM   12   C CD1 . LEU A 1 2  ? 66.140 28.766 45.870 1.00 126.45 ? 24  LEU A CD1 1 
ATOM   13   C CD2 . LEU A 1 2  ? 68.488 28.507 45.050 1.00 126.45 ? 24  LEU A CD2 1 
ATOM   14   N N   . HIS A 1 3  ? 68.656 24.973 44.142 1.00 128.26 ? 25  HIS A N   1 
ATOM   15   C CA  . HIS A 1 3  ? 69.416 24.678 42.939 1.00 128.26 ? 25  HIS A CA  1 
ATOM   16   C C   . HIS A 1 3  ? 68.843 23.458 42.227 1.00 128.26 ? 25  HIS A C   1 
ATOM   17   O O   . HIS A 1 3  ? 68.911 23.354 41.007 1.00 128.26 ? 25  HIS A O   1 
ATOM   18   C CB  . HIS A 1 3  ? 70.881 24.416 43.300 1.00 154.92 ? 25  HIS A CB  1 
ATOM   19   C CG  . HIS A 1 3  ? 71.188 22.977 43.573 1.00 154.92 ? 25  HIS A CG  1 
ATOM   20   N ND1 . HIS A 1 3  ? 71.886 22.184 42.689 1.00 154.92 ? 25  HIS A ND1 1 
ATOM   21   C CD2 . HIS A 1 3  ? 70.877 22.182 44.625 1.00 154.92 ? 25  HIS A CD2 1 
ATOM   22   C CE1 . HIS A 1 3  ? 71.993 20.963 43.183 1.00 154.92 ? 25  HIS A CE1 1 
ATOM   23   N NE2 . HIS A 1 3  ? 71.388 20.935 44.356 1.00 154.92 ? 25  HIS A NE2 1 
ATOM   24   N N   . TRP A 1 4  ? 68.271 22.546 43.005 1.00 87.09  ? 26  TRP A N   1 
ATOM   25   C CA  . TRP A 1 4  ? 67.702 21.311 42.475 1.00 87.09  ? 26  TRP A CA  1 
ATOM   26   C C   . TRP A 1 4  ? 66.187 21.378 42.339 1.00 87.09  ? 26  TRP A C   1 
ATOM   27   O O   . TRP A 1 4  ? 65.577 20.508 41.718 1.00 87.09  ? 26  TRP A O   1 
ATOM   28   C CB  . TRP A 1 4  ? 68.072 20.149 43.398 1.00 178.34 ? 26  TRP A CB  1 
ATOM   29   C CG  . TRP A 1 4  ? 68.438 18.876 42.703 1.00 178.34 ? 26  TRP A CG  1 
ATOM   30   C CD1 . TRP A 1 4  ? 68.108 17.612 43.096 1.00 178.34 ? 26  TRP A CD1 1 
ATOM   31   C CD2 . TRP A 1 4  ? 69.236 18.734 41.523 1.00 178.34 ? 26  TRP A CD2 1 
ATOM   32   N NE1 . TRP A 1 4  ? 68.652 16.689 42.237 1.00 178.34 ? 26  TRP A NE1 1 
ATOM   33   C CE2 . TRP A 1 4  ? 69.350 17.349 41.261 1.00 178.34 ? 26  TRP A CE2 1 
ATOM   34   C CE3 . TRP A 1 4  ? 69.867 19.639 40.660 1.00 178.34 ? 26  TRP A CE3 1 
ATOM   35   C CZ2 . TRP A 1 4  ? 70.071 16.847 40.171 1.00 178.34 ? 26  TRP A CZ2 1 
ATOM   36   C CZ3 . TRP A 1 4  ? 70.585 19.140 39.573 1.00 178.34 ? 26  TRP A CZ3 1 
ATOM   37   C CH2 . TRP A 1 4  ? 70.680 17.755 39.341 1.00 178.34 ? 26  TRP A CH2 1 
ATOM   38   N N   . ARG A 1 5  ? 65.580 22.406 42.923 1.00 122.13 ? 27  ARG A N   1 
ATOM   39   C CA  . ARG A 1 5  ? 64.132 22.554 42.871 1.00 122.13 ? 27  ARG A CA  1 
ATOM   40   C C   . ARG A 1 5  ? 63.698 23.774 42.082 1.00 122.13 ? 27  ARG A C   1 
ATOM   41   O O   . ARG A 1 5  ? 62.571 23.831 41.597 1.00 122.13 ? 27  ARG A O   1 
ATOM   42   C CB  . ARG A 1 5  ? 63.558 22.635 44.286 1.00 182.99 ? 27  ARG A CB  1 
ATOM   43   N N   . ALA A 1 6  ? 64.585 24.756 41.965 1.00 131.03 ? 28  ALA A N   1 
ATOM   44   C CA  . ALA A 1 6  ? 64.281 25.970 41.216 1.00 131.03 ? 28  ALA A CA  1 
ATOM   45   C C   . ALA A 1 6  ? 64.288 25.627 39.729 1.00 131.03 ? 28  ALA A C   1 
ATOM   46   O O   . ALA A 1 6  ? 63.775 26.380 38.898 1.00 131.03 ? 28  ALA A O   1 
ATOM   47   C CB  . ALA A 1 6  ? 65.317 27.047 41.514 1.00 172.56 ? 28  ALA A CB  1 
ATOM   48   N N   . ALA A 1 7  ? 64.875 24.477 39.415 1.00 87.09  ? 29  ALA A N   1 
ATOM   49   C CA  . ALA A 1 7  ? 64.970 23.993 38.048 1.00 87.09  ? 29  ALA A CA  1 
ATOM   50   C C   . ALA A 1 7  ? 63.774 23.111 37.716 1.00 87.09  ? 29  ALA A C   1 
ATOM   51   O O   . ALA A 1 7  ? 62.933 23.477 36.896 1.00 87.09  ? 29  ALA A O   1 
ATOM   52   C CB  . ALA A 1 7  ? 66.263 23.208 37.865 1.00 108.12 ? 29  ALA A CB  1 
ATOM   53   N N   . GLY A 1 8  ? 63.703 21.949 38.357 1.00 114.36 ? 30  GLY A N   1 
ATOM   54   C CA  . GLY A 1 8  ? 62.600 21.040 38.117 1.00 114.36 ? 30  GLY A CA  1 
ATOM   55   C C   . GLY A 1 8  ? 61.264 21.756 38.022 1.00 114.36 ? 30  GLY A C   1 
ATOM   56   O O   . GLY A 1 8  ? 60.319 21.239 37.429 1.00 114.36 ? 30  GLY A O   1 
ATOM   57   N N   . ALA A 1 9  ? 61.181 22.952 38.598 1.00 137.97 ? 31  ALA A N   1 
ATOM   58   C CA  . ALA A 1 9  ? 59.942 23.718 38.569 1.00 137.97 ? 31  ALA A CA  1 
ATOM   59   C C   . ALA A 1 9  ? 59.892 24.713 37.425 1.00 137.97 ? 31  ALA A C   1 
ATOM   60   O O   . ALA A 1 9  ? 58.848 24.891 36.800 1.00 137.97 ? 31  ALA A O   1 
ATOM   61   C CB  . ALA A 1 9  ? 59.748 24.449 39.883 1.00 156.87 ? 31  ALA A CB  1 
ATOM   62   N N   . ALA A 1 10 ? 61.015 25.371 37.159 1.00 132.90 ? 32  ALA A N   1 
ATOM   63   C CA  . ALA A 1 10 ? 61.075 26.359 36.091 1.00 132.90 ? 32  ALA A CA  1 
ATOM   64   C C   . ALA A 1 10 ? 60.589 25.782 34.783 1.00 132.90 ? 32  ALA A C   1 
ATOM   65   O O   . ALA A 1 10 ? 59.846 26.425 34.054 1.00 132.90 ? 32  ALA A O   1 
ATOM   66   C CB  . ALA A 1 10 ? 62.479 26.862 35.920 1.00 168.03 ? 32  ALA A CB  1 
ATOM   67   N N   . THR A 1 11 ? 61.027 24.569 34.475 1.00 124.14 ? 33  THR A N   1 
ATOM   68   C CA  . THR A 1 11 ? 60.608 23.937 33.238 1.00 124.14 ? 33  THR A CA  1 
ATOM   69   C C   . THR A 1 11 ? 59.090 24.019 33.129 1.00 124.14 ? 33  THR A C   1 
ATOM   70   O O   . THR A 1 11 ? 58.562 24.340 32.069 1.00 124.14 ? 33  THR A O   1 
ATOM   71   C CB  . THR A 1 11 ? 61.042 22.468 33.176 1.00 76.53  ? 33  THR A CB  1 
ATOM   72   O OG1 . THR A 1 11 ? 60.146 21.671 33.959 1.00 76.53  ? 33  THR A OG1 1 
ATOM   73   C CG2 . THR A 1 11 ? 62.463 22.310 33.696 1.00 76.53  ? 33  THR A CG2 1 
ATOM   74   N N   . VAL A 1 12 ? 58.385 23.748 34.225 1.00 99.21  ? 34  VAL A N   1 
ATOM   75   C CA  . VAL A 1 12 ? 56.929 23.822 34.199 1.00 99.21  ? 34  VAL A CA  1 
ATOM   76   C C   . VAL A 1 12 ? 56.513 25.238 33.814 1.00 99.21  ? 34  VAL A C   1 
ATOM   77   O O   . VAL A 1 12 ? 55.333 25.520 33.633 1.00 99.21  ? 34  VAL A O   1 
ATOM   78   C CB  . VAL A 1 12 ? 56.298 23.471 35.564 1.00 186.53 ? 34  VAL A CB  1 
ATOM   79   C CG1 . VAL A 1 12 ? 54.814 23.198 35.382 1.00 186.53 ? 34  VAL A CG1 1 
ATOM   80   C CG2 . VAL A 1 12 ? 56.977 22.252 36.163 1.00 186.53 ? 34  VAL A CG2 1 
ATOM   81   N N   . LEU A 1 13 ? 57.494 26.126 33.696 1.00 101.32 ? 35  LEU A N   1 
ATOM   82   C CA  . LEU A 1 13 ? 57.249 27.510 33.307 1.00 101.32 ? 35  LEU A CA  1 
ATOM   83   C C   . LEU A 1 13 ? 57.434 27.624 31.800 1.00 101.32 ? 35  LEU A C   1 
ATOM   84   O O   . LEU A 1 13 ? 56.600 28.202 31.108 1.00 101.32 ? 35  LEU A O   1 
ATOM   85   C CB  . LEU A 1 13 ? 58.227 28.453 34.012 1.00 143.06 ? 35  LEU A CB  1 
ATOM   86   C CG  . LEU A 1 13 ? 58.174 28.423 35.537 1.00 143.06 ? 35  LEU A CG  1 
ATOM   87   C CD1 . LEU A 1 13 ? 59.415 29.079 36.127 1.00 143.06 ? 35  LEU A CD1 1 
ATOM   88   C CD2 . LEU A 1 13 ? 56.918 29.139 35.989 1.00 143.06 ? 35  LEU A CD2 1 
ATOM   89   N N   . LEU A 1 14 ? 58.531 27.063 31.298 1.00 118.05 ? 36  LEU A N   1 
ATOM   90   C CA  . LEU A 1 14 ? 58.828 27.094 29.870 1.00 118.05 ? 36  LEU A CA  1 
ATOM   91   C C   . LEU A 1 14 ? 57.699 26.454 29.078 1.00 118.05 ? 36  LEU A C   1 
ATOM   92   O O   . LEU A 1 14 ? 57.266 26.987 28.057 1.00 118.05 ? 36  LEU A O   1 
ATOM   93   C CB  . LEU A 1 14 ? 60.131 26.350 29.574 1.00 121.26 ? 36  LEU A CB  1 
ATOM   94   C CG  . LEU A 1 14 ? 60.392 26.073 28.092 1.00 121.26 ? 36  LEU A CG  1 
ATOM   95   C CD1 . LEU A 1 14 ? 61.054 27.283 27.449 1.00 121.26 ? 36  LEU A CD1 1 
ATOM   96   C CD2 . LEU A 1 14 ? 61.266 24.840 27.952 1.00 121.26 ? 36  LEU A CD2 1 
ATOM   97   N N   . VAL A 1 15 ? 57.233 25.304 29.552 1.00 56.49  ? 37  VAL A N   1 
ATOM   98   C CA  . VAL A 1 15 ? 56.153 24.587 28.892 1.00 56.49  ? 37  VAL A CA  1 
ATOM   99   C C   . VAL A 1 15 ? 54.941 25.485 28.753 1.00 56.49  ? 37  VAL A C   1 
ATOM   100  O O   . VAL A 1 15 ? 54.192 25.377 27.792 1.00 56.49  ? 37  VAL A O   1 
ATOM   101  C CB  . VAL A 1 15 ? 55.759 23.313 29.670 1.00 66.03  ? 37  VAL A CB  1 
ATOM   102  C CG1 . VAL A 1 15 ? 54.268 23.307 29.974 1.00 66.03  ? 37  VAL A CG1 1 
ATOM   103  C CG2 . VAL A 1 15 ? 56.138 22.089 28.856 1.00 66.03  ? 37  VAL A CG2 1 
ATOM   104  N N   . ILE A 1 16 ? 54.735 26.363 29.722 1.00 69.11  ? 38  ILE A N   1 
ATOM   105  C CA  . ILE A 1 16 ? 53.609 27.275 29.638 1.00 69.11  ? 38  ILE A CA  1 
ATOM   106  C C   . ILE A 1 16 ? 53.925 28.222 28.485 1.00 69.11  ? 38  ILE A C   1 
ATOM   107  O O   . ILE A 1 16 ? 53.089 28.443 27.612 1.00 69.11  ? 38  ILE A O   1 
ATOM   108  C CB  . ILE A 1 16 ? 53.428 28.073 30.953 1.00 116.76 ? 38  ILE A CB  1 
ATOM   109  C CG1 . ILE A 1 16 ? 52.555 27.278 31.928 1.00 116.76 ? 38  ILE A CG1 1 
ATOM   110  C CG2 . ILE A 1 16 ? 52.767 29.419 30.672 1.00 116.76 ? 38  ILE A CG2 1 
ATOM   111  C CD1 . ILE A 1 16 ? 52.953 25.824 32.090 1.00 116.76 ? 38  ILE A CD1 1 
ATOM   112  N N   . VAL A 1 17 ? 55.148 28.755 28.483 1.00 75.86  ? 39  VAL A N   1 
ATOM   113  C CA  . VAL A 1 17 ? 55.606 29.674 27.440 1.00 75.86  ? 39  VAL A CA  1 
ATOM   114  C C   . VAL A 1 17 ? 55.326 29.077 26.076 1.00 75.86  ? 39  VAL A C   1 
ATOM   115  O O   . VAL A 1 17 ? 54.797 29.744 25.192 1.00 75.86  ? 39  VAL A O   1 
ATOM   116  C CB  . VAL A 1 17 ? 57.116 29.933 27.539 1.00 140.44 ? 39  VAL A CB  1 
ATOM   117  C CG1 . VAL A 1 17 ? 57.581 30.759 26.349 1.00 140.44 ? 39  VAL A CG1 1 
ATOM   118  C CG2 . VAL A 1 17 ? 57.431 30.642 28.838 1.00 140.44 ? 39  VAL A CG2 1 
ATOM   119  N N   . LEU A 1 18 ? 55.706 27.818 25.908 1.00 56.44  ? 40  LEU A N   1 
ATOM   120  C CA  . LEU A 1 18 ? 55.468 27.129 24.657 1.00 56.44  ? 40  LEU A CA  1 
ATOM   121  C C   . LEU A 1 18 ? 53.999 27.304 24.316 1.00 56.44  ? 40  LEU A C   1 
ATOM   122  O O   . LEU A 1 18 ? 53.642 28.154 23.505 1.00 56.44  ? 40  LEU A O   1 
ATOM   123  C CB  . LEU A 1 18 ? 55.785 25.644 24.795 1.00 25.87  ? 40  LEU A CB  1 
ATOM   124  C CG  . LEU A 1 18 ? 57.250 25.283 25.058 1.00 25.87  ? 40  LEU A CG  1 
ATOM   125  C CD1 . LEU A 1 18 ? 57.467 23.810 24.708 1.00 25.87  ? 40  LEU A CD1 1 
ATOM   126  C CD2 . LEU A 1 18 ? 58.180 26.177 24.249 1.00 25.87  ? 40  LEU A CD2 1 
ATOM   127  N N   . LEU A 1 19 ? 53.148 26.510 24.956 1.00 46.58  ? 41  LEU A N   1 
ATOM   128  C CA  . LEU A 1 19 ? 51.710 26.576 24.723 1.00 46.58  ? 41  LEU A CA  1 
ATOM   129  C C   . LEU A 1 19 ? 51.217 28.013 24.669 1.00 46.58  ? 41  LEU A C   1 
ATOM   130  O O   . LEU A 1 19 ? 50.278 28.318 23.943 1.00 46.58  ? 41  LEU A O   1 
ATOM   131  C CB  . LEU A 1 19 ? 50.957 25.811 25.817 1.00 60.81  ? 41  LEU A CB  1 
ATOM   132  C CG  . LEU A 1 19 ? 51.371 24.350 26.042 1.00 60.81  ? 41  LEU A CG  1 
ATOM   133  C CD1 . LEU A 1 19 ? 50.157 23.539 26.449 1.00 60.81  ? 41  LEU A CD1 1 
ATOM   134  C CD2 . LEU A 1 19 ? 52.005 23.766 24.781 1.00 60.81  ? 41  LEU A CD2 1 
ATOM   135  N N   . ALA A 1 20 ? 51.860 28.893 25.428 1.00 102.07 ? 42  ALA A N   1 
ATOM   136  C CA  . ALA A 1 20 ? 51.482 30.301 25.459 1.00 102.07 ? 42  ALA A CA  1 
ATOM   137  C C   . ALA A 1 20 ? 51.832 30.989 24.146 1.00 102.07 ? 42  ALA A C   1 
ATOM   138  O O   . ALA A 1 20 ? 50.992 31.650 23.539 1.00 102.07 ? 42  ALA A O   1 
ATOM   139  C CB  . ALA A 1 20 ? 52.180 31.005 26.615 1.00 201.16 ? 42  ALA A CB  1 
ATOM   140  N N   . GLY A 1 21 ? 53.081 30.837 23.717 1.00 121.73 ? 43  GLY A N   1 
ATOM   141  C CA  . GLY A 1 21 ? 53.515 31.448 22.474 1.00 121.73 ? 43  GLY A CA  1 
ATOM   142  C C   . GLY A 1 21 ? 52.845 30.796 21.282 1.00 121.73 ? 43  GLY A C   1 
ATOM   143  O O   . GLY A 1 21 ? 52.519 31.459 20.299 1.00 121.73 ? 43  GLY A O   1 
ATOM   144  N N   . SER A 1 22 ? 52.640 29.487 21.375 1.00 75.75  ? 44  SER A N   1 
ATOM   145  C CA  . SER A 1 22 ? 52.002 28.729 20.311 1.00 75.75  ? 44  SER A CA  1 
ATOM   146  C C   . SER A 1 22 ? 50.674 29.352 19.929 1.00 75.75  ? 44  SER A C   1 
ATOM   147  O O   . SER A 1 22 ? 50.504 29.849 18.819 1.00 75.75  ? 44  SER A O   1 
ATOM   148  C CB  . SER A 1 22 ? 51.758 27.290 20.759 1.00 69.48  ? 44  SER A CB  1 
ATOM   149  O OG  . SER A 1 22 ? 52.978 26.591 20.901 1.00 69.48  ? 44  SER A OG  1 
ATOM   150  N N   . TYR A 1 23 ? 49.734 29.325 20.863 1.00 96.48  ? 45  TYR A N   1 
ATOM   151  C CA  . TYR A 1 23 ? 48.409 29.866 20.620 1.00 96.48  ? 45  TYR A CA  1 
ATOM   152  C C   . TYR A 1 23 ? 48.349 31.381 20.721 1.00 96.48  ? 45  TYR A C   1 
ATOM   153  O O   . TYR A 1 23 ? 47.342 31.938 21.156 1.00 96.48  ? 45  TYR A O   1 
ATOM   154  C CB  . TYR A 1 23 ? 47.406 29.246 21.592 1.00 207.41 ? 45  TYR A CB  1 
ATOM   155  C CG  . TYR A 1 23 ? 47.295 27.741 21.481 1.00 207.41 ? 45  TYR A CG  1 
ATOM   156  C CD1 . TYR A 1 23 ? 48.435 26.934 21.452 1.00 207.41 ? 45  TYR A CD1 1 
ATOM   157  C CD2 . TYR A 1 23 ? 46.049 27.121 21.420 1.00 207.41 ? 45  TYR A CD2 1 
ATOM   158  C CE1 . TYR A 1 23 ? 48.335 25.549 21.366 1.00 207.41 ? 45  TYR A CE1 1 
ATOM   159  C CE2 . TYR A 1 23 ? 45.937 25.735 21.335 1.00 207.41 ? 45  TYR A CE2 1 
ATOM   160  C CZ  . TYR A 1 23 ? 47.083 24.956 21.309 1.00 207.41 ? 45  TYR A CZ  1 
ATOM   161  O OH  . TYR A 1 23 ? 46.971 23.585 21.235 1.00 207.41 ? 45  TYR A OH  1 
ATOM   162  N N   . LEU A 1 24 ? 49.432 32.042 20.326 1.00 79.98  ? 46  LEU A N   1 
ATOM   163  C CA  . LEU A 1 24 ? 49.491 33.502 20.349 1.00 79.98  ? 46  LEU A CA  1 
ATOM   164  C C   . LEU A 1 24 ? 50.189 33.997 19.093 1.00 79.98  ? 46  LEU A C   1 
ATOM   165  O O   . LEU A 1 24 ? 49.841 35.039 18.542 1.00 79.98  ? 46  LEU A O   1 
ATOM   166  C CB  . LEU A 1 24 ? 50.241 34.013 21.586 1.00 119.83 ? 46  LEU A CB  1 
ATOM   167  C CG  . LEU A 1 24 ? 49.887 35.450 21.998 1.00 119.83 ? 46  LEU A CG  1 
ATOM   168  C CD1 . LEU A 1 24 ? 49.824 35.544 23.509 1.00 119.83 ? 46  LEU A CD1 1 
ATOM   169  C CD2 . LEU A 1 24 ? 50.911 36.430 21.444 1.00 119.83 ? 46  LEU A CD2 1 
ATOM   170  N N   . ALA A 1 25 ? 51.187 33.246 18.647 1.00 131.75 ? 47  ALA A N   1 
ATOM   171  C CA  . ALA A 1 25 ? 51.910 33.608 17.440 1.00 131.75 ? 47  ALA A CA  1 
ATOM   172  C C   . ALA A 1 25 ? 50.966 33.360 16.269 1.00 131.75 ? 47  ALA A C   1 
ATOM   173  O O   . ALA A 1 25 ? 50.949 34.113 15.292 1.00 131.75 ? 47  ALA A O   1 
ATOM   174  C CB  . ALA A 1 25 ? 53.163 32.756 17.302 1.00 146.28 ? 47  ALA A CB  1 
ATOM   175  N N   . VAL A 1 26 ? 50.177 32.297 16.384 1.00 103.30 ? 48  VAL A N   1 
ATOM   176  C CA  . VAL A 1 26 ? 49.220 31.948 15.348 1.00 103.30 ? 48  VAL A CA  1 
ATOM   177  C C   . VAL A 1 26 ? 48.296 33.133 15.143 1.00 103.30 ? 48  VAL A C   1 
ATOM   178  O O   . VAL A 1 26 ? 48.275 33.723 14.068 1.00 103.30 ? 48  VAL A O   1 
ATOM   179  C CB  . VAL A 1 26 ? 48.370 30.711 15.738 1.00 24.80  ? 48  VAL A CB  1 
ATOM   180  C CG1 . VAL A 1 26 ? 47.121 30.638 14.879 1.00 24.80  ? 48  VAL A CG1 1 
ATOM   181  C CG2 . VAL A 1 26 ? 49.194 29.440 15.574 1.00 24.80  ? 48  VAL A CG2 1 
ATOM   182  N N   . LEU A 1 27 ? 47.546 33.490 16.182 1.00 65.73  ? 49  LEU A N   1 
ATOM   183  C CA  . LEU A 1 27 ? 46.615 34.610 16.094 1.00 65.73  ? 49  LEU A CA  1 
ATOM   184  C C   . LEU A 1 27 ? 47.315 35.928 15.759 1.00 65.73  ? 49  LEU A C   1 
ATOM   185  O O   . LEU A 1 27 ? 46.704 36.998 15.795 1.00 65.73  ? 49  LEU A O   1 
ATOM   186  C CB  . LEU A 1 27 ? 45.826 34.749 17.398 1.00 186.57 ? 49  LEU A CB  1 
ATOM   187  C CG  . LEU A 1 27 ? 46.618 34.838 18.701 1.00 186.57 ? 49  LEU A CG  1 
ATOM   188  C CD1 . LEU A 1 27 ? 46.860 36.300 19.049 1.00 186.57 ? 49  LEU A CD1 1 
ATOM   189  C CD2 . LEU A 1 27 ? 45.847 34.143 19.815 1.00 186.57 ? 49  LEU A CD2 1 
ATOM   190  N N   . ALA A 1 28 ? 48.600 35.842 15.431 1.00 70.81  ? 50  ALA A N   1 
ATOM   191  C CA  . ALA A 1 28 ? 49.381 37.016 15.072 1.00 70.81  ? 50  ALA A CA  1 
ATOM   192  C C   . ALA A 1 28 ? 49.780 36.892 13.613 1.00 70.81  ? 50  ALA A C   1 
ATOM   193  O O   . ALA A 1 28 ? 50.044 37.888 12.946 1.00 70.81  ? 50  ALA A O   1 
ATOM   194  C CB  . ALA A 1 28 ? 50.622 37.111 15.946 1.00 91.45  ? 50  ALA A CB  1 
ATOM   195  N N   . GLU A 1 29 ? 49.807 35.655 13.123 1.00 140.74 ? 51  GLU A N   1 
ATOM   196  C CA  . GLU A 1 29 ? 50.179 35.367 11.742 1.00 140.74 ? 51  GLU A CA  1 
ATOM   197  C C   . GLU A 1 29 ? 49.016 34.825 10.909 1.00 140.74 ? 51  GLU A C   1 
ATOM   198  O O   . GLU A 1 29 ? 48.953 35.053 9.701  1.00 140.74 ? 51  GLU A O   1 
ATOM   199  C CB  . GLU A 1 29 ? 51.320 34.349 11.716 1.00 44.54  ? 51  GLU A CB  1 
ATOM   200  C CG  . GLU A 1 29 ? 52.533 34.749 12.528 1.00 44.54  ? 51  GLU A CG  1 
ATOM   201  C CD  . GLU A 1 29 ? 53.777 34.905 11.674 1.00 44.54  ? 51  GLU A CD  1 
ATOM   202  O OE1 . GLU A 1 29 ? 54.284 33.881 11.145 1.00 44.54  ? 51  GLU A OE1 1 
ATOM   203  O OE2 . GLU A 1 29 ? 54.241 36.058 11.537 1.00 44.54  ? 51  GLU A OE2 1 
ATOM   204  N N   . ARG A 1 30 ? 48.108 34.104 11.564 1.00 136.11 ? 52  ARG A N   1 
ATOM   205  C CA  . ARG A 1 30 ? 46.941 33.492 10.922 1.00 136.11 ? 52  ARG A CA  1 
ATOM   206  C C   . ARG A 1 30 ? 46.404 34.222 9.692  1.00 136.11 ? 52  ARG A C   1 
ATOM   207  O O   . ARG A 1 30 ? 46.024 33.585 8.707  1.00 136.11 ? 52  ARG A O   1 
ATOM   208  C CB  . ARG A 1 30 ? 45.808 33.328 11.942 1.00 184.01 ? 52  ARG A CB  1 
ATOM   209  C CG  . ARG A 1 30 ? 44.540 32.698 11.376 1.00 184.01 ? 52  ARG A CG  1 
ATOM   210  C CD  . ARG A 1 30 ? 44.193 31.399 12.085 1.00 184.01 ? 52  ARG A CD  1 
ATOM   211  N NE  . ARG A 1 30 ? 43.987 30.304 11.140 1.00 184.01 ? 52  ARG A NE  1 
ATOM   212  C CZ  . ARG A 1 30 ? 43.739 29.046 11.492 1.00 184.01 ? 52  ARG A CZ  1 
ATOM   213  N NH1 . ARG A 1 30 ? 43.665 28.715 12.776 1.00 184.01 ? 52  ARG A NH1 1 
ATOM   214  N NH2 . ARG A 1 30 ? 43.568 28.117 10.559 1.00 184.01 ? 52  ARG A NH2 1 
ATOM   215  N N   . GLY A 1 31 ? 46.363 35.549 9.748  1.00 183.51 ? 53  GLY A N   1 
ATOM   216  C CA  . GLY A 1 31 ? 45.863 36.311 8.617  1.00 183.51 ? 53  GLY A CA  1 
ATOM   217  C C   . GLY A 1 31 ? 46.907 37.238 8.029  1.00 183.51 ? 53  GLY A C   1 
ATOM   218  O O   . GLY A 1 31 ? 46.910 38.434 8.321  1.00 183.51 ? 53  GLY A O   1 
ATOM   219  N N   . ALA A 1 32 ? 47.790 36.690 7.196  1.00 129.60 ? 54  ALA A N   1 
ATOM   220  C CA  . ALA A 1 32 ? 48.844 37.485 6.575  1.00 129.60 ? 54  ALA A CA  1 
ATOM   221  C C   . ALA A 1 32 ? 49.762 36.648 5.679  1.00 129.60 ? 54  ALA A C   1 
ATOM   222  O O   . ALA A 1 32 ? 49.701 35.416 5.684  1.00 129.60 ? 54  ALA A O   1 
ATOM   223  C CB  . ALA A 1 32 ? 49.672 38.179 7.661  1.00 75.72  ? 54  ALA A CB  1 
ATOM   224  N N   . PRO A 1 33 ? 50.613 37.321 4.881  1.00 51.61  ? 55  PRO A N   1 
ATOM   225  C CA  . PRO A 1 33 ? 51.580 36.708 3.954  1.00 51.61  ? 55  PRO A CA  1 
ATOM   226  C C   . PRO A 1 33 ? 52.572 35.736 4.612  1.00 51.61  ? 55  PRO A C   1 
ATOM   227  O O   . PRO A 1 33 ? 53.527 35.282 3.980  1.00 51.61  ? 55  PRO A O   1 
ATOM   228  C CB  . PRO A 1 33 ? 52.307 37.910 3.354  1.00 74.93  ? 55  PRO A CB  1 
ATOM   229  C CG  . PRO A 1 33 ? 51.361 39.063 3.537  1.00 74.93  ? 55  PRO A CG  1 
ATOM   230  C CD  . PRO A 1 33 ? 50.645 38.795 4.812  1.00 74.93  ? 55  PRO A CD  1 
ATOM   231  N N   . GLY A 1 34 ? 52.328 35.411 5.876  1.00 60.75  ? 56  GLY A N   1 
ATOM   232  C CA  . GLY A 1 34 ? 53.225 34.536 6.603  1.00 60.75  ? 56  GLY A CA  1 
ATOM   233  C C   . GLY A 1 34 ? 53.027 33.048 6.453  1.00 60.75  ? 56  GLY A C   1 
ATOM   234  O O   . GLY A 1 34 ? 51.971 32.582 6.034  1.00 60.75  ? 56  GLY A O   1 
ATOM   235  N N   . ALA A 1 35 ? 54.071 32.312 6.830  1.00 108.87 ? 57  ALA A N   1 
ATOM   236  C CA  . ALA A 1 35 ? 54.101 30.858 6.766  1.00 108.87 ? 57  ALA A CA  1 
ATOM   237  C C   . ALA A 1 35 ? 52.989 30.199 7.575  1.00 108.87 ? 57  ALA A C   1 
ATOM   238  O O   . ALA A 1 35 ? 52.088 30.866 8.087  1.00 108.87 ? 57  ALA A O   1 
ATOM   239  C CB  . ALA A 1 35 ? 55.463 30.350 7.239  1.00 121.54 ? 57  ALA A CB  1 
ATOM   240  N N   . GLN A 1 36 ? 53.079 28.878 7.687  1.00 111.13 ? 58  GLN A N   1 
ATOM   241  C CA  . GLN A 1 36 ? 52.094 28.068 8.394  1.00 111.13 ? 58  GLN A CA  1 
ATOM   242  C C   . GLN A 1 36 ? 51.852 28.426 9.854  1.00 111.13 ? 58  GLN A C   1 
ATOM   243  O O   . GLN A 1 36 ? 51.090 27.739 10.534 1.00 111.13 ? 58  GLN A O   1 
ATOM   244  C CB  . GLN A 1 36 ? 52.475 26.589 8.297  1.00 127.58 ? 58  GLN A CB  1 
ATOM   245  C CG  . GLN A 1 36 ? 51.294 25.637 8.343  1.00 127.58 ? 58  GLN A CG  1 
ATOM   246  C CD  . GLN A 1 36 ? 51.712 24.189 8.179  1.00 127.58 ? 58  GLN A CD  1 
ATOM   247  O OE1 . GLN A 1 36 ? 51.983 23.731 7.069  1.00 127.58 ? 58  GLN A OE1 1 
ATOM   248  N NE2 . GLN A 1 36 ? 51.768 23.459 9.288  1.00 127.58 ? 58  GLN A NE2 1 
ATOM   249  N N   . LEU A 1 37 ? 52.492 29.483 10.349 1.00 89.30  ? 59  LEU A N   1 
ATOM   250  C CA  . LEU A 1 37 ? 52.279 29.896 11.736 1.00 89.30  ? 59  LEU A CA  1 
ATOM   251  C C   . LEU A 1 37 ? 50.868 30.460 11.772 1.00 89.30  ? 59  LEU A C   1 
ATOM   252  O O   . LEU A 1 37 ? 50.588 31.473 12.409 1.00 89.30  ? 59  LEU A O   1 
ATOM   253  C CB  . LEU A 1 37 ? 53.298 30.964 12.153 1.00 55.91  ? 59  LEU A CB  1 
ATOM   254  C CG  . LEU A 1 37 ? 54.666 30.435 12.609 1.00 55.91  ? 59  LEU A CG  1 
ATOM   255  C CD1 . LEU A 1 37 ? 55.509 31.583 13.139 1.00 55.91  ? 59  LEU A CD1 1 
ATOM   256  C CD2 . LEU A 1 37 ? 54.489 29.358 13.674 1.00 55.91  ? 59  LEU A CD2 1 
ATOM   257  N N   . ILE A 1 38 ? 49.990 29.773 11.053 1.00 82.81  ? 60  ILE A N   1 
ATOM   258  C CA  . ILE A 1 38 ? 48.593 30.135 10.927 1.00 82.81  ? 60  ILE A CA  1 
ATOM   259  C C   . ILE A 1 38 ? 47.731 29.007 11.486 1.00 82.81  ? 60  ILE A C   1 
ATOM   260  O O   . ILE A 1 38 ? 46.516 28.984 11.293 1.00 82.81  ? 60  ILE A O   1 
ATOM   261  C CB  . ILE A 1 38 ? 48.231 30.372 9.441  1.00 97.34  ? 60  ILE A CB  1 
ATOM   262  C CG1 . ILE A 1 38 ? 48.227 29.042 8.683  1.00 97.34  ? 60  ILE A CG1 1 
ATOM   263  C CG2 . ILE A 1 38 ? 49.251 31.304 8.798  1.00 97.34  ? 60  ILE A CG2 1 
ATOM   264  N N   . THR A 1 39 ? 48.372 28.071 12.177 1.00 80.00  ? 61  THR A N   1 
ATOM   265  C CA  . THR A 1 39 ? 47.667 26.942 12.768 1.00 80.00  ? 61  THR A CA  1 
ATOM   266  C C   . THR A 1 39 ? 48.249 26.657 14.139 1.00 80.00  ? 61  THR A C   1 
ATOM   267  O O   . THR A 1 39 ? 49.464 26.534 14.293 1.00 80.00  ? 61  THR A O   1 
ATOM   268  C CB  . THR A 1 39 ? 47.805 25.684 11.897 1.00 81.34  ? 61  THR A CB  1 
ATOM   269  O OG1 . THR A 1 39 ? 47.664 26.051 10.522 1.00 81.34  ? 61  THR A OG1 1 
ATOM   270  C CG2 . THR A 1 39 ? 46.736 24.666 12.244 1.00 81.34  ? 61  THR A CG2 1 
ATOM   271  N N   . TYR A 1 40 ? 47.377 26.561 15.135 1.00 139.51 ? 62  TYR A N   1 
ATOM   272  C CA  . TYR A 1 40 ? 47.810 26.294 16.497 1.00 139.51 ? 62  TYR A CA  1 
ATOM   273  C C   . TYR A 1 40 ? 48.652 25.025 16.591 1.00 139.51 ? 62  TYR A C   1 
ATOM   274  O O   . TYR A 1 40 ? 49.732 25.039 17.182 1.00 139.51 ? 62  TYR A O   1 
ATOM   275  C CB  . TYR A 1 40 ? 46.596 26.193 17.419 1.00 185.28 ? 62  TYR A CB  1 
ATOM   276  C CG  . TYR A 1 40 ? 45.888 27.511 17.615 1.00 185.28 ? 62  TYR A CG  1 
ATOM   277  C CD1 . TYR A 1 40 ? 46.538 28.586 18.220 1.00 185.28 ? 62  TYR A CD1 1 
ATOM   278  C CD2 . TYR A 1 40 ? 44.572 27.690 17.191 1.00 185.28 ? 62  TYR A CD2 1 
ATOM   279  C CE1 . TYR A 1 40 ? 45.896 29.808 18.400 1.00 185.28 ? 62  TYR A CE1 1 
ATOM   280  C CE2 . TYR A 1 40 ? 43.918 28.909 17.366 1.00 185.28 ? 62  TYR A CE2 1 
ATOM   281  C CZ  . TYR A 1 40 ? 44.588 29.964 17.971 1.00 185.28 ? 62  TYR A CZ  1 
ATOM   282  O OH  . TYR A 1 40 ? 43.952 31.171 18.149 1.00 185.28 ? 62  TYR A OH  1 
ATOM   283  N N   . PRO A 1 41 ? 48.175 23.911 16.005 1.00 78.73  ? 63  PRO A N   1 
ATOM   284  C CA  . PRO A 1 41 ? 48.928 22.649 16.053 1.00 78.73  ? 63  PRO A CA  1 
ATOM   285  C C   . PRO A 1 41 ? 50.269 22.724 15.322 1.00 78.73  ? 63  PRO A C   1 
ATOM   286  O O   . PRO A 1 41 ? 51.053 21.767 15.340 1.00 78.73  ? 63  PRO A O   1 
ATOM   287  C CB  . PRO A 1 41 ? 47.987 21.630 15.402 1.00 106.64 ? 63  PRO A CB  1 
ATOM   288  C CG  . PRO A 1 41 ? 46.648 22.300 15.333 1.00 106.64 ? 63  PRO A CG  1 
ATOM   289  C CD  . PRO A 1 41 ? 46.906 23.766 15.272 1.00 106.64 ? 63  PRO A CD  1 
ATOM   290  N N   . ARG A 1 42 ? 50.517 23.866 14.680 1.00 60.31  ? 64  ARG A N   1 
ATOM   291  C CA  . ARG A 1 42 ? 51.748 24.093 13.931 1.00 60.31  ? 64  ARG A CA  1 
ATOM   292  C C   . ARG A 1 42 ? 52.668 25.009 14.716 1.00 60.31  ? 64  ARG A C   1 
ATOM   293  O O   . ARG A 1 42 ? 53.879 24.818 14.728 1.00 60.31  ? 64  ARG A O   1 
ATOM   294  C CB  . ARG A 1 42 ? 51.430 24.720 12.572 1.00 90.09  ? 64  ARG A CB  1 
ATOM   295  N N   . ALA A 1 43 ? 52.089 26.008 15.371 1.00 93.68  ? 65  ALA A N   1 
ATOM   296  C CA  . ALA A 1 43 ? 52.879 26.934 16.165 1.00 93.68  ? 65  ALA A CA  1 
ATOM   297  C C   . ALA A 1 43 ? 53.629 26.156 17.246 1.00 93.68  ? 65  ALA A C   1 
ATOM   298  O O   . ALA A 1 43 ? 54.771 26.484 17.574 1.00 93.68  ? 65  ALA A O   1 
ATOM   299  C CB  . ALA A 1 43 ? 51.980 27.985 16.795 1.00 4.68   ? 65  ALA A CB  1 
ATOM   300  N N   . LEU A 1 44 ? 52.983 25.125 17.790 1.00 69.94  ? 66  LEU A N   1 
ATOM   301  C CA  . LEU A 1 44 ? 53.583 24.284 18.827 1.00 69.94  ? 66  LEU A CA  1 
ATOM   302  C C   . LEU A 1 44 ? 54.979 23.839 18.421 1.00 69.94  ? 66  LEU A C   1 
ATOM   303  O O   . LEU A 1 44 ? 55.979 24.266 18.997 1.00 69.94  ? 66  LEU A O   1 
ATOM   304  C CB  . LEU A 1 44 ? 52.744 23.030 19.052 1.00 73.79  ? 66  LEU A CB  1 
ATOM   305  C CG  . LEU A 1 44 ? 51.465 23.090 19.878 1.00 73.79  ? 66  LEU A CG  1 
ATOM   306  C CD1 . LEU A 1 44 ? 51.200 21.700 20.447 1.00 73.79  ? 66  LEU A CD1 1 
ATOM   307  C CD2 . LEU A 1 44 ? 51.591 24.115 20.988 1.00 73.79  ? 66  LEU A CD2 1 
ATOM   308  N N   . TRP A 1 45 ? 55.022 22.957 17.427 1.00 68.12  ? 67  TRP A N   1 
ATOM   309  C CA  . TRP A 1 45 ? 56.270 22.419 16.905 1.00 68.12  ? 67  TRP A CA  1 
ATOM   310  C C   . TRP A 1 45 ? 57.246 23.556 16.616 1.00 68.12  ? 67  TRP A C   1 
ATOM   311  O O   . TRP A 1 45 ? 58.454 23.339 16.548 1.00 68.12  ? 67  TRP A O   1 
ATOM   312  C CB  . TRP A 1 45 ? 55.988 21.592 15.639 1.00 92.48  ? 67  TRP A CB  1 
ATOM   313  C CG  . TRP A 1 45 ? 57.187 21.287 14.788 1.00 92.48  ? 67  TRP A CG  1 
ATOM   314  C CD1 . TRP A 1 45 ? 57.462 21.805 13.556 1.00 92.48  ? 67  TRP A CD1 1 
ATOM   315  C CD2 . TRP A 1 45 ? 58.275 20.406 15.105 1.00 92.48  ? 67  TRP A CD2 1 
ATOM   316  N NE1 . TRP A 1 45 ? 58.653 21.306 13.083 1.00 92.48  ? 67  TRP A NE1 1 
ATOM   317  C CE2 . TRP A 1 45 ? 59.175 20.445 14.013 1.00 92.48  ? 67  TRP A CE2 1 
ATOM   318  C CE3 . TRP A 1 45 ? 58.579 19.588 16.202 1.00 92.48  ? 67  TRP A CE3 1 
ATOM   319  C CZ2 . TRP A 1 45 ? 60.360 19.699 13.986 1.00 92.48  ? 67  TRP A CZ2 1 
ATOM   320  C CZ3 . TRP A 1 45 ? 59.761 18.844 16.175 1.00 92.48  ? 67  TRP A CZ3 1 
ATOM   321  C CH2 . TRP A 1 45 ? 60.635 18.907 15.072 1.00 92.48  ? 67  TRP A CH2 1 
ATOM   322  N N   . TRP A 1 46 ? 56.723 24.769 16.460 1.00 65.10  ? 68  TRP A N   1 
ATOM   323  C CA  . TRP A 1 46 ? 57.575 25.925 16.200 1.00 65.10  ? 68  TRP A CA  1 
ATOM   324  C C   . TRP A 1 46 ? 58.129 26.452 17.508 1.00 65.10  ? 68  TRP A C   1 
ATOM   325  O O   . TRP A 1 46 ? 59.303 26.818 17.597 1.00 65.10  ? 68  TRP A O   1 
ATOM   326  C CB  . TRP A 1 46 ? 56.800 27.045 15.526 1.00 48.81  ? 68  TRP A CB  1 
ATOM   327  C CG  . TRP A 1 46 ? 57.526 28.342 15.592 1.00 48.81  ? 68  TRP A CG  1 
ATOM   328  C CD1 . TRP A 1 46 ? 58.616 28.705 14.861 1.00 48.81  ? 68  TRP A CD1 1 
ATOM   329  C CD2 . TRP A 1 46 ? 57.215 29.456 16.430 1.00 48.81  ? 68  TRP A CD2 1 
ATOM   330  N NE1 . TRP A 1 46 ? 59.006 29.981 15.187 1.00 48.81  ? 68  TRP A NE1 1 
ATOM   331  C CE2 . TRP A 1 46 ? 58.162 30.467 16.148 1.00 48.81  ? 68  TRP A CE2 1 
ATOM   332  C CE3 . TRP A 1 46 ? 56.228 29.701 17.390 1.00 48.81  ? 68  TRP A CE3 1 
ATOM   333  C CZ2 . TRP A 1 46 ? 58.152 31.708 16.793 1.00 48.81  ? 68  TRP A CZ2 1 
ATOM   334  C CZ3 . TRP A 1 46 ? 56.215 30.934 18.030 1.00 48.81  ? 68  TRP A CZ3 1 
ATOM   335  C CH2 . TRP A 1 46 ? 57.173 31.925 17.727 1.00 48.81  ? 68  TRP A CH2 1 
ATOM   336  N N   . SER A 1 47 ? 57.263 26.511 18.514 1.00 60.16  ? 69  SER A N   1 
ATOM   337  C CA  . SER A 1 47 ? 57.659 26.973 19.834 1.00 60.16  ? 69  SER A CA  1 
ATOM   338  C C   . SER A 1 47 ? 58.807 26.088 20.301 1.00 60.16  ? 69  SER A C   1 
ATOM   339  O O   . SER A 1 47 ? 59.832 26.575 20.777 1.00 60.16  ? 69  SER A O   1 
ATOM   340  C CB  . SER A 1 47 ? 56.486 26.856 20.806 1.00 56.82  ? 69  SER A CB  1 
ATOM   341  O OG  . SER A 1 47 ? 55.565 27.922 20.627 1.00 56.82  ? 69  SER A OG  1 
ATOM   342  N N   . VAL A 1 48 ? 58.626 24.781 20.142 1.00 40.96  ? 70  VAL A N   1 
ATOM   343  C CA  . VAL A 1 48 ? 59.635 23.810 20.538 1.00 40.96  ? 70  VAL A CA  1 
ATOM   344  C C   . VAL A 1 48 ? 60.971 24.013 19.831 1.00 40.96  ? 70  VAL A C   1 
ATOM   345  O O   . VAL A 1 48 ? 62.001 24.154 20.494 1.00 40.96  ? 70  VAL A O   1 
ATOM   346  C CB  . VAL A 1 48 ? 59.153 22.376 20.269 1.00 32.80  ? 70  VAL A CB  1 
ATOM   347  C CG1 . VAL A 1 48 ? 60.244 21.375 20.634 1.00 32.80  ? 70  VAL A CG1 1 
ATOM   348  C CG2 . VAL A 1 48 ? 57.879 22.109 21.061 1.00 32.80  ? 70  VAL A CG2 1 
ATOM   349  N N   . GLU A 1 49 ? 60.962 24.018 18.495 1.00 89.57  ? 71  GLU A N   1 
ATOM   350  C CA  . GLU A 1 49 ? 62.193 24.206 17.722 1.00 89.57  ? 71  GLU A CA  1 
ATOM   351  C C   . GLU A 1 49 ? 62.838 25.522 18.137 1.00 89.57  ? 71  GLU A C   1 
ATOM   352  O O   . GLU A 1 49 ? 64.040 25.583 18.401 1.00 89.57  ? 71  GLU A O   1 
ATOM   353  C CB  . GLU A 1 49 ? 61.902 24.217 16.212 1.00 26.67  ? 71  GLU A CB  1 
ATOM   354  N N   . THR A 1 50 ? 62.024 26.570 18.210 1.00 61.86  ? 72  THR A N   1 
ATOM   355  C CA  . THR A 1 50 ? 62.507 27.887 18.602 1.00 61.86  ? 72  THR A CA  1 
ATOM   356  C C   . THR A 1 50 ? 63.115 27.859 20.009 1.00 61.86  ? 72  THR A C   1 
ATOM   357  O O   . THR A 1 50 ? 64.249 28.306 20.226 1.00 61.86  ? 72  THR A O   1 
ATOM   358  C CB  . THR A 1 50 ? 61.362 28.927 18.593 1.00 93.49  ? 72  THR A CB  1 
ATOM   359  O OG1 . THR A 1 50 ? 60.784 29.003 17.282 1.00 93.49  ? 72  THR A OG1 1 
ATOM   360  C CG2 . THR A 1 50 ? 61.890 30.300 18.996 1.00 93.49  ? 72  THR A CG2 1 
ATOM   361  N N   . ALA A 1 51 ? 62.337 27.334 20.953 1.00 66.99  ? 73  ALA A N   1 
ATOM   362  C CA  . ALA A 1 51 ? 62.741 27.231 22.348 1.00 66.99  ? 73  ALA A CA  1 
ATOM   363  C C   . ALA A 1 51 ? 64.024 26.432 22.508 1.00 66.99  ? 73  ALA A C   1 
ATOM   364  O O   . ALA A 1 51 ? 64.865 26.761 23.335 1.00 66.99  ? 73  ALA A O   1 
ATOM   365  C CB  . ALA A 1 51 ? 61.625 26.592 23.161 1.00 78.09  ? 73  ALA A CB  1 
ATOM   366  N N   . THR A 1 52 ? 64.168 25.369 21.731 1.00 48.18  ? 74  THR A N   1 
ATOM   367  C CA  . THR A 1 52 ? 65.370 24.561 21.805 1.00 48.18  ? 74  THR A CA  1 
ATOM   368  C C   . THR A 1 52 ? 66.427 25.306 21.031 1.00 48.18  ? 74  THR A C   1 
ATOM   369  O O   . THR A 1 52 ? 67.619 25.001 21.138 1.00 48.18  ? 74  THR A O   1 
ATOM   370  C CB  . THR A 1 52 ? 65.191 23.220 21.113 1.00 80.41  ? 74  THR A CB  1 
ATOM   371  O OG1 . THR A 1 52 ? 63.947 22.640 21.507 1.00 80.41  ? 74  THR A OG1 1 
ATOM   372  C CG2 . THR A 1 52 ? 66.327 22.289 21.470 1.00 80.41  ? 74  THR A CG2 1 
ATOM   373  N N   . THR A 1 53 ? 65.968 26.299 20.265 1.00 71.55  ? 75  THR A N   1 
ATOM   374  C CA  . THR A 1 53 ? 66.803 27.119 19.388 1.00 71.55  ? 75  THR A CA  1 
ATOM   375  C C   . THR A 1 53 ? 67.601 26.202 18.477 1.00 71.55  ? 75  THR A C   1 
ATOM   376  O O   . THR A 1 53 ? 68.794 25.977 18.647 1.00 71.55  ? 75  THR A O   1 
ATOM   377  C CB  . THR A 1 53 ? 67.762 28.078 20.155 1.00 78.57  ? 75  THR A CB  1 
ATOM   378  O OG1 . THR A 1 53 ? 69.094 27.944 19.643 1.00 78.57  ? 75  THR A OG1 1 
ATOM   379  C CG2 . THR A 1 53 ? 67.749 27.798 21.639 1.00 78.57  ? 75  THR A CG2 1 
ATOM   380  N N   . VAL A 1 54 ? 66.891 25.649 17.510 1.00 146.85 ? 76  VAL A N   1 
ATOM   381  C CA  . VAL A 1 54 ? 67.467 24.753 16.535 1.00 146.85 ? 76  VAL A CA  1 
ATOM   382  C C   . VAL A 1 54 ? 67.171 25.393 15.180 1.00 146.85 ? 76  VAL A C   1 
ATOM   383  O O   . VAL A 1 54 ? 67.890 25.187 14.201 1.00 146.85 ? 76  VAL A O   1 
ATOM   384  C CB  . VAL A 1 54 ? 66.810 23.372 16.641 1.00 61.16  ? 76  VAL A CB  1 
ATOM   385  C CG1 . VAL A 1 54 ? 67.609 22.361 15.877 1.00 61.16  ? 76  VAL A CG1 1 
ATOM   386  C CG2 . VAL A 1 54 ? 66.707 22.960 18.099 1.00 61.16  ? 76  VAL A CG2 1 
ATOM   387  N N   . GLY A 1 55 ? 66.105 26.191 15.157 1.00 148.34 ? 77  GLY A N   1 
ATOM   388  C CA  . GLY A 1 55 ? 65.689 26.896 13.956 1.00 148.34 ? 77  GLY A CA  1 
ATOM   389  C C   . GLY A 1 55 ? 65.770 26.072 12.695 1.00 148.34 ? 77  GLY A C   1 
ATOM   390  O O   . GLY A 1 55 ? 66.690 26.239 11.900 1.00 148.34 ? 77  GLY A O   1 
ATOM   391  N N   . TYR A 1 56 ? 64.805 25.182 12.507 1.00 62.83  ? 78  TYR A N   1 
ATOM   392  C CA  . TYR A 1 56 ? 64.798 24.337 11.324 1.00 62.83  ? 78  TYR A CA  1 
ATOM   393  C C   . TYR A 1 56 ? 64.663 25.199 10.096 1.00 62.83  ? 78  TYR A C   1 
ATOM   394  O O   . TYR A 1 56 ? 65.282 24.921 9.079  1.00 62.83  ? 78  TYR A O   1 
ATOM   395  C CB  . TYR A 1 56 ? 63.644 23.332 11.380 1.00 37.79  ? 78  TYR A CB  1 
ATOM   396  C CG  . TYR A 1 56 ? 64.064 22.011 11.965 1.00 37.79  ? 78  TYR A CG  1 
ATOM   397  C CD1 . TYR A 1 56 ? 65.248 21.389 11.553 1.00 37.79  ? 78  TYR A CD1 1 
ATOM   398  C CD2 . TYR A 1 56 ? 63.315 21.407 12.978 1.00 37.79  ? 78  TYR A CD2 1 
ATOM   399  C CE1 . TYR A 1 56 ? 65.682 20.195 12.140 1.00 37.79  ? 78  TYR A CE1 1 
ATOM   400  C CE2 . TYR A 1 56 ? 63.738 20.209 13.577 1.00 37.79  ? 78  TYR A CE2 1 
ATOM   401  C CZ  . TYR A 1 56 ? 64.922 19.606 13.155 1.00 37.79  ? 78  TYR A CZ  1 
ATOM   402  O OH  . TYR A 1 56 ? 65.330 18.419 13.740 1.00 37.79  ? 78  TYR A OH  1 
ATOM   403  N N   . GLY A 1 57 ? 63.864 26.257 10.213 1.00 72.42  ? 79  GLY A N   1 
ATOM   404  C CA  . GLY A 1 57 ? 63.635 27.149 9.092  1.00 72.42  ? 79  GLY A CA  1 
ATOM   405  C C   . GLY A 1 57 ? 62.320 26.783 8.424  1.00 72.42  ? 79  GLY A C   1 
ATOM   406  O O   . GLY A 1 57 ? 61.731 27.571 7.678  1.00 72.42  ? 79  GLY A O   1 
ATOM   407  N N   . ASP A 1 58 ? 61.869 25.565 8.704  1.00 83.32  ? 80  ASP A N   1 
ATOM   408  C CA  . ASP A 1 58 ? 60.622 25.042 8.172  1.00 83.32  ? 80  ASP A CA  1 
ATOM   409  C C   . ASP A 1 58 ? 59.469 25.969 8.544  1.00 83.32  ? 80  ASP A C   1 
ATOM   410  O O   . ASP A 1 58 ? 58.440 25.985 7.874  1.00 83.32  ? 80  ASP A O   1 
ATOM   411  C CB  . ASP A 1 58 ? 60.364 23.652 8.752  1.00 61.13  ? 80  ASP A CB  1 
ATOM   412  C CG  . ASP A 1 58 ? 59.739 23.703 10.138 1.00 61.13  ? 80  ASP A CG  1 
ATOM   413  O OD1 . ASP A 1 58 ? 60.438 24.063 11.121 1.00 61.13  ? 80  ASP A OD1 1 
ATOM   414  O OD2 . ASP A 1 58 ? 58.537 23.382 10.239 1.00 61.13  ? 80  ASP A OD2 1 
ATOM   415  N N   . LEU A 1 59 ? 59.649 26.734 9.619  1.00 85.94  ? 81  LEU A N   1 
ATOM   416  C CA  . LEU A 1 59 ? 58.628 27.667 10.088 1.00 85.94  ? 81  LEU A CA  1 
ATOM   417  C C   . LEU A 1 59 ? 59.234 28.833 10.869 1.00 85.94  ? 81  LEU A C   1 
ATOM   418  O O   . LEU A 1 59 ? 60.241 28.666 11.560 1.00 85.94  ? 81  LEU A O   1 
ATOM   419  C CB  . LEU A 1 59 ? 57.622 26.941 10.985 1.00 80.09  ? 81  LEU A CB  1 
ATOM   420  C CG  . LEU A 1 59 ? 56.788 25.796 10.408 1.00 80.09  ? 81  LEU A CG  1 
ATOM   421  C CD1 . LEU A 1 59 ? 55.872 25.246 11.480 1.00 80.09  ? 81  LEU A CD1 1 
ATOM   422  C CD2 . LEU A 1 59 ? 55.969 26.293 9.245  1.00 80.09  ? 81  LEU A CD2 1 
ATOM   423  N N   . TYR A 1 60 ? 58.609 30.005 10.747 1.00 35.63  ? 82  TYR A N   1 
ATOM   424  C CA  . TYR A 1 60 ? 59.029 31.223 11.441 1.00 35.63  ? 82  TYR A CA  1 
ATOM   425  C C   . TYR A 1 60 ? 58.035 32.379 11.286 1.00 35.63  ? 82  TYR A C   1 
ATOM   426  O O   . TYR A 1 60 ? 57.277 32.448 10.318 1.00 35.63  ? 82  TYR A O   1 
ATOM   427  C CB  . TYR A 1 60 ? 60.407 31.674 10.964 1.00 98.82  ? 82  TYR A CB  1 
ATOM   428  C CG  . TYR A 1 60 ? 60.525 31.872 9.480  1.00 98.82  ? 82  TYR A CG  1 
ATOM   429  C CD1 . TYR A 1 60 ? 60.580 30.780 8.616  1.00 98.82  ? 82  TYR A CD1 1 
ATOM   430  C CD2 . TYR A 1 60 ? 60.639 33.149 8.940  1.00 98.82  ? 82  TYR A CD2 1 
ATOM   431  C CE1 . TYR A 1 60 ? 60.753 30.951 7.247  1.00 98.82  ? 82  TYR A CE1 1 
ATOM   432  C CE2 . TYR A 1 60 ? 60.813 33.335 7.574  1.00 98.82  ? 82  TYR A CE2 1 
ATOM   433  C CZ  . TYR A 1 60 ? 60.872 32.230 6.733  1.00 98.82  ? 82  TYR A CZ  1 
ATOM   434  O OH  . TYR A 1 60 ? 61.072 32.403 5.383  1.00 98.82  ? 82  TYR A OH  1 
ATOM   435  N N   . PRO A 1 61 ? 58.017 33.305 12.253 1.00 57.61  ? 83  PRO A N   1 
ATOM   436  C CA  . PRO A 1 61 ? 57.085 34.428 12.146 1.00 57.61  ? 83  PRO A CA  1 
ATOM   437  C C   . PRO A 1 61 ? 57.538 35.516 11.173 1.00 57.61  ? 83  PRO A C   1 
ATOM   438  O O   . PRO A 1 61 ? 58.731 35.699 10.924 1.00 57.61  ? 83  PRO A O   1 
ATOM   439  C CB  . PRO A 1 61 ? 56.987 34.942 13.577 1.00 90.41  ? 83  PRO A CB  1 
ATOM   440  C CG  . PRO A 1 61 ? 58.313 34.626 14.164 1.00 90.41  ? 83  PRO A CG  1 
ATOM   441  C CD  . PRO A 1 61 ? 58.814 33.370 13.489 1.00 90.41  ? 83  PRO A CD  1 
ATOM   442  N N   . VAL A 1 62 ? 56.559 36.225 10.622 1.00 83.59  ? 84  VAL A N   1 
ATOM   443  C CA  . VAL A 1 62 ? 56.805 37.312 9.686  1.00 83.59  ? 84  VAL A CA  1 
ATOM   444  C C   . VAL A 1 62 ? 56.051 38.526 10.194 1.00 83.59  ? 84  VAL A C   1 
ATOM   445  O O   . VAL A 1 62 ? 56.279 39.648 9.749  1.00 83.59  ? 84  VAL A O   1 
ATOM   446  C CB  . VAL A 1 62 ? 56.291 36.982 8.279  1.00 51.98  ? 84  VAL A CB  1 
ATOM   447  C CG1 . VAL A 1 62 ? 57.109 37.742 7.248  1.00 51.98  ? 84  VAL A CG1 1 
ATOM   448  C CG2 . VAL A 1 62 ? 56.362 35.484 8.034  1.00 51.98  ? 84  VAL A CG2 1 
ATOM   449  N N   . THR A 1 63 ? 55.133 38.279 11.121 1.00 97.15  ? 85  THR A N   1 
ATOM   450  C CA  . THR A 1 63 ? 54.349 39.336 11.731 1.00 97.15  ? 85  THR A CA  1 
ATOM   451  C C   . THR A 1 63 ? 55.264 40.008 12.745 1.00 97.15  ? 85  THR A C   1 
ATOM   452  O O   . THR A 1 63 ? 55.951 39.320 13.501 1.00 97.15  ? 85  THR A O   1 
ATOM   453  C CB  . THR A 1 63 ? 53.149 38.770 12.497 1.00 65.33  ? 85  THR A CB  1 
ATOM   454  O OG1 . THR A 1 63 ? 52.612 37.643 11.796 1.00 65.33  ? 85  THR A OG1 1 
ATOM   455  C CG2 . THR A 1 63 ? 52.082 39.847 12.670 1.00 65.33  ? 85  THR A CG2 1 
ATOM   456  N N   . LEU A 1 64 ? 55.281 41.336 12.771 1.00 116.13 ? 86  LEU A N   1 
ATOM   457  C CA  . LEU A 1 64 ? 56.134 42.037 13.726 1.00 116.13 ? 86  LEU A CA  1 
ATOM   458  C C   . LEU A 1 64 ? 55.936 41.426 15.107 1.00 116.13 ? 86  LEU A C   1 
ATOM   459  O O   . LEU A 1 64 ? 56.899 41.085 15.794 1.00 116.13 ? 86  LEU A O   1 
ATOM   460  C CB  . LEU A 1 64 ? 55.793 43.527 13.762 1.00 182.23 ? 86  LEU A CB  1 
ATOM   461  C CG  . LEU A 1 64 ? 56.852 44.408 14.433 1.00 182.23 ? 86  LEU A CG  1 
ATOM   462  C CD1 . LEU A 1 64 ? 58.131 44.392 13.605 1.00 182.23 ? 86  LEU A CD1 1 
ATOM   463  C CD2 . LEU A 1 64 ? 56.324 45.827 14.583 1.00 182.23 ? 86  LEU A CD2 1 
ATOM   464  N N   . TRP A 1 65 ? 54.674 41.281 15.499 1.00 70.70  ? 87  TRP A N   1 
ATOM   465  C CA  . TRP A 1 65 ? 54.323 40.698 16.786 1.00 70.70  ? 87  TRP A CA  1 
ATOM   466  C C   . TRP A 1 65 ? 54.784 39.244 16.835 1.00 70.70  ? 87  TRP A C   1 
ATOM   467  O O   . TRP A 1 65 ? 55.494 38.831 17.753 1.00 70.70  ? 87  TRP A O   1 
ATOM   468  C CB  . TRP A 1 65 ? 52.809 40.774 16.999 1.00 203.73 ? 87  TRP A CB  1 
ATOM   469  C CG  . TRP A 1 65 ? 52.365 41.967 17.796 1.00 203.73 ? 87  TRP A CG  1 
ATOM   470  C CD1 . TRP A 1 65 ? 51.275 42.044 18.614 1.00 203.73 ? 87  TRP A CD1 1 
ATOM   471  C CD2 . TRP A 1 65 ? 53.005 43.251 17.857 1.00 203.73 ? 87  TRP A CD2 1 
ATOM   472  N NE1 . TRP A 1 65 ? 51.196 43.293 19.182 1.00 203.73 ? 87  TRP A NE1 1 
ATOM   473  C CE2 . TRP A 1 65 ? 52.244 44.054 18.735 1.00 203.73 ? 87  TRP A CE2 1 
ATOM   474  C CE3 . TRP A 1 65 ? 54.147 43.801 17.256 1.00 203.73 ? 87  TRP A CE3 1 
ATOM   475  C CZ2 . TRP A 1 65 ? 52.589 45.379 19.028 1.00 203.73 ? 87  TRP A CZ2 1 
ATOM   476  C CZ3 . TRP A 1 65 ? 54.490 45.120 17.548 1.00 203.73 ? 87  TRP A CZ3 1 
ATOM   477  C CH2 . TRP A 1 65 ? 53.712 45.892 18.427 1.00 203.73 ? 87  TRP A CH2 1 
ATOM   478  N N   . GLY A 1 66 ? 54.373 38.470 15.841 1.00 60.44  ? 88  GLY A N   1 
ATOM   479  C CA  . GLY A 1 66 ? 54.765 37.079 15.792 1.00 60.44  ? 88  GLY A CA  1 
ATOM   480  C C   . GLY A 1 66 ? 56.248 36.932 16.045 1.00 60.44  ? 88  GLY A C   1 
ATOM   481  O O   . GLY A 1 66 ? 56.681 35.920 16.592 1.00 60.44  ? 88  GLY A O   1 
ATOM   482  N N   . ARG A 1 67 ? 57.024 37.942 15.650 1.00 65.64  ? 89  ARG A N   1 
ATOM   483  C CA  . ARG A 1 67 ? 58.475 37.923 15.844 1.00 65.64  ? 89  ARG A CA  1 
ATOM   484  C C   . ARG A 1 67 ? 58.798 38.149 17.314 1.00 65.64  ? 89  ARG A C   1 
ATOM   485  O O   . ARG A 1 67 ? 59.782 37.621 17.838 1.00 65.64  ? 89  ARG A O   1 
ATOM   486  C CB  . ARG A 1 67 ? 59.147 39.002 14.991 1.00 90.50  ? 89  ARG A CB  1 
ATOM   487  C CG  . ARG A 1 67 ? 58.843 38.879 13.508 1.00 90.50  ? 89  ARG A CG  1 
ATOM   488  C CD  . ARG A 1 67 ? 60.087 39.045 12.649 1.00 90.50  ? 89  ARG A CD  1 
ATOM   489  N NE  . ARG A 1 67 ? 60.058 38.169 11.479 1.00 90.50  ? 89  ARG A NE  1 
ATOM   490  C CZ  . ARG A 1 67 ? 60.420 38.539 10.255 1.00 90.50  ? 89  ARG A CZ  1 
ATOM   491  N NH1 . ARG A 1 67 ? 60.841 39.777 10.028 1.00 90.50  ? 89  ARG A NH1 1 
ATOM   492  N NH2 . ARG A 1 67 ? 60.359 37.669 9.256  1.00 90.50  ? 89  ARG A NH2 1 
ATOM   493  N N   . CYS A 1 68 ? 57.964 38.940 17.978 1.00 74.86  ? 90  CYS A N   1 
ATOM   494  C CA  . CYS A 1 68 ? 58.160 39.202 19.391 1.00 74.86  ? 90  CYS A CA  1 
ATOM   495  C C   . CYS A 1 68 ? 57.989 37.876 20.099 1.00 74.86  ? 90  CYS A C   1 
ATOM   496  O O   . CYS A 1 68 ? 58.913 37.386 20.748 1.00 74.86  ? 90  CYS A O   1 
ATOM   497  C CB  . CYS A 1 68 ? 57.128 40.203 19.903 1.00 123.86 ? 90  CYS A CB  1 
ATOM   498  S SG  . CYS A 1 68 ? 57.713 41.913 19.892 1.00 123.86 ? 90  CYS A SG  1 
ATOM   499  N N   . VAL A 1 69 ? 56.803 37.293 19.952 1.00 56.74  ? 91  VAL A N   1 
ATOM   500  C CA  . VAL A 1 69 ? 56.504 36.006 20.565 1.00 56.74  ? 91  VAL A CA  1 
ATOM   501  C C   . VAL A 1 69 ? 57.678 35.042 20.362 1.00 56.74  ? 91  VAL A C   1 
ATOM   502  O O   . VAL A 1 69 ? 57.974 34.205 21.227 1.00 56.74  ? 91  VAL A O   1 
ATOM   503  C CB  . VAL A 1 69 ? 55.222 35.393 19.963 1.00 45.28  ? 91  VAL A CB  1 
ATOM   504  C CG1 . VAL A 1 69 ? 54.915 34.046 20.616 1.00 45.28  ? 91  VAL A CG1 1 
ATOM   505  C CG2 . VAL A 1 69 ? 54.065 36.348 20.159 1.00 45.28  ? 91  VAL A CG2 1 
ATOM   506  N N   . ALA A 1 70 ? 58.352 35.165 19.221 1.00 46.96  ? 92  ALA A N   1 
ATOM   507  C CA  . ALA A 1 70 ? 59.496 34.315 18.937 1.00 46.96  ? 92  ALA A CA  1 
ATOM   508  C C   . ALA A 1 70 ? 60.585 34.606 19.974 1.00 46.96  ? 92  ALA A C   1 
ATOM   509  O O   . ALA A 1 70 ? 61.019 33.713 20.712 1.00 46.96  ? 92  ALA A O   1 
ATOM   510  C CB  . ALA A 1 70 ? 60.012 34.585 17.534 1.00 74.35  ? 92  ALA A CB  1 
ATOM   511  N N   . VAL A 1 71 ? 61.013 35.864 20.032 1.00 85.02  ? 93  VAL A N   1 
ATOM   512  C CA  . VAL A 1 71 ? 62.045 36.273 20.976 1.00 85.02  ? 93  VAL A CA  1 
ATOM   513  C C   . VAL A 1 71 ? 61.757 35.678 22.348 1.00 85.02  ? 93  VAL A C   1 
ATOM   514  O O   . VAL A 1 71 ? 62.589 34.980 22.924 1.00 85.02  ? 93  VAL A O   1 
ATOM   515  C CB  . VAL A 1 71 ? 62.112 37.811 21.096 1.00 71.94  ? 93  VAL A CB  1 
ATOM   516  C CG1 . VAL A 1 71 ? 62.482 38.214 22.514 1.00 71.94  ? 93  VAL A CG1 1 
ATOM   517  C CG2 . VAL A 1 71 ? 63.133 38.359 20.117 1.00 71.94  ? 93  VAL A CG2 1 
ATOM   518  N N   . VAL A 1 72 ? 60.569 35.958 22.865 1.00 50.56  ? 94  VAL A N   1 
ATOM   519  C CA  . VAL A 1 72 ? 60.175 35.441 24.161 1.00 50.56  ? 94  VAL A CA  1 
ATOM   520  C C   . VAL A 1 72 ? 60.388 33.938 24.236 1.00 50.56  ? 94  VAL A C   1 
ATOM   521  O O   . VAL A 1 72 ? 61.208 33.461 25.017 1.00 50.56  ? 94  VAL A O   1 
ATOM   522  C CB  . VAL A 1 72 ? 58.699 35.733 24.446 1.00 50.02  ? 94  VAL A CB  1 
ATOM   523  C CG1 . VAL A 1 72 ? 58.155 34.739 25.473 1.00 50.02  ? 94  VAL A CG1 1 
ATOM   524  C CG2 . VAL A 1 72 ? 58.546 37.163 24.931 1.00 50.02  ? 94  VAL A CG2 1 
ATOM   525  N N   . VAL A 1 73 ? 59.648 33.191 23.424 1.00 74.97  ? 95  VAL A N   1 
ATOM   526  C CA  . VAL A 1 73 ? 59.767 31.741 23.435 1.00 74.97  ? 95  VAL A CA  1 
ATOM   527  C C   . VAL A 1 73 ? 61.220 31.302 23.268 1.00 74.97  ? 95  VAL A C   1 
ATOM   528  O O   . VAL A 1 73 ? 61.561 30.146 23.516 1.00 74.97  ? 95  VAL A O   1 
ATOM   529  C CB  . VAL A 1 73 ? 58.910 31.104 22.329 1.00 39.35  ? 95  VAL A CB  1 
ATOM   530  C CG1 . VAL A 1 73 ? 59.398 31.565 20.987 1.00 39.35  ? 95  VAL A CG1 1 
ATOM   531  C CG2 . VAL A 1 73 ? 58.966 29.581 22.428 1.00 39.35  ? 95  VAL A CG2 1 
ATOM   532  N N   . MET A 1 74 ? 62.076 32.226 22.850 1.00 80.33  ? 96  MET A N   1 
ATOM   533  C CA  . MET A 1 74 ? 63.480 31.900 22.684 1.00 80.33  ? 96  MET A CA  1 
ATOM   534  C C   . MET A 1 74 ? 64.187 31.938 24.024 1.00 80.33  ? 96  MET A C   1 
ATOM   535  O O   . MET A 1 74 ? 64.628 30.904 24.512 1.00 80.33  ? 96  MET A O   1 
ATOM   536  C CB  . MET A 1 74 ? 64.156 32.873 21.737 1.00 87.14  ? 96  MET A CB  1 
ATOM   537  C CG  . MET A 1 74 ? 64.572 32.244 20.439 1.00 87.14  ? 96  MET A CG  1 
ATOM   538  S SD  . MET A 1 74 ? 64.158 33.359 19.117 1.00 87.14  ? 96  MET A SD  1 
ATOM   539  C CE  . MET A 1 74 ? 65.746 33.660 18.387 1.00 87.14  ? 96  MET A CE  1 
ATOM   540  N N   . VAL A 1 75 ? 64.297 33.120 24.626 1.00 79.79  ? 97  VAL A N   1 
ATOM   541  C CA  . VAL A 1 75 ? 64.966 33.235 25.921 1.00 79.79  ? 97  VAL A CA  1 
ATOM   542  C C   . VAL A 1 75 ? 64.437 32.173 26.872 1.00 79.79  ? 97  VAL A C   1 
ATOM   543  O O   . VAL A 1 75 ? 65.208 31.478 27.527 1.00 79.79  ? 97  VAL A O   1 
ATOM   544  C CB  . VAL A 1 75 ? 64.780 34.641 26.554 1.00 72.70  ? 97  VAL A CB  1 
ATOM   545  C CG1 . VAL A 1 75 ? 64.706 35.683 25.461 1.00 72.70  ? 97  VAL A CG1 1 
ATOM   546  C CG2 . VAL A 1 75 ? 63.534 34.688 27.430 1.00 72.70  ? 97  VAL A CG2 1 
ATOM   547  N N   . ALA A 1 76 ? 63.117 32.043 26.930 1.00 43.54  ? 98  ALA A N   1 
ATOM   548  C CA  . ALA A 1 76 ? 62.486 31.051 27.782 1.00 43.54  ? 98  ALA A CA  1 
ATOM   549  C C   . ALA A 1 76 ? 63.308 29.777 27.729 1.00 43.54  ? 98  ALA A C   1 
ATOM   550  O O   . ALA A 1 76 ? 63.575 29.158 28.750 1.00 43.54  ? 98  ALA A O   1 
ATOM   551  C CB  . ALA A 1 76 ? 61.077 30.774 27.301 1.00 28.38  ? 98  ALA A CB  1 
ATOM   552  N N   . GLY A 1 77 ? 63.718 29.397 26.527 1.00 51.00  ? 99  GLY A N   1 
ATOM   553  C CA  . GLY A 1 77 ? 64.513 28.195 26.369 1.00 51.00  ? 99  GLY A CA  1 
ATOM   554  C C   . GLY A 1 77 ? 65.968 28.360 26.782 1.00 51.00  ? 99  GLY A C   1 
ATOM   555  O O   . GLY A 1 77 ? 66.489 27.553 27.556 1.00 51.00  ? 99  GLY A O   1 
ATOM   556  N N   . ILE A 1 78 ? 66.634 29.389 26.264 1.00 85.20  ? 100 ILE A N   1 
ATOM   557  C CA  . ILE A 1 78 ? 68.038 29.624 26.594 1.00 85.20  ? 100 ILE A CA  1 
ATOM   558  C C   . ILE A 1 78 ? 68.161 29.695 28.101 1.00 85.20  ? 100 ILE A C   1 
ATOM   559  O O   . ILE A 1 78 ? 69.153 29.258 28.684 1.00 85.20  ? 100 ILE A O   1 
ATOM   560  C CB  . ILE A 1 78 ? 68.556 30.964 26.021 1.00 93.59  ? 100 ILE A CB  1 
ATOM   561  C CG1 . ILE A 1 78 ? 68.080 31.149 24.581 1.00 93.59  ? 100 ILE A CG1 1 
ATOM   562  C CG2 . ILE A 1 78 ? 70.074 30.999 26.074 1.00 93.59  ? 100 ILE A CG2 1 
ATOM   563  C CD1 . ILE A 1 78 ? 68.403 32.514 24.012 1.00 93.59  ? 100 ILE A CD1 1 
ATOM   564  N N   . THR A 1 79 ? 67.124 30.247 28.717 1.00 55.74  ? 101 THR A N   1 
ATOM   565  C CA  . THR A 1 79 ? 67.063 30.428 30.154 1.00 55.74  ? 101 THR A CA  1 
ATOM   566  C C   . THR A 1 79 ? 66.576 29.180 30.885 1.00 55.74  ? 101 THR A C   1 
ATOM   567  O O   . THR A 1 79 ? 67.325 28.582 31.649 1.00 55.74  ? 101 THR A O   1 
ATOM   568  C CB  . THR A 1 79 ? 66.166 31.636 30.473 1.00 73.96  ? 101 THR A CB  1 
ATOM   569  O OG1 . THR A 1 79 ? 66.984 32.811 30.561 1.00 73.96  ? 101 THR A OG1 1 
ATOM   570  C CG2 . THR A 1 79 ? 65.392 31.424 31.769 1.00 73.96  ? 101 THR A CG2 1 
ATOM   571  N N   . SER A 1 80 ? 65.332 28.783 30.653 1.00 79.05  ? 102 SER A N   1 
ATOM   572  C CA  . SER A 1 80 ? 64.803 27.599 31.316 1.00 79.05  ? 102 SER A CA  1 
ATOM   573  C C   . SER A 1 80 ? 65.825 26.463 31.320 1.00 79.05  ? 102 SER A C   1 
ATOM   574  O O   . SER A 1 80 ? 65.906 25.692 32.277 1.00 79.05  ? 102 SER A O   1 
ATOM   575  C CB  . SER A 1 80 ? 63.521 27.122 30.626 1.00 133.82 ? 102 SER A CB  1 
ATOM   576  O OG  . SER A 1 80 ? 63.582 25.734 30.332 1.00 133.82 ? 102 SER A OG  1 
ATOM   577  N N   . PHE A 1 81 ? 66.610 26.361 30.253 1.00 81.62  ? 103 PHE A N   1 
ATOM   578  C CA  . PHE A 1 81 ? 67.606 25.304 30.170 1.00 81.62  ? 103 PHE A CA  1 
ATOM   579  C C   . PHE A 1 81 ? 68.870 25.651 30.932 1.00 81.62  ? 103 PHE A C   1 
ATOM   580  O O   . PHE A 1 81 ? 69.535 24.769 31.471 1.00 81.62  ? 103 PHE A O   1 
ATOM   581  C CB  . PHE A 1 81 ? 67.929 25.002 28.711 1.00 63.20  ? 103 PHE A CB  1 
ATOM   582  C CG  . PHE A 1 81 ? 67.093 23.903 28.138 1.00 63.20  ? 103 PHE A CG  1 
ATOM   583  C CD1 . PHE A 1 81 ? 67.231 22.597 28.602 1.00 63.20  ? 103 PHE A CD1 1 
ATOM   584  C CD2 . PHE A 1 81 ? 66.143 24.172 27.167 1.00 63.20  ? 103 PHE A CD2 1 
ATOM   585  C CE1 . PHE A 1 81 ? 66.431 21.575 28.109 1.00 63.20  ? 103 PHE A CE1 1 
ATOM   586  C CE2 . PHE A 1 81 ? 65.339 23.159 26.666 1.00 63.20  ? 103 PHE A CE2 1 
ATOM   587  C CZ  . PHE A 1 81 ? 65.483 21.855 27.140 1.00 63.20  ? 103 PHE A CZ  1 
ATOM   588  N N   . GLY A 1 82 ? 69.194 26.938 30.980 1.00 93.93  ? 104 GLY A N   1 
ATOM   589  C CA  . GLY A 1 82 ? 70.379 27.374 31.697 1.00 93.93  ? 104 GLY A CA  1 
ATOM   590  C C   . GLY A 1 82 ? 70.342 26.929 33.144 1.00 93.93  ? 104 GLY A C   1 
ATOM   591  O O   . GLY A 1 82 ? 71.313 26.376 33.663 1.00 93.93  ? 104 GLY A O   1 
ATOM   592  N N   . LEU A 1 83 ? 69.214 27.173 33.800 1.00 61.64  ? 105 LEU A N   1 
ATOM   593  C CA  . LEU A 1 83 ? 69.047 26.781 35.187 1.00 61.64  ? 105 LEU A CA  1 
ATOM   594  C C   . LEU A 1 83 ? 69.428 25.317 35.353 1.00 61.64  ? 105 LEU A C   1 
ATOM   595  O O   . LEU A 1 83 ? 70.267 24.979 36.185 1.00 61.64  ? 105 LEU A O   1 
ATOM   596  C CB  . LEU A 1 83 ? 67.601 26.989 35.619 1.00 93.93  ? 105 LEU A CB  1 
ATOM   597  C CG  . LEU A 1 83 ? 67.352 28.273 36.406 1.00 93.93  ? 105 LEU A CG  1 
ATOM   598  C CD1 . LEU A 1 83 ? 66.681 29.304 35.514 1.00 93.93  ? 105 LEU A CD1 1 
ATOM   599  C CD2 . LEU A 1 83 ? 66.488 27.960 37.613 1.00 93.93  ? 105 LEU A CD2 1 
ATOM   600  N N   . VAL A 1 84 ? 68.814 24.451 34.553 1.00 46.85  ? 106 VAL A N   1 
ATOM   601  C CA  . VAL A 1 84 ? 69.102 23.024 34.623 1.00 46.85  ? 106 VAL A CA  1 
ATOM   602  C C   . VAL A 1 84 ? 70.602 22.778 34.576 1.00 46.85  ? 106 VAL A C   1 
ATOM   603  O O   . VAL A 1 84 ? 71.103 21.840 35.195 1.00 46.85  ? 106 VAL A O   1 
ATOM   604  C CB  . VAL A 1 84 ? 68.442 22.255 33.465 1.00 44.63  ? 106 VAL A CB  1 
ATOM   605  C CG1 . VAL A 1 84 ? 68.797 20.771 33.548 1.00 44.63  ? 106 VAL A CG1 1 
ATOM   606  C CG2 . VAL A 1 84 ? 66.935 22.450 33.511 1.00 44.63  ? 106 VAL A CG2 1 
ATOM   607  N N   . THR A 1 85 ? 71.321 23.612 33.836 1.00 75.47  ? 107 THR A N   1 
ATOM   608  C CA  . THR A 1 85 ? 72.763 23.453 33.760 1.00 75.47  ? 107 THR A CA  1 
ATOM   609  C C   . THR A 1 85 ? 73.329 23.945 35.074 1.00 75.47  ? 107 THR A C   1 
ATOM   610  O O   . THR A 1 85 ? 74.237 23.332 35.634 1.00 75.47  ? 107 THR A O   1 
ATOM   611  C CB  . THR A 1 85 ? 73.375 24.273 32.613 1.00 115.17 ? 107 THR A CB  1 
ATOM   612  O OG1 . THR A 1 85 ? 73.632 23.404 31.506 1.00 115.17 ? 107 THR A OG1 1 
ATOM   613  C CG2 . THR A 1 85 ? 74.690 24.916 33.039 1.00 115.17 ? 107 THR A CG2 1 
ATOM   614  N N   . ALA A 1 86 ? 72.784 25.058 35.560 1.00 84.84  ? 108 ALA A N   1 
ATOM   615  C CA  . ALA A 1 86 ? 73.224 25.639 36.824 1.00 84.84  ? 108 ALA A CA  1 
ATOM   616  C C   . ALA A 1 86 ? 73.062 24.575 37.889 1.00 84.84  ? 108 ALA A C   1 
ATOM   617  O O   . ALA A 1 86 ? 74.015 24.221 38.580 1.00 84.84  ? 108 ALA A O   1 
ATOM   618  C CB  . ALA A 1 86 ? 72.381 26.855 37.165 1.00 60.16  ? 108 ALA A CB  1 
ATOM   619  N N   . ALA A 1 87 ? 71.842 24.065 38.004 1.00 66.90  ? 109 ALA A N   1 
ATOM   620  C CA  . ALA A 1 87 ? 71.536 23.024 38.967 1.00 66.90  ? 109 ALA A CA  1 
ATOM   621  C C   . ALA A 1 87 ? 72.652 21.993 38.953 1.00 66.90  ? 109 ALA A C   1 
ATOM   622  O O   . ALA A 1 87 ? 73.287 21.734 39.969 1.00 66.90  ? 109 ALA A O   1 
ATOM   623  C CB  . ALA A 1 87 ? 70.220 22.360 38.609 1.00 31.90  ? 109 ALA A CB  1 
ATOM   624  N N   . LEU A 1 88 ? 72.896 21.417 37.785 1.00 62.93  ? 110 LEU A N   1 
ATOM   625  C CA  . LEU A 1 88 ? 73.932 20.404 37.639 1.00 62.93  ? 110 LEU A CA  1 
ATOM   626  C C   . LEU A 1 88 ? 75.341 20.900 37.978 1.00 62.93  ? 110 LEU A C   1 
ATOM   627  O O   . LEU A 1 88 ? 76.153 20.149 38.519 1.00 62.93  ? 110 LEU A O   1 
ATOM   628  C CB  . LEU A 1 88 ? 73.910 19.853 36.213 1.00 86.41  ? 110 LEU A CB  1 
ATOM   629  C CG  . LEU A 1 88 ? 72.952 18.691 35.952 1.00 86.41  ? 110 LEU A CG  1 
ATOM   630  C CD1 . LEU A 1 88 ? 71.514 19.135 36.181 1.00 86.41  ? 110 LEU A CD1 1 
ATOM   631  C CD2 . LEU A 1 88 ? 73.146 18.198 34.527 1.00 86.41  ? 110 LEU A CD2 1 
ATOM   632  N N   . ALA A 1 89 ? 75.632 22.158 37.658 1.00 102.69 ? 111 ALA A N   1 
ATOM   633  C CA  . ALA A 1 89 ? 76.949 22.723 37.925 1.00 102.69 ? 111 ALA A CA  1 
ATOM   634  C C   . ALA A 1 89 ? 77.271 22.718 39.408 1.00 102.69 ? 111 ALA A C   1 
ATOM   635  O O   . ALA A 1 89 ? 78.423 22.546 39.792 1.00 102.69 ? 111 ALA A O   1 
ATOM   636  C CB  . ALA A 1 89 ? 77.035 24.140 37.387 1.00 71.13  ? 111 ALA A CB  1 
ATOM   637  N N   . THR A 1 90 ? 76.255 22.909 40.243 1.00 140.03 ? 112 THR A N   1 
ATOM   638  C CA  . THR A 1 90 ? 76.458 22.927 41.688 1.00 140.03 ? 112 THR A CA  1 
ATOM   639  C C   . THR A 1 90 ? 76.404 21.526 42.286 1.00 140.03 ? 112 THR A C   1 
ATOM   640  O O   . THR A 1 90 ? 77.173 21.200 43.188 1.00 140.03 ? 112 THR A O   1 
ATOM   641  C CB  . THR A 1 90 ? 75.407 23.802 42.395 1.00 67.34  ? 112 THR A CB  1 
ATOM   642  O OG1 . THR A 1 90 ? 74.367 22.976 42.922 1.00 67.34  ? 112 THR A OG1 1 
ATOM   643  C CG2 . THR A 1 90 ? 74.803 24.800 41.430 1.00 67.34  ? 112 THR A CG2 1 
ATOM   644  N N   . TRP A 1 91 ? 75.493 20.699 41.783 1.00 96.78  ? 113 TRP A N   1 
ATOM   645  C CA  . TRP A 1 91 ? 75.341 19.332 42.274 1.00 96.78  ? 113 TRP A CA  1 
ATOM   646  C C   . TRP A 1 91 ? 76.612 18.535 41.999 1.00 96.78  ? 113 TRP A C   1 
ATOM   647  O O   . TRP A 1 91 ? 76.715 17.355 42.337 1.00 96.78  ? 113 TRP A O   1 
ATOM   648  C CB  . TRP A 1 91 ? 74.141 18.663 41.597 1.00 183.49 ? 113 TRP A CB  1 
ATOM   649  C CG  . TRP A 1 91 ? 73.896 17.252 42.036 1.00 183.49 ? 113 TRP A CG  1 
ATOM   650  C CD1 . TRP A 1 91 ? 73.402 16.829 43.237 1.00 183.49 ? 113 TRP A CD1 1 
ATOM   651  C CD2 . TRP A 1 91 ? 74.126 16.069 41.257 1.00 183.49 ? 113 TRP A CD2 1 
ATOM   652  N NE1 . TRP A 1 91 ? 73.309 15.454 43.251 1.00 183.49 ? 113 TRP A NE1 1 
ATOM   653  C CE2 . TRP A 1 91 ? 73.745 14.962 42.051 1.00 183.49 ? 113 TRP A CE2 1 
ATOM   654  C CE3 . TRP A 1 91 ? 74.618 15.844 39.963 1.00 183.49 ? 113 TRP A CE3 1 
ATOM   655  C CZ2 . TRP A 1 91 ? 73.838 13.653 41.594 1.00 183.49 ? 113 TRP A CZ2 1 
ATOM   656  C CZ3 . TRP A 1 91 ? 74.710 14.536 39.509 1.00 183.49 ? 113 TRP A CZ3 1 
ATOM   657  C CH2 . TRP A 1 91 ? 74.322 13.457 40.320 1.00 183.49 ? 113 TRP A CH2 1 
ATOM   658  N N   . PHE A 1 92 ? 77.577 19.197 41.370 1.00 111.31 ? 114 PHE A N   1 
ATOM   659  C CA  . PHE A 1 92 ? 78.860 18.583 41.068 1.00 111.31 ? 114 PHE A CA  1 
ATOM   660  C C   . PHE A 1 92 ? 79.878 19.201 42.014 1.00 111.31 ? 114 PHE A C   1 
ATOM   661  O O   . PHE A 1 92 ? 80.970 18.676 42.202 1.00 111.31 ? 114 PHE A O   1 
ATOM   662  C CB  . PHE A 1 92 ? 79.242 18.840 39.610 1.00 127.13 ? 114 PHE A CB  1 
ATOM   663  C CG  . PHE A 1 92 ? 78.821 17.742 38.678 1.00 127.13 ? 114 PHE A CG  1 
ATOM   664  C CD1 . PHE A 1 92 ? 78.106 16.649 39.158 1.00 127.13 ? 114 PHE A CD1 1 
ATOM   665  C CD2 . PHE A 1 92 ? 79.134 17.797 37.327 1.00 127.13 ? 114 PHE A CD2 1 
ATOM   666  C CE1 . PHE A 1 92 ? 77.708 15.625 38.307 1.00 127.13 ? 114 PHE A CE1 1 
ATOM   667  C CE2 . PHE A 1 92 ? 78.739 16.774 36.465 1.00 127.13 ? 114 PHE A CE2 1 
ATOM   668  C CZ  . PHE A 1 92 ? 78.023 15.685 36.959 1.00 127.13 ? 114 PHE A CZ  1 
ATOM   669  N N   . VAL A 1 93 ? 79.487 20.325 42.608 1.00 156.63 ? 115 VAL A N   1 
ATOM   670  C CA  . VAL A 1 93 ? 80.311 21.036 43.572 1.00 156.63 ? 115 VAL A CA  1 
ATOM   671  C C   . VAL A 1 93 ? 79.885 20.509 44.946 1.00 156.63 ? 115 VAL A C   1 
ATOM   672  O O   . VAL A 1 93 ? 80.652 20.543 45.909 1.00 156.63 ? 115 VAL A O   1 
ATOM   673  C CB  . VAL A 1 93 ? 80.078 22.565 43.465 1.00 101.11 ? 115 VAL A CB  1 
ATOM   674  C CG1 . VAL A 1 93 ? 80.438 23.265 44.764 1.00 101.11 ? 115 VAL A CG1 1 
ATOM   675  C CG2 . VAL A 1 93 ? 80.894 23.140 42.324 1.00 101.11 ? 115 VAL A CG2 1 
ATOM   676  N N   . GLY A 1 94 ? 78.651 20.005 45.017 1.00 125.69 ? 116 GLY A N   1 
ATOM   677  C CA  . GLY A 1 94 ? 78.120 19.447 46.253 1.00 125.69 ? 116 GLY A CA  1 
ATOM   678  C C   . GLY A 1 94 ? 78.794 18.119 46.529 1.00 125.69 ? 116 GLY A C   1 
ATOM   679  O O   . GLY A 1 94 ? 78.229 17.209 47.136 1.00 125.69 ? 116 GLY A O   1 
ATOM   680  N N   . ARG A 1 95 ? 80.021 18.024 46.038 1.00 105.62 ? 117 ARG A N   1 
ATOM   681  C CA  . ARG A 1 95 ? 80.868 16.858 46.197 1.00 105.62 ? 117 ARG A CA  1 
ATOM   682  C C   . ARG A 1 95 ? 82.278 17.422 46.344 1.00 105.62 ? 117 ARG A C   1 
ATOM   683  O O   . ARG A 1 95 ? 83.212 17.036 45.633 1.00 105.62 ? 117 ARG A O   1 
ATOM   684  C CB  . ARG A 1 95 ? 80.771 15.951 44.971 1.00 119.24 ? 117 ARG A CB  1 
ATOM   685  C CG  . ARG A 1 95 ? 79.702 14.881 45.089 1.00 119.24 ? 117 ARG A CG  1 
ATOM   686  C CD  . ARG A 1 95 ? 80.250 13.636 45.758 1.00 119.24 ? 117 ARG A CD  1 
ATOM   687  N NE  . ARG A 1 95 ? 79.211 12.635 45.974 1.00 119.24 ? 117 ARG A NE  1 
ATOM   688  N N   . GLU A 1 96 ? 82.394 18.373 47.269 1.00 217.48 ? 118 GLU A N   1 
ATOM   689  C CA  . GLU A 1 96 ? 83.648 19.046 47.584 1.00 217.48 ? 118 GLU A CA  1 
ATOM   690  C C   . GLU A 1 96 ? 84.121 18.536 48.942 1.00 217.48 ? 118 GLU A C   1 
ATOM   691  O O   . GLU A 1 96 ? 85.295 18.643 49.289 1.00 217.48 ? 118 GLU A O   1 
ATOM   692  C CB  . GLU A 1 96 ? 83.432 20.561 47.654 1.00 177.38 ? 118 GLU A CB  1 
ATOM   693  C CG  . GLU A 1 96 ? 82.557 21.009 48.824 1.00 177.38 ? 118 GLU A CG  1 
ATOM   694  C CD  . GLU A 1 96 ? 82.516 22.520 48.995 1.00 177.38 ? 118 GLU A CD  1 
ATOM   695  O OE1 . GLU A 1 96 ? 83.371 23.218 48.407 1.00 177.38 ? 118 GLU A OE1 1 
ATOM   696  O OE2 . GLU A 1 96 ? 81.624 23.010 49.721 1.00 177.38 ? 118 GLU A OE2 1 
ATOM   697  N N   . GLN A 1 97 ? 83.182 17.988 49.703 1.00 179.95 ? 119 GLN A N   1 
ATOM   698  C CA  . GLN A 1 97 ? 83.461 17.447 51.021 1.00 179.95 ? 119 GLN A CA  1 
ATOM   699  C C   . GLN A 1 97 ? 84.405 16.242 50.910 1.00 179.95 ? 119 GLN A C   1 
ATOM   700  O O   . GLN A 1 97 ? 85.329 16.137 51.746 1.00 179.95 ? 119 GLN A O   1 
ATOM   701  C CB  . GLN A 1 97 ? 82.142 17.027 51.675 1.00 193.75 ? 119 GLN A CB  1 
ATOM   702  C CG  . GLN A 1 97 ? 81.682 15.718 51.082 1.00 193.75 ? 119 GLN A CG  1 
ATOM   703  C CD  . GLN A 1 97 ? 80.206 15.615 50.787 1.00 193.75 ? 119 GLN A CD  1 
ATOM   704  O OE1 . GLN A 1 97 ? 79.595 14.626 51.132 1.00 193.75 ? 119 GLN A OE1 1 
ATOM   705  N NE2 . GLN A 1 97 ? 79.635 16.611 50.129 1.00 193.75 ? 119 GLN A NE2 1 
ATOM   706  N N   . ALA B 1 1  ? 85.298 9.520  40.592 1.00 173.57 ? 23  ALA B N   1 
ATOM   707  C CA  . ALA B 1 1  ? 84.639 10.739 41.145 1.00 173.57 ? 23  ALA B CA  1 
ATOM   708  C C   . ALA B 1 1  ? 83.162 10.775 40.768 1.00 173.57 ? 23  ALA B C   1 
ATOM   709  O O   . ALA B 1 1  ? 82.400 9.868  41.107 1.00 173.57 ? 23  ALA B O   1 
ATOM   710  C CB  . ALA B 1 1  ? 85.344 11.988 40.624 1.00 82.33  ? 23  ALA B CB  1 
ATOM   711  N N   . LEU B 1 2  ? 82.767 11.834 40.067 1.00 159.27 ? 24  LEU B N   1 
ATOM   712  C CA  . LEU B 1 2  ? 81.389 12.008 39.623 1.00 159.27 ? 24  LEU B CA  1 
ATOM   713  C C   . LEU B 1 2  ? 81.316 13.119 38.582 1.00 159.27 ? 24  LEU B C   1 
ATOM   714  O O   . LEU B 1 2  ? 81.114 12.866 37.397 1.00 159.27 ? 24  LEU B O   1 
ATOM   715  C CB  . LEU B 1 2  ? 80.490 12.359 40.807 1.00 123.64 ? 24  LEU B CB  1 
ATOM   716  C CG  . LEU B 1 2  ? 79.006 12.519 40.473 1.00 123.64 ? 24  LEU B CG  1 
ATOM   717  C CD1 . LEU B 1 2  ? 78.228 11.336 41.029 1.00 123.64 ? 24  LEU B CD1 1 
ATOM   718  C CD2 . LEU B 1 2  ? 78.488 13.828 41.050 1.00 123.64 ? 24  LEU B CD2 1 
ATOM   719  N N   . HIS B 1 3  ? 81.483 14.353 39.038 1.00 108.17 ? 25  HIS B N   1 
ATOM   720  C CA  . HIS B 1 3  ? 81.442 15.505 38.154 1.00 108.17 ? 25  HIS B CA  1 
ATOM   721  C C   . HIS B 1 3  ? 82.260 15.248 36.898 1.00 108.17 ? 25  HIS B C   1 
ATOM   722  O O   . HIS B 1 3  ? 81.951 15.764 35.831 1.00 108.17 ? 25  HIS B O   1 
ATOM   723  C CB  . HIS B 1 3  ? 81.994 16.736 38.879 1.00 154.23 ? 25  HIS B CB  1 
ATOM   724  C CG  . HIS B 1 3  ? 83.467 16.934 38.696 1.00 154.23 ? 25  HIS B CG  1 
ATOM   725  N ND1 . HIS B 1 3  ? 83.991 17.920 37.888 1.00 154.23 ? 25  HIS B ND1 1 
ATOM   726  C CD2 . HIS B 1 3  ? 84.528 16.265 39.208 1.00 154.23 ? 25  HIS B CD2 1 
ATOM   727  C CE1 . HIS B 1 3  ? 85.311 17.849 37.909 1.00 154.23 ? 25  HIS B CE1 1 
ATOM   728  N NE2 . HIS B 1 3  ? 85.662 16.854 38.702 1.00 154.23 ? 25  HIS B NE2 1 
ATOM   729  N N   . TRP B 1 4  ? 83.299 14.436 37.037 1.00 76.21  ? 26  TRP B N   1 
ATOM   730  C CA  . TRP B 1 4  ? 84.195 14.119 35.931 1.00 76.21  ? 26  TRP B CA  1 
ATOM   731  C C   . TRP B 1 4  ? 83.896 12.762 35.312 1.00 76.21  ? 26  TRP B C   1 
ATOM   732  O O   . TRP B 1 4  ? 84.420 12.434 34.248 1.00 76.21  ? 26  TRP B O   1 
ATOM   733  C CB  . TRP B 1 4  ? 85.643 14.132 36.432 1.00 172.63 ? 26  TRP B CB  1 
ATOM   734  C CG  . TRP B 1 4  ? 86.642 14.742 35.494 1.00 172.63 ? 26  TRP B CG  1 
ATOM   735  C CD1 . TRP B 1 4  ? 87.913 14.302 35.258 1.00 172.63 ? 26  TRP B CD1 1 
ATOM   736  C CD2 . TRP B 1 4  ? 86.472 15.922 34.702 1.00 172.63 ? 26  TRP B CD2 1 
ATOM   737  N NE1 . TRP B 1 4  ? 88.546 15.135 34.370 1.00 172.63 ? 26  TRP B NE1 1 
ATOM   738  C CE2 . TRP B 1 4  ? 87.685 16.138 34.011 1.00 172.63 ? 26  TRP B CE2 1 
ATOM   739  C CE3 . TRP B 1 4  ? 85.414 16.820 34.507 1.00 172.63 ? 26  TRP B CE3 1 
ATOM   740  C CZ2 . TRP B 1 4  ? 87.871 17.216 33.139 1.00 172.63 ? 26  TRP B CZ2 1 
ATOM   741  C CZ3 . TRP B 1 4  ? 85.597 17.893 33.639 1.00 172.63 ? 26  TRP B CZ3 1 
ATOM   742  C CH2 . TRP B 1 4  ? 86.819 18.080 32.967 1.00 172.63 ? 26  TRP B CH2 1 
ATOM   743  N N   . ARG B 1 5  ? 83.063 11.972 35.979 1.00 123.46 ? 27  ARG B N   1 
ATOM   744  C CA  . ARG B 1 5  ? 82.728 10.644 35.482 1.00 123.46 ? 27  ARG B CA  1 
ATOM   745  C C   . ARG B 1 5  ? 81.265 10.520 35.094 1.00 123.46 ? 27  ARG B C   1 
ATOM   746  O O   . ARG B 1 5  ? 80.902 9.652  34.301 1.00 123.46 ? 27  ARG B O   1 
ATOM   747  C CB  . ARG B 1 5  ? 83.065 9.585  36.532 1.00 181.55 ? 27  ARG B CB  1 
ATOM   748  N N   . ALA B 1 6  ? 80.425 11.379 35.660 1.00 152.63 ? 28  ALA B N   1 
ATOM   749  C CA  . ALA B 1 6  ? 79.001 11.361 35.350 1.00 152.63 ? 28  ALA B CA  1 
ATOM   750  C C   . ALA B 1 6  ? 78.814 11.920 33.944 1.00 152.63 ? 28  ALA B C   1 
ATOM   751  O O   . ALA B 1 6  ? 77.767 11.742 33.321 1.00 152.63 ? 28  ALA B O   1 
ATOM   752  C CB  . ALA B 1 6  ? 78.233 12.204 36.360 1.00 169.17 ? 28  ALA B CB  1 
ATOM   753  N N   . ALA B 1 7  ? 79.850 12.596 33.457 1.00 93.54  ? 29  ALA B N   1 
ATOM   754  C CA  . ALA B 1 7  ? 79.845 13.197 32.132 1.00 93.54  ? 29  ALA B CA  1 
ATOM   755  C C   . ALA B 1 7  ? 80.400 12.216 31.107 1.00 93.54  ? 29  ALA B C   1 
ATOM   756  O O   . ALA B 1 7  ? 79.671 11.737 30.239 1.00 93.54  ? 29  ALA B O   1 
ATOM   757  C CB  . ALA B 1 7  ? 80.676 14.475 32.138 1.00 107.23 ? 29  ALA B CB  1 
ATOM   758  N N   . GLY B 1 8  ? 81.693 11.922 31.213 1.00 121.85 ? 30  GLY B N   1 
ATOM   759  C CA  . GLY B 1 8  ? 82.319 10.996 30.289 1.00 121.85 ? 30  GLY B CA  1 
ATOM   760  C C   . GLY B 1 8  ? 81.452 9.783  30.005 1.00 121.85 ? 30  GLY B C   1 
ATOM   761  O O   . GLY B 1 8  ? 81.613 9.129  28.976 1.00 121.85 ? 30  GLY B O   1 
ATOM   762  N N   . ALA B 1 9  ? 80.524 9.482  30.909 1.00 132.44 ? 31  ALA B N   1 
ATOM   763  C CA  . ALA B 1 9  ? 79.645 8.333  30.733 1.00 132.44 ? 31  ALA B CA  1 
ATOM   764  C C   . ALA B 1 9  ? 78.320 8.701  30.088 1.00 132.44 ? 31  ALA B C   1 
ATOM   765  O O   . ALA B 1 9  ? 77.809 7.960  29.248 1.00 132.44 ? 31  ALA B O   1 
ATOM   766  C CB  . ALA B 1 9  ? 79.387 7.662  32.066 1.00 151.29 ? 31  ALA B CB  1 
ATOM   767  N N   . ALA B 1 10 ? 77.760 9.836  30.488 1.00 130.47 ? 32  ALA B N   1 
ATOM   768  C CA  . ALA B 1 10 ? 76.483 10.278 29.947 1.00 130.47 ? 32  ALA B CA  1 
ATOM   769  C C   . ALA B 1 10 ? 76.514 10.317 28.438 1.00 130.47 ? 32  ALA B C   1 
ATOM   770  O O   . ALA B 1 10 ? 75.572 9.888  27.784 1.00 130.47 ? 32  ALA B O   1 
ATOM   771  C CB  . ALA B 1 10 ? 76.136 11.643 30.473 1.00 166.05 ? 32  ALA B CB  1 
ATOM   772  N N   . THR B 1 11 ? 77.593 10.851 27.884 1.00 109.18 ? 33  THR B N   1 
ATOM   773  C CA  . THR B 1 11 ? 77.703 10.925 26.441 1.00 109.18 ? 33  THR B CA  1 
ATOM   774  C C   . THR B 1 11 ? 77.398 9.555  25.848 1.00 109.18 ? 33  THR B C   1 
ATOM   775  O O   . THR B 1 11 ? 76.670 9.454  24.863 1.00 109.18 ? 33  THR B O   1 
ATOM   776  C CB  . THR B 1 11 ? 79.099 11.364 26.001 1.00 64.35  ? 33  THR B CB  1 
ATOM   777  O OG1 . THR B 1 11 ? 79.993 10.248 26.072 1.00 64.35  ? 33  THR B OG1 1 
ATOM   778  C CG2 . THR B 1 11 ? 79.607 12.495 26.887 1.00 64.35  ? 33  THR B CG2 1 
ATOM   779  N N   . VAL B 1 12 ? 77.936 8.498  26.451 1.00 92.26  ? 34  VAL B N   1 
ATOM   780  C CA  . VAL B 1 12 ? 77.675 7.154  25.949 1.00 92.26  ? 34  VAL B CA  1 
ATOM   781  C C   . VAL B 1 12 ? 76.174 6.896  25.987 1.00 92.26  ? 34  VAL B C   1 
ATOM   782  O O   . VAL B 1 12 ? 75.702 5.862  25.526 1.00 92.26  ? 34  VAL B O   1 
ATOM   783  C CB  . VAL B 1 12 ? 78.385 6.066  26.779 1.00 173.88 ? 34  VAL B CB  1 
ATOM   784  C CG1 . VAL B 1 12 ? 78.388 4.758  26.005 1.00 173.88 ? 34  VAL B CG1 1 
ATOM   785  C CG2 . VAL B 1 12 ? 79.808 6.487  27.089 1.00 173.88 ? 34  VAL B CG2 1 
ATOM   786  N N   . LEU B 1 13 ? 75.430 7.844  26.550 1.00 103.66 ? 35  LEU B N   1 
ATOM   787  C CA  . LEU B 1 13 ? 73.976 7.747  26.631 1.00 103.66 ? 35  LEU B CA  1 
ATOM   788  C C   . LEU B 1 13 ? 73.380 8.475  25.433 1.00 103.66 ? 35  LEU B C   1 
ATOM   789  O O   . LEU B 1 13 ? 72.500 7.948  24.753 1.00 103.66 ? 35  LEU B O   1 
ATOM   790  C CB  . LEU B 1 13 ? 73.462 8.384  27.924 1.00 170.52 ? 35  LEU B CB  1 
ATOM   791  C CG  . LEU B 1 13 ? 74.006 7.770  29.211 1.00 170.52 ? 35  LEU B CG  1 
ATOM   792  C CD1 . LEU B 1 13 ? 73.752 8.696  30.394 1.00 170.52 ? 35  LEU B CD1 1 
ATOM   793  C CD2 . LEU B 1 13 ? 73.334 6.428  29.425 1.00 170.52 ? 35  LEU B CD2 1 
ATOM   794  N N   . LEU B 1 14 ? 73.870 9.686  25.177 1.00 103.32 ? 36  LEU B N   1 
ATOM   795  C CA  . LEU B 1 14 ? 73.390 10.492 24.057 1.00 103.32 ? 36  LEU B CA  1 
ATOM   796  C C   . LEU B 1 14 ? 73.574 9.744  22.751 1.00 103.32 ? 36  LEU B C   1 
ATOM   797  O O   . LEU B 1 14 ? 72.675 9.714  21.913 1.00 103.32 ? 36  LEU B O   1 
ATOM   798  C CB  . LEU B 1 14 ? 74.146 11.817 23.984 1.00 93.19  ? 36  LEU B CB  1 
ATOM   799  C CG  . LEU B 1 14 ? 73.928 12.609 22.696 1.00 93.19  ? 36  LEU B CG  1 
ATOM   800  C CD1 . LEU B 1 14 ? 72.666 13.453 22.815 1.00 93.19  ? 36  LEU B CD1 1 
ATOM   801  C CD2 . LEU B 1 14 ? 75.136 13.483 22.433 1.00 93.19  ? 36  LEU B CD2 1 
ATOM   802  N N   . VAL B 1 15 ? 74.749 9.148  22.582 1.00 85.21  ? 37  VAL B N   1 
ATOM   803  C CA  . VAL B 1 15 ? 75.052 8.396  21.377 1.00 85.21  ? 37  VAL B CA  1 
ATOM   804  C C   . VAL B 1 15 ? 74.013 7.313  21.158 1.00 85.21  ? 37  VAL B C   1 
ATOM   805  O O   . VAL B 1 15 ? 73.689 6.977  20.021 1.00 85.21  ? 37  VAL B O   1 
ATOM   806  C CB  . VAL B 1 15 ? 76.449 7.755  21.449 1.00 75.86  ? 37  VAL B CB  1 
ATOM   807  C CG1 . VAL B 1 15 ? 76.368 6.257  21.185 1.00 75.86  ? 37  VAL B CG1 1 
ATOM   808  C CG2 . VAL B 1 15 ? 77.361 8.420  20.435 1.00 75.86  ? 37  VAL B CG2 1 
ATOM   809  N N   . ILE B 1 16 ? 73.498 6.752  22.243 1.00 100.51 ? 38  ILE B N   1 
ATOM   810  C CA  . ILE B 1 16 ? 72.477 5.728  22.112 1.00 100.51 ? 38  ILE B CA  1 
ATOM   811  C C   . ILE B 1 16 ? 71.240 6.440  21.570 1.00 100.51 ? 38  ILE B C   1 
ATOM   812  O O   . ILE B 1 16 ? 70.628 5.988  20.602 1.00 100.51 ? 38  ILE B O   1 
ATOM   813  C CB  . ILE B 1 16 ? 72.161 5.065  23.475 1.00 109.28 ? 38  ILE B CB  1 
ATOM   814  C CG1 . ILE B 1 16 ? 73.121 3.899  23.721 1.00 109.28 ? 38  ILE B CG1 1 
ATOM   815  C CG2 . ILE B 1 16 ? 70.730 4.541  23.491 1.00 109.28 ? 38  ILE B CG2 1 
ATOM   816  C CD1 . ILE B 1 16 ? 74.580 4.223  23.471 1.00 109.28 ? 38  ILE B CD1 1 
ATOM   817  N N   . VAL B 1 17 ? 70.899 7.570  22.190 1.00 75.57  ? 39  VAL B N   1 
ATOM   818  C CA  . VAL B 1 17 ? 69.745 8.369  21.781 1.00 75.57  ? 39  VAL B CA  1 
ATOM   819  C C   . VAL B 1 17 ? 69.799 8.617  20.285 1.00 75.57  ? 39  VAL B C   1 
ATOM   820  O O   . VAL B 1 17 ? 68.809 8.446  19.577 1.00 75.57  ? 39  VAL B O   1 
ATOM   821  C CB  . VAL B 1 17 ? 69.727 9.736  22.488 1.00 150.91 ? 39  VAL B CB  1 
ATOM   822  C CG1 . VAL B 1 17 ? 68.609 10.601 21.924 1.00 150.91 ? 39  VAL B CG1 1 
ATOM   823  C CG2 . VAL B 1 17 ? 69.548 9.541  23.977 1.00 150.91 ? 39  VAL B CG2 1 
ATOM   824  N N   . LEU B 1 18 ? 70.964 9.042  19.815 1.00 64.79  ? 40  LEU B N   1 
ATOM   825  C CA  . LEU B 1 18 ? 71.147 9.295  18.404 1.00 64.79  ? 40  LEU B CA  1 
ATOM   826  C C   . LEU B 1 18 ? 70.680 8.058  17.662 1.00 64.79  ? 40  LEU B C   1 
ATOM   827  O O   . LEU B 1 18 ? 69.564 8.024  17.143 1.00 64.79  ? 40  LEU B O   1 
ATOM   828  C CB  . LEU B 1 18 ? 72.620 9.556  18.100 1.00 30.63  ? 40  LEU B CB  1 
ATOM   829  C CG  . LEU B 1 18 ? 73.233 10.821 18.705 1.00 30.63  ? 40  LEU B CG  1 
ATOM   830  C CD1 . LEU B 1 18 ? 74.512 11.163 17.948 1.00 30.63  ? 40  LEU B CD1 1 
ATOM   831  C CD2 . LEU B 1 18 ? 72.238 11.978 18.646 1.00 30.63  ? 40  LEU B CD2 1 
ATOM   832  N N   . LEU B 1 19 ? 71.531 7.036  17.631 1.00 61.75  ? 41  LEU B N   1 
ATOM   833  C CA  . LEU B 1 19 ? 71.210 5.789  16.948 1.00 61.75  ? 41  LEU B CA  1 
ATOM   834  C C   . LEU B 1 19 ? 69.792 5.335  17.253 1.00 61.75  ? 41  LEU B C   1 
ATOM   835  O O   . LEU B 1 19 ? 69.144 4.725  16.409 1.00 61.75  ? 41  LEU B O   1 
ATOM   836  C CB  . LEU B 1 19 ? 72.197 4.696  17.349 1.00 51.23  ? 41  LEU B CB  1 
ATOM   837  C CG  . LEU B 1 19 ? 73.684 5.015  17.156 1.00 51.23  ? 41  LEU B CG  1 
ATOM   838  C CD1 . LEU B 1 19 ? 74.428 3.747  16.786 1.00 51.23  ? 41  LEU B CD1 1 
ATOM   839  C CD2 . LEU B 1 19 ? 73.876 6.072  16.078 1.00 51.23  ? 41  LEU B CD2 1 
ATOM   840  N N   . ALA B 1 20 ? 69.311 5.646  18.453 1.00 99.86  ? 42  ALA B N   1 
ATOM   841  C CA  . ALA B 1 20 ? 67.961 5.270  18.862 1.00 99.86  ? 42  ALA B CA  1 
ATOM   842  C C   . ALA B 1 20 ? 66.916 6.076  18.102 1.00 99.86  ? 42  ALA B C   1 
ATOM   843  O O   . ALA B 1 20 ? 65.986 5.516  17.525 1.00 99.86  ? 42  ALA B O   1 
ATOM   844  C CB  . ALA B 1 20 ? 67.789 5.483  20.360 1.00 195.79 ? 42  ALA B CB  1 
ATOM   845  N N   . GLY B 1 21 ? 67.071 7.396  18.110 1.00 121.01 ? 43  GLY B N   1 
ATOM   846  C CA  . GLY B 1 21 ? 66.131 8.253  17.412 1.00 121.01 ? 43  GLY B CA  1 
ATOM   847  C C   . GLY B 1 21 ? 66.246 8.079  15.912 1.00 121.01 ? 43  GLY B C   1 
ATOM   848  O O   . GLY B 1 21 ? 65.251 8.134  15.192 1.00 121.01 ? 43  GLY B O   1 
ATOM   849  N N   . SER B 1 22 ? 67.470 7.864  15.445 1.00 82.01  ? 44  SER B N   1 
ATOM   850  C CA  . SER B 1 22 ? 67.732 7.676  14.027 1.00 82.01  ? 44  SER B CA  1 
ATOM   851  C C   . SER B 1 22 ? 66.853 6.578  13.460 1.00 82.01  ? 44  SER B C   1 
ATOM   852  O O   . SER B 1 22 ? 65.991 6.827  12.621 1.00 82.01  ? 44  SER B O   1 
ATOM   853  C CB  . SER B 1 22 ? 69.195 7.300  13.805 1.00 71.68  ? 44  SER B CB  1 
ATOM   854  O OG  . SER B 1 22 ? 70.049 8.389  14.099 1.00 71.68  ? 44  SER B OG  1 
ATOM   855  N N   . TYR B 1 23 ? 67.078 5.359  13.929 1.00 78.96  ? 45  TYR B N   1 
ATOM   856  C CA  . TYR B 1 23 ? 66.323 4.213  13.453 1.00 78.96  ? 45  TYR B CA  1 
ATOM   857  C C   . TYR B 1 23 ? 64.937 4.107  14.073 1.00 78.96  ? 45  TYR B C   1 
ATOM   858  O O   . TYR B 1 23 ? 64.437 3.008  14.301 1.00 78.96  ? 45  TYR B O   1 
ATOM   859  C CB  . TYR B 1 23 ? 67.108 2.928  13.717 1.00 194.30 ? 45  TYR B CB  1 
ATOM   860  C CG  . TYR B 1 23 ? 68.458 2.881  13.035 1.00 194.30 ? 45  TYR B CG  1 
ATOM   861  C CD1 . TYR B 1 23 ? 69.343 3.958  13.112 1.00 194.30 ? 45  TYR B CD1 1 
ATOM   862  C CD2 . TYR B 1 23 ? 68.856 1.752  12.321 1.00 194.30 ? 45  TYR B CD2 1 
ATOM   863  C CE1 . TYR B 1 23 ? 70.590 3.911  12.497 1.00 194.30 ? 45  TYR B CE1 1 
ATOM   864  C CE2 . TYR B 1 23 ? 70.102 1.694  11.702 1.00 194.30 ? 45  TYR B CE2 1 
ATOM   865  C CZ  . TYR B 1 23 ? 70.963 2.776  11.794 1.00 194.30 ? 45  TYR B CZ  1 
ATOM   866  O OH  . TYR B 1 23 ? 72.198 2.714  11.189 1.00 194.30 ? 45  TYR B OH  1 
ATOM   867  N N   . LEU B 1 24 ? 64.323 5.251  14.351 1.00 74.28  ? 46  LEU B N   1 
ATOM   868  C CA  . LEU B 1 24 ? 62.981 5.279  14.921 1.00 74.28  ? 46  LEU B CA  1 
ATOM   869  C C   . LEU B 1 24 ? 62.180 6.388  14.256 1.00 74.28  ? 46  LEU B C   1 
ATOM   870  O O   . LEU B 1 24 ? 60.980 6.255  14.032 1.00 74.28  ? 46  LEU B O   1 
ATOM   871  C CB  . LEU B 1 24 ? 63.025 5.515  16.434 1.00 112.87 ? 46  LEU B CB  1 
ATOM   872  C CG  . LEU B 1 24 ? 61.782 5.018  17.187 1.00 112.87 ? 46  LEU B CG  1 
ATOM   873  C CD1 . LEU B 1 24 ? 62.202 4.397  18.504 1.00 112.87 ? 46  LEU B CD1 1 
ATOM   874  C CD2 . LEU B 1 24 ? 60.812 6.166  17.425 1.00 112.87 ? 46  LEU B CD2 1 
ATOM   875  N N   . ALA B 1 25 ? 62.851 7.491  13.949 1.00 115.92 ? 47  ALA B N   1 
ATOM   876  C CA  . ALA B 1 25 ? 62.192 8.607  13.290 1.00 115.92 ? 47  ALA B CA  1 
ATOM   877  C C   . ALA B 1 25 ? 61.906 8.167  11.862 1.00 115.92 ? 47  ALA B C   1 
ATOM   878  O O   . ALA B 1 25 ? 60.873 8.507  11.287 1.00 115.92 ? 47  ALA B O   1 
ATOM   879  C CB  . ALA B 1 25 ? 63.097 9.832  13.299 1.00 146.37 ? 47  ALA B CB  1 
ATOM   880  N N   . VAL B 1 26 ? 62.833 7.401  11.299 1.00 68.98  ? 48  VAL B N   1 
ATOM   881  C CA  . VAL B 1 26 ? 62.684 6.899  9.942  1.00 68.98  ? 48  VAL B CA  1 
ATOM   882  C C   . VAL B 1 26 ? 61.396 6.103  9.871  1.00 68.98  ? 48  VAL B C   1 
ATOM   883  O O   . VAL B 1 26 ? 60.480 6.471  9.145  1.00 68.98  ? 48  VAL B O   1 
ATOM   884  C CB  . VAL B 1 26 ? 63.863 5.978  9.532  1.00 35.08  ? 48  VAL B CB  1 
ATOM   885  C CG1 . VAL B 1 26 ? 63.471 5.137  8.326  1.00 35.08  ? 48  VAL B CG1 1 
ATOM   886  C CG2 . VAL B 1 26 ? 65.104 6.815  9.219  1.00 35.08  ? 48  VAL B CG2 1 
ATOM   887  N N   . LEU B 1 27 ? 61.322 5.020  10.640 1.00 84.09  ? 49  LEU B N   1 
ATOM   888  C CA  . LEU B 1 27 ? 60.134 4.177  10.646 1.00 84.09  ? 49  LEU B CA  1 
ATOM   889  C C   . LEU B 1 27 ? 58.883 4.939  11.085 1.00 84.09  ? 49  LEU B C   1 
ATOM   890  O O   . LEU B 1 27 ? 57.823 4.349  11.296 1.00 84.09  ? 49  LEU B O   1 
ATOM   891  C CB  . LEU B 1 27 ? 60.351 2.962  11.550 1.00 177.37 ? 49  LEU B CB  1 
ATOM   892  C CG  . LEU B 1 27 ? 60.813 3.214  12.985 1.00 177.37 ? 49  LEU B CG  1 
ATOM   893  C CD1 . LEU B 1 27 ? 59.602 3.297  13.902 1.00 177.37 ? 49  LEU B CD1 1 
ATOM   894  C CD2 . LEU B 1 27 ? 61.741 2.092  13.426 1.00 177.37 ? 49  LEU B CD2 1 
ATOM   895  N N   . ALA B 1 28 ? 59.013 6.253  11.221 1.00 85.08  ? 50  ALA B N   1 
ATOM   896  C CA  . ALA B 1 28 ? 57.893 7.099  11.608 1.00 85.08  ? 50  ALA B CA  1 
ATOM   897  C C   . ALA B 1 28 ? 57.557 8.014  10.436 1.00 85.08  ? 50  ALA B C   1 
ATOM   898  O O   . ALA B 1 28 ? 56.434 8.497  10.315 1.00 85.08  ? 50  ALA B O   1 
ATOM   899  C CB  . ALA B 1 28 ? 58.257 7.926  12.833 1.00 95.57  ? 50  ALA B CB  1 
ATOM   900  N N   . GLU B 1 29 ? 58.545 8.234  9.571  1.00 135.88 ? 51  GLU B N   1 
ATOM   901  C CA  . GLU B 1 29 ? 58.389 9.093  8.402  1.00 135.88 ? 51  GLU B CA  1 
ATOM   902  C C   . GLU B 1 29 ? 58.465 8.326  7.082  1.00 135.88 ? 51  GLU B C   1 
ATOM   903  O O   . GLU B 1 29 ? 57.834 8.713  6.100  1.00 135.88 ? 51  GLU B O   1 
ATOM   904  C CB  . GLU B 1 29 ? 59.469 10.175 8.403  1.00 58.94  ? 51  GLU B CB  1 
ATOM   905  C CG  . GLU B 1 29 ? 59.528 10.993 9.673  1.00 58.94  ? 51  GLU B CG  1 
ATOM   906  C CD  . GLU B 1 29 ? 59.252 12.466 9.434  1.00 58.94  ? 51  GLU B CD  1 
ATOM   907  O OE1 . GLU B 1 29 ? 60.090 13.145 8.786  1.00 58.94  ? 51  GLU B OE1 1 
ATOM   908  O OE2 . GLU B 1 29 ? 58.194 12.940 9.900  1.00 58.94  ? 51  GLU B OE2 1 
ATOM   909  N N   . ARG B 1 30 ? 59.244 7.247  7.071  1.00 114.57 ? 52  ARG B N   1 
ATOM   910  C CA  . ARG B 1 30 ? 59.446 6.407  5.888  1.00 114.57 ? 52  ARG B CA  1 
ATOM   911  C C   . ARG B 1 30 ? 58.279 6.358  4.904  1.00 114.57 ? 52  ARG B C   1 
ATOM   912  O O   . ARG B 1 30 ? 58.486 6.376  3.690  1.00 114.57 ? 52  ARG B O   1 
ATOM   913  C CB  . ARG B 1 30 ? 59.806 4.980  6.315  1.00 170.44 ? 52  ARG B CB  1 
ATOM   914  C CG  . ARG B 1 30 ? 60.037 4.019  5.156  1.00 170.44 ? 52  ARG B CG  1 
ATOM   915  C CD  . ARG B 1 30 ? 61.445 3.446  5.174  1.00 170.44 ? 52  ARG B CD  1 
ATOM   916  N NE  . ARG B 1 30 ? 62.116 3.615  3.888  1.00 170.44 ? 52  ARG B NE  1 
ATOM   917  C CZ  . ARG B 1 30 ? 63.377 3.268  3.647  1.00 170.44 ? 52  ARG B CZ  1 
ATOM   918  N NH1 . ARG B 1 30 ? 64.116 2.727  4.609  1.00 170.44 ? 52  ARG B NH1 1 
ATOM   919  N NH2 . ARG B 1 30 ? 63.901 3.465  2.442  1.00 170.44 ? 52  ARG B NH2 1 
ATOM   920  N N   . GLY B 1 31 ? 57.057 6.286  5.421  1.00 182.79 ? 53  GLY B N   1 
ATOM   921  C CA  . GLY B 1 31 ? 55.899 6.233  4.547  1.00 182.79 ? 53  GLY B CA  1 
ATOM   922  C C   . GLY B 1 31 ? 54.966 7.412  4.741  1.00 182.79 ? 53  GLY B C   1 
ATOM   923  O O   . GLY B 1 31 ? 53.952 7.294  5.430  1.00 182.79 ? 53  GLY B O   1 
ATOM   924  N N   . ALA B 1 32 ? 55.303 8.548  4.134  1.00 100.03 ? 54  ALA B N   1 
ATOM   925  C CA  . ALA B 1 32 ? 54.484 9.750  4.255  1.00 100.03 ? 54  ALA B CA  1 
ATOM   926  C C   . ALA B 1 32 ? 55.074 10.940 3.497  1.00 100.03 ? 54  ALA B C   1 
ATOM   927  O O   . ALA B 1 32 ? 56.218 10.892 3.034  1.00 100.03 ? 54  ALA B O   1 
ATOM   928  C CB  . ALA B 1 32 ? 54.311 10.111 5.728  1.00 60.31  ? 54  ALA B CB  1 
ATOM   929  N N   . PRO B 1 33 ? 54.283 12.023 3.351  1.00 91.33  ? 55  PRO B N   1 
ATOM   930  C CA  . PRO B 1 33 ? 54.657 13.271 2.661  1.00 91.33  ? 55  PRO B CA  1 
ATOM   931  C C   . PRO B 1 33 ? 55.913 13.956 3.219  1.00 91.33  ? 55  PRO B C   1 
ATOM   932  O O   . PRO B 1 33 ? 56.240 15.082 2.838  1.00 91.33  ? 55  PRO B O   1 
ATOM   933  C CB  . PRO B 1 33 ? 53.423 14.157 2.833  1.00 72.81  ? 55  PRO B CB  1 
ATOM   934  C CG  . PRO B 1 33 ? 52.294 13.202 3.084  1.00 72.81  ? 55  PRO B CG  1 
ATOM   935  C CD  . PRO B 1 33 ? 52.890 12.066 3.840  1.00 72.81  ? 55  PRO B CD  1 
ATOM   936  N N   . GLY B 1 34 ? 56.618 13.267 4.108  1.00 41.72  ? 56  GLY B N   1 
ATOM   937  C CA  . GLY B 1 34 ? 57.794 13.844 4.726  1.00 41.72  ? 56  GLY B CA  1 
ATOM   938  C C   . GLY B 1 34 ? 59.102 13.726 3.990  1.00 41.72  ? 56  GLY B C   1 
ATOM   939  O O   . GLY B 1 34 ? 59.260 12.897 3.095  1.00 41.72  ? 56  GLY B O   1 
ATOM   940  N N   . ALA B 1 35 ? 60.048 14.563 4.409  1.00 124.25 ? 57  ALA B N   1 
ATOM   941  C CA  . ALA B 1 35 ? 61.385 14.626 3.839  1.00 124.25 ? 57  ALA B CA  1 
ATOM   942  C C   . ALA B 1 35 ? 62.135 13.301 3.909  1.00 124.25 ? 57  ALA B C   1 
ATOM   943  O O   . ALA B 1 35 ? 61.574 12.268 4.283  1.00 124.25 ? 57  ALA B O   1 
ATOM   944  C CB  . ALA B 1 35 ? 62.191 15.718 4.535  1.00 110.28 ? 57  ALA B CB  1 
ATOM   945  N N   . GLN B 1 36 ? 63.415 13.356 3.555  1.00 131.49 ? 58  GLN B N   1 
ATOM   946  C CA  . GLN B 1 36 ? 64.286 12.187 3.525  1.00 131.49 ? 58  GLN B CA  1 
ATOM   947  C C   . GLN B 1 36 ? 64.419 11.417 4.831  1.00 131.49 ? 58  GLN B C   1 
ATOM   948  O O   . GLN B 1 36 ? 65.195 10.463 4.903  1.00 131.49 ? 58  GLN B O   1 
ATOM   949  C CB  . GLN B 1 36 ? 65.679 12.591 3.033  1.00 140.05 ? 58  GLN B CB  1 
ATOM   950  C CG  . GLN B 1 36 ? 66.432 11.485 2.313  1.00 140.05 ? 58  GLN B CG  1 
ATOM   951  C CD  . GLN B 1 36 ? 67.777 11.946 1.791  1.00 140.05 ? 58  GLN B CD  1 
ATOM   952  O OE1 . GLN B 1 36 ? 67.858 12.612 0.760  1.00 140.05 ? 58  GLN B OE1 1 
ATOM   953  N NE2 . GLN B 1 36 ? 68.843 11.594 2.503  1.00 140.05 ? 58  GLN B NE2 1 
ATOM   954  N N   . LEU B 1 37 ? 63.682 11.818 5.863  1.00 71.35  ? 59  LEU B N   1 
ATOM   955  C CA  . LEU B 1 37 ? 63.744 11.102 7.135  1.00 71.35  ? 59  LEU B CA  1 
ATOM   956  C C   . LEU B 1 37 ? 63.053 9.771  6.880  1.00 71.35  ? 59  LEU B C   1 
ATOM   957  O O   . LEU B 1 37 ? 62.289 9.264  7.699  1.00 71.35  ? 59  LEU B O   1 
ATOM   958  C CB  . LEU B 1 37 ? 63.027 11.888 8.238  1.00 62.77  ? 59  LEU B CB  1 
ATOM   959  C CG  . LEU B 1 37 ? 63.848 12.992 8.923  1.00 62.77  ? 59  LEU B CG  1 
ATOM   960  C CD1 . LEU B 1 37 ? 63.066 13.564 10.093 1.00 62.77  ? 59  LEU B CD1 1 
ATOM   961  C CD2 . LEU B 1 37 ? 65.189 12.440 9.393  1.00 62.77  ? 59  LEU B CD2 1 
ATOM   962  N N   . ILE B 1 38 ? 63.339 9.227  5.705  1.00 90.58  ? 60  ILE B N   1 
ATOM   963  C CA  . ILE B 1 38 ? 62.783 7.973  5.244  1.00 90.58  ? 60  ILE B CA  1 
ATOM   964  C C   . ILE B 1 38 ? 63.916 6.976  5.016  1.00 90.58  ? 60  ILE B C   1 
ATOM   965  O O   . ILE B 1 38 ? 63.720 5.919  4.419  1.00 90.58  ? 60  ILE B O   1 
ATOM   966  C CB  . ILE B 1 38 ? 62.009 8.185  3.920  1.00 102.69 ? 60  ILE B CB  1 
ATOM   967  C CG1 . ILE B 1 38 ? 62.987 8.477  2.778  1.00 102.69 ? 60  ILE B CG1 1 
ATOM   968  C CG2 . ILE B 1 38 ? 61.047 9.360  4.060  1.00 102.69 ? 60  ILE B CG2 1 
ATOM   969  N N   . THR B 1 39 ? 65.106 7.324  5.492  1.00 83.01  ? 61  THR B N   1 
ATOM   970  C CA  . THR B 1 39 ? 66.270 6.460  5.345  1.00 83.01  ? 61  THR B CA  1 
ATOM   971  C C   . THR B 1 39 ? 67.078 6.495  6.629  1.00 83.01  ? 61  THR B C   1 
ATOM   972  O O   . THR B 1 39 ? 67.397 7.570  7.145  1.00 83.01  ? 61  THR B O   1 
ATOM   973  C CB  . THR B 1 39 ? 67.160 6.924  4.185  1.00 95.47  ? 61  THR B CB  1 
ATOM   974  O OG1 . THR B 1 39 ? 66.333 7.301  3.081  1.00 95.47  ? 61  THR B OG1 1 
ATOM   975  C CG2 . THR B 1 39 ? 68.090 5.811  3.744  1.00 95.47  ? 61  THR B CG2 1 
ATOM   976  N N   . TYR B 1 40 ? 67.398 5.317  7.149  1.00 139.80 ? 62  TYR B N   1 
ATOM   977  C CA  . TYR B 1 40 ? 68.166 5.218  8.381  1.00 139.80 ? 62  TYR B CA  1 
ATOM   978  C C   . TYR B 1 40 ? 69.485 5.978  8.294  1.00 139.80 ? 62  TYR B C   1 
ATOM   979  O O   . TYR B 1 40 ? 69.811 6.761  9.186  1.00 139.80 ? 62  TYR B O   1 
ATOM   980  C CB  . TYR B 1 40 ? 68.422 3.750  8.717  1.00 214.80 ? 62  TYR B CB  1 
ATOM   981  C CG  . TYR B 1 40 ? 67.171 3.009  9.121  1.00 214.80 ? 62  TYR B CG  1 
ATOM   982  C CD1 . TYR B 1 40 ? 66.459 3.378  10.262 1.00 214.80 ? 62  TYR B CD1 1 
ATOM   983  C CD2 . TYR B 1 40 ? 66.693 1.942  8.361  1.00 214.80 ? 62  TYR B CD2 1 
ATOM   984  C CE1 . TYR B 1 40 ? 65.300 2.703  10.639 1.00 214.80 ? 62  TYR B CE1 1 
ATOM   985  C CE2 . TYR B 1 40 ? 65.533 1.258  8.729  1.00 214.80 ? 62  TYR B CE2 1 
ATOM   986  C CZ  . TYR B 1 40 ? 64.843 1.645  9.869  1.00 214.80 ? 62  TYR B CZ  1 
ATOM   987  O OH  . TYR B 1 40 ? 63.698 0.976  10.242 1.00 214.80 ? 62  TYR B OH  1 
ATOM   988  N N   . PRO B 1 41 ? 70.260 5.764  7.216  1.00 91.29  ? 63  PRO B N   1 
ATOM   989  C CA  . PRO B 1 41 ? 71.547 6.459  7.058  1.00 91.29  ? 63  PRO B CA  1 
ATOM   990  C C   . PRO B 1 41 ? 71.397 7.975  6.920  1.00 91.29  ? 63  PRO B C   1 
ATOM   991  O O   . PRO B 1 41 ? 72.391 8.706  6.855  1.00 91.29  ? 63  PRO B O   1 
ATOM   992  C CB  . PRO B 1 41 ? 72.155 5.836  5.797  1.00 116.80 ? 63  PRO B CB  1 
ATOM   993  C CG  . PRO B 1 41 ? 71.339 4.610  5.518  1.00 116.80 ? 63  PRO B CG  1 
ATOM   994  C CD  . PRO B 1 41 ? 69.983 4.857  6.089  1.00 116.80 ? 63  PRO B CD  1 
ATOM   995  N N   . ARG B 1 42 ? 70.147 8.433  6.873  1.00 63.17  ? 64  ARG B N   1 
ATOM   996  C CA  . ARG B 1 42 ? 69.837 9.850  6.735  1.00 63.17  ? 64  ARG B CA  1 
ATOM   997  C C   . ARG B 1 42 ? 69.370 10.406 8.067  1.00 63.17  ? 64  ARG B C   1 
ATOM   998  O O   . ARG B 1 42 ? 69.706 11.529 8.430  1.00 63.17  ? 64  ARG B O   1 
ATOM   999  C CB  . ARG B 1 42 ? 68.751 10.053 5.676  1.00 80.88  ? 64  ARG B CB  1 
ATOM   1000 N N   . ALA B 1 43 ? 68.590 9.616  8.794  1.00 90.91  ? 65  ALA B N   1 
ATOM   1001 C CA  . ALA B 1 43 ? 68.097 10.045 10.094 1.00 90.91  ? 65  ALA B CA  1 
ATOM   1002 C C   . ALA B 1 43 ? 69.284 10.350 11.005 1.00 90.91  ? 65  ALA B C   1 
ATOM   1003 O O   . ALA B 1 43 ? 69.234 11.285 11.802 1.00 90.91  ? 65  ALA B O   1 
ATOM   1004 C CB  . ALA B 1 43 ? 67.221 8.960  10.708 1.00 33.08  ? 65  ALA B CB  1 
ATOM   1005 N N   . LEU B 1 44 ? 70.350 9.561  10.876 1.00 96.65  ? 66  LEU B N   1 
ATOM   1006 C CA  . LEU B 1 44 ? 71.564 9.741  11.674 1.00 96.65  ? 66  LEU B CA  1 
ATOM   1007 C C   . LEU B 1 44 ? 72.018 11.189 11.645 1.00 96.65  ? 66  LEU B C   1 
ATOM   1008 O O   . LEU B 1 44 ? 71.948 11.899 12.648 1.00 96.65  ? 66  LEU B O   1 
ATOM   1009 C CB  . LEU B 1 44 ? 72.702 8.888  11.122 1.00 90.10  ? 66  LEU B CB  1 
ATOM   1010 C CG  . LEU B 1 44 ? 72.769 7.392  11.414 1.00 90.10  ? 66  LEU B CG  1 
ATOM   1011 C CD1 . LEU B 1 44 ? 74.222 6.947  11.307 1.00 90.10  ? 66  LEU B CD1 1 
ATOM   1012 C CD2 . LEU B 1 44 ? 72.212 7.088  12.789 1.00 90.10  ? 66  LEU B CD2 1 
ATOM   1013 N N   . TRP B 1 45 ? 72.502 11.606 10.480 1.00 81.17  ? 67  TRP B N   1 
ATOM   1014 C CA  . TRP B 1 45 ? 72.984 12.964 10.268 1.00 81.17  ? 67  TRP B CA  1 
ATOM   1015 C C   . TRP B 1 45 ? 71.950 13.966 10.770 1.00 81.17  ? 67  TRP B C   1 
ATOM   1016 O O   . TRP B 1 45 ? 72.283 15.112 11.050 1.00 81.17  ? 67  TRP B O   1 
ATOM   1017 C CB  . TRP B 1 45 ? 73.286 13.179 8.774  1.00 61.75  ? 67  TRP B CB  1 
ATOM   1018 C CG  . TRP B 1 45 ? 73.433 14.611 8.346  1.00 61.75  ? 67  TRP B CG  1 
ATOM   1019 C CD1 . TRP B 1 45 ? 72.567 15.317 7.570  1.00 61.75  ? 67  TRP B CD1 1 
ATOM   1020 C CD2 . TRP B 1 45 ? 74.499 15.513 8.678  1.00 61.75  ? 67  TRP B CD2 1 
ATOM   1021 N NE1 . TRP B 1 45 ? 73.020 16.605 7.393  1.00 61.75  ? 67  TRP B NE1 1 
ATOM   1022 C CE2 . TRP B 1 45 ? 74.203 16.754 8.063  1.00 61.75  ? 67  TRP B CE2 1 
ATOM   1023 C CE3 . TRP B 1 45 ? 75.674 15.397 9.432  1.00 61.75  ? 67  TRP B CE3 1 
ATOM   1024 C CZ2 . TRP B 1 45 ? 75.038 17.871 8.180  1.00 61.75  ? 67  TRP B CZ2 1 
ATOM   1025 C CZ3 . TRP B 1 45 ? 76.507 16.515 9.549  1.00 61.75  ? 67  TRP B CZ3 1 
ATOM   1026 C CH2 . TRP B 1 45 ? 76.180 17.733 8.925  1.00 61.75  ? 67  TRP B CH2 1 
ATOM   1027 N N   . TRP B 1 46 ? 70.700 13.529 10.895 1.00 58.82  ? 68  TRP B N   1 
ATOM   1028 C CA  . TRP B 1 46 ? 69.642 14.406 11.390 1.00 58.82  ? 68  TRP B CA  1 
ATOM   1029 C C   . TRP B 1 46 ? 69.669 14.432 12.908 1.00 58.82  ? 68  TRP B C   1 
ATOM   1030 O O   . TRP B 1 46 ? 69.505 15.484 13.529 1.00 58.82  ? 68  TRP B O   1 
ATOM   1031 C CB  . TRP B 1 46 ? 68.271 13.920 10.949 1.00 32.28  ? 68  TRP B CB  1 
ATOM   1032 C CG  . TRP B 1 46 ? 67.180 14.559 11.732 1.00 32.28  ? 68  TRP B CG  1 
ATOM   1033 C CD1 . TRP B 1 46 ? 66.734 15.841 11.618 1.00 32.28  ? 68  TRP B CD1 1 
ATOM   1034 C CD2 . TRP B 1 46 ? 66.389 13.948 12.754 1.00 32.28  ? 68  TRP B CD2 1 
ATOM   1035 N NE1 . TRP B 1 46 ? 65.709 16.072 12.504 1.00 32.28  ? 68  TRP B NE1 1 
ATOM   1036 C CE2 . TRP B 1 46 ? 65.475 14.925 13.214 1.00 32.28  ? 68  TRP B CE2 1 
ATOM   1037 C CE3 . TRP B 1 46 ? 66.359 12.670 13.325 1.00 32.28  ? 68  TRP B CE3 1 
ATOM   1038 C CZ2 . TRP B 1 46 ? 64.540 14.664 14.220 1.00 32.28  ? 68  TRP B CZ2 1 
ATOM   1039 C CZ3 . TRP B 1 46 ? 65.430 12.408 14.324 1.00 32.28  ? 68  TRP B CZ3 1 
ATOM   1040 C CH2 . TRP B 1 46 ? 64.531 13.403 14.762 1.00 32.28  ? 68  TRP B CH2 1 
ATOM   1041 N N   . SER B 1 47 ? 69.852 13.255 13.498 1.00 56.42  ? 69  SER B N   1 
ATOM   1042 C CA  . SER B 1 47 ? 69.924 13.127 14.944 1.00 56.42  ? 69  SER B CA  1 
ATOM   1043 C C   . SER B 1 47 ? 71.048 14.030 15.419 1.00 56.42  ? 69  SER B C   1 
ATOM   1044 O O   . SER B 1 47 ? 70.887 14.805 16.357 1.00 56.42  ? 69  SER B O   1 
ATOM   1045 C CB  . SER B 1 47 ? 70.225 11.677 15.332 1.00 68.84  ? 69  SER B CB  1 
ATOM   1046 O OG  . SER B 1 47 ? 69.061 10.872 15.247 1.00 68.84  ? 69  SER B OG  1 
ATOM   1047 N N   . VAL B 1 48 ? 72.186 13.931 14.745 1.00 33.40  ? 70  VAL B N   1 
ATOM   1048 C CA  . VAL B 1 48 ? 73.351 14.729 15.085 1.00 33.40  ? 70  VAL B CA  1 
ATOM   1049 C C   . VAL B 1 48 ? 73.087 16.233 15.016 1.00 33.40  ? 70  VAL B C   1 
ATOM   1050 O O   . VAL B 1 48 ? 73.312 16.945 15.996 1.00 33.40  ? 70  VAL B O   1 
ATOM   1051 C CB  . VAL B 1 48 ? 74.538 14.390 14.161 1.00 28.97  ? 70  VAL B CB  1 
ATOM   1052 C CG1 . VAL B 1 48 ? 75.732 15.282 14.494 1.00 28.97  ? 70  VAL B CG1 1 
ATOM   1053 C CG2 . VAL B 1 48 ? 74.895 12.913 14.302 1.00 28.97  ? 70  VAL B CG2 1 
ATOM   1054 N N   . GLU B 1 49 ? 72.628 16.717 13.864 1.00 75.47  ? 71  GLU B N   1 
ATOM   1055 C CA  . GLU B 1 49 ? 72.346 18.144 13.695 1.00 75.47  ? 71  GLU B CA  1 
ATOM   1056 C C   . GLU B 1 49 ? 71.347 18.574 14.754 1.00 75.47  ? 71  GLU B C   1 
ATOM   1057 O O   . GLU B 1 49 ? 71.532 19.591 15.419 1.00 75.47  ? 71  GLU B O   1 
ATOM   1058 C CB  . GLU B 1 49 ? 71.779 18.436 12.295 1.00 59.15  ? 71  GLU B CB  1 
ATOM   1059 N N   . THR B 1 50 ? 70.295 17.782 14.915 1.00 55.69  ? 72  THR B N   1 
ATOM   1060 C CA  . THR B 1 50 ? 69.261 18.074 15.900 1.00 55.69  ? 72  THR B CA  1 
ATOM   1061 C C   . THR B 1 50 ? 69.846 18.118 17.314 1.00 55.69  ? 72  THR B C   1 
ATOM   1062 O O   . THR B 1 50 ? 69.648 19.088 18.055 1.00 55.69  ? 72  THR B O   1 
ATOM   1063 C CB  . THR B 1 50 ? 68.145 17.003 15.873 1.00 90.47  ? 72  THR B CB  1 
ATOM   1064 O OG1 . THR B 1 50 ? 67.555 16.948 14.566 1.00 90.47  ? 72  THR B OG1 1 
ATOM   1065 C CG2 . THR B 1 50 ? 67.073 17.331 16.905 1.00 90.47  ? 72  THR B CG2 1 
ATOM   1066 N N   . ALA B 1 51 ? 70.561 17.050 17.669 1.00 51.66  ? 73  ALA B N   1 
ATOM   1067 C CA  . ALA B 1 51 ? 71.186 16.908 18.977 1.00 51.66  ? 73  ALA B CA  1 
ATOM   1068 C C   . ALA B 1 51 ? 72.144 18.048 19.272 1.00 51.66  ? 73  ALA B C   1 
ATOM   1069 O O   . ALA B 1 51 ? 72.228 18.519 20.401 1.00 51.66  ? 73  ALA B O   1 
ATOM   1070 C CB  . ALA B 1 51 ? 71.918 15.581 19.057 1.00 58.83  ? 73  ALA B CB  1 
ATOM   1071 N N   . THR B 1 52 ? 72.882 18.480 18.262 1.00 23.11  ? 74  THR B N   1 
ATOM   1072 C CA  . THR B 1 52 ? 73.812 19.582 18.449 1.00 23.11  ? 74  THR B CA  1 
ATOM   1073 C C   . THR B 1 52 ? 72.987 20.847 18.426 1.00 23.11  ? 74  THR B C   1 
ATOM   1074 O O   . THR B 1 52 ? 73.453 21.918 18.823 1.00 23.11  ? 74  THR B O   1 
ATOM   1075 C CB  . THR B 1 52 ? 74.802 19.684 17.298 1.00 49.69  ? 74  THR B CB  1 
ATOM   1076 O OG1 . THR B 1 52 ? 75.316 18.387 16.992 1.00 49.69  ? 74  THR B OG1 1 
ATOM   1077 C CG2 . THR B 1 52 ? 75.936 20.616 17.663 1.00 49.69  ? 74  THR B CG2 1 
ATOM   1078 N N   . THR B 1 53 ? 71.746 20.691 17.972 1.00 73.54  ? 75  THR B N   1 
ATOM   1079 C CA  . THR B 1 53 ? 70.792 21.783 17.804 1.00 73.54  ? 75  THR B CA  1 
ATOM   1080 C C   . THR B 1 53 ? 71.435 22.871 16.958 1.00 73.54  ? 75  THR B C   1 
ATOM   1081 O O   . THR B 1 53 ? 71.855 23.916 17.440 1.00 73.54  ? 75  THR B O   1 
ATOM   1082 C CB  . THR B 1 53 ? 70.291 22.378 19.144 1.00 51.43  ? 75  THR B CB  1 
ATOM   1083 O OG1 . THR B 1 53 ? 70.414 23.805 19.113 1.00 51.43  ? 75  THR B OG1 1 
ATOM   1084 C CG2 . THR B 1 53 ? 71.058 21.820 20.314 1.00 51.43  ? 75  THR B CG2 1 
ATOM   1085 N N   . VAL B 1 54 ? 71.526 22.576 15.671 1.00 146.59 ? 76  VAL B N   1 
ATOM   1086 C CA  . VAL B 1 54 ? 72.099 23.480 14.700 1.00 146.59 ? 76  VAL B CA  1 
ATOM   1087 C C   . VAL B 1 54 ? 71.002 23.699 13.661 1.00 146.59 ? 76  VAL B C   1 
ATOM   1088 O O   . VAL B 1 54 ? 70.950 24.730 12.992 1.00 146.59 ? 76  VAL B O   1 
ATOM   1089 C CB  . VAL B 1 54 ? 73.337 22.843 14.056 1.00 55.21  ? 76  VAL B CB  1 
ATOM   1090 C CG1 . VAL B 1 54 ? 74.121 23.879 13.303 1.00 55.21  ? 76  VAL B CG1 1 
ATOM   1091 C CG2 . VAL B 1 54 ? 74.208 22.208 15.130 1.00 55.21  ? 76  VAL B CG2 1 
ATOM   1092 N N   . GLY B 1 55 ? 70.117 22.710 13.560 1.00 130.62 ? 77  GLY B N   1 
ATOM   1093 C CA  . GLY B 1 55 ? 68.998 22.763 12.635 1.00 130.62 ? 77  GLY B CA  1 
ATOM   1094 C C   . GLY B 1 55 ? 69.345 23.313 11.273 1.00 130.62 ? 77  GLY B C   1 
ATOM   1095 O O   . GLY B 1 55 ? 69.037 24.459 10.967 1.00 130.62 ? 77  GLY B O   1 
ATOM   1096 N N   . TYR B 1 56 ? 69.983 22.492 10.449 1.00 53.28  ? 78  TYR B N   1 
ATOM   1097 C CA  . TYR B 1 56 ? 70.367 22.930 9.116  1.00 53.28  ? 78  TYR B CA  1 
ATOM   1098 C C   . TYR B 1 56 ? 69.131 23.251 8.324  1.00 53.28  ? 78  TYR B C   1 
ATOM   1099 O O   . TYR B 1 56 ? 69.122 24.206 7.561  1.00 53.28  ? 78  TYR B O   1 
ATOM   1100 C CB  . TYR B 1 56 ? 71.176 21.846 8.400  1.00 36.75  ? 78  TYR B CB  1 
ATOM   1101 C CG  . TYR B 1 56 ? 72.662 22.029 8.566  1.00 36.75  ? 78  TYR B CG  1 
ATOM   1102 C CD1 . TYR B 1 56 ? 73.250 23.289 8.393  1.00 36.75  ? 78  TYR B CD1 1 
ATOM   1103 C CD2 . TYR B 1 56 ? 73.473 20.965 8.959  1.00 36.75  ? 78  TYR B CD2 1 
ATOM   1104 C CE1 . TYR B 1 56 ? 74.617 23.489 8.616  1.00 36.75  ? 78  TYR B CE1 1 
ATOM   1105 C CE2 . TYR B 1 56 ? 74.845 21.148 9.187  1.00 36.75  ? 78  TYR B CE2 1 
ATOM   1106 C CZ  . TYR B 1 56 ? 75.414 22.413 9.016  1.00 36.75  ? 78  TYR B CZ  1 
ATOM   1107 O OH  . TYR B 1 56 ? 76.768 22.597 9.247  1.00 36.75  ? 78  TYR B OH  1 
ATOM   1108 N N   . GLY B 1 57 ? 68.085 22.456 8.532  1.00 41.45  ? 79  GLY B N   1 
ATOM   1109 C CA  . GLY B 1 57 ? 66.843 22.653 7.810  1.00 41.45  ? 79  GLY B CA  1 
ATOM   1110 C C   . GLY B 1 57 ? 66.789 21.685 6.639  1.00 41.45  ? 79  GLY B C   1 
ATOM   1111 O O   . GLY B 1 57 ? 65.727 21.405 6.078  1.00 41.45  ? 79  GLY B O   1 
ATOM   1112 N N   . ASP B 1 58 ? 67.961 21.176 6.277  1.00 42.91  ? 80  ASP B N   1 
ATOM   1113 C CA  . ASP B 1 58 ? 68.106 20.217 5.191  1.00 42.91  ? 80  ASP B CA  1 
ATOM   1114 C C   . ASP B 1 58 ? 67.221 18.997 5.451  1.00 42.91  ? 80  ASP B C   1 
ATOM   1115 O O   . ASP B 1 58 ? 66.848 18.287 4.523  1.00 42.91  ? 80  ASP B O   1 
ATOM   1116 C CB  . ASP B 1 58 ? 69.566 19.775 5.094  1.00 58.15  ? 80  ASP B CB  1 
ATOM   1117 C CG  . ASP B 1 58 ? 69.913 18.680 6.094  1.00 58.15  ? 80  ASP B CG  1 
ATOM   1118 O OD1 . ASP B 1 58 ? 70.004 18.962 7.322  1.00 58.15  ? 80  ASP B OD1 1 
ATOM   1119 O OD2 . ASP B 1 58 ? 70.091 17.530 5.637  1.00 58.15  ? 80  ASP B OD2 1 
ATOM   1120 N N   . LEU B 1 59 ? 66.900 18.758 6.721  1.00 60.81  ? 81  LEU B N   1 
ATOM   1121 C CA  . LEU B 1 59 ? 66.064 17.627 7.115  1.00 60.81  ? 81  LEU B CA  1 
ATOM   1122 C C   . LEU B 1 59 ? 65.324 17.891 8.427  1.00 60.81  ? 81  LEU B C   1 
ATOM   1123 O O   . LEU B 1 59 ? 65.843 18.571 9.316  1.00 60.81  ? 81  LEU B O   1 
ATOM   1124 C CB  . LEU B 1 59 ? 66.920 16.366 7.277  1.00 54.62  ? 81  LEU B CB  1 
ATOM   1125 C CG  . LEU B 1 59 ? 67.685 15.818 6.072  1.00 54.62  ? 81  LEU B CG  1 
ATOM   1126 C CD1 . LEU B 1 59 ? 68.438 14.571 6.478  1.00 54.62  ? 81  LEU B CD1 1 
ATOM   1127 C CD2 . LEU B 1 59 ? 66.727 15.490 4.957  1.00 54.62  ? 81  LEU B CD2 1 
ATOM   1128 N N   . TYR B 1 60 ? 64.111 17.344 8.528  1.00 36.04  ? 82  TYR B N   1 
ATOM   1129 C CA  . TYR B 1 60 ? 63.263 17.464 9.717  1.00 36.04  ? 82  TYR B CA  1 
ATOM   1130 C C   . TYR B 1 60 ? 62.004 16.587 9.657  1.00 36.04  ? 82  TYR B C   1 
ATOM   1131 O O   . TYR B 1 60 ? 61.509 16.248 8.583  1.00 36.04  ? 82  TYR B O   1 
ATOM   1132 C CB  . TYR B 1 60 ? 62.856 18.917 9.949  1.00 101.73 ? 82  TYR B CB  1 
ATOM   1133 C CG  . TYR B 1 60 ? 62.178 19.573 8.780  1.00 101.73 ? 82  TYR B CG  1 
ATOM   1134 C CD1 . TYR B 1 60 ? 62.906 19.955 7.656  1.00 101.73 ? 82  TYR B CD1 1 
ATOM   1135 C CD2 . TYR B 1 60 ? 60.820 19.866 8.818  1.00 101.73 ? 82  TYR B CD2 1 
ATOM   1136 C CE1 . TYR B 1 60 ? 62.302 20.620 6.600  1.00 101.73 ? 82  TYR B CE1 1 
ATOM   1137 C CE2 . TYR B 1 60 ? 60.205 20.530 7.769  1.00 101.73 ? 82  TYR B CE2 1 
ATOM   1138 C CZ  . TYR B 1 60 ? 60.953 20.907 6.663  1.00 101.73 ? 82  TYR B CZ  1 
ATOM   1139 O OH  . TYR B 1 60 ? 60.357 21.592 5.629  1.00 101.73 ? 82  TYR B OH  1 
ATOM   1140 N N   . PRO B 1 61 ? 61.474 16.197 10.824 1.00 49.05  ? 83  PRO B N   1 
ATOM   1141 C CA  . PRO B 1 61 ? 60.277 15.360 10.818 1.00 49.05  ? 83  PRO B CA  1 
ATOM   1142 C C   . PRO B 1 61 ? 58.992 16.133 10.535 1.00 49.05  ? 83  PRO B C   1 
ATOM   1143 O O   . PRO B 1 61 ? 58.890 17.331 10.804 1.00 49.05  ? 83  PRO B O   1 
ATOM   1144 C CB  . PRO B 1 61 ? 60.276 14.736 12.206 1.00 65.61  ? 83  PRO B CB  1 
ATOM   1145 C CG  . PRO B 1 61 ? 60.933 15.752 13.057 1.00 65.61  ? 83  PRO B CG  1 
ATOM   1146 C CD  . PRO B 1 61 ? 61.936 16.481 12.193 1.00 65.61  ? 83  PRO B CD  1 
ATOM   1147 N N   . VAL B 1 62 ? 58.017 15.423 9.977  1.00 69.60  ? 84  VAL B N   1 
ATOM   1148 C CA  . VAL B 1 62 ? 56.716 15.989 9.651  1.00 69.60  ? 84  VAL B CA  1 
ATOM   1149 C C   . VAL B 1 62 ? 55.664 15.089 10.266 1.00 69.60  ? 84  VAL B C   1 
ATOM   1150 O O   . VAL B 1 62 ? 54.498 15.455 10.370 1.00 69.60  ? 84  VAL B O   1 
ATOM   1151 C CB  . VAL B 1 62 ? 56.477 16.040 8.139  1.00 94.21  ? 84  VAL B CB  1 
ATOM   1152 C CG1 . VAL B 1 62 ? 55.525 17.178 7.813  1.00 94.21  ? 84  VAL B CG1 1 
ATOM   1153 C CG2 . VAL B 1 62 ? 57.797 16.212 7.405  1.00 94.21  ? 84  VAL B CG2 1 
ATOM   1154 N N   . THR B 1 63 ? 56.094 13.897 10.658 1.00 106.20 ? 85  THR B N   1 
ATOM   1155 C CA  . THR B 1 63 ? 55.218 12.932 11.296 1.00 106.20 ? 85  THR B CA  1 
ATOM   1156 C C   . THR B 1 63 ? 55.057 13.399 12.733 1.00 106.20 ? 85  THR B C   1 
ATOM   1157 O O   . THR B 1 63 ? 56.043 13.762 13.375 1.00 106.20 ? 85  THR B O   1 
ATOM   1158 C CB  . THR B 1 63 ? 55.854 11.538 11.333 1.00 70.98  ? 85  THR B CB  1 
ATOM   1159 O OG1 . THR B 1 63 ? 56.593 11.310 10.128 1.00 70.98  ? 85  THR B OG1 1 
ATOM   1160 C CG2 . THR B 1 63 ? 54.778 10.474 11.503 1.00 70.98  ? 85  THR B CG2 1 
ATOM   1161 N N   . LEU B 1 64 ? 53.831 13.396 13.246 1.00 144.22 ? 86  LEU B N   1 
ATOM   1162 C CA  . LEU B 1 64 ? 53.612 13.827 14.623 1.00 144.22 ? 86  LEU B CA  1 
ATOM   1163 C C   . LEU B 1 64 ? 54.630 13.134 15.526 1.00 144.22 ? 86  LEU B C   1 
ATOM   1164 O O   . LEU B 1 64 ? 55.304 13.779 16.330 1.00 144.22 ? 86  LEU B O   1 
ATOM   1165 C CB  . LEU B 1 64 ? 52.193 13.481 15.078 1.00 194.89 ? 86  LEU B CB  1 
ATOM   1166 C CG  . LEU B 1 64 ? 51.736 14.207 16.348 1.00 194.89 ? 86  LEU B CG  1 
ATOM   1167 C CD1 . LEU B 1 64 ? 51.630 15.701 16.074 1.00 194.89 ? 86  LEU B CD1 1 
ATOM   1168 C CD2 . LEU B 1 64 ? 50.398 13.645 16.812 1.00 194.89 ? 86  LEU B CD2 1 
ATOM   1169 N N   . TRP B 1 65 ? 54.740 11.818 15.371 1.00 86.76  ? 87  TRP B N   1 
ATOM   1170 C CA  . TRP B 1 65 ? 55.676 11.022 16.148 1.00 86.76  ? 87  TRP B CA  1 
ATOM   1171 C C   . TRP B 1 65 ? 57.101 11.445 15.820 1.00 86.76  ? 87  TRP B C   1 
ATOM   1172 O O   . TRP B 1 65 ? 57.888 11.768 16.708 1.00 86.76  ? 87  TRP B O   1 
ATOM   1173 C CB  . TRP B 1 65 ? 55.485 9.536  15.833 1.00 178.09 ? 87  TRP B CB  1 
ATOM   1174 C CG  . TRP B 1 65 ? 54.589 8.817  16.801 1.00 178.09 ? 87  TRP B CG  1 
ATOM   1175 C CD1 . TRP B 1 65 ? 54.659 7.500  17.156 1.00 178.09 ? 87  TRP B CD1 1 
ATOM   1176 C CD2 . TRP B 1 65 ? 53.496 9.376  17.545 1.00 178.09 ? 87  TRP B CD2 1 
ATOM   1177 N NE1 . TRP B 1 65 ? 53.681 7.205  18.074 1.00 178.09 ? 87  TRP B NE1 1 
ATOM   1178 C CE2 . TRP B 1 65 ? 52.953 8.337  18.330 1.00 178.09 ? 87  TRP B CE2 1 
ATOM   1179 C CE3 . TRP B 1 65 ? 52.923 10.653 17.624 1.00 178.09 ? 87  TRP B CE3 1 
ATOM   1180 C CZ2 . TRP B 1 65 ? 51.864 8.537  19.186 1.00 178.09 ? 87  TRP B CZ2 1 
ATOM   1181 C CZ3 . TRP B 1 65 ? 51.839 10.851 18.476 1.00 178.09 ? 87  TRP B CZ3 1 
ATOM   1182 C CH2 . TRP B 1 65 ? 51.323 9.797  19.244 1.00 178.09 ? 87  TRP B CH2 1 
ATOM   1183 N N   . GLY B 1 66 ? 57.428 11.441 14.536 1.00 49.94  ? 88  GLY B N   1 
ATOM   1184 C CA  . GLY B 1 66 ? 58.759 11.836 14.125 1.00 49.94  ? 88  GLY B CA  1 
ATOM   1185 C C   . GLY B 1 66 ? 59.173 13.121 14.808 1.00 49.94  ? 88  GLY B C   1 
ATOM   1186 O O   . GLY B 1 66 ? 60.358 13.329 15.064 1.00 49.94  ? 88  GLY B O   1 
ATOM   1187 N N   . ARG B 1 67 ? 58.195 13.980 15.106 1.00 45.45  ? 89  ARG B N   1 
ATOM   1188 C CA  . ARG B 1 67 ? 58.461 15.256 15.772 1.00 45.45  ? 89  ARG B CA  1 
ATOM   1189 C C   . ARG B 1 67 ? 58.794 15.007 17.236 1.00 45.45  ? 89  ARG B C   1 
ATOM   1190 O O   . ARG B 1 67 ? 59.590 15.725 17.839 1.00 45.45  ? 89  ARG B O   1 
ATOM   1191 C CB  . ARG B 1 67 ? 57.250 16.183 15.662 1.00 92.12  ? 89  ARG B CB  1 
ATOM   1192 C CG  . ARG B 1 67 ? 56.821 16.451 14.230 1.00 92.12  ? 89  ARG B CG  1 
ATOM   1193 C CD  . ARG B 1 67 ? 56.532 17.921 13.982 1.00 92.12  ? 89  ARG B CD  1 
ATOM   1194 N NE  . ARG B 1 67 ? 56.943 18.337 12.642 1.00 92.12  ? 89  ARG B NE  1 
ATOM   1195 C CZ  . ARG B 1 67 ? 56.227 19.125 11.844 1.00 92.12  ? 89  ARG B CZ  1 
ATOM   1196 N NH1 . ARG B 1 67 ? 55.050 19.592 12.244 1.00 92.12  ? 89  ARG B NH1 1 
ATOM   1197 N NH2 . ARG B 1 67 ? 56.687 19.447 10.641 1.00 92.12  ? 89  ARG B NH2 1 
ATOM   1198 N N   . CYS B 1 68 ? 58.180 13.981 17.807 1.00 79.55  ? 90  CYS B N   1 
ATOM   1199 C CA  . CYS B 1 68 ? 58.445 13.637 19.191 1.00 79.55  ? 90  CYS B CA  1 
ATOM   1200 C C   . CYS B 1 68 ? 59.901 13.229 19.254 1.00 79.55  ? 90  CYS B C   1 
ATOM   1201 O O   . CYS B 1 68 ? 60.695 13.852 19.955 1.00 79.55  ? 90  CYS B O   1 
ATOM   1202 C CB  . CYS B 1 68 ? 57.558 12.476 19.639 1.00 115.53 ? 90  CYS B CB  1 
ATOM   1203 S SG  . CYS B 1 68 ? 56.034 12.998 20.460 1.00 115.53 ? 90  CYS B SG  1 
ATOM   1204 N N   . VAL B 1 69 ? 60.244 12.190 18.501 1.00 33.46  ? 91  VAL B N   1 
ATOM   1205 C CA  . VAL B 1 69 ? 61.614 11.697 18.457 1.00 33.46  ? 91  VAL B CA  1 
ATOM   1206 C C   . VAL B 1 69 ? 62.584 12.868 18.339 1.00 33.46  ? 91  VAL B C   1 
ATOM   1207 O O   . VAL B 1 69 ? 63.694 12.833 18.887 1.00 33.46  ? 91  VAL B O   1 
ATOM   1208 C CB  . VAL B 1 69 ? 61.821 10.733 17.270 1.00 14.94  ? 91  VAL B CB  1 
ATOM   1209 C CG1 . VAL B 1 69 ? 63.257 10.217 17.229 1.00 14.94  ? 91  VAL B CG1 1 
ATOM   1210 C CG2 . VAL B 1 69 ? 60.854 9.570  17.397 1.00 14.94  ? 91  VAL B CG2 1 
ATOM   1211 N N   . ALA B 1 70 ? 62.164 13.912 17.634 1.00 36.70  ? 92  ALA B N   1 
ATOM   1212 C CA  . ALA B 1 70 ? 63.009 15.088 17.483 1.00 36.70  ? 92  ALA B CA  1 
ATOM   1213 C C   . ALA B 1 70 ? 63.232 15.716 18.867 1.00 36.70  ? 92  ALA B C   1 
ATOM   1214 O O   . ALA B 1 70 ? 64.370 15.859 19.333 1.00 36.70  ? 92  ALA B O   1 
ATOM   1215 C CB  . ALA B 1 70 ? 62.347 16.088 16.548 1.00 77.48  ? 92  ALA B CB  1 
ATOM   1216 N N   . VAL B 1 71 ? 62.134 16.081 19.524 1.00 83.08  ? 93  VAL B N   1 
ATOM   1217 C CA  . VAL B 1 71 ? 62.206 16.688 20.845 1.00 83.08  ? 93  VAL B CA  1 
ATOM   1218 C C   . VAL B 1 71 ? 63.192 15.915 21.710 1.00 83.08  ? 93  VAL B C   1 
ATOM   1219 O O   . VAL B 1 71 ? 64.144 16.478 22.242 1.00 83.08  ? 93  VAL B O   1 
ATOM   1220 C CB  . VAL B 1 71 ? 60.826 16.694 21.529 1.00 42.20  ? 93  VAL B CB  1 
ATOM   1221 C CG1 . VAL B 1 71 ? 60.982 16.508 23.026 1.00 42.20  ? 93  VAL B CG1 1 
ATOM   1222 C CG2 . VAL B 1 71 ? 60.112 17.999 21.239 1.00 42.20  ? 93  VAL B CG2 1 
ATOM   1223 N N   . VAL B 1 72 ? 62.959 14.617 21.842 1.00 34.68  ? 94  VAL B N   1 
ATOM   1224 C CA  . VAL B 1 72 ? 63.833 13.777 22.639 1.00 34.68  ? 94  VAL B CA  1 
ATOM   1225 C C   . VAL B 1 72 ? 65.286 13.961 22.235 1.00 34.68  ? 94  VAL B C   1 
ATOM   1226 O O   . VAL B 1 72 ? 66.103 14.438 23.028 1.00 34.68  ? 94  VAL B O   1 
ATOM   1227 C CB  . VAL B 1 72 ? 63.475 12.294 22.478 1.00 45.50  ? 94  VAL B CB  1 
ATOM   1228 C CG1 . VAL B 1 72 ? 64.684 11.416 22.815 1.00 45.50  ? 94  VAL B CG1 1 
ATOM   1229 C CG2 . VAL B 1 72 ? 62.287 11.958 23.367 1.00 45.50  ? 94  VAL B CG2 1 
ATOM   1230 N N   . VAL B 1 73 ? 65.609 13.583 21.001 1.00 37.44  ? 95  VAL B N   1 
ATOM   1231 C CA  . VAL B 1 73 ? 66.979 13.701 20.522 1.00 37.44  ? 95  VAL B CA  1 
ATOM   1232 C C   . VAL B 1 73 ? 67.511 15.118 20.725 1.00 37.44  ? 95  VAL B C   1 
ATOM   1233 O O   . VAL B 1 73 ? 68.715 15.358 20.637 1.00 37.44  ? 95  VAL B O   1 
ATOM   1234 C CB  . VAL B 1 73 ? 67.086 13.319 19.038 1.00 65.46  ? 95  VAL B CB  1 
ATOM   1235 C CG1 . VAL B 1 73 ? 66.264 14.267 18.211 1.00 65.46  ? 95  VAL B CG1 1 
ATOM   1236 C CG2 . VAL B 1 73 ? 68.538 13.347 18.592 1.00 65.46  ? 95  VAL B CG2 1 
ATOM   1237 N N   . MET B 1 74 ? 66.615 16.057 21.001 1.00 69.60  ? 96  MET B N   1 
ATOM   1238 C CA  . MET B 1 74 ? 67.040 17.422 21.228 1.00 69.60  ? 96  MET B CA  1 
ATOM   1239 C C   . MET B 1 74 ? 67.555 17.584 22.647 1.00 69.60  ? 96  MET B C   1 
ATOM   1240 O O   . MET B 1 74 ? 68.742 17.826 22.850 1.00 69.60  ? 96  MET B O   1 
ATOM   1241 C CB  . MET B 1 74 ? 65.896 18.391 20.997 1.00 63.55  ? 96  MET B CB  1 
ATOM   1242 C CG  . MET B 1 74 ? 66.090 19.266 19.794 1.00 63.55  ? 96  MET B CG  1 
ATOM   1243 S SD  . MET B 1 74 ? 64.552 19.353 18.925 1.00 63.55  ? 96  MET B SD  1 
ATOM   1244 C CE  . MET B 1 74 ? 64.230 21.108 18.951 1.00 63.55  ? 96  MET B CE  1 
ATOM   1245 N N   . VAL B 1 75 ? 66.672 17.450 23.634 1.00 83.36  ? 97  VAL B N   1 
ATOM   1246 C CA  . VAL B 1 75 ? 67.094 17.596 25.025 1.00 83.36  ? 97  VAL B CA  1 
ATOM   1247 C C   . VAL B 1 75 ? 68.340 16.763 25.272 1.00 83.36  ? 97  VAL B C   1 
ATOM   1248 O O   . VAL B 1 75 ? 69.311 17.248 25.847 1.00 83.36  ? 97  VAL B O   1 
ATOM   1249 C CB  . VAL B 1 75 ? 65.978 17.175 26.020 1.00 82.94  ? 97  VAL B CB  1 
ATOM   1250 C CG1 . VAL B 1 75 ? 64.622 17.503 25.433 1.00 82.94  ? 97  VAL B CG1 1 
ATOM   1251 C CG2 . VAL B 1 75 ? 66.079 15.692 26.358 1.00 82.94  ? 97  VAL B CG2 1 
ATOM   1252 N N   . ALA B 1 76 ? 68.311 15.514 24.819 1.00 38.06  ? 98  ALA B N   1 
ATOM   1253 C CA  . ALA B 1 76 ? 69.451 14.623 24.975 1.00 38.06  ? 98  ALA B CA  1 
ATOM   1254 C C   . ALA B 1 76 ? 70.728 15.421 24.747 1.00 38.06  ? 98  ALA B C   1 
ATOM   1255 O O   . ALA B 1 76 ? 71.690 15.303 25.494 1.00 38.06  ? 98  ALA B O   1 
ATOM   1256 C CB  . ALA B 1 76 ? 69.365 13.488 23.970 1.00 34.71  ? 98  ALA B CB  1 
ATOM   1257 N N   . GLY B 1 77 ? 70.722 16.250 23.714 1.00 42.71  ? 99  GLY B N   1 
ATOM   1258 C CA  . GLY B 1 77 ? 71.886 17.056 23.416 1.00 42.71  ? 99  GLY B CA  1 
ATOM   1259 C C   . GLY B 1 77 ? 72.052 18.252 24.338 1.00 42.71  ? 99  GLY B C   1 
ATOM   1260 O O   . GLY B 1 77 ? 73.131 18.455 24.894 1.00 42.71  ? 99  GLY B O   1 
ATOM   1261 N N   . ILE B 1 78 ? 71.001 19.053 24.496 1.00 89.67  ? 100 ILE B N   1 
ATOM   1262 C CA  . ILE B 1 78 ? 71.075 20.229 25.359 1.00 89.67  ? 100 ILE B CA  1 
ATOM   1263 C C   . ILE B 1 78 ? 71.540 19.788 26.736 1.00 89.67  ? 100 ILE B C   1 
ATOM   1264 O O   . ILE B 1 78 ? 72.267 20.499 27.429 1.00 89.67  ? 100 ILE B O   1 
ATOM   1265 C CB  . ILE B 1 78 ? 69.697 20.911 25.532 1.00 101.80 ? 100 ILE B CB  1 
ATOM   1266 C CG1 . ILE B 1 78 ? 68.972 20.997 24.190 1.00 101.80 ? 100 ILE B CG1 1 
ATOM   1267 C CG2 . ILE B 1 78 ? 69.877 22.304 26.125 1.00 101.80 ? 100 ILE B CG2 1 
ATOM   1268 C CD1 . ILE B 1 78 ? 67.549 21.496 24.308 1.00 101.80 ? 100 ILE B CD1 1 
ATOM   1269 N N   . THR B 1 79 ? 71.110 18.592 27.112 1.00 33.13  ? 101 THR B N   1 
ATOM   1270 C CA  . THR B 1 79 ? 71.424 18.005 28.396 1.00 33.13  ? 101 THR B CA  1 
ATOM   1271 C C   . THR B 1 79 ? 72.770 17.292 28.392 1.00 33.13  ? 101 THR B C   1 
ATOM   1272 O O   . THR B 1 79 ? 73.688 17.712 29.082 1.00 33.13  ? 101 THR B O   1 
ATOM   1273 C CB  . THR B 1 79 ? 70.298 17.039 28.793 1.00 40.71  ? 101 THR B CB  1 
ATOM   1274 O OG1 . THR B 1 79 ? 69.341 17.754 29.580 1.00 40.71  ? 101 THR B OG1 1 
ATOM   1275 C CG2 . THR B 1 79 ? 70.833 15.834 29.560 1.00 40.71  ? 101 THR B CG2 1 
ATOM   1276 N N   . SER B 1 80 ? 72.901 16.223 27.617 1.00 74.82  ? 102 SER B N   1 
ATOM   1277 C CA  . SER B 1 80 ? 74.163 15.499 27.574 1.00 74.82  ? 102 SER B CA  1 
ATOM   1278 C C   . SER B 1 80 ? 75.350 16.460 27.520 1.00 74.82  ? 102 SER B C   1 
ATOM   1279 O O   . SER B 1 80 ? 76.403 16.193 28.097 1.00 74.82  ? 102 SER B O   1 
ATOM   1280 C CB  . SER B 1 80 ? 74.209 14.568 26.360 1.00 129.14 ? 102 SER B CB  1 
ATOM   1281 O OG  . SER B 1 80 ? 75.407 14.748 25.620 1.00 129.14 ? 102 SER B OG  1 
ATOM   1282 N N   . PHE B 1 81 ? 75.183 17.585 26.835 1.00 82.30  ? 103 PHE B N   1 
ATOM   1283 C CA  . PHE B 1 81 ? 76.267 18.549 26.725 1.00 82.30  ? 103 PHE B CA  1 
ATOM   1284 C C   . PHE B 1 81 ? 76.363 19.438 27.949 1.00 82.30  ? 103 PHE B C   1 
ATOM   1285 O O   . PHE B 1 81 ? 77.450 19.867 28.324 1.00 82.30  ? 103 PHE B O   1 
ATOM   1286 C CB  . PHE B 1 81 ? 76.094 19.397 25.468 1.00 64.16  ? 103 PHE B CB  1 
ATOM   1287 C CG  . PHE B 1 81 ? 76.813 18.844 24.280 1.00 64.16  ? 103 PHE B CG  1 
ATOM   1288 C CD1 . PHE B 1 81 ? 78.200 18.809 24.253 1.00 64.16  ? 103 PHE B CD1 1 
ATOM   1289 C CD2 . PHE B 1 81 ? 76.111 18.319 23.208 1.00 64.16  ? 103 PHE B CD2 1 
ATOM   1290 C CE1 . PHE B 1 81 ? 78.881 18.258 23.175 1.00 64.16  ? 103 PHE B CE1 1 
ATOM   1291 C CE2 . PHE B 1 81 ? 76.780 17.766 22.126 1.00 64.16  ? 103 PHE B CE2 1 
ATOM   1292 C CZ  . PHE B 1 81 ? 78.170 17.735 22.111 1.00 64.16  ? 103 PHE B CZ  1 
ATOM   1293 N N   . GLY B 1 82 ? 75.224 19.707 28.575 1.00 89.20  ? 104 GLY B N   1 
ATOM   1294 C CA  . GLY B 1 82 ? 75.215 20.541 29.765 1.00 89.20  ? 104 GLY B CA  1 
ATOM   1295 C C   . GLY B 1 82 ? 76.117 19.974 30.841 1.00 89.20  ? 104 GLY B C   1 
ATOM   1296 O O   . GLY B 1 82 ? 76.928 20.691 31.424 1.00 89.20  ? 104 GLY B O   1 
ATOM   1297 N N   . LEU B 1 83 ? 75.972 18.680 31.102 1.00 68.52  ? 105 LEU B N   1 
ATOM   1298 C CA  . LEU B 1 83 ? 76.787 18.013 32.098 1.00 68.52  ? 105 LEU B CA  1 
ATOM   1299 C C   . LEU B 1 83 ? 78.257 18.317 31.843 1.00 68.52  ? 105 LEU B C   1 
ATOM   1300 O O   . LEU B 1 83 ? 78.965 18.786 32.733 1.00 68.52  ? 105 LEU B O   1 
ATOM   1301 C CB  . LEU B 1 83 ? 76.557 16.509 32.038 1.00 76.56  ? 105 LEU B CB  1 
ATOM   1302 C CG  . LEU B 1 83 ? 75.600 15.973 33.095 1.00 76.56  ? 105 LEU B CG  1 
ATOM   1303 C CD1 . LEU B 1 83 ? 74.251 15.668 32.470 1.00 76.56  ? 105 LEU B CD1 1 
ATOM   1304 C CD2 . LEU B 1 83 ? 76.198 14.728 33.721 1.00 76.56  ? 105 LEU B CD2 1 
ATOM   1305 N N   . VAL B 1 84 ? 78.715 18.051 30.624 1.00 48.29  ? 106 VAL B N   1 
ATOM   1306 C CA  . VAL B 1 84 ? 80.106 18.308 30.265 1.00 48.29  ? 106 VAL B CA  1 
ATOM   1307 C C   . VAL B 1 84 ? 80.507 19.722 30.653 1.00 48.29  ? 106 VAL B C   1 
ATOM   1308 O O   . VAL B 1 84 ? 81.655 19.965 31.013 1.00 48.29  ? 106 VAL B O   1 
ATOM   1309 C CB  . VAL B 1 84 ? 80.344 18.128 28.755 1.00 51.36  ? 106 VAL B CB  1 
ATOM   1310 C CG1 . VAL B 1 84 ? 81.797 18.441 28.411 1.00 51.36  ? 106 VAL B CG1 1 
ATOM   1311 C CG2 . VAL B 1 84 ? 79.991 16.709 28.345 1.00 51.36  ? 106 VAL B CG2 1 
ATOM   1312 N N   . THR B 1 85 ? 79.567 20.657 30.571 1.00 71.86  ? 107 THR B N   1 
ATOM   1313 C CA  . THR B 1 85 ? 79.866 22.029 30.950 1.00 71.86  ? 107 THR B CA  1 
ATOM   1314 C C   . THR B 1 85 ? 79.926 22.066 32.461 1.00 71.86  ? 107 THR B C   1 
ATOM   1315 O O   . THR B 1 85 ? 80.798 22.708 33.038 1.00 71.86  ? 107 THR B O   1 
ATOM   1316 C CB  . THR B 1 85 ? 78.789 23.014 30.470 1.00 114.25 ? 107 THR B CB  1 
ATOM   1317 O OG1 . THR B 1 85 ? 79.250 23.671 29.285 1.00 114.25 ? 107 THR B OG1 1 
ATOM   1318 C CG2 . THR B 1 85 ? 78.507 24.073 31.533 1.00 114.25 ? 107 THR B CG2 1 
ATOM   1319 N N   . ALA B 1 86 ? 78.988 21.369 33.096 1.00 76.84  ? 108 ALA B N   1 
ATOM   1320 C CA  . ALA B 1 86 ? 78.939 21.302 34.549 1.00 76.84  ? 108 ALA B CA  1 
ATOM   1321 C C   . ALA B 1 86 ? 80.275 20.763 35.022 1.00 76.84  ? 108 ALA B C   1 
ATOM   1322 O O   . ALA B 1 86 ? 80.965 21.395 35.820 1.00 76.84  ? 108 ALA B O   1 
ATOM   1323 C CB  . ALA B 1 86 ? 77.820 20.381 34.995 1.00 61.29  ? 108 ALA B CB  1 
ATOM   1324 N N   . ALA B 1 87 ? 80.634 19.590 34.514 1.00 64.82  ? 109 ALA B N   1 
ATOM   1325 C CA  . ALA B 1 87 ? 81.896 18.960 34.863 1.00 64.82  ? 109 ALA B CA  1 
ATOM   1326 C C   . ALA B 1 87 ? 82.994 20.012 34.864 1.00 64.82  ? 109 ALA B C   1 
ATOM   1327 O O   . ALA B 1 87 ? 83.666 20.226 35.866 1.00 64.82  ? 109 ALA B O   1 
ATOM   1328 C CB  . ALA B 1 87 ? 82.225 17.872 33.857 1.00 16.74  ? 109 ALA B CB  1 
ATOM   1329 N N   . LEU B 1 88 ? 83.159 20.682 33.734 1.00 54.77  ? 110 LEU B N   1 
ATOM   1330 C CA  . LEU B 1 88 ? 84.183 21.705 33.597 1.00 54.77  ? 110 LEU B CA  1 
ATOM   1331 C C   . LEU B 1 88 ? 84.015 22.880 34.559 1.00 54.77  ? 110 LEU B C   1 
ATOM   1332 O O   . LEU B 1 88 ? 85.003 23.438 35.032 1.00 54.77  ? 110 LEU B O   1 
ATOM   1333 C CB  . LEU B 1 88 ? 84.206 22.219 32.153 1.00 79.82  ? 110 LEU B CB  1 
ATOM   1334 C CG  . LEU B 1 88 ? 85.076 21.436 31.165 1.00 79.82  ? 110 LEU B CG  1 
ATOM   1335 C CD1 . LEU B 1 88 ? 84.561 20.009 31.022 1.00 79.82  ? 110 LEU B CD1 1 
ATOM   1336 C CD2 . LEU B 1 88 ? 85.074 22.149 29.828 1.00 79.82  ? 110 LEU B CD2 1 
ATOM   1337 N N   . ALA B 1 89 ? 82.772 23.259 34.843 1.00 102.37 ? 111 ALA B N   1 
ATOM   1338 C CA  . ALA B 1 89 ? 82.506 24.382 35.740 1.00 102.37 ? 111 ALA B CA  1 
ATOM   1339 C C   . ALA B 1 89 ? 83.057 24.132 37.130 1.00 102.37 ? 111 ALA B C   1 
ATOM   1340 O O   . ALA B 1 89 ? 83.491 25.062 37.799 1.00 102.37 ? 111 ALA B O   1 
ATOM   1341 C CB  . ALA B 1 89 ? 81.012 24.653 35.826 1.00 73.23  ? 111 ALA B CB  1 
ATOM   1342 N N   . THR B 1 90 ? 83.037 22.876 37.566 1.00 129.01 ? 112 THR B N   1 
ATOM   1343 C CA  . THR B 1 90 ? 83.539 22.527 38.891 1.00 129.01 ? 112 THR B CA  1 
ATOM   1344 C C   . THR B 1 90 ? 85.041 22.268 38.878 1.00 129.01 ? 112 THR B C   1 
ATOM   1345 O O   . THR B 1 90 ? 85.751 22.654 39.807 1.00 129.01 ? 112 THR B O   1 
ATOM   1346 C CB  . THR B 1 90 ? 82.835 21.278 39.449 1.00 76.73  ? 112 THR B CB  1 
ATOM   1347 O OG1 . THR B 1 90 ? 83.652 20.124 39.228 1.00 76.73  ? 112 THR B OG1 1 
ATOM   1348 C CG2 . THR B 1 90 ? 81.497 21.069 38.772 1.00 76.73  ? 112 THR B CG2 1 
ATOM   1349 N N   . TRP B 1 91 ? 85.523 21.611 37.828 1.00 102.90 ? 113 TRP B N   1 
ATOM   1350 C CA  . TRP B 1 91 ? 86.947 21.304 37.698 1.00 102.90 ? 113 TRP B CA  1 
ATOM   1351 C C   . TRP B 1 91 ? 87.757 22.596 37.613 1.00 102.90 ? 113 TRP B C   1 
ATOM   1352 O O   . TRP B 1 91 ? 88.984 22.578 37.509 1.00 102.90 ? 113 TRP B O   1 
ATOM   1353 C CB  . TRP B 1 91 ? 87.185 20.446 36.450 1.00 165.57 ? 113 TRP B CB  1 
ATOM   1354 C CG  . TRP B 1 91 ? 88.617 20.074 36.231 1.00 165.57 ? 113 TRP B CG  1 
ATOM   1355 C CD1 . TRP B 1 91 ? 89.358 19.175 36.941 1.00 165.57 ? 113 TRP B CD1 1 
ATOM   1356 C CD2 . TRP B 1 91 ? 89.482 20.588 35.208 1.00 165.57 ? 113 TRP B CD2 1 
ATOM   1357 N NE1 . TRP B 1 91 ? 90.631 19.096 36.419 1.00 165.57 ? 113 TRP B NE1 1 
ATOM   1358 C CE2 . TRP B 1 91 ? 90.734 19.950 35.357 1.00 165.57 ? 113 TRP B CE2 1 
ATOM   1359 C CE3 . TRP B 1 91 ? 89.312 21.528 34.181 1.00 165.57 ? 113 TRP B CE3 1 
ATOM   1360 C CZ2 . TRP B 1 91 ? 91.809 20.219 34.517 1.00 165.57 ? 113 TRP B CZ2 1 
ATOM   1361 C CZ3 . TRP B 1 91 ? 90.386 21.793 33.344 1.00 165.57 ? 113 TRP B CZ3 1 
ATOM   1362 C CH2 . TRP B 1 91 ? 91.618 21.143 33.515 1.00 165.57 ? 113 TRP B CH2 1 
ATOM   1363 N N   . PHE B 1 92 ? 87.048 23.719 37.650 1.00 112.88 ? 114 PHE B N   1 
ATOM   1364 C CA  . PHE B 1 92 ? 87.675 25.028 37.609 1.00 112.88 ? 114 PHE B CA  1 
ATOM   1365 C C   . PHE B 1 92 ? 87.554 25.617 39.002 1.00 112.88 ? 114 PHE B C   1 
ATOM   1366 O O   . PHE B 1 92 ? 88.245 26.569 39.357 1.00 112.88 ? 114 PHE B O   1 
ATOM   1367 C CB  . PHE B 1 92 ? 86.985 25.921 36.578 1.00 135.15 ? 114 PHE B CB  1 
ATOM   1368 C CG  . PHE B 1 92 ? 87.634 25.884 35.225 1.00 135.15 ? 114 PHE B CG  1 
ATOM   1369 C CD1 . PHE B 1 92 ? 88.728 25.052 34.993 1.00 135.15 ? 114 PHE B CD1 1 
ATOM   1370 C CD2 . PHE B 1 92 ? 87.160 26.675 34.185 1.00 135.15 ? 114 PHE B CD2 1 
ATOM   1371 C CE1 . PHE B 1 92 ? 89.340 25.009 33.748 1.00 135.15 ? 114 PHE B CE1 1 
ATOM   1372 C CE2 . PHE B 1 92 ? 87.769 26.640 32.933 1.00 135.15 ? 114 PHE B CE2 1 
ATOM   1373 C CZ  . PHE B 1 92 ? 88.863 25.802 32.715 1.00 135.15 ? 114 PHE B CZ  1 
ATOM   1374 N N   . VAL B 1 93 ? 86.659 25.024 39.788 1.00 146.34 ? 115 VAL B N   1 
ATOM   1375 C CA  . VAL B 1 93 ? 86.428 25.424 41.171 1.00 146.34 ? 115 VAL B CA  1 
ATOM   1376 C C   . VAL B 1 93 ? 87.332 24.524 42.015 1.00 146.34 ? 115 VAL B C   1 
ATOM   1377 O O   . VAL B 1 93 ? 87.728 24.884 43.123 1.00 146.34 ? 115 VAL B O   1 
ATOM   1378 C CB  . VAL B 1 93 ? 84.939 25.228 41.557 1.00 100.10 ? 115 VAL B CB  1 
ATOM   1379 C CG1 . VAL B 1 93 ? 84.780 25.081 43.059 1.00 100.10 ? 115 VAL B CG1 1 
ATOM   1380 C CG2 . VAL B 1 93 ? 84.118 26.407 41.069 1.00 100.10 ? 115 VAL B CG2 1 
ATOM   1381 N N   . GLY B 1 94 ? 87.670 23.358 41.462 1.00 138.06 ? 116 GLY B N   1 
ATOM   1382 C CA  . GLY B 1 94 ? 88.548 22.413 42.140 1.00 138.06 ? 116 GLY B CA  1 
ATOM   1383 C C   . GLY B 1 94 ? 89.968 22.951 42.133 1.00 138.06 ? 116 GLY B C   1 
ATOM   1384 O O   . GLY B 1 94 ? 90.952 22.208 42.131 1.00 138.06 ? 116 GLY B O   1 
ATOM   1385 N N   . ARG B 1 95 ? 90.045 24.275 42.103 1.00 87.46  ? 117 ARG B N   1 
ATOM   1386 C CA  . ARG B 1 95 ? 91.293 25.014 42.110 1.00 87.46  ? 117 ARG B CA  1 
ATOM   1387 C C   . ARG B 1 95 ? 90.993 26.263 42.931 1.00 87.46  ? 117 ARG B C   1 
ATOM   1388 O O   . ARG B 1 95 ? 91.228 27.397 42.498 1.00 87.46  ? 117 ARG B O   1 
ATOM   1389 C CB  . ARG B 1 95 ? 91.705 25.388 40.687 1.00 115.28 ? 117 ARG B CB  1 
ATOM   1390 C CG  . ARG B 1 95 ? 92.604 24.362 40.028 1.00 115.28 ? 117 ARG B CG  1 
ATOM   1391 C CD  . ARG B 1 95 ? 94.062 24.632 40.346 1.00 115.28 ? 117 ARG B CD  1 
ATOM   1392 N NE  . ARG B 1 95 ? 94.937 23.597 39.807 1.00 115.28 ? 117 ARG B NE  1 
ATOM   1393 N N   . GLU B 1 96 ? 90.438 26.019 44.116 1.00 227.64 ? 118 GLU B N   1 
ATOM   1394 C CA  . GLU B 1 96 ? 90.078 27.060 45.071 1.00 227.64 ? 118 GLU B CA  1 
ATOM   1395 C C   . GLU B 1 96 ? 91.078 26.996 46.222 1.00 227.64 ? 118 GLU B C   1 
ATOM   1396 O O   . GLU B 1 96 ? 91.247 27.958 46.972 1.00 227.64 ? 118 GLU B O   1 
ATOM   1397 C CB  . GLU B 1 96 ? 88.663 26.816 45.611 1.00 173.47 ? 118 GLU B CB  1 
ATOM   1398 C CG  . GLU B 1 96 ? 88.535 25.565 46.479 1.00 173.47 ? 118 GLU B CG  1 
ATOM   1399 C CD  . GLU B 1 96 ? 87.181 25.447 47.161 1.00 173.47 ? 118 GLU B CD  1 
ATOM   1400 O OE1 . GLU B 1 96 ? 86.438 26.452 47.206 1.00 173.47 ? 118 GLU B OE1 1 
ATOM   1401 O OE2 . GLU B 1 96 ? 86.860 24.345 47.654 1.00 173.47 ? 118 GLU B OE2 1 
ATOM   1402 N N   . GLN B 1 97 ? 91.734 25.846 46.350 1.00 156.48 ? 119 GLN B N   1 
ATOM   1403 C CA  . GLN B 1 97 ? 92.720 25.620 47.396 1.00 156.48 ? 119 GLN B CA  1 
ATOM   1404 C C   . GLN B 1 97 ? 93.927 26.549 47.187 1.00 156.48 ? 119 GLN B C   1 
ATOM   1405 O O   . GLN B 1 97 ? 94.424 27.103 48.192 1.00 156.48 ? 119 GLN B O   1 
ATOM   1406 C CB  . GLN B 1 97 ? 93.166 24.164 47.346 1.00 167.90 ? 119 GLN B CB  1 
ATOM   1407 C CG  . GLN B 1 97 ? 94.138 23.947 46.215 1.00 167.90 ? 119 GLN B CG  1 
ATOM   1408 C CD  . GLN B 1 97 ? 93.924 22.709 45.391 1.00 167.90 ? 119 GLN B CD  1 
ATOM   1409 O OE1 . GLN B 1 97 ? 94.882 22.044 45.056 1.00 167.90 ? 119 GLN B OE1 1 
ATOM   1410 N NE2 . GLN B 1 97 ? 92.688 22.407 45.035 1.00 167.90 ? 119 GLN B NE2 1 
ATOM   1411 N N   . ALA C 1 1  ? 96.625 31.050 36.298 1.00 185.72 ? 23  ALA C N   1 
ATOM   1412 C CA  . ALA C 1 1  ? 95.577 30.238 36.984 1.00 185.72 ? 23  ALA C CA  1 
ATOM   1413 C C   . ALA C 1 1  ? 95.222 29.007 36.158 1.00 185.72 ? 23  ALA C C   1 
ATOM   1414 O O   . ALA C 1 1  ? 96.082 28.172 35.866 1.00 185.72 ? 23  ALA C O   1 
ATOM   1415 C CB  . ALA C 1 1  ? 94.327 31.090 37.216 1.00 81.17  ? 23  ALA C CB  1 
ATOM   1416 N N   . LEU C 1 2  ? 93.949 28.903 35.788 1.00 139.11 ? 24  LEU C N   1 
ATOM   1417 C CA  . LEU C 1 2  ? 93.456 27.789 34.988 1.00 139.11 ? 24  LEU C CA  1 
ATOM   1418 C C   . LEU C 1 2  ? 92.067 28.110 34.456 1.00 139.11 ? 24  LEU C C   1 
ATOM   1419 O O   . LEU C 1 2  ? 91.887 28.364 33.268 1.00 139.11 ? 24  LEU C O   1 
ATOM   1420 C CB  . LEU C 1 2  ? 93.397 26.514 35.828 1.00 97.45  ? 24  LEU C CB  1 
ATOM   1421 C CG  . LEU C 1 2  ? 92.938 25.259 35.086 1.00 97.45  ? 24  LEU C CG  1 
ATOM   1422 C CD1 . LEU C 1 2  ? 94.125 24.328 34.882 1.00 97.45  ? 24  LEU C CD1 1 
ATOM   1423 C CD2 . LEU C 1 2  ? 91.836 24.564 35.871 1.00 97.45  ? 24  LEU C CD2 1 
ATOM   1424 N N   . HIS C 1 3  ? 91.085 28.097 35.348 1.00 125.98 ? 25  HIS C N   1 
ATOM   1425 C CA  . HIS C 1 3  ? 89.712 28.393 34.978 1.00 125.98 ? 25  HIS C CA  1 
ATOM   1426 C C   . HIS C 1 3  ? 89.646 29.620 34.077 1.00 125.98 ? 25  HIS C C   1 
ATOM   1427 O O   . HIS C 1 3  ? 88.770 29.728 33.226 1.00 125.98 ? 25  HIS C O   1 
ATOM   1428 C CB  . HIS C 1 3  ? 88.875 28.637 36.237 1.00 139.32 ? 25  HIS C CB  1 
ATOM   1429 C CG  . HIS C 1 3  ? 88.826 30.073 36.660 1.00 139.32 ? 25  HIS C CG  1 
ATOM   1430 N ND1 . HIS C 1 3  ? 87.709 30.862 36.491 1.00 139.32 ? 25  HIS C ND1 1 
ATOM   1431 C CD2 . HIS C 1 3  ? 89.761 30.866 37.232 1.00 139.32 ? 25  HIS C CD2 1 
ATOM   1432 C CE1 . HIS C 1 3  ? 87.958 32.079 36.940 1.00 139.32 ? 25  HIS C CE1 1 
ATOM   1433 N NE2 . HIS C 1 3  ? 89.197 32.109 37.395 1.00 139.32 ? 25  HIS C NE2 1 
ATOM   1434 N N   . TRP C 1 4  ? 90.588 30.535 34.272 1.00 78.73  ? 26  TRP C N   1 
ATOM   1435 C CA  . TRP C 1 4  ? 90.641 31.776 33.512 1.00 78.73  ? 26  TRP C CA  1 
ATOM   1436 C C   . TRP C 1 4  ? 91.665 31.723 32.388 1.00 78.73  ? 26  TRP C C   1 
ATOM   1437 O O   . TRP C 1 4  ? 91.692 32.604 31.527 1.00 78.73  ? 26  TRP C O   1 
ATOM   1438 C CB  . TRP C 1 4  ? 90.989 32.930 34.454 1.00 190.57 ? 26  TRP C CB  1 
ATOM   1439 C CG  . TRP C 1 4  ? 90.245 34.204 34.204 1.00 190.57 ? 26  TRP C CG  1 
ATOM   1440 C CD1 . TRP C 1 4  ? 90.748 35.470 34.284 1.00 190.57 ? 26  TRP C CD1 1 
ATOM   1441 C CD2 . TRP C 1 4  ? 88.858 34.343 33.874 1.00 190.57 ? 26  TRP C CD2 1 
ATOM   1442 N NE1 . TRP C 1 4  ? 89.761 36.391 34.029 1.00 190.57 ? 26  TRP C NE1 1 
ATOM   1443 C CE2 . TRP C 1 4  ? 88.590 35.728 33.773 1.00 190.57 ? 26  TRP C CE2 1 
ATOM   1444 C CE3 . TRP C 1 4  ? 87.813 33.435 33.655 1.00 190.57 ? 26  TRP C CE3 1 
ATOM   1445 C CZ2 . TRP C 1 4  ? 87.319 36.227 33.462 1.00 190.57 ? 26  TRP C CZ2 1 
ATOM   1446 C CZ3 . TRP C 1 4  ? 86.547 33.932 33.346 1.00 190.57 ? 26  TRP C CZ3 1 
ATOM   1447 C CH2 . TRP C 1 4  ? 86.313 35.317 33.253 1.00 190.57 ? 26  TRP C CH2 1 
ATOM   1448 N N   . ARG C 1 5  ? 92.512 30.699 32.397 1.00 123.92 ? 27  ARG C N   1 
ATOM   1449 C CA  . ARG C 1 5  ? 93.545 30.568 31.378 1.00 123.92 ? 27  ARG C CA  1 
ATOM   1450 C C   . ARG C 1 5  ? 93.339 29.357 30.490 1.00 123.92 ? 27  ARG C C   1 
ATOM   1451 O O   . ARG C 1 5  ? 93.842 29.314 29.369 1.00 123.92 ? 27  ARG C O   1 
ATOM   1452 C CB  . ARG C 1 5  ? 94.926 30.489 32.032 1.00 184.77 ? 27  ARG C CB  1 
ATOM   1453 N N   . ALA C 1 6  ? 92.611 28.368 30.994 1.00 122.00 ? 28  ALA C N   1 
ATOM   1454 C CA  . ALA C 1 6  ? 92.338 27.161 30.223 1.00 122.00 ? 28  ALA C CA  1 
ATOM   1455 C C   . ALA C 1 6  ? 91.328 27.510 29.137 1.00 122.00 ? 28  ALA C C   1 
ATOM   1456 O O   . ALA C 1 6  ? 91.151 26.766 28.168 1.00 122.00 ? 28  ALA C O   1 
ATOM   1457 C CB  . ALA C 1 6  ? 91.781 26.073 31.131 1.00 172.75 ? 28  ALA C CB  1 
ATOM   1458 N N   . ALA C 1 7  ? 90.675 28.656 29.315 1.00 88.61  ? 29  ALA C N   1 
ATOM   1459 C CA  . ALA C 1 7  ? 89.677 29.148 28.375 1.00 88.61  ? 29  ALA C CA  1 
ATOM   1460 C C   . ALA C 1 7  ? 90.327 30.043 27.328 1.00 88.61  ? 29  ALA C C   1 
ATOM   1461 O O   . ALA C 1 7  ? 90.391 29.693 26.150 1.00 88.61  ? 29  ALA C O   1 
ATOM   1462 C CB  . ALA C 1 7  ? 88.596 29.920 29.121 1.00 113.77 ? 29  ALA C CB  1 
ATOM   1463 N N   . GLY C 1 8  ? 90.808 31.202 27.765 1.00 117.70 ? 30  GLY C N   1 
ATOM   1464 C CA  . GLY C 1 8  ? 91.451 32.122 26.850 1.00 117.70 ? 30  GLY C CA  1 
ATOM   1465 C C   . GLY C 1 8  ? 92.375 31.418 25.874 1.00 117.70 ? 30  GLY C C   1 
ATOM   1466 O O   . GLY C 1 8  ? 92.668 31.948 24.803 1.00 117.70 ? 30  GLY C O   1 
ATOM   1467 N N   . ALA C 1 9  ? 92.831 30.220 26.230 1.00 127.14 ? 31  ALA C N   1 
ATOM   1468 C CA  . ALA C 1 9  ? 93.731 29.469 25.363 1.00 127.14 ? 31  ALA C CA  1 
ATOM   1469 C C   . ALA C 1 9  ? 93.002 28.480 24.475 1.00 127.14 ? 31  ALA C C   1 
ATOM   1470 O O   . ALA C 1 9  ? 93.350 28.315 23.307 1.00 127.14 ? 31  ALA C O   1 
ATOM   1471 C CB  . ALA C 1 9  ? 94.766 28.732 26.193 1.00 157.58 ? 31  ALA C CB  1 
ATOM   1472 N N   . ALA C 1 10 ? 91.998 27.814 25.031 1.00 135.47 ? 32  ALA C N   1 
ATOM   1473 C CA  . ALA C 1 10 ? 91.237 26.830 24.275 1.00 135.47 ? 32  ALA C CA  1 
ATOM   1474 C C   . ALA C 1 10 ? 90.708 27.419 22.988 1.00 135.47 ? 32  ALA C C   1 
ATOM   1475 O O   . ALA C 1 10 ? 90.768 26.787 21.940 1.00 135.47 ? 32  ALA C O   1 
ATOM   1476 C CB  . ALA C 1 10 ? 90.087 26.314 25.096 1.00 170.66 ? 32  ALA C CB  1 
ATOM   1477 N N   . THR C 1 11 ? 90.171 28.628 23.070 1.00 93.46  ? 33  THR C N   1 
ATOM   1478 C CA  . THR C 1 11 ? 89.641 29.268 21.882 1.00 93.46  ? 33  THR C CA  1 
ATOM   1479 C C   . THR C 1 11 ? 90.686 29.202 20.775 1.00 93.46  ? 33  THR C C   1 
ATOM   1480 O O   . THR C 1 11 ? 90.361 28.891 19.632 1.00 93.46  ? 33  THR C O   1 
ATOM   1481 C CB  . THR C 1 11 ? 89.271 30.732 22.142 1.00 50.04  ? 33  THR C CB  1 
ATOM   1482 O OG1 . THR C 1 11 ? 90.455 31.533 22.118 1.00 50.04  ? 33  THR C OG1 1 
ATOM   1483 C CG2 . THR C 1 11 ? 88.574 30.879 23.487 1.00 50.04  ? 33  THR C CG2 1 
ATOM   1484 N N   . VAL C 1 12 ? 91.944 29.475 21.111 1.00 96.99  ? 34  VAL C N   1 
ATOM   1485 C CA  . VAL C 1 12 ? 93.000 29.416 20.109 1.00 96.99  ? 34  VAL C CA  1 
ATOM   1486 C C   . VAL C 1 12 ? 93.054 28.006 19.532 1.00 96.99  ? 34  VAL C C   1 
ATOM   1487 O O   . VAL C 1 12 ? 93.806 27.736 18.603 1.00 96.99  ? 34  VAL C O   1 
ATOM   1488 C CB  . VAL C 1 12 ? 94.386 29.765 20.691 1.00 178.14 ? 34  VAL C CB  1 
ATOM   1489 C CG1 . VAL C 1 12 ? 95.356 30.053 19.557 1.00 178.14 ? 34  VAL C CG1 1 
ATOM   1490 C CG2 . VAL C 1 12 ? 94.285 30.973 21.604 1.00 178.14 ? 34  VAL C CG2 1 
ATOM   1491 N N   . LEU C 1 13 ? 92.253 27.109 20.096 1.00 87.49  ? 35  LEU C N   1 
ATOM   1492 C CA  . LEU C 1 13 ? 92.177 25.729 19.629 1.00 87.49  ? 35  LEU C CA  1 
ATOM   1493 C C   . LEU C 1 13 ? 91.022 25.621 18.643 1.00 87.49  ? 35  LEU C C   1 
ATOM   1494 O O   . LEU C 1 13 ? 91.171 25.052 17.565 1.00 87.49  ? 35  LEU C O   1 
ATOM   1495 C CB  . LEU C 1 13 ? 91.937 24.773 20.798 1.00 157.86 ? 35  LEU C CB  1 
ATOM   1496 C CG  . LEU C 1 13 ? 93.007 24.798 21.885 1.00 157.86 ? 35  LEU C CG  1 
ATOM   1497 C CD1 . LEU C 1 13 ? 92.496 24.125 23.151 1.00 157.86 ? 35  LEU C CD1 1 
ATOM   1498 C CD2 . LEU C 1 13 ? 94.241 24.094 21.362 1.00 157.86 ? 35  LEU C CD2 1 
ATOM   1499 N N   . LEU C 1 14 ? 89.872 26.175 19.019 1.00 100.14 ? 36  LEU C N   1 
ATOM   1500 C CA  . LEU C 1 14 ? 88.689 26.146 18.166 1.00 100.14 ? 36  LEU C CA  1 
ATOM   1501 C C   . LEU C 1 14 ? 88.981 26.802 16.827 1.00 100.14 ? 36  LEU C C   1 
ATOM   1502 O O   . LEU C 1 14 ? 88.612 26.279 15.773 1.00 100.14 ? 36  LEU C O   1 
ATOM   1503 C CB  . LEU C 1 14 ? 87.527 26.877 18.835 1.00 112.92 ? 36  LEU C CB  1 
ATOM   1504 C CG  . LEU C 1 14 ? 86.333 27.157 17.922 1.00 112.92 ? 36  LEU C CG  1 
ATOM   1505 C CD1 . LEU C 1 14 ? 85.414 25.942 17.885 1.00 112.92 ? 36  LEU C CD1 1 
ATOM   1506 C CD2 . LEU C 1 14 ? 85.589 28.383 18.421 1.00 112.92 ? 36  LEU C CD2 1 
ATOM   1507 N N   . VAL C 1 15 ? 89.638 27.957 16.877 1.00 76.58  ? 37  VAL C N   1 
ATOM   1508 C CA  . VAL C 1 15 ? 89.985 28.686 15.668 1.00 76.58  ? 37  VAL C CA  1 
ATOM   1509 C C   . VAL C 1 15 ? 90.783 27.799 14.730 1.00 76.58  ? 37  VAL C C   1 
ATOM   1510 O O   . VAL C 1 15 ? 90.675 27.916 13.513 1.00 76.58  ? 37  VAL C O   1 
ATOM   1511 C CB  . VAL C 1 15 ? 90.795 29.952 15.994 1.00 80.26  ? 37  VAL C CB  1 
ATOM   1512 C CG1 . VAL C 1 15 ? 92.101 29.973 15.208 1.00 80.26  ? 37  VAL C CG1 1 
ATOM   1513 C CG2 . VAL C 1 15 ? 89.962 31.174 15.667 1.00 80.26  ? 37  VAL C CG2 1 
ATOM   1514 N N   . ILE C 1 16 ? 91.599 26.918 15.294 1.00 76.62  ? 38  ILE C N   1 
ATOM   1515 C CA  . ILE C 1 16 ? 92.376 26.015 14.463 1.00 76.62  ? 38  ILE C CA  1 
ATOM   1516 C C   . ILE C 1 16 ? 91.367 25.071 13.819 1.00 76.62  ? 38  ILE C C   1 
ATOM   1517 O O   . ILE C 1 16 ? 91.388 24.862 12.608 1.00 76.62  ? 38  ILE C O   1 
ATOM   1518 C CB  . ILE C 1 16 ? 93.405 25.214 15.302 1.00 121.53 ? 38  ILE C CB  1 
ATOM   1519 C CG1 . ILE C 1 16 ? 94.706 26.013 15.436 1.00 121.53 ? 38  ILE C CG1 1 
ATOM   1520 C CG2 . ILE C 1 16 ? 93.710 23.877 14.635 1.00 121.53 ? 38  ILE C CG2 1 
ATOM   1521 C CD1 . ILE C 1 16 ? 94.517 27.464 15.842 1.00 121.53 ? 38  ILE C CD1 1 
ATOM   1522 N N   . VAL C 1 17 ? 90.469 24.527 14.639 1.00 76.33  ? 39  VAL C N   1 
ATOM   1523 C CA  . VAL C 1 17 ? 89.433 23.609 14.171 1.00 76.33  ? 39  VAL C CA  1 
ATOM   1524 C C   . VAL C 1 17 ? 88.718 24.215 12.983 1.00 76.33  ? 39  VAL C C   1 
ATOM   1525 O O   . VAL C 1 17 ? 88.516 23.558 11.964 1.00 76.33  ? 39  VAL C O   1 
ATOM   1526 C CB  . VAL C 1 17 ? 88.388 23.334 15.261 1.00 139.06 ? 39  VAL C CB  1 
ATOM   1527 C CG1 . VAL C 1 17 ? 87.246 22.508 14.691 1.00 139.06 ? 39  VAL C CG1 1 
ATOM   1528 C CG2 . VAL C 1 17 ? 89.036 22.615 16.424 1.00 139.06 ? 39  VAL C CG2 1 
ATOM   1529 N N   . LEU C 1 18 ? 88.321 25.471 13.132 1.00 48.09  ? 40  LEU C N   1 
ATOM   1530 C CA  . LEU C 1 18 ? 87.648 26.166 12.059 1.00 48.09  ? 40  LEU C CA  1 
ATOM   1531 C C   . LEU C 1 18 ? 88.496 26.006 10.809 1.00 48.09  ? 40  LEU C C   1 
ATOM   1532 O O   . LEU C 1 18 ? 88.205 25.164 9.955  1.00 48.09  ? 40  LEU C O   1 
ATOM   1533 C CB  . LEU C 1 18 ? 87.507 27.644 12.401 1.00 25.25  ? 40  LEU C CB  1 
ATOM   1534 C CG  . LEU C 1 18 ? 86.599 27.993 13.586 1.00 25.25  ? 40  LEU C CG  1 
ATOM   1535 C CD1 . LEU C 1 18 ? 86.195 29.467 13.495 1.00 25.25  ? 40  LEU C CD1 1 
ATOM   1536 C CD2 . LEU C 1 18 ? 85.369 27.099 13.596 1.00 25.25  ? 40  LEU C CD2 1 
ATOM   1537 N N   . LEU C 1 19 ? 89.557 26.804 10.717 1.00 50.73  ? 41  LEU C N   1 
ATOM   1538 C CA  . LEU C 1 19 ? 90.454 26.757 9.570  1.00 50.73  ? 41  LEU C CA  1 
ATOM   1539 C C   . LEU C 1 19 ? 90.787 25.327 9.183  1.00 50.73  ? 41  LEU C C   1 
ATOM   1540 O O   . LEU C 1 19 ? 90.991 25.036 8.011  1.00 50.73  ? 41  LEU C O   1 
ATOM   1541 C CB  . LEU C 1 19 ? 91.741 27.525 9.872  1.00 67.05  ? 41  LEU C CB  1 
ATOM   1542 C CG  . LEU C 1 19 ? 91.580 28.980 10.337 1.00 67.05  ? 41  LEU C CG  1 
ATOM   1543 C CD1 . LEU C 1 19 ? 92.747 29.804 9.824  1.00 67.05  ? 41  LEU C CD1 1 
ATOM   1544 C CD2 . LEU C 1 19 ? 90.258 29.563 9.840  1.00 67.05  ? 41  LEU C CD2 1 
ATOM   1545 N N   . ALA C 1 20 ? 90.827 24.436 10.168 1.00 93.30  ? 42  ALA C N   1 
ATOM   1546 C CA  . ALA C 1 20 ? 91.134 23.032 9.921  1.00 93.30  ? 42  ALA C CA  1 
ATOM   1547 C C   . ALA C 1 20 ? 89.992 22.348 9.183  1.00 93.30  ? 42  ALA C C   1 
ATOM   1548 O O   . ALA C 1 20 ? 90.202 21.699 8.160  1.00 93.30  ? 42  ALA C O   1 
ATOM   1549 C CB  . ALA C 1 20 ? 91.403 22.316 11.236 1.00 191.27 ? 42  ALA C CB  1 
ATOM   1550 N N   . GLY C 1 21 ? 88.782 22.491 9.711  1.00 127.02 ? 43  GLY C N   1 
ATOM   1551 C CA  . GLY C 1 21 ? 87.626 21.880 9.083  1.00 127.02 ? 43  GLY C CA  1 
ATOM   1552 C C   . GLY C 1 21 ? 87.313 22.544 7.760  1.00 127.02 ? 43  GLY C C   1 
ATOM   1553 O O   . GLY C 1 21 ? 86.891 21.888 6.807  1.00 127.02 ? 43  GLY C O   1 
ATOM   1554 N N   . SER C 1 22 ? 87.525 23.855 7.706  1.00 63.12  ? 44  SER C N   1 
ATOM   1555 C CA  . SER C 1 22 ? 87.271 24.624 6.497  1.00 63.12  ? 44  SER C CA  1 
ATOM   1556 C C   . SER C 1 22 ? 87.990 24.015 5.309  1.00 63.12  ? 44  SER C C   1 
ATOM   1557 O O   . SER C 1 22 ? 87.365 23.524 4.371  1.00 63.12  ? 44  SER C O   1 
ATOM   1558 C CB  . SER C 1 22 ? 87.744 26.064 6.677  1.00 58.84  ? 44  SER C CB  1 
ATOM   1559 O OG  . SER C 1 22 ? 86.939 26.750 7.618  1.00 58.84  ? 44  SER C OG  1 
ATOM   1560 N N   . TYR C 1 23 ? 89.314 24.046 5.363  1.00 87.53  ? 45  TYR C N   1 
ATOM   1561 C CA  . TYR C 1 23 ? 90.129 23.519 4.283  1.00 87.53  ? 45  TYR C CA  1 
ATOM   1562 C C   . TYR C 1 23 ? 90.249 22.004 4.302  1.00 87.53  ? 45  TYR C C   1 
ATOM   1563 O O   . TYR C 1 23 ? 91.289 21.455 3.938  1.00 87.53  ? 45  TYR C O   1 
ATOM   1564 C CB  . TYR C 1 23 ? 91.522 24.147 4.325  1.00 202.20 ? 45  TYR C CB  1 
ATOM   1565 C CG  . TYR C 1 23 ? 91.522 25.654 4.183  1.00 202.20 ? 45  TYR C CG  1 
ATOM   1566 C CD1 . TYR C 1 23 ? 90.658 26.450 4.940  1.00 202.20 ? 45  TYR C CD1 1 
ATOM   1567 C CD2 . TYR C 1 23 ? 92.396 26.287 3.302  1.00 202.20 ? 45  TYR C CD2 1 
ATOM   1568 C CE1 . TYR C 1 23 ? 90.667 27.835 4.824  1.00 202.20 ? 45  TYR C CE1 1 
ATOM   1569 C CE2 . TYR C 1 23 ? 92.414 27.674 3.178  1.00 202.20 ? 45  TYR C CE2 1 
ATOM   1570 C CZ  . TYR C 1 23 ? 91.549 28.441 3.941  1.00 202.20 ? 45  TYR C CZ  1 
ATOM   1571 O OH  . TYR C 1 23 ? 91.573 29.812 3.825  1.00 202.20 ? 45  TYR C OH  1 
ATOM   1572 N N   . LEU C 1 24 ? 89.186 21.334 4.736  1.00 70.18  ? 46  LEU C N   1 
ATOM   1573 C CA  . LEU C 1 24 ? 89.166 19.876 4.775  1.00 70.18  ? 46  LEU C CA  1 
ATOM   1574 C C   . LEU C 1 24 ? 87.802 19.381 4.316  1.00 70.18  ? 46  LEU C C   1 
ATOM   1575 O O   . LEU C 1 24 ? 87.691 18.345 3.662  1.00 70.18  ? 46  LEU C O   1 
ATOM   1576 C CB  . LEU C 1 24 ? 89.453 19.353 6.186  1.00 106.63 ? 46  LEU C CB  1 
ATOM   1577 C CG  . LEU C 1 24 ? 89.998 17.917 6.235  1.00 106.63 ? 46  LEU C CG  1 
ATOM   1578 C CD1 . LEU C 1 24 ? 91.063 17.817 7.302  1.00 106.63 ? 46  LEU C CD1 1 
ATOM   1579 C CD2 . LEU C 1 24 ? 88.874 16.929 6.512  1.00 106.63 ? 46  LEU C CD2 1 
ATOM   1580 N N   . ALA C 1 25 ? 86.761 20.122 4.670  1.00 128.85 ? 47  ALA C N   1 
ATOM   1581 C CA  . ALA C 1 25 ? 85.413 19.757 4.265  1.00 128.85 ? 47  ALA C CA  1 
ATOM   1582 C C   . ALA C 1 25 ? 85.317 20.020 2.765  1.00 128.85 ? 47  ALA C C   1 
ATOM   1583 O O   . ALA C 1 25 ? 84.674 19.272 2.026  1.00 128.85 ? 47  ALA C O   1 
ATOM   1584 C CB  . ALA C 1 25 ? 84.392 20.596 5.020  1.00 143.48 ? 47  ALA C CB  1 
ATOM   1585 N N   . VAL C 1 26 ? 85.970 21.091 2.325  1.00 83.71  ? 48  VAL C N   1 
ATOM   1586 C CA  . VAL C 1 26 ? 85.972 21.454 0.916  1.00 83.71  ? 48  VAL C CA  1 
ATOM   1587 C C   . VAL C 1 26 ? 86.522 20.279 0.129  1.00 83.71  ? 48  VAL C C   1 
ATOM   1588 O O   . VAL C 1 26 ? 85.816 19.695 -0.682 1.00 83.71  ? 48  VAL C O   1 
ATOM   1589 C CB  . VAL C 1 26 ? 86.853 22.699 0.640  1.00 30.53  ? 48  VAL C CB  1 
ATOM   1590 C CG1 . VAL C 1 26 ? 87.185 22.786 -0.834 1.00 30.53  ? 48  VAL C CG1 1 
ATOM   1591 C CG2 . VAL C 1 26 ? 86.135 23.962 1.092  1.00 30.53  ? 48  VAL C CG2 1 
ATOM   1592 N N   . LEU C 1 27 ? 87.779 19.925 0.382  1.00 67.05  ? 49  LEU C N   1 
ATOM   1593 C CA  . LEU C 1 27 ? 88.411 18.816 -0.323 1.00 67.05  ? 49  LEU C CA  1 
ATOM   1594 C C   . LEU C 1 27 ? 87.674 17.493 -0.108 1.00 67.05  ? 49  LEU C C   1 
ATOM   1595 O O   . LEU C 1 27 ? 88.152 16.428 -0.502 1.00 67.05  ? 49  LEU C O   1 
ATOM   1596 C CB  . LEU C 1 27 ? 89.874 18.679 0.106  1.00 182.32 ? 49  LEU C CB  1 
ATOM   1597 C CG  . LEU C 1 27 ? 90.172 18.576 1.602  1.00 182.32 ? 49  LEU C CG  1 
ATOM   1598 C CD1 . LEU C 1 27 ? 90.235 17.110 2.007  1.00 182.32 ? 49  LEU C CD1 1 
ATOM   1599 C CD2 . LEU C 1 27 ? 91.490 19.274 1.910  1.00 182.32 ? 49  LEU C CD2 1 
ATOM   1600 N N   . ALA C 1 28 ? 86.507 17.567 0.520  1.00 68.38  ? 50  ALA C N   1 
ATOM   1601 C CA  . ALA C 1 28 ? 85.699 16.384 0.769  1.00 68.38  ? 50  ALA C CA  1 
ATOM   1602 C C   . ALA C 1 28 ? 84.415 16.511 -0.039 1.00 68.38  ? 50  ALA C C   1 
ATOM   1603 O O   . ALA C 1 28 ? 83.773 15.515 -0.364 1.00 68.38  ? 50  ALA C O   1 
ATOM   1604 C CB  . ALA C 1 28 ? 85.376 16.269 2.255  1.00 101.60 ? 50  ALA C CB  1 
ATOM   1605 N N   . GLU C 1 29 ? 84.057 17.750 -0.365 1.00 126.82 ? 51  GLU C N   1 
ATOM   1606 C CA  . GLU C 1 29 ? 82.848 18.039 -1.127 1.00 126.82 ? 51  GLU C CA  1 
ATOM   1607 C C   . GLU C 1 29 ? 83.140 18.598 -2.519 1.00 126.82 ? 51  GLU C C   1 
ATOM   1608 O O   . GLU C 1 29 ? 82.372 18.377 -3.452 1.00 126.82 ? 51  GLU C O   1 
ATOM   1609 C CB  . GLU C 1 29 ? 81.983 19.042 -0.366 1.00 60.80  ? 51  GLU C CB  1 
ATOM   1610 C CG  . GLU C 1 29 ? 81.640 18.628 1.050  1.00 60.80  ? 51  GLU C CG  1 
ATOM   1611 C CD  . GLU C 1 29 ? 80.143 18.463 1.268  1.00 60.80  ? 51  GLU C CD  1 
ATOM   1612 O OE1 . GLU C 1 29 ? 79.403 19.482 1.233  1.00 60.80  ? 51  GLU C OE1 1 
ATOM   1613 O OE2 . GLU C 1 29 ? 79.712 17.307 1.477  1.00 60.80  ? 51  GLU C OE2 1 
ATOM   1614 N N   . ARG C 1 30 ? 84.248 19.326 -2.641 1.00 129.29 ? 52  ARG C N   1 
ATOM   1615 C CA  . ARG C 1 30 ? 84.671 19.953 -3.897 1.00 129.29 ? 52  ARG C CA  1 
ATOM   1616 C C   . ARG C 1 30 ? 84.238 19.236 -5.174 1.00 129.29 ? 52  ARG C C   1 
ATOM   1617 O O   . ARG C 1 30 ? 83.850 19.881 -6.151 1.00 129.29 ? 52  ARG C O   1 
ATOM   1618 C CB  . ARG C 1 30 ? 86.194 20.125 -3.909 1.00 168.73 ? 52  ARG C CB  1 
ATOM   1619 C CG  . ARG C 1 30 ? 86.741 20.770 -5.176 1.00 168.73 ? 52  ARG C CG  1 
ATOM   1620 C CD  . ARG C 1 30 ? 87.470 22.071 -4.875 1.00 168.73 ? 52  ARG C CD  1 
ATOM   1621 N NE  . ARG C 1 30 ? 86.978 23.172 -5.699 1.00 168.73 ? 52  ARG C NE  1 
ATOM   1622 C CZ  . ARG C 1 30 ? 87.393 24.431 -5.594 1.00 168.73 ? 52  ARG C CZ  1 
ATOM   1623 N NH1 . ARG C 1 30 ? 88.314 24.758 -4.695 1.00 168.73 ? 52  ARG C NH1 1 
ATOM   1624 N NH2 . ARG C 1 30 ? 86.883 25.365 -6.388 1.00 168.73 ? 52  ARG C NH2 1 
ATOM   1625 N N   . GLY C 1 31 ? 84.312 17.909 -5.174 1.00 179.08 ? 53  GLY C N   1 
ATOM   1626 C CA  . GLY C 1 31 ? 83.919 17.158 -6.353 1.00 179.08 ? 53  GLY C CA  1 
ATOM   1627 C C   . GLY C 1 31 ? 82.756 16.223 -6.091 1.00 179.08 ? 53  GLY C C   1 
ATOM   1628 O O   . GLY C 1 31 ? 82.957 15.026 -5.886 1.00 179.08 ? 53  GLY C O   1 
ATOM   1629 N N   . ALA C 1 32 ? 81.539 16.764 -6.102 1.00 143.79 ? 54  ALA C N   1 
ATOM   1630 C CA  . ALA C 1 32 ? 80.346 15.961 -5.855 1.00 143.79 ? 54  ALA C CA  1 
ATOM   1631 C C   . ALA C 1 32 ? 79.060 16.791 -5.886 1.00 143.79 ? 54  ALA C C   1 
ATOM   1632 O O   . ALA C 1 32 ? 79.103 18.023 -5.909 1.00 143.79 ? 54  ALA C O   1 
ATOM   1633 C CB  . ALA C 1 32 ? 80.471 15.253 -4.503 1.00 73.53  ? 54  ALA C CB  1 
ATOM   1634 N N   . PRO C 1 33 ? 77.897 16.113 -5.906 1.00 68.30  ? 55  PRO C N   1 
ATOM   1635 C CA  . PRO C 1 33 ? 76.554 16.720 -5.929 1.00 68.30  ? 55  PRO C CA  1 
ATOM   1636 C C   . PRO C 1 33 ? 76.263 17.681 -4.764 1.00 68.30  ? 55  PRO C C   1 
ATOM   1637 O O   . PRO C 1 33 ? 75.132 18.128 -4.581 1.00 68.30  ? 55  PRO C O   1 
ATOM   1638 C CB  . PRO C 1 33 ? 75.619 15.512 -5.890 1.00 70.99  ? 55  PRO C CB  1 
ATOM   1639 C CG  . PRO C 1 33 ? 76.447 14.366 -6.410 1.00 70.99  ? 55  PRO C CG  1 
ATOM   1640 C CD  . PRO C 1 33 ? 77.833 14.638 -5.952 1.00 70.99  ? 55  PRO C CD  1 
ATOM   1641 N N   . GLY C 1 34 ? 77.294 18.001 -3.991 1.00 45.12  ? 56  GLY C N   1 
ATOM   1642 C CA  . GLY C 1 34 ? 77.118 18.865 -2.843 1.00 45.12  ? 56  GLY C CA  1 
ATOM   1643 C C   . GLY C 1 34 ? 77.157 20.356 -3.073 1.00 45.12  ? 56  GLY C C   1 
ATOM   1644 O O   . GLY C 1 34 ? 77.651 20.838 -4.088 1.00 45.12  ? 56  GLY C O   1 
ATOM   1645 N N   . ALA C 1 35 ? 76.640 21.077 -2.081 1.00 117.24 ? 57  ALA C N   1 
ATOM   1646 C CA  . ALA C 1 35 ? 76.570 22.530 -2.092 1.00 117.24 ? 57  ALA C CA  1 
ATOM   1647 C C   . ALA C 1 35 ? 77.933 23.199 -2.241 1.00 117.24 ? 57  ALA C C   1 
ATOM   1648 O O   . ALA C 1 35 ? 78.945 22.539 -2.481 1.00 117.24 ? 57  ALA C O   1 
ATOM   1649 C CB  . ALA C 1 35 ? 75.883 23.022 -0.818 1.00 121.38 ? 57  ALA C CB  1 
ATOM   1650 N N   . GLN C 1 36 ? 77.937 24.519 -2.082 1.00 140.52 ? 58  GLN C N   1 
ATOM   1651 C CA  . GLN C 1 36 ? 79.136 25.337 -2.217 1.00 140.52 ? 58  GLN C CA  1 
ATOM   1652 C C   . GLN C 1 36 ? 80.303 24.975 -1.308 1.00 140.52 ? 58  GLN C C   1 
ATOM   1653 O O   . GLN C 1 36 ? 81.322 25.667 -1.312 1.00 140.52 ? 58  GLN C O   1 
ATOM   1654 C CB  . GLN C 1 36 ? 78.783 26.812 -2.016 1.00 150.59 ? 58  GLN C CB  1 
ATOM   1655 C CG  . GLN C 1 36 ? 79.680 27.775 -2.773 1.00 150.59 ? 58  GLN C CG  1 
ATOM   1656 C CD  . GLN C 1 36 ? 79.256 29.221 -2.597 1.00 150.59 ? 58  GLN C CD  1 
ATOM   1657 O OE1 . GLN C 1 36 ? 78.305 29.681 -3.228 1.00 150.59 ? 58  GLN C OE1 1 
ATOM   1658 N NE2 . GLN C 1 36 ? 79.961 29.945 -1.733 1.00 150.59 ? 58  GLN C NE2 1 
ATOM   1659 N N   . LEU C 1 37 ? 80.169 23.910 -0.522 1.00 53.50  ? 59  LEU C N   1 
ATOM   1660 C CA  . LEU C 1 37 ? 81.269 23.494 0.348  1.00 53.50  ? 59  LEU C CA  1 
ATOM   1661 C C   . LEU C 1 37 ? 82.342 22.943 -0.587 1.00 53.50  ? 59  LEU C C   1 
ATOM   1662 O O   . LEU C 1 37 ? 82.988 21.933 -0.322 1.00 53.50  ? 59  LEU C O   1 
ATOM   1663 C CB  . LEU C 1 37 ? 80.798 22.417 1.334  1.00 51.11  ? 59  LEU C CB  1 
ATOM   1664 C CG  . LEU C 1 37 ? 80.097 22.931 2.599  1.00 51.11  ? 59  LEU C CG  1 
ATOM   1665 C CD1 . LEU C 1 37 ? 79.842 21.772 3.544  1.00 51.11  ? 59  LEU C CD1 1 
ATOM   1666 C CD2 . LEU C 1 37 ? 80.945 23.999 3.274  1.00 51.11  ? 59  LEU C CD2 1 
ATOM   1667 N N   . ILE C 1 38 ? 82.499 23.642 -1.702 1.00 72.69  ? 60  ILE C N   1 
ATOM   1668 C CA  . ILE C 1 38 ? 83.444 23.294 -2.743 1.00 72.69  ? 60  ILE C CA  1 
ATOM   1669 C C   . ILE C 1 38 ? 84.450 24.428 -2.902 1.00 72.69  ? 60  ILE C C   1 
ATOM   1670 O O   . ILE C 1 38 ? 85.213 24.467 -3.865 1.00 72.69  ? 60  ILE C O   1 
ATOM   1671 C CB  . ILE C 1 38 ? 82.705 23.069 -4.088 1.00 97.34  ? 60  ILE C CB  1 
ATOM   1672 C CG1 . ILE C 1 38 ? 82.188 24.402 -4.638 1.00 97.34  ? 60  ILE C CG1 1 
ATOM   1673 C CG2 . ILE C 1 38 ? 81.524 22.127 -3.883 1.00 97.34  ? 60  ILE C CG2 1 
ATOM   1674 N N   . THR C 1 39 ? 84.441 25.354 -1.951 1.00 95.17  ? 61  THR C N   1 
ATOM   1675 C CA  . THR C 1 39 ? 85.355 26.488 -1.981 1.00 95.17  ? 61  THR C CA  1 
ATOM   1676 C C   . THR C 1 39 ? 85.852 26.760 -0.574 1.00 95.17  ? 61  THR C C   1 
ATOM   1677 O O   . THR C 1 39 ? 85.061 26.865 0.363  1.00 95.17  ? 61  THR C O   1 
ATOM   1678 C CB  . THR C 1 39 ? 84.659 27.747 -2.517 1.00 69.34  ? 61  THR C CB  1 
ATOM   1679 O OG1 . THR C 1 39 ? 83.839 27.388 -3.630 1.00 69.34  ? 61  THR C OG1 1 
ATOM   1680 C CG2 . THR C 1 39 ? 85.673 28.775 -2.974 1.00 69.34  ? 61  THR C CG2 1 
ATOM   1681 N N   . TYR C 1 40 ? 87.166 26.862 -0.429 1.00 150.22 ? 62  TYR C N   1 
ATOM   1682 C CA  . TYR C 1 40 ? 87.766 27.117 0.870  1.00 150.22 ? 62  TYR C CA  1 
ATOM   1683 C C   . TYR C 1 40 ? 87.202 28.377 1.524  1.00 150.22 ? 62  TYR C C   1 
ATOM   1684 O O   . TYR C 1 40 ? 86.807 28.349 2.690  1.00 150.22 ? 62  TYR C O   1 
ATOM   1685 C CB  . TYR C 1 40 ? 89.284 27.228 0.730  1.00 155.48 ? 62  TYR C CB  1 
ATOM   1686 C CG  . TYR C 1 40 ? 89.944 25.916 0.383  1.00 155.48 ? 62  TYR C CG  1 
ATOM   1687 C CD1 . TYR C 1 40 ? 89.878 24.831 1.257  1.00 155.48 ? 62  TYR C CD1 1 
ATOM   1688 C CD2 . TYR C 1 40 ? 90.628 25.754 -0.819 1.00 155.48 ? 62  TYR C CD2 1 
ATOM   1689 C CE1 . TYR C 1 40 ? 90.478 23.615 0.944  1.00 155.48 ? 62  TYR C CE1 1 
ATOM   1690 C CE2 . TYR C 1 40 ? 91.233 24.539 -1.143 1.00 155.48 ? 62  TYR C CE2 1 
ATOM   1691 C CZ  . TYR C 1 40 ? 91.153 23.474 -0.256 1.00 155.48 ? 62  TYR C CZ  1 
ATOM   1692 O OH  . TYR C 1 40 ? 91.747 22.272 -0.565 1.00 155.48 ? 62  TYR C OH  1 
ATOM   1693 N N   . PRO C 1 41 ? 87.149 29.499 0.781  1.00 95.31  ? 63  PRO C N   1 
ATOM   1694 C CA  . PRO C 1 41 ? 86.620 30.754 1.337  1.00 95.31  ? 63  PRO C CA  1 
ATOM   1695 C C   . PRO C 1 41 ? 85.141 30.671 1.703  1.00 95.31  ? 63  PRO C C   1 
ATOM   1696 O O   . PRO C 1 41 ? 84.571 31.621 2.252  1.00 95.31  ? 63  PRO C O   1 
ATOM   1697 C CB  . PRO C 1 41 ? 86.868 31.785 0.232  1.00 123.82 ? 63  PRO C CB  1 
ATOM   1698 C CG  . PRO C 1 41 ? 87.815 31.128 -0.730 1.00 123.82 ? 63  PRO C CG  1 
ATOM   1699 C CD  . PRO C 1 41 ? 87.589 29.658 -0.615 1.00 123.82 ? 63  PRO C CD  1 
ATOM   1700 N N   . ARG C 1 42 ? 84.530 29.531 1.390  1.00 75.24  ? 64  ARG C N   1 
ATOM   1701 C CA  . ARG C 1 42 ? 83.118 29.292 1.668  1.00 75.24  ? 64  ARG C CA  1 
ATOM   1702 C C   . ARG C 1 42 ? 82.975 28.362 2.861  1.00 75.24  ? 64  ARG C C   1 
ATOM   1703 O O   . ARG C 1 42 ? 82.094 28.543 3.693  1.00 75.24  ? 64  ARG C O   1 
ATOM   1704 C CB  . ARG C 1 42 ? 82.435 28.674 0.443  1.00 94.52  ? 64  ARG C CB  1 
ATOM   1705 N N   . ALA C 1 43 ? 83.845 27.363 2.939  1.00 82.72  ? 65  ALA C N   1 
ATOM   1706 C CA  . ALA C 1 43 ? 83.806 26.425 4.049  1.00 82.72  ? 65  ALA C CA  1 
ATOM   1707 C C   . ALA C 1 43 ? 83.980 27.191 5.357  1.00 82.72  ? 65  ALA C C   1 
ATOM   1708 O O   . ALA C 1 43 ? 83.361 26.851 6.363  1.00 82.72  ? 65  ALA C O   1 
ATOM   1709 C CB  . ALA C 1 43 ? 84.906 25.381 3.898  1.00 6.52   ? 65  ALA C CB  1 
ATOM   1710 N N   . LEU C 1 44 ? 84.819 28.226 5.334  1.00 91.34  ? 66  LEU C N   1 
ATOM   1711 C CA  . LEU C 1 44 ? 85.075 29.056 6.514  1.00 91.34  ? 66  LEU C CA  1 
ATOM   1712 C C   . LEU C 1 44 ? 83.771 29.492 7.161  1.00 91.34  ? 66  LEU C C   1 
ATOM   1713 O O   . LEU C 1 44 ? 83.426 29.055 8.260  1.00 91.34  ? 66  LEU C O   1 
ATOM   1714 C CB  . LEU C 1 44 ? 85.844 30.316 6.126  1.00 76.69  ? 66  LEU C CB  1 
ATOM   1715 C CG  . LEU C 1 44 ? 87.346 30.266 5.874  1.00 76.69  ? 66  LEU C CG  1 
ATOM   1716 C CD1 . LEU C 1 44 ? 87.920 31.655 6.126  1.00 76.69  ? 66  LEU C CD1 1 
ATOM   1717 C CD2 . LEU C 1 44 ? 88.005 29.239 6.769  1.00 76.69  ? 66  LEU C CD2 1 
ATOM   1718 N N   . TRP C 1 45 ? 83.062 30.375 6.464  1.00 77.07  ? 67  TRP C N   1 
ATOM   1719 C CA  . TRP C 1 45 ? 81.790 30.904 6.929  1.00 77.07  ? 67  TRP C CA  1 
ATOM   1720 C C   . TRP C 1 45 ? 80.883 29.760 7.365  1.00 77.07  ? 67  TRP C C   1 
ATOM   1721 O O   . TRP C 1 45 ? 79.947 29.966 8.131  1.00 77.07  ? 67  TRP C O   1 
ATOM   1722 C CB  . TRP C 1 45 ? 81.138 31.737 5.812  1.00 62.98  ? 67  TRP C CB  1 
ATOM   1723 C CG  . TRP C 1 45 ? 79.678 32.035 6.000  1.00 62.98  ? 67  TRP C CG  1 
ATOM   1724 C CD1 . TRP C 1 45 ? 78.646 31.524 5.273  1.00 62.98  ? 67  TRP C CD1 1 
ATOM   1725 C CD2 . TRP C 1 45 ? 79.084 32.904 6.981  1.00 62.98  ? 67  TRP C CD2 1 
ATOM   1726 N NE1 . TRP C 1 45 ? 77.446 32.013 5.736  1.00 62.98  ? 67  TRP C NE1 1 
ATOM   1727 C CE2 . TRP C 1 45 ? 77.683 32.862 6.783  1.00 62.98  ? 67  TRP C CE2 1 
ATOM   1728 C CE3 . TRP C 1 45 ? 79.598 33.712 8.006  1.00 62.98  ? 67  TRP C CE3 1 
ATOM   1729 C CZ2 . TRP C 1 45 ? 76.787 33.596 7.572  1.00 62.98  ? 67  TRP C CZ2 1 
ATOM   1730 C CZ3 . TRP C 1 45 ? 78.704 34.444 8.793  1.00 62.98  ? 67  TRP C CZ3 1 
ATOM   1731 C CH2 . TRP C 1 45 ? 77.313 34.378 8.568  1.00 62.98  ? 67  TRP C CH2 1 
ATOM   1732 N N   . TRP C 1 46 ? 81.168 28.552 6.888  1.00 53.26  ? 68  TRP C N   1 
ATOM   1733 C CA  . TRP C 1 46 ? 80.367 27.387 7.261  1.00 53.26  ? 68  TRP C CA  1 
ATOM   1734 C C   . TRP C 1 46 ? 80.843 26.849 8.593  1.00 53.26  ? 68  TRP C C   1 
ATOM   1735 O O   . TRP C 1 46 ? 80.041 26.471 9.445  1.00 53.26  ? 68  TRP C O   1 
ATOM   1736 C CB  . TRP C 1 46 ? 80.491 26.276 6.230  1.00 29.25  ? 68  TRP C CB  1 
ATOM   1737 C CG  . TRP C 1 46 ? 80.006 24.972 6.752  1.00 29.25  ? 68  TRP C CG  1 
ATOM   1738 C CD1 . TRP C 1 46 ? 78.709 24.602 6.943  1.00 29.25  ? 68  TRP C CD1 1 
ATOM   1739 C CD2 . TRP C 1 46 ? 80.806 23.858 7.145  1.00 29.25  ? 68  TRP C CD2 1 
ATOM   1740 N NE1 . TRP C 1 46 ? 78.649 23.323 7.429  1.00 29.25  ? 68  TRP C NE1 1 
ATOM   1741 C CE2 . TRP C 1 46 ? 79.924 22.839 7.563  1.00 29.25  ? 68  TRP C CE2 1 
ATOM   1742 C CE3 . TRP C 1 46 ? 82.181 23.619 7.182  1.00 29.25  ? 68  TRP C CE3 1 
ATOM   1743 C CZ2 . TRP C 1 46 ? 80.374 21.592 8.018  1.00 29.25  ? 68  TRP C CZ2 1 
ATOM   1744 C CZ3 . TRP C 1 46 ? 82.632 22.380 7.631  1.00 29.25  ? 68  TRP C CZ3 1 
ATOM   1745 C CH2 . TRP C 1 46 ? 81.730 21.381 8.043  1.00 29.25  ? 68  TRP C CH2 1 
ATOM   1746 N N   . SER C 1 47 ? 82.160 26.796 8.751  1.00 69.62  ? 69  SER C N   1 
ATOM   1747 C CA  . SER C 1 47 ? 82.765 26.323 9.984  1.00 69.62  ? 69  SER C CA  1 
ATOM   1748 C C   . SER C 1 47 ? 82.229 27.193 11.107 1.00 69.62  ? 69  SER C C   1 
ATOM   1749 O O   . SER C 1 47 ? 81.798 26.695 12.142 1.00 69.62  ? 69  SER C O   1 
ATOM   1750 C CB  . SER C 1 47 ? 84.289 26.453 9.911  1.00 83.47  ? 69  SER C CB  1 
ATOM   1751 O OG  . SER C 1 47 ? 84.861 25.399 9.153  1.00 83.47  ? 69  SER C OG  1 
ATOM   1752 N N   . VAL C 1 48 ? 82.248 28.500 10.878 1.00 35.37  ? 70  VAL C N   1 
ATOM   1753 C CA  . VAL C 1 48 ? 81.768 29.459 11.862 1.00 35.37  ? 70  VAL C CA  1 
ATOM   1754 C C   . VAL C 1 48 ? 80.305 29.244 12.245 1.00 35.37  ? 70  VAL C C   1 
ATOM   1755 O O   . VAL C 1 48 ? 79.991 29.093 13.422 1.00 35.37  ? 70  VAL C O   1 
ATOM   1756 C CB  . VAL C 1 48 ? 81.939 30.907 11.350 1.00 24.78  ? 70  VAL C CB  1 
ATOM   1757 C CG1 . VAL C 1 48 ? 81.380 31.892 12.370 1.00 24.78  ? 70  VAL C CG1 1 
ATOM   1758 C CG2 . VAL C 1 48 ? 83.408 31.187 11.072 1.00 24.78  ? 70  VAL C CG2 1 
ATOM   1759 N N   . GLU C 1 49 ? 79.412 29.244 11.258 1.00 74.08  ? 71  GLU C N   1 
ATOM   1760 C CA  . GLU C 1 49 ? 77.986 29.049 11.523 1.00 74.08  ? 71  GLU C CA  1 
ATOM   1761 C C   . GLU C 1 49 ? 77.799 27.727 12.252 1.00 74.08  ? 71  GLU C C   1 
ATOM   1762 O O   . GLU C 1 49 ? 77.095 27.651 13.258 1.00 74.08  ? 71  GLU C O   1 
ATOM   1763 C CB  . GLU C 1 49 ? 77.178 29.045 10.213 1.00 51.97  ? 71  GLU C CB  1 
ATOM   1764 N N   . THR C 1 50 ? 78.451 26.688 11.745 1.00 56.61  ? 72  THR C N   1 
ATOM   1765 C CA  . THR C 1 50 ? 78.363 25.363 12.345 1.00 56.61  ? 72  THR C CA  1 
ATOM   1766 C C   . THR C 1 50 ? 78.866 25.381 13.787 1.00 56.61  ? 72  THR C C   1 
ATOM   1767 O O   . THR C 1 50 ? 78.180 24.925 14.704 1.00 56.61  ? 72  THR C O   1 
ATOM   1768 C CB  . THR C 1 50 ? 79.202 24.334 11.552 1.00 84.25  ? 72  THR C CB  1 
ATOM   1769 O OG1 . THR C 1 50 ? 78.740 24.273 10.195 1.00 84.25  ? 72  THR C OG1 1 
ATOM   1770 C CG2 . THR C 1 50 ? 79.092 22.954 12.191 1.00 84.25  ? 72  THR C CG2 1 
ATOM   1771 N N   . ALA C 1 51 ? 80.075 25.907 13.965 1.00 56.71  ? 73  ALA C N   1 
ATOM   1772 C CA  . ALA C 1 51 ? 80.720 25.998 15.270 1.00 56.71  ? 73  ALA C CA  1 
ATOM   1773 C C   . ALA C 1 51 ? 79.880 26.782 16.266 1.00 56.71  ? 73  ALA C C   1 
ATOM   1774 O O   . ALA C 1 51 ? 79.821 26.440 17.435 1.00 56.71  ? 73  ALA C O   1 
ATOM   1775 C CB  . ALA C 1 51 ? 82.087 26.645 15.124 1.00 67.97  ? 73  ALA C CB  1 
ATOM   1776 N N   . THR C 1 52 ? 79.243 27.847 15.810 1.00 7.07   ? 74  THR C N   1 
ATOM   1777 C CA  . THR C 1 52 ? 78.409 28.639 16.687 1.00 7.07   ? 74  THR C CA  1 
ATOM   1778 C C   . THR C 1 52 ? 77.113 27.879 16.820 1.00 7.07   ? 74  THR C C   1 
ATOM   1779 O O   . THR C 1 52 ? 76.301 28.165 17.707 1.00 7.07   ? 74  THR C O   1 
ATOM   1780 C CB  . THR C 1 52 ? 78.064 29.990 16.067 1.00 23.63  ? 74  THR C CB  1 
ATOM   1781 O OG1 . THR C 1 52 ? 79.243 30.577 15.519 1.00 23.63  ? 74  THR C OG1 1 
ATOM   1782 C CG2 . THR C 1 52 ? 77.466 30.914 17.103 1.00 23.63  ? 74  THR C CG2 1 
ATOM   1783 N N   . THR C 1 53 ? 76.936 26.905 15.928 1.00 65.21  ? 75  THR C N   1 
ATOM   1784 C CA  . THR C 1 53 ? 75.729 26.084 15.837 1.00 65.21  ? 75  THR C CA  1 
ATOM   1785 C C   . THR C 1 53 ? 74.520 26.996 15.712 1.00 65.21  ? 75  THR C C   1 
ATOM   1786 O O   . THR C 1 53 ? 73.759 27.209 16.648 1.00 65.21  ? 75  THR C O   1 
ATOM   1787 C CB  . THR C 1 53 ? 75.546 25.117 17.036 1.00 51.91  ? 75  THR C CB  1 
ATOM   1788 O OG1 . THR C 1 53 ? 74.217 25.241 17.559 1.00 51.91  ? 75  THR C OG1 1 
ATOM   1789 C CG2 . THR C 1 53 ? 76.559 25.389 18.116 1.00 51.91  ? 75  THR C CG2 1 
ATOM   1790 N N   . VAL C 1 54 ? 74.385 27.558 14.523 1.00 149.65 ? 76  VAL C N   1 
ATOM   1791 C CA  . VAL C 1 54 ? 73.298 28.454 14.202 1.00 149.65 ? 76  VAL C CA  1 
ATOM   1792 C C   . VAL C 1 54 ? 72.605 27.823 12.999 1.00 149.65 ? 76  VAL C C   1 
ATOM   1793 O O   . VAL C 1 54 ? 71.413 28.025 12.768 1.00 149.65 ? 76  VAL C O   1 
ATOM   1794 C CB  . VAL C 1 54 ? 73.847 29.843 13.845 1.00 43.98  ? 76  VAL C CB  1 
ATOM   1795 C CG1 . VAL C 1 54 ? 72.741 30.850 13.833 1.00 43.98  ? 76  VAL C CG1 1 
ATOM   1796 C CG2 . VAL C 1 54 ? 74.907 30.254 14.854 1.00 43.98  ? 76  VAL C CG2 1 
ATOM   1797 N N   . GLY C 1 55 ? 73.379 27.036 12.253 1.00 161.60 ? 77  GLY C N   1 
ATOM   1798 C CA  . GLY C 1 55 ? 72.875 26.342 11.079 1.00 161.60 ? 77  GLY C CA  1 
ATOM   1799 C C   . GLY C 1 55 ? 71.957 27.170 10.209 1.00 161.60 ? 77  GLY C C   1 
ATOM   1800 O O   . GLY C 1 55 ? 70.741 26.996 10.243 1.00 161.60 ? 77  GLY C O   1 
ATOM   1801 N N   . TYR C 1 56 ? 72.537 28.071 9.423  1.00 80.00  ? 78  TYR C N   1 
ATOM   1802 C CA  . TYR C 1 56 ? 71.740 28.923 8.558  1.00 80.00  ? 78  TYR C CA  1 
ATOM   1803 C C   . TYR C 1 56 ? 71.015 28.069 7.554  1.00 80.00  ? 78  TYR C C   1 
ATOM   1804 O O   . TYR C 1 56 ? 69.872 28.345 7.224  1.00 80.00  ? 78  TYR C O   1 
ATOM   1805 C CB  . TYR C 1 56 ? 72.624 29.940 7.832  1.00 45.30  ? 78  TYR C CB  1 
ATOM   1806 C CG  . TYR C 1 56 ? 72.705 31.253 8.554  1.00 45.30  ? 78  TYR C CG  1 
ATOM   1807 C CD1 . TYR C 1 56 ? 71.552 31.865 9.054  1.00 45.30  ? 78  TYR C CD1 1 
ATOM   1808 C CD2 . TYR C 1 56 ? 73.937 31.856 8.801  1.00 45.30  ? 78  TYR C CD2 1 
ATOM   1809 C CE1 . TYR C 1 56 ? 71.621 33.054 9.796  1.00 45.30  ? 78  TYR C CE1 1 
ATOM   1810 C CE2 . TYR C 1 56 ? 74.027 33.050 9.543  1.00 45.30  ? 78  TYR C CE2 1 
ATOM   1811 C CZ  . TYR C 1 56 ? 72.865 33.645 10.040 1.00 45.30  ? 78  TYR C CZ  1 
ATOM   1812 O OH  . TYR C 1 56 ? 72.954 34.822 10.766 1.00 45.30  ? 78  TYR C OH  1 
ATOM   1813 N N   . GLY C 1 57 ? 71.685 27.018 7.093  1.00 74.91  ? 79  GLY C N   1 
ATOM   1814 C CA  . GLY C 1 57 ? 71.097 26.137 6.103  1.00 74.91  ? 79  GLY C CA  1 
ATOM   1815 C C   . GLY C 1 57 ? 71.612 26.519 4.728  1.00 74.91  ? 79  GLY C C   1 
ATOM   1816 O O   . GLY C 1 57 ? 71.549 25.740 3.776  1.00 74.91  ? 79  GLY C O   1 
ATOM   1817 N N   . ASP C 1 58 ? 72.124 27.741 4.639  1.00 58.01  ? 80  ASP C N   1 
ATOM   1818 C CA  . ASP C 1 58 ? 72.686 28.277 3.410  1.00 58.01  ? 80  ASP C CA  1 
ATOM   1819 C C   . ASP C 1 58 ? 73.791 27.357 2.891  1.00 58.01  ? 80  ASP C C   1 
ATOM   1820 O O   . ASP C 1 58 ? 74.095 27.354 1.700  1.00 58.01  ? 80  ASP C O   1 
ATOM   1821 C CB  . ASP C 1 58 ? 73.262 29.667 3.677  1.00 67.60  ? 80  ASP C CB  1 
ATOM   1822 C CG  . ASP C 1 58 ? 74.659 29.617 4.274  1.00 67.60  ? 80  ASP C CG  1 
ATOM   1823 O OD1 . ASP C 1 58 ? 74.813 29.244 5.468  1.00 67.60  ? 80  ASP C OD1 1 
ATOM   1824 O OD2 . ASP C 1 58 ? 75.609 29.953 3.536  1.00 67.60  ? 80  ASP C OD2 1 
ATOM   1825 N N   . LEU C 1 59 ? 74.390 26.584 3.798  1.00 75.99  ? 81  LEU C N   1 
ATOM   1826 C CA  . LEU C 1 59 ? 75.466 25.657 3.446  1.00 75.99  ? 81  LEU C CA  1 
ATOM   1827 C C   . LEU C 1 59 ? 75.552 24.485 4.421  1.00 75.99  ? 81  LEU C C   1 
ATOM   1828 O O   . LEU C 1 59 ? 75.278 24.637 5.616  1.00 75.99  ? 81  LEU C O   1 
ATOM   1829 C CB  . LEU C 1 59 ? 76.815 26.388 3.431  1.00 49.21  ? 81  LEU C CB  1 
ATOM   1830 C CG  . LEU C 1 59 ? 77.039 27.547 2.453  1.00 49.21  ? 81  LEU C CG  1 
ATOM   1831 C CD1 . LEU C 1 59 ? 78.431 28.098 2.629  1.00 49.21  ? 81  LEU C CD1 1 
ATOM   1832 C CD2 . LEU C 1 59 ? 76.858 27.070 1.039  1.00 49.21  ? 81  LEU C CD2 1 
ATOM   1833 N N   . TYR C 1 60 ? 75.934 23.322 3.890  1.00 38.98  ? 82  TYR C N   1 
ATOM   1834 C CA  . TYR C 1 60 ? 76.103 22.096 4.674  1.00 38.98  ? 82  TYR C CA  1 
ATOM   1835 C C   . TYR C 1 60 ? 76.736 20.950 3.878  1.00 38.98  ? 82  TYR C C   1 
ATOM   1836 O O   . TYR C 1 60 ? 76.645 20.896 2.655  1.00 38.98  ? 82  TYR C O   1 
ATOM   1837 C CB  . TYR C 1 60 ? 74.768 21.633 5.250  1.00 100.23 ? 82  TYR C CB  1 
ATOM   1838 C CG  . TYR C 1 60 ? 73.678 21.440 4.232  1.00 100.23 ? 82  TYR C CG  1 
ATOM   1839 C CD1 . TYR C 1 60 ? 73.049 22.533 3.646  1.00 100.23 ? 82  TYR C CD1 1 
ATOM   1840 C CD2 . TYR C 1 60 ? 73.234 20.165 3.898  1.00 100.23 ? 82  TYR C CD2 1 
ATOM   1841 C CE1 . TYR C 1 60 ? 71.999 22.365 2.757  1.00 100.23 ? 82  TYR C CE1 1 
ATOM   1842 C CE2 . TYR C 1 60 ? 72.185 19.984 3.011  1.00 100.23 ? 82  TYR C CE2 1 
ATOM   1843 C CZ  . TYR C 1 60 ? 71.569 21.088 2.446  1.00 100.23 ? 82  TYR C CZ  1 
ATOM   1844 O OH  . TYR C 1 60 ? 70.509 20.917 1.585  1.00 100.23 ? 82  TYR C OH  1 
ATOM   1845 N N   . PRO C 1 61 ? 77.406 20.021 4.569  1.00 50.31  ? 83  PRO C N   1 
ATOM   1846 C CA  . PRO C 1 61 ? 78.027 18.911 3.849  1.00 50.31  ? 83  PRO C CA  1 
ATOM   1847 C C   . PRO C 1 61 ? 77.043 17.824 3.428  1.00 50.31  ? 83  PRO C C   1 
ATOM   1848 O O   . PRO C 1 61 ? 75.997 17.630 4.054  1.00 50.31  ? 83  PRO C O   1 
ATOM   1849 C CB  . PRO C 1 61 ? 79.068 18.390 4.832  1.00 85.79  ? 83  PRO C CB  1 
ATOM   1850 C CG  . PRO C 1 61 ? 78.486 18.689 6.164  1.00 85.79  ? 83  PRO C CG  1 
ATOM   1851 C CD  . PRO C 1 61 ? 77.651 19.941 6.019  1.00 85.79  ? 83  PRO C CD  1 
ATOM   1852 N N   . VAL C 1 62 ? 77.395 17.125 2.353  1.00 72.85  ? 84  VAL C N   1 
ATOM   1853 C CA  . VAL C 1 62 ? 76.585 16.039 1.820  1.00 72.85  ? 84  VAL C CA  1 
ATOM   1854 C C   . VAL C 1 62 ? 77.488 14.832 1.670  1.00 72.85  ? 84  VAL C C   1 
ATOM   1855 O O   . VAL C 1 62 ? 77.023 13.711 1.481  1.00 72.85  ? 84  VAL C O   1 
ATOM   1856 C CB  . VAL C 1 62 ? 76.007 16.380 0.443  1.00 52.28  ? 84  VAL C CB  1 
ATOM   1857 C CG1 . VAL C 1 62 ? 74.710 15.614 0.234  1.00 52.28  ? 84  VAL C CG1 1 
ATOM   1858 C CG2 . VAL C 1 62 ? 75.782 17.881 0.322  1.00 52.28  ? 84  VAL C CG2 1 
ATOM   1859 N N   . THR C 1 63 ? 78.790 15.082 1.739  1.00 92.04  ? 85  THR C N   1 
ATOM   1860 C CA  . THR C 1 63 ? 79.784 14.028 1.645  1.00 92.04  ? 85  THR C CA  1 
ATOM   1861 C C   . THR C 1 63 ? 79.797 13.342 3.000  1.00 92.04  ? 85  THR C C   1 
ATOM   1862 O O   . THR C 1 63 ? 79.796 14.018 4.027  1.00 92.04  ? 85  THR C O   1 
ATOM   1863 C CB  . THR C 1 63 ? 81.184 14.601 1.404  1.00 90.13  ? 85  THR C CB  1 
ATOM   1864 O OG1 . THR C 1 63 ? 81.100 15.734 0.532  1.00 90.13  ? 85  THR C OG1 1 
ATOM   1865 C CG2 . THR C 1 63 ? 82.091 13.536 0.800  1.00 90.13  ? 85  THR C CG2 1 
ATOM   1866 N N   . LEU C 1 64 ? 79.808 12.013 3.018  1.00 123.13 ? 86  LEU C N   1 
ATOM   1867 C CA  . LEU C 1 64 ? 79.827 11.301 4.291  1.00 123.13 ? 86  LEU C CA  1 
ATOM   1868 C C   . LEU C 1 64 ? 80.906 11.908 5.183  1.00 123.13 ? 86  LEU C C   1 
ATOM   1869 O O   . LEU C 1 64 ? 80.660 12.234 6.345  1.00 123.13 ? 86  LEU C O   1 
ATOM   1870 C CB  . LEU C 1 64 ? 80.110 9.815  4.073  1.00 177.20 ? 86  LEU C CB  1 
ATOM   1871 C CG  . LEU C 1 64 ? 79.790 8.922  5.275  1.00 177.20 ? 86  LEU C CG  1 
ATOM   1872 C CD1 . LEU C 1 64 ? 78.289 8.928  5.529  1.00 177.20 ? 86  LEU C CD1 1 
ATOM   1873 C CD2 . LEU C 1 64 ? 80.288 7.509  5.016  1.00 177.20 ? 86  LEU C CD2 1 
ATOM   1874 N N   . TRP C 1 65 ? 82.099 12.066 4.620  1.00 105.09 ? 87  TRP C N   1 
ATOM   1875 C CA  . TRP C 1 65 ? 83.225 12.645 5.340  1.00 105.09 ? 87  TRP C CA  1 
ATOM   1876 C C   . TRP C 1 65 ? 82.912 14.093 5.701  1.00 105.09 ? 87  TRP C C   1 
ATOM   1877 O O   . TRP C 1 65 ? 83.004 14.491 6.862  1.00 105.09 ? 87  TRP C O   1 
ATOM   1878 C CB  . TRP C 1 65 ? 84.486 12.585 4.472  1.00 201.42 ? 87  TRP C CB  1 
ATOM   1879 C CG  . TRP C 1 65 ? 85.357 11.392 4.747  1.00 201.42 ? 87  TRP C CG  1 
ATOM   1880 C CD1 . TRP C 1 65 ? 86.714 11.324 4.613  1.00 201.42 ? 87  TRP C CD1 1 
ATOM   1881 C CD2 . TRP C 1 65 ? 84.932 10.102 5.212  1.00 201.42 ? 87  TRP C CD2 1 
ATOM   1882 N NE1 . TRP C 1 65 ? 87.161 10.073 4.966  1.00 201.42 ? 87  TRP C NE1 1 
ATOM   1883 C CE2 . TRP C 1 65 ? 86.090 9.304  5.338  1.00 201.42 ? 87  TRP C CE2 1 
ATOM   1884 C CE3 . TRP C 1 65 ? 83.687 9.542  5.535  1.00 201.42 ? 87  TRP C CE3 1 
ATOM   1885 C CZ2 . TRP C 1 65 ? 86.039 7.974  5.774  1.00 201.42 ? 87  TRP C CZ2 1 
ATOM   1886 C CZ3 . TRP C 1 65 ? 83.637 8.220  5.969  1.00 201.42 ? 87  TRP C CZ3 1 
ATOM   1887 C CH2 . TRP C 1 65 ? 84.807 7.453  6.083  1.00 201.42 ? 87  TRP C CH2 1 
ATOM   1888 N N   . GLY C 1 66 ? 82.543 14.879 4.696  1.00 64.22  ? 88  GLY C N   1 
ATOM   1889 C CA  . GLY C 1 66 ? 82.213 16.267 4.941  1.00 64.22  ? 88  GLY C CA  1 
ATOM   1890 C C   . GLY C 1 66 ? 81.290 16.398 6.135  1.00 64.22  ? 88  GLY C C   1 
ATOM   1891 O O   . GLY C 1 66 ? 81.337 17.401 6.844  1.00 64.22  ? 88  GLY C O   1 
ATOM   1892 N N   . ARG C 1 67 ? 80.455 15.383 6.360  1.00 96.43  ? 89  ARG C N   1 
ATOM   1893 C CA  . ARG C 1 67 ? 79.517 15.385 7.482  1.00 96.43  ? 89  ARG C CA  1 
ATOM   1894 C C   . ARG C 1 67 ? 80.275 15.148 8.779  1.00 96.43  ? 89  ARG C C   1 
ATOM   1895 O O   . ARG C 1 67 ? 79.902 15.660 9.836  1.00 96.43  ? 89  ARG C O   1 
ATOM   1896 C CB  . ARG C 1 67 ? 78.451 14.301 7.296  1.00 108.14 ? 89  ARG C CB  1 
ATOM   1897 C CG  . ARG C 1 67 ? 77.670 14.434 5.998  1.00 108.14 ? 89  ARG C CG  1 
ATOM   1898 C CD  . ARG C 1 67 ? 76.174 14.261 6.206  1.00 108.14 ? 89  ARG C CD  1 
ATOM   1899 N NE  . ARG C 1 67 ? 75.401 15.143 5.335  1.00 108.14 ? 89  ARG C NE  1 
ATOM   1900 C CZ  . ARG C 1 67 ? 74.309 14.773 4.672  1.00 108.14 ? 89  ARG C CZ  1 
ATOM   1901 N NH1 . ARG C 1 67 ? 73.851 13.531 4.778  1.00 108.14 ? 89  ARG C NH1 1 
ATOM   1902 N NH2 . ARG C 1 67 ? 73.673 15.646 3.901  1.00 108.14 ? 89  ARG C NH2 1 
ATOM   1903 N N   . CYS C 1 68 ? 81.344 14.366 8.695  1.00 55.15  ? 90  CYS C N   1 
ATOM   1904 C CA  . CYS C 1 68 ? 82.155 14.093 9.870  1.00 55.15  ? 90  CYS C CA  1 
ATOM   1905 C C   . CYS C 1 68 ? 82.751 15.416 10.291 1.00 55.15  ? 90  CYS C C   1 
ATOM   1906 O O   . CYS C 1 68 ? 82.505 15.893 11.397 1.00 55.15  ? 90  CYS C O   1 
ATOM   1907 C CB  . CYS C 1 68 ? 83.266 13.100 9.540  1.00 107.02 ? 90  CYS C CB  1 
ATOM   1908 S SG  . CYS C 1 68 ? 82.840 11.387 9.910  1.00 107.02 ? 90  CYS C SG  1 
ATOM   1909 N N   . VAL C 1 69 ? 83.520 16.014 9.388  1.00 42.16  ? 91  VAL C N   1 
ATOM   1910 C CA  . VAL C 1 69 ? 84.150 17.302 9.649  1.00 42.16  ? 91  VAL C CA  1 
ATOM   1911 C C   . VAL C 1 69 ? 83.145 18.254 10.301 1.00 42.16  ? 91  VAL C C   1 
ATOM   1912 O O   . VAL C 1 69 ? 83.506 19.081 11.147 1.00 42.16  ? 91  VAL C O   1 
ATOM   1913 C CB  . VAL C 1 69 ? 84.686 17.934 8.343  1.00 51.75  ? 91  VAL C CB  1 
ATOM   1914 C CG1 . VAL C 1 69 ? 85.343 19.279 8.628  1.00 51.75  ? 91  VAL C CG1 1 
ATOM   1915 C CG2 . VAL C 1 69 ? 85.684 16.992 7.700  1.00 51.75  ? 91  VAL C CG2 1 
ATOM   1916 N N   . ALA C 1 70 ? 81.881 18.129 9.911  1.00 43.91  ? 92  ALA C N   1 
ATOM   1917 C CA  . ALA C 1 70 ? 80.842 18.968 10.488 1.00 43.91  ? 92  ALA C CA  1 
ATOM   1918 C C   . ALA C 1 70 ? 80.740 18.655 11.986 1.00 43.91  ? 92  ALA C C   1 
ATOM   1919 O O   . ALA C 1 70 ? 80.918 19.535 12.834 1.00 43.91  ? 92  ALA C O   1 
ATOM   1920 C CB  . ALA C 1 70 ? 79.515 18.700 9.799  1.00 82.86  ? 92  ALA C CB  1 
ATOM   1921 N N   . VAL C 1 71 ? 80.465 17.394 12.302 1.00 47.04  ? 93  VAL C N   1 
ATOM   1922 C CA  . VAL C 1 71 ? 80.347 16.971 13.688 1.00 47.04  ? 93  VAL C CA  1 
ATOM   1923 C C   . VAL C 1 71 ? 81.486 17.564 14.509 1.00 47.04  ? 93  VAL C C   1 
ATOM   1924 O O   . VAL C 1 71 ? 81.264 18.253 15.501 1.00 47.04  ? 93  VAL C O   1 
ATOM   1925 C CB  . VAL C 1 71 ? 80.387 15.434 13.802 1.00 54.67  ? 93  VAL C CB  1 
ATOM   1926 C CG1 . VAL C 1 71 ? 81.078 15.017 15.094 1.00 54.67  ? 93  VAL C CG1 1 
ATOM   1927 C CG2 . VAL C 1 71 ? 78.976 14.881 13.761 1.00 54.67  ? 93  VAL C CG2 1 
ATOM   1928 N N   . VAL C 1 72 ? 82.710 17.293 14.086 1.00 44.26  ? 94  VAL C N   1 
ATOM   1929 C CA  . VAL C 1 72 ? 83.872 17.809 14.783 1.00 44.26  ? 94  VAL C CA  1 
ATOM   1930 C C   . VAL C 1 72 ? 83.757 19.310 14.997 1.00 44.26  ? 94  VAL C C   1 
ATOM   1931 O O   . VAL C 1 72 ? 83.672 19.775 16.130 1.00 44.26  ? 94  VAL C O   1 
ATOM   1932 C CB  . VAL C 1 72 ? 85.159 17.532 13.993 1.00 42.81  ? 94  VAL C CB  1 
ATOM   1933 C CG1 . VAL C 1 72 ? 86.247 18.529 14.394 1.00 42.81  ? 94  VAL C CG1 1 
ATOM   1934 C CG2 . VAL C 1 72 ? 85.607 16.099 14.234 1.00 42.81  ? 94  VAL C CG2 1 
ATOM   1935 N N   . VAL C 1 73 ? 83.752 20.067 13.905 1.00 45.50  ? 95  VAL C N   1 
ATOM   1936 C CA  . VAL C 1 73 ? 83.668 21.514 14.010 1.00 45.50  ? 95  VAL C CA  1 
ATOM   1937 C C   . VAL C 1 73 ? 82.485 21.939 14.875 1.00 45.50  ? 95  VAL C C   1 
ATOM   1938 O O   . VAL C 1 73 ? 82.396 23.093 15.303 1.00 45.50  ? 95  VAL C O   1 
ATOM   1939 C CB  . VAL C 1 73 ? 83.549 22.165 12.623 1.00 63.71  ? 95  VAL C CB  1 
ATOM   1940 C CG1 . VAL C 1 73 ? 82.286 21.707 11.954 1.00 63.71  ? 95  VAL C CG1 1 
ATOM   1941 C CG2 . VAL C 1 73 ? 83.567 23.685 12.750 1.00 63.71  ? 95  VAL C CG2 1 
ATOM   1942 N N   . MET C 1 74 ? 81.576 21.008 15.137 1.00 90.80  ? 96  MET C N   1 
ATOM   1943 C CA  . MET C 1 74 ? 80.428 21.323 15.968 1.00 90.80  ? 96  MET C CA  1 
ATOM   1944 C C   . MET C 1 74 ? 80.813 21.274 17.435 1.00 90.80  ? 96  MET C C   1 
ATOM   1945 O O   . MET C 1 74 ? 80.813 22.302 18.104 1.00 90.80  ? 96  MET C O   1 
ATOM   1946 C CB  . MET C 1 74 ? 79.291 20.349 15.714 1.00 73.31  ? 96  MET C CB  1 
ATOM   1947 C CG  . MET C 1 74 ? 78.105 20.978 15.043 1.00 73.31  ? 96  MET C CG  1 
ATOM   1948 S SD  . MET C 1 74 ? 77.534 19.871 13.780 1.00 73.31  ? 96  MET C SD  1 
ATOM   1949 C CE  . MET C 1 74 ? 75.862 19.558 14.318 1.00 73.31  ? 96  MET C CE  1 
ATOM   1950 N N   . VAL C 1 75 ? 81.147 20.088 17.939 1.00 46.30  ? 97  VAL C N   1 
ATOM   1951 C CA  . VAL C 1 75 ? 81.522 19.960 19.343 1.00 46.30  ? 97  VAL C CA  1 
ATOM   1952 C C   . VAL C 1 75 ? 82.548 21.023 19.694 1.00 46.30  ? 97  VAL C C   1 
ATOM   1953 O O   . VAL C 1 75 ? 82.416 21.708 20.700 1.00 46.30  ? 97  VAL C O   1 
ATOM   1954 C CB  . VAL C 1 75 ? 82.091 18.551 19.668 1.00 44.71  ? 97  VAL C CB  1 
ATOM   1955 C CG1 . VAL C 1 75 ? 81.413 17.512 18.802 1.00 44.71  ? 97  VAL C CG1 1 
ATOM   1956 C CG2 . VAL C 1 75 ? 83.601 18.514 19.474 1.00 44.71  ? 97  VAL C CG2 1 
ATOM   1957 N N   . ALA C 1 76 ? 83.559 21.167 18.847 1.00 42.84  ? 98  ALA C N   1 
ATOM   1958 C CA  . ALA C 1 76 ? 84.598 22.160 19.063 1.00 42.84  ? 98  ALA C CA  1 
ATOM   1959 C C   . ALA C 1 76 ? 83.950 23.425 19.588 1.00 42.84  ? 98  ALA C C   1 
ATOM   1960 O O   . ALA C 1 76 ? 84.436 24.034 20.527 1.00 42.84  ? 98  ALA C O   1 
ATOM   1961 C CB  . ALA C 1 76 ? 85.316 22.455 17.763 1.00 52.09  ? 98  ALA C CB  1 
ATOM   1962 N N   . GLY C 1 77 ? 82.836 23.807 18.983 1.00 20.59  ? 99  GLY C N   1 
ATOM   1963 C CA  . GLY C 1 77 ? 82.140 25.003 19.414 1.00 20.59  ? 99  GLY C CA  1 
ATOM   1964 C C   . GLY C 1 77 ? 81.343 24.823 20.694 1.00 20.59  ? 99  GLY C C   1 
ATOM   1965 O O   . GLY C 1 77 ? 81.470 25.630 21.617 1.00 20.59  ? 99  GLY C O   1 
ATOM   1966 N N   . ILE C 1 78 ? 80.512 23.782 20.757 1.00 86.18  ? 100 ILE C N   1 
ATOM   1967 C CA  . ILE C 1 78 ? 79.702 23.531 21.948 1.00 86.18  ? 100 ILE C CA  1 
ATOM   1968 C C   . ILE C 1 78 ? 80.630 23.453 23.147 1.00 86.18  ? 100 ILE C C   1 
ATOM   1969 O O   . ILE C 1 78 ? 80.292 23.877 24.255 1.00 86.18  ? 100 ILE C O   1 
ATOM   1970 C CB  . ILE C 1 78 ? 78.942 22.187 21.863 1.00 93.27  ? 100 ILE C CB  1 
ATOM   1971 C CG1 . ILE C 1 78 ? 78.325 22.011 20.480 1.00 93.27  ? 100 ILE C CG1 1 
ATOM   1972 C CG2 . ILE C 1 78 ? 77.855 22.135 22.928 1.00 93.27  ? 100 ILE C CG2 1 
ATOM   1973 C CD1 . ILE C 1 78 ? 77.707 20.649 20.267 1.00 93.27  ? 100 ILE C CD1 1 
ATOM   1974 N N   . THR C 1 79 ? 81.815 22.910 22.896 1.00 38.86  ? 101 THR C N   1 
ATOM   1975 C CA  . THR C 1 79 ? 82.829 22.723 23.911 1.00 38.86  ? 101 THR C CA  1 
ATOM   1976 C C   . THR C 1 79 ? 83.670 23.971 24.126 1.00 38.86  ? 101 THR C C   1 
ATOM   1977 O O   . THR C 1 79 ? 83.625 24.565 25.193 1.00 38.86  ? 101 THR C O   1 
ATOM   1978 C CB  . THR C 1 79 ? 83.706 21.529 23.525 1.00 31.16  ? 101 THR C CB  1 
ATOM   1979 O OG1 . THR C 1 79 ? 83.167 20.346 24.133 1.00 31.16  ? 101 THR C OG1 1 
ATOM   1980 C CG2 . THR C 1 79 ? 85.148 21.743 23.947 1.00 31.16  ? 101 THR C CG2 1 
ATOM   1981 N N   . SER C 1 80 ? 84.431 24.379 23.120 1.00 63.09  ? 102 SER C N   1 
ATOM   1982 C CA  . SER C 1 80 ? 85.261 25.568 23.264 1.00 63.09  ? 102 SER C CA  1 
ATOM   1983 C C   . SER C 1 80 ? 84.504 26.693 23.969 1.00 63.09  ? 102 SER C C   1 
ATOM   1984 O O   . SER C 1 80 ? 85.085 27.460 24.734 1.00 63.09  ? 102 SER C O   1 
ATOM   1985 C CB  . SER C 1 80 ? 85.742 26.061 21.896 1.00 147.09 ? 102 SER C CB  1 
ATOM   1986 O OG  . SER C 1 80 ? 85.494 27.450 21.735 1.00 147.09 ? 102 SER C OG  1 
ATOM   1987 N N   . PHE C 1 81 ? 83.205 26.791 23.718 1.00 58.96  ? 103 PHE C N   1 
ATOM   1988 C CA  . PHE C 1 81 ? 82.415 27.841 24.339 1.00 58.96  ? 103 PHE C CA  1 
ATOM   1989 C C   . PHE C 1 81 ? 82.000 27.476 25.749 1.00 58.96  ? 103 PHE C C   1 
ATOM   1990 O O   . PHE C 1 81 ? 81.870 28.347 26.603 1.00 58.96  ? 103 PHE C O   1 
ATOM   1991 C CB  . PHE C 1 81 ? 81.187 28.149 23.486 1.00 80.78  ? 103 PHE C CB  1 
ATOM   1992 C CG  . PHE C 1 81 ? 81.408 29.257 22.510 1.00 80.78  ? 103 PHE C CG  1 
ATOM   1993 C CD1 . PHE C 1 81 ? 81.619 30.557 22.959 1.00 80.78  ? 103 PHE C CD1 1 
ATOM   1994 C CD2 . PHE C 1 81 ? 81.446 29.001 21.147 1.00 80.78  ? 103 PHE C CD2 1 
ATOM   1995 C CE1 . PHE C 1 81 ? 81.867 31.590 22.065 1.00 80.78  ? 103 PHE C CE1 1 
ATOM   1996 C CE2 . PHE C 1 81 ? 81.694 30.024 20.243 1.00 80.78  ? 103 PHE C CE2 1 
ATOM   1997 C CZ  . PHE C 1 81 ? 81.905 31.324 20.703 1.00 80.78  ? 103 PHE C CZ  1 
ATOM   1998 N N   . GLY C 1 82 ? 81.797 26.185 25.991 1.00 65.90  ? 104 GLY C N   1 
ATOM   1999 C CA  . GLY C 1 82 ? 81.411 25.735 27.316 1.00 65.90  ? 104 GLY C CA  1 
ATOM   2000 C C   . GLY C 1 82 ? 82.418 26.173 28.364 1.00 65.90  ? 104 GLY C C   1 
ATOM   2001 O O   . GLY C 1 82 ? 82.051 26.711 29.408 1.00 65.90  ? 104 GLY C O   1 
ATOM   2002 N N   . LEU C 1 83 ? 83.693 25.937 28.082 1.00 49.06  ? 105 LEU C N   1 
ATOM   2003 C CA  . LEU C 1 83 ? 84.753 26.324 28.993 1.00 49.06  ? 105 LEU C CA  1 
ATOM   2004 C C   . LEU C 1 83 ? 84.579 27.785 29.386 1.00 49.06  ? 105 LEU C C   1 
ATOM   2005 O O   . LEU C 1 83 ? 84.519 28.114 30.570 1.00 49.06  ? 105 LEU C O   1 
ATOM   2006 C CB  . LEU C 1 83 ? 86.110 26.133 28.328 1.00 67.65  ? 105 LEU C CB  1 
ATOM   2007 C CG  . LEU C 1 83 ? 86.830 24.849 28.725 1.00 67.65  ? 105 LEU C CG  1 
ATOM   2008 C CD1 . LEU C 1 83 ? 86.733 23.833 27.605 1.00 67.65  ? 105 LEU C CD1 1 
ATOM   2009 C CD2 . LEU C 1 83 ? 88.279 25.165 29.033 1.00 67.65  ? 105 LEU C CD2 1 
ATOM   2010 N N   . VAL C 1 84 ? 84.495 28.662 28.391 1.00 40.69  ? 106 VAL C N   1 
ATOM   2011 C CA  . VAL C 1 84 ? 84.320 30.085 28.656 1.00 40.69  ? 106 VAL C CA  1 
ATOM   2012 C C   . VAL C 1 84 ? 83.177 30.315 29.641 1.00 40.69  ? 106 VAL C C   1 
ATOM   2013 O O   . VAL C 1 84 ? 83.219 31.242 30.447 1.00 40.69  ? 106 VAL C O   1 
ATOM   2014 C CB  . VAL C 1 84 ? 84.020 30.865 27.365 1.00 69.59  ? 106 VAL C CB  1 
ATOM   2015 C CG1 . VAL C 1 84 ? 83.806 32.346 27.680 1.00 69.59  ? 106 VAL C CG1 1 
ATOM   2016 C CG2 . VAL C 1 84 ? 85.164 30.685 26.387 1.00 69.59  ? 106 VAL C CG2 1 
ATOM   2017 N N   . THR C 1 85 ? 82.151 29.477 29.573 1.00 86.17  ? 107 THR C N   1 
ATOM   2018 C CA  . THR C 1 85 ? 81.034 29.620 30.493 1.00 86.17  ? 107 THR C CA  1 
ATOM   2019 C C   . THR C 1 85 ? 81.506 29.115 31.838 1.00 86.17  ? 107 THR C C   1 
ATOM   2020 O O   . THR C 1 85 ? 81.212 29.711 32.870 1.00 86.17  ? 107 THR C O   1 
ATOM   2021 C CB  . THR C 1 85 ? 79.808 28.800 30.051 1.00 137.70 ? 107 THR C CB  1 
ATOM   2022 O OG1 . THR C 1 85 ? 78.866 29.671 29.416 1.00 137.70 ? 107 THR C OG1 1 
ATOM   2023 C CG2 . THR C 1 85 ? 79.131 28.142 31.252 1.00 137.70 ? 107 THR C CG2 1 
ATOM   2024 N N   . ALA C 1 86 ? 82.238 28.006 31.813 1.00 80.33  ? 108 ALA C N   1 
ATOM   2025 C CA  . ALA C 1 86 ? 82.772 27.418 33.033 1.00 80.33  ? 108 ALA C CA  1 
ATOM   2026 C C   . ALA C 1 86 ? 83.608 28.480 33.717 1.00 80.33  ? 108 ALA C C   1 
ATOM   2027 O O   . ALA C 1 86 ? 83.370 28.822 34.875 1.00 80.33  ? 108 ALA C O   1 
ATOM   2028 C CB  . ALA C 1 86 ? 83.630 26.209 32.702 1.00 56.84  ? 108 ALA C CB  1 
ATOM   2029 N N   . ALA C 1 87 ? 84.586 29.002 32.985 1.00 57.57  ? 109 ALA C N   1 
ATOM   2030 C CA  . ALA C 1 87 ? 85.457 30.041 33.501 1.00 57.57  ? 109 ALA C CA  1 
ATOM   2031 C C   . ALA C 1 87 ? 84.619 31.064 34.252 1.00 57.57  ? 109 ALA C C   1 
ATOM   2032 O O   . ALA C 1 87 ? 84.835 31.319 35.431 1.00 57.57  ? 109 ALA C O   1 
ATOM   2033 C CB  . ALA C 1 87 ? 86.186 30.716 32.362 1.00 4.90   ? 109 ALA C CB  1 
ATOM   2034 N N   . LEU C 1 88 ? 83.644 31.639 33.564 1.00 84.25  ? 110 LEU C N   1 
ATOM   2035 C CA  . LEU C 1 88 ? 82.780 32.643 34.169 1.00 84.25  ? 110 LEU C CA  1 
ATOM   2036 C C   . LEU C 1 88 ? 81.975 32.131 35.368 1.00 84.25  ? 110 LEU C C   1 
ATOM   2037 O O   . LEU C 1 88 ? 81.744 32.871 36.325 1.00 84.25  ? 110 LEU C O   1 
ATOM   2038 C CB  . LEU C 1 88 ? 81.828 33.200 33.109 1.00 98.47  ? 110 LEU C CB  1 
ATOM   2039 C CG  . LEU C 1 88 ? 82.352 34.375 32.280 1.00 98.47  ? 110 LEU C CG  1 
ATOM   2040 C CD1 . LEU C 1 88 ? 83.569 33.946 31.471 1.00 98.47  ? 110 LEU C CD1 1 
ATOM   2041 C CD2 . LEU C 1 88 ? 81.248 34.872 31.370 1.00 98.47  ? 110 LEU C CD2 1 
ATOM   2042 N N   . ALA C 1 89 ? 81.547 30.871 35.315 1.00 108.86 ? 111 ALA C N   1 
ATOM   2043 C CA  . ALA C 1 89 ? 80.759 30.291 36.399 1.00 108.86 ? 111 ALA C CA  1 
ATOM   2044 C C   . ALA C 1 89 ? 81.525 30.285 37.708 1.00 108.86 ? 111 ALA C C   1 
ATOM   2045 O O   . ALA C 1 89 ? 80.937 30.443 38.772 1.00 108.86 ? 111 ALA C O   1 
ATOM   2046 C CB  . ALA C 1 89 ? 80.336 28.874 36.047 1.00 61.87  ? 111 ALA C CB  1 
ATOM   2047 N N   . THR C 1 90 ? 82.838 30.103 37.633 1.00 131.43 ? 112 THR C N   1 
ATOM   2048 C CA  . THR C 1 90 ? 83.664 30.075 38.834 1.00 131.43 ? 112 THR C CA  1 
ATOM   2049 C C   . THR C 1 90 ? 84.103 31.475 39.256 1.00 131.43 ? 112 THR C C   1 
ATOM   2050 O O   . THR C 1 90 ? 84.142 31.788 40.446 1.00 131.43 ? 112 THR C O   1 
ATOM   2051 C CB  . THR C 1 90 ? 84.926 29.205 38.633 1.00 65.78  ? 112 THR C CB  1 
ATOM   2052 O OG1 . THR C 1 90 ? 86.043 30.045 38.324 1.00 65.78  ? 112 THR C OG1 1 
ATOM   2053 C CG2 . THR C 1 90 ? 84.719 28.218 37.506 1.00 65.78  ? 112 THR C CG2 1 
ATOM   2054 N N   . TRP C 1 91 ? 84.432 32.314 38.278 1.00 125.70 ? 113 TRP C N   1 
ATOM   2055 C CA  . TRP C 1 91 ? 84.869 33.680 38.550 1.00 125.70 ? 113 TRP C CA  1 
ATOM   2056 C C   . TRP C 1 91 ? 83.742 34.464 39.215 1.00 125.70 ? 113 TRP C C   1 
ATOM   2057 O O   . TRP C 1 91 ? 83.888 35.642 39.548 1.00 125.70 ? 113 TRP C O   1 
ATOM   2058 C CB  . TRP C 1 91 ? 85.295 34.363 37.246 1.00 166.82 ? 113 TRP C CB  1 
ATOM   2059 C CG  . TRP C 1 91 ? 85.765 35.775 37.420 1.00 166.82 ? 113 TRP C CG  1 
ATOM   2060 C CD1 . TRP C 1 91 ? 86.939 36.198 37.975 1.00 166.82 ? 113 TRP C CD1 1 
ATOM   2061 C CD2 . TRP C 1 91 ? 85.063 36.958 37.011 1.00 166.82 ? 113 TRP C CD2 1 
ATOM   2062 N NE1 . TRP C 1 91 ? 87.010 37.573 37.934 1.00 166.82 ? 113 TRP C NE1 1 
ATOM   2063 C CE2 . TRP C 1 91 ? 85.876 38.065 37.350 1.00 166.82 ? 113 TRP C CE2 1 
ATOM   2064 C CE3 . TRP C 1 91 ? 83.825 37.185 36.392 1.00 166.82 ? 113 TRP C CE3 1 
ATOM   2065 C CZ2 . TRP C 1 91 ? 85.490 39.376 37.087 1.00 166.82 ? 113 TRP C CZ2 1 
ATOM   2066 C CZ3 . TRP C 1 91 ? 83.444 38.494 36.133 1.00 166.82 ? 113 TRP C CZ3 1 
ATOM   2067 C CH2 . TRP C 1 91 ? 84.271 39.572 36.479 1.00 166.82 ? 113 TRP C CH2 1 
ATOM   2068 N N   . PHE C 1 92 ? 82.610 33.795 39.396 1.00 120.34 ? 114 PHE C N   1 
ATOM   2069 C CA  . PHE C 1 92 ? 81.458 34.398 40.044 1.00 120.34 ? 114 PHE C CA  1 
ATOM   2070 C C   . PHE C 1 92 ? 81.347 33.764 41.421 1.00 120.34 ? 114 PHE C C   1 
ATOM   2071 O O   . PHE C 1 92 ? 80.662 34.275 42.299 1.00 120.34 ? 114 PHE C O   1 
ATOM   2072 C CB  . PHE C 1 92 ? 80.196 34.143 39.223 1.00 155.76 ? 114 PHE C CB  1 
ATOM   2073 C CG  . PHE C 1 92 ? 79.870 35.247 38.262 1.00 155.76 ? 114 PHE C CG  1 
ATOM   2074 C CD1 . PHE C 1 92 ? 80.716 36.347 38.147 1.00 155.76 ? 114 PHE C CD1 1 
ATOM   2075 C CD2 . PHE C 1 92 ? 78.726 35.195 37.475 1.00 155.76 ? 114 PHE C CD2 1 
ATOM   2076 C CE1 . PHE C 1 92 ? 80.430 37.381 37.264 1.00 155.76 ? 114 PHE C CE1 1 
ATOM   2077 C CE2 . PHE C 1 92 ? 78.429 36.228 36.584 1.00 155.76 ? 114 PHE C CE2 1 
ATOM   2078 C CZ  . PHE C 1 92 ? 79.286 37.324 36.479 1.00 155.76 ? 114 PHE C CZ  1 
ATOM   2079 N N   . VAL C 1 93 ? 82.047 32.644 41.585 1.00 147.30 ? 115 VAL C N   1 
ATOM   2080 C CA  . VAL C 1 93 ? 82.096 31.918 42.843 1.00 147.30 ? 115 VAL C CA  1 
ATOM   2081 C C   . VAL C 1 93 ? 83.329 32.448 43.575 1.00 147.30 ? 115 VAL C C   1 
ATOM   2082 O O   . VAL C 1 93 ? 83.407 32.413 44.803 1.00 147.30 ? 115 VAL C O   1 
ATOM   2083 C CB  . VAL C 1 93 ? 82.210 30.395 42.589 1.00 85.47  ? 115 VAL C CB  1 
ATOM   2084 C CG1 . VAL C 1 93 ? 82.823 29.689 43.788 1.00 85.47  ? 115 VAL C CG1 1 
ATOM   2085 C CG2 . VAL C 1 93 ? 80.844 29.812 42.289 1.00 85.47  ? 115 VAL C CG2 1 
ATOM   2086 N N   . GLY C 1 94 ? 84.288 32.951 42.797 1.00 141.54 ? 116 GLY C N   1 
ATOM   2087 C CA  . GLY C 1 94 ? 85.511 33.513 43.353 1.00 141.54 ? 116 GLY C CA  1 
ATOM   2088 C C   . GLY C 1 94 ? 85.195 34.834 44.029 1.00 141.54 ? 116 GLY C C   1 
ATOM   2089 O O   . GLY C 1 94 ? 86.021 35.747 44.103 1.00 141.54 ? 116 GLY C O   1 
ATOM   2090 N N   . ARG C 1 95 ? 83.958 34.921 44.501 1.00 98.93  ? 117 ARG C N   1 
ATOM   2091 C CA  . ARG C 1 95 ? 83.434 36.079 45.203 1.00 98.93  ? 117 ARG C CA  1 
ATOM   2092 C C   . ARG C 1 95 ? 82.497 35.497 46.254 1.00 98.93  ? 117 ARG C C   1 
ATOM   2093 O O   . ARG C 1 95 ? 81.324 35.875 46.360 1.00 98.93  ? 117 ARG C O   1 
ATOM   2094 C CB  . ARG C 1 95 ? 82.671 36.992 44.243 1.00 135.48 ? 117 ARG C CB  1 
ATOM   2095 C CG  . ARG C 1 95 ? 83.534 38.073 43.618 1.00 135.48 ? 117 ARG C CG  1 
ATOM   2096 C CD  . ARG C 1 95 ? 83.582 39.310 44.496 1.00 135.48 ? 117 ARG C CD  1 
ATOM   2097 N NE  . ARG C 1 95 ? 84.489 40.320 43.962 1.00 135.48 ? 117 ARG C NE  1 
ATOM   2098 N N   . GLU C 1 96 ? 83.043 34.543 47.005 1.00 220.34 ? 118 GLU C N   1 
ATOM   2099 C CA  . GLU C 1 96 ? 82.336 33.854 48.077 1.00 220.34 ? 118 GLU C CA  1 
ATOM   2100 C C   . GLU C 1 96 ? 82.906 34.354 49.401 1.00 220.34 ? 118 GLU C C   1 
ATOM   2101 O O   . GLU C 1 96 ? 82.277 34.234 50.451 1.00 220.34 ? 118 GLU C O   1 
ATOM   2102 C CB  . GLU C 1 96 ? 82.553 32.341 47.967 1.00 156.56 ? 118 GLU C CB  1 
ATOM   2103 C CG  . GLU C 1 96 ? 83.990 31.898 48.234 1.00 156.56 ? 118 GLU C CG  1 
ATOM   2104 C CD  . GLU C 1 96 ? 84.142 30.388 48.316 1.00 156.56 ? 118 GLU C CD  1 
ATOM   2105 O OE1 . GLU C 1 96 ? 83.119 29.682 48.453 1.00 156.56 ? 118 GLU C OE1 1 
ATOM   2106 O OE2 . GLU C 1 96 ? 85.291 29.904 48.243 1.00 156.56 ? 118 GLU C OE2 1 
ATOM   2107 N N   . GLN C 1 97 ? 84.110 34.912 49.332 1.00 182.89 ? 119 GLN C N   1 
ATOM   2108 C CA  . GLN C 1 97 ? 84.794 35.439 50.503 1.00 182.89 ? 119 GLN C CA  1 
ATOM   2109 C C   . GLN C 1 97 ? 84.019 36.639 51.070 1.00 182.89 ? 119 GLN C C   1 
ATOM   2110 O O   . GLN C 1 97 ? 83.901 36.729 52.311 1.00 182.89 ? 119 GLN C O   1 
ATOM   2111 C CB  . GLN C 1 97 ? 86.204 35.869 50.103 1.00 185.30 ? 119 GLN C CB  1 
ATOM   2112 C CG  . GLN C 1 97 ? 86.159 37.195 49.384 1.00 185.30 ? 119 GLN C CG  1 
ATOM   2113 C CD  . GLN C 1 97 ? 87.019 37.301 48.152 1.00 185.30 ? 119 GLN C CD  1 
ATOM   2114 O OE1 . GLN C 1 97 ? 87.672 38.307 47.966 1.00 185.30 ? 119 GLN C OE1 1 
ATOM   2115 N NE2 . GLN C 1 97 ? 87.002 36.295 47.294 1.00 185.30 ? 119 GLN C NE2 1 
ATOM   2116 N N   . ALA D 1 1  ? 76.858 43.530 44.033 1.00 189.15 ? 23  ALA D N   1 
ATOM   2117 C CA  . ALA D 1 1  ? 77.708 42.304 43.987 1.00 189.15 ? 23  ALA D CA  1 
ATOM   2118 C C   . ALA D 1 1  ? 78.529 42.266 42.703 1.00 189.15 ? 23  ALA D C   1 
ATOM   2119 O O   . ALA D 1 1  ? 79.325 43.168 42.434 1.00 189.15 ? 23  ALA D O   1 
ATOM   2120 C CB  . ALA D 1 1  ? 76.828 41.058 44.083 1.00 76.26  ? 23  ALA D CB  1 
ATOM   2121 N N   . LEU D 1 2  ? 78.330 41.212 41.918 1.00 159.21 ? 24  LEU D N   1 
ATOM   2122 C CA  . LEU D 1 2  ? 79.033 41.036 40.652 1.00 159.21 ? 24  LEU D CA  1 
ATOM   2123 C C   . LEU D 1 2  ? 78.367 39.934 39.838 1.00 159.21 ? 24  LEU D C   1 
ATOM   2124 O O   . LEU D 1 2  ? 77.708 40.196 38.834 1.00 159.21 ? 24  LEU D O   1 
ATOM   2125 C CB  . LEU D 1 2  ? 80.498 40.673 40.901 1.00 124.16 ? 24  LEU D CB  1 
ATOM   2126 C CG  . LEU D 1 2  ? 81.355 40.507 39.645 1.00 124.16 ? 24  LEU D CG  1 
ATOM   2127 C CD1 . LEU D 1 2  ? 82.313 41.681 39.526 1.00 124.16 ? 24  LEU D CD1 1 
ATOM   2128 C CD2 . LEU D 1 2  ? 82.116 39.191 39.709 1.00 124.16 ? 24  LEU D CD2 1 
ATOM   2129 N N   . HIS D 1 3  ? 78.545 38.696 40.283 1.00 142.73 ? 25  HIS D N   1 
ATOM   2130 C CA  . HIS D 1 3  ? 77.960 37.550 39.609 1.00 142.73 ? 25  HIS D CA  1 
ATOM   2131 C C   . HIS D 1 3  ? 76.505 37.819 39.246 1.00 142.73 ? 25  HIS D C   1 
ATOM   2132 O O   . HIS D 1 3  ? 75.999 37.309 38.252 1.00 142.73 ? 25  HIS D O   1 
ATOM   2133 C CB  . HIS D 1 3  ? 78.042 36.317 40.513 1.00 164.64 ? 25  HIS D CB  1 
ATOM   2134 C CG  . HIS D 1 3  ? 76.838 36.126 41.383 1.00 164.64 ? 25  HIS D CG  1 
ATOM   2135 N ND1 . HIS D 1 3  ? 75.896 35.149 41.145 1.00 164.64 ? 25  HIS D ND1 1 
ATOM   2136 C CD2 . HIS D 1 3  ? 76.418 36.796 42.481 1.00 164.64 ? 25  HIS D CD2 1 
ATOM   2137 C CE1 . HIS D 1 3  ? 74.945 35.225 42.061 1.00 164.64 ? 25  HIS D CE1 1 
ATOM   2138 N NE2 . HIS D 1 3  ? 75.238 36.217 42.884 1.00 164.64 ? 25  HIS D NE2 1 
ATOM   2139 N N   . TRP D 1 4  ? 75.845 38.634 40.062 1.00 98.88  ? 26  TRP D N   1 
ATOM   2140 C CA  . TRP D 1 4  ? 74.439 38.967 39.867 1.00 98.88  ? 26  TRP D CA  1 
ATOM   2141 C C   . TRP D 1 4  ? 74.246 40.328 39.212 1.00 98.88  ? 26  TRP D C   1 
ATOM   2142 O O   . TRP D 1 4  ? 73.141 40.667 38.790 1.00 98.88  ? 26  TRP D O   1 
ATOM   2143 C CB  . TRP D 1 4  ? 73.726 38.956 41.220 1.00 179.07 ? 26  TRP D CB  1 
ATOM   2144 C CG  . TRP D 1 4  ? 72.353 38.357 41.213 1.00 179.07 ? 26  TRP D CG  1 
ATOM   2145 C CD1 . TRP D 1 4  ? 71.268 38.802 41.908 1.00 179.07 ? 26  TRP D CD1 1 
ATOM   2146 C CD2 . TRP D 1 4  ? 71.926 37.182 40.513 1.00 179.07 ? 26  TRP D CD2 1 
ATOM   2147 N NE1 . TRP D 1 4  ? 70.191 37.979 41.689 1.00 179.07 ? 26  TRP D NE1 1 
ATOM   2148 C CE2 . TRP D 1 4  ? 70.566 36.976 40.836 1.00 179.07 ? 26  TRP D CE2 1 
ATOM   2149 C CE3 . TRP D 1 4  ? 72.558 36.283 39.644 1.00 179.07 ? 26  TRP D CE3 1 
ATOM   2150 C CZ2 . TRP D 1 4  ? 69.826 35.907 40.322 1.00 179.07 ? 26  TRP D CZ2 1 
ATOM   2151 C CZ3 . TRP D 1 4  ? 71.822 35.218 39.133 1.00 179.07 ? 26  TRP D CZ3 1 
ATOM   2152 C CH2 . TRP D 1 4  ? 70.469 35.041 39.474 1.00 179.07 ? 26  TRP D CH2 1 
ATOM   2153 N N   . ARG D 1 5  ? 75.319 41.107 39.130 1.00 108.83 ? 27  ARG D N   1 
ATOM   2154 C CA  . ARG D 1 5  ? 75.238 42.437 38.541 1.00 108.83 ? 27  ARG D CA  1 
ATOM   2155 C C   . ARG D 1 5  ? 76.042 42.559 37.262 1.00 108.83 ? 27  ARG D C   1 
ATOM   2156 O O   . ARG D 1 5  ? 75.775 43.434 36.441 1.00 108.83 ? 27  ARG D O   1 
ATOM   2157 C CB  . ARG D 1 5  ? 75.717 43.489 39.544 1.00 187.93 ? 27  ARG D CB  1 
ATOM   2158 N N   . ALA D 1 6  ? 77.036 41.692 37.099 1.00 145.36 ? 28  ALA D N   1 
ATOM   2159 C CA  . ALA D 1 6  ? 77.867 41.707 35.902 1.00 145.36 ? 28  ALA D CA  1 
ATOM   2160 C C   . ALA D 1 6  ? 77.041 41.158 34.746 1.00 145.36 ? 28  ALA D C   1 
ATOM   2161 O O   . ALA D 1 6  ? 77.385 41.336 33.575 1.00 145.36 ? 28  ALA D O   1 
ATOM   2162 C CB  . ALA D 1 6  ? 79.111 40.853 36.114 1.00 172.16 ? 28  ALA D CB  1 
ATOM   2163 N N   . ALA D 1 7  ? 75.944 40.491 35.097 1.00 106.66 ? 29  ALA D N   1 
ATOM   2164 C CA  . ALA D 1 7  ? 75.037 39.901 34.121 1.00 106.66 ? 29  ALA D CA  1 
ATOM   2165 C C   . ALA D 1 7  ? 73.940 40.893 33.753 1.00 106.66 ? 29  ALA D C   1 
ATOM   2166 O O   . ALA D 1 7  ? 73.885 41.376 32.623 1.00 106.66 ? 29  ALA D O   1 
ATOM   2167 C CB  . ALA D 1 7  ? 74.420 38.625 34.688 1.00 119.26 ? 29  ALA D CB  1 
ATOM   2168 N N   . GLY D 1 8  ? 73.072 41.192 34.714 1.00 135.26 ? 30  GLY D N   1 
ATOM   2169 C CA  . GLY D 1 8  ? 71.992 42.128 34.469 1.00 135.26 ? 30  GLY D CA  1 
ATOM   2170 C C   . GLY D 1 8  ? 72.441 43.339 33.673 1.00 135.26 ? 30  GLY D C   1 
ATOM   2171 O O   . GLY D 1 8  ? 71.628 44.002 33.034 1.00 135.26 ? 30  GLY D O   1 
ATOM   2172 N N   . ALA D 1 9  ? 73.738 43.629 33.701 1.00 130.51 ? 31  ALA D N   1 
ATOM   2173 C CA  . ALA D 1 9  ? 74.271 44.774 32.975 1.00 130.51 ? 31  ALA D CA  1 
ATOM   2174 C C   . ALA D 1 9  ? 74.797 44.405 31.601 1.00 130.51 ? 31  ALA D C   1 
ATOM   2175 O O   . ALA D 1 9  ? 74.606 45.150 30.642 1.00 130.51 ? 31  ALA D O   1 
ATOM   2176 C CB  . ALA D 1 9  ? 75.373 45.434 33.777 1.00 154.48 ? 31  ALA D CB  1 
ATOM   2177 N N   . ALA D 1 10 ? 75.471 43.265 31.508 1.00 124.43 ? 32  ALA D N   1 
ATOM   2178 C CA  . ALA D 1 10 ? 76.030 42.822 30.238 1.00 124.43 ? 32  ALA D CA  1 
ATOM   2179 C C   . ALA D 1 10 ? 74.979 42.797 29.153 1.00 124.43 ? 32  ALA D C   1 
ATOM   2180 O O   . ALA D 1 10 ? 75.225 43.226 28.033 1.00 124.43 ? 32  ALA D O   1 
ATOM   2181 C CB  . ALA D 1 10 ? 76.632 41.453 30.380 1.00 169.43 ? 32  ALA D CB  1 
ATOM   2182 N N   . THR D 1 11 ? 73.806 42.273 29.481 1.00 97.06  ? 33  THR D N   1 
ATOM   2183 C CA  . THR D 1 11 ? 72.737 42.210 28.500 1.00 97.06  ? 33  THR D CA  1 
ATOM   2184 C C   . THR D 1 11 ? 72.568 43.582 27.863 1.00 97.06  ? 33  THR D C   1 
ATOM   2185 O O   . THR D 1 11 ? 72.428 43.685 26.648 1.00 97.06  ? 33  THR D O   1 
ATOM   2186 C CB  . THR D 1 11 ? 71.407 41.780 29.132 1.00 93.15  ? 33  THR D CB  1 
ATOM   2187 O OG1 . THR D 1 11 ? 70.812 42.897 29.800 1.00 93.15  ? 33  THR D OG1 1 
ATOM   2188 C CG2 . THR D 1 11 ? 71.630 40.645 30.124 1.00 93.15  ? 33  THR D CG2 1 
ATOM   2189 N N   . VAL D 1 12 ? 72.596 44.636 28.673 1.00 89.34  ? 34  VAL D N   1 
ATOM   2190 C CA  . VAL D 1 12 ? 72.457 45.981 28.134 1.00 89.34  ? 34  VAL D CA  1 
ATOM   2191 C C   . VAL D 1 12 ? 73.585 46.234 27.143 1.00 89.34  ? 34  VAL D C   1 
ATOM   2192 O O   . VAL D 1 12 ? 73.625 47.271 26.488 1.00 89.34  ? 34  VAL D O   1 
ATOM   2193 C CB  . VAL D 1 12 ? 72.513 47.067 29.231 1.00 191.25 ? 34  VAL D CB  1 
ATOM   2194 C CG1 . VAL D 1 12 ? 71.993 48.384 28.673 1.00 191.25 ? 34  VAL D CG1 1 
ATOM   2195 C CG2 . VAL D 1 12 ? 71.680 46.650 30.432 1.00 191.25 ? 34  VAL D CG2 1 
ATOM   2196 N N   . LEU D 1 13 ? 74.503 45.278 27.043 1.00 87.37  ? 35  LEU D N   1 
ATOM   2197 C CA  . LEU D 1 13 ? 75.622 45.370 26.112 1.00 87.37  ? 35  LEU D CA  1 
ATOM   2198 C C   . LEU D 1 13 ? 75.235 44.646 24.827 1.00 87.37  ? 35  LEU D C   1 
ATOM   2199 O O   . LEU D 1 13 ? 75.420 45.171 23.730 1.00 87.37  ? 35  LEU D O   1 
ATOM   2200 C CB  . LEU D 1 13 ? 76.874 44.720 26.702 1.00 155.22 ? 35  LEU D CB  1 
ATOM   2201 C CG  . LEU D 1 13 ? 77.361 45.325 28.015 1.00 155.22 ? 35  LEU D CG  1 
ATOM   2202 C CD1 . LEU D 1 13 ? 78.344 44.387 28.703 1.00 155.22 ? 35  LEU D CD1 1 
ATOM   2203 C CD2 . LEU D 1 13 ? 78.008 46.662 27.717 1.00 155.22 ? 35  LEU D CD2 1 
ATOM   2204 N N   . LEU D 1 14 ? 74.689 43.440 24.970 1.00 102.09 ? 36  LEU D N   1 
ATOM   2205 C CA  . LEU D 1 14 ? 74.269 42.643 23.823 1.00 102.09 ? 36  LEU D CA  1 
ATOM   2206 C C   . LEU D 1 14 ? 73.249 43.400 22.997 1.00 102.09 ? 36  LEU D C   1 
ATOM   2207 O O   . LEU D 1 14 ? 73.336 43.435 21.771 1.00 102.09 ? 36  LEU D O   1 
ATOM   2208 C CB  . LEU D 1 14 ? 73.655 41.323 24.282 1.00 93.16  ? 36  LEU D CB  1 
ATOM   2209 C CG  . LEU D 1 14 ? 72.928 40.540 23.190 1.00 93.16  ? 36  LEU D CG  1 
ATOM   2210 C CD1 . LEU D 1 14 ? 73.924 39.689 22.413 1.00 93.16  ? 36  LEU D CD1 1 
ATOM   2211 C CD2 . LEU D 1 14 ? 71.855 39.675 23.819 1.00 93.16  ? 36  LEU D CD2 1 
ATOM   2212 N N   . VAL D 1 15 ? 72.277 43.999 23.676 1.00 78.59  ? 37  VAL D N   1 
ATOM   2213 C CA  . VAL D 1 15 ? 71.239 44.763 23.001 1.00 78.59  ? 37  VAL D CA  1 
ATOM   2214 C C   . VAL D 1 15 ? 71.858 45.848 22.134 1.00 78.59  ? 37  VAL D C   1 
ATOM   2215 O O   . VAL D 1 15 ? 71.320 46.194 21.085 1.00 78.59  ? 37  VAL D O   1 
ATOM   2216 C CB  . VAL D 1 15 ? 70.271 45.409 24.008 1.00 63.85  ? 37  VAL D CB  1 
ATOM   2217 C CG1 . VAL D 1 15 ? 70.166 46.915 23.764 1.00 63.85  ? 37  VAL D CG1 1 
ATOM   2218 C CG2 . VAL D 1 15 ? 68.912 44.753 23.889 1.00 63.85  ? 37  VAL D CG2 1 
ATOM   2219 N N   . ILE D 1 16 ? 72.981 46.398 22.577 1.00 89.27  ? 38  ILE D N   1 
ATOM   2220 C CA  . ILE D 1 16 ? 73.647 47.420 21.789 1.00 89.27  ? 38  ILE D CA  1 
ATOM   2221 C C   . ILE D 1 16 ? 74.176 46.707 20.549 1.00 89.27  ? 38  ILE D C   1 
ATOM   2222 O O   . ILE D 1 16 ? 73.964 47.164 19.426 1.00 89.27  ? 38  ILE D O   1 
ATOM   2223 C CB  . ILE D 1 16 ? 74.814 48.071 22.574 1.00 116.39 ? 38  ILE D CB  1 
ATOM   2224 C CG1 . ILE D 1 16 ? 74.291 49.241 23.414 1.00 116.39 ? 38  ILE D CG1 1 
ATOM   2225 C CG2 . ILE D 1 16 ? 75.877 48.586 21.612 1.00 116.39 ? 38  ILE D CG2 1 
ATOM   2226 C CD1 . ILE D 1 16 ? 73.050 48.927 24.226 1.00 116.39 ? 38  ILE D CD1 1 
ATOM   2227 N N   . VAL D 1 17 ? 74.839 45.570 20.765 1.00 81.74  ? 39  VAL D N   1 
ATOM   2228 C CA  . VAL D 1 17 ? 75.396 44.767 19.674 1.00 81.74  ? 39  VAL D CA  1 
ATOM   2229 C C   . VAL D 1 17 ? 74.334 44.527 18.616 1.00 81.74  ? 39  VAL D C   1 
ATOM   2230 O O   . VAL D 1 17 ? 74.576 44.698 17.424 1.00 81.74  ? 39  VAL D O   1 
ATOM   2231 C CB  . VAL D 1 17 ? 75.881 43.396 20.175 1.00 155.25 ? 39  VAL D CB  1 
ATOM   2232 C CG1 . VAL D 1 17 ? 76.305 42.531 18.995 1.00 155.25 ? 39  VAL D CG1 1 
ATOM   2233 C CG2 . VAL D 1 17 ? 77.031 43.578 21.144 1.00 155.25 ? 39  VAL D CG2 1 
ATOM   2234 N N   . LEU D 1 18 ? 73.159 44.111 19.065 1.00 46.21  ? 40  LEU D N   1 
ATOM   2235 C CA  . LEU D 1 18 ? 72.060 43.874 18.160 1.00 46.21  ? 40  LEU D CA  1 
ATOM   2236 C C   . LEU D 1 18 ? 71.909 45.116 17.307 1.00 46.21  ? 40  LEU D C   1 
ATOM   2237 O O   . LEU D 1 18 ? 72.375 45.151 16.171 1.00 46.21  ? 40  LEU D O   1 
ATOM   2238 C CB  . LEU D 1 18 ? 70.773 43.626 18.942 1.00 19.85  ? 40  LEU D CB  1 
ATOM   2239 C CG  . LEU D 1 18 ? 70.721 42.352 19.792 1.00 19.85  ? 40  LEU D CG  1 
ATOM   2240 C CD1 . LEU D 1 18 ? 69.264 42.020 20.104 1.00 19.85  ? 40  LEU D CD1 1 
ATOM   2241 C CD2 . LEU D 1 18 ? 71.394 41.191 19.067 1.00 19.85  ? 40  LEU D CD2 1 
ATOM   2242 N N   . LEU D 1 19 ? 71.273 46.141 17.868 1.00 70.89  ? 41  LEU D N   1 
ATOM   2243 C CA  . LEU D 1 19 ? 71.052 47.393 17.154 1.00 70.89  ? 41  LEU D CA  1 
ATOM   2244 C C   . LEU D 1 19 ? 72.299 47.837 16.408 1.00 70.89  ? 41  LEU D C   1 
ATOM   2245 O O   . LEU D 1 19 ? 72.201 48.453 15.350 1.00 70.89  ? 41  LEU D O   1 
ATOM   2246 C CB  . LEU D 1 19 ? 70.613 48.490 18.127 1.00 68.04  ? 41  LEU D CB  1 
ATOM   2247 C CG  . LEU D 1 19 ? 69.390 48.182 19.002 1.00 68.04  ? 41  LEU D CG  1 
ATOM   2248 C CD1 . LEU D 1 19 ? 68.604 49.458 19.239 1.00 68.04  ? 41  LEU D CD1 1 
ATOM   2249 C CD2 . LEU D 1 19 ? 68.503 47.132 18.340 1.00 68.04  ? 41  LEU D CD2 1 
ATOM   2250 N N   . ALA D 1 20 ? 73.467 47.515 16.955 1.00 108.81 ? 42  ALA D N   1 
ATOM   2251 C CA  . ALA D 1 20 ? 74.735 47.882 16.334 1.00 108.81 ? 42  ALA D CA  1 
ATOM   2252 C C   . ALA D 1 20 ? 74.974 47.078 15.064 1.00 108.81 ? 42  ALA D C   1 
ATOM   2253 O O   . ALA D 1 20 ? 75.268 47.640 14.011 1.00 108.81 ? 42  ALA D O   1 
ATOM   2254 C CB  . ALA D 1 20 ? 75.881 47.658 17.311 1.00 199.32 ? 42  ALA D CB  1 
ATOM   2255 N N   . GLY D 1 21 ? 74.854 45.758 15.171 1.00 101.55 ? 43  GLY D N   1 
ATOM   2256 C CA  . GLY D 1 21 ? 75.056 44.901 14.018 1.00 101.55 ? 43  GLY D CA  1 
ATOM   2257 C C   . GLY D 1 21 ? 73.950 45.089 13.001 1.00 101.55 ? 43  GLY D C   1 
ATOM   2258 O O   . GLY D 1 21 ? 74.185 45.036 11.796 1.00 101.55 ? 43  GLY D O   1 
ATOM   2259 N N   . SER D 1 22 ? 72.739 45.311 13.496 1.00 90.68  ? 44  SER D N   1 
ATOM   2260 C CA  . SER D 1 22 ? 71.582 45.515 12.638 1.00 90.68  ? 44  SER D CA  1 
ATOM   2261 C C   . SER D 1 22 ? 71.845 46.615 11.624 1.00 90.68  ? 44  SER D C   1 
ATOM   2262 O O   . SER D 1 22 ? 71.899 46.372 10.422 1.00 90.68  ? 44  SER D O   1 
ATOM   2263 C CB  . SER D 1 22 ? 70.364 45.899 13.474 1.00 69.56  ? 44  SER D CB  1 
ATOM   2264 O OG  . SER D 1 22 ? 69.929 44.809 14.262 1.00 69.56  ? 44  SER D OG  1 
ATOM   2265 N N   . TYR D 1 23 ? 72.012 47.831 12.124 1.00 97.82  ? 45  TYR D N   1 
ATOM   2266 C CA  . TYR D 1 23 ? 72.250 48.978 11.264 1.00 97.82  ? 45  TYR D CA  1 
ATOM   2267 C C   . TYR D 1 23 ? 73.687 49.076 10.771 1.00 97.82  ? 45  TYR D C   1 
ATOM   2268 O O   . TYR D 1 23 ? 74.216 50.173 10.598 1.00 97.82  ? 45  TYR D O   1 
ATOM   2269 C CB  . TYR D 1 23 ? 71.867 50.264 11.998 1.00 201.44 ? 45  TYR D CB  1 
ATOM   2270 C CG  . TYR D 1 23 ? 70.415 50.322 12.422 1.00 201.44 ? 45  TYR D CG  1 
ATOM   2271 C CD1 . TYR D 1 23 ? 69.811 49.248 13.080 1.00 201.44 ? 45  TYR D CD1 1 
ATOM   2272 C CD2 . TYR D 1 23 ? 69.646 51.458 12.176 1.00 201.44 ? 45  TYR D CD2 1 
ATOM   2273 C CE1 . TYR D 1 23 ? 68.482 49.305 13.483 1.00 201.44 ? 45  TYR D CE1 1 
ATOM   2274 C CE2 . TYR D 1 23 ? 68.315 51.527 12.575 1.00 201.44 ? 45  TYR D CE2 1 
ATOM   2275 C CZ  . TYR D 1 23 ? 67.740 50.448 13.228 1.00 201.44 ? 45  TYR D CZ  1 
ATOM   2276 O OH  . TYR D 1 23 ? 66.426 50.520 13.631 1.00 201.44 ? 45  TYR D OH  1 
ATOM   2277 N N   . LEU D 1 24 ? 74.316 47.926 10.554 1.00 77.93  ? 46  LEU D N   1 
ATOM   2278 C CA  . LEU D 1 24 ? 75.688 47.885 10.056 1.00 77.93  ? 46  LEU D CA  1 
ATOM   2279 C C   . LEU D 1 24 ? 75.811 46.778 9.022  1.00 77.93  ? 46  LEU D C   1 
ATOM   2280 O O   . LEU D 1 24 ? 76.540 46.908 8.042  1.00 77.93  ? 46  LEU D O   1 
ATOM   2281 C CB  . LEU D 1 24 ? 76.685 47.637 11.190 1.00 127.18 ? 46  LEU D CB  1 
ATOM   2282 C CG  . LEU D 1 24 ? 78.110 48.122 10.895 1.00 127.18 ? 46  LEU D CG  1 
ATOM   2283 C CD1 . LEU D 1 24 ? 78.708 48.732 12.150 1.00 127.18 ? 46  LEU D CD1 1 
ATOM   2284 C CD2 . LEU D 1 24 ? 78.970 46.968 10.401 1.00 127.18 ? 46  LEU D CD2 1 
ATOM   2285 N N   . ALA D 1 25 ? 75.100 45.681 9.251  1.00 110.03 ? 47  ALA D N   1 
ATOM   2286 C CA  . ALA D 1 25 ? 75.121 44.567 8.314  1.00 110.03 ? 47  ALA D CA  1 
ATOM   2287 C C   . ALA D 1 25 ? 74.358 45.017 7.074  1.00 110.03 ? 47  ALA D C   1 
ATOM   2288 O O   . ALA D 1 25 ? 74.719 44.679 5.946  1.00 110.03 ? 47  ALA D O   1 
ATOM   2289 C CB  . ALA D 1 25 ? 74.454 43.346 8.935  1.00 141.67 ? 47  ALA D CB  1 
ATOM   2290 N N   . VAL D 1 26 ? 73.302 45.792 7.297  1.00 85.53  ? 48  VAL D N   1 
ATOM   2291 C CA  . VAL D 1 26 ? 72.489 46.304 6.207  1.00 85.53  ? 48  VAL D CA  1 
ATOM   2292 C C   . VAL D 1 26 ? 73.392 47.095 5.280  1.00 85.53  ? 48  VAL D C   1 
ATOM   2293 O O   . VAL D 1 26 ? 73.567 46.725 4.125  1.00 85.53  ? 48  VAL D O   1 
ATOM   2294 C CB  . VAL D 1 26 ? 71.356 47.234 6.716  1.00 65.33  ? 48  VAL D CB  1 
ATOM   2295 C CG1 . VAL D 1 26 ? 70.822 48.080 5.575  1.00 65.33  ? 48  VAL D CG1 1 
ATOM   2296 C CG2 . VAL D 1 26 ? 70.230 46.407 7.328  1.00 65.33  ? 48  VAL D CG2 1 
ATOM   2297 N N   . LEU D 1 27 ? 73.978 48.171 5.796  1.00 67.01  ? 49  LEU D N   1 
ATOM   2298 C CA  . LEU D 1 27 ? 74.859 49.009 4.992  1.00 67.01  ? 49  LEU D CA  1 
ATOM   2299 C C   . LEU D 1 27 ? 76.064 48.238 4.454  1.00 67.01  ? 49  LEU D C   1 
ATOM   2300 O O   . LEU D 1 27 ? 76.987 48.821 3.884  1.00 67.01  ? 49  LEU D O   1 
ATOM   2301 C CB  . LEU D 1 27 ? 75.326 50.219 5.804  1.00 191.45 ? 49  LEU D CB  1 
ATOM   2302 C CG  . LEU D 1 27 ? 75.964 49.957 7.168  1.00 191.45 ? 49  LEU D CG  1 
ATOM   2303 C CD1 . LEU D 1 27 ? 77.474 49.861 7.012  1.00 191.45 ? 49  LEU D CD1 1 
ATOM   2304 C CD2 . LEU D 1 27 ? 75.595 51.080 8.128  1.00 191.45 ? 49  LEU D CD2 1 
ATOM   2305 N N   . ALA D 1 28 ? 76.050 46.923 4.638  1.00 83.93  ? 50  ALA D N   1 
ATOM   2306 C CA  . ALA D 1 28 ? 77.126 46.071 4.154  1.00 83.93  ? 50  ALA D CA  1 
ATOM   2307 C C   . ALA D 1 28 ? 76.563 45.165 3.069  1.00 83.93  ? 50  ALA D C   1 
ATOM   2308 O O   . ALA D 1 28 ? 77.297 44.679 2.214  1.00 83.93  ? 50  ALA D O   1 
ATOM   2309 C CB  . ALA D 1 28 ? 77.686 45.236 5.293  1.00 100.04 ? 50  ALA D CB  1 
ATOM   2310 N N   . GLU D 1 29 ? 75.250 44.956 3.110  1.00 90.35  ? 51  GLU D N   1 
ATOM   2311 C CA  . GLU D 1 29 ? 74.562 44.105 2.146  1.00 90.35  ? 51  GLU D CA  1 
ATOM   2312 C C   . GLU D 1 29 ? 73.614 44.881 1.235  1.00 90.35  ? 51  GLU D C   1 
ATOM   2313 O O   . GLU D 1 29 ? 73.401 44.498 0.087  1.00 90.35  ? 51  GLU D O   1 
ATOM   2314 C CB  . GLU D 1 29 ? 73.766 43.030 2.881  1.00 63.27  ? 51  GLU D CB  1 
ATOM   2315 C CG  . GLU D 1 29 ? 74.581 42.201 3.850  1.00 63.27  ? 51  GLU D CG  1 
ATOM   2316 C CD  . GLU D 1 29 ? 74.606 40.729 3.480  1.00 63.27  ? 51  GLU D CD  1 
ATOM   2317 O OE1 . GLU D 1 29 ? 73.548 40.058 3.574  1.00 63.27  ? 51  GLU D OE1 1 
ATOM   2318 O OE2 . GLU D 1 29 ? 75.691 40.246 3.095  1.00 63.27  ? 51  GLU D OE2 1 
ATOM   2319 N N   . ARG D 1 30 ? 73.046 45.965 1.761  1.00 117.62 ? 52  ARG D N   1 
ATOM   2320 C CA  . ARG D 1 30 ? 72.096 46.816 1.036  1.00 117.62 ? 52  ARG D CA  1 
ATOM   2321 C C   . ARG D 1 30 ? 72.277 46.869 -0.480 1.00 117.62 ? 52  ARG D C   1 
ATOM   2322 O O   . ARG D 1 30 ? 71.298 46.862 -1.227 1.00 117.62 ? 52  ARG D O   1 
ATOM   2323 C CB  . ARG D 1 30 ? 72.137 48.242 1.598  1.00 192.14 ? 52  ARG D CB  1 
ATOM   2324 C CG  . ARG D 1 30 ? 71.184 49.214 0.911  1.00 192.14 ? 52  ARG D CG  1 
ATOM   2325 C CD  . ARG D 1 30 ? 70.169 49.792 1.889  1.00 192.14 ? 52  ARG D CD  1 
ATOM   2326 N NE  . ARG D 1 30 ? 68.799 49.637 1.407  1.00 192.14 ? 52  ARG D NE  1 
ATOM   2327 C CZ  . ARG D 1 30 ? 67.716 49.990 2.093  1.00 192.14 ? 52  ARG D CZ  1 
ATOM   2328 N NH1 . ARG D 1 30 ? 67.837 50.526 3.302  1.00 192.14 ? 52  ARG D NH1 1 
ATOM   2329 N NH2 . ARG D 1 30 ? 66.510 49.806 1.570  1.00 192.14 ? 52  ARG D NH2 1 
ATOM   2330 N N   . GLY D 1 31 ? 73.522 46.931 -0.935 1.00 185.63 ? 53  GLY D N   1 
ATOM   2331 C CA  . GLY D 1 31 ? 73.771 46.986 -2.364 1.00 185.63 ? 53  GLY D CA  1 
ATOM   2332 C C   . GLY D 1 31 ? 74.574 45.802 -2.864 1.00 185.63 ? 53  GLY D C   1 
ATOM   2333 O O   . GLY D 1 31 ? 75.787 45.909 -3.051 1.00 185.63 ? 53  GLY D O   1 
ATOM   2334 N N   . ALA D 1 32 ? 73.902 44.674 -3.087 1.00 117.78 ? 54  ALA D N   1 
ATOM   2335 C CA  . ALA D 1 32 ? 74.574 43.469 -3.562 1.00 117.78 ? 54  ALA D CA  1 
ATOM   2336 C C   . ALA D 1 32 ? 73.616 42.287 -3.716 1.00 117.78 ? 54  ALA D C   1 
ATOM   2337 O O   . ALA D 1 32 ? 72.465 42.343 -3.277 1.00 117.78 ? 54  ALA D O   1 
ATOM   2338 C CB  . ALA D 1 32 ? 75.704 43.095 -2.599 1.00 80.27  ? 54  ALA D CB  1 
ATOM   2339 N N   . PRO D 1 33 ? 74.084 41.204 -4.363 1.00 56.29  ? 55  PRO D N   1 
ATOM   2340 C CA  . PRO D 1 33 ? 73.330 39.960 -4.612 1.00 56.29  ? 55  PRO D CA  1 
ATOM   2341 C C   . PRO D 1 33 ? 72.787 39.273 -3.349 1.00 56.29  ? 55  PRO D C   1 
ATOM   2342 O O   . PRO D 1 33 ? 72.279 38.153 -3.406 1.00 56.29  ? 55  PRO D O   1 
ATOM   2343 C CB  . PRO D 1 33 ? 74.342 39.066 -5.326 1.00 47.32  ? 55  PRO D CB  1 
ATOM   2344 C CG  . PRO D 1 33 ? 75.349 40.018 -5.913 1.00 47.32  ? 55  PRO D CG  1 
ATOM   2345 C CD  . PRO D 1 33 ? 75.434 41.155 -4.957 1.00 47.32  ? 55  PRO D CD  1 
ATOM   2346 N N   . GLY D 1 34 ? 72.887 39.957 -2.215 1.00 58.29  ? 56  GLY D N   1 
ATOM   2347 C CA  . GLY D 1 34 ? 72.444 39.383 -0.962 1.00 58.29  ? 56  GLY D CA  1 
ATOM   2348 C C   . GLY D 1 34 ? 70.983 39.511 -0.609 1.00 58.29  ? 56  GLY D C   1 
ATOM   2349 O O   . GLY D 1 34 ? 70.261 40.345 -1.152 1.00 58.29  ? 56  GLY D O   1 
ATOM   2350 N N   . ALA D 1 35 ? 70.571 38.675 0.340  1.00 111.75 ? 57  ALA D N   1 
ATOM   2351 C CA  . ALA D 1 35 ? 69.203 38.622 0.835  1.00 111.75 ? 57  ALA D CA  1 
ATOM   2352 C C   . ALA D 1 35 ? 68.714 39.949 1.401  1.00 111.75 ? 57  ALA D C   1 
ATOM   2353 O O   . ALA D 1 35 ? 69.384 40.978 1.291  1.00 111.75 ? 57  ALA D O   1 
ATOM   2354 C CB  . ALA D 1 35 ? 69.079 37.528 1.892  1.00 112.43 ? 57  ALA D CB  1 
ATOM   2355 N N   . GLN D 1 36 ? 67.538 39.902 2.019  1.00 142.96 ? 58  GLN D N   1 
ATOM   2356 C CA  . GLN D 1 36 ? 66.893 41.075 2.596  1.00 142.96 ? 58  GLN D CA  1 
ATOM   2357 C C   . GLN D 1 36 ? 67.693 41.836 3.645  1.00 142.96 ? 58  GLN D C   1 
ATOM   2358 O O   . GLN D 1 36 ? 67.183 42.792 4.231  1.00 142.96 ? 58  GLN D O   1 
ATOM   2359 C CB  . GLN D 1 36 ? 65.537 40.681 3.187  1.00 157.80 ? 58  GLN D CB  1 
ATOM   2360 C CG  . GLN D 1 36 ? 64.508 41.796 3.178  1.00 157.80 ? 58  GLN D CG  1 
ATOM   2361 C CD  . GLN D 1 36 ? 63.164 41.346 3.713  1.00 157.80 ? 58  GLN D CD  1 
ATOM   2362 O OE1 . GLN D 1 36 ? 62.395 40.688 3.012  1.00 157.80 ? 58  GLN D OE1 1 
ATOM   2363 N NE2 . GLN D 1 36 ? 62.873 41.697 4.963  1.00 157.80 ? 58  GLN D NE2 1 
ATOM   2364 N N   . LEU D 1 37 ? 68.932 41.422 3.899  1.00 74.97  ? 59  LEU D N   1 
ATOM   2365 C CA  . LEU D 1 37 ? 69.760 42.129 4.873  1.00 74.97  ? 59  LEU D CA  1 
ATOM   2366 C C   . LEU D 1 37 ? 70.103 43.461 4.218  1.00 74.97  ? 59  LEU D C   1 
ATOM   2367 O O   . LEU D 1 37 ? 71.225 43.959 4.299  1.00 74.97  ? 59  LEU D O   1 
ATOM   2368 C CB  . LEU D 1 37 ? 71.032 41.331 5.185  1.00 81.40  ? 59  LEU D CB  1 
ATOM   2369 C CG  . LEU D 1 37 ? 70.887 40.224 6.239  1.00 81.40  ? 59  LEU D CG  1 
ATOM   2370 C CD1 . LEU D 1 37 ? 72.251 39.639 6.557  1.00 81.40  ? 59  LEU D CD1 1 
ATOM   2371 C CD2 . LEU D 1 37 ? 70.233 40.778 7.499  1.00 81.40  ? 59  LEU D CD2 1 
ATOM   2372 N N   . ILE D 1 38 ? 69.096 44.015 3.557  1.00 64.77  ? 60  ILE D N   1 
ATOM   2373 C CA  . ILE D 1 38 ? 69.199 45.270 2.842  1.00 64.77  ? 60  ILE D CA  1 
ATOM   2374 C C   . ILE D 1 38 ? 68.224 46.274 3.452  1.00 64.77  ? 60  ILE D C   1 
ATOM   2375 O O   . ILE D 1 38 ? 67.967 47.336 2.886  1.00 64.77  ? 60  ILE D O   1 
ATOM   2376 C CB  . ILE D 1 38 ? 68.858 45.065 1.342  1.00 109.21 ? 60  ILE D CB  1 
ATOM   2377 C CG1 . ILE D 1 38 ? 67.362 44.786 1.174  1.00 109.21 ? 60  ILE D CG1 1 
ATOM   2378 C CG2 . ILE D 1 38 ? 69.647 43.885 0.782  1.00 109.21 ? 60  ILE D CG2 1 
ATOM   2379 N N   . THR D 1 39 ? 67.679 45.926 4.610  1.00 89.72  ? 61  THR D N   1 
ATOM   2380 C CA  . THR D 1 39 ? 66.737 46.795 5.300  1.00 89.72  ? 61  THR D CA  1 
ATOM   2381 C C   . THR D 1 39 ? 67.024 46.752 6.789  1.00 89.72  ? 61  THR D C   1 
ATOM   2382 O O   . THR D 1 39 ? 67.130 45.676 7.382  1.00 89.72  ? 61  THR D O   1 
ATOM   2383 C CB  . THR D 1 39 ? 65.290 46.345 5.056  1.00 79.79  ? 61  THR D CB  1 
ATOM   2384 O OG1 . THR D 1 39 ? 65.139 45.977 3.682  1.00 79.79  ? 61  THR D OG1 1 
ATOM   2385 C CG2 . THR D 1 39 ? 64.318 47.467 5.370  1.00 79.79  ? 61  THR D CG2 1 
ATOM   2386 N N   . TYR D 1 40 ? 67.157 47.927 7.391  1.00 130.35 ? 62  TYR D N   1 
ATOM   2387 C CA  . TYR D 1 40 ? 67.436 48.019 8.815  1.00 130.35 ? 62  TYR D CA  1 
ATOM   2388 C C   . TYR D 1 40 ? 66.405 47.265 9.650  1.00 130.35 ? 62  TYR D C   1 
ATOM   2389 O O   . TYR D 1 40 ? 66.769 46.474 10.519 1.00 130.35 ? 62  TYR D O   1 
ATOM   2390 C CB  . TYR D 1 40 ? 67.490 49.485 9.240  1.00 197.04 ? 62  TYR D CB  1 
ATOM   2391 C CG  . TYR D 1 40 ? 68.686 50.220 8.684  1.00 197.04 ? 62  TYR D CG  1 
ATOM   2392 C CD1 . TYR D 1 40 ? 69.981 49.839 9.030  1.00 197.04 ? 62  TYR D CD1 1 
ATOM   2393 C CD2 . TYR D 1 40 ? 68.526 51.292 7.806  1.00 197.04 ? 62  TYR D CD2 1 
ATOM   2394 C CE1 . TYR D 1 40 ? 71.091 50.507 8.518  1.00 197.04 ? 62  TYR D CE1 1 
ATOM   2395 C CE2 . TYR D 1 40 ? 69.630 51.969 7.286  1.00 197.04 ? 62  TYR D CE2 1 
ATOM   2396 C CZ  . TYR D 1 40 ? 70.909 51.570 7.647  1.00 197.04 ? 62  TYR D CZ  1 
ATOM   2397 O OH  . TYR D 1 40 ? 72.006 52.231 7.141  1.00 197.04 ? 62  TYR D OH  1 
ATOM   2398 N N   . PRO D 1 41 ? 65.103 47.492 9.394  1.00 88.10  ? 63  PRO D N   1 
ATOM   2399 C CA  . PRO D 1 41 ? 64.048 46.805 10.155 1.00 88.10  ? 63  PRO D CA  1 
ATOM   2400 C C   . PRO D 1 41 ? 64.051 45.290 9.947  1.00 88.10  ? 63  PRO D C   1 
ATOM   2401 O O   . PRO D 1 41 ? 63.274 44.563 10.575 1.00 88.10  ? 63  PRO D O   1 
ATOM   2402 C CB  . PRO D 1 41 ? 62.748 47.441 9.651  1.00 133.46 ? 63  PRO D CB  1 
ATOM   2403 C CG  . PRO D 1 41 ? 63.163 48.665 8.892  1.00 133.46 ? 63  PRO D CG  1 
ATOM   2404 C CD  . PRO D 1 41 ? 64.543 48.406 8.384  1.00 133.46 ? 63  PRO D CD  1 
ATOM   2405 N N   . ARG D 1 42 ? 64.929 44.829 9.059  1.00 45.34  ? 64  ARG D N   1 
ATOM   2406 C CA  . ARG D 1 42 ? 65.049 43.414 8.742  1.00 45.34  ? 64  ARG D CA  1 
ATOM   2407 C C   . ARG D 1 42 ? 66.298 42.846 9.396  1.00 45.34  ? 64  ARG D C   1 
ATOM   2408 O O   . ARG D 1 42 ? 66.296 41.724 9.891  1.00 45.34  ? 64  ARG D O   1 
ATOM   2409 C CB  . ARG D 1 42 ? 65.117 43.218 7.222  1.00 84.58  ? 64  ARG D CB  1 
ATOM   2410 N N   . ALA D 1 43 ? 67.368 43.627 9.393  1.00 78.30  ? 65  ALA D N   1 
ATOM   2411 C CA  . ALA D 1 43 ? 68.608 43.184 10.002 1.00 78.30  ? 65  ALA D CA  1 
ATOM   2412 C C   . ALA D 1 43 ? 68.360 42.873 11.482 1.00 78.30  ? 65  ALA D C   1 
ATOM   2413 O O   . ALA D 1 43 ? 68.930 41.929 12.033 1.00 78.30  ? 65  ALA D O   1 
ATOM   2414 C CB  . ALA D 1 43 ? 69.672 44.265 9.849  1.00 26.26  ? 65  ALA D CB  1 
ATOM   2415 N N   . LEU D 1 44 ? 67.499 43.668 12.115 1.00 80.46  ? 66  LEU D N   1 
ATOM   2416 C CA  . LEU D 1 44 ? 67.158 43.487 13.525 1.00 80.46  ? 66  LEU D CA  1 
ATOM   2417 C C   . LEU D 1 44 ? 66.798 42.041 13.808 1.00 80.46  ? 66  LEU D C   1 
ATOM   2418 O O   . LEU D 1 44 ? 67.533 41.319 14.483 1.00 80.46  ? 66  LEU D O   1 
ATOM   2419 C CB  . LEU D 1 44 ? 65.954 44.347 13.901 1.00 70.79  ? 66  LEU D CB  1 
ATOM   2420 C CG  . LEU D 1 44 ? 66.118 45.841 14.168 1.00 70.79  ? 66  LEU D CG  1 
ATOM   2421 C CD1 . LEU D 1 44 ? 64.991 46.291 15.083 1.00 70.79  ? 66  LEU D CD1 1 
ATOM   2422 C CD2 . LEU D 1 44 ? 67.465 46.131 14.795 1.00 70.79  ? 66  LEU D CD2 1 
ATOM   2423 N N   . TRP D 1 45 ? 65.642 41.639 13.290 1.00 73.25  ? 67  TRP D N   1 
ATOM   2424 C CA  . TRP D 1 45 ? 65.135 40.285 13.462 1.00 73.25  ? 67  TRP D CA  1 
ATOM   2425 C C   . TRP D 1 45 ? 66.229 39.273 13.125 1.00 73.25  ? 67  TRP D C   1 
ATOM   2426 O O   . TRP D 1 45 ? 66.170 38.124 13.557 1.00 73.25  ? 67  TRP D O   1 
ATOM   2427 C CB  . TRP D 1 45 ? 63.889 40.082 12.575 1.00 86.84  ? 67  TRP D CB  1 
ATOM   2428 C CG  . TRP D 1 45 ? 63.475 38.653 12.356 1.00 86.84  ? 67  TRP D CG  1 
ATOM   2429 C CD1 . TRP D 1 45 ? 63.570 37.949 11.193 1.00 86.84  ? 67  TRP D CD1 1 
ATOM   2430 C CD2 . TRP D 1 45 ? 62.916 37.750 13.323 1.00 86.84  ? 67  TRP D CD2 1 
ATOM   2431 N NE1 . TRP D 1 45 ? 63.109 36.666 11.370 1.00 86.84  ? 67  TRP D NE1 1 
ATOM   2432 C CE2 . TRP D 1 45 ? 62.701 36.516 12.669 1.00 86.84  ? 67  TRP D CE2 1 
ATOM   2433 C CE3 . TRP D 1 45 ? 62.576 37.865 14.677 1.00 86.84  ? 67  TRP D CE3 1 
ATOM   2434 C CZ2 . TRP D 1 45 ? 62.162 35.399 13.322 1.00 86.84  ? 67  TRP D CZ2 1 
ATOM   2435 C CZ3 . TRP D 1 45 ? 62.038 36.750 15.328 1.00 86.84  ? 67  TRP D CZ3 1 
ATOM   2436 C CH2 . TRP D 1 45 ? 61.839 35.535 14.646 1.00 86.84  ? 67  TRP D CH2 1 
ATOM   2437 N N   . TRP D 1 46 ? 67.235 39.706 12.368 1.00 55.24  ? 68  TRP D N   1 
ATOM   2438 C CA  . TRP D 1 46 ? 68.332 38.820 11.999 1.00 55.24  ? 68  TRP D CA  1 
ATOM   2439 C C   . TRP D 1 46 ? 69.341 38.783 13.122 1.00 55.24  ? 68  TRP D C   1 
ATOM   2440 O O   . TRP D 1 46 ? 69.872 37.725 13.459 1.00 55.24  ? 68  TRP D O   1 
ATOM   2441 C CB  . TRP D 1 46 ? 69.033 39.302 10.736 1.00 37.77  ? 68  TRP D CB  1 
ATOM   2442 C CG  . TRP D 1 46 ? 70.360 38.652 10.552 1.00 37.77  ? 68  TRP D CG  1 
ATOM   2443 C CD1 . TRP D 1 46 ? 70.595 37.369 10.156 1.00 37.77  ? 68  TRP D CD1 1 
ATOM   2444 C CD2 . TRP D 1 46 ? 71.640 39.250 10.759 1.00 37.77  ? 68  TRP D CD2 1 
ATOM   2445 N NE1 . TRP D 1 46 ? 71.946 37.129 10.100 1.00 37.77  ? 68  TRP D NE1 1 
ATOM   2446 C CE2 . TRP D 1 46 ? 72.613 38.268 10.465 1.00 37.77  ? 68  TRP D CE2 1 
ATOM   2447 C CE3 . TRP D 1 46 ? 72.062 40.521 11.164 1.00 37.77  ? 68  TRP D CE3 1 
ATOM   2448 C CZ2 . TRP D 1 46 ? 73.987 38.516 10.563 1.00 37.77  ? 68  TRP D CZ2 1 
ATOM   2449 C CZ3 . TRP D 1 46 ? 73.427 40.771 11.259 1.00 37.77  ? 68  TRP D CZ3 1 
ATOM   2450 C CH2 . TRP D 1 46 ? 74.374 39.770 10.958 1.00 37.77  ? 68  TRP D CH2 1 
ATOM   2451 N N   . SER D 1 47 ? 69.620 39.955 13.681 1.00 76.15  ? 69  SER D N   1 
ATOM   2452 C CA  . SER D 1 47 ? 70.558 40.070 14.784 1.00 76.15  ? 69  SER D CA  1 
ATOM   2453 C C   . SER D 1 47 ? 70.054 39.169 15.900 1.00 76.15  ? 69  SER D C   1 
ATOM   2454 O O   . SER D 1 47 ? 70.808 38.388 16.478 1.00 76.15  ? 69  SER D O   1 
ATOM   2455 C CB  . SER D 1 47 ? 70.619 41.516 15.277 1.00 62.90  ? 69  SER D CB  1 
ATOM   2456 O OG  . SER D 1 47 ? 71.421 42.313 14.424 1.00 62.90  ? 69  SER D OG  1 
ATOM   2457 N N   . VAL D 1 48 ? 68.762 39.276 16.182 1.00 26.75  ? 70  VAL D N   1 
ATOM   2458 C CA  . VAL D 1 48 ? 68.136 38.479 17.226 1.00 26.75  ? 70  VAL D CA  1 
ATOM   2459 C C   . VAL D 1 48 ? 68.266 36.974 16.992 1.00 26.75  ? 70  VAL D C   1 
ATOM   2460 O O   . VAL D 1 48 ? 68.766 36.256 17.856 1.00 26.75  ? 70  VAL D O   1 
ATOM   2461 C CB  . VAL D 1 48 ? 66.639 38.830 17.365 1.00 22.81  ? 70  VAL D CB  1 
ATOM   2462 C CG1 . VAL D 1 48 ? 65.988 37.939 18.415 1.00 22.81  ? 70  VAL D CG1 1 
ATOM   2463 C CG2 . VAL D 1 48 ? 66.484 40.307 17.722 1.00 22.81  ? 70  VAL D CG2 1 
ATOM   2464 N N   . GLU D 1 49 ? 67.810 36.496 15.834 1.00 95.30  ? 71  GLU D N   1 
ATOM   2465 C CA  . GLU D 1 49 ? 67.889 35.069 15.514 1.00 95.30  ? 71  GLU D CA  1 
ATOM   2466 C C   . GLU D 1 49 ? 69.341 34.624 15.606 1.00 95.30  ? 71  GLU D C   1 
ATOM   2467 O O   . GLU D 1 49 ? 69.651 33.603 16.217 1.00 95.30  ? 71  GLU D O   1 
ATOM   2468 C CB  . GLU D 1 49 ? 67.347 34.788 14.101 1.00 52.22  ? 71  GLU D CB  1 
ATOM   2469 N N   . THR D 1 50 ? 70.228 35.410 15.008 1.00 64.31  ? 72  THR D N   1 
ATOM   2470 C CA  . THR D 1 50 ? 71.654 35.109 15.022 1.00 64.31  ? 72  THR D CA  1 
ATOM   2471 C C   . THR D 1 50 ? 72.192 35.059 16.450 1.00 64.31  ? 72  THR D C   1 
ATOM   2472 O O   . THR D 1 50 ? 72.837 34.083 16.851 1.00 64.31  ? 72  THR D O   1 
ATOM   2473 C CB  . THR D 1 50 ? 72.459 36.174 14.242 1.00 104.91 ? 72  THR D CB  1 
ATOM   2474 O OG1 . THR D 1 50 ? 71.999 36.235 12.885 1.00 104.91 ? 72  THR D OG1 1 
ATOM   2475 C CG2 . THR D 1 50 ? 73.946 35.832 14.263 1.00 104.91 ? 72  THR D CG2 1 
ATOM   2476 N N   . ALA D 1 51 ? 71.920 36.126 17.200 1.00 62.99  ? 73  ALA D N   1 
ATOM   2477 C CA  . ALA D 1 51 ? 72.360 36.259 18.584 1.00 62.99  ? 73  ALA D CA  1 
ATOM   2478 C C   . ALA D 1 51 ? 71.849 35.120 19.451 1.00 62.99  ? 73  ALA D C   1 
ATOM   2479 O O   . ALA D 1 51 ? 72.556 34.639 20.330 1.00 62.99  ? 73  ALA D O   1 
ATOM   2480 C CB  . ALA D 1 51 ? 71.893 37.589 19.147 1.00 59.08  ? 73  ALA D CB  1 
ATOM   2481 N N   . THR D 1 52 ? 70.615 34.698 19.218 1.00 41.15  ? 74  THR D N   1 
ATOM   2482 C CA  . THR D 1 52 ? 70.054 33.600 19.986 1.00 41.15  ? 74  THR D CA  1 
ATOM   2483 C C   . THR D 1 52 ? 70.627 32.334 19.401 1.00 41.15  ? 74  THR D C   1 
ATOM   2484 O O   . THR D 1 52 ? 70.541 31.262 20.010 1.00 41.15  ? 74  THR D O   1 
ATOM   2485 C CB  . THR D 1 52 ? 68.547 33.511 19.824 1.00 66.37  ? 74  THR D CB  1 
ATOM   2486 O OG1 . THR D 1 52 ? 67.973 34.813 19.957 1.00 66.37  ? 74  THR D OG1 1 
ATOM   2487 C CG2 . THR D 1 52 ? 67.960 32.581 20.864 1.00 66.37  ? 74  THR D CG2 1 
ATOM   2488 N N   . THR D 1 53 ? 71.225 32.487 18.218 1.00 67.16  ? 75  THR D N   1 
ATOM   2489 C CA  . THR D 1 53 ? 71.802 31.393 17.437 1.00 67.16  ? 75  THR D CA  1 
ATOM   2490 C C   . THR D 1 53 ? 70.748 30.315 17.256 1.00 67.16  ? 75  THR D C   1 
ATOM   2491 O O   . THR D 1 53 ? 70.764 29.266 17.892 1.00 67.16  ? 75  THR D O   1 
ATOM   2492 C CB  . THR D 1 53 ? 73.082 30.783 18.069 1.00 71.11  ? 75  THR D CB  1 
ATOM   2493 O OG1 . THR D 1 53 ? 72.963 29.357 18.125 1.00 71.11  ? 75  THR D OG1 1 
ATOM   2494 C CG2 . THR D 1 53 ? 73.326 31.337 19.453 1.00 71.11  ? 75  THR D CG2 1 
ATOM   2495 N N   . VAL D 1 54 ? 69.804 30.623 16.382 1.00 163.10 ? 76  VAL D N   1 
ATOM   2496 C CA  . VAL D 1 54 ? 68.713 29.729 16.062 1.00 163.10 ? 76  VAL D CA  1 
ATOM   2497 C C   . VAL D 1 54 ? 68.804 29.512 14.554 1.00 163.10 ? 76  VAL D C   1 
ATOM   2498 O O   . VAL D 1 54 ? 68.376 28.484 14.026 1.00 163.10 ? 76  VAL D O   1 
ATOM   2499 C CB  . VAL D 1 54 ? 67.372 30.376 16.441 1.00 82.84  ? 76  VAL D CB  1 
ATOM   2500 C CG1 . VAL D 1 54 ? 66.278 29.348 16.425 1.00 82.84  ? 76  VAL D CG1 1 
ATOM   2501 C CG2 . VAL D 1 54 ? 67.475 31.002 17.821 1.00 82.84  ? 76  VAL D CG2 1 
ATOM   2502 N N   . GLY D 1 55 ? 69.390 30.500 13.879 1.00 139.35 ? 77  GLY D N   1 
ATOM   2503 C CA  . GLY D 1 55 ? 69.575 30.450 12.438 1.00 139.35 ? 77  GLY D CA  1 
ATOM   2504 C C   . GLY D 1 55 ? 68.390 29.911 11.677 1.00 139.35 ? 77  GLY D C   1 
ATOM   2505 O O   . GLY D 1 55 ? 68.397 28.764 11.239 1.00 139.35 ? 77  GLY D O   1 
ATOM   2506 N N   . TYR D 1 56 ? 67.370 30.743 11.511 1.00 47.60  ? 78  TYR D N   1 
ATOM   2507 C CA  . TYR D 1 56 ? 66.175 30.316 10.800 1.00 47.60  ? 78  TYR D CA  1 
ATOM   2508 C C   . TYR D 1 56 ? 66.533 29.992 9.375  1.00 47.60  ? 78  TYR D C   1 
ATOM   2509 O O   . TYR D 1 56 ? 66.011 29.044 8.808  1.00 47.60  ? 78  TYR D O   1 
ATOM   2510 C CB  . TYR D 1 56 ? 65.100 31.409 10.831 1.00 36.53  ? 78  TYR D CB  1 
ATOM   2511 C CG  . TYR D 1 56 ? 64.127 31.230 11.968 1.00 36.53  ? 78  TYR D CG  1 
ATOM   2512 C CD1 . TYR D 1 56 ? 63.573 29.974 12.244 1.00 36.53  ? 78  TYR D CD1 1 
ATOM   2513 C CD2 . TYR D 1 56 ? 63.810 32.294 12.811 1.00 36.53  ? 78  TYR D CD2 1 
ATOM   2514 C CE1 . TYR D 1 56 ? 62.727 29.776 13.341 1.00 36.53  ? 78  TYR D CE1 1 
ATOM   2515 C CE2 . TYR D 1 56 ? 62.963 32.116 13.916 1.00 36.53  ? 78  TYR D CE2 1 
ATOM   2516 C CZ  . TYR D 1 56 ? 62.423 30.853 14.179 1.00 36.53  ? 78  TYR D CZ  1 
ATOM   2517 O OH  . TYR D 1 56 ? 61.579 30.678 15.267 1.00 36.53  ? 78  TYR D OH  1 
ATOM   2518 N N   . GLY D 1 57 ? 67.447 30.778 8.816  1.00 77.90  ? 79  GLY D N   1 
ATOM   2519 C CA  . GLY D 1 57 ? 67.857 30.581 7.438  1.00 77.90  ? 79  GLY D CA  1 
ATOM   2520 C C   . GLY D 1 57 ? 67.109 31.561 6.552  1.00 77.90  ? 79  GLY D C   1 
ATOM   2521 O O   . GLY D 1 57 ? 67.504 31.842 5.418  1.00 77.90  ? 79  GLY D O   1 
ATOM   2522 N N   . ASP D 1 58 ? 66.011 32.079 7.091  1.00 68.75  ? 80  ASP D N   1 
ATOM   2523 C CA  . ASP D 1 58 ? 65.174 33.049 6.402  1.00 68.75  ? 80  ASP D CA  1 
ATOM   2524 C C   . ASP D 1 58 ? 66.005 34.263 5.989  1.00 68.75  ? 80  ASP D C   1 
ATOM   2525 O O   . ASP D 1 58 ? 65.646 34.978 5.056  1.00 68.75  ? 80  ASP D O   1 
ATOM   2526 C CB  . ASP D 1 58 ? 64.044 33.497 7.328  1.00 106.89 ? 80  ASP D CB  1 
ATOM   2527 C CG  . ASP D 1 58 ? 64.479 34.585 8.298  1.00 106.89 ? 80  ASP D CG  1 
ATOM   2528 O OD1 . ASP D 1 58 ? 65.244 34.292 9.253  1.00 106.89 ? 80  ASP D OD1 1 
ATOM   2529 O OD2 . ASP D 1 58 ? 64.048 35.740 8.095  1.00 106.89 ? 80  ASP D OD2 1 
ATOM   2530 N N   . LEU D 1 59 ? 67.111 34.491 6.697  1.00 73.32  ? 81  LEU D N   1 
ATOM   2531 C CA  . LEU D 1 59 ? 68.001 35.618 6.418  1.00 73.32  ? 81  LEU D CA  1 
ATOM   2532 C C   . LEU D 1 59 ? 69.433 35.342 6.875  1.00 73.32  ? 81  LEU D C   1 
ATOM   2533 O O   . LEU D 1 59 ? 69.654 34.658 7.879  1.00 73.32  ? 81  LEU D O   1 
ATOM   2534 C CB  . LEU D 1 59 ? 67.499 36.881 7.123  1.00 58.88  ? 81  LEU D CB  1 
ATOM   2535 C CG  . LEU D 1 59 ? 66.122 37.441 6.765  1.00 58.88  ? 81  LEU D CG  1 
ATOM   2536 C CD1 . LEU D 1 59 ? 65.855 38.681 7.583  1.00 58.88  ? 81  LEU D CD1 1 
ATOM   2537 C CD2 . LEU D 1 59 ? 66.067 37.776 5.298  1.00 58.88  ? 81  LEU D CD2 1 
ATOM   2538 N N   . TYR D 1 60 ? 70.392 35.884 6.123  1.00 53.09  ? 82  TYR D N   1 
ATOM   2539 C CA  . TYR D 1 60 ? 71.821 35.748 6.415  1.00 53.09  ? 82  TYR D CA  1 
ATOM   2540 C C   . TYR D 1 60 ? 72.706 36.621 5.514  1.00 53.09  ? 82  TYR D C   1 
ATOM   2541 O O   . TYR D 1 60 ? 72.335 36.969 4.396  1.00 53.09  ? 82  TYR D O   1 
ATOM   2542 C CB  . TYR D 1 60 ? 72.265 34.289 6.299  1.00 106.71 ? 82  TYR D CB  1 
ATOM   2543 C CG  . TYR D 1 60 ? 71.957 33.637 4.976  1.00 106.71 ? 82  TYR D CG  1 
ATOM   2544 C CD1 . TYR D 1 60 ? 70.653 33.267 4.649  1.00 106.71 ? 82  TYR D CD1 1 
ATOM   2545 C CD2 . TYR D 1 60 ? 72.973 33.336 4.075  1.00 106.71 ? 82  TYR D CD2 1 
ATOM   2546 C CE1 . TYR D 1 60 ? 70.368 32.608 3.463  1.00 106.71 ? 82  TYR D CE1 1 
ATOM   2547 C CE2 . TYR D 1 60 ? 72.701 32.679 2.886  1.00 106.71 ? 82  TYR D CE2 1 
ATOM   2548 C CZ  . TYR D 1 60 ? 71.396 32.314 2.587  1.00 106.71 ? 82  TYR D CZ  1 
ATOM   2549 O OH  . TYR D 1 60 ? 71.119 31.636 1.423  1.00 106.71 ? 82  TYR D OH  1 
ATOM   2550 N N   . PRO D 1 61 ? 73.895 36.994 6.002  1.00 53.84  ? 83  PRO D N   1 
ATOM   2551 C CA  . PRO D 1 61 ? 74.773 37.826 5.182  1.00 53.84  ? 83  PRO D CA  1 
ATOM   2552 C C   . PRO D 1 61 ? 75.512 37.052 4.093  1.00 53.84  ? 83  PRO D C   1 
ATOM   2553 O O   . PRO D 1 61 ? 75.764 35.852 4.217  1.00 53.84  ? 83  PRO D O   1 
ATOM   2554 C CB  . PRO D 1 61 ? 75.729 38.436 6.198  1.00 75.74  ? 83  PRO D CB  1 
ATOM   2555 C CG  . PRO D 1 61 ? 75.823 37.413 7.268  1.00 75.74  ? 83  PRO D CG  1 
ATOM   2556 C CD  . PRO D 1 61 ? 74.493 36.697 7.317  1.00 75.74  ? 83  PRO D CD  1 
ATOM   2557 N N   . VAL D 1 62 ? 75.849 37.762 3.022  1.00 63.13  ? 84  VAL D N   1 
ATOM   2558 C CA  . VAL D 1 62 ? 76.574 37.193 1.894  1.00 63.13  ? 84  VAL D CA  1 
ATOM   2559 C C   . VAL D 1 62 ? 77.771 38.082 1.629  1.00 63.13  ? 84  VAL D C   1 
ATOM   2560 O O   . VAL D 1 62 ? 78.687 37.710 0.903  1.00 63.13  ? 84  VAL D O   1 
ATOM   2561 C CB  . VAL D 1 62 ? 75.717 37.153 0.624  1.00 68.22  ? 84  VAL D CB  1 
ATOM   2562 C CG1 . VAL D 1 62 ? 76.183 36.013 -0.268 1.00 68.22  ? 84  VAL D CG1 1 
ATOM   2563 C CG2 . VAL D 1 62 ? 74.250 36.995 0.988  1.00 68.22  ? 84  VAL D CG2 1 
ATOM   2564 N N   . THR D 1 63 ? 77.735 39.273 2.213  1.00 109.83 ? 85  THR D N   1 
ATOM   2565 C CA  . THR D 1 63 ? 78.819 40.231 2.085  1.00 109.83 ? 85  THR D CA  1 
ATOM   2566 C C   . THR D 1 63 ? 79.914 39.752 3.023  1.00 109.83 ? 85  THR D C   1 
ATOM   2567 O O   . THR D 1 63 ? 79.626 39.388 4.163  1.00 109.83 ? 85  THR D O   1 
ATOM   2568 C CB  . THR D 1 63 ? 78.391 41.627 2.552  1.00 75.84  ? 85  THR D CB  1 
ATOM   2569 O OG1 . THR D 1 63 ? 77.032 41.869 2.172  1.00 75.84  ? 85  THR D OG1 1 
ATOM   2570 C CG2 . THR D 1 63 ? 79.303 42.686 1.947  1.00 75.84  ? 85  THR D CG2 1 
ATOM   2571 N N   . LEU D 1 64 ? 81.161 39.748 2.562  1.00 129.02 ? 86  LEU D N   1 
ATOM   2572 C CA  . LEU D 1 64 ? 82.257 39.305 3.417  1.00 129.02 ? 86  LEU D CA  1 
ATOM   2573 C C   . LEU D 1 64 ? 82.136 39.993 4.773  1.00 129.02 ? 86  LEU D C   1 
ATOM   2574 O O   . LEU D 1 64 ? 82.188 39.348 5.821  1.00 129.02 ? 86  LEU D O   1 
ATOM   2575 C CB  . LEU D 1 64 ? 83.607 39.640 2.783  1.00 179.58 ? 86  LEU D CB  1 
ATOM   2576 C CG  . LEU D 1 64 ? 84.801 38.902 3.397  1.00 179.58 ? 86  LEU D CG  1 
ATOM   2577 C CD1 . LEU D 1 64 ? 84.679 37.409 3.119  1.00 179.58 ? 86  LEU D CD1 1 
ATOM   2578 C CD2 . LEU D 1 64 ? 86.100 39.453 2.825  1.00 179.58 ? 86  LEU D CD2 1 
ATOM   2579 N N   . TRP D 1 65 ? 81.962 41.310 4.739  1.00 90.44  ? 87  TRP D N   1 
ATOM   2580 C CA  . TRP D 1 65 ? 81.815 42.103 5.950  1.00 90.44  ? 87  TRP D CA  1 
ATOM   2581 C C   . TRP D 1 65 ? 80.546 41.687 6.681  1.00 90.44  ? 87  TRP D C   1 
ATOM   2582 O O   . TRP D 1 65 ? 80.577 41.359 7.865  1.00 90.44  ? 87  TRP D O   1 
ATOM   2583 C CB  . TRP D 1 65 ? 81.750 43.590 5.594  1.00 198.51 ? 87  TRP D CB  1 
ATOM   2584 C CG  . TRP D 1 65 ? 83.069 44.297 5.691  1.00 198.51 ? 87  TRP D CG  1 
ATOM   2585 C CD1 . TRP D 1 65 ? 83.271 45.610 6.004  1.00 198.51 ? 87  TRP D CD1 1 
ATOM   2586 C CD2 . TRP D 1 65 ? 84.371 43.727 5.487  1.00 198.51 ? 87  TRP D CD2 1 
ATOM   2587 N NE1 . TRP D 1 65 ? 84.615 45.894 6.008  1.00 198.51 ? 87  TRP D NE1 1 
ATOM   2588 C CE2 . TRP D 1 65 ? 85.313 44.757 5.694  1.00 198.51 ? 87  TRP D CE2 1 
ATOM   2589 C CE3 . TRP D 1 65 ? 84.833 42.446 5.149  1.00 198.51 ? 87  TRP D CE3 1 
ATOM   2590 C CZ2 . TRP D 1 65 ? 86.693 44.546 5.576  1.00 198.51 ? 87  TRP D CZ2 1 
ATOM   2591 C CZ3 . TRP D 1 65 ? 86.206 42.237 5.031  1.00 198.51 ? 87  TRP D CZ3 1 
ATOM   2592 C CH2 . TRP D 1 65 ? 87.118 43.283 5.244  1.00 198.51 ? 87  TRP D CH2 1 
ATOM   2593 N N   . GLY D 1 66 ? 79.427 41.703 5.965  1.00 70.91  ? 88  GLY D N   1 
ATOM   2594 C CA  . GLY D 1 66 ? 78.170 41.314 6.569  1.00 70.91  ? 88  GLY D CA  1 
ATOM   2595 C C   . GLY D 1 66 ? 78.321 40.024 7.350  1.00 70.91  ? 88  GLY D C   1 
ATOM   2596 O O   . GLY D 1 66 ? 77.629 39.815 8.346  1.00 70.91  ? 88  GLY D O   1 
ATOM   2597 N N   . ARG D 1 67 ? 79.229 39.160 6.898  1.00 62.03  ? 89  ARG D N   1 
ATOM   2598 C CA  . ARG D 1 67 ? 79.478 37.884 7.562  1.00 62.03  ? 89  ARG D CA  1 
ATOM   2599 C C   . ARG D 1 67 ? 80.239 38.122 8.859  1.00 62.03  ? 89  ARG D C   1 
ATOM   2600 O O   . ARG D 1 67 ? 80.063 37.398 9.842  1.00 62.03  ? 89  ARG D O   1 
ATOM   2601 C CB  . ARG D 1 67 ? 80.280 36.952 6.653  1.00 100.38 ? 89  ARG D CB  1 
ATOM   2602 C CG  . ARG D 1 67 ? 79.613 36.693 5.314  1.00 100.38 ? 89  ARG D CG  1 
ATOM   2603 C CD  . ARG D 1 67 ? 79.646 35.225 4.929  1.00 100.38 ? 89  ARG D CD  1 
ATOM   2604 N NE  . ARG D 1 67 ? 78.428 34.820 4.229  1.00 100.38 ? 89  ARG D NE  1 
ATOM   2605 C CZ  . ARG D 1 67 ? 78.403 34.037 3.155  1.00 100.38 ? 89  ARG D CZ  1 
ATOM   2606 N NH1 . ARG D 1 67 ? 79.534 33.564 2.643  1.00 100.38 ? 89  ARG D NH1 1 
ATOM   2607 N NH2 . ARG D 1 67 ? 77.244 33.726 2.589  1.00 100.38 ? 89  ARG D NH2 1 
ATOM   2608 N N   . CYS D 1 68 ? 81.090 39.140 8.858  1.00 70.37  ? 90  CYS D N   1 
ATOM   2609 C CA  . CYS D 1 68 ? 81.845 39.474 10.052 1.00 70.37  ? 90  CYS D CA  1 
ATOM   2610 C C   . CYS D 1 68 ? 80.827 39.887 11.099 1.00 70.37  ? 90  CYS D C   1 
ATOM   2611 O O   . CYS D 1 68 ? 80.717 39.259 12.154 1.00 70.37  ? 90  CYS D O   1 
ATOM   2612 C CB  . CYS D 1 68 ? 82.807 40.628 9.777  1.00 116.71 ? 90  CYS D CB  1 
ATOM   2613 S SG  . CYS D 1 68 ? 84.474 40.092 9.340  1.00 116.71 ? 90  CYS D SG  1 
ATOM   2614 N N   . VAL D 1 69 ? 80.070 40.937 10.788 1.00 26.17  ? 91  VAL D N   1 
ATOM   2615 C CA  . VAL D 1 69 ? 79.042 41.437 11.695 1.00 26.17  ? 91  VAL D CA  1 
ATOM   2616 C C   . VAL D 1 69 ? 78.241 40.268 12.271 1.00 26.17  ? 91  VAL D C   1 
ATOM   2617 O O   . VAL D 1 69 ? 77.802 40.305 13.426 1.00 26.17  ? 91  VAL D O   1 
ATOM   2618 C CB  . VAL D 1 69 ? 78.088 42.409 10.966 1.00 62.48  ? 91  VAL D CB  1 
ATOM   2619 C CG1 . VAL D 1 69 ? 77.022 42.928 11.923 1.00 62.48  ? 91  VAL D CG1 1 
ATOM   2620 C CG2 . VAL D 1 69 ? 78.886 43.565 10.393 1.00 62.48  ? 91  VAL D CG2 1 
ATOM   2621 N N   . ALA D 1 70 ? 78.059 39.226 11.465 1.00 42.73  ? 92  ALA D N   1 
ATOM   2622 C CA  . ALA D 1 70 ? 77.330 38.055 11.919 1.00 42.73  ? 92  ALA D CA  1 
ATOM   2623 C C   . ALA D 1 70 ? 78.105 37.420 13.073 1.00 42.73  ? 92  ALA D C   1 
ATOM   2624 O O   . ALA D 1 70 ? 77.588 37.277 14.185 1.00 42.73  ? 92  ALA D O   1 
ATOM   2625 C CB  . ALA D 1 70 ? 77.170 37.062 10.778 1.00 74.41  ? 92  ALA D CB  1 
ATOM   2626 N N   . VAL D 1 71 ? 79.352 37.048 12.804 1.00 68.03  ? 93  VAL D N   1 
ATOM   2627 C CA  . VAL D 1 71 ? 80.199 36.432 13.820 1.00 68.03  ? 93  VAL D CA  1 
ATOM   2628 C C   . VAL D 1 71 ? 80.078 37.197 15.132 1.00 68.03  ? 93  VAL D C   1 
ATOM   2629 O O   . VAL D 1 71 ? 79.742 36.632 16.169 1.00 68.03  ? 93  VAL D O   1 
ATOM   2630 C CB  . VAL D 1 71 ? 81.679 36.417 13.378 1.00 68.23  ? 93  VAL D CB  1 
ATOM   2631 C CG1 . VAL D 1 71 ? 82.587 36.593 14.578 1.00 68.23  ? 93  VAL D CG1 1 
ATOM   2632 C CG2 . VAL D 1 71 ? 81.994 35.110 12.673 1.00 68.23  ? 93  VAL D CG2 1 
ATOM   2633 N N   . VAL D 1 72 ? 80.355 38.490 15.076 1.00 27.84  ? 94  VAL D N   1 
ATOM   2634 C CA  . VAL D 1 72 ? 80.262 39.329 16.258 1.00 27.84  ? 94  VAL D CA  1 
ATOM   2635 C C   . VAL D 1 72 ? 78.917 39.158 16.950 1.00 27.84  ? 94  VAL D C   1 
ATOM   2636 O O   . VAL D 1 72 ? 78.851 38.680 18.073 1.00 27.84  ? 94  VAL D O   1 
ATOM   2637 C CB  . VAL D 1 72 ? 80.426 40.811 15.899 1.00 37.84  ? 94  VAL D CB  1 
ATOM   2638 C CG1 . VAL D 1 72 ? 79.771 41.690 16.970 1.00 37.84  ? 94  VAL D CG1 1 
ATOM   2639 C CG2 . VAL D 1 72 ? 81.901 41.137 15.739 1.00 37.84  ? 94  VAL D CG2 1 
ATOM   2640 N N   . VAL D 1 73 ? 77.843 39.549 16.274 1.00 54.95  ? 95  VAL D N   1 
ATOM   2641 C CA  . VAL D 1 73 ? 76.516 39.438 16.858 1.00 54.95  ? 95  VAL D CA  1 
ATOM   2642 C C   . VAL D 1 73 ? 76.252 38.023 17.368 1.00 54.95  ? 95  VAL D C   1 
ATOM   2643 O O   . VAL D 1 73 ? 75.309 37.791 18.128 1.00 54.95  ? 95  VAL D O   1 
ATOM   2644 C CB  . VAL D 1 73 ? 75.425 39.831 15.842 1.00 85.54  ? 95  VAL D CB  1 
ATOM   2645 C CG1 . VAL D 1 73 ? 75.456 38.889 14.668 1.00 85.54  ? 95  VAL D CG1 1 
ATOM   2646 C CG2 . VAL D 1 73 ? 74.057 39.811 16.505 1.00 85.54  ? 95  VAL D CG2 1 
ATOM   2647 N N   . MET D 1 74 ? 77.084 37.074 16.951 1.00 85.43  ? 96  MET D N   1 
ATOM   2648 C CA  . MET D 1 74 ? 76.917 35.705 17.400 1.00 85.43  ? 96  MET D CA  1 
ATOM   2649 C C   . MET D 1 74 ? 77.507 35.535 18.785 1.00 85.43  ? 96  MET D C   1 
ATOM   2650 O O   . MET D 1 74 ? 76.773 35.300 19.739 1.00 85.43  ? 96  MET D O   1 
ATOM   2651 C CB  . MET D 1 74 ? 77.587 34.736 16.448 1.00 86.29  ? 96  MET D CB  1 
ATOM   2652 C CG  . MET D 1 74 ? 76.617 33.875 15.697 1.00 86.29  ? 96  MET D CG  1 
ATOM   2653 S SD  . MET D 1 74 ? 77.145 33.788 14.001 1.00 86.29  ? 96  MET D SD  1 
ATOM   2654 C CE  . MET D 1 74 ? 77.387 32.032 13.796 1.00 86.29  ? 96  MET D CE  1 
ATOM   2655 N N   . VAL D 1 75 ? 78.827 35.656 18.908 1.00 71.47  ? 97  VAL D N   1 
ATOM   2656 C CA  . VAL D 1 75 ? 79.471 35.502 20.214 1.00 71.47  ? 97  VAL D CA  1 
ATOM   2657 C C   . VAL D 1 75 ? 78.737 36.339 21.251 1.00 71.47  ? 97  VAL D C   1 
ATOM   2658 O O   . VAL D 1 75 ? 78.415 35.853 22.330 1.00 71.47  ? 97  VAL D O   1 
ATOM   2659 C CB  . VAL D 1 75 ? 80.967 35.912 20.179 1.00 51.14  ? 97  VAL D CB  1 
ATOM   2660 C CG1 . VAL D 1 75 ? 81.558 35.581 18.824 1.00 51.14  ? 97  VAL D CG1 1 
ATOM   2661 C CG2 . VAL D 1 75 ? 81.135 37.396 20.501 1.00 51.14  ? 97  VAL D CG2 1 
ATOM   2662 N N   . ALA D 1 76 ? 78.466 37.593 20.913 1.00 25.22  ? 98  ALA D N   1 
ATOM   2663 C CA  . ALA D 1 76 ? 77.744 38.487 21.803 1.00 25.22  ? 98  ALA D CA  1 
ATOM   2664 C C   . ALA D 1 76 ? 76.644 37.694 22.496 1.00 25.22  ? 98  ALA D C   1 
ATOM   2665 O O   . ALA D 1 76 ? 76.447 37.809 23.692 1.00 25.22  ? 98  ALA D O   1 
ATOM   2666 C CB  . ALA D 1 76 ? 77.130 39.627 21.012 1.00 59.41  ? 98  ALA D CB  1 
ATOM   2667 N N   . GLY D 1 77 ? 75.936 36.877 21.733 1.00 47.88  ? 99  GLY D N   1 
ATOM   2668 C CA  . GLY D 1 77 ? 74.874 36.082 22.307 1.00 47.88  ? 99  GLY D CA  1 
ATOM   2669 C C   . GLY D 1 77 ? 75.372 34.880 23.088 1.00 47.88  ? 99  GLY D C   1 
ATOM   2670 O O   . GLY D 1 77 ? 74.958 34.678 24.227 1.00 47.88  ? 99  GLY D O   1 
ATOM   2671 N N   . ILE D 1 78 ? 76.244 34.072 22.487 1.00 80.51  ? 100 ILE D N   1 
ATOM   2672 C CA  . ILE D 1 78 ? 76.769 32.887 23.164 1.00 80.51  ? 100 ILE D CA  1 
ATOM   2673 C C   . ILE D 1 78 ? 77.373 33.318 24.487 1.00 80.51  ? 100 ILE D C   1 
ATOM   2674 O O   . ILE D 1 78 ? 77.311 32.604 25.489 1.00 80.51  ? 100 ILE D O   1 
ATOM   2675 C CB  . ILE D 1 78 ? 77.888 32.197 22.349 1.00 114.22 ? 100 ILE D CB  1 
ATOM   2676 C CG1 . ILE D 1 78 ? 77.501 32.117 20.874 1.00 114.22 ? 100 ILE D CG1 1 
ATOM   2677 C CG2 . ILE D 1 78 ? 78.146 30.801 22.897 1.00 114.22 ? 100 ILE D CG2 1 
ATOM   2678 C CD1 . ILE D 1 78 ? 78.618 31.612 19.987 1.00 114.22 ? 100 ILE D CD1 1 
ATOM   2679 N N   . THR D 1 79 ? 77.952 34.509 24.468 1.00 39.96  ? 101 THR D N   1 
ATOM   2680 C CA  . THR D 1 79 ? 78.603 35.085 25.624 1.00 39.96  ? 101 THR D CA  1 
ATOM   2681 C C   . THR D 1 79 ? 77.620 35.799 26.545 1.00 39.96  ? 101 THR D C   1 
ATOM   2682 O O   . THR D 1 79 ? 77.418 35.373 27.673 1.00 39.96  ? 101 THR D O   1 
ATOM   2683 C CB  . THR D 1 79 ? 79.707 36.041 25.149 1.00 68.57  ? 101 THR D CB  1 
ATOM   2684 O OG1 . THR D 1 79 ? 80.940 35.315 25.066 1.00 68.57  ? 101 THR D OG1 1 
ATOM   2685 C CG2 . THR D 1 79 ? 79.850 37.237 26.084 1.00 68.57  ? 101 THR D CG2 1 
ATOM   2686 N N   . SER D 1 80 ? 77.003 36.876 26.073 1.00 76.60  ? 102 SER D N   1 
ATOM   2687 C CA  . SER D 1 80 ? 76.056 37.609 26.904 1.00 76.60  ? 102 SER D CA  1 
ATOM   2688 C C   . SER D 1 80 ? 75.143 36.658 27.672 1.00 76.60  ? 102 SER D C   1 
ATOM   2689 O O   . SER D 1 80 ? 74.766 36.931 28.809 1.00 76.60  ? 102 SER D O   1 
ATOM   2690 C CB  . SER D 1 80 ? 75.204 38.551 26.051 1.00 127.74 ? 102 SER D CB  1 
ATOM   2691 O OG  . SER D 1 80 ? 73.824 38.383 26.331 1.00 127.74 ? 102 SER D OG  1 
ATOM   2692 N N   . PHE D 1 81 ? 74.793 35.537 27.055 1.00 62.47  ? 103 PHE D N   1 
ATOM   2693 C CA  . PHE D 1 81 ? 73.917 34.578 27.711 1.00 62.47  ? 103 PHE D CA  1 
ATOM   2694 C C   . PHE D 1 81 ? 74.676 33.676 28.668 1.00 62.47  ? 103 PHE D C   1 
ATOM   2695 O O   . PHE D 1 81 ? 74.133 33.243 29.682 1.00 62.47  ? 103 PHE D O   1 
ATOM   2696 C CB  . PHE D 1 81 ? 73.177 33.741 26.671 1.00 87.43  ? 103 PHE D CB  1 
ATOM   2697 C CG  . PHE D 1 81 ? 71.845 34.305 26.297 1.00 87.43  ? 103 PHE D CG  1 
ATOM   2698 C CD1 . PHE D 1 81 ? 70.814 34.347 27.227 1.00 87.43  ? 103 PHE D CD1 1 
ATOM   2699 C CD2 . PHE D 1 81 ? 71.629 34.832 25.031 1.00 87.43  ? 103 PHE D CD2 1 
ATOM   2700 C CE1 . PHE D 1 81 ? 69.587 34.907 26.904 1.00 87.43  ? 103 PHE D CE1 1 
ATOM   2701 C CE2 . PHE D 1 81 ? 70.406 35.396 24.697 1.00 87.43  ? 103 PHE D CE2 1 
ATOM   2702 C CZ  . PHE D 1 81 ? 69.383 35.434 25.635 1.00 87.43  ? 103 PHE D CZ  1 
ATOM   2703 N N   . GLY D 1 82 ? 75.935 33.399 28.347 1.00 94.57  ? 104 GLY D N   1 
ATOM   2704 C CA  . GLY D 1 82 ? 76.746 32.556 29.206 1.00 94.57  ? 104 GLY D CA  1 
ATOM   2705 C C   . GLY D 1 82 ? 76.824 33.117 30.610 1.00 94.57  ? 104 GLY D C   1 
ATOM   2706 O O   . GLY D 1 82 ? 76.624 32.400 31.588 1.00 94.57  ? 104 GLY D O   1 
ATOM   2707 N N   . LEU D 1 83 ? 77.117 34.408 30.706 1.00 94.18  ? 105 LEU D N   1 
ATOM   2708 C CA  . LEU D 1 83 ? 77.207 35.071 31.993 1.00 94.18  ? 105 LEU D CA  1 
ATOM   2709 C C   . LEU D 1 83 ? 75.958 34.775 32.809 1.00 94.18  ? 105 LEU D C   1 
ATOM   2710 O O   . LEU D 1 83 ? 76.047 34.297 33.940 1.00 94.18  ? 105 LEU D O   1 
ATOM   2711 C CB  . LEU D 1 83 ? 77.348 36.576 31.799 1.00 109.91 ? 105 LEU D CB  1 
ATOM   2712 C CG  . LEU D 1 83 ? 78.777 37.100 31.924 1.00 109.91 ? 105 LEU D CG  1 
ATOM   2713 C CD1 . LEU D 1 83 ? 79.335 37.406 30.543 1.00 109.91 ? 105 LEU D CD1 1 
ATOM   2714 C CD2 . LEU D 1 83 ? 78.783 38.341 32.794 1.00 109.91 ? 105 LEU D CD2 1 
ATOM   2715 N N   . VAL D 1 84 ? 74.793 35.056 32.231 1.00 51.57  ? 106 VAL D N   1 
ATOM   2716 C CA  . VAL D 1 84 ? 73.529 34.808 32.919 1.00 51.57  ? 106 VAL D CA  1 
ATOM   2717 C C   . VAL D 1 84 ? 73.491 33.389 33.474 1.00 51.57  ? 106 VAL D C   1 
ATOM   2718 O O   . VAL D 1 84 ? 72.900 33.145 34.523 1.00 51.57  ? 106 VAL D O   1 
ATOM   2719 C CB  . VAL D 1 84 ? 72.326 35.002 31.978 1.00 47.00  ? 106 VAL D CB  1 
ATOM   2720 C CG1 . VAL D 1 84 ? 71.026 34.700 32.716 1.00 47.00  ? 106 VAL D CG1 1 
ATOM   2721 C CG2 . VAL D 1 84 ? 72.318 36.420 31.445 1.00 47.00  ? 106 VAL D CG2 1 
ATOM   2722 N N   . THR D 1 85 ? 74.110 32.450 32.768 1.00 63.08  ? 107 THR D N   1 
ATOM   2723 C CA  . THR D 1 85 ? 74.138 31.079 33.246 1.00 63.08  ? 107 THR D CA  1 
ATOM   2724 C C   . THR D 1 85 ? 75.125 31.033 34.393 1.00 63.08  ? 107 THR D C   1 
ATOM   2725 O O   . THR D 1 85 ? 74.874 30.392 35.410 1.00 63.08  ? 107 THR D O   1 
ATOM   2726 C CB  . THR D 1 85 ? 74.592 30.094 32.156 1.00 122.85 ? 107 THR D CB  1 
ATOM   2727 O OG1 . THR D 1 85 ? 73.442 29.449 31.603 1.00 122.85 ? 107 THR D OG1 1 
ATOM   2728 C CG2 . THR D 1 85 ? 75.516 29.027 32.735 1.00 122.85 ? 107 THR D CG2 1 
ATOM   2729 N N   . ALA D 1 86 ? 76.251 31.719 34.218 1.00 66.80  ? 108 ALA D N   1 
ATOM   2730 C CA  . ALA D 1 86 ? 77.281 31.774 35.245 1.00 66.80  ? 108 ALA D CA  1 
ATOM   2731 C C   . ALA D 1 86 ? 76.632 32.311 36.503 1.00 66.80  ? 108 ALA D C   1 
ATOM   2732 O O   . ALA D 1 86 ? 76.665 31.674 37.555 1.00 66.80  ? 108 ALA D O   1 
ATOM   2733 C CB  . ALA D 1 86 ? 78.408 32.691 34.808 1.00 57.88  ? 108 ALA D CB  1 
ATOM   2734 N N   . ALA D 1 87 ? 76.035 33.489 36.380 1.00 66.86  ? 109 ALA D N   1 
ATOM   2735 C CA  . ALA D 1 87 ? 75.355 34.123 37.498 1.00 66.86  ? 109 ALA D CA  1 
ATOM   2736 C C   . ALA D 1 87 ? 74.543 33.075 38.246 1.00 66.86  ? 109 ALA D C   1 
ATOM   2737 O O   . ALA D 1 87 ? 74.735 32.856 39.435 1.00 66.86  ? 109 ALA D O   1 
ATOM   2738 C CB  . ALA D 1 87 ? 74.437 35.226 36.988 1.00 21.49  ? 109 ALA D CB  1 
ATOM   2739 N N   . LEU D 1 88 ? 73.644 32.417 37.532 1.00 57.04  ? 110 LEU D N   1 
ATOM   2740 C CA  . LEU D 1 88 ? 72.792 31.398 38.129 1.00 57.04  ? 110 LEU D CA  1 
ATOM   2741 C C   . LEU D 1 88 ? 73.562 30.213 38.713 1.00 57.04  ? 110 LEU D C   1 
ATOM   2742 O O   . LEU D 1 88 ? 73.161 29.654 39.730 1.00 57.04  ? 110 LEU D O   1 
ATOM   2743 C CB  . LEU D 1 88 ? 71.788 30.894 37.088 1.00 93.49  ? 110 LEU D CB  1 
ATOM   2744 C CG  . LEU D 1 88 ? 70.485 31.691 36.962 1.00 93.49  ? 110 LEU D CG  1 
ATOM   2745 C CD1 . LEU D 1 88 ? 70.777 33.116 36.507 1.00 93.49  ? 110 LEU D CD1 1 
ATOM   2746 C CD2 . LEU D 1 88 ? 69.563 30.989 35.981 1.00 93.49  ? 110 LEU D CD2 1 
ATOM   2747 N N   . ALA D 1 89 ? 74.661 29.830 38.070 1.00 122.81 ? 111 ALA D N   1 
ATOM   2748 C CA  . ALA D 1 89 ? 75.457 28.700 38.539 1.00 122.81 ? 111 ALA D CA  1 
ATOM   2749 C C   . ALA D 1 89 ? 76.004 28.941 39.934 1.00 122.81 ? 111 ALA D C   1 
ATOM   2750 O O   . ALA D 1 89 ? 76.133 28.007 40.720 1.00 122.81 ? 111 ALA D O   1 
ATOM   2751 C CB  . ALA D 1 89 ? 76.606 28.425 37.576 1.00 86.13  ? 111 ALA D CB  1 
ATOM   2752 N N   . THR D 1 90 ? 76.326 30.192 40.241 1.00 128.65 ? 112 THR D N   1 
ATOM   2753 C CA  . THR D 1 90 ? 76.869 30.529 41.553 1.00 128.65 ? 112 THR D CA  1 
ATOM   2754 C C   . THR D 1 90 ? 75.766 30.793 42.573 1.00 128.65 ? 112 THR D C   1 
ATOM   2755 O O   . THR D 1 90 ? 75.877 30.403 43.735 1.00 128.65 ? 112 THR D O   1 
ATOM   2756 C CB  . THR D 1 90 ? 77.781 31.774 41.482 1.00 92.80  ? 112 THR D CB  1 
ATOM   2757 O OG1 . THR D 1 90 ? 77.042 32.931 41.886 1.00 92.80  ? 112 THR D OG1 1 
ATOM   2758 C CG2 . THR D 1 90 ? 78.290 31.980 40.075 1.00 92.80  ? 112 THR D CG2 1 
ATOM   2759 N N   . TRP D 1 91 ? 74.701 31.457 42.134 1.00 116.90 ? 113 TRP D N   1 
ATOM   2760 C CA  . TRP D 1 91 ? 73.581 31.774 43.012 1.00 116.90 ? 113 TRP D CA  1 
ATOM   2761 C C   . TRP D 1 91 ? 72.923 30.487 43.498 1.00 116.90 ? 113 TRP D C   1 
ATOM   2762 O O   . TRP D 1 91 ? 71.956 30.510 44.262 1.00 116.90 ? 113 TRP D O   1 
ATOM   2763 C CB  . TRP D 1 91 ? 72.562 32.645 42.265 1.00 187.44 ? 113 TRP D CB  1 
ATOM   2764 C CG  . TRP D 1 91 ? 71.363 33.026 43.082 1.00 187.44 ? 113 TRP D CG  1 
ATOM   2765 C CD1 . TRP D 1 91 ? 71.313 33.927 44.111 1.00 187.44 ? 113 TRP D CD1 1 
ATOM   2766 C CD2 . TRP D 1 91 ? 70.030 32.523 42.920 1.00 187.44 ? 113 TRP D CD2 1 
ATOM   2767 N NE1 . TRP D 1 91 ? 70.032 34.017 44.599 1.00 187.44 ? 113 TRP D NE1 1 
ATOM   2768 C CE2 . TRP D 1 91 ? 69.227 33.170 43.889 1.00 187.44 ? 113 TRP D CE2 1 
ATOM   2769 C CE3 . TRP D 1 91 ? 69.442 31.594 42.053 1.00 187.44 ? 113 TRP D CE3 1 
ATOM   2770 C CZ2 . TRP D 1 91 ? 67.858 32.909 44.010 1.00 187.44 ? 113 TRP D CZ2 1 
ATOM   2771 C CZ3 . TRP D 1 91 ? 68.089 31.339 42.175 1.00 187.44 ? 113 TRP D CZ3 1 
ATOM   2772 C CH2 . TRP D 1 91 ? 67.308 31.992 43.144 1.00 187.44 ? 113 TRP D CH2 1 
ATOM   2773 N N   . PHE D 1 92 ? 73.456 29.361 43.036 1.00 94.93  ? 114 PHE D N   1 
ATOM   2774 C CA  . PHE D 1 92 ? 72.956 28.055 43.430 1.00 94.93  ? 114 PHE D CA  1 
ATOM   2775 C C   . PHE D 1 92 ? 73.992 27.452 44.359 1.00 94.93  ? 114 PHE D C   1 
ATOM   2776 O O   . PHE D 1 92 ? 73.722 26.494 45.076 1.00 94.93  ? 114 PHE D O   1 
ATOM   2777 C CB  . PHE D 1 92 ? 72.745 27.170 42.200 1.00 140.41 ? 114 PHE D CB  1 
ATOM   2778 C CG  . PHE D 1 92 ? 71.346 27.219 41.658 1.00 140.41 ? 114 PHE D CG  1 
ATOM   2779 C CD1 . PHE D 1 92 ? 70.396 28.057 42.237 1.00 140.41 ? 114 PHE D CD1 1 
ATOM   2780 C CD2 . PHE D 1 92 ? 70.976 26.436 40.573 1.00 140.41 ? 114 PHE D CD2 1 
ATOM   2781 C CE1 . PHE D 1 92 ? 69.097 28.116 41.745 1.00 140.41 ? 114 PHE D CE1 1 
ATOM   2782 C CE2 . PHE D 1 92 ? 69.673 26.487 40.070 1.00 140.41 ? 114 PHE D CE2 1 
ATOM   2783 C CZ  . PHE D 1 92 ? 68.732 27.331 40.660 1.00 140.41 ? 114 PHE D CZ  1 
ATOM   2784 N N   . VAL D 1 93 ? 75.182 28.043 44.336 1.00 154.47 ? 115 VAL D N   1 
ATOM   2785 C CA  . VAL D 1 93 ? 76.288 27.628 45.181 1.00 154.47 ? 115 VAL D CA  1 
ATOM   2786 C C   . VAL D 1 93 ? 76.209 28.525 46.423 1.00 154.47 ? 115 VAL D C   1 
ATOM   2787 O O   . VAL D 1 93 ? 76.679 28.161 47.505 1.00 154.47 ? 115 VAL D O   1 
ATOM   2788 C CB  . VAL D 1 93 ? 77.644 27.818 44.444 1.00 119.78 ? 115 VAL D CB  1 
ATOM   2789 C CG1 . VAL D 1 93 ? 78.783 27.951 45.439 1.00 119.78 ? 115 VAL D CG1 1 
ATOM   2790 C CG2 . VAL D 1 93 ? 77.890 26.638 43.526 1.00 119.78 ? 115 VAL D CG2 1 
ATOM   2791 N N   . GLY D 1 94 ? 75.598 29.699 46.250 1.00 147.03 ? 116 GLY D N   1 
ATOM   2792 C CA  . GLY D 1 94 ? 75.430 30.644 47.346 1.00 147.03 ? 116 GLY D CA  1 
ATOM   2793 C C   . GLY D 1 94 ? 74.384 30.110 48.305 1.00 147.03 ? 116 GLY D C   1 
ATOM   2794 O O   . GLY D 1 94 ? 73.669 30.857 48.978 1.00 147.03 ? 116 GLY D O   1 
ATOM   2795 N N   . ARG D 1 95 ? 74.298 28.786 48.332 1.00 81.26  ? 117 ARG D N   1 
ATOM   2796 C CA  . ARG D 1 95 ? 73.384 28.049 49.186 1.00 81.26  ? 117 ARG D CA  1 
ATOM   2797 C C   . ARG D 1 95 ? 74.151 26.791 49.577 1.00 81.26  ? 117 ARG D C   1 
ATOM   2798 O O   . ARG D 1 95 ? 73.676 25.660 49.415 1.00 81.26  ? 117 ARG D O   1 
ATOM   2799 C CB  . ARG D 1 95 ? 72.106 27.689 48.429 1.00 129.09 ? 117 ARG D CB  1 
ATOM   2800 C CG  . ARG D 1 95 ? 71.006 28.727 48.567 1.00 129.09 ? 117 ARG D CG  1 
ATOM   2801 C CD  . ARG D 1 95 ? 70.153 28.460 49.790 1.00 129.09 ? 117 ARG D CD  1 
ATOM   2802 N NE  . ARG D 1 95 ? 69.155 29.505 49.993 1.00 129.09 ? 117 ARG D NE  1 
ATOM   2803 N N   . GLU D 1 96 ? 75.366 27.024 50.069 1.00 219.72 ? 118 GLU D N   1 
ATOM   2804 C CA  . GLU D 1 96 ? 76.272 25.974 50.518 1.00 219.72 ? 118 GLU D CA  1 
ATOM   2805 C C   . GLU D 1 96 ? 76.330 26.031 52.042 1.00 219.72 ? 118 GLU D C   1 
ATOM   2806 O O   . GLU D 1 96 ? 76.709 25.064 52.702 1.00 219.72 ? 118 GLU D O   1 
ATOM   2807 C CB  . GLU D 1 96 ? 77.675 26.207 49.947 1.00 193.70 ? 118 GLU D CB  1 
ATOM   2808 C CG  . GLU D 1 96 ? 78.371 27.453 50.498 1.00 193.70 ? 118 GLU D CG  1 
ATOM   2809 C CD  . GLU D 1 96 ? 79.828 27.559 50.074 1.00 193.70 ? 118 GLU D CD  1 
ATOM   2810 O OE1 . GLU D 1 96 ? 80.394 26.551 49.597 1.00 193.70 ? 118 GLU D OE1 1 
ATOM   2811 O OE2 . GLU D 1 96 ? 80.409 28.657 50.219 1.00 193.70 ? 118 GLU D OE2 1 
ATOM   2812 N N   . GLN D 1 97 ? 75.952 27.181 52.588 1.00 165.84 ? 119 GLN D N   1 
ATOM   2813 C CA  . GLN D 1 97 ? 75.945 27.402 54.025 1.00 165.84 ? 119 GLN D CA  1 
ATOM   2814 C C   . GLN D 1 97 ? 74.913 26.480 54.693 1.00 165.84 ? 119 GLN D C   1 
ATOM   2815 O O   . GLN D 1 97 ? 75.226 25.924 55.766 1.00 165.84 ? 119 GLN D O   1 
ATOM   2816 C CB  . GLN D 1 97 ? 75.591 28.862 54.300 1.00 171.94 ? 119 GLN D CB  1 
ATOM   2817 C CG  . GLN D 1 97 ? 74.116 29.089 54.133 1.00 171.94 ? 119 GLN D CG  1 
ATOM   2818 C CD  . GLN D 1 97 ? 73.711 30.338 53.393 1.00 171.94 ? 119 GLN D CD  1 
ATOM   2819 O OE1 . GLN D 1 97 ? 72.820 31.038 53.833 1.00 171.94 ? 119 GLN D OE1 1 
ATOM   2820 N NE2 . GLN D 1 97 ? 74.344 30.617 52.270 1.00 171.94 ? 119 GLN D NE2 1 
HETATM 2821 K K   . K   E 2 .  ? 67.868 26.595 9.017  1.00 57.73  ? 401 K   A K   1 
HETATM 2822 K K   . K   F 2 .  ? 70.574 26.590 15.816 1.00 74.76  ? 402 K   A K   1 
HETATM 2823 K K   . K   G 2 .  ? 71.815 26.478 18.867 1.00 75.52  ? 403 K   A K   1 
HETATM 2824 O O   . HOH H 3 .  ? 69.120 26.480 12.189 1.00 66.21  ? 500 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  ALA 1  23  23  ALA ALA A . n 
A 1 2  LEU 2  24  24  LEU LEU A . n 
A 1 3  HIS 3  25  25  HIS HIS A . n 
A 1 4  TRP 4  26  26  TRP TRP A . n 
A 1 5  ARG 5  27  27  ARG ARG A . n 
A 1 6  ALA 6  28  28  ALA ALA A . n 
A 1 7  ALA 7  29  29  ALA ALA A . n 
A 1 8  GLY 8  30  30  GLY GLY A . n 
A 1 9  ALA 9  31  31  ALA ALA A . n 
A 1 10 ALA 10 32  32  ALA ALA A . n 
A 1 11 THR 11 33  33  THR THR A . n 
A 1 12 VAL 12 34  34  VAL VAL A . n 
A 1 13 LEU 13 35  35  LEU LEU A . n 
A 1 14 LEU 14 36  36  LEU LEU A . n 
A 1 15 VAL 15 37  37  VAL VAL A . n 
A 1 16 ILE 16 38  38  ILE ILE A . n 
A 1 17 VAL 17 39  39  VAL VAL A . n 
A 1 18 LEU 18 40  40  LEU LEU A . n 
A 1 19 LEU 19 41  41  LEU LEU A . n 
A 1 20 ALA 20 42  42  ALA ALA A . n 
A 1 21 GLY 21 43  43  GLY GLY A . n 
A 1 22 SER 22 44  44  SER SER A . n 
A 1 23 TYR 23 45  45  TYR TYR A . n 
A 1 24 LEU 24 46  46  LEU LEU A . n 
A 1 25 ALA 25 47  47  ALA ALA A . n 
A 1 26 VAL 26 48  48  VAL VAL A . n 
A 1 27 LEU 27 49  49  LEU LEU A . n 
A 1 28 ALA 28 50  50  ALA ALA A . n 
A 1 29 GLU 29 51  51  GLU GLU A . n 
A 1 30 ARG 30 52  52  ARG ARG A . n 
A 1 31 GLY 31 53  53  GLY GLY A . n 
A 1 32 ALA 32 54  54  ALA ALA A . n 
A 1 33 PRO 33 55  55  PRO PRO A . n 
A 1 34 GLY 34 56  56  GLY GLY A . n 
A 1 35 ALA 35 57  57  ALA ALA A . n 
A 1 36 GLN 36 58  58  GLN GLN A . n 
A 1 37 LEU 37 59  59  LEU LEU A . n 
A 1 38 ILE 38 60  60  ILE ILE A . n 
A 1 39 THR 39 61  61  THR THR A . n 
A 1 40 TYR 40 62  62  TYR TYR A . n 
A 1 41 PRO 41 63  63  PRO PRO A . n 
A 1 42 ARG 42 64  64  ARG ARG A . n 
A 1 43 ALA 43 65  65  ALA ALA A . n 
A 1 44 LEU 44 66  66  LEU LEU A . n 
A 1 45 TRP 45 67  67  TRP TRP A . n 
A 1 46 TRP 46 68  68  TRP TRP A . n 
A 1 47 SER 47 69  69  SER SER A . n 
A 1 48 VAL 48 70  70  VAL VAL A . n 
A 1 49 GLU 49 71  71  GLU GLU A . n 
A 1 50 THR 50 72  72  THR THR A . n 
A 1 51 ALA 51 73  73  ALA ALA A . n 
A 1 52 THR 52 74  74  THR THR A . n 
A 1 53 THR 53 75  75  THR THR A . n 
A 1 54 VAL 54 76  76  VAL VAL A . n 
A 1 55 GLY 55 77  77  GLY GLY A . n 
A 1 56 TYR 56 78  78  TYR TYR A . n 
A 1 57 GLY 57 79  79  GLY GLY A . n 
A 1 58 ASP 58 80  80  ASP ASP A . n 
A 1 59 LEU 59 81  81  LEU LEU A . n 
A 1 60 TYR 60 82  82  TYR TYR A . n 
A 1 61 PRO 61 83  83  PRO PRO A . n 
A 1 62 VAL 62 84  84  VAL VAL A . n 
A 1 63 THR 63 85  85  THR THR A . n 
A 1 64 LEU 64 86  86  LEU LEU A . n 
A 1 65 TRP 65 87  87  TRP TRP A . n 
A 1 66 GLY 66 88  88  GLY GLY A . n 
A 1 67 ARG 67 89  89  ARG ARG A . n 
A 1 68 CYS 68 90  90  CYS CYS A . n 
A 1 69 VAL 69 91  91  VAL VAL A . n 
A 1 70 ALA 70 92  92  ALA ALA A . n 
A 1 71 VAL 71 93  93  VAL VAL A . n 
A 1 72 VAL 72 94  94  VAL VAL A . n 
A 1 73 VAL 73 95  95  VAL VAL A . n 
A 1 74 MET 74 96  96  MET MET A . n 
A 1 75 VAL 75 97  97  VAL VAL A . n 
A 1 76 ALA 76 98  98  ALA ALA A . n 
A 1 77 GLY 77 99  99  GLY GLY A . n 
A 1 78 ILE 78 100 100 ILE ILE A . n 
A 1 79 THR 79 101 101 THR THR A . n 
A 1 80 SER 80 102 102 SER SER A . n 
A 1 81 PHE 81 103 103 PHE PHE A . n 
A 1 82 GLY 82 104 104 GLY GLY A . n 
A 1 83 LEU 83 105 105 LEU LEU A . n 
A 1 84 VAL 84 106 106 VAL VAL A . n 
A 1 85 THR 85 107 107 THR THR A . n 
A 1 86 ALA 86 108 108 ALA ALA A . n 
A 1 87 ALA 87 109 109 ALA ALA A . n 
A 1 88 LEU 88 110 110 LEU LEU A . n 
A 1 89 ALA 89 111 111 ALA ALA A . n 
A 1 90 THR 90 112 112 THR THR A . n 
A 1 91 TRP 91 113 113 TRP TRP A . n 
A 1 92 PHE 92 114 114 PHE PHE A . n 
A 1 93 VAL 93 115 115 VAL VAL A . n 
A 1 94 GLY 94 116 116 GLY GLY A . n 
A 1 95 ARG 95 117 117 ARG ARG A . n 
A 1 96 GLU 96 118 118 GLU GLU A . n 
A 1 97 GLN 97 119 119 GLN GLN A . n 
B 1 1  ALA 1  23  23  ALA ALA B . n 
B 1 2  LEU 2  24  24  LEU LEU B . n 
B 1 3  HIS 3  25  25  HIS HIS B . n 
B 1 4  TRP 4  26  26  TRP TRP B . n 
B 1 5  ARG 5  27  27  ARG ARG B . n 
B 1 6  ALA 6  28  28  ALA ALA B . n 
B 1 7  ALA 7  29  29  ALA ALA B . n 
B 1 8  GLY 8  30  30  GLY GLY B . n 
B 1 9  ALA 9  31  31  ALA ALA B . n 
B 1 10 ALA 10 32  32  ALA ALA B . n 
B 1 11 THR 11 33  33  THR THR B . n 
B 1 12 VAL 12 34  34  VAL VAL B . n 
B 1 13 LEU 13 35  35  LEU LEU B . n 
B 1 14 LEU 14 36  36  LEU LEU B . n 
B 1 15 VAL 15 37  37  VAL VAL B . n 
B 1 16 ILE 16 38  38  ILE ILE B . n 
B 1 17 VAL 17 39  39  VAL VAL B . n 
B 1 18 LEU 18 40  40  LEU LEU B . n 
B 1 19 LEU 19 41  41  LEU LEU B . n 
B 1 20 ALA 20 42  42  ALA ALA B . n 
B 1 21 GLY 21 43  43  GLY GLY B . n 
B 1 22 SER 22 44  44  SER SER B . n 
B 1 23 TYR 23 45  45  TYR TYR B . n 
B 1 24 LEU 24 46  46  LEU LEU B . n 
B 1 25 ALA 25 47  47  ALA ALA B . n 
B 1 26 VAL 26 48  48  VAL VAL B . n 
B 1 27 LEU 27 49  49  LEU LEU B . n 
B 1 28 ALA 28 50  50  ALA ALA B . n 
B 1 29 GLU 29 51  51  GLU GLU B . n 
B 1 30 ARG 30 52  52  ARG ARG B . n 
B 1 31 GLY 31 53  53  GLY GLY B . n 
B 1 32 ALA 32 54  54  ALA ALA B . n 
B 1 33 PRO 33 55  55  PRO PRO B . n 
B 1 34 GLY 34 56  56  GLY GLY B . n 
B 1 35 ALA 35 57  57  ALA ALA B . n 
B 1 36 GLN 36 58  58  GLN GLN B . n 
B 1 37 LEU 37 59  59  LEU LEU B . n 
B 1 38 ILE 38 60  60  ILE ILE B . n 
B 1 39 THR 39 61  61  THR THR B . n 
B 1 40 TYR 40 62  62  TYR TYR B . n 
B 1 41 PRO 41 63  63  PRO PRO B . n 
B 1 42 ARG 42 64  64  ARG ARG B . n 
B 1 43 ALA 43 65  65  ALA ALA B . n 
B 1 44 LEU 44 66  66  LEU LEU B . n 
B 1 45 TRP 45 67  67  TRP TRP B . n 
B 1 46 TRP 46 68  68  TRP TRP B . n 
B 1 47 SER 47 69  69  SER SER B . n 
B 1 48 VAL 48 70  70  VAL VAL B . n 
B 1 49 GLU 49 71  71  GLU GLU B . n 
B 1 50 THR 50 72  72  THR THR B . n 
B 1 51 ALA 51 73  73  ALA ALA B . n 
B 1 52 THR 52 74  74  THR THR B . n 
B 1 53 THR 53 75  75  THR THR B . n 
B 1 54 VAL 54 76  76  VAL VAL B . n 
B 1 55 GLY 55 77  77  GLY GLY B . n 
B 1 56 TYR 56 78  78  TYR TYR B . n 
B 1 57 GLY 57 79  79  GLY GLY B . n 
B 1 58 ASP 58 80  80  ASP ASP B . n 
B 1 59 LEU 59 81  81  LEU LEU B . n 
B 1 60 TYR 60 82  82  TYR TYR B . n 
B 1 61 PRO 61 83  83  PRO PRO B . n 
B 1 62 VAL 62 84  84  VAL VAL B . n 
B 1 63 THR 63 85  85  THR THR B . n 
B 1 64 LEU 64 86  86  LEU LEU B . n 
B 1 65 TRP 65 87  87  TRP TRP B . n 
B 1 66 GLY 66 88  88  GLY GLY B . n 
B 1 67 ARG 67 89  89  ARG ARG B . n 
B 1 68 CYS 68 90  90  CYS CYS B . n 
B 1 69 VAL 69 91  91  VAL VAL B . n 
B 1 70 ALA 70 92  92  ALA ALA B . n 
B 1 71 VAL 71 93  93  VAL VAL B . n 
B 1 72 VAL 72 94  94  VAL VAL B . n 
B 1 73 VAL 73 95  95  VAL VAL B . n 
B 1 74 MET 74 96  96  MET MET B . n 
B 1 75 VAL 75 97  97  VAL VAL B . n 
B 1 76 ALA 76 98  98  ALA ALA B . n 
B 1 77 GLY 77 99  99  GLY GLY B . n 
B 1 78 ILE 78 100 100 ILE ILE B . n 
B 1 79 THR 79 101 101 THR THR B . n 
B 1 80 SER 80 102 102 SER SER B . n 
B 1 81 PHE 81 103 103 PHE PHE B . n 
B 1 82 GLY 82 104 104 GLY GLY B . n 
B 1 83 LEU 83 105 105 LEU LEU B . n 
B 1 84 VAL 84 106 106 VAL VAL B . n 
B 1 85 THR 85 107 107 THR THR B . n 
B 1 86 ALA 86 108 108 ALA ALA B . n 
B 1 87 ALA 87 109 109 ALA ALA B . n 
B 1 88 LEU 88 110 110 LEU LEU B . n 
B 1 89 ALA 89 111 111 ALA ALA B . n 
B 1 90 THR 90 112 112 THR THR B . n 
B 1 91 TRP 91 113 113 TRP TRP B . n 
B 1 92 PHE 92 114 114 PHE PHE B . n 
B 1 93 VAL 93 115 115 VAL VAL B . n 
B 1 94 GLY 94 116 116 GLY GLY B . n 
B 1 95 ARG 95 117 117 ARG ARG B . n 
B 1 96 GLU 96 118 118 GLU GLU B . n 
B 1 97 GLN 97 119 119 GLN GLN B . n 
C 1 1  ALA 1  23  23  ALA ALA C . n 
C 1 2  LEU 2  24  24  LEU LEU C . n 
C 1 3  HIS 3  25  25  HIS HIS C . n 
C 1 4  TRP 4  26  26  TRP TRP C . n 
C 1 5  ARG 5  27  27  ARG ARG C . n 
C 1 6  ALA 6  28  28  ALA ALA C . n 
C 1 7  ALA 7  29  29  ALA ALA C . n 
C 1 8  GLY 8  30  30  GLY GLY C . n 
C 1 9  ALA 9  31  31  ALA ALA C . n 
C 1 10 ALA 10 32  32  ALA ALA C . n 
C 1 11 THR 11 33  33  THR THR C . n 
C 1 12 VAL 12 34  34  VAL VAL C . n 
C 1 13 LEU 13 35  35  LEU LEU C . n 
C 1 14 LEU 14 36  36  LEU LEU C . n 
C 1 15 VAL 15 37  37  VAL VAL C . n 
C 1 16 ILE 16 38  38  ILE ILE C . n 
C 1 17 VAL 17 39  39  VAL VAL C . n 
C 1 18 LEU 18 40  40  LEU LEU C . n 
C 1 19 LEU 19 41  41  LEU LEU C . n 
C 1 20 ALA 20 42  42  ALA ALA C . n 
C 1 21 GLY 21 43  43  GLY GLY C . n 
C 1 22 SER 22 44  44  SER SER C . n 
C 1 23 TYR 23 45  45  TYR TYR C . n 
C 1 24 LEU 24 46  46  LEU LEU C . n 
C 1 25 ALA 25 47  47  ALA ALA C . n 
C 1 26 VAL 26 48  48  VAL VAL C . n 
C 1 27 LEU 27 49  49  LEU LEU C . n 
C 1 28 ALA 28 50  50  ALA ALA C . n 
C 1 29 GLU 29 51  51  GLU GLU C . n 
C 1 30 ARG 30 52  52  ARG ARG C . n 
C 1 31 GLY 31 53  53  GLY GLY C . n 
C 1 32 ALA 32 54  54  ALA ALA C . n 
C 1 33 PRO 33 55  55  PRO PRO C . n 
C 1 34 GLY 34 56  56  GLY GLY C . n 
C 1 35 ALA 35 57  57  ALA ALA C . n 
C 1 36 GLN 36 58  58  GLN GLN C . n 
C 1 37 LEU 37 59  59  LEU LEU C . n 
C 1 38 ILE 38 60  60  ILE ILE C . n 
C 1 39 THR 39 61  61  THR THR C . n 
C 1 40 TYR 40 62  62  TYR TYR C . n 
C 1 41 PRO 41 63  63  PRO PRO C . n 
C 1 42 ARG 42 64  64  ARG ARG C . n 
C 1 43 ALA 43 65  65  ALA ALA C . n 
C 1 44 LEU 44 66  66  LEU LEU C . n 
C 1 45 TRP 45 67  67  TRP TRP C . n 
C 1 46 TRP 46 68  68  TRP TRP C . n 
C 1 47 SER 47 69  69  SER SER C . n 
C 1 48 VAL 48 70  70  VAL VAL C . n 
C 1 49 GLU 49 71  71  GLU GLU C . n 
C 1 50 THR 50 72  72  THR THR C . n 
C 1 51 ALA 51 73  73  ALA ALA C . n 
C 1 52 THR 52 74  74  THR THR C . n 
C 1 53 THR 53 75  75  THR THR C . n 
C 1 54 VAL 54 76  76  VAL VAL C . n 
C 1 55 GLY 55 77  77  GLY GLY C . n 
C 1 56 TYR 56 78  78  TYR TYR C . n 
C 1 57 GLY 57 79  79  GLY GLY C . n 
C 1 58 ASP 58 80  80  ASP ASP C . n 
C 1 59 LEU 59 81  81  LEU LEU C . n 
C 1 60 TYR 60 82  82  TYR TYR C . n 
C 1 61 PRO 61 83  83  PRO PRO C . n 
C 1 62 VAL 62 84  84  VAL VAL C . n 
C 1 63 THR 63 85  85  THR THR C . n 
C 1 64 LEU 64 86  86  LEU LEU C . n 
C 1 65 TRP 65 87  87  TRP TRP C . n 
C 1 66 GLY 66 88  88  GLY GLY C . n 
C 1 67 ARG 67 89  89  ARG ARG C . n 
C 1 68 CYS 68 90  90  CYS CYS C . n 
C 1 69 VAL 69 91  91  VAL VAL C . n 
C 1 70 ALA 70 92  92  ALA ALA C . n 
C 1 71 VAL 71 93  93  VAL VAL C . n 
C 1 72 VAL 72 94  94  VAL VAL C . n 
C 1 73 VAL 73 95  95  VAL VAL C . n 
C 1 74 MET 74 96  96  MET MET C . n 
C 1 75 VAL 75 97  97  VAL VAL C . n 
C 1 76 ALA 76 98  98  ALA ALA C . n 
C 1 77 GLY 77 99  99  GLY GLY C . n 
C 1 78 ILE 78 100 100 ILE ILE C . n 
C 1 79 THR 79 101 101 THR THR C . n 
C 1 80 SER 80 102 102 SER SER C . n 
C 1 81 PHE 81 103 103 PHE PHE C . n 
C 1 82 GLY 82 104 104 GLY GLY C . n 
C 1 83 LEU 83 105 105 LEU LEU C . n 
C 1 84 VAL 84 106 106 VAL VAL C . n 
C 1 85 THR 85 107 107 THR THR C . n 
C 1 86 ALA 86 108 108 ALA ALA C . n 
C 1 87 ALA 87 109 109 ALA ALA C . n 
C 1 88 LEU 88 110 110 LEU LEU C . n 
C 1 89 ALA 89 111 111 ALA ALA C . n 
C 1 90 THR 90 112 112 THR THR C . n 
C 1 91 TRP 91 113 113 TRP TRP C . n 
C 1 92 PHE 92 114 114 PHE PHE C . n 
C 1 93 VAL 93 115 115 VAL VAL C . n 
C 1 94 GLY 94 116 116 GLY GLY C . n 
C 1 95 ARG 95 117 117 ARG ARG C . n 
C 1 96 GLU 96 118 118 GLU GLU C . n 
C 1 97 GLN 97 119 119 GLN GLN C . n 
D 1 1  ALA 1  23  23  ALA ALA D . n 
D 1 2  LEU 2  24  24  LEU LEU D . n 
D 1 3  HIS 3  25  25  HIS HIS D . n 
D 1 4  TRP 4  26  26  TRP TRP D . n 
D 1 5  ARG 5  27  27  ARG ARG D . n 
D 1 6  ALA 6  28  28  ALA ALA D . n 
D 1 7  ALA 7  29  29  ALA ALA D . n 
D 1 8  GLY 8  30  30  GLY GLY D . n 
D 1 9  ALA 9  31  31  ALA ALA D . n 
D 1 10 ALA 10 32  32  ALA ALA D . n 
D 1 11 THR 11 33  33  THR THR D . n 
D 1 12 VAL 12 34  34  VAL VAL D . n 
D 1 13 LEU 13 35  35  LEU LEU D . n 
D 1 14 LEU 14 36  36  LEU LEU D . n 
D 1 15 VAL 15 37  37  VAL VAL D . n 
D 1 16 ILE 16 38  38  ILE ILE D . n 
D 1 17 VAL 17 39  39  VAL VAL D . n 
D 1 18 LEU 18 40  40  LEU LEU D . n 
D 1 19 LEU 19 41  41  LEU LEU D . n 
D 1 20 ALA 20 42  42  ALA ALA D . n 
D 1 21 GLY 21 43  43  GLY GLY D . n 
D 1 22 SER 22 44  44  SER SER D . n 
D 1 23 TYR 23 45  45  TYR TYR D . n 
D 1 24 LEU 24 46  46  LEU LEU D . n 
D 1 25 ALA 25 47  47  ALA ALA D . n 
D 1 26 VAL 26 48  48  VAL VAL D . n 
D 1 27 LEU 27 49  49  LEU LEU D . n 
D 1 28 ALA 28 50  50  ALA ALA D . n 
D 1 29 GLU 29 51  51  GLU GLU D . n 
D 1 30 ARG 30 52  52  ARG ARG D . n 
D 1 31 GLY 31 53  53  GLY GLY D . n 
D 1 32 ALA 32 54  54  ALA ALA D . n 
D 1 33 PRO 33 55  55  PRO PRO D . n 
D 1 34 GLY 34 56  56  GLY GLY D . n 
D 1 35 ALA 35 57  57  ALA ALA D . n 
D 1 36 GLN 36 58  58  GLN GLN D . n 
D 1 37 LEU 37 59  59  LEU LEU D . n 
D 1 38 ILE 38 60  60  ILE ILE D . n 
D 1 39 THR 39 61  61  THR THR D . n 
D 1 40 TYR 40 62  62  TYR TYR D . n 
D 1 41 PRO 41 63  63  PRO PRO D . n 
D 1 42 ARG 42 64  64  ARG ARG D . n 
D 1 43 ALA 43 65  65  ALA ALA D . n 
D 1 44 LEU 44 66  66  LEU LEU D . n 
D 1 45 TRP 45 67  67  TRP TRP D . n 
D 1 46 TRP 46 68  68  TRP TRP D . n 
D 1 47 SER 47 69  69  SER SER D . n 
D 1 48 VAL 48 70  70  VAL VAL D . n 
D 1 49 GLU 49 71  71  GLU GLU D . n 
D 1 50 THR 50 72  72  THR THR D . n 
D 1 51 ALA 51 73  73  ALA ALA D . n 
D 1 52 THR 52 74  74  THR THR D . n 
D 1 53 THR 53 75  75  THR THR D . n 
D 1 54 VAL 54 76  76  VAL VAL D . n 
D 1 55 GLY 55 77  77  GLY GLY D . n 
D 1 56 TYR 56 78  78  TYR TYR D . n 
D 1 57 GLY 57 79  79  GLY GLY D . n 
D 1 58 ASP 58 80  80  ASP ASP D . n 
D 1 59 LEU 59 81  81  LEU LEU D . n 
D 1 60 TYR 60 82  82  TYR TYR D . n 
D 1 61 PRO 61 83  83  PRO PRO D . n 
D 1 62 VAL 62 84  84  VAL VAL D . n 
D 1 63 THR 63 85  85  THR THR D . n 
D 1 64 LEU 64 86  86  LEU LEU D . n 
D 1 65 TRP 65 87  87  TRP TRP D . n 
D 1 66 GLY 66 88  88  GLY GLY D . n 
D 1 67 ARG 67 89  89  ARG ARG D . n 
D 1 68 CYS 68 90  90  CYS CYS D . n 
D 1 69 VAL 69 91  91  VAL VAL D . n 
D 1 70 ALA 70 92  92  ALA ALA D . n 
D 1 71 VAL 71 93  93  VAL VAL D . n 
D 1 72 VAL 72 94  94  VAL VAL D . n 
D 1 73 VAL 73 95  95  VAL VAL D . n 
D 1 74 MET 74 96  96  MET MET D . n 
D 1 75 VAL 75 97  97  VAL VAL D . n 
D 1 76 ALA 76 98  98  ALA ALA D . n 
D 1 77 GLY 77 99  99  GLY GLY D . n 
D 1 78 ILE 78 100 100 ILE ILE D . n 
D 1 79 THR 79 101 101 THR THR D . n 
D 1 80 SER 80 102 102 SER SER D . n 
D 1 81 PHE 81 103 103 PHE PHE D . n 
D 1 82 GLY 82 104 104 GLY GLY D . n 
D 1 83 LEU 83 105 105 LEU LEU D . n 
D 1 84 VAL 84 106 106 VAL VAL D . n 
D 1 85 THR 85 107 107 THR THR D . n 
D 1 86 ALA 86 108 108 ALA ALA D . n 
D 1 87 ALA 87 109 109 ALA ALA D . n 
D 1 88 LEU 88 110 110 LEU LEU D . n 
D 1 89 ALA 89 111 111 ALA ALA D . n 
D 1 90 THR 90 112 112 THR THR D . n 
D 1 91 TRP 91 113 113 TRP TRP D . n 
D 1 92 PHE 92 114 114 PHE PHE D . n 
D 1 93 VAL 93 115 115 VAL VAL D . n 
D 1 94 GLY 94 116 116 GLY GLY D . n 
D 1 95 ARG 95 117 117 ARG ARG D . n 
D 1 96 GLU 96 118 118 GLU GLU D . n 
D 1 97 GLN 97 119 119 GLN GLN D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 2 K   1 401 1 K   K   A . 
F 2 K   1 402 2 K   K   A . 
G 2 K   1 403 3 K   K   A . 
H 3 HOH 1 500 1 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA,PQS 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 7230  ? 
1 MORE         -75   ? 
1 'SSA (A^2)'  17310 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1   O   ? A THR 53 ? A THR 75  ? 1_555 K ? F K . ? A K 402 ? 1_555 O   ? A VAL 54 ? A VAL 76  ? 1_555 84.8  ? 
2   O   ? A THR 53 ? A THR 75  ? 1_555 K ? F K . ? A K 402 ? 1_555 K   ? G K   .  ? A K   403 ? 1_555 54.6  ? 
3   O   ? A VAL 54 ? A VAL 76  ? 1_555 K ? F K . ? A K 402 ? 1_555 K   ? G K   .  ? A K   403 ? 1_555 135.7 ? 
4   O   ? A THR 53 ? A THR 75  ? 1_555 K ? F K . ? A K 402 ? 1_555 O   ? B THR 53 ? B THR 75  ? 1_555 69.9  ? 
5   O   ? A VAL 54 ? A VAL 76  ? 1_555 K ? F K . ? A K 402 ? 1_555 O   ? B THR 53 ? B THR 75  ? 1_555 101.5 ? 
6   K   ? G K   .  ? A K   403 ? 1_555 K ? F K . ? A K 402 ? 1_555 O   ? B THR 53 ? B THR 75  ? 1_555 52.1  ? 
7   O   ? A THR 53 ? A THR 75  ? 1_555 K ? F K . ? A K 402 ? 1_555 O   ? B VAL 54 ? B VAL 76  ? 1_555 130.6 ? 
8   O   ? A VAL 54 ? A VAL 76  ? 1_555 K ? F K . ? A K 402 ? 1_555 O   ? B VAL 54 ? B VAL 76  ? 1_555 58.2  ? 
9   K   ? G K   .  ? A K   403 ? 1_555 K ? F K . ? A K 402 ? 1_555 O   ? B VAL 54 ? B VAL 76  ? 1_555 135.1 ? 
10  O   ? B THR 53 ? B THR 75  ? 1_555 K ? F K . ? A K 402 ? 1_555 O   ? B VAL 54 ? B VAL 76  ? 1_555 85.7  ? 
11  O   ? A THR 53 ? A THR 75  ? 1_555 K ? F K . ? A K 402 ? 1_555 O   ? C THR 53 ? C THR 75  ? 1_555 108.9 ? 
12  O   ? A VAL 54 ? A VAL 76  ? 1_555 K ? F K . ? A K 402 ? 1_555 O   ? C THR 53 ? C THR 75  ? 1_555 159.4 ? 
13  K   ? G K   .  ? A K   403 ? 1_555 K ? F K . ? A K 402 ? 1_555 O   ? C THR 53 ? C THR 75  ? 1_555 54.4  ? 
14  O   ? B THR 53 ? B THR 75  ? 1_555 K ? F K . ? A K 402 ? 1_555 O   ? C THR 53 ? C THR 75  ? 1_555 70.5  ? 
15  O   ? B VAL 54 ? B VAL 76  ? 1_555 K ? F K . ? A K 402 ? 1_555 O   ? C THR 53 ? C THR 75  ? 1_555 101.7 ? 
16  O   ? A THR 53 ? A THR 75  ? 1_555 K ? F K . ? A K 402 ? 1_555 O   ? C VAL 54 ? C VAL 76  ? 1_555 158.8 ? 
17  O   ? A VAL 54 ? A VAL 76  ? 1_555 K ? F K . ? A K 402 ? 1_555 O   ? C VAL 54 ? C VAL 76  ? 1_555 86.8  ? 
18  K   ? G K   .  ? A K   403 ? 1_555 K ? F K . ? A K 402 ? 1_555 O   ? C VAL 54 ? C VAL 76  ? 1_555 137.4 ? 
19  O   ? B THR 53 ? B THR 75  ? 1_555 K ? F K . ? A K 402 ? 1_555 O   ? C VAL 54 ? C VAL 76  ? 1_555 131.1 ? 
20  O   ? B VAL 54 ? B VAL 76  ? 1_555 K ? F K . ? A K 402 ? 1_555 O   ? C VAL 54 ? C VAL 76  ? 1_555 58.0  ? 
21  O   ? C THR 53 ? C THR 75  ? 1_555 K ? F K . ? A K 402 ? 1_555 O   ? C VAL 54 ? C VAL 76  ? 1_555 84.9  ? 
22  O   ? A THR 53 ? A THR 75  ? 1_555 K ? F K . ? A K 402 ? 1_555 O   ? D THR 53 ? D THR 75  ? 1_555 70.2  ? 
23  O   ? A VAL 54 ? A VAL 76  ? 1_555 K ? F K . ? A K 402 ? 1_555 O   ? D THR 53 ? D THR 75  ? 1_555 130.9 ? 
24  K   ? G K   .  ? A K   403 ? 1_555 K ? F K . ? A K 402 ? 1_555 O   ? D THR 53 ? D THR 75  ? 1_555 55.9  ? 
25  O   ? B THR 53 ? B THR 75  ? 1_555 K ? F K . ? A K 402 ? 1_555 O   ? D THR 53 ? D THR 75  ? 1_555 108.0 ? 
26  O   ? B VAL 54 ? B VAL 76  ? 1_555 K ? F K . ? A K 402 ? 1_555 O   ? D THR 53 ? D THR 75  ? 1_555 158.9 ? 
27  O   ? C THR 53 ? C THR 75  ? 1_555 K ? F K . ? A K 402 ? 1_555 O   ? D THR 53 ? D THR 75  ? 1_555 69.4  ? 
28  O   ? C VAL 54 ? C VAL 76  ? 1_555 K ? F K . ? A K 402 ? 1_555 O   ? D THR 53 ? D THR 75  ? 1_555 101.4 ? 
29  O   ? A THR 53 ? A THR 75  ? 1_555 K ? F K . ? A K 402 ? 1_555 O   ? D VAL 54 ? D VAL 76  ? 1_555 101.5 ? 
30  O   ? A VAL 54 ? A VAL 76  ? 1_555 K ? F K . ? A K 402 ? 1_555 O   ? D VAL 54 ? D VAL 76  ? 1_555 58.4  ? 
31  K   ? G K   .  ? A K   403 ? 1_555 K ? F K . ? A K 402 ? 1_555 O   ? D VAL 54 ? D VAL 76  ? 1_555 138.4 ? 
32  O   ? B THR 53 ? B THR 75  ? 1_555 K ? F K . ? A K 402 ? 1_555 O   ? D VAL 54 ? D VAL 76  ? 1_555 159.4 ? 
33  O   ? B VAL 54 ? B VAL 76  ? 1_555 K ? F K . ? A K 402 ? 1_555 O   ? D VAL 54 ? D VAL 76  ? 1_555 86.5  ? 
34  O   ? C THR 53 ? C THR 75  ? 1_555 K ? F K . ? A K 402 ? 1_555 O   ? D VAL 54 ? D VAL 76  ? 1_555 129.9 ? 
35  O   ? C VAL 54 ? C VAL 76  ? 1_555 K ? F K . ? A K 402 ? 1_555 O   ? D VAL 54 ? D VAL 76  ? 1_555 57.7  ? 
36  O   ? D THR 53 ? D THR 75  ? 1_555 K ? F K . ? A K 402 ? 1_555 O   ? D VAL 54 ? D VAL 76  ? 1_555 85.4  ? 
37  O   ? A THR 53 ? A THR 75  ? 1_555 K ? G K . ? A K 403 ? 1_555 OG1 ? A THR 53 ? A THR 75  ? 1_555 41.6  ? 
38  O   ? A THR 53 ? A THR 75  ? 1_555 K ? G K . ? A K 403 ? 1_555 O   ? B THR 53 ? B THR 75  ? 1_555 80.6  ? 
39  OG1 ? A THR 53 ? A THR 75  ? 1_555 K ? G K . ? A K 403 ? 1_555 O   ? B THR 53 ? B THR 75  ? 1_555 122.1 ? 
40  O   ? A THR 53 ? A THR 75  ? 1_555 K ? G K . ? A K 403 ? 1_555 OG1 ? B THR 53 ? B THR 75  ? 1_555 53.6  ? 
41  OG1 ? A THR 53 ? A THR 75  ? 1_555 K ? G K . ? A K 403 ? 1_555 OG1 ? B THR 53 ? B THR 75  ? 1_555 89.5  ? 
42  O   ? B THR 53 ? B THR 75  ? 1_555 K ? G K . ? A K 403 ? 1_555 OG1 ? B THR 53 ? B THR 75  ? 1_555 43.5  ? 
43  O   ? A THR 53 ? A THR 75  ? 1_555 K ? G K . ? A K 403 ? 1_555 O   ? C THR 53 ? C THR 75  ? 1_555 128.0 ? 
44  OG1 ? A THR 53 ? A THR 75  ? 1_555 K ? G K . ? A K 403 ? 1_555 O   ? C THR 53 ? C THR 75  ? 1_555 127.8 ? 
45  O   ? B THR 53 ? B THR 75  ? 1_555 K ? G K . ? A K 403 ? 1_555 O   ? C THR 53 ? C THR 75  ? 1_555 81.1  ? 
46  OG1 ? B THR 53 ? B THR 75  ? 1_555 K ? G K . ? A K 403 ? 1_555 O   ? C THR 53 ? C THR 75  ? 1_555 124.6 ? 
47  O   ? A THR 53 ? A THR 75  ? 1_555 K ? G K . ? A K 403 ? 1_555 OG1 ? C THR 53 ? C THR 75  ? 1_555 133.5 ? 
48  OG1 ? A THR 53 ? A THR 75  ? 1_555 K ? G K . ? A K 403 ? 1_555 OG1 ? C THR 53 ? C THR 75  ? 1_555 168.2 ? 
49  O   ? B THR 53 ? B THR 75  ? 1_555 K ? G K . ? A K 403 ? 1_555 OG1 ? C THR 53 ? C THR 75  ? 1_555 54.3  ? 
50  OG1 ? B THR 53 ? B THR 75  ? 1_555 K ? G K . ? A K 403 ? 1_555 OG1 ? C THR 53 ? C THR 75  ? 1_555 92.4  ? 
51  O   ? C THR 53 ? C THR 75  ? 1_555 K ? G K . ? A K 403 ? 1_555 OG1 ? C THR 53 ? C THR 75  ? 1_555 43.0  ? 
52  O   ? A THR 53 ? A THR 75  ? 1_555 K ? G K . ? A K 403 ? 1_555 O   ? D THR 53 ? D THR 75  ? 1_555 78.1  ? 
53  OG1 ? A THR 53 ? A THR 75  ? 1_555 K ? G K . ? A K 403 ? 1_555 O   ? D THR 53 ? D THR 75  ? 1_555 51.7  ? 
54  O   ? B THR 53 ? B THR 75  ? 1_555 K ? G K . ? A K 403 ? 1_555 O   ? D THR 53 ? D THR 75  ? 1_555 129.1 ? 
55  OG1 ? B THR 53 ? B THR 75  ? 1_555 K ? G K . ? A K 403 ? 1_555 O   ? D THR 53 ? D THR 75  ? 1_555 130.9 ? 
56  O   ? C THR 53 ? C THR 75  ? 1_555 K ? G K . ? A K 403 ? 1_555 O   ? D THR 53 ? D THR 75  ? 1_555 76.9  ? 
57  OG1 ? C THR 53 ? C THR 75  ? 1_555 K ? G K . ? A K 403 ? 1_555 O   ? D THR 53 ? D THR 75  ? 1_555 119.9 ? 
58  O   ? A THR 53 ? A THR 75  ? 1_555 K ? G K . ? A K 403 ? 1_555 OG1 ? D THR 53 ? D THR 75  ? 1_555 119.0 ? 
59  OG1 ? A THR 53 ? A THR 75  ? 1_555 K ? G K . ? A K 403 ? 1_555 OG1 ? D THR 53 ? D THR 75  ? 1_555 87.1  ? 
60  O   ? B THR 53 ? B THR 75  ? 1_555 K ? G K . ? A K 403 ? 1_555 OG1 ? D THR 53 ? D THR 75  ? 1_555 132.1 ? 
61  OG1 ? B THR 53 ? B THR 75  ? 1_555 K ? G K . ? A K 403 ? 1_555 OG1 ? D THR 53 ? D THR 75  ? 1_555 169.4 ? 
62  O   ? C THR 53 ? C THR 75  ? 1_555 K ? G K . ? A K 403 ? 1_555 OG1 ? D THR 53 ? D THR 75  ? 1_555 51.9  ? 
63  OG1 ? C THR 53 ? C THR 75  ? 1_555 K ? G K . ? A K 403 ? 1_555 OG1 ? D THR 53 ? D THR 75  ? 1_555 89.0  ? 
64  O   ? D THR 53 ? D THR 75  ? 1_555 K ? G K . ? A K 403 ? 1_555 OG1 ? D THR 53 ? D THR 75  ? 1_555 41.0  ? 
65  O   ? A GLY 55 ? A GLY 77  ? 1_555 K ? E K . ? A K 401 ? 1_555 O   ? A TYR 56 ? A TYR 78  ? 1_555 66.7  ? 
66  O   ? A GLY 55 ? A GLY 77  ? 1_555 K ? E K . ? A K 401 ? 1_555 O   ? B GLY 55 ? B GLY 77  ? 1_555 59.2  ? 
67  O   ? A TYR 56 ? A TYR 78  ? 1_555 K ? E K . ? A K 401 ? 1_555 O   ? B GLY 55 ? B GLY 77  ? 1_555 86.0  ? 
68  O   ? A GLY 55 ? A GLY 77  ? 1_555 K ? E K . ? A K 401 ? 1_555 O   ? B TYR 56 ? B TYR 78  ? 1_555 120.1 ? 
69  O   ? A TYR 56 ? A TYR 78  ? 1_555 K ? E K . ? A K 401 ? 1_555 O   ? B TYR 56 ? B TYR 78  ? 1_555 86.0  ? 
70  O   ? B GLY 55 ? B GLY 77  ? 1_555 K ? E K . ? A K 401 ? 1_555 O   ? B TYR 56 ? B TYR 78  ? 1_555 67.0  ? 
71  O   ? A GLY 55 ? A GLY 77  ? 1_555 K ? E K . ? A K 401 ? 1_555 O   ? H HOH .  ? B HOH 500 ? 1_555 43.9  ? 
72  O   ? A TYR 56 ? A TYR 78  ? 1_555 K ? E K . ? A K 401 ? 1_555 O   ? H HOH .  ? B HOH 500 ? 1_555 105.7 ? 
73  O   ? B GLY 55 ? B GLY 77  ? 1_555 K ? E K . ? A K 401 ? 1_555 O   ? H HOH .  ? B HOH 500 ? 1_555 42.1  ? 
74  O   ? B TYR 56 ? B TYR 78  ? 1_555 K ? E K . ? A K 401 ? 1_555 O   ? H HOH .  ? B HOH 500 ? 1_555 105.4 ? 
75  O   ? A GLY 55 ? A GLY 77  ? 1_555 K ? E K . ? A K 401 ? 1_555 O   ? C GLY 55 ? C GLY 77  ? 1_555 90.0  ? 
76  O   ? A TYR 56 ? A TYR 78  ? 1_555 K ? E K . ? A K 401 ? 1_555 O   ? C GLY 55 ? C GLY 77  ? 1_555 145.8 ? 
77  O   ? B GLY 55 ? B GLY 77  ? 1_555 K ? E K . ? A K 401 ? 1_555 O   ? C GLY 55 ? C GLY 77  ? 1_555 60.1  ? 
78  O   ? B TYR 56 ? B TYR 78  ? 1_555 K ? E K . ? A K 401 ? 1_555 O   ? C GLY 55 ? C GLY 77  ? 1_555 84.9  ? 
79  O   ? H HOH .  ? B HOH 500 ? 1_555 K ? E K . ? A K 401 ? 1_555 O   ? C GLY 55 ? C GLY 77  ? 1_555 46.2  ? 
80  O   ? A GLY 55 ? A GLY 77  ? 1_555 K ? E K . ? A K 401 ? 1_555 O   ? C TYR 56 ? C TYR 78  ? 1_555 144.2 ? 
81  O   ? A TYR 56 ? A TYR 78  ? 1_555 K ? E K . ? A K 401 ? 1_555 O   ? C TYR 56 ? C TYR 78  ? 1_555 146.3 ? 
82  O   ? B GLY 55 ? B GLY 77  ? 1_555 K ? E K . ? A K 401 ? 1_555 O   ? C TYR 56 ? C TYR 78  ? 1_555 119.3 ? 
83  O   ? B TYR 56 ? B TYR 78  ? 1_555 K ? E K . ? A K 401 ? 1_555 O   ? C TYR 56 ? C TYR 78  ? 1_555 84.5  ? 
84  O   ? H HOH .  ? B HOH 500 ? 1_555 K ? E K . ? A K 401 ? 1_555 O   ? C TYR 56 ? C TYR 78  ? 1_555 108.0 ? 
85  O   ? C GLY 55 ? C GLY 77  ? 1_555 K ? E K . ? A K 401 ? 1_555 O   ? C TYR 56 ? C TYR 78  ? 1_555 65.1  ? 
86  O   ? A GLY 55 ? A GLY 77  ? 1_555 K ? E K . ? A K 401 ? 1_555 O   ? D GLY 55 ? D GLY 77  ? 1_555 59.5  ? 
87  O   ? A TYR 56 ? A TYR 78  ? 1_555 K ? E K . ? A K 401 ? 1_555 O   ? D GLY 55 ? D GLY 77  ? 1_555 120.1 ? 
88  O   ? B GLY 55 ? B GLY 77  ? 1_555 K ? E K . ? A K 401 ? 1_555 O   ? D GLY 55 ? D GLY 77  ? 1_555 88.1  ? 
89  O   ? B TYR 56 ? B TYR 78  ? 1_555 K ? E K . ? A K 401 ? 1_555 O   ? D GLY 55 ? D GLY 77  ? 1_555 143.4 ? 
90  O   ? H HOH .  ? B HOH 500 ? 1_555 K ? E K . ? A K 401 ? 1_555 O   ? D GLY 55 ? D GLY 77  ? 1_555 46.0  ? 
91  O   ? C GLY 55 ? C GLY 77  ? 1_555 K ? E K . ? A K 401 ? 1_555 O   ? D GLY 55 ? D GLY 77  ? 1_555 59.0  ? 
92  O   ? C TYR 56 ? C TYR 78  ? 1_555 K ? E K . ? A K 401 ? 1_555 O   ? D GLY 55 ? D GLY 77  ? 1_555 85.1  ? 
93  O   ? A GLY 55 ? A GLY 77  ? 1_555 K ? E K . ? A K 401 ? 1_555 O   ? D TYR 56 ? D TYR 78  ? 1_555 85.8  ? 
94  O   ? A TYR 56 ? A TYR 78  ? 1_555 K ? E K . ? A K 401 ? 1_555 O   ? D TYR 56 ? D TYR 78  ? 1_555 85.8  ? 
95  O   ? B GLY 55 ? B GLY 77  ? 1_555 K ? E K . ? A K 401 ? 1_555 O   ? D TYR 56 ? D TYR 78  ? 1_555 144.4 ? 
96  O   ? B TYR 56 ? B TYR 78  ? 1_555 K ? E K . ? A K 401 ? 1_555 O   ? D TYR 56 ? D TYR 78  ? 1_555 146.5 ? 
97  O   ? H HOH .  ? B HOH 500 ? 1_555 K ? E K . ? A K 401 ? 1_555 O   ? D TYR 56 ? D TYR 78  ? 1_555 108.1 ? 
98  O   ? C GLY 55 ? C GLY 77  ? 1_555 K ? E K . ? A K 401 ? 1_555 O   ? D TYR 56 ? D TYR 78  ? 1_555 118.4 ? 
99  O   ? C TYR 56 ? C TYR 78  ? 1_555 K ? E K . ? A K 401 ? 1_555 O   ? D TYR 56 ? D TYR 78  ? 1_555 84.5  ? 
100 O   ? D GLY 55 ? D GLY 77  ? 1_555 K ? E K . ? A K 401 ? 1_555 O   ? D TYR 56 ? D TYR 78  ? 1_555 66.5  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1998-07-29 
2 'Structure model' 1 1 2007-10-16 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-04 
5 'Structure model' 1 4 2021-11-03 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Refinement description'    
5 5 'Structure model' 'Database references'       
6 5 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' software               
2 5 'Structure model' database_2             
3 5 'Structure model' pdbx_struct_conn_angle 
4 5 'Structure model' struct_conn            
5 5 'Structure model' struct_ref_seq_dif     
6 5 'Structure model' struct_site            
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_software.name'                              
2  5 'Structure model' '_database_2.pdbx_DOI'                        
3  5 'Structure model' '_database_2.pdbx_database_accession'         
4  5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_asym_id'  
5  5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id'  
6  5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'   
7  5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 
8  5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 
9  5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 
10 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id'  
11 5 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id'   
12 5 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 
13 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_asym_id'  
14 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id'  
15 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'   
16 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 
17 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 
18 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 
19 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id'  
20 5 'Structure model' '_pdbx_struct_conn_angle.value'               
21 5 'Structure model' '_struct_conn.pdbx_dist_value'                
22 5 'Structure model' '_struct_conn.ptnr1_auth_asym_id'             
23 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id'             
24 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
25 5 'Structure model' '_struct_conn.ptnr1_label_asym_id'            
26 5 'Structure model' '_struct_conn.ptnr1_label_atom_id'            
27 5 'Structure model' '_struct_conn.ptnr1_label_comp_id'            
28 5 'Structure model' '_struct_conn.ptnr1_label_seq_id'             
29 5 'Structure model' '_struct_conn.ptnr2_auth_asym_id'             
30 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id'             
31 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
32 5 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
33 5 'Structure model' '_struct_conn.ptnr2_label_atom_id'            
34 5 'Structure model' '_struct_conn.ptnr2_label_comp_id'            
35 5 'Structure model' '_struct_conn.ptnr2_label_seq_id'             
36 5 'Structure model' '_struct_ref_seq_dif.details'                 
37 5 'Structure model' '_struct_site.pdbx_auth_asym_id'              
38 5 'Structure model' '_struct_site.pdbx_auth_comp_id'              
39 5 'Structure model' '_struct_site.pdbx_auth_seq_id'               
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' .               ? 1 
SCALEPACK 'data scaling'   .               ? 2 
CCP4      'model building' 'PROGRAM SUITE' ? 3 
SHELXL-97 'model building' .               ? 4 
X-PLOR    refinement       3.851           ? 5 
CCP4      phasing          .               ? 6 
SHELXL-97 phasing          .               ? 7 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LEU A 24  ? ? -166.69 -71.94  
2  1 ALA A 29  ? ? -91.37  -67.66  
3  1 VAL A 34  ? ? -59.43  -5.50   
4  1 LEU A 40  ? ? -51.31  -79.32  
5  1 TYR A 45  ? ? -78.78  33.65   
6  1 LEU A 46  ? ? -139.23 -35.99  
7  1 LEU A 49  ? ? -59.89  8.38    
8  1 ARG A 52  ? ? -29.31  -40.86  
9  1 ALA A 54  ? ? 178.78  168.60  
10 1 PRO A 55  ? ? -56.95  9.51    
11 1 ALA A 57  ? ? -58.34  -171.69 
12 1 GLN A 58  ? ? -57.32  3.64    
13 1 LEU A 59  ? ? -70.63  40.33   
14 1 LEU A 66  ? ? -49.04  -70.28  
15 1 THR A 75  ? ? 53.34   74.28   
16 1 ARG A 117 ? ? -144.35 51.30   
17 1 LEU B 24  ? ? -166.60 -71.99  
18 1 ALA B 29  ? ? -91.16  -67.63  
19 1 VAL B 34  ? ? -59.43  -5.48   
20 1 LEU B 40  ? ? -51.48  -79.15  
21 1 TYR B 45  ? ? -78.80  33.67   
22 1 LEU B 46  ? ? -139.12 -36.21  
23 1 LEU B 49  ? ? -60.33  8.44    
24 1 ARG B 52  ? ? -29.29  -40.95  
25 1 ALA B 54  ? ? 178.96  168.72  
26 1 PRO B 55  ? ? -57.09  9.39    
27 1 ALA B 57  ? ? -58.04  -171.88 
28 1 GLN B 58  ? ? -57.26  3.73    
29 1 LEU B 59  ? ? -70.72  40.50   
30 1 LEU B 66  ? ? -49.23  -70.09  
31 1 THR B 75  ? ? 53.17   74.38   
32 1 ARG B 117 ? ? -144.54 51.36   
33 1 LEU C 24  ? ? -166.70 -72.08  
34 1 ALA C 29  ? ? -91.13  -67.64  
35 1 VAL C 34  ? ? -59.52  -5.31   
36 1 LEU C 40  ? ? -51.22  -79.01  
37 1 TYR C 45  ? ? -78.88  33.68   
38 1 LEU C 46  ? ? -139.28 -35.93  
39 1 LEU C 49  ? ? -59.86  8.35    
40 1 ARG C 52  ? ? -29.19  -40.88  
41 1 ALA C 54  ? ? 178.79  168.57  
42 1 PRO C 55  ? ? -56.84  9.25    
43 1 ALA C 57  ? ? -58.31  -171.63 
44 1 GLN C 58  ? ? -57.37  3.52    
45 1 LEU C 59  ? ? -70.49  40.37   
46 1 THR C 75  ? ? 53.97   74.42   
47 1 ARG C 117 ? ? -144.56 51.47   
48 1 LEU D 24  ? ? -166.62 -71.92  
49 1 ALA D 29  ? ? -91.21  -67.51  
50 1 VAL D 34  ? ? -59.65  -5.28   
51 1 LEU D 40  ? ? -51.38  -79.44  
52 1 TYR D 45  ? ? -78.86  33.56   
53 1 LEU D 46  ? ? -139.08 -36.19  
54 1 LEU D 49  ? ? -60.10  8.32    
55 1 ARG D 52  ? ? -29.39  -40.86  
56 1 ALA D 54  ? ? 178.60  168.81  
57 1 PRO D 55  ? ? -57.04  9.18    
58 1 ALA D 57  ? ? -58.06  -171.66 
59 1 GLN D 58  ? ? -57.44  3.58    
60 1 LEU D 59  ? ? -70.53  40.58   
61 1 LEU D 66  ? ? -49.23  -70.38  
62 1 THR D 75  ? ? 53.25   74.29   
63 1 ARG D 117 ? ? -144.69 51.49   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ARG 27  ? CG  ? A ARG 5  CG  
2  1 Y 1 A ARG 27  ? CD  ? A ARG 5  CD  
3  1 Y 1 A ARG 27  ? NE  ? A ARG 5  NE  
4  1 Y 1 A ARG 27  ? CZ  ? A ARG 5  CZ  
5  1 Y 1 A ARG 27  ? NH1 ? A ARG 5  NH1 
6  1 Y 1 A ARG 27  ? NH2 ? A ARG 5  NH2 
7  1 Y 1 A ILE 60  ? CD1 ? A ILE 38 CD1 
8  1 Y 1 A ARG 64  ? CG  ? A ARG 42 CG  
9  1 Y 1 A ARG 64  ? CD  ? A ARG 42 CD  
10 1 Y 1 A ARG 64  ? NE  ? A ARG 42 NE  
11 1 Y 1 A ARG 64  ? CZ  ? A ARG 42 CZ  
12 1 Y 1 A ARG 64  ? NH1 ? A ARG 42 NH1 
13 1 Y 1 A ARG 64  ? NH2 ? A ARG 42 NH2 
14 1 Y 1 A GLU 71  ? CG  ? A GLU 49 CG  
15 1 Y 1 A GLU 71  ? CD  ? A GLU 49 CD  
16 1 Y 1 A GLU 71  ? OE1 ? A GLU 49 OE1 
17 1 Y 1 A GLU 71  ? OE2 ? A GLU 49 OE2 
18 1 Y 1 A ARG 117 ? CZ  ? A ARG 95 CZ  
19 1 Y 1 A ARG 117 ? NH1 ? A ARG 95 NH1 
20 1 Y 1 A ARG 117 ? NH2 ? A ARG 95 NH2 
21 1 Y 1 B ARG 27  ? CG  ? B ARG 5  CG  
22 1 Y 1 B ARG 27  ? CD  ? B ARG 5  CD  
23 1 Y 1 B ARG 27  ? NE  ? B ARG 5  NE  
24 1 Y 1 B ARG 27  ? CZ  ? B ARG 5  CZ  
25 1 Y 1 B ARG 27  ? NH1 ? B ARG 5  NH1 
26 1 Y 1 B ARG 27  ? NH2 ? B ARG 5  NH2 
27 1 Y 1 B ILE 60  ? CD1 ? B ILE 38 CD1 
28 1 Y 1 B ARG 64  ? CG  ? B ARG 42 CG  
29 1 Y 1 B ARG 64  ? CD  ? B ARG 42 CD  
30 1 Y 1 B ARG 64  ? NE  ? B ARG 42 NE  
31 1 Y 1 B ARG 64  ? CZ  ? B ARG 42 CZ  
32 1 Y 1 B ARG 64  ? NH1 ? B ARG 42 NH1 
33 1 Y 1 B ARG 64  ? NH2 ? B ARG 42 NH2 
34 1 Y 1 B GLU 71  ? CG  ? B GLU 49 CG  
35 1 Y 1 B GLU 71  ? CD  ? B GLU 49 CD  
36 1 Y 1 B GLU 71  ? OE1 ? B GLU 49 OE1 
37 1 Y 1 B GLU 71  ? OE2 ? B GLU 49 OE2 
38 1 Y 1 B ARG 117 ? CZ  ? B ARG 95 CZ  
39 1 Y 1 B ARG 117 ? NH1 ? B ARG 95 NH1 
40 1 Y 1 B ARG 117 ? NH2 ? B ARG 95 NH2 
41 1 Y 1 C ARG 27  ? CG  ? C ARG 5  CG  
42 1 Y 1 C ARG 27  ? CD  ? C ARG 5  CD  
43 1 Y 1 C ARG 27  ? NE  ? C ARG 5  NE  
44 1 Y 1 C ARG 27  ? CZ  ? C ARG 5  CZ  
45 1 Y 1 C ARG 27  ? NH1 ? C ARG 5  NH1 
46 1 Y 1 C ARG 27  ? NH2 ? C ARG 5  NH2 
47 1 Y 1 C ILE 60  ? CD1 ? C ILE 38 CD1 
48 1 Y 1 C ARG 64  ? CG  ? C ARG 42 CG  
49 1 Y 1 C ARG 64  ? CD  ? C ARG 42 CD  
50 1 Y 1 C ARG 64  ? NE  ? C ARG 42 NE  
51 1 Y 1 C ARG 64  ? CZ  ? C ARG 42 CZ  
52 1 Y 1 C ARG 64  ? NH1 ? C ARG 42 NH1 
53 1 Y 1 C ARG 64  ? NH2 ? C ARG 42 NH2 
54 1 Y 1 C GLU 71  ? CG  ? C GLU 49 CG  
55 1 Y 1 C GLU 71  ? CD  ? C GLU 49 CD  
56 1 Y 1 C GLU 71  ? OE1 ? C GLU 49 OE1 
57 1 Y 1 C GLU 71  ? OE2 ? C GLU 49 OE2 
58 1 Y 1 C ARG 117 ? CZ  ? C ARG 95 CZ  
59 1 Y 1 C ARG 117 ? NH1 ? C ARG 95 NH1 
60 1 Y 1 C ARG 117 ? NH2 ? C ARG 95 NH2 
61 1 Y 1 D ARG 27  ? CG  ? D ARG 5  CG  
62 1 Y 1 D ARG 27  ? CD  ? D ARG 5  CD  
63 1 Y 1 D ARG 27  ? NE  ? D ARG 5  NE  
64 1 Y 1 D ARG 27  ? CZ  ? D ARG 5  CZ  
65 1 Y 1 D ARG 27  ? NH1 ? D ARG 5  NH1 
66 1 Y 1 D ARG 27  ? NH2 ? D ARG 5  NH2 
67 1 Y 1 D ILE 60  ? CD1 ? D ILE 38 CD1 
68 1 Y 1 D ARG 64  ? CG  ? D ARG 42 CG  
69 1 Y 1 D ARG 64  ? CD  ? D ARG 42 CD  
70 1 Y 1 D ARG 64  ? NE  ? D ARG 42 NE  
71 1 Y 1 D ARG 64  ? CZ  ? D ARG 42 CZ  
72 1 Y 1 D ARG 64  ? NH1 ? D ARG 42 NH1 
73 1 Y 1 D ARG 64  ? NH2 ? D ARG 42 NH2 
74 1 Y 1 D GLU 71  ? CG  ? D GLU 49 CG  
75 1 Y 1 D GLU 71  ? CD  ? D GLU 49 CD  
76 1 Y 1 D GLU 71  ? OE1 ? D GLU 49 OE1 
77 1 Y 1 D GLU 71  ? OE2 ? D GLU 49 OE2 
78 1 Y 1 D ARG 117 ? CZ  ? D ARG 95 CZ  
79 1 Y 1 D ARG 117 ? NH1 ? D ARG 95 NH1 
80 1 Y 1 D ARG 117 ? NH2 ? D ARG 95 NH2 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'POTASSIUM ION' K   
3 water           HOH 
# 



If you find results from this site helpful for your research, please cite one of our papers:

elNémo is maintained by Yves-Henri Sanejouand.
It was developed by Karsten Suhre.
Between 2003 and 2014, it was hosted by IGS (Marseille).
Last modification: October 18th, 2018.