CNRS Nantes University UFIP UFIP
home |  start a new run |  job status |  references&downloads |  examples |  help  

Should you encounter any unexpected behaviour,
please let us know.


***    ***

elNémo ID: 2111101136547946

Job options:

ID        	=	 2111101136547946
JOBID     	=	 
USERID    	=	 unknown
PRIVAT    	=	 0

NMODES    	=	 5
DQMIN     	=	 -100
DQMAX     	=	 100
DQSTEP    	=	 20
DOGRAPHS  	=	 on

DOPROJMODS	=	 0
DORMSD    	=	 0

NRBL      	=	 0
CUTOFF    	=	 0
CAONLY    	=	 0


Input data for this run:


data_1AV1
# 
_entry.id   1AV1 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.292 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1AV1         
WWPDB D_1000171292 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1AV1 
_pdbx_database_status.recvd_initial_deposition_date   1997-09-23 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Borhani, D.W.'     1 
'Rogers, D.P.'      2 
'Engler, J.A.'      3 
'Brouillette, C.G.' 4 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Crystal structure of truncated human apolipoprotein A-I suggests a lipid-bound conformation.' Proc.Natl.Acad.Sci.USA 94   
12291 12296 1997 PNASA6 US 0027-8424 0040 ? 9356442 10.1073/pnas.94.23.12291 
1       
;Structural Analysis of Apolipoprotein A-I: Limited Proteolysis of Methionine-Reduced and-Oxidized Lipid-Free and Lipid-Bound Human Apo A-I
;
Biochemistry           36   7615  ?     1997 BICHAW US 0006-2960 0033 ? ?       ?                        
2       'Truncation of the Amino Terminus of Human Apolipoprotein A-I Substantially Alters Only the Lipid-Free Conformation' 
Biochemistry           36   288   ?     1997 BICHAW US 0006-2960 0033 ? ?       ?                        
3       'Structural Models of Human Apolipoprotein A-I' Biochim.Biophys.Acta   1256 103   ?     1995 BBACAQ NE 0006-3002 0113 ? ? 
?                        
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Borhani, D.W.'        1  
primary 'Rogers, D.P.'         2  
primary 'Engler, J.A.'         3  
primary 'Brouillette, C.G.'    4  
1       'Roberts, L.M.'        5  
1       'Ray, M.J.'            6  
1       'Shih, T.W.'           7  
1       'Hayden, E.'           8  
1       'Reader, M.M.'         9  
1       'Brouillette, C.G.'    10 
2       'Rogers, D.P.'         11 
2       'Brouillette, C.G.'    12 
2       'Engler, J.A.'         13 
2       'Tendian, S.W.'        14 
2       'Roberts, L.'          15 
2       'Mishra, V.K.'         16 
2       'Anantharamaiah, G.M.' 17 
2       'Lund-Katz, S.'        18 
2       'Phillips, M.C.'       19 
2       'Ray, M.J.'            20 
3       'Brouillette, C.G.'    21 
3       'Anantharamaiah, G.M.' 22 
# 
_cell.entry_id           1AV1 
_cell.length_a           97.470 
_cell.length_b           113.870 
_cell.length_c           196.190 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1AV1 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'APOLIPOPROTEIN A-I' 
_entity.formula_weight             23440.559 
_entity.pdbx_number_of_molecules   4 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              'N-TERMINAL MET, DEL(1-43)' 
_entity.pdbx_fragment              'LIPID-BINDING DOMAIN' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'APO A-I' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPL
RAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLST
LSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPL
RAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLST
LSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LEU n 
1 3   LYS n 
1 4   LEU n 
1 5   LEU n 
1 6   ASP n 
1 7   ASN n 
1 8   TRP n 
1 9   ASP n 
1 10  SER n 
1 11  VAL n 
1 12  THR n 
1 13  SER n 
1 14  THR n 
1 15  PHE n 
1 16  SER n 
1 17  LYS n 
1 18  LEU n 
1 19  ARG n 
1 20  GLU n 
1 21  GLN n 
1 22  LEU n 
1 23  GLY n 
1 24  PRO n 
1 25  VAL n 
1 26  THR n 
1 27  GLN n 
1 28  GLU n 
1 29  PHE n 
1 30  TRP n 
1 31  ASP n 
1 32  ASN n 
1 33  LEU n 
1 34  GLU n 
1 35  LYS n 
1 36  GLU n 
1 37  THR n 
1 38  GLU n 
1 39  GLY n 
1 40  LEU n 
1 41  ARG n 
1 42  GLN n 
1 43  GLU n 
1 44  MET n 
1 45  SER n 
1 46  LYS n 
1 47  ASP n 
1 48  LEU n 
1 49  GLU n 
1 50  GLU n 
1 51  VAL n 
1 52  LYS n 
1 53  ALA n 
1 54  LYS n 
1 55  VAL n 
1 56  GLN n 
1 57  PRO n 
1 58  TYR n 
1 59  LEU n 
1 60  ASP n 
1 61  ASP n 
1 62  PHE n 
1 63  GLN n 
1 64  LYS n 
1 65  LYS n 
1 66  TRP n 
1 67  GLN n 
1 68  GLU n 
1 69  GLU n 
1 70  MET n 
1 71  GLU n 
1 72  LEU n 
1 73  TYR n 
1 74  ARG n 
1 75  GLN n 
1 76  LYS n 
1 77  VAL n 
1 78  GLU n 
1 79  PRO n 
1 80  LEU n 
1 81  ARG n 
1 82  ALA n 
1 83  GLU n 
1 84  LEU n 
1 85  GLN n 
1 86  GLU n 
1 87  GLY n 
1 88  ALA n 
1 89  ARG n 
1 90  GLN n 
1 91  LYS n 
1 92  LEU n 
1 93  HIS n 
1 94  GLU n 
1 95  LEU n 
1 96  GLN n 
1 97  GLU n 
1 98  LYS n 
1 99  LEU n 
1 100 SER n 
1 101 PRO n 
1 102 LEU n 
1 103 GLY n 
1 104 GLU n 
1 105 GLU n 
1 106 MET n 
1 107 ARG n 
1 108 ASP n 
1 109 ARG n 
1 110 ALA n 
1 111 ARG n 
1 112 ALA n 
1 113 HIS n 
1 114 VAL n 
1 115 ASP n 
1 116 ALA n 
1 117 LEU n 
1 118 ARG n 
1 119 THR n 
1 120 HIS n 
1 121 LEU n 
1 122 ALA n 
1 123 PRO n 
1 124 TYR n 
1 125 SER n 
1 126 ASP n 
1 127 GLU n 
1 128 LEU n 
1 129 ARG n 
1 130 GLN n 
1 131 ARG n 
1 132 LEU n 
1 133 ALA n 
1 134 ALA n 
1 135 ARG n 
1 136 LEU n 
1 137 GLU n 
1 138 ALA n 
1 139 LEU n 
1 140 LYS n 
1 141 GLU n 
1 142 ASN n 
1 143 GLY n 
1 144 GLY n 
1 145 ALA n 
1 146 ARG n 
1 147 LEU n 
1 148 ALA n 
1 149 GLU n 
1 150 TYR n 
1 151 HIS n 
1 152 ALA n 
1 153 LYS n 
1 154 ALA n 
1 155 THR n 
1 156 GLU n 
1 157 HIS n 
1 158 LEU n 
1 159 SER n 
1 160 THR n 
1 161 LEU n 
1 162 SER n 
1 163 GLU n 
1 164 LYS n 
1 165 ALA n 
1 166 LYS n 
1 167 PRO n 
1 168 ALA n 
1 169 LEU n 
1 170 GLU n 
1 171 ASP n 
1 172 LEU n 
1 173 ARG n 
1 174 GLN n 
1 175 GLY n 
1 176 LEU n 
1 177 LEU n 
1 178 PRO n 
1 179 VAL n 
1 180 LEU n 
1 181 GLU n 
1 182 SER n 
1 183 PHE n 
1 184 LYS n 
1 185 VAL n 
1 186 SER n 
1 187 PHE n 
1 188 LEU n 
1 189 SER n 
1 190 ALA n 
1 191 LEU n 
1 192 GLU n 
1 193 GLU n 
1 194 TYR n 
1 195 THR n 
1 196 LYS n 
1 197 LYS n 
1 198 LEU n 
1 199 ASN n 
1 200 THR n 
1 201 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    BLOOD 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            BL21 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 (DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               PGEMEX 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       BL21 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    APOA1_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P02647 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTST
FSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHE
LQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQ
GLLPVLESFKVSFLSALEEYTKKLNTQ
;
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1AV1 A 2 ? 201 ? P02647 68 ? 267 ? 44 243 
2 1 1AV1 B 2 ? 201 ? P02647 68 ? 267 ? 44 243 
3 1 1AV1 C 2 ? 201 ? P02647 68 ? 267 ? 44 243 
4 1 1AV1 D 2 ? 201 ? P02647 68 ? 267 ? 44 243 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1AV1 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   2 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      5.83 
_exptl_crystal.density_percent_sol   72. 
_exptl_crystal.description           
;DATA WERE EXCLUDED ON A RESOLUTION-DEPENDENT BASIS FOR ALL RESOLUTION SHELLS IN WHICH THE  FOR FULLY-RECORDED REFLECTIONS IN THAT SHELL WAS LESS THAN 2.5.
;
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;PROTEIN WAS CRYSTALLIZED FROM 1.2 M NA CITRATE, 100 MM HEPES, PH 7.5 AT 4 DEGREES CELSIUS. CRYSTALS WERE STABILIZED IN 1.4 M NA CITRATE, 100 MM HEPES, PH 7.5., temperature 277K
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           283 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1996-01-24 
_diffrn_detector.details                'DUAL SLITS' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'GRAPHITE(002)' 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        MACSCIENCE 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1AV1 
_reflns.observed_criterion_sigma_I   0. 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30.0 
_reflns.d_resolution_high            4.0 
_reflns.number_obs                   16089 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         85. 
_reflns.pdbx_Rmerge_I_obs            0.1660000 
_reflns.pdbx_Rsym_value              0.1660000 
_reflns.pdbx_netI_over_sigmaI        3.7 
_reflns.B_iso_Wilson_estimate        70.0 
_reflns.pdbx_redundancy              3.6 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             4.0 
_reflns_shell.d_res_low              4.22 
_reflns_shell.percent_possible_all   50. 
_reflns_shell.Rmerge_I_obs           0.7320000 
_reflns_shell.pdbx_Rsym_value        0.7320000 
_reflns_shell.meanI_over_sigI_obs    0.9 
_reflns_shell.pdbx_redundancy        1.3 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1AV1 
_refine.ls_number_reflns_obs                     15543 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               10000000.00 
_refine.pdbx_data_cutoff_low_absF                0.001 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             27.0 
_refine.ls_d_res_high                            4.0 
_refine.ls_percent_reflns_obs                    81.8 
_refine.ls_R_factor_obs                          0.3820000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.3820000 
_refine.ls_R_factor_R_free                       0.4280000 
_refine.ls_R_factor_R_free_error                 0.015 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  785 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            119.984 
_refine.aniso_B[2][2]                            138.351 
_refine.aniso_B[3][3]                            128.014 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
'DATA USED IN REFINEMENT WERE SHARPENED BY APPLICATION OF AN ARTIFICIAL TEMPERATURE FACTOR (-70. A**2).' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MIRAS 
_refine.pdbx_isotropic_thermal_model             '24 (GROUPED) THERMAL FACT' 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3294 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               3294 
_refine_hist.d_res_high                       4.0 
_refine_hist.d_res_low                        27.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.010 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.66  ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      18.9  ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      1.43  ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_restr_ncs.dom_id              1 
_refine_ls_restr_ncs.ncs_model_details   CONSTRAINTS 
_refine_ls_restr_ncs.rms_dev_position    ? 
_refine_ls_restr_ncs.weight_position     ? 
_refine_ls_restr_ncs.rms_dev_B_iso       ? 
_refine_ls_restr_ncs.weight_B_iso        ? 
_refine_ls_restr_ncs.pdbx_type           . 
_refine_ls_restr_ncs.pdbx_auth_asym_id   . 
_refine_ls_restr_ncs.pdbx_ens_id         1 
_refine_ls_restr_ncs.pdbx_refine_id      'X-RAY DIFFRACTION' 
_refine_ls_restr_ncs.pdbx_ordinal        1 
_refine_ls_restr_ncs.pdbx_number         ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   8 
_refine_ls_shell.d_res_high                       4.00 
_refine_ls_shell.d_res_low                        4.18 
_refine_ls_shell.number_reflns_R_work             946 
_refine_ls_shell.R_factor_R_work                  0.4300000 
_refine_ls_shell.percent_reflns_obs               42.7 
_refine_ls_shell.R_factor_R_free                  0.4620000 
_refine_ls_shell.R_factor_R_free_error            0.064 
_refine_ls_shell.percent_reflns_R_free            5.0 
_refine_ls_shell.number_reflns_R_free             52 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PARHCSDX.PRO TOPH19.PEP 'X-RAY DIFFRACTION' 
2 ?            ?          'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_oper.id 
_struct_ncs_oper.code 
_struct_ncs_oper.details 
_struct_ncs_oper.matrix[1][1] 
_struct_ncs_oper.matrix[1][2] 
_struct_ncs_oper.matrix[1][3] 
_struct_ncs_oper.matrix[2][1] 
_struct_ncs_oper.matrix[2][2] 
_struct_ncs_oper.matrix[2][3] 
_struct_ncs_oper.matrix[3][1] 
_struct_ncs_oper.matrix[3][2] 
_struct_ncs_oper.matrix[3][3] 
_struct_ncs_oper.vector[1] 
_struct_ncs_oper.vector[2] 
_struct_ncs_oper.vector[3] 
1 given ? -0.231719 -0.855967 -0.462202 -0.856755 -0.045469 0.513715  -0.460739 0.515028  -0.722818 76.14400 41.28500  50.60500 
2 given ? 0.057013  0.997283  -0.046640 0.997171  -0.059174 -0.046348 -0.048982 -0.043865 -0.997836 17.83200 -16.34300 53.15900 
3 given ? -0.846149 -0.118168 0.519680  -0.159004 -0.874725 -0.457792 0.508674  -0.469991 0.721359  60.98600 54.79700  -2.87700 
# 
_struct_ncs_dom.id            1 
_struct_ncs_dom.pdbx_ens_id   1 
_struct_ncs_dom.details       ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  1AV1 
_struct.title                     'CRYSTAL STRUCTURE OF HUMAN APOLIPOPROTEIN A-I' 
_struct.pdbx_descriptor           'APOLIPOPROTEIN A-I' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1AV1 
_struct_keywords.pdbx_keywords   'LIPID TRANSPORT' 
_struct_keywords.text            'LIPOPROTEIN, LIPID TRANSPORT, CHOLESTEROL METABOLISM, ATHEROSCLEROSIS, HDL, LCAT-ACTIVATION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  TRP A 8   ? GLY A 23  ? TRP A 50  GLY A 65  1 ? 16 
HELX_P HELX_P2  2  PRO A 24  ? SER A 45  ? PRO A 66  SER A 87  1 ? 22 
HELX_P HELX_P3  3  LYS A 46  ? GLN A 56  ? LYS A 88  GLN A 98  1 ? 11 
HELX_P HELX_P4  4  PRO A 57  ? GLU A 78  ? PRO A 99  GLU A 120 1 ? 22 
HELX_P HELX_P5  5  PRO A 79  ? SER A 100 ? PRO A 121 SER A 142 1 ? 22 
HELX_P HELX_P6  6  PRO A 101 ? ALA A 122 ? PRO A 143 ALA A 164 1 ? 22 
HELX_P HELX_P7  7  PRO A 123 ? GLY A 144 ? PRO A 165 GLY A 186 1 ? 22 
HELX_P HELX_P8  8  ALA A 145 ? LYS A 166 ? ALA A 187 LYS A 208 1 ? 22 
HELX_P HELX_P9  9  PRO A 167 ? LEU A 177 ? PRO A 209 LEU A 219 1 ? 11 
HELX_P HELX_P10 10 SER A 186 ? GLN A 201 ? SER A 228 GLN A 243 1 ? 16 
HELX_P HELX_P11 11 TRP B 8   ? GLY B 23  ? TRP B 50  GLY B 65  1 ? 16 
HELX_P HELX_P12 12 PRO B 24  ? SER B 45  ? PRO B 66  SER B 87  1 ? 22 
HELX_P HELX_P13 13 LYS B 46  ? GLN B 56  ? LYS B 88  GLN B 98  1 ? 11 
HELX_P HELX_P14 14 PRO B 57  ? GLU B 78  ? PRO B 99  GLU B 120 1 ? 22 
HELX_P HELX_P15 15 PRO B 79  ? SER B 100 ? PRO B 121 SER B 142 1 ? 22 
HELX_P HELX_P16 16 PRO B 101 ? ALA B 122 ? PRO B 143 ALA B 164 1 ? 22 
HELX_P HELX_P17 17 PRO B 123 ? GLY B 144 ? PRO B 165 GLY B 186 1 ? 22 
HELX_P HELX_P18 18 ALA B 145 ? LYS B 166 ? ALA B 187 LYS B 208 1 ? 22 
HELX_P HELX_P19 19 PRO B 167 ? LEU B 177 ? PRO B 209 LEU B 219 1 ? 11 
HELX_P HELX_P20 20 SER B 186 ? GLN B 201 ? SER B 228 GLN B 243 1 ? 16 
HELX_P HELX_P21 21 TRP C 8   ? GLY C 23  ? TRP C 50  GLY C 65  1 ? 16 
HELX_P HELX_P22 22 PRO C 24  ? SER C 45  ? PRO C 66  SER C 87  1 ? 22 
HELX_P HELX_P23 23 LYS C 46  ? GLN C 56  ? LYS C 88  GLN C 98  1 ? 11 
HELX_P HELX_P24 24 PRO C 57  ? GLU C 78  ? PRO C 99  GLU C 120 1 ? 22 
HELX_P HELX_P25 25 PRO C 79  ? SER C 100 ? PRO C 121 SER C 142 1 ? 22 
HELX_P HELX_P26 26 PRO C 101 ? ALA C 122 ? PRO C 143 ALA C 164 1 ? 22 
HELX_P HELX_P27 27 PRO C 123 ? GLY C 144 ? PRO C 165 GLY C 186 1 ? 22 
HELX_P HELX_P28 28 ALA C 145 ? LYS C 166 ? ALA C 187 LYS C 208 1 ? 22 
HELX_P HELX_P29 29 PRO C 167 ? LEU C 177 ? PRO C 209 LEU C 219 1 ? 11 
HELX_P HELX_P30 30 SER C 186 ? GLN C 201 ? SER C 228 GLN C 243 1 ? 16 
HELX_P HELX_P31 31 TRP D 8   ? GLY D 23  ? TRP D 50  GLY D 65  1 ? 16 
HELX_P HELX_P32 32 PRO D 24  ? SER D 45  ? PRO D 66  SER D 87  1 ? 22 
HELX_P HELX_P33 33 LYS D 46  ? GLN D 56  ? LYS D 88  GLN D 98  1 ? 11 
HELX_P HELX_P34 34 PRO D 57  ? GLU D 78  ? PRO D 99  GLU D 120 1 ? 22 
HELX_P HELX_P35 35 PRO D 79  ? SER D 100 ? PRO D 121 SER D 142 1 ? 22 
HELX_P HELX_P36 36 PRO D 101 ? ALA D 122 ? PRO D 143 ALA D 164 1 ? 22 
HELX_P HELX_P37 37 PRO D 123 ? GLY D 144 ? PRO D 165 GLY D 186 1 ? 22 
HELX_P HELX_P38 38 ALA D 145 ? LYS D 166 ? ALA D 187 LYS D 208 1 ? 22 
HELX_P HELX_P39 39 PRO D 167 ? LEU D 177 ? PRO D 209 LEU D 219 1 ? 11 
HELX_P HELX_P40 40 SER D 186 ? GLN D 201 ? SER D 228 GLN D 243 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_database_PDB_matrix.entry_id          1AV1 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1AV1 
_atom_sites.fract_transf_matrix[1][1]   0.010260 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008782 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005097 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N   . MET A 1 1   ? 8.153   31.407  59.548  1.00 182.68 ? 43  MET A N   1 
ATOM 2    C CA  . MET A 1 1   ? 8.561   30.228  58.722  1.00 182.68 ? 43  MET A CA  1 
ATOM 3    C C   . MET A 1 1   ? 9.997   29.817  59.022  1.00 182.68 ? 43  MET A C   1 
ATOM 4    O O   . MET A 1 1   ? 10.910  30.123  58.254  1.00 182.68 ? 43  MET A O   1 
ATOM 5    C CB  . MET A 1 1   ? 8.435   30.557  57.229  1.00 182.68 ? 43  MET A CB  1 
ATOM 6    C CG  . MET A 1 1   ? 7.111   30.162  56.605  1.00 182.68 ? 43  MET A CG  1 
ATOM 7    S SD  . MET A 1 1   ? 6.779   28.394  56.836  1.00 182.68 ? 43  MET A SD  1 
ATOM 8    C CE  . MET A 1 1   ? 7.824   27.649  55.560  1.00 182.68 ? 43  MET A CE  1 
ATOM 9    N N   . LEU A 1 2   ? 10.187  29.092  60.119  1.00 182.68 ? 44  LEU A N   1 
ATOM 10   C CA  . LEU A 1 2   ? 11.515  28.652  60.526  1.00 182.68 ? 44  LEU A CA  1 
ATOM 11   C C   . LEU A 1 2   ? 12.314  27.929  59.481  1.00 182.68 ? 44  LEU A C   1 
ATOM 12   O O   . LEU A 1 2   ? 11.991  26.807  59.098  1.00 182.68 ? 44  LEU A O   1 
ATOM 13   C CB  . LEU A 1 2   ? 11.428  27.808  61.775  1.00 182.68 ? 44  LEU A CB  1 
ATOM 14   C CG  . LEU A 1 2   ? 11.367  28.820  62.893  1.00 182.68 ? 44  LEU A CG  1 
ATOM 15   C CD1 . LEU A 1 2   ? 10.820  28.175  64.124  1.00 182.68 ? 44  LEU A CD1 1 
ATOM 16   C CD2 . LEU A 1 2   ? 12.755  29.420  63.073  1.00 182.68 ? 44  LEU A CD2 1 
ATOM 17   N N   . LYS A 1 3   ? 13.373  28.586  59.032  1.00 182.68 ? 45  LYS A N   1 
ATOM 18   C CA  . LYS A 1 3   ? 14.231  28.005  58.028  1.00 182.68 ? 45  LYS A CA  1 
ATOM 19   C C   . LYS A 1 3   ? 15.241  27.110  58.705  1.00 182.68 ? 45  LYS A C   1 
ATOM 20   O O   . LYS A 1 3   ? 16.350  27.523  59.024  1.00 182.68 ? 45  LYS A O   1 
ATOM 21   C CB  . LYS A 1 3   ? 14.946  29.081  57.232  1.00 182.68 ? 45  LYS A CB  1 
ATOM 22   C CG  . LYS A 1 3   ? 15.582  28.515  55.988  1.00 182.68 ? 45  LYS A CG  1 
ATOM 23   C CD  . LYS A 1 3   ? 15.916  29.593  54.977  1.00 182.68 ? 45  LYS A CD  1 
ATOM 24   C CE  . LYS A 1 3   ? 16.385  28.983  53.659  1.00 182.68 ? 45  LYS A CE  1 
ATOM 25   N NZ  . LYS A 1 3   ? 16.530  29.992  52.564  1.00 182.68 ? 45  LYS A NZ  1 
ATOM 26   N N   . LEU A 1 4   ? 14.821  25.881  58.953  1.00 182.68 ? 46  LEU A N   1 
ATOM 27   C CA  . LEU A 1 4   ? 15.663  24.886  59.586  1.00 182.68 ? 46  LEU A CA  1 
ATOM 28   C C   . LEU A 1 4   ? 16.520  24.275  58.487  1.00 182.68 ? 46  LEU A C   1 
ATOM 29   O O   . LEU A 1 4   ? 17.516  23.599  58.746  1.00 182.68 ? 46  LEU A O   1 
ATOM 30   C CB  . LEU A 1 4   ? 14.776  23.829  60.228  1.00 182.68 ? 46  LEU A CB  1 
ATOM 31   C CG  . LEU A 1 4   ? 13.562  24.439  60.931  1.00 182.68 ? 46  LEU A CG  1 
ATOM 32   C CD1 . LEU A 1 4   ? 12.562  23.367  61.291  1.00 182.68 ? 46  LEU A CD1 1 
ATOM 33   C CD2 . LEU A 1 4   ? 13.993  25.226  62.147  1.00 182.68 ? 46  LEU A CD2 1 
ATOM 34   N N   . LEU A 1 5   ? 16.145  24.602  57.256  1.00 182.68 ? 47  LEU A N   1 
ATOM 35   C CA  . LEU A 1 5   ? 16.802  24.148  56.039  1.00 182.68 ? 47  LEU A CA  1 
ATOM 36   C C   . LEU A 1 5   ? 18.262  24.579  55.961  1.00 182.68 ? 47  LEU A C   1 
ATOM 37   O O   . LEU A 1 5   ? 18.930  24.402  54.940  1.00 182.68 ? 47  LEU A O   1 
ATOM 38   C CB  . LEU A 1 5   ? 16.023  24.680  54.849  1.00 182.68 ? 47  LEU A CB  1 
ATOM 39   C CG  . LEU A 1 5   ? 14.521  24.418  54.936  1.00 182.68 ? 47  LEU A CG  1 
ATOM 40   C CD1 . LEU A 1 5   ? 13.849  25.038  53.734  1.00 182.68 ? 47  LEU A CD1 1 
ATOM 41   C CD2 . LEU A 1 5   ? 14.241  22.921  55.003  1.00 182.68 ? 47  LEU A CD2 1 
ATOM 42   N N   . ASP A 1 6   ? 18.750  25.158  57.052  1.00 182.68 ? 48  ASP A N   1 
ATOM 43   C CA  . ASP A 1 6   ? 20.131  25.595  57.138  1.00 182.68 ? 48  ASP A CA  1 
ATOM 44   C C   . ASP A 1 6   ? 20.957  24.391  57.550  1.00 182.68 ? 48  ASP A C   1 
ATOM 45   O O   . ASP A 1 6   ? 22.059  24.529  58.056  1.00 182.68 ? 48  ASP A O   1 
ATOM 46   C CB  . ASP A 1 6   ? 20.280  26.722  58.167  1.00 182.68 ? 48  ASP A CB  1 
ATOM 47   C CG  . ASP A 1 6   ? 19.481  27.977  57.798  1.00 182.68 ? 48  ASP A CG  1 
ATOM 48   O OD1 . ASP A 1 6   ? 18.672  27.931  56.843  1.00 182.68 ? 48  ASP A OD1 1 
ATOM 49   O OD2 . ASP A 1 6   ? 19.648  29.017  58.473  1.00 182.68 ? 48  ASP A OD2 1 
ATOM 50   N N   . ASN A 1 7   ? 20.411  23.200  57.340  1.00 182.68 ? 49  ASN A N   1 
ATOM 51   C CA  . ASN A 1 7   ? 21.108  21.977  57.681  1.00 182.68 ? 49  ASN A CA  1 
ATOM 52   C C   . ASN A 1 7   ? 22.533  22.013  57.135  1.00 182.68 ? 49  ASN A C   1 
ATOM 53   O O   . ASN A 1 7   ? 23.374  21.182  57.493  1.00 182.68 ? 49  ASN A O   1 
ATOM 54   C CB  . ASN A 1 7   ? 20.370  20.778  57.110  1.00 182.68 ? 49  ASN A CB  1 
ATOM 55   C CG  . ASN A 1 7   ? 20.728  19.494  57.820  1.00 182.68 ? 49  ASN A CG  1 
ATOM 56   O OD1 . ASN A 1 7   ? 21.750  19.406  58.500  1.00 182.68 ? 49  ASN A OD1 1 
ATOM 57   N ND2 . ASN A 1 7   ? 19.878  18.489  57.679  1.00 182.68 ? 49  ASN A ND2 1 
ATOM 58   N N   . TRP A 1 8   ? 22.779  22.943  56.213  1.00 173.39 ? 50  TRP A N   1 
ATOM 59   C CA  . TRP A 1 8   ? 24.109  23.120  55.659  1.00 173.39 ? 50  TRP A CA  1 
ATOM 60   C C   . TRP A 1 8   ? 24.929  23.759  56.782  1.00 173.39 ? 50  TRP A C   1 
ATOM 61   O O   . TRP A 1 8   ? 25.957  23.226  57.168  1.00 173.39 ? 50  TRP A O   1 
ATOM 62   C CB  . TRP A 1 8   ? 24.104  24.029  54.424  1.00 173.39 ? 50  TRP A CB  1 
ATOM 63   C CG  . TRP A 1 8   ? 23.145  23.638  53.294  1.00 173.39 ? 50  TRP A CG  1 
ATOM 64   C CD1 . TRP A 1 8   ? 21.925  24.187  53.042  1.00 173.39 ? 50  TRP A CD1 1 
ATOM 65   C CD2 . TRP A 1 8   ? 23.368  22.676  52.240  1.00 173.39 ? 50  TRP A CD2 1 
ATOM 66   N NE1 . TRP A 1 8   ? 21.373  23.647  51.903  1.00 173.39 ? 50  TRP A NE1 1 
ATOM 67   C CE2 . TRP A 1 8   ? 22.237  22.715  51.387  1.00 173.39 ? 50  TRP A CE2 1 
ATOM 68   C CE3 . TRP A 1 8   ? 24.411  21.791  51.931  1.00 173.39 ? 50  TRP A CE3 1 
ATOM 69   C CZ2 . TRP A 1 8   ? 22.117  21.904  50.249  1.00 173.39 ? 50  TRP A CZ2 1 
ATOM 70   C CZ3 . TRP A 1 8   ? 24.289  20.981  50.793  1.00 173.39 ? 50  TRP A CZ3 1 
ATOM 71   C CH2 . TRP A 1 8   ? 23.149  21.048  49.969  1.00 173.39 ? 50  TRP A CH2 1 
ATOM 72   N N   . ASP A 1 9   ? 24.420  24.855  57.348  1.00 173.39 ? 51  ASP A N   1 
ATOM 73   C CA  . ASP A 1 9   ? 25.081  25.571  58.448  1.00 173.39 ? 51  ASP A CA  1 
ATOM 74   C C   . ASP A 1 9   ? 25.597  24.603  59.494  1.00 173.39 ? 51  ASP A C   1 
ATOM 75   O O   . ASP A 1 9   ? 26.714  24.733  59.984  1.00 173.39 ? 51  ASP A O   1 
ATOM 76   C CB  . ASP A 1 9   ? 24.106  26.548  59.112  1.00 173.39 ? 51  ASP A CB  1 
ATOM 77   C CG  . ASP A 1 9   ? 24.595  27.034  60.461  1.00 173.39 ? 51  ASP A CG  1 
ATOM 78   O OD1 . ASP A 1 9   ? 25.501  27.893  60.490  1.00 173.39 ? 51  ASP A OD1 1 
ATOM 79   O OD2 . ASP A 1 9   ? 24.086  26.523  61.484  1.00 173.39 ? 51  ASP A OD2 1 
ATOM 80   N N   . SER A 1 10  ? 24.764  23.627  59.817  1.00 173.39 ? 52  SER A N   1 
ATOM 81   C CA  . SER A 1 10  ? 25.106  22.621  60.792  1.00 173.39 ? 52  SER A CA  1 
ATOM 82   C C   . SER A 1 10  ? 26.297  21.782  60.341  1.00 173.39 ? 52  SER A C   1 
ATOM 83   O O   . SER A 1 10  ? 27.237  21.577  61.100  1.00 173.39 ? 52  SER A O   1 
ATOM 84   C CB  . SER A 1 10  ? 23.894  21.730  61.021  1.00 173.39 ? 52  SER A CB  1 
ATOM 85   O OG  . SER A 1 10  ? 24.263  20.577  61.735  1.00 173.39 ? 52  SER A OG  1 
ATOM 86   N N   . VAL A 1 11  ? 26.272  21.336  59.094  1.00 173.39 ? 53  VAL A N   1 
ATOM 87   C CA  . VAL A 1 11  ? 27.341  20.503  58.580  1.00 173.39 ? 53  VAL A CA  1 
ATOM 88   C C   . VAL A 1 11  ? 28.609  21.240  58.150  1.00 173.39 ? 53  VAL A C   1 
ATOM 89   O O   . VAL A 1 11  ? 29.713  20.830  58.485  1.00 173.39 ? 53  VAL A O   1 
ATOM 90   C CB  . VAL A 1 11  ? 26.818  19.601  57.460  1.00 173.39 ? 53  VAL A CB  1 
ATOM 91   C CG1 . VAL A 1 11  ? 25.599  18.829  57.949  1.00 173.39 ? 53  VAL A CG1 1 
ATOM 92   C CG2 . VAL A 1 11  ? 26.463  20.413  56.234  1.00 173.39 ? 53  VAL A CG2 1 
ATOM 93   N N   . THR A 1 12  ? 28.441  22.322  57.406  1.00 181.14 ? 54  THR A N   1 
ATOM 94   C CA  . THR A 1 12  ? 29.546  23.130  56.907  1.00 181.14 ? 54  THR A CA  1 
ATOM 95   C C   . THR A 1 12  ? 30.530  23.554  57.994  1.00 181.14 ? 54  THR A C   1 
ATOM 96   O O   . THR A 1 12  ? 31.669  23.086  58.028  1.00 181.14 ? 54  THR A O   1 
ATOM 97   C CB  . THR A 1 12  ? 29.001  24.382  56.171  1.00 181.14 ? 54  THR A CB  1 
ATOM 98   O OG1 . THR A 1 12  ? 28.129  25.112  57.042  1.00 181.14 ? 54  THR A OG1 1 
ATOM 99   C CG2 . THR A 1 12  ? 28.230  23.969  54.915  1.00 181.14 ? 54  THR A CG2 1 
ATOM 100  N N   . SER A 1 13  ? 30.062  24.405  58.903  1.00 181.14 ? 55  SER A N   1 
ATOM 101  C CA  . SER A 1 13  ? 30.873  24.925  60.003  1.00 181.14 ? 55  SER A CA  1 
ATOM 102  C C   . SER A 1 13  ? 31.556  23.831  60.816  1.00 181.14 ? 55  SER A C   1 
ATOM 103  O O   . SER A 1 13  ? 32.588  24.062  61.448  1.00 181.14 ? 55  SER A O   1 
ATOM 104  C CB  . SER A 1 13  ? 29.988  25.767  60.924  1.00 181.14 ? 55  SER A CB  1 
ATOM 105  O OG  . SER A 1 13  ? 28.895  24.991  61.388  1.00 181.14 ? 55  SER A OG  1 
ATOM 106  N N   . THR A 1 14  ? 30.985  22.635  60.760  1.00 181.14 ? 56  THR A N   1 
ATOM 107  C CA  . THR A 1 14  ? 31.506  21.497  61.502  1.00 181.14 ? 56  THR A CA  1 
ATOM 108  C C   . THR A 1 14  ? 32.460  20.615  60.710  1.00 181.14 ? 56  THR A C   1 
ATOM 109  O O   . THR A 1 14  ? 33.655  20.532  61.000  1.00 181.14 ? 56  THR A O   1 
ATOM 110  C CB  . THR A 1 14  ? 30.349  20.617  61.992  1.00 181.14 ? 56  THR A CB  1 
ATOM 111  O OG1 . THR A 1 14  ? 29.552  20.200  60.875  1.00 181.14 ? 56  THR A OG1 1 
ATOM 112  C CG2 . THR A 1 14  ? 29.480  21.394  62.951  1.00 181.14 ? 56  THR A CG2 1 
ATOM 113  N N   . PHE A 1 15  ? 31.897  19.936  59.722  1.00 181.14 ? 57  PHE A N   1 
ATOM 114  C CA  . PHE A 1 15  ? 32.622  19.009  58.885  1.00 181.14 ? 57  PHE A CA  1 
ATOM 115  C C   . PHE A 1 15  ? 33.583  19.635  57.888  1.00 181.14 ? 57  PHE A C   1 
ATOM 116  O O   . PHE A 1 15  ? 34.761  19.284  57.862  1.00 181.14 ? 57  PHE A O   1 
ATOM 117  C CB  . PHE A 1 15  ? 31.618  18.105  58.164  1.00 181.14 ? 57  PHE A CB  1 
ATOM 118  C CG  . PHE A 1 15  ? 30.632  17.428  59.090  1.00 181.14 ? 57  PHE A CG  1 
ATOM 119  C CD1 . PHE A 1 15  ? 31.067  16.543  60.070  1.00 181.14 ? 57  PHE A CD1 1 
ATOM 120  C CD2 . PHE A 1 15  ? 29.271  17.684  58.986  1.00 181.14 ? 57  PHE A CD2 1 
ATOM 121  C CE1 . PHE A 1 15  ? 30.155  15.919  60.934  1.00 181.14 ? 57  PHE A CE1 1 
ATOM 122  C CE2 . PHE A 1 15  ? 28.352  17.067  59.846  1.00 181.14 ? 57  PHE A CE2 1 
ATOM 123  C CZ  . PHE A 1 15  ? 28.797  16.183  60.819  1.00 181.14 ? 57  PHE A CZ  1 
ATOM 124  N N   . SER A 1 16  ? 33.092  20.572  57.088  1.00 181.14 ? 58  SER A N   1 
ATOM 125  C CA  . SER A 1 16  ? 33.923  21.206  56.072  1.00 181.14 ? 58  SER A CA  1 
ATOM 126  C C   . SER A 1 16  ? 35.232  21.797  56.585  1.00 181.14 ? 58  SER A C   1 
ATOM 127  O O   . SER A 1 16  ? 36.273  21.621  55.953  1.00 181.14 ? 58  SER A O   1 
ATOM 128  C CB  . SER A 1 16  ? 33.136  22.267  55.310  1.00 181.14 ? 58  SER A CB  1 
ATOM 129  O OG  . SER A 1 16  ? 33.883  22.741  54.202  1.00 181.14 ? 58  SER A OG  1 
ATOM 130  N N   . LYS A 1 17  ? 35.193  22.462  57.738  1.00 181.14 ? 59  LYS A N   1 
ATOM 131  C CA  . LYS A 1 17  ? 36.402  23.067  58.291  1.00 181.14 ? 59  LYS A CA  1 
ATOM 132  C C   . LYS A 1 17  ? 37.519  22.060  58.494  1.00 181.14 ? 59  LYS A C   1 
ATOM 133  O O   . LYS A 1 17  ? 38.636  22.269  58.041  1.00 181.14 ? 59  LYS A O   1 
ATOM 134  C CB  . LYS A 1 17  ? 36.134  23.769  59.627  1.00 181.14 ? 59  LYS A CB  1 
ATOM 135  C CG  . LYS A 1 17  ? 37.427  24.280  60.274  1.00 181.14 ? 59  LYS A CG  1 
ATOM 136  C CD  . LYS A 1 17  ? 37.237  25.009  61.594  1.00 181.14 ? 59  LYS A CD  1 
ATOM 137  C CE  . LYS A 1 17  ? 38.582  25.531  62.110  1.00 181.14 ? 59  LYS A CE  1 
ATOM 138  N NZ  . LYS A 1 17  ? 38.470  26.370  63.338  1.00 181.14 ? 59  LYS A NZ  1 
ATOM 139  N N   . LEU A 1 18  ? 37.212  20.961  59.171  1.00 181.14 ? 60  LEU A N   1 
ATOM 140  C CA  . LEU A 1 18  ? 38.215  19.945  59.450  1.00 181.14 ? 60  LEU A CA  1 
ATOM 141  C C   . LEU A 1 18  ? 38.944  19.448  58.211  1.00 181.14 ? 60  LEU A C   1 
ATOM 142  O O   . LEU A 1 18  ? 40.131  19.145  58.269  1.00 181.14 ? 60  LEU A O   1 
ATOM 143  C CB  . LEU A 1 18  ? 37.592  18.760  60.179  1.00 181.14 ? 60  LEU A CB  1 
ATOM 144  C CG  . LEU A 1 18  ? 38.622  17.778  60.737  1.00 181.14 ? 60  LEU A CG  1 
ATOM 145  C CD1 . LEU A 1 18  ? 39.458  18.461  61.812  1.00 181.14 ? 60  LEU A CD1 1 
ATOM 146  C CD2 . LEU A 1 18  ? 37.928  16.554  61.288  1.00 181.14 ? 60  LEU A CD2 1 
ATOM 147  N N   . ARG A 1 19  ? 38.224  19.353  57.100  1.00 181.14 ? 61  ARG A N   1 
ATOM 148  C CA  . ARG A 1 19  ? 38.795  18.880  55.844  1.00 181.14 ? 61  ARG A CA  1 
ATOM 149  C C   . ARG A 1 19  ? 39.628  19.929  55.114  1.00 181.14 ? 61  ARG A C   1 
ATOM 150  O O   . ARG A 1 19  ? 40.806  19.706  54.826  1.00 181.14 ? 61  ARG A O   1 
ATOM 151  C CB  . ARG A 1 19  ? 37.676  18.380  54.928  1.00 181.14 ? 61  ARG A CB  1 
ATOM 152  C CG  . ARG A 1 19  ? 38.072  18.213  53.471  1.00 181.14 ? 61  ARG A CG  1 
ATOM 153  C CD  . ARG A 1 19  ? 36.840  18.051  52.609  1.00 181.14 ? 61  ARG A CD  1 
ATOM 154  N NE  . ARG A 1 19  ? 37.029  18.615  51.275  1.00 181.14 ? 61  ARG A NE  1 
ATOM 155  C CZ  . ARG A 1 19  ? 36.054  18.775  50.384  1.00 181.14 ? 61  ARG A CZ  1 
ATOM 156  N NH1 . ARG A 1 19  ? 34.810  18.414  50.678  1.00 181.14 ? 61  ARG A NH1 1 
ATOM 157  N NH2 . ARG A 1 19  ? 36.321  19.303  49.196  1.00 181.14 ? 61  ARG A NH2 1 
ATOM 158  N N   . GLU A 1 20  ? 38.997  21.055  54.794  1.00 181.14 ? 62  GLU A N   1 
ATOM 159  C CA  . GLU A 1 20  ? 39.660  22.141  54.080  1.00 181.14 ? 62  GLU A CA  1 
ATOM 160  C C   . GLU A 1 20  ? 40.823  22.698  54.901  1.00 181.14 ? 62  GLU A C   1 
ATOM 161  O O   . GLU A 1 20  ? 41.882  23.022  54.359  1.00 181.14 ? 62  GLU A O   1 
ATOM 162  C CB  . GLU A 1 20  ? 38.644  23.240  53.732  1.00 181.14 ? 62  GLU A CB  1 
ATOM 163  C CG  . GLU A 1 20  ? 39.088  24.185  52.607  1.00 181.14 ? 62  GLU A CG  1 
ATOM 164  C CD  . GLU A 1 20  ? 37.924  24.833  51.849  1.00 181.14 ? 62  GLU A CD  1 
ATOM 165  O OE1 . GLU A 1 20  ? 36.819  24.247  51.810  1.00 181.14 ? 62  GLU A OE1 1 
ATOM 166  O OE2 . GLU A 1 20  ? 38.123  25.924  51.267  1.00 181.14 ? 62  GLU A OE2 1 
ATOM 167  N N   . GLN A 1 21  ? 40.644  22.734  56.217  1.00 181.14 ? 63  GLN A N   1 
ATOM 168  C CA  . GLN A 1 21  ? 41.673  23.242  57.111  1.00 181.14 ? 63  GLN A CA  1 
ATOM 169  C C   . GLN A 1 21  ? 42.781  22.226  57.368  1.00 181.14 ? 63  GLN A C   1 
ATOM 170  O O   . GLN A 1 21  ? 43.800  22.556  57.975  1.00 181.14 ? 63  GLN A O   1 
ATOM 171  C CB  . GLN A 1 21  ? 41.053  23.717  58.424  1.00 181.14 ? 63  GLN A CB  1 
ATOM 172  C CG  . GLN A 1 21  ? 40.142  24.931  58.295  1.00 181.14 ? 63  GLN A CG  1 
ATOM 173  C CD  . GLN A 1 21  ? 40.901  26.217  58.034  1.00 181.14 ? 63  GLN A CD  1 
ATOM 174  O OE1 . GLN A 1 21  ? 41.934  26.480  58.656  1.00 181.14 ? 63  GLN A OE1 1 
ATOM 175  N NE2 . GLN A 1 21  ? 40.381  27.037  57.124  1.00 181.14 ? 63  GLN A NE2 1 
ATOM 176  N N   . LEU A 1 22  ? 42.584  20.989  56.922  1.00 181.14 ? 64  LEU A N   1 
ATOM 177  C CA  . LEU A 1 22  ? 43.618  19.987  57.102  1.00 181.14 ? 64  LEU A CA  1 
ATOM 178  C C   . LEU A 1 22  ? 44.458  19.875  55.840  1.00 181.14 ? 64  LEU A C   1 
ATOM 179  O O   . LEU A 1 22  ? 45.243  18.946  55.669  1.00 181.14 ? 64  LEU A O   1 
ATOM 180  C CB  . LEU A 1 22  ? 43.044  18.644  57.509  1.00 181.14 ? 64  LEU A CB  1 
ATOM 181  C CG  . LEU A 1 22  ? 44.118  17.844  58.243  1.00 181.14 ? 64  LEU A CG  1 
ATOM 182  C CD1 . LEU A 1 22  ? 44.871  18.726  59.246  1.00 181.14 ? 64  LEU A CD1 1 
ATOM 183  C CD2 . LEU A 1 22  ? 43.476  16.666  58.926  1.00 181.14 ? 64  LEU A CD2 1 
ATOM 184  N N   . GLY A 1 23  ? 44.291  20.872  54.976  1.00 181.14 ? 65  GLY A N   1 
ATOM 185  C CA  . GLY A 1 23  ? 45.045  20.963  53.745  1.00 181.14 ? 65  GLY A CA  1 
ATOM 186  C C   . GLY A 1 23  ? 46.512  21.271  53.994  1.00 181.14 ? 65  GLY A C   1 
ATOM 187  O O   . GLY A 1 23  ? 47.321  21.013  53.107  1.00 181.14 ? 65  GLY A O   1 
ATOM 188  N N   . PRO A 1 24  ? 46.897  21.857  55.152  1.00 168.93 ? 66  PRO A N   1 
ATOM 189  C CA  . PRO A 1 24  ? 48.307  22.148  55.416  1.00 168.93 ? 66  PRO A CA  1 
ATOM 190  C C   . PRO A 1 24  ? 49.169  20.897  55.369  1.00 168.93 ? 66  PRO A C   1 
ATOM 191  O O   . PRO A 1 24  ? 50.382  20.962  55.549  1.00 168.93 ? 66  PRO A O   1 
ATOM 192  C CB  . PRO A 1 24  ? 48.275  22.734  56.830  1.00 168.93 ? 66  PRO A CB  1 
ATOM 193  C CG  . PRO A 1 24  ? 46.978  22.237  57.396  1.00 168.93 ? 66  PRO A CG  1 
ATOM 194  C CD  . PRO A 1 24  ? 46.088  22.446  56.226  1.00 168.93 ? 66  PRO A CD  1 
ATOM 195  N N   . VAL A 1 25  ? 48.515  19.757  55.176  1.00 168.93 ? 67  VAL A N   1 
ATOM 196  C CA  . VAL A 1 25  ? 49.176  18.471  55.071  1.00 168.93 ? 67  VAL A CA  1 
ATOM 197  C C   . VAL A 1 25  ? 50.197  18.460  53.925  1.00 168.93 ? 67  VAL A C   1 
ATOM 198  O O   . VAL A 1 25  ? 51.401  18.388  54.167  1.00 168.93 ? 67  VAL A O   1 
ATOM 199  C CB  . VAL A 1 25  ? 48.119  17.333  54.899  1.00 168.93 ? 67  VAL A CB  1 
ATOM 200  C CG1 . VAL A 1 25  ? 47.131  17.654  53.771  1.00 168.93 ? 67  VAL A CG1 1 
ATOM 201  C CG2 . VAL A 1 25  ? 48.800  16.002  54.665  1.00 168.93 ? 67  VAL A CG2 1 
ATOM 202  N N   . THR A 1 26  ? 49.716  18.580  52.688  1.00 168.93 ? 68  THR A N   1 
ATOM 203  C CA  . THR A 1 26  ? 50.584  18.580  51.510  1.00 168.93 ? 68  THR A CA  1 
ATOM 204  C C   . THR A 1 26  ? 51.527  19.779  51.546  1.00 168.93 ? 68  THR A C   1 
ATOM 205  O O   . THR A 1 26  ? 52.622  19.750  50.978  1.00 168.93 ? 68  THR A O   1 
ATOM 206  C CB  . THR A 1 26  ? 49.757  18.587  50.197  1.00 168.93 ? 68  THR A CB  1 
ATOM 207  O OG1 . THR A 1 26  ? 50.638  18.647  49.068  1.00 168.93 ? 68  THR A OG1 1 
ATOM 208  C CG2 . THR A 1 26  ? 48.800  19.773  50.162  1.00 168.93 ? 68  THR A CG2 1 
ATOM 209  N N   . GLN A 1 27  ? 51.086  20.824  52.238  1.00 168.93 ? 69  GLN A N   1 
ATOM 210  C CA  . GLN A 1 27  ? 51.860  22.042  52.403  1.00 168.93 ? 69  GLN A CA  1 
ATOM 211  C C   . GLN A 1 27  ? 53.138  21.711  53.171  1.00 168.93 ? 69  GLN A C   1 
ATOM 212  O O   . GLN A 1 27  ? 54.218  21.618  52.584  1.00 168.93 ? 69  GLN A O   1 
ATOM 213  C CB  . GLN A 1 27  ? 51.040  23.084  53.180  1.00 168.93 ? 69  GLN A CB  1 
ATOM 214  C CG  . GLN A 1 27  ? 51.822  24.332  53.589  1.00 168.93 ? 69  GLN A CG  1 
ATOM 215  C CD  . GLN A 1 27  ? 51.108  25.172  54.635  1.00 168.93 ? 69  GLN A CD  1 
ATOM 216  O OE1 . GLN A 1 27  ? 50.365  24.653  55.469  1.00 168.93 ? 69  GLN A OE1 1 
ATOM 217  N NE2 . GLN A 1 27  ? 51.344  26.480  54.601  1.00 168.93 ? 69  GLN A NE2 1 
ATOM 218  N N   . GLU A 1 28  ? 52.995  21.489  54.477  1.00 168.93 ? 70  GLU A N   1 
ATOM 219  C CA  . GLU A 1 28  ? 54.133  21.186  55.338  1.00 168.93 ? 70  GLU A CA  1 
ATOM 220  C C   . GLU A 1 28  ? 54.827  19.875  55.016  1.00 168.93 ? 70  GLU A C   1 
ATOM 221  O O   . GLU A 1 28  ? 56.039  19.761  55.155  1.00 168.93 ? 70  GLU A O   1 
ATOM 222  C CB  . GLU A 1 28  ? 53.737  21.230  56.817  1.00 168.93 ? 70  GLU A CB  1 
ATOM 223  C CG  . GLU A 1 28  ? 53.351  22.622  57.309  1.00 168.93 ? 70  GLU A CG  1 
ATOM 224  C CD  . GLU A 1 28  ? 53.616  22.825  58.792  1.00 168.93 ? 70  GLU A CD  1 
ATOM 225  O OE1 . GLU A 1 28  ? 53.542  21.834  59.556  1.00 168.93 ? 70  GLU A OE1 1 
ATOM 226  O OE2 . GLU A 1 28  ? 53.902  23.978  59.193  1.00 168.93 ? 70  GLU A OE2 1 
ATOM 227  N N   . PHE A 1 29  ? 54.066  18.883  54.584  1.00 168.93 ? 71  PHE A N   1 
ATOM 228  C CA  . PHE A 1 29  ? 54.661  17.609  54.252  1.00 168.93 ? 71  PHE A CA  1 
ATOM 229  C C   . PHE A 1 29  ? 55.217  17.565  52.851  1.00 168.93 ? 71  PHE A C   1 
ATOM 230  O O   . PHE A 1 29  ? 56.401  17.809  52.653  1.00 168.93 ? 71  PHE A O   1 
ATOM 231  C CB  . PHE A 1 29  ? 53.674  16.469  54.472  1.00 168.93 ? 71  PHE A CB  1 
ATOM 232  C CG  . PHE A 1 29  ? 53.909  15.723  55.739  1.00 168.93 ? 71  PHE A CG  1 
ATOM 233  C CD1 . PHE A 1 29  ? 54.683  16.283  56.752  1.00 168.93 ? 71  PHE A CD1 1 
ATOM 234  C CD2 . PHE A 1 29  ? 53.381  14.453  55.917  1.00 168.93 ? 71  PHE A CD2 1 
ATOM 235  C CE1 . PHE A 1 29  ? 54.925  15.593  57.922  1.00 168.93 ? 71  PHE A CE1 1 
ATOM 236  C CE2 . PHE A 1 29  ? 53.617  13.753  57.087  1.00 168.93 ? 71  PHE A CE2 1 
ATOM 237  C CZ  . PHE A 1 29  ? 54.395  14.324  58.092  1.00 168.93 ? 71  PHE A CZ  1 
ATOM 238  N N   . TRP A 1 30  ? 54.338  17.325  51.884  1.00 168.93 ? 72  TRP A N   1 
ATOM 239  C CA  . TRP A 1 30  ? 54.722  17.197  50.487  1.00 168.93 ? 72  TRP A CA  1 
ATOM 240  C C   . TRP A 1 30  ? 55.774  18.193  50.022  1.00 168.93 ? 72  TRP A C   1 
ATOM 241  O O   . TRP A 1 30  ? 56.871  17.792  49.643  1.00 168.93 ? 72  TRP A O   1 
ATOM 242  C CB  . TRP A 1 30  ? 53.473  17.233  49.595  1.00 168.93 ? 72  TRP A CB  1 
ATOM 243  C CG  . TRP A 1 30  ? 53.344  16.071  48.617  1.00 168.93 ? 72  TRP A CG  1 
ATOM 244  C CD1 . TRP A 1 30  ? 53.752  16.049  47.314  1.00 168.93 ? 72  TRP A CD1 1 
ATOM 245  C CD2 . TRP A 1 30  ? 52.723  14.788  48.856  1.00 168.93 ? 72  TRP A CD2 1 
ATOM 246  N NE1 . TRP A 1 30  ? 53.425  14.848  46.725  1.00 168.93 ? 72  TRP A NE1 1 
ATOM 247  C CE2 . TRP A 1 30  ? 52.792  14.056  47.647  1.00 168.93 ? 72  TRP A CE2 1 
ATOM 248  C CE3 . TRP A 1 30  ? 52.115  14.190  49.970  1.00 168.93 ? 72  TRP A CE3 1 
ATOM 249  C CZ2 . TRP A 1 30  ? 52.276  12.755  47.519  1.00 168.93 ? 72  TRP A CZ2 1 
ATOM 250  C CZ3 . TRP A 1 30  ? 51.602  12.896  49.840  1.00 168.93 ? 72  TRP A CZ3 1 
ATOM 251  C CH2 . TRP A 1 30  ? 51.687  12.195  48.622  1.00 168.93 ? 72  TRP A CH2 1 
ATOM 252  N N   . ASP A 1 31  ? 55.491  19.483  50.125  1.00 168.93 ? 73  ASP A N   1 
ATOM 253  C CA  . ASP A 1 31  ? 56.467  20.456  49.680  1.00 168.93 ? 73  ASP A CA  1 
ATOM 254  C C   . ASP A 1 31  ? 57.774  20.432  50.451  1.00 168.93 ? 73  ASP A C   1 
ATOM 255  O O   . ASP A 1 31  ? 58.804  20.825  49.915  1.00 168.93 ? 73  ASP A O   1 
ATOM 256  C CB  . ASP A 1 31  ? 55.863  21.849  49.585  1.00 168.93 ? 73  ASP A CB  1 
ATOM 257  C CG  . ASP A 1 31  ? 55.212  22.095  48.234  1.00 168.93 ? 73  ASP A CG  1 
ATOM 258  O OD1 . ASP A 1 31  ? 54.079  21.612  48.018  1.00 168.93 ? 73  ASP A OD1 1 
ATOM 259  O OD2 . ASP A 1 31  ? 55.849  22.748  47.378  1.00 168.93 ? 73  ASP A OD2 1 
ATOM 260  N N   . ASN A 1 32  ? 57.744  19.955  51.693  1.00 168.93 ? 74  ASN A N   1 
ATOM 261  C CA  . ASN A 1 32  ? 58.970  19.836  52.481  1.00 168.93 ? 74  ASN A CA  1 
ATOM 262  C C   . ASN A 1 32  ? 59.703  18.607  51.975  1.00 168.93 ? 74  ASN A C   1 
ATOM 263  O O   . ASN A 1 32  ? 60.932  18.583  51.893  1.00 168.93 ? 74  ASN A O   1 
ATOM 264  C CB  . ASN A 1 32  ? 58.665  19.631  53.967  1.00 168.93 ? 74  ASN A CB  1 
ATOM 265  C CG  . ASN A 1 32  ? 58.583  20.931  54.736  1.00 168.93 ? 74  ASN A CG  1 
ATOM 266  O OD1 . ASN A 1 32  ? 58.548  22.014  54.151  1.00 168.93 ? 74  ASN A OD1 1 
ATOM 267  N ND2 . ASN A 1 32  ? 58.536  20.829  56.061  1.00 168.93 ? 74  ASN A ND2 1 
ATOM 268  N N   . LEU A 1 33  ? 58.917  17.592  51.631  1.00 168.93 ? 75  LEU A N   1 
ATOM 269  C CA  . LEU A 1 33  ? 59.429  16.328  51.134  1.00 168.93 ? 75  LEU A CA  1 
ATOM 270  C C   . LEU A 1 33  ? 60.097  16.540  49.799  1.00 168.93 ? 75  LEU A C   1 
ATOM 271  O O   . LEU A 1 33  ? 61.312  16.543  49.714  1.00 168.93 ? 75  LEU A O   1 
ATOM 272  C CB  . LEU A 1 33  ? 58.294  15.312  50.976  1.00 168.93 ? 75  LEU A CB  1 
ATOM 273  C CG  . LEU A 1 33  ? 57.303  15.158  52.133  1.00 168.93 ? 75  LEU A CG  1 
ATOM 274  C CD1 . LEU A 1 33  ? 56.348  14.008  51.852  1.00 168.93 ? 75  LEU A CD1 1 
ATOM 275  C CD2 . LEU A 1 33  ? 58.032  14.973  53.456  1.00 168.93 ? 75  LEU A CD2 1 
ATOM 276  N N   . GLU A 1 34  ? 59.296  16.756  48.763  1.00 168.93 ? 76  GLU A N   1 
ATOM 277  C CA  . GLU A 1 34  ? 59.822  16.978  47.425  1.00 168.93 ? 76  GLU A CA  1 
ATOM 278  C C   . GLU A 1 34  ? 60.968  17.997  47.433  1.00 168.93 ? 76  GLU A C   1 
ATOM 279  O O   . GLU A 1 34  ? 61.868  17.924  46.597  1.00 168.93 ? 76  GLU A O   1 
ATOM 280  C CB  . GLU A 1 34  ? 58.701  17.426  46.481  1.00 168.93 ? 76  GLU A CB  1 
ATOM 281  C CG  . GLU A 1 34  ? 59.104  17.485  45.005  1.00 168.93 ? 76  GLU A CG  1 
ATOM 282  C CD  . GLU A 1 34  ? 59.097  18.899  44.422  1.00 168.93 ? 76  GLU A CD  1 
ATOM 283  O OE1 . GLU A 1 34  ? 59.159  19.885  45.196  1.00 168.93 ? 76  GLU A OE1 1 
ATOM 284  O OE2 . GLU A 1 34  ? 59.038  19.020  43.176  1.00 168.93 ? 76  GLU A OE2 1 
ATOM 285  N N   . LYS A 1 35  ? 60.947  18.915  48.402  1.00 168.93 ? 77  LYS A N   1 
ATOM 286  C CA  . LYS A 1 35  ? 61.987  19.939  48.536  1.00 168.93 ? 77  LYS A CA  1 
ATOM 287  C C   . LYS A 1 35  ? 63.298  19.324  49.008  1.00 168.93 ? 77  LYS A C   1 
ATOM 288  O O   . LYS A 1 35  ? 64.372  19.764  48.609  1.00 168.93 ? 77  LYS A O   1 
ATOM 289  C CB  . LYS A 1 35  ? 61.554  21.027  49.521  1.00 168.93 ? 77  LYS A CB  1 
ATOM 290  C CG  . LYS A 1 35  ? 62.471  22.247  49.567  1.00 168.93 ? 77  LYS A CG  1 
ATOM 291  C CD  . LYS A 1 35  ? 61.930  23.323  50.508  1.00 168.93 ? 77  LYS A CD  1 
ATOM 292  C CE  . LYS A 1 35  ? 62.800  24.586  50.487  1.00 168.93 ? 77  LYS A CE  1 
ATOM 293  N NZ  . LYS A 1 35  ? 62.284  25.670  51.387  1.00 168.93 ? 77  LYS A NZ  1 
ATOM 294  N N   . GLU A 1 36  ? 63.214  18.342  49.897  1.00 168.93 ? 78  GLU A N   1 
ATOM 295  C CA  . GLU A 1 36  ? 64.414  17.676  50.381  1.00 168.93 ? 78  GLU A CA  1 
ATOM 296  C C   . GLU A 1 36  ? 64.753  16.480  49.502  1.00 168.93 ? 78  GLU A C   1 
ATOM 297  O O   . GLU A 1 36  ? 65.912  16.272  49.157  1.00 168.93 ? 78  GLU A O   1 
ATOM 298  C CB  . GLU A 1 36  ? 64.256  17.257  51.831  1.00 168.93 ? 78  GLU A CB  1 
ATOM 299  C CG  . GLU A 1 36  ? 64.184  18.436  52.767  1.00 168.93 ? 78  GLU A CG  1 
ATOM 300  C CD  . GLU A 1 36  ? 64.635  18.088  54.160  1.00 168.93 ? 78  GLU A CD  1 
ATOM 301  O OE1 . GLU A 1 36  ? 63.844  17.486  54.908  1.00 168.93 ? 78  GLU A OE1 1 
ATOM 302  O OE2 . GLU A 1 36  ? 65.790  18.424  54.503  1.00 168.93 ? 78  GLU A OE2 1 
ATOM 303  N N   . THR A 1 37  ? 63.724  15.720  49.130  1.00 168.93 ? 79  THR A N   1 
ATOM 304  C CA  . THR A 1 37  ? 63.829  14.539  48.270  1.00 168.93 ? 79  THR A CA  1 
ATOM 305  C C   . THR A 1 37  ? 64.616  14.868  47.007  1.00 168.93 ? 79  THR A C   1 
ATOM 306  O O   . THR A 1 37  ? 65.797  14.531  46.898  1.00 168.93 ? 79  THR A O   1 
ATOM 307  C CB  . THR A 1 37  ? 62.413  14.020  47.844  1.00 168.93 ? 79  THR A CB  1 
ATOM 308  O OG1 . THR A 1 37  ? 61.630  13.718  49.005  1.00 168.93 ? 79  THR A OG1 1 
ATOM 309  C CG2 . THR A 1 37  ? 62.524  12.752  46.992  1.00 168.93 ? 79  THR A CG2 1 
ATOM 310  N N   . GLU A 1 38  ? 63.955  15.525  46.056  1.00 168.93 ? 80  GLU A N   1 
ATOM 311  C CA  . GLU A 1 38  ? 64.603  15.900  44.804  1.00 168.93 ? 80  GLU A CA  1 
ATOM 312  C C   . GLU A 1 38  ? 65.740  16.891  45.121  1.00 168.93 ? 80  GLU A C   1 
ATOM 313  O O   . GLU A 1 38  ? 66.757  16.907  44.428  1.00 168.93 ? 80  GLU A O   1 
ATOM 314  C CB  . GLU A 1 38  ? 63.567  16.475  43.808  1.00 168.93 ? 80  GLU A CB  1 
ATOM 315  C CG  . GLU A 1 38  ? 63.862  16.197  42.314  1.00 168.93 ? 80  GLU A CG  1 
ATOM 316  C CD  . GLU A 1 38  ? 62.699  16.546  41.366  1.00 168.93 ? 80  GLU A CD  1 
ATOM 317  O OE1 . GLU A 1 38  ? 61.847  15.667  41.109  1.00 168.93 ? 80  GLU A OE1 1 
ATOM 318  O OE2 . GLU A 1 38  ? 62.646  17.689  40.854  1.00 168.93 ? 80  GLU A OE2 1 
ATOM 319  N N   . GLY A 1 39  ? 65.613  17.603  46.247  1.00 168.93 ? 81  GLY A N   1 
ATOM 320  C CA  . GLY A 1 39  ? 66.621  18.572  46.672  1.00 168.93 ? 81  GLY A CA  1 
ATOM 321  C C   . GLY A 1 39  ? 67.967  17.964  47.035  1.00 168.93 ? 81  GLY A C   1 
ATOM 322  O O   . GLY A 1 39  ? 69.001  18.636  46.981  1.00 168.93 ? 81  GLY A O   1 
ATOM 323  N N   . LEU A 1 40  ? 67.947  16.704  47.457  1.00 168.93 ? 82  LEU A N   1 
ATOM 324  C CA  . LEU A 1 40  ? 69.168  15.994  47.796  1.00 168.93 ? 82  LEU A CA  1 
ATOM 325  C C   . LEU A 1 40  ? 69.499  15.116  46.601  1.00 168.93 ? 82  LEU A C   1 
ATOM 326  O O   . LEU A 1 40  ? 70.650  14.742  46.394  1.00 168.93 ? 82  LEU A O   1 
ATOM 327  C CB  . LEU A 1 40  ? 68.982  15.155  49.059  1.00 168.93 ? 82  LEU A CB  1 
ATOM 328  C CG  . LEU A 1 40  ? 68.707  15.969  50.325  1.00 168.93 ? 82  LEU A CG  1 
ATOM 329  C CD1 . LEU A 1 40  ? 68.569  15.046  51.524  1.00 168.93 ? 82  LEU A CD1 1 
ATOM 330  C CD2 . LEU A 1 40  ? 69.822  16.978  50.551  1.00 168.93 ? 82  LEU A CD2 1 
ATOM 331  N N   . ARG A 1 41  ? 68.474  14.815  45.805  1.00 168.93 ? 83  ARG A N   1 
ATOM 332  C CA  . ARG A 1 41  ? 68.621  14.010  44.595  1.00 168.93 ? 83  ARG A CA  1 
ATOM 333  C C   . ARG A 1 41  ? 69.447  14.794  43.579  1.00 168.93 ? 83  ARG A C   1 
ATOM 334  O O   . ARG A 1 41  ? 70.084  14.218  42.697  1.00 168.93 ? 83  ARG A O   1 
ATOM 335  C CB  . ARG A 1 41  ? 67.245  13.688  43.995  1.00 168.93 ? 83  ARG A CB  1 
ATOM 336  C CG  . ARG A 1 41  ? 67.308  13.143  42.578  1.00 168.93 ? 83  ARG A CG  1 
ATOM 337  C CD  . ARG A 1 41  ? 65.951  12.786  41.997  1.00 168.93 ? 83  ARG A CD  1 
ATOM 338  N NE  . ARG A 1 41  ? 66.110  12.194  40.670  1.00 168.93 ? 83  ARG A NE  1 
ATOM 339  C CZ  . ARG A 1 41  ? 65.110  11.865  39.857  1.00 168.93 ? 83  ARG A CZ  1 
ATOM 340  N NH1 . ARG A 1 41  ? 63.849  12.064  40.221  1.00 168.93 ? 83  ARG A NH1 1 
ATOM 341  N NH2 . ARG A 1 41  ? 65.379  11.325  38.674  1.00 168.93 ? 83  ARG A NH2 1 
ATOM 342  N N   . GLN A 1 42  ? 69.393  16.118  43.698  1.00 168.93 ? 84  GLN A N   1 
ATOM 343  C CA  . GLN A 1 42  ? 70.131  17.024  42.822  1.00 168.93 ? 84  GLN A CA  1 
ATOM 344  C C   . GLN A 1 42  ? 71.573  17.117  43.303  1.00 168.93 ? 84  GLN A C   1 
ATOM 345  O O   . GLN A 1 42  ? 72.502  17.208  42.499  1.00 168.93 ? 84  GLN A O   1 
ATOM 346  C CB  . GLN A 1 42  ? 69.488  18.420  42.843  1.00 168.93 ? 84  GLN A CB  1 
ATOM 347  C CG  . GLN A 1 42  ? 70.193  19.488  41.989  1.00 168.93 ? 84  GLN A CG  1 
ATOM 348  C CD  . GLN A 1 42  ? 69.542  20.872  42.103  1.00 168.93 ? 84  GLN A CD  1 
ATOM 349  O OE1 . GLN A 1 42  ? 68.365  21.050  41.772  1.00 168.93 ? 84  GLN A OE1 1 
ATOM 350  N NE2 . GLN A 1 42  ? 70.313  21.857  42.564  1.00 168.93 ? 84  GLN A NE2 1 
ATOM 351  N N   . GLU A 1 43  ? 71.750  17.111  44.621  1.00 168.93 ? 85  GLU A N   1 
ATOM 352  C CA  . GLU A 1 43  ? 73.075  17.191  45.211  1.00 168.93 ? 85  GLU A CA  1 
ATOM 353  C C   . GLU A 1 43  ? 73.827  15.911  44.883  1.00 168.93 ? 85  GLU A C   1 
ATOM 354  O O   . GLU A 1 43  ? 75.020  15.940  44.605  1.00 168.93 ? 85  GLU A O   1 
ATOM 355  C CB  . GLU A 1 43  ? 72.966  17.386  46.726  1.00 168.93 ? 85  GLU A CB  1 
ATOM 356  C CG  . GLU A 1 43  ? 74.107  18.185  47.337  1.00 168.93 ? 85  GLU A CG  1 
ATOM 357  C CD  . GLU A 1 43  ? 73.714  18.870  48.638  1.00 168.93 ? 85  GLU A CD  1 
ATOM 358  O OE1 . GLU A 1 43  ? 73.765  18.219  49.704  1.00 168.93 ? 85  GLU A OE1 1 
ATOM 359  O OE2 . GLU A 1 43  ? 73.359  20.068  48.594  1.00 168.93 ? 85  GLU A OE2 1 
ATOM 360  N N   . MET A 1 44  ? 73.097  14.801  44.847  1.00 168.93 ? 86  MET A N   1 
ATOM 361  C CA  . MET A 1 44  ? 73.681  13.506  44.546  1.00 168.93 ? 86  MET A CA  1 
ATOM 362  C C   . MET A 1 44  ? 74.009  13.309  43.092  1.00 168.93 ? 86  MET A C   1 
ATOM 363  O O   . MET A 1 44  ? 75.069  12.793  42.768  1.00 168.93 ? 86  MET A O   1 
ATOM 364  C CB  . MET A 1 44  ? 72.773  12.375  45.004  1.00 168.93 ? 86  MET A CB  1 
ATOM 365  C CG  . MET A 1 44  ? 72.994  12.031  46.443  1.00 168.93 ? 86  MET A CG  1 
ATOM 366  S SD  . MET A 1 44  ? 74.757  12.131  46.792  1.00 168.93 ? 86  MET A SD  1 
ATOM 367  C CE  . MET A 1 44  ? 75.188  10.422  46.872  1.00 168.93 ? 86  MET A CE  1 
ATOM 368  N N   . SER A 1 45  ? 73.083  13.672  42.213  1.00 168.93 ? 87  SER A N   1 
ATOM 369  C CA  . SER A 1 45  ? 73.330  13.514  40.790  1.00 168.93 ? 87  SER A CA  1 
ATOM 370  C C   . SER A 1 45  ? 74.527  14.368  40.410  1.00 168.93 ? 87  SER A C   1 
ATOM 371  O O   . SER A 1 45  ? 75.269  14.024  39.494  1.00 168.93 ? 87  SER A O   1 
ATOM 372  C CB  . SER A 1 45  ? 72.106  13.903  39.960  1.00 168.93 ? 87  SER A CB  1 
ATOM 373  O OG  . SER A 1 45  ? 71.825  15.285  40.070  1.00 168.93 ? 87  SER A OG  1 
ATOM 374  N N   . LYS A 1 46  ? 74.724  15.473  41.128  1.00 86.56  ? 88  LYS A N   1 
ATOM 375  C CA  . LYS A 1 46  ? 75.864  16.345  40.858  1.00 86.56  ? 88  LYS A CA  1 
ATOM 376  C C   . LYS A 1 46  ? 77.087  15.825  41.607  1.00 86.56  ? 88  LYS A C   1 
ATOM 377  O O   . LYS A 1 46  ? 78.221  16.000  41.154  1.00 86.56  ? 88  LYS A O   1 
ATOM 378  C CB  . LYS A 1 46  ? 75.581  17.803  41.246  1.00 86.56  ? 88  LYS A CB  1 
ATOM 379  C CG  . LYS A 1 46  ? 76.568  18.824  40.616  1.00 86.56  ? 88  LYS A CG  1 
ATOM 380  C CD  . LYS A 1 46  ? 76.205  20.291  40.952  1.00 86.56  ? 88  LYS A CD  1 
ATOM 381  C CE  . LYS A 1 46  ? 77.063  21.341  40.194  1.00 86.56  ? 88  LYS A CE  1 
ATOM 382  N NZ  . LYS A 1 46  ? 76.739  22.760  40.603  1.00 86.56  ? 88  LYS A NZ  1 
ATOM 383  N N   . ASP A 1 47  ? 76.852  15.177  42.746  1.00 86.56  ? 89  ASP A N   1 
ATOM 384  C CA  . ASP A 1 47  ? 77.937  14.618  43.547  1.00 86.56  ? 89  ASP A CA  1 
ATOM 385  C C   . ASP A 1 47  ? 78.520  13.417  42.798  1.00 86.56  ? 89  ASP A C   1 
ATOM 386  O O   . ASP A 1 47  ? 79.726  13.167  42.839  1.00 86.56  ? 89  ASP A O   1 
ATOM 387  C CB  . ASP A 1 47  ? 77.409  14.176  44.915  1.00 86.56  ? 89  ASP A CB  1 
ATOM 388  C CG  . ASP A 1 47  ? 78.509  14.007  45.944  1.00 86.56  ? 89  ASP A CG  1 
ATOM 389  O OD1 . ASP A 1 47  ? 79.178  12.954  45.938  1.00 86.56  ? 89  ASP A OD1 1 
ATOM 390  O OD2 . ASP A 1 47  ? 78.694  14.929  46.766  1.00 86.56  ? 89  ASP A OD2 1 
ATOM 391  N N   . LEU A 1 48  ? 77.647  12.713  42.078  1.00 86.56  ? 90  LEU A N   1 
ATOM 392  C CA  . LEU A 1 48  ? 78.002  11.529  41.298  1.00 86.56  ? 90  LEU A CA  1 
ATOM 393  C C   . LEU A 1 48  ? 78.800  11.897  40.057  1.00 86.56  ? 90  LEU A C   1 
ATOM 394  O O   . LEU A 1 48  ? 79.711  11.174  39.652  1.00 86.56  ? 90  LEU A O   1 
ATOM 395  C CB  . LEU A 1 48  ? 76.724  10.791  40.875  1.00 86.56  ? 90  LEU A CB  1 
ATOM 396  C CG  . LEU A 1 48  ? 76.626  10.256  39.440  1.00 86.56  ? 90  LEU A CG  1 
ATOM 397  C CD1 . LEU A 1 48  ? 77.451  8.988   39.293  1.00 86.56  ? 90  LEU A CD1 1 
ATOM 398  C CD2 . LEU A 1 48  ? 75.178  9.991   39.079  1.00 86.56  ? 90  LEU A CD2 1 
ATOM 399  N N   . GLU A 1 49  ? 78.426  13.013  39.442  1.00 86.56  ? 91  GLU A N   1 
ATOM 400  C CA  . GLU A 1 49  ? 79.076  13.482  38.229  1.00 86.56  ? 91  GLU A CA  1 
ATOM 401  C C   . GLU A 1 49  ? 80.585  13.444  38.366  1.00 86.56  ? 91  GLU A C   1 
ATOM 402  O O   . GLU A 1 49  ? 81.248  12.689  37.663  1.00 86.56  ? 91  GLU A O   1 
ATOM 403  C CB  . GLU A 1 49  ? 78.616  14.905  37.895  1.00 86.56  ? 91  GLU A CB  1 
ATOM 404  C CG  . GLU A 1 49  ? 78.725  15.274  36.413  1.00 86.56  ? 91  GLU A CG  1 
ATOM 405  C CD  . GLU A 1 49  ? 77.671  14.590  35.527  1.00 86.56  ? 91  GLU A CD  1 
ATOM 406  O OE1 . GLU A 1 49  ? 76.997  13.633  35.986  1.00 86.56  ? 91  GLU A OE1 1 
ATOM 407  O OE2 . GLU A 1 49  ? 77.514  15.018  34.359  1.00 86.56  ? 91  GLU A OE2 1 
ATOM 408  N N   . GLU A 1 50  ? 81.105  14.215  39.320  1.00 86.56  ? 92  GLU A N   1 
ATOM 409  C CA  . GLU A 1 50  ? 82.544  14.295  39.587  1.00 86.56  ? 92  GLU A CA  1 
ATOM 410  C C   . GLU A 1 50  ? 83.147  12.913  39.583  1.00 86.56  ? 92  GLU A C   1 
ATOM 411  O O   . GLU A 1 50  ? 84.246  12.697  39.091  1.00 86.56  ? 92  GLU A O   1 
ATOM 412  C CB  . GLU A 1 50  ? 82.810  14.872  40.974  1.00 86.56  ? 92  GLU A CB  1 
ATOM 413  C CG  . GLU A 1 50  ? 82.116  16.176  41.285  1.00 86.56  ? 92  GLU A CG  1 
ATOM 414  C CD  . GLU A 1 50  ? 82.435  16.676  42.688  1.00 86.56  ? 92  GLU A CD  1 
ATOM 415  O OE1 . GLU A 1 50  ? 82.636  15.836  43.602  1.00 86.56  ? 92  GLU A OE1 1 
ATOM 416  O OE2 . GLU A 1 50  ? 82.487  17.916  42.872  1.00 86.56  ? 92  GLU A OE2 1 
ATOM 417  N N   . VAL A 1 51  ? 82.427  11.992  40.203  1.00 86.56  ? 93  VAL A N   1 
ATOM 418  C CA  . VAL A 1 51  ? 82.859  10.619  40.287  1.00 86.56  ? 93  VAL A CA  1 
ATOM 419  C C   . VAL A 1 51  ? 83.009  10.100  38.885  1.00 86.56  ? 93  VAL A C   1 
ATOM 420  O O   . VAL A 1 51  ? 84.119  9.824   38.439  1.00 86.56  ? 93  VAL A O   1 
ATOM 421  C CB  . VAL A 1 51  ? 81.827  9.773   40.998  1.00 86.56  ? 93  VAL A CB  1 
ATOM 422  C CG1 . VAL A 1 51  ? 82.296  8.333   41.063  1.00 86.56  ? 93  VAL A CG1 1 
ATOM 423  C CG2 . VAL A 1 51  ? 81.555  10.351  42.371  1.00 86.56  ? 93  VAL A CG2 1 
ATOM 424  N N   . LYS A 1 52  ? 81.883  9.996   38.187  1.00 86.56  ? 94  LYS A N   1 
ATOM 425  C CA  . LYS A 1 52  ? 81.884  9.522   36.816  1.00 86.56  ? 94  LYS A CA  1 
ATOM 426  C C   . LYS A 1 52  ? 82.940  10.284  36.012  1.00 86.56  ? 94  LYS A C   1 
ATOM 427  O O   . LYS A 1 52  ? 83.535  9.742   35.085  1.00 86.56  ? 94  LYS A O   1 
ATOM 428  C CB  . LYS A 1 52  ? 80.501  9.716   36.179  1.00 86.56  ? 94  LYS A CB  1 
ATOM 429  C CG  . LYS A 1 52  ? 79.657  8.440   36.033  1.00 86.56  ? 94  LYS A CG  1 
ATOM 430  C CD  . LYS A 1 52  ? 78.562  8.601   34.950  1.00 86.56  ? 94  LYS A CD  1 
ATOM 431  C CE  . LYS A 1 52  ? 77.820  7.292   34.664  1.00 86.56  ? 94  LYS A CE  1 
ATOM 432  N NZ  . LYS A 1 52  ? 76.873  7.286   33.505  1.00 86.56  ? 94  LYS A NZ  1 
ATOM 433  N N   . ALA A 1 53  ? 83.226  11.514  36.433  1.00 86.56  ? 95  ALA A N   1 
ATOM 434  C CA  . ALA A 1 53  ? 84.196  12.366  35.755  1.00 86.56  ? 95  ALA A CA  1 
ATOM 435  C C   . ALA A 1 53  ? 85.624  11.964  36.069  1.00 86.56  ? 95  ALA A C   1 
ATOM 436  O O   . ALA A 1 53  ? 86.473  11.919  35.183  1.00 86.56  ? 95  ALA A O   1 
ATOM 437  C CB  . ALA A 1 53  ? 83.968  13.824  36.129  1.00 86.56  ? 95  ALA A CB  1 
ATOM 438  N N   . LYS A 1 54  ? 85.874  11.636  37.329  1.00 86.56  ? 96  LYS A N   1 
ATOM 439  C CA  . LYS A 1 54  ? 87.209  11.251  37.749  1.00 86.56  ? 96  LYS A CA  1 
ATOM 440  C C   . LYS A 1 54  ? 87.531  9.838   37.296  1.00 86.56  ? 96  LYS A C   1 
ATOM 441  O O   . LYS A 1 54  ? 88.622  9.331   37.553  1.00 86.56  ? 96  LYS A O   1 
ATOM 442  C CB  . LYS A 1 54  ? 87.345  11.348  39.273  1.00 86.56  ? 96  LYS A CB  1 
ATOM 443  C CG  . LYS A 1 54  ? 87.521  12.763  39.840  1.00 86.56  ? 96  LYS A CG  1 
ATOM 444  C CD  . LYS A 1 54  ? 87.737  12.706  41.360  1.00 86.56  ? 96  LYS A CD  1 
ATOM 445  C CE  . LYS A 1 54  ? 87.953  14.080  41.991  1.00 86.56  ? 96  LYS A CE  1 
ATOM 446  N NZ  . LYS A 1 54  ? 87.939  14.011  43.494  1.00 86.56  ? 96  LYS A NZ  1 
ATOM 447  N N   . VAL A 1 55  ? 86.604  9.221   36.573  1.00 86.56  ? 97  VAL A N   1 
ATOM 448  C CA  . VAL A 1 55  ? 86.811  7.859   36.135  1.00 86.56  ? 97  VAL A CA  1 
ATOM 449  C C   . VAL A 1 55  ? 86.674  7.634   34.659  1.00 86.56  ? 97  VAL A C   1 
ATOM 450  O O   . VAL A 1 55  ? 87.396  6.827   34.086  1.00 86.56  ? 97  VAL A O   1 
ATOM 451  C CB  . VAL A 1 55  ? 85.820  6.937   36.805  1.00 86.56  ? 97  VAL A CB  1 
ATOM 452  C CG1 . VAL A 1 55  ? 86.144  5.513   36.452  1.00 86.56  ? 97  VAL A CG1 1 
ATOM 453  C CG2 . VAL A 1 55  ? 85.829  7.156   38.307  1.00 86.56  ? 97  VAL A CG2 1 
ATOM 454  N N   . GLN A 1 56  ? 85.700  8.303   34.061  1.00 86.56  ? 98  GLN A N   1 
ATOM 455  C CA  . GLN A 1 56  ? 85.445  8.147   32.644  1.00 86.56  ? 98  GLN A CA  1 
ATOM 456  C C   . GLN A 1 56  ? 86.689  7.874   31.830  1.00 86.56  ? 98  GLN A C   1 
ATOM 457  O O   . GLN A 1 56  ? 86.870  6.775   31.347  1.00 86.56  ? 98  GLN A O   1 
ATOM 458  C CB  . GLN A 1 56  ? 84.687  9.338   32.059  1.00 86.56  ? 98  GLN A CB  1 
ATOM 459  C CG  . GLN A 1 56  ? 84.679  9.350   30.525  1.00 86.56  ? 98  GLN A CG  1 
ATOM 460  C CD  . GLN A 1 56  ? 84.332  7.986   29.937  1.00 86.56  ? 98  GLN A CD  1 
ATOM 461  O OE1 . GLN A 1 56  ? 85.149  7.362   29.272  1.00 86.56  ? 98  GLN A OE1 1 
ATOM 462  N NE2 . GLN A 1 56  ? 83.129  7.508   30.209  1.00 86.56  ? 98  GLN A NE2 1 
ATOM 463  N N   . PRO A 1 57  ? 87.600  8.852   31.743  1.00 102.83 ? 99  PRO A N   1 
ATOM 464  C CA  . PRO A 1 57  ? 88.818  8.632   30.957  1.00 102.83 ? 99  PRO A CA  1 
ATOM 465  C C   . PRO A 1 57  ? 89.496  7.337   31.352  1.00 102.83 ? 99  PRO A C   1 
ATOM 466  O O   . PRO A 1 57  ? 89.974  6.590   30.498  1.00 102.83 ? 99  PRO A O   1 
ATOM 467  C CB  . PRO A 1 57  ? 89.667  9.842   31.318  1.00 102.83 ? 99  PRO A CB  1 
ATOM 468  C CG  . PRO A 1 57  ? 89.211  10.172  32.712  1.00 102.83 ? 99  PRO A CG  1 
ATOM 469  C CD  . PRO A 1 57  ? 87.728  10.054  32.578  1.00 102.83 ? 99  PRO A CD  1 
ATOM 470  N N   . TYR A 1 58  ? 89.502  7.048   32.644  1.00 102.83 ? 100 TYR A N   1 
ATOM 471  C CA  . TYR A 1 58  ? 90.115  5.828   33.061  1.00 102.83 ? 100 TYR A CA  1 
ATOM 472  C C   . TYR A 1 58  ? 89.360  4.682   32.412  1.00 102.83 ? 100 TYR A C   1 
ATOM 473  O O   . TYR A 1 58  ? 89.933  3.879   31.697  1.00 102.83 ? 100 TYR A O   1 
ATOM 474  C CB  . TYR A 1 58  ? 90.116  5.649   34.571  1.00 102.83 ? 100 TYR A CB  1 
ATOM 475  C CG  . TYR A 1 58  ? 90.587  4.272   34.778  1.00 102.83 ? 100 TYR A CG  1 
ATOM 476  C CD1 . TYR A 1 58  ? 91.826  3.902   34.274  1.00 102.83 ? 100 TYR A CD1 1 
ATOM 477  C CD2 . TYR A 1 58  ? 89.702  3.267   35.135  1.00 102.83 ? 100 TYR A CD2 1 
ATOM 478  C CE1 . TYR A 1 58  ? 92.157  2.591   34.082  1.00 102.83 ? 100 TYR A CE1 1 
ATOM 479  C CE2 . TYR A 1 58  ? 90.023  1.942   34.948  1.00 102.83 ? 100 TYR A CE2 1 
ATOM 480  C CZ  . TYR A 1 58  ? 91.249  1.610   34.411  1.00 102.83 ? 100 TYR A CZ  1 
ATOM 481  O OH  . TYR A 1 58  ? 91.553  0.296   34.149  1.00 102.83 ? 100 TYR A OH  1 
ATOM 482  N N   . LEU A 1 59  ? 88.081  4.576   32.726  1.00 102.83 ? 101 LEU A N   1 
ATOM 483  C CA  . LEU A 1 59  ? 87.244  3.536   32.167  1.00 102.83 ? 101 LEU A CA  1 
ATOM 484  C C   . LEU A 1 59  ? 87.501  3.460   30.690  1.00 102.83 ? 101 LEU A C   1 
ATOM 485  O O   . LEU A 1 59  ? 87.735  2.395   30.152  1.00 102.83 ? 101 LEU A O   1 
ATOM 486  C CB  . LEU A 1 59  ? 85.782  3.886   32.391  1.00 102.83 ? 101 LEU A CB  1 
ATOM 487  C CG  . LEU A 1 59  ? 84.854  3.743   31.183  1.00 102.83 ? 101 LEU A CG  1 
ATOM 488  C CD1 . LEU A 1 59  ? 84.633  2.274   30.872  1.00 102.83 ? 101 LEU A CD1 1 
ATOM 489  C CD2 . LEU A 1 59  ? 83.540  4.441   31.457  1.00 102.83 ? 101 LEU A CD2 1 
ATOM 490  N N   . ASP A 1 60  ? 87.382  4.615   30.052  1.00 102.83 ? 102 ASP A N   1 
ATOM 491  C CA  . ASP A 1 60  ? 87.594  4.792   28.631  1.00 102.83 ? 102 ASP A CA  1 
ATOM 492  C C   . ASP A 1 60  ? 88.626  3.813   28.163  1.00 102.83 ? 102 ASP A C   1 
ATOM 493  O O   . ASP A 1 60  ? 88.421  3.098   27.192  1.00 102.83 ? 102 ASP A O   1 
ATOM 494  C CB  . ASP A 1 60  ? 88.121  6.191   28.358  1.00 102.83 ? 102 ASP A CB  1 
ATOM 495  C CG  . ASP A 1 60  ? 87.151  7.034   27.591  1.00 102.83 ? 102 ASP A CG  1 
ATOM 496  O OD1 . ASP A 1 60  ? 86.326  6.462   26.847  1.00 102.83 ? 102 ASP A OD1 1 
ATOM 497  O OD2 . ASP A 1 60  ? 87.194  8.271   27.750  1.00 102.83 ? 102 ASP A OD2 1 
ATOM 498  N N   . ASP A 1 61  ? 89.726  3.772   28.903  1.00 102.83 ? 103 ASP A N   1 
ATOM 499  C CA  . ASP A 1 61  ? 90.832  2.880   28.630  1.00 102.83 ? 103 ASP A CA  1 
ATOM 500  C C   . ASP A 1 61  ? 90.256  1.547   28.203  1.00 102.83 ? 103 ASP A C   1 
ATOM 501  O O   . ASP A 1 61  ? 90.496  1.066   27.101  1.00 102.83 ? 103 ASP A O   1 
ATOM 502  C CB  . ASP A 1 61  ? 91.646  2.726   29.917  1.00 102.83 ? 103 ASP A CB  1 
ATOM 503  C CG  . ASP A 1 61  ? 92.724  1.670   29.831  1.00 102.83 ? 103 ASP A CG  1 
ATOM 504  O OD1 . ASP A 1 61  ? 92.980  1.108   28.745  1.00 102.83 ? 103 ASP A OD1 1 
ATOM 505  O OD2 . ASP A 1 61  ? 93.337  1.405   30.883  1.00 102.83 ? 103 ASP A OD2 1 
ATOM 506  N N   . PHE A 1 62  ? 89.427  0.996   29.063  1.00 102.83 ? 104 PHE A N   1 
ATOM 507  C CA  . PHE A 1 62  ? 88.812  -0.271  28.787  1.00 102.83 ? 104 PHE A CA  1 
ATOM 508  C C   . PHE A 1 62  ? 88.114  -0.414  27.441  1.00 102.83 ? 104 PHE A C   1 
ATOM 509  O O   . PHE A 1 62  ? 88.201  -1.459  26.819  1.00 102.83 ? 104 PHE A O   1 
ATOM 510  C CB  . PHE A 1 62  ? 87.860  -0.615  29.904  1.00 102.83 ? 104 PHE A CB  1 
ATOM 511  C CG  . PHE A 1 62  ? 87.392  -2.011  29.849  1.00 102.83 ? 104 PHE A CG  1 
ATOM 512  C CD1 . PHE A 1 62  ? 86.420  -2.384  28.940  1.00 102.83 ? 104 PHE A CD1 1 
ATOM 513  C CD2 . PHE A 1 62  ? 87.948  -2.974  30.680  1.00 102.83 ? 104 PHE A CD2 1 
ATOM 514  C CE1 . PHE A 1 62  ? 86.011  -3.692  28.849  1.00 102.83 ? 104 PHE A CE1 1 
ATOM 515  C CE2 . PHE A 1 62  ? 87.540  -4.293  30.598  1.00 102.83 ? 104 PHE A CE2 1 
ATOM 516  C CZ  . PHE A 1 62  ? 86.572  -4.654  29.683  1.00 102.83 ? 104 PHE A CZ  1 
ATOM 517  N N   . GLN A 1 63  ? 87.399  0.609   26.998  1.00 102.83 ? 105 GLN A N   1 
ATOM 518  C CA  . GLN A 1 63  ? 86.702  0.520   25.716  1.00 102.83 ? 105 GLN A CA  1 
ATOM 519  C C   . GLN A 1 63  ? 87.650  0.091   24.611  1.00 102.83 ? 105 GLN A C   1 
ATOM 520  O O   . GLN A 1 63  ? 87.348  -0.805  23.834  1.00 102.83 ? 105 GLN A O   1 
ATOM 521  C CB  . GLN A 1 63  ? 86.040  1.854   25.341  1.00 102.83 ? 105 GLN A CB  1 
ATOM 522  C CG  . GLN A 1 63  ? 84.631  2.083   25.937  1.00 102.83 ? 105 GLN A CG  1 
ATOM 523  C CD  . GLN A 1 63  ? 83.834  3.214   25.240  1.00 102.83 ? 105 GLN A CD  1 
ATOM 524  O OE1 . GLN A 1 63  ? 84.371  4.292   24.952  1.00 102.83 ? 105 GLN A OE1 1 
ATOM 525  N NE2 . GLN A 1 63  ? 82.546  2.962   24.973  1.00 102.83 ? 105 GLN A NE2 1 
ATOM 526  N N   . LYS A 1 64  ? 88.807  0.734   24.552  1.00 102.83 ? 106 LYS A N   1 
ATOM 527  C CA  . LYS A 1 64  ? 89.797  0.386   23.548  1.00 102.83 ? 106 LYS A CA  1 
ATOM 528  C C   . LYS A 1 64  ? 90.254  -1.027  23.829  1.00 102.83 ? 106 LYS A C   1 
ATOM 529  O O   . LYS A 1 64  ? 90.698  -1.733  22.932  1.00 102.83 ? 106 LYS A O   1 
ATOM 530  C CB  . LYS A 1 64  ? 90.995  1.331   23.611  1.00 102.83 ? 106 LYS A CB  1 
ATOM 531  C CG  . LYS A 1 64  ? 92.103  1.037   22.578  1.00 102.83 ? 106 LYS A CG  1 
ATOM 532  C CD  . LYS A 1 64  ? 93.306  1.993   22.747  1.00 102.83 ? 106 LYS A CD  1 
ATOM 533  C CE  . LYS A 1 64  ? 94.428  1.760   21.720  1.00 102.83 ? 106 LYS A CE  1 
ATOM 534  N NZ  . LYS A 1 64  ? 95.571  2.720   21.904  1.00 102.83 ? 106 LYS A NZ  1 
ATOM 535  N N   . LYS A 1 65  ? 90.174  -1.429  25.089  1.00 102.83 ? 107 LYS A N   1 
ATOM 536  C CA  . LYS A 1 65  ? 90.571  -2.772  25.456  1.00 102.83 ? 107 LYS A CA  1 
ATOM 537  C C   . LYS A 1 65  ? 89.641  -3.780  24.783  1.00 102.83 ? 107 LYS A C   1 
ATOM 538  O O   . LYS A 1 65  ? 90.102  -4.786  24.248  1.00 102.83 ? 107 LYS A O   1 
ATOM 539  C CB  . LYS A 1 65  ? 90.564  -2.939  26.981  1.00 102.83 ? 107 LYS A CB  1 
ATOM 540  C CG  . LYS A 1 65  ? 91.703  -2.212  27.729  1.00 102.83 ? 107 LYS A CG  1 
ATOM 541  C CD  . LYS A 1 65  ? 93.081  -2.820  27.403  1.00 102.83 ? 107 LYS A CD  1 
ATOM 542  C CE  . LYS A 1 65  ? 94.270  -2.105  28.087  1.00 102.83 ? 107 LYS A CE  1 
ATOM 543  N NZ  . LYS A 1 65  ? 94.413  -2.340  29.559  1.00 102.83 ? 107 LYS A NZ  1 
ATOM 544  N N   . TRP A 1 66  ? 88.340  -3.492  24.763  1.00 102.83 ? 108 TRP A N   1 
ATOM 545  C CA  . TRP A 1 66  ? 87.380  -4.405  24.127  1.00 102.83 ? 108 TRP A CA  1 
ATOM 546  C C   . TRP A 1 66  ? 87.668  -4.398  22.634  1.00 102.83 ? 108 TRP A C   1 
ATOM 547  O O   . TRP A 1 66  ? 87.746  -5.448  21.997  1.00 102.83 ? 108 TRP A O   1 
ATOM 548  C CB  . TRP A 1 66  ? 85.918  -3.973  24.390  1.00 102.83 ? 108 TRP A CB  1 
ATOM 549  C CG  . TRP A 1 66  ? 84.843  -5.032  24.016  1.00 102.83 ? 108 TRP A CG  1 
ATOM 550  C CD1 . TRP A 1 66  ? 85.057  -6.335  23.644  1.00 102.83 ? 108 TRP A CD1 1 
ATOM 551  C CD2 . TRP A 1 66  ? 83.399  -4.853  23.976  1.00 102.83 ? 108 TRP A CD2 1 
ATOM 552  N NE1 . TRP A 1 66  ? 83.862  -6.967  23.374  1.00 102.83 ? 108 TRP A NE1 1 
ATOM 553  C CE2 . TRP A 1 66  ? 82.826  -6.080  23.567  1.00 102.83 ? 108 TRP A CE2 1 
ATOM 554  C CE3 . TRP A 1 66  ? 82.539  -3.763  24.242  1.00 102.83 ? 108 TRP A CE3 1 
ATOM 555  C CZ2 . TRP A 1 66  ? 81.432  -6.264  23.415  1.00 102.83 ? 108 TRP A CZ2 1 
ATOM 556  C CZ3 . TRP A 1 66  ? 81.145  -3.948  24.090  1.00 102.83 ? 108 TRP A CZ3 1 
ATOM 557  C CH2 . TRP A 1 66  ? 80.613  -5.188  23.680  1.00 102.83 ? 108 TRP A CH2 1 
ATOM 558  N N   . GLN A 1 67  ? 87.885  -3.197  22.109  1.00 102.83 ? 109 GLN A N   1 
ATOM 559  C CA  . GLN A 1 67  ? 88.192  -2.985  20.700  1.00 102.83 ? 109 GLN A CA  1 
ATOM 560  C C   . GLN A 1 67  ? 89.365  -3.844  20.265  1.00 102.83 ? 109 GLN A C   1 
ATOM 561  O O   . GLN A 1 67  ? 89.452  -4.272  19.113  1.00 102.83 ? 109 GLN A O   1 
ATOM 562  C CB  . GLN A 1 67  ? 88.560  -1.517  20.472  1.00 102.83 ? 109 GLN A CB  1 
ATOM 563  C CG  . GLN A 1 67  ? 87.412  -0.543  20.650  1.00 102.83 ? 109 GLN A CG  1 
ATOM 564  C CD  . GLN A 1 67  ? 86.374  -0.676  19.552  1.00 102.83 ? 109 GLN A CD  1 
ATOM 565  O OE1 . GLN A 1 67  ? 86.408  0.058   18.556  1.00 102.83 ? 109 GLN A OE1 1 
ATOM 566  N NE2 . GLN A 1 67  ? 85.455  -1.628  19.715  1.00 102.83 ? 109 GLN A NE2 1 
ATOM 567  N N   . GLU A 1 68  ? 90.269  -4.080  21.207  1.00 102.83 ? 110 GLU A N   1 
ATOM 568  C CA  . GLU A 1 68  ? 91.467  -4.862  20.954  1.00 102.83 ? 110 GLU A CA  1 
ATOM 569  C C   . GLU A 1 68  ? 91.169  -6.330  20.698  1.00 102.83 ? 110 GLU A C   1 
ATOM 570  O O   . GLU A 1 68  ? 91.556  -6.880  19.667  1.00 102.83 ? 110 GLU A O   1 
ATOM 571  C CB  . GLU A 1 68  ? 92.452  -4.708  22.121  1.00 102.83 ? 110 GLU A CB  1 
ATOM 572  C CG  . GLU A 1 68  ? 93.828  -5.328  21.877  1.00 102.83 ? 110 GLU A CG  1 
ATOM 573  C CD  . GLU A 1 68  ? 94.859  -4.911  22.915  1.00 102.83 ? 110 GLU A CD  1 
ATOM 574  O OE1 . GLU A 1 68  ? 94.639  -5.179  24.119  1.00 102.83 ? 110 GLU A OE1 1 
ATOM 575  O OE2 . GLU A 1 68  ? 95.893  -4.318  22.521  1.00 102.83 ? 110 GLU A OE2 1 
ATOM 576  N N   . GLU A 1 69  ? 90.476  -6.958  21.635  1.00 102.83 ? 111 GLU A N   1 
ATOM 577  C CA  . GLU A 1 69  ? 90.137  -8.363  21.508  1.00 102.83 ? 111 GLU A CA  1 
ATOM 578  C C   . GLU A 1 69  ? 89.250  -8.568  20.291  1.00 102.83 ? 111 GLU A C   1 
ATOM 579  O O   . GLU A 1 69  ? 89.470  -9.466  19.478  1.00 102.83 ? 111 GLU A O   1 
ATOM 580  C CB  . GLU A 1 69  ? 89.384  -8.810  22.756  1.00 102.83 ? 111 GLU A CB  1 
ATOM 581  C CG  . GLU A 1 69  ? 90.097  -8.503  24.063  1.00 102.83 ? 111 GLU A CG  1 
ATOM 582  C CD  . GLU A 1 69  ? 91.419  -9.228  24.199  1.00 102.83 ? 111 GLU A CD  1 
ATOM 583  O OE1 . GLU A 1 69  ? 91.532  -10.359 23.693  1.00 102.83 ? 111 GLU A OE1 1 
ATOM 584  O OE2 . GLU A 1 69  ? 92.348  -8.669  24.814  1.00 102.83 ? 111 GLU A OE2 1 
ATOM 585  N N   . MET A 1 70  ? 88.277  -7.677  20.163  1.00 102.83 ? 112 MET A N   1 
ATOM 586  C CA  . MET A 1 70  ? 87.303  -7.715  19.090  1.00 102.83 ? 112 MET A CA  1 
ATOM 587  C C   . MET A 1 70  ? 87.841  -8.010  17.697  1.00 102.83 ? 112 MET A C   1 
ATOM 588  O O   . MET A 1 70  ? 87.480  -9.021  17.095  1.00 102.83 ? 112 MET A O   1 
ATOM 589  C CB  . MET A 1 70  ? 86.520  -6.410  19.059  1.00 102.83 ? 112 MET A CB  1 
ATOM 590  C CG  . MET A 1 70  ? 85.236  -6.544  18.293  1.00 102.83 ? 112 MET A CG  1 
ATOM 591  S SD  . MET A 1 70  ? 84.442  -8.069  18.824  1.00 102.83 ? 112 MET A SD  1 
ATOM 592  C CE  . MET A 1 70  ? 83.233  -7.450  20.007  1.00 102.83 ? 112 MET A CE  1 
ATOM 593  N N   . GLU A 1 71  ? 88.661  -7.100  17.173  1.00 102.83 ? 113 GLU A N   1 
ATOM 594  C CA  . GLU A 1 71  ? 89.233  -7.254  15.837  1.00 102.83 ? 113 GLU A CA  1 
ATOM 595  C C   . GLU A 1 71  ? 89.885  -8.610  15.620  1.00 102.83 ? 113 GLU A C   1 
ATOM 596  O O   . GLU A 1 71  ? 89.633  -9.265  14.617  1.00 102.83 ? 113 GLU A O   1 
ATOM 597  C CB  . GLU A 1 71  ? 90.238  -6.135  15.532  1.00 102.83 ? 113 GLU A CB  1 
ATOM 598  C CG  . GLU A 1 71  ? 89.614  -4.776  15.192  1.00 102.83 ? 113 GLU A CG  1 
ATOM 599  C CD  . GLU A 1 71  ? 89.033  -4.692  13.780  1.00 102.83 ? 113 GLU A CD  1 
ATOM 600  O OE1 . GLU A 1 71  ? 89.143  -5.671  13.012  1.00 102.83 ? 113 GLU A OE1 1 
ATOM 601  O OE2 . GLU A 1 71  ? 88.470  -3.629  13.432  1.00 102.83 ? 113 GLU A OE2 1 
ATOM 602  N N   . LEU A 1 72  ? 90.670  -9.051  16.594  1.00 102.83 ? 114 LEU A N   1 
ATOM 603  C CA  . LEU A 1 72  ? 91.367  -10.328 16.513  1.00 102.83 ? 114 LEU A CA  1 
ATOM 604  C C   . LEU A 1 72  ? 90.417  -11.486 16.187  1.00 102.83 ? 114 LEU A C   1 
ATOM 605  O O   . LEU A 1 72  ? 90.699  -12.326 15.323  1.00 102.83 ? 114 LEU A O   1 
ATOM 606  C CB  . LEU A 1 72  ? 92.083  -10.581 17.833  1.00 102.83 ? 114 LEU A CB  1 
ATOM 607  C CG  . LEU A 1 72  ? 93.034  -11.770 17.853  1.00 102.83 ? 114 LEU A CG  1 
ATOM 608  C CD1 . LEU A 1 72  ? 94.098  -11.600 16.778  1.00 102.83 ? 114 LEU A CD1 1 
ATOM 609  C CD2 . LEU A 1 72  ? 93.659  -11.874 19.224  1.00 102.83 ? 114 LEU A CD2 1 
ATOM 610  N N   . TYR A 1 73  ? 89.288  -11.516 16.883  1.00 102.83 ? 115 TYR A N   1 
ATOM 611  C CA  . TYR A 1 73  ? 88.290  -12.548 16.667  1.00 102.83 ? 115 TYR A CA  1 
ATOM 612  C C   . TYR A 1 73  ? 87.686  -12.308 15.304  1.00 102.83 ? 115 TYR A C   1 
ATOM 613  O O   . TYR A 1 73  ? 87.593  -13.217 14.480  1.00 102.83 ? 115 TYR A O   1 
ATOM 614  C CB  . TYR A 1 73  ? 87.227  -12.443 17.740  1.00 102.83 ? 115 TYR A CB  1 
ATOM 615  C CG  . TYR A 1 73  ? 85.989  -13.265 17.497  1.00 102.83 ? 115 TYR A CG  1 
ATOM 616  C CD1 . TYR A 1 73  ? 85.877  -14.565 17.997  1.00 102.83 ? 115 TYR A CD1 1 
ATOM 617  C CD2 . TYR A 1 73  ? 84.891  -12.712 16.840  1.00 102.83 ? 115 TYR A CD2 1 
ATOM 618  C CE1 . TYR A 1 73  ? 84.695  -15.287 17.860  1.00 102.83 ? 115 TYR A CE1 1 
ATOM 619  C CE2 . TYR A 1 73  ? 83.711  -13.420 16.693  1.00 102.83 ? 115 TYR A CE2 1 
ATOM 620  C CZ  . TYR A 1 73  ? 83.614  -14.703 17.210  1.00 102.83 ? 115 TYR A CZ  1 
ATOM 621  O OH  . TYR A 1 73  ? 82.417  -15.372 17.103  1.00 102.83 ? 115 TYR A OH  1 
ATOM 622  N N   . ARG A 1 74  ? 87.334  -11.051 15.063  1.00 102.83 ? 116 ARG A N   1 
ATOM 623  C CA  . ARG A 1 74  ? 86.763  -10.623 13.804  1.00 102.83 ? 116 ARG A CA  1 
ATOM 624  C C   . ARG A 1 74  ? 87.695  -11.096 12.692  1.00 102.83 ? 116 ARG A C   1 
ATOM 625  O O   . ARG A 1 74  ? 87.293  -11.212 11.541  1.00 102.83 ? 116 ARG A O   1 
ATOM 626  C CB  . ARG A 1 74  ? 86.638  -9.100  13.826  1.00 102.83 ? 116 ARG A CB  1 
ATOM 627  C CG  . ARG A 1 74  ? 85.895  -8.480  12.661  1.00 102.83 ? 116 ARG A CG  1 
ATOM 628  C CD  . ARG A 1 74  ? 85.409  -7.067  13.013  1.00 102.83 ? 116 ARG A CD  1 
ATOM 629  N NE  . ARG A 1 74  ? 84.321  -7.080  13.997  1.00 102.83 ? 116 ARG A NE  1 
ATOM 630  C CZ  . ARG A 1 74  ? 83.455  -6.082  14.189  1.00 102.83 ? 116 ARG A CZ  1 
ATOM 631  N NH1 . ARG A 1 74  ? 83.533  -4.962  13.479  1.00 102.83 ? 116 ARG A NH1 1 
ATOM 632  N NH2 . ARG A 1 74  ? 82.474  -6.217  15.072  1.00 102.83 ? 116 ARG A NH2 1 
ATOM 633  N N   . GLN A 1 75  ? 88.924  -11.437 13.071  1.00 102.83 ? 117 GLN A N   1 
ATOM 634  C CA  . GLN A 1 75  ? 89.917  -11.913 12.128  1.00 102.83 ? 117 GLN A CA  1 
ATOM 635  C C   . GLN A 1 75  ? 89.967  -13.399 11.910  1.00 102.83 ? 117 GLN A C   1 
ATOM 636  O O   . GLN A 1 75  ? 89.839  -13.865 10.780  1.00 102.83 ? 117 GLN A O   1 
ATOM 637  C CB  . GLN A 1 75  ? 91.298  -11.390 12.496  1.00 102.83 ? 117 GLN A CB  1 
ATOM 638  C CG  . GLN A 1 75  ? 91.396  -9.914  12.224  1.00 102.83 ? 117 GLN A CG  1 
ATOM 639  C CD  . GLN A 1 75  ? 90.576  -9.525  10.996  1.00 102.83 ? 117 GLN A CD  1 
ATOM 640  O OE1 . GLN A 1 75  ? 90.867  -9.962  9.877   1.00 102.83 ? 117 GLN A OE1 1 
ATOM 641  N NE2 . GLN A 1 75  ? 89.509  -8.756  11.210  1.00 102.83 ? 117 GLN A NE2 1 
ATOM 642  N N   . LYS A 1 76  ? 90.193  -14.141 12.983  1.00 102.83 ? 118 LYS A N   1 
ATOM 643  C CA  . LYS A 1 76  ? 90.267  -15.589 12.893  1.00 102.83 ? 118 LYS A CA  1 
ATOM 644  C C   . LYS A 1 76  ? 89.025  -16.153 12.204  1.00 102.83 ? 118 LYS A C   1 
ATOM 645  O O   . LYS A 1 76  ? 89.099  -17.066 11.381  1.00 102.83 ? 118 LYS A O   1 
ATOM 646  C CB  . LYS A 1 76  ? 90.416  -16.175 14.302  1.00 102.83 ? 118 LYS A CB  1 
ATOM 647  C CG  . LYS A 1 76  ? 90.469  -17.699 14.361  1.00 102.83 ? 118 LYS A CG  1 
ATOM 648  C CD  . LYS A 1 76  ? 91.692  -18.272 13.646  1.00 102.83 ? 118 LYS A CD  1 
ATOM 649  C CE  . LYS A 1 76  ? 91.617  -19.797 13.552  1.00 102.83 ? 118 LYS A CE  1 
ATOM 650  N NZ  . LYS A 1 76  ? 90.448  -20.271 12.743  1.00 102.83 ? 118 LYS A NZ  1 
ATOM 651  N N   . VAL A 1 77  ? 87.895  -15.535 12.497  1.00 102.83 ? 119 VAL A N   1 
ATOM 652  C CA  . VAL A 1 77  ? 86.634  -15.962 11.954  1.00 102.83 ? 119 VAL A CA  1 
ATOM 653  C C   . VAL A 1 77  ? 86.432  -15.544 10.513  1.00 102.83 ? 119 VAL A C   1 
ATOM 654  O O   . VAL A 1 77  ? 85.894  -16.304 9.716   1.00 102.83 ? 119 VAL A O   1 
ATOM 655  C CB  . VAL A 1 77  ? 85.520  -15.428 12.818  1.00 102.83 ? 119 VAL A CB  1 
ATOM 656  C CG1 . VAL A 1 77  ? 84.198  -15.954 12.343  1.00 102.83 ? 119 VAL A CG1 1 
ATOM 657  C CG2 . VAL A 1 77  ? 85.774  -15.824 14.261  1.00 102.83 ? 119 VAL A CG2 1 
ATOM 658  N N   . GLU A 1 78  ? 86.923  -14.361 10.168  1.00 102.83 ? 120 GLU A N   1 
ATOM 659  C CA  . GLU A 1 78  ? 86.803  -13.829 8.814   1.00 102.83 ? 120 GLU A CA  1 
ATOM 660  C C   . GLU A 1 78  ? 86.908  -14.803 7.638   1.00 102.83 ? 120 GLU A C   1 
ATOM 661  O O   . GLU A 1 78  ? 86.151  -14.691 6.681   1.00 102.83 ? 120 GLU A O   1 
ATOM 662  C CB  . GLU A 1 78  ? 87.818  -12.712 8.606   1.00 102.83 ? 120 GLU A CB  1 
ATOM 663  C CG  . GLU A 1 78  ? 87.210  -11.325 8.540   1.00 102.83 ? 120 GLU A CG  1 
ATOM 664  C CD  . GLU A 1 78  ? 86.369  -11.088 7.293   1.00 102.83 ? 120 GLU A CD  1 
ATOM 665  O OE1 . GLU A 1 78  ? 86.428  -11.912 6.352   1.00 102.83 ? 120 GLU A OE1 1 
ATOM 666  O OE2 . GLU A 1 78  ? 85.652  -10.060 7.253   1.00 102.83 ? 120 GLU A OE2 1 
ATOM 667  N N   . PRO A 1 79  ? 87.867  -15.749 7.681   1.00 72.25  ? 121 PRO A N   1 
ATOM 668  C CA  . PRO A 1 79  ? 88.108  -16.759 6.632   1.00 72.25  ? 121 PRO A CA  1 
ATOM 669  C C   . PRO A 1 79  ? 87.001  -17.792 6.473   1.00 72.25  ? 121 PRO A C   1 
ATOM 670  O O   . PRO A 1 79  ? 86.678  -18.244 5.370   1.00 72.25  ? 121 PRO A O   1 
ATOM 671  C CB  . PRO A 1 79  ? 89.372  -17.468 7.128   1.00 72.25  ? 121 PRO A CB  1 
ATOM 672  C CG  . PRO A 1 79  ? 90.036  -16.458 8.023   1.00 72.25  ? 121 PRO A CG  1 
ATOM 673  C CD  . PRO A 1 79  ? 88.874  -15.874 8.748   1.00 72.25  ? 121 PRO A CD  1 
ATOM 674  N N   . LEU A 1 80  ? 86.477  -18.200 7.615   1.00 72.25  ? 122 LEU A N   1 
ATOM 675  C CA  . LEU A 1 80  ? 85.430  -19.190 7.689   1.00 72.25  ? 122 LEU A CA  1 
ATOM 676  C C   . LEU A 1 80  ? 84.227  -18.612 6.977   1.00 72.25  ? 122 LEU A C   1 
ATOM 677  O O   . LEU A 1 80  ? 83.456  -19.328 6.357   1.00 72.25  ? 122 LEU A O   1 
ATOM 678  C CB  . LEU A 1 80  ? 85.146  -19.472 9.154   1.00 72.25  ? 122 LEU A CB  1 
ATOM 679  C CG  . LEU A 1 80  ? 86.419  -19.275 9.990   1.00 72.25  ? 122 LEU A CG  1 
ATOM 680  C CD1 . LEU A 1 80  ? 86.142  -19.564 11.431  1.00 72.25  ? 122 LEU A CD1 1 
ATOM 681  C CD2 . LEU A 1 80  ? 87.571  -20.133 9.482   1.00 72.25  ? 122 LEU A CD2 1 
ATOM 682  N N   . ARG A 1 81  ? 84.149  -17.287 6.991   1.00 72.25  ? 123 ARG A N   1 
ATOM 683  C CA  . ARG A 1 81  ? 83.078  -16.562 6.333   1.00 72.25  ? 123 ARG A CA  1 
ATOM 684  C C   . ARG A 1 81  ? 83.019  -16.910 4.852   1.00 72.25  ? 123 ARG A C   1 
ATOM 685  O O   . ARG A 1 81  ? 82.027  -17.456 4.406   1.00 72.25  ? 123 ARG A O   1 
ATOM 686  C CB  . ARG A 1 81  ? 83.277  -15.056 6.491   1.00 72.25  ? 123 ARG A CB  1 
ATOM 687  C CG  . ARG A 1 81  ? 82.305  -14.229 5.677   1.00 72.25  ? 123 ARG A CG  1 
ATOM 688  C CD  . ARG A 1 81  ? 82.752  -12.787 5.568   1.00 72.25  ? 123 ARG A CD  1 
ATOM 689  N NE  . ARG A 1 81  ? 81.780  -11.991 4.825   1.00 72.25  ? 123 ARG A NE  1 
ATOM 690  C CZ  . ARG A 1 81  ? 81.870  -10.679 4.625   1.00 72.25  ? 123 ARG A CZ  1 
ATOM 691  N NH1 . ARG A 1 81  ? 82.896  -9.984  5.104   1.00 72.25  ? 123 ARG A NH1 1 
ATOM 692  N NH2 . ARG A 1 81  ? 80.921  -10.057 3.947   1.00 72.25  ? 123 ARG A NH2 1 
ATOM 693  N N   . ALA A 1 82  ? 84.080  -16.598 4.106   1.00 72.25  ? 124 ALA A N   1 
ATOM 694  C CA  . ALA A 1 82  ? 84.150  -16.868 2.662   1.00 72.25  ? 124 ALA A CA  1 
ATOM 695  C C   . ALA A 1 82  ? 83.810  -18.313 2.317   1.00 72.25  ? 124 ALA A C   1 
ATOM 696  O O   . ALA A 1 82  ? 83.133  -18.600 1.323   1.00 72.25  ? 124 ALA A O   1 
ATOM 697  C CB  . ALA A 1 82  ? 85.532  -16.516 2.131   1.00 72.25  ? 124 ALA A CB  1 
ATOM 698  N N   . GLU A 1 83  ? 84.296  -19.214 3.157   1.00 72.25  ? 125 GLU A N   1 
ATOM 699  C CA  . GLU A 1 83  ? 84.059  -20.633 3.004   1.00 72.25  ? 125 GLU A CA  1 
ATOM 700  C C   . GLU A 1 83  ? 82.559  -20.899 2.997   1.00 72.25  ? 125 GLU A C   1 
ATOM 701  O O   . GLU A 1 83  ? 82.074  -21.805 2.320   1.00 72.25  ? 125 GLU A O   1 
ATOM 702  C CB  . GLU A 1 83  ? 84.723  -21.342 4.169   1.00 72.25  ? 125 GLU A CB  1 
ATOM 703  C CG  . GLU A 1 83  ? 84.232  -22.743 4.415   1.00 72.25  ? 125 GLU A CG  1 
ATOM 704  C CD  . GLU A 1 83  ? 84.505  -23.195 5.836   1.00 72.25  ? 125 GLU A CD  1 
ATOM 705  O OE1 . GLU A 1 83  ? 83.857  -22.646 6.760   1.00 72.25  ? 125 GLU A OE1 1 
ATOM 706  O OE2 . GLU A 1 83  ? 85.370  -24.085 6.024   1.00 72.25  ? 125 GLU A OE2 1 
ATOM 707  N N   . LEU A 1 84  ? 81.839  -20.086 3.756   1.00 72.25  ? 126 LEU A N   1 
ATOM 708  C CA  . LEU A 1 84  ? 80.403  -20.198 3.862   1.00 72.25  ? 126 LEU A CA  1 
ATOM 709  C C   . LEU A 1 84  ? 79.755  -19.180 2.958   1.00 72.25  ? 126 LEU A C   1 
ATOM 710  O O   . LEU A 1 84  ? 78.663  -19.395 2.448   1.00 72.25  ? 126 LEU A O   1 
ATOM 711  C CB  . LEU A 1 84  ? 80.007  -19.911 5.294   1.00 72.25  ? 126 LEU A CB  1 
ATOM 712  C CG  . LEU A 1 84  ? 80.998  -20.576 6.230   1.00 72.25  ? 126 LEU A CG  1 
ATOM 713  C CD1 . LEU A 1 84  ? 80.878  -19.998 7.601   1.00 72.25  ? 126 LEU A CD1 1 
ATOM 714  C CD2 . LEU A 1 84  ? 80.800  -22.069 6.216   1.00 72.25  ? 126 LEU A CD2 1 
ATOM 715  N N   . GLN A 1 85  ? 80.478  -18.098 2.712   1.00 72.25  ? 127 GLN A N   1 
ATOM 716  C CA  . GLN A 1 85  ? 79.990  -17.005 1.901   1.00 72.25  ? 127 GLN A CA  1 
ATOM 717  C C   . GLN A 1 85  ? 79.857  -17.463 0.479   1.00 72.25  ? 127 GLN A C   1 
ATOM 718  O O   . GLN A 1 85  ? 78.757  -17.732 0.008   1.00 72.25  ? 127 GLN A O   1 
ATOM 719  C CB  . GLN A 1 85  ? 80.946  -15.828 1.970   1.00 72.25  ? 127 GLN A CB  1 
ATOM 720  C CG  . GLN A 1 85  ? 80.433  -14.599 1.271   1.00 72.25  ? 127 GLN A CG  1 
ATOM 721  C CD  . GLN A 1 85  ? 81.516  -13.574 1.049   1.00 72.25  ? 127 GLN A CD  1 
ATOM 722  O OE1 . GLN A 1 85  ? 81.477  -12.832 0.071   1.00 72.25  ? 127 GLN A OE1 1 
ATOM 723  N NE2 . GLN A 1 85  ? 82.506  -13.534 1.945   1.00 72.25  ? 127 GLN A NE2 1 
ATOM 724  N N   . GLU A 1 86  ? 80.983  -17.567 -0.209  1.00 72.25  ? 128 GLU A N   1 
ATOM 725  C CA  . GLU A 1 86  ? 80.945  -18.016 -1.577  1.00 72.25  ? 128 GLU A CA  1 
ATOM 726  C C   . GLU A 1 86  ? 80.498  -19.475 -1.592  1.00 72.25  ? 128 GLU A C   1 
ATOM 727  O O   . GLU A 1 86  ? 79.770  -19.893 -2.496  1.00 72.25  ? 128 GLU A O   1 
ATOM 728  C CB  . GLU A 1 86  ? 82.304  -17.831 -2.230  1.00 72.25  ? 128 GLU A CB  1 
ATOM 729  C CG  . GLU A 1 86  ? 82.260  -18.018 -3.735  1.00 72.25  ? 128 GLU A CG  1 
ATOM 730  C CD  . GLU A 1 86  ? 83.493  -17.475 -4.438  1.00 72.25  ? 128 GLU A CD  1 
ATOM 731  O OE1 . GLU A 1 86  ? 84.619  -17.674 -3.925  1.00 72.25  ? 128 GLU A OE1 1 
ATOM 732  O OE2 . GLU A 1 86  ? 83.335  -16.849 -5.510  1.00 72.25  ? 128 GLU A OE2 1 
ATOM 733  N N   . GLY A 1 87  ? 80.833  -20.196 -0.519  1.00 72.25  ? 129 GLY A N   1 
ATOM 734  C CA  . GLY A 1 87  ? 80.467  -21.600 -0.389  1.00 72.25  ? 129 GLY A CA  1 
ATOM 735  C C   . GLY A 1 87  ? 78.984  -21.872 -0.583  1.00 72.25  ? 129 GLY A C   1 
ATOM 736  O O   . GLY A 1 87  ? 78.598  -22.899 -1.145  1.00 72.25  ? 129 GLY A O   1 
ATOM 737  N N   . ALA A 1 88  ? 78.149  -20.944 -0.132  1.00 72.25  ? 130 ALA A N   1 
ATOM 738  C CA  . ALA A 1 88  ? 76.711  -21.086 -0.274  1.00 72.25  ? 130 ALA A CA  1 
ATOM 739  C C   . ALA A 1 88  ? 76.261  -20.581 -1.646  1.00 72.25  ? 130 ALA A C   1 
ATOM 740  O O   . ALA A 1 88  ? 75.597  -21.306 -2.393  1.00 72.25  ? 130 ALA A O   1 
ATOM 741  C CB  . ALA A 1 88  ? 76.014  -20.322 0.819   1.00 72.25  ? 130 ALA A CB  1 
ATOM 742  N N   . ARG A 1 89  ? 76.640  -19.341 -1.963  1.00 72.25  ? 131 ARG A N   1 
ATOM 743  C CA  . ARG A 1 89  ? 76.313  -18.678 -3.229  1.00 72.25  ? 131 ARG A CA  1 
ATOM 744  C C   . ARG A 1 89  ? 76.246  -19.655 -4.371  1.00 72.25  ? 131 ARG A C   1 
ATOM 745  O O   . ARG A 1 89  ? 75.328  -19.626 -5.182  1.00 72.25  ? 131 ARG A O   1 
ATOM 746  C CB  . ARG A 1 89  ? 77.387  -17.646 -3.572  1.00 72.25  ? 131 ARG A CB  1 
ATOM 747  C CG  . ARG A 1 89  ? 77.400  -16.425 -2.679  1.00 72.25  ? 131 ARG A CG  1 
ATOM 748  C CD  . ARG A 1 89  ? 78.641  -15.560 -2.906  1.00 72.25  ? 131 ARG A CD  1 
ATOM 749  N NE  . ARG A 1 89  ? 78.459  -14.191 -2.421  1.00 72.25  ? 131 ARG A NE  1 
ATOM 750  C CZ  . ARG A 1 89  ? 79.443  -13.315 -2.234  1.00 72.25  ? 131 ARG A CZ  1 
ATOM 751  N NH1 . ARG A 1 89  ? 80.706  -13.651 -2.482  1.00 72.25  ? 131 ARG A NH1 1 
ATOM 752  N NH2 . ARG A 1 89  ? 79.156  -12.079 -1.844  1.00 72.25  ? 131 ARG A NH2 1 
ATOM 753  N N   . GLN A 1 90  ? 77.241  -20.530 -4.397  1.00 72.25  ? 132 GLN A N   1 
ATOM 754  C CA  . GLN A 1 90  ? 77.381  -21.550 -5.417  1.00 72.25  ? 132 GLN A CA  1 
ATOM 755  C C   . GLN A 1 90  ? 76.211  -22.493 -5.505  1.00 72.25  ? 132 GLN A C   1 
ATOM 756  O O   . GLN A 1 90  ? 75.517  -22.527 -6.513  1.00 72.25  ? 132 GLN A O   1 
ATOM 757  C CB  . GLN A 1 90  ? 78.654  -22.353 -5.178  1.00 72.25  ? 132 GLN A CB  1 
ATOM 758  C CG  . GLN A 1 90  ? 79.932  -21.555 -5.385  1.00 72.25  ? 132 GLN A CG  1 
ATOM 759  C CD  . GLN A 1 90  ? 80.243  -21.278 -6.856  1.00 72.25  ? 132 GLN A CD  1 
ATOM 760  O OE1 . GLN A 1 90  ? 79.408  -20.754 -7.601  1.00 72.25  ? 132 GLN A OE1 1 
ATOM 761  N NE2 . GLN A 1 90  ? 81.464  -21.616 -7.272  1.00 72.25  ? 132 GLN A NE2 1 
ATOM 762  N N   . LYS A 1 91  ? 75.985  -23.256 -4.449  1.00 72.25  ? 133 LYS A N   1 
ATOM 763  C CA  . LYS A 1 91  ? 74.895  -24.210 -4.455  1.00 72.25  ? 133 LYS A CA  1 
ATOM 764  C C   . LYS A 1 91  ? 73.577  -23.531 -4.792  1.00 72.25  ? 133 LYS A C   1 
ATOM 765  O O   . LYS A 1 91  ? 72.722  -24.106 -5.461  1.00 72.25  ? 133 LYS A O   1 
ATOM 766  C CB  . LYS A 1 91  ? 74.860  -24.968 -3.126  1.00 72.25  ? 133 LYS A CB  1 
ATOM 767  C CG  . LYS A 1 91  ? 76.181  -25.736 -2.876  1.00 72.25  ? 133 LYS A CG  1 
ATOM 768  C CD  . LYS A 1 91  ? 76.131  -26.749 -1.721  1.00 72.25  ? 133 LYS A CD  1 
ATOM 769  C CE  . LYS A 1 91  ? 77.415  -27.612 -1.667  1.00 72.25  ? 133 LYS A CE  1 
ATOM 770  N NZ  . LYS A 1 91  ? 77.383  -28.727 -0.656  1.00 72.25  ? 133 LYS A NZ  1 
ATOM 771  N N   . LEU A 1 92  ? 73.487  -22.251 -4.464  1.00 72.25  ? 134 LEU A N   1 
ATOM 772  C CA  . LEU A 1 92  ? 72.278  -21.498 -4.738  1.00 72.25  ? 134 LEU A CA  1 
ATOM 773  C C   . LEU A 1 92  ? 72.272  -21.129 -6.199  1.00 72.25  ? 134 LEU A C   1 
ATOM 774  O O   . LEU A 1 92  ? 71.250  -21.225 -6.865  1.00 72.25  ? 134 LEU A O   1 
ATOM 775  C CB  . LEU A 1 92  ? 72.243  -20.238 -3.897  1.00 72.25  ? 134 LEU A CB  1 
ATOM 776  C CG  . LEU A 1 92  ? 72.774  -20.442 -2.478  1.00 72.25  ? 134 LEU A CG  1 
ATOM 777  C CD1 . LEU A 1 92  ? 72.273  -19.323 -1.600  1.00 72.25  ? 134 LEU A CD1 1 
ATOM 778  C CD2 . LEU A 1 92  ? 72.335  -21.776 -1.901  1.00 72.25  ? 134 LEU A CD2 1 
ATOM 779  N N   . HIS A 1 93  ? 73.438  -20.732 -6.690  1.00 72.25  ? 135 HIS A N   1 
ATOM 780  C CA  . HIS A 1 93  ? 73.625  -20.351 -8.087  1.00 72.25  ? 135 HIS A CA  1 
ATOM 781  C C   . HIS A 1 93  ? 73.164  -21.491 -8.987  1.00 72.25  ? 135 HIS A C   1 
ATOM 782  O O   . HIS A 1 93  ? 72.257  -21.327 -9.803  1.00 72.25  ? 135 HIS A O   1 
ATOM 783  C CB  . HIS A 1 93  ? 75.107  -20.106 -8.364  1.00 72.25  ? 135 HIS A CB  1 
ATOM 784  C CG  . HIS A 1 93  ? 75.449  -18.687 -8.697  1.00 72.25  ? 135 HIS A CG  1 
ATOM 785  N ND1 . HIS A 1 93  ? 75.478  -18.211 -9.992  1.00 72.25  ? 135 HIS A ND1 1 
ATOM 786  C CD2 . HIS A 1 93  ? 75.855  -17.665 -7.911  1.00 72.25  ? 135 HIS A CD2 1 
ATOM 787  C CE1 . HIS A 1 93  ? 75.895  -16.956 -9.989  1.00 72.25  ? 135 HIS A CE1 1 
ATOM 788  N NE2 . HIS A 1 93  ? 76.130  -16.601 -8.738  1.00 72.25  ? 135 HIS A NE2 1 
ATOM 789  N N   . GLU A 1 94  ? 73.813  -22.645 -8.826  1.00 72.25  ? 136 GLU A N   1 
ATOM 790  C CA  . GLU A 1 94  ? 73.513  -23.847 -9.603  1.00 72.25  ? 136 GLU A CA  1 
ATOM 791  C C   . GLU A 1 94  ? 72.021  -24.033 -9.631  1.00 72.25  ? 136 GLU A C   1 
ATOM 792  O O   . GLU A 1 94  ? 71.393  -24.047 -10.682 1.00 72.25  ? 136 GLU A O   1 
ATOM 793  C CB  . GLU A 1 94  ? 74.088  -25.106 -8.933  1.00 72.25  ? 136 GLU A CB  1 
ATOM 794  C CG  . GLU A 1 94  ? 75.602  -25.172 -8.734  1.00 72.25  ? 136 GLU A CG  1 
ATOM 795  C CD  . GLU A 1 94  ? 76.065  -26.452 -8.006  1.00 72.25  ? 136 GLU A CD  1 
ATOM 796  O OE1 . GLU A 1 94  ? 75.276  -27.034 -7.217  1.00 72.25  ? 136 GLU A OE1 1 
ATOM 797  O OE2 . GLU A 1 94  ? 77.230  -26.870 -8.223  1.00 72.25  ? 136 GLU A OE2 1 
ATOM 798  N N   . LEU A 1 95  ? 71.471  -24.138 -8.433  1.00 72.25  ? 137 LEU A N   1 
ATOM 799  C CA  . LEU A 1 95  ? 70.066  -24.357 -8.248  1.00 72.25  ? 137 LEU A CA  1 
ATOM 800  C C   . LEU A 1 95  ? 69.212  -23.604 -9.218  1.00 72.25  ? 137 LEU A C   1 
ATOM 801  O O   . LEU A 1 95  ? 68.554  -24.211 -10.052 1.00 72.25  ? 137 LEU A O   1 
ATOM 802  C CB  . LEU A 1 95  ? 69.657  -23.988 -6.838  1.00 72.25  ? 137 LEU A CB  1 
ATOM 803  C CG  . LEU A 1 95  ? 68.192  -24.304 -6.581  1.00 72.25  ? 137 LEU A CG  1 
ATOM 804  C CD1 . LEU A 1 95  ? 67.879  -25.719 -7.026  1.00 72.25  ? 137 LEU A CD1 1 
ATOM 805  C CD2 . LEU A 1 95  ? 67.908  -24.132 -5.118  1.00 72.25  ? 137 LEU A CD2 1 
ATOM 806  N N   . GLN A 1 96  ? 69.234  -22.281 -9.115  1.00 72.25  ? 138 GLN A N   1 
ATOM 807  C CA  . GLN A 1 96  ? 68.418  -21.455 -9.985  1.00 72.25  ? 138 GLN A CA  1 
ATOM 808  C C   . GLN A 1 96  ? 68.595  -21.894 -11.420 1.00 72.25  ? 138 GLN A C   1 
ATOM 809  O O   . GLN A 1 96  ? 67.609  -22.046 -12.128 1.00 72.25  ? 138 GLN A O   1 
ATOM 810  C CB  . GLN A 1 96  ? 68.717  -19.951 -9.812  1.00 72.25  ? 138 GLN A CB  1 
ATOM 811  C CG  . GLN A 1 96  ? 67.497  -19.001 -10.090 1.00 72.25  ? 138 GLN A CG  1 
ATOM 812  C CD  . GLN A 1 96  ? 67.729  -17.488 -9.749  1.00 72.25  ? 138 GLN A CD  1 
ATOM 813  O OE1 . GLN A 1 96  ? 68.679  -17.115 -9.052  1.00 72.25  ? 138 GLN A OE1 1 
ATOM 814  N NE2 . GLN A 1 96  ? 66.839  -16.627 -10.250 1.00 72.25  ? 138 GLN A NE2 1 
ATOM 815  N N   . GLU A 1 97  ? 69.826  -22.186 -11.835 1.00 72.25  ? 139 GLU A N   1 
ATOM 816  C CA  . GLU A 1 97  ? 70.017  -22.629 -13.213 1.00 72.25  ? 139 GLU A CA  1 
ATOM 817  C C   . GLU A 1 97  ? 69.409  -24.014 -13.416 1.00 72.25  ? 139 GLU A C   1 
ATOM 818  O O   . GLU A 1 97  ? 68.952  -24.337 -14.510 1.00 72.25  ? 139 GLU A O   1 
ATOM 819  C CB  . GLU A 1 97  ? 71.486  -22.624 -13.646 1.00 72.25  ? 139 GLU A CB  1 
ATOM 820  C CG  . GLU A 1 97  ? 71.667  -22.676 -15.191 1.00 72.25  ? 139 GLU A CG  1 
ATOM 821  C CD  . GLU A 1 97  ? 72.506  -23.871 -15.707 1.00 72.25  ? 139 GLU A CD  1 
ATOM 822  O OE1 . GLU A 1 97  ? 73.582  -24.161 -15.127 1.00 72.25  ? 139 GLU A OE1 1 
ATOM 823  O OE2 . GLU A 1 97  ? 72.100  -24.503 -16.719 1.00 72.25  ? 139 GLU A OE2 1 
ATOM 824  N N   . LYS A 1 98  ? 69.399  -24.840 -12.378 1.00 72.25  ? 140 LYS A N   1 
ATOM 825  C CA  . LYS A 1 98  ? 68.793  -26.143 -12.542 1.00 72.25  ? 140 LYS A CA  1 
ATOM 826  C C   . LYS A 1 98  ? 67.301  -25.983 -12.338 1.00 72.25  ? 140 LYS A C   1 
ATOM 827  O O   . LYS A 1 98  ? 66.554  -26.951 -12.322 1.00 72.25  ? 140 LYS A O   1 
ATOM 828  C CB  . LYS A 1 98  ? 69.363  -27.154 -11.561 1.00 72.25  ? 140 LYS A CB  1 
ATOM 829  C CG  . LYS A 1 98  ? 69.195  -28.585 -12.062 1.00 72.25  ? 140 LYS A CG  1 
ATOM 830  C CD  . LYS A 1 98  ? 69.772  -29.635 -11.111 1.00 72.25  ? 140 LYS A CD  1 
ATOM 831  C CE  . LYS A 1 98  ? 69.644  -31.057 -11.689 1.00 72.25  ? 140 LYS A CE  1 
ATOM 832  N NZ  . LYS A 1 98  ? 70.026  -32.109 -10.700 1.00 72.25  ? 140 LYS A NZ  1 
ATOM 833  N N   . LEU A 1 99  ? 66.868  -24.743 -12.173 1.00 72.25  ? 141 LEU A N   1 
ATOM 834  C CA  . LEU A 1 99  ? 65.462  -24.470 -11.976 1.00 72.25  ? 141 LEU A CA  1 
ATOM 835  C C   . LEU A 1 99  ? 64.802  -23.821 -13.164 1.00 72.25  ? 141 LEU A C   1 
ATOM 836  O O   . LEU A 1 99  ? 63.642  -23.438 -13.108 1.00 72.25  ? 141 LEU A O   1 
ATOM 837  C CB  . LEU A 1 99  ? 65.261  -23.635 -10.726 1.00 72.25  ? 141 LEU A CB  1 
ATOM 838  C CG  . LEU A 1 99  ? 65.786  -24.356 -9.488  1.00 72.25  ? 141 LEU A CG  1 
ATOM 839  C CD1 . LEU A 1 99  ? 65.208  -23.717 -8.262  1.00 72.25  ? 141 LEU A CD1 1 
ATOM 840  C CD2 . LEU A 1 99  ? 65.420  -25.827 -9.523  1.00 72.25  ? 141 LEU A CD2 1 
ATOM 841  N N   . SER A 1 100 ? 65.556  -23.679 -14.243 1.00 72.25  ? 142 SER A N   1 
ATOM 842  C CA  . SER A 1 100 ? 64.995  -23.117 -15.458 1.00 72.25  ? 142 SER A CA  1 
ATOM 843  C C   . SER A 1 100 ? 64.085  -24.119 -16.190 1.00 72.25  ? 142 SER A C   1 
ATOM 844  O O   . SER A 1 100 ? 63.336  -23.712 -17.086 1.00 72.25  ? 142 SER A O   1 
ATOM 845  C CB  . SER A 1 100 ? 66.083  -22.564 -16.387 1.00 72.25  ? 142 SER A CB  1 
ATOM 846  O OG  . SER A 1 100 ? 66.898  -23.596 -16.920 1.00 72.25  ? 142 SER A OG  1 
ATOM 847  N N   . PRO A 1 101 ? 64.180  -25.442 -15.870 1.00 78.45  ? 143 PRO A N   1 
ATOM 848  C CA  . PRO A 1 101 ? 63.312  -26.423 -16.539 1.00 78.45  ? 143 PRO A CA  1 
ATOM 849  C C   . PRO A 1 101 ? 61.860  -26.067 -16.251 1.00 78.45  ? 143 PRO A C   1 
ATOM 850  O O   . PRO A 1 101 ? 60.969  -26.192 -17.099 1.00 78.45  ? 143 PRO A O   1 
ATOM 851  C CB  . PRO A 1 101 ? 63.702  -27.740 -15.849 1.00 78.45  ? 143 PRO A CB  1 
ATOM 852  C CG  . PRO A 1 101 ? 64.352  -27.301 -14.556 1.00 78.45  ? 143 PRO A CG  1 
ATOM 853  C CD  . PRO A 1 101 ? 65.159  -26.163 -15.036 1.00 78.45  ? 143 PRO A CD  1 
ATOM 854  N N   . LEU A 1 102 ? 61.681  -25.526 -15.056 1.00 78.45  ? 144 LEU A N   1 
ATOM 855  C CA  . LEU A 1 102 ? 60.400  -25.096 -14.550 1.00 78.45  ? 144 LEU A CA  1 
ATOM 856  C C   . LEU A 1 102 ? 59.858  -24.013 -15.478 1.00 78.45  ? 144 LEU A C   1 
ATOM 857  O O   . LEU A 1 102 ? 58.662  -23.767 -15.527 1.00 78.45  ? 144 LEU A O   1 
ATOM 858  C CB  . LEU A 1 102 ? 60.607  -24.558 -13.140 1.00 78.45  ? 144 LEU A CB  1 
ATOM 859  C CG  . LEU A 1 102 ? 61.065  -25.573 -12.079 1.00 78.45  ? 144 LEU A CG  1 
ATOM 860  C CD1 . LEU A 1 102 ? 61.496  -26.907 -12.660 1.00 78.45  ? 144 LEU A CD1 1 
ATOM 861  C CD2 . LEU A 1 102 ? 62.163  -24.979 -11.244 1.00 78.45  ? 144 LEU A CD2 1 
ATOM 862  N N   . GLY A 1 103 ? 60.762  -23.373 -16.217 1.00 78.45  ? 145 GLY A N   1 
ATOM 863  C CA  . GLY A 1 103 ? 60.386  -22.344 -17.170 1.00 78.45  ? 145 GLY A CA  1 
ATOM 864  C C   . GLY A 1 103 ? 59.466  -22.924 -18.225 1.00 78.45  ? 145 GLY A C   1 
ATOM 865  O O   . GLY A 1 103 ? 58.252  -22.751 -18.134 1.00 78.45  ? 145 GLY A O   1 
ATOM 866  N N   . GLU A 1 104 ? 60.028  -23.633 -19.207 1.00 78.45  ? 146 GLU A N   1 
ATOM 867  C CA  . GLU A 1 104 ? 59.220  -24.254 -20.267 1.00 78.45  ? 146 GLU A CA  1 
ATOM 868  C C   . GLU A 1 104 ? 58.114  -25.115 -19.649 1.00 78.45  ? 146 GLU A C   1 
ATOM 869  O O   . GLU A 1 104 ? 57.046  -25.287 -20.235 1.00 78.45  ? 146 GLU A O   1 
ATOM 870  C CB  . GLU A 1 104 ? 60.082  -25.130 -21.213 1.00 78.45  ? 146 GLU A CB  1 
ATOM 871  C CG  . GLU A 1 104 ? 59.322  -25.692 -22.472 1.00 78.45  ? 146 GLU A CG  1 
ATOM 872  C CD  . GLU A 1 104 ? 60.110  -26.737 -23.306 1.00 78.45  ? 146 GLU A CD  1 
ATOM 873  O OE1 . GLU A 1 104 ? 60.144  -27.927 -22.903 1.00 78.45  ? 146 GLU A OE1 1 
ATOM 874  O OE2 . GLU A 1 104 ? 60.657  -26.381 -24.384 1.00 78.45  ? 146 GLU A OE2 1 
ATOM 875  N N   . GLU A 1 105 ? 58.372  -25.660 -18.465 1.00 78.45  ? 147 GLU A N   1 
ATOM 876  C CA  . GLU A 1 105 ? 57.375  -26.494 -17.804 1.00 78.45  ? 147 GLU A CA  1 
ATOM 877  C C   . GLU A 1 105 ? 56.215  -25.654 -17.285 1.00 78.45  ? 147 GLU A C   1 
ATOM 878  O O   . GLU A 1 105 ? 55.173  -25.537 -17.936 1.00 78.45  ? 147 GLU A O   1 
ATOM 879  C CB  . GLU A 1 105 ? 58.018  -27.290 -16.663 1.00 78.45  ? 147 GLU A CB  1 
ATOM 880  C CG  . GLU A 1 105 ? 58.054  -28.811 -16.911 1.00 78.45  ? 147 GLU A CG  1 
ATOM 881  C CD  . GLU A 1 105 ? 58.850  -29.594 -15.858 1.00 78.45  ? 147 GLU A CD  1 
ATOM 882  O OE1 . GLU A 1 105 ? 59.233  -28.999 -14.816 1.00 78.45  ? 147 GLU A OE1 1 
ATOM 883  O OE2 . GLU A 1 105 ? 59.090  -30.811 -16.089 1.00 78.45  ? 147 GLU A OE2 1 
ATOM 884  N N   . MET A 1 106 ? 56.426  -25.077 -16.107 1.00 78.45  ? 148 MET A N   1 
ATOM 885  C CA  . MET A 1 106 ? 55.457  -24.228 -15.447 1.00 78.45  ? 148 MET A CA  1 
ATOM 886  C C   . MET A 1 106 ? 54.817  -23.328 -16.488 1.00 78.45  ? 148 MET A C   1 
ATOM 887  O O   . MET A 1 106 ? 53.688  -23.568 -16.895 1.00 78.45  ? 148 MET A O   1 
ATOM 888  C CB  . MET A 1 106 ? 56.183  -23.398 -14.375 1.00 78.45  ? 148 MET A CB  1 
ATOM 889  C CG  . MET A 1 106 ? 55.354  -22.360 -13.622 1.00 78.45  ? 148 MET A CG  1 
ATOM 890  S SD  . MET A 1 106 ? 56.324  -21.372 -12.403 1.00 78.45  ? 148 MET A SD  1 
ATOM 891  C CE  . MET A 1 106 ? 54.989  -20.497 -11.497 1.00 78.45  ? 148 MET A CE  1 
ATOM 892  N N   . ARG A 1 107 ? 55.609  -22.406 -17.029 1.00 78.45  ? 149 ARG A N   1 
ATOM 893  C CA  . ARG A 1 107 ? 55.121  -21.446 -18.017 1.00 78.45  ? 149 ARG A CA  1 
ATOM 894  C C   . ARG A 1 107 ? 54.333  -22.041 -19.176 1.00 78.45  ? 149 ARG A C   1 
ATOM 895  O O   . ARG A 1 107 ? 53.119  -21.863 -19.237 1.00 78.45  ? 149 ARG A O   1 
ATOM 896  C CB  . ARG A 1 107 ? 56.256  -20.536 -18.535 1.00 78.45  ? 149 ARG A CB  1 
ATOM 897  C CG  . ARG A 1 107 ? 55.777  -19.282 -19.327 1.00 78.45  ? 149 ARG A CG  1 
ATOM 898  C CD  . ARG A 1 107 ? 56.890  -18.197 -19.544 1.00 78.45  ? 149 ARG A CD  1 
ATOM 899  N NE  . ARG A 1 107 ? 56.368  -16.902 -20.036 1.00 78.45  ? 149 ARG A NE  1 
ATOM 900  C CZ  . ARG A 1 107 ? 57.047  -15.744 -20.053 1.00 78.45  ? 149 ARG A CZ  1 
ATOM 901  N NH1 . ARG A 1 107 ? 58.303  -15.686 -19.611 1.00 78.45  ? 149 ARG A NH1 1 
ATOM 902  N NH2 . ARG A 1 107 ? 56.466  -14.631 -20.513 1.00 78.45  ? 149 ARG A NH2 1 
ATOM 903  N N   . ASP A 1 108 ? 54.995  -22.760 -20.078 1.00 78.45  ? 150 ASP A N   1 
ATOM 904  C CA  . ASP A 1 108 ? 54.277  -23.329 -21.213 1.00 78.45  ? 150 ASP A CA  1 
ATOM 905  C C   . ASP A 1 108 ? 53.050  -24.109 -20.779 1.00 78.45  ? 150 ASP A C   1 
ATOM 906  O O   . ASP A 1 108 ? 52.070  -24.182 -21.518 1.00 78.45  ? 150 ASP A O   1 
ATOM 907  C CB  . ASP A 1 108 ? 55.180  -24.206 -22.084 1.00 78.45  ? 150 ASP A CB  1 
ATOM 908  C CG  . ASP A 1 108 ? 55.606  -23.512 -23.374 1.00 78.45  ? 150 ASP A CG  1 
ATOM 909  O OD1 . ASP A 1 108 ? 56.586  -22.736 -23.337 1.00 78.45  ? 150 ASP A OD1 1 
ATOM 910  O OD2 . ASP A 1 108 ? 54.967  -23.748 -24.427 1.00 78.45  ? 150 ASP A OD2 1 
ATOM 911  N N   . ARG A 1 109 ? 53.089  -24.660 -19.571 1.00 78.45  ? 151 ARG A N   1 
ATOM 912  C CA  . ARG A 1 109 ? 51.948  -25.407 -19.075 1.00 78.45  ? 151 ARG A CA  1 
ATOM 913  C C   . ARG A 1 109 ? 50.805  -24.472 -18.687 1.00 78.45  ? 151 ARG A C   1 
ATOM 914  O O   . ARG A 1 109 ? 49.679  -24.606 -19.170 1.00 78.45  ? 151 ARG A O   1 
ATOM 915  C CB  . ARG A 1 109 ? 52.342  -26.283 -17.883 1.00 78.45  ? 151 ARG A CB  1 
ATOM 916  C CG  . ARG A 1 109 ? 51.137  -26.897 -17.207 1.00 78.45  ? 151 ARG A CG  1 
ATOM 917  C CD  . ARG A 1 109 ? 51.390  -28.280 -16.646 1.00 78.45  ? 151 ARG A CD  1 
ATOM 918  N NE  . ARG A 1 109 ? 50.123  -28.868 -16.213 1.00 78.45  ? 151 ARG A NE  1 
ATOM 919  C CZ  . ARG A 1 109 ? 49.456  -29.801 -16.890 1.00 78.45  ? 151 ARG A CZ  1 
ATOM 920  N NH1 . ARG A 1 109 ? 49.938  -30.275 -18.034 1.00 78.45  ? 151 ARG A NH1 1 
ATOM 921  N NH2 . ARG A 1 109 ? 48.266  -30.208 -16.462 1.00 78.45  ? 151 ARG A NH2 1 
ATOM 922  N N   . ALA A 1 110 ? 51.121  -23.522 -17.816 1.00 78.45  ? 152 ALA A N   1 
ATOM 923  C CA  . ALA A 1 110 ? 50.162  -22.548 -17.313 1.00 78.45  ? 152 ALA A CA  1 
ATOM 924  C C   . ALA A 1 110 ? 49.622  -21.690 -18.422 1.00 78.45  ? 152 ALA A C   1 
ATOM 925  O O   . ALA A 1 110 ? 48.411  -21.491 -18.537 1.00 78.45  ? 152 ALA A O   1 
ATOM 926  C CB  . ALA A 1 110 ? 50.820  -21.673 -16.290 1.00 78.45  ? 152 ALA A CB  1 
ATOM 927  N N   . ARG A 1 111 ? 50.571  -21.071 -19.117 1.00 78.45  ? 153 ARG A N   1 
ATOM 928  C CA  . ARG A 1 111 ? 50.349  -20.210 -20.259 1.00 78.45  ? 153 ARG A CA  1 
ATOM 929  C C   . ARG A 1 111 ? 48.898  -20.214 -20.665 1.00 78.45  ? 153 ARG A C   1 
ATOM 930  O O   . ARG A 1 111 ? 48.141  -19.304 -20.350 1.00 78.45  ? 153 ARG A O   1 
ATOM 931  C CB  . ARG A 1 111 ? 51.211  -20.723 -21.423 1.00 78.45  ? 153 ARG A CB  1 
ATOM 932  C CG  . ARG A 1 111 ? 50.848  -20.183 -22.810 1.00 78.45  ? 153 ARG A CG  1 
ATOM 933  C CD  . ARG A 1 111 ? 51.620  -20.898 -23.950 1.00 78.45  ? 153 ARG A CD  1 
ATOM 934  N NE  . ARG A 1 111 ? 51.276  -20.363 -25.279 1.00 78.45  ? 153 ARG A NE  1 
ATOM 935  C CZ  . ARG A 1 111 ? 51.928  -20.624 -26.418 1.00 78.45  ? 153 ARG A CZ  1 
ATOM 936  N NH1 . ARG A 1 111 ? 52.988  -21.437 -26.439 1.00 78.45  ? 153 ARG A NH1 1 
ATOM 937  N NH2 . ARG A 1 111 ? 51.532  -20.035 -27.548 1.00 78.45  ? 153 ARG A NH2 1 
ATOM 938  N N   . ALA A 1 112 ? 48.499  -21.343 -21.226 1.00 78.45  ? 154 ALA A N   1 
ATOM 939  C CA  . ALA A 1 112 ? 47.155  -21.528 -21.714 1.00 78.45  ? 154 ALA A CA  1 
ATOM 940  C C   . ALA A 1 112 ? 46.076  -21.142 -20.724 1.00 78.45  ? 154 ALA A C   1 
ATOM 941  O O   . ALA A 1 112 ? 45.419  -20.127 -20.896 1.00 78.45  ? 154 ALA A O   1 
ATOM 942  C CB  . ALA A 1 112 ? 46.970  -22.937 -22.174 1.00 78.45  ? 154 ALA A CB  1 
ATOM 943  N N   . HIS A 1 113 ? 45.909  -21.937 -19.679 1.00 78.45  ? 155 HIS A N   1 
ATOM 944  C CA  . HIS A 1 113 ? 44.880  -21.651 -18.699 1.00 78.45  ? 155 HIS A CA  1 
ATOM 945  C C   . HIS A 1 113 ? 44.889  -20.195 -18.300 1.00 78.45  ? 155 HIS A C   1 
ATOM 946  O O   . HIS A 1 113 ? 43.838  -19.575 -18.188 1.00 78.45  ? 155 HIS A O   1 
ATOM 947  C CB  . HIS A 1 113 ? 45.042  -22.559 -17.497 1.00 78.45  ? 155 HIS A CB  1 
ATOM 948  C CG  . HIS A 1 113 ? 44.951  -24.004 -17.823 1.00 78.45  ? 155 HIS A CG  1 
ATOM 949  N ND1 . HIS A 1 113 ? 46.037  -24.855 -17.786 1.00 78.45  ? 155 HIS A ND1 1 
ATOM 950  C CD2 . HIS A 1 113 ? 43.900  -24.756 -18.252 1.00 78.45  ? 155 HIS A CD2 1 
ATOM 951  C CE1 . HIS A 1 113 ? 45.659  -26.063 -18.169 1.00 78.45  ? 155 HIS A CE1 1 
ATOM 952  N NE2 . HIS A 1 113 ? 44.373  -26.035 -18.459 1.00 78.45  ? 155 HIS A NE2 1 
ATOM 953  N N   . VAL A 1 114 ? 46.082  -19.625 -18.194 1.00 78.45  ? 156 VAL A N   1 
ATOM 954  C CA  . VAL A 1 114 ? 46.228  -18.230 -17.830 1.00 78.45  ? 156 VAL A CA  1 
ATOM 955  C C   . VAL A 1 114 ? 45.431  -17.376 -18.780 1.00 78.45  ? 156 VAL A C   1 
ATOM 956  O O   . VAL A 1 114 ? 44.604  -16.561 -18.381 1.00 78.45  ? 156 VAL A O   1 
ATOM 957  C CB  . VAL A 1 114 ? 47.654  -17.769 -17.998 1.00 78.45  ? 156 VAL A CB  1 
ATOM 958  C CG1 . VAL A 1 114 ? 47.769  -16.325 -17.593 1.00 78.45  ? 156 VAL A CG1 1 
ATOM 959  C CG2 . VAL A 1 114 ? 48.588  -18.652 -17.225 1.00 78.45  ? 156 VAL A CG2 1 
ATOM 960  N N   . ASP A 1 115 ? 45.736  -17.561 -20.052 1.00 78.45  ? 157 ASP A N   1 
ATOM 961  C CA  . ASP A 1 115 ? 45.102  -16.835 -21.133 1.00 78.45  ? 157 ASP A CA  1 
ATOM 962  C C   . ASP A 1 115 ? 43.580  -16.917 -21.087 1.00 78.45  ? 157 ASP A C   1 
ATOM 963  O O   . ASP A 1 115 ? 42.892  -15.960 -21.436 1.00 78.45  ? 157 ASP A O   1 
ATOM 964  C CB  . ASP A 1 115 ? 45.616  -17.394 -22.461 1.00 78.45  ? 157 ASP A CB  1 
ATOM 965  C CG  . ASP A 1 115 ? 45.217  -16.546 -23.652 1.00 78.45  ? 157 ASP A CG  1 
ATOM 966  O OD1 . ASP A 1 115 ? 44.034  -16.601 -24.063 1.00 78.45  ? 157 ASP A OD1 1 
ATOM 967  O OD2 . ASP A 1 115 ? 46.099  -15.836 -24.188 1.00 78.45  ? 157 ASP A OD2 1 
ATOM 968  N N   . ALA A 1 116 ? 43.059  -18.063 -20.662 1.00 78.45  ? 158 ALA A N   1 
ATOM 969  C CA  . ALA A 1 116 ? 41.620  -18.267 -20.586 1.00 78.45  ? 158 ALA A CA  1 
ATOM 970  C C   . ALA A 1 116 ? 40.943  -17.015 -20.080 1.00 78.45  ? 158 ALA A C   1 
ATOM 971  O O   . ALA A 1 116 ? 40.016  -16.501 -20.687 1.00 78.45  ? 158 ALA A O   1 
ATOM 972  C CB  . ALA A 1 116 ? 41.306  -19.432 -19.662 1.00 78.45  ? 158 ALA A CB  1 
ATOM 973  N N   . LEU A 1 117 ? 41.476  -16.478 -19.000 1.00 78.45  ? 159 LEU A N   1 
ATOM 974  C CA  . LEU A 1 117 ? 40.901  -15.291 -18.435 1.00 78.45  ? 159 LEU A CA  1 
ATOM 975  C C   . LEU A 1 117 ? 41.122  -14.094 -19.317 1.00 78.45  ? 159 LEU A C   1 
ATOM 976  O O   . LEU A 1 117 ? 40.204  -13.310 -19.494 1.00 78.45  ? 159 LEU A O   1 
ATOM 977  C CB  . LEU A 1 117 ? 41.416  -15.079 -17.027 1.00 78.45  ? 159 LEU A CB  1 
ATOM 978  C CG  . LEU A 1 117 ? 41.066  -16.303 -16.178 1.00 78.45  ? 159 LEU A CG  1 
ATOM 979  C CD1 . LEU A 1 117 ? 41.077  -15.907 -14.720 1.00 78.45  ? 159 LEU A CD1 1 
ATOM 980  C CD2 . LEU A 1 117 ? 39.692  -16.862 -16.551 1.00 78.45  ? 159 LEU A CD2 1 
ATOM 981  N N   . ARG A 1 118 ? 42.307  -13.991 -19.924 1.00 78.45  ? 160 ARG A N   1 
ATOM 982  C CA  . ARG A 1 118 ? 42.617  -12.879 -20.837 1.00 78.45  ? 160 ARG A CA  1 
ATOM 983  C C   . ARG A 1 118 ? 41.381  -12.664 -21.679 1.00 78.45  ? 160 ARG A C   1 
ATOM 984  O O   . ARG A 1 118 ? 40.892  -11.553 -21.839 1.00 78.45  ? 160 ARG A O   1 
ATOM 985  C CB  . ARG A 1 118 ? 43.783  -13.232 -21.794 1.00 78.45  ? 160 ARG A CB  1 
ATOM 986  C CG  . ARG A 1 118 ? 43.896  -12.308 -23.068 1.00 78.45  ? 160 ARG A CG  1 
ATOM 987  C CD  . ARG A 1 118 ? 44.910  -12.787 -24.165 1.00 78.45  ? 160 ARG A CD  1 
ATOM 988  N NE  . ARG A 1 118 ? 45.109  -11.809 -25.259 1.00 78.45  ? 160 ARG A NE  1 
ATOM 989  C CZ  . ARG A 1 118 ? 46.091  -11.846 -26.176 1.00 78.45  ? 160 ARG A CZ  1 
ATOM 990  N NH1 . ARG A 1 118 ? 47.000  -12.823 -26.179 1.00 78.45  ? 160 ARG A NH1 1 
ATOM 991  N NH2 . ARG A 1 118 ? 46.208  -10.857 -27.066 1.00 78.45  ? 160 ARG A NH2 1 
ATOM 992  N N   . THR A 1 119 ? 40.845  -13.780 -22.142 1.00 78.45  ? 161 THR A N   1 
ATOM 993  C CA  . THR A 1 119 ? 39.674  -13.789 -22.982 1.00 78.45  ? 161 THR A CA  1 
ATOM 994  C C   . THR A 1 119 ? 38.378  -13.735 -22.195 1.00 78.45  ? 161 THR A C   1 
ATOM 995  O O   . THR A 1 119 ? 37.422  -13.094 -22.616 1.00 78.45  ? 161 THR A O   1 
ATOM 996  C CB  . THR A 1 119 ? 39.720  -15.012 -23.884 1.00 78.45  ? 161 THR A CB  1 
ATOM 997  O OG1 . THR A 1 119 ? 40.215  -16.128 -23.131 1.00 78.45  ? 161 THR A OG1 1 
ATOM 998  C CG2 . THR A 1 119 ? 40.656  -14.757 -25.064 1.00 78.45  ? 161 THR A CG2 1 
ATOM 999  N N   . HIS A 1 120 ? 38.350  -14.384 -21.042 1.00 78.45  ? 162 HIS A N   1 
ATOM 1000 C CA  . HIS A 1 120 ? 37.154  -14.368 -20.227 1.00 78.45  ? 162 HIS A CA  1 
ATOM 1001 C C   . HIS A 1 120 ? 36.991  -13.021 -19.565 1.00 78.45  ? 162 HIS A C   1 
ATOM 1002 O O   . HIS A 1 120 ? 35.968  -12.751 -18.951 1.00 78.45  ? 162 HIS A O   1 
ATOM 1003 C CB  . HIS A 1 120 ? 37.209  -15.460 -19.174 1.00 78.45  ? 162 HIS A CB  1 
ATOM 1004 C CG  . HIS A 1 120 ? 36.377  -16.652 -19.513 1.00 78.45  ? 162 HIS A CG  1 
ATOM 1005 N ND1 . HIS A 1 120 ? 35.141  -16.540 -20.111 1.00 78.45  ? 162 HIS A ND1 1 
ATOM 1006 C CD2 . HIS A 1 120 ? 36.601  -17.978 -19.359 1.00 78.45  ? 162 HIS A CD2 1 
ATOM 1007 C CE1 . HIS A 1 120 ? 34.640  -17.746 -20.314 1.00 78.45  ? 162 HIS A CE1 1 
ATOM 1008 N NE2 . HIS A 1 120 ? 35.506  -18.637 -19.864 1.00 78.45  ? 162 HIS A NE2 1 
ATOM 1009 N N   . LEU A 1 121 ? 37.984  -12.158 -19.748 1.00 78.45  ? 163 LEU A N   1 
ATOM 1010 C CA  . LEU A 1 121 ? 37.988  -10.830 -19.160 1.00 78.45  ? 163 LEU A CA  1 
ATOM 1011 C C   . LEU A 1 121 ? 37.714  -9.748  -20.157 1.00 78.45  ? 163 LEU A C   1 
ATOM 1012 O O   . LEU A 1 121 ? 36.758  -8.993  -20.017 1.00 78.45  ? 163 LEU A O   1 
ATOM 1013 C CB  . LEU A 1 121 ? 39.347  -10.518 -18.560 1.00 78.45  ? 163 LEU A CB  1 
ATOM 1014 C CG  . LEU A 1 121 ? 39.647  -11.028 -17.167 1.00 78.45  ? 163 LEU A CG  1 
ATOM 1015 C CD1 . LEU A 1 121 ? 40.814  -10.219 -16.621 1.00 78.45  ? 163 LEU A CD1 1 
ATOM 1016 C CD2 . LEU A 1 121 ? 38.423  -10.860 -16.281 1.00 78.45  ? 163 LEU A CD2 1 
ATOM 1017 N N   . ALA A 1 122 ? 38.613  -9.660  -21.137 1.00 78.45  ? 164 ALA A N   1 
ATOM 1018 C CA  . ALA A 1 122 ? 38.588  -8.664  -22.212 1.00 78.45  ? 164 ALA A CA  1 
ATOM 1019 C C   . ALA A 1 122 ? 37.268  -7.961  -22.481 1.00 78.45  ? 164 ALA A C   1 
ATOM 1020 O O   . ALA A 1 122 ? 37.235  -6.736  -22.626 1.00 78.45  ? 164 ALA A O   1 
ATOM 1021 C CB  . ALA A 1 122 ? 39.137  -9.256  -23.498 1.00 78.45  ? 164 ALA A CB  1 
ATOM 1022 N N   . PRO A 1 123 ? 36.171  -8.729  -22.605 1.00 97.21  ? 165 PRO A N   1 
ATOM 1023 C CA  . PRO A 1 123 ? 34.873  -8.105  -22.858 1.00 97.21  ? 165 PRO A CA  1 
ATOM 1024 C C   . PRO A 1 123 ? 34.486  -7.151  -21.742 1.00 97.21  ? 165 PRO A C   1 
ATOM 1025 O O   . PRO A 1 123 ? 34.055  -6.033  -21.993 1.00 97.21  ? 165 PRO A O   1 
ATOM 1026 C CB  . PRO A 1 123 ? 33.926  -9.304  -22.900 1.00 97.21  ? 165 PRO A CB  1 
ATOM 1027 C CG  . PRO A 1 123 ? 34.650  -10.363 -22.086 1.00 97.21  ? 165 PRO A CG  1 
ATOM 1028 C CD  . PRO A 1 123 ? 36.035  -10.196 -22.607 1.00 97.21  ? 165 PRO A CD  1 
ATOM 1029 N N   . TYR A 1 124 ? 34.649  -7.601  -20.507 1.00 97.21  ? 166 TYR A N   1 
ATOM 1030 C CA  . TYR A 1 124 ? 34.304  -6.786  -19.367 1.00 97.21  ? 166 TYR A CA  1 
ATOM 1031 C C   . TYR A 1 124 ? 35.074  -5.498  -19.304 1.00 97.21  ? 166 TYR A C   1 
ATOM 1032 O O   . TYR A 1 124 ? 34.503  -4.465  -18.994 1.00 97.21  ? 166 TYR A O   1 
ATOM 1033 C CB  . TYR A 1 124 ? 34.423  -7.593  -18.084 1.00 97.21  ? 166 TYR A CB  1 
ATOM 1034 C CG  . TYR A 1 124 ? 33.265  -8.549  -17.913 1.00 97.21  ? 166 TYR A CG  1 
ATOM 1035 C CD1 . TYR A 1 124 ? 32.117  -8.410  -18.690 1.00 97.21  ? 166 TYR A CD1 1 
ATOM 1036 C CD2 . TYR A 1 124 ? 33.296  -9.574  -16.966 1.00 97.21  ? 166 TYR A CD2 1 
ATOM 1037 C CE1 . TYR A 1 124 ? 31.023  -9.258  -18.536 1.00 97.21  ? 166 TYR A CE1 1 
ATOM 1038 C CE2 . TYR A 1 124 ? 32.200  -10.437 -16.800 1.00 97.21  ? 166 TYR A CE2 1 
ATOM 1039 C CZ  . TYR A 1 124 ? 31.066  -10.269 -17.594 1.00 97.21  ? 166 TYR A CZ  1 
ATOM 1040 O OH  . TYR A 1 124 ? 29.966  -11.092 -17.465 1.00 97.21  ? 166 TYR A OH  1 
ATOM 1041 N N   . SER A 1 125 ? 36.363  -5.549  -19.609 1.00 97.21  ? 167 SER A N   1 
ATOM 1042 C CA  . SER A 1 125 ? 37.159  -4.337  -19.619 1.00 97.21  ? 167 SER A CA  1 
ATOM 1043 C C   . SER A 1 125 ? 36.384  -3.427  -20.541 1.00 97.21  ? 167 SER A C   1 
ATOM 1044 O O   . SER A 1 125 ? 35.824  -2.426  -20.113 1.00 97.21  ? 167 SER A O   1 
ATOM 1045 C CB  . SER A 1 125 ? 38.529  -4.612  -20.222 1.00 97.21  ? 167 SER A CB  1 
ATOM 1046 O OG  . SER A 1 125 ? 39.207  -5.608  -19.483 1.00 97.21  ? 167 SER A OG  1 
ATOM 1047 N N   . ASP A 1 126 ? 36.232  -3.886  -21.776 1.00 97.21  ? 168 ASP A N   1 
ATOM 1048 C CA  . ASP A 1 126 ? 35.499  -3.155  -22.797 1.00 97.21  ? 168 ASP A CA  1 
ATOM 1049 C C   . ASP A 1 126 ? 34.153  -2.671  -22.295 1.00 97.21  ? 168 ASP A C   1 
ATOM 1050 O O   . ASP A 1 126 ? 33.761  -1.542  -22.556 1.00 97.21  ? 168 ASP A O   1 
ATOM 1051 C CB  . ASP A 1 126 ? 35.245  -4.046  -24.012 1.00 97.21  ? 168 ASP A CB  1 
ATOM 1052 C CG  . ASP A 1 126 ? 36.365  -4.001  -25.032 1.00 97.21  ? 168 ASP A CG  1 
ATOM 1053 O OD1 . ASP A 1 126 ? 37.432  -3.398  -24.762 1.00 97.21  ? 168 ASP A OD1 1 
ATOM 1054 O OD2 . ASP A 1 126 ? 36.162  -4.580  -26.124 1.00 97.21  ? 168 ASP A OD2 1 
ATOM 1055 N N   . GLU A 1 127 ? 33.463  -3.521  -21.543 1.00 97.21  ? 169 GLU A N   1 
ATOM 1056 C CA  . GLU A 1 127 ? 32.136  -3.193  -21.035 1.00 97.21  ? 169 GLU A CA  1 
ATOM 1057 C C   . GLU A 1 127 ? 32.188  -2.049  -20.051 1.00 97.21  ? 169 GLU A C   1 
ATOM 1058 O O   . GLU A 1 127 ? 31.402  -1.117  -20.145 1.00 97.21  ? 169 GLU A O   1 
ATOM 1059 C CB  . GLU A 1 127 ? 31.477  -4.425  -20.388 1.00 97.21  ? 169 GLU A CB  1 
ATOM 1060 C CG  . GLU A 1 127 ? 29.987  -4.246  -20.001 1.00 97.21  ? 169 GLU A CG  1 
ATOM 1061 C CD  . GLU A 1 127 ? 29.274  -5.562  -19.623 1.00 97.21  ? 169 GLU A CD  1 
ATOM 1062 O OE1 . GLU A 1 127 ? 28.812  -6.293  -20.532 1.00 97.21  ? 169 GLU A OE1 1 
ATOM 1063 O OE2 . GLU A 1 127 ? 29.153  -5.859  -18.414 1.00 97.21  ? 169 GLU A OE2 1 
ATOM 1064 N N   . LEU A 1 128 ? 33.147  -2.103  -19.136 1.00 97.21  ? 170 LEU A N   1 
ATOM 1065 C CA  . LEU A 1 128 ? 33.278  -1.069  -18.129 1.00 97.21  ? 170 LEU A CA  1 
ATOM 1066 C C   . LEU A 1 128 ? 33.853  0.205   -18.651 1.00 97.21  ? 170 LEU A C   1 
ATOM 1067 O O   . LEU A 1 128 ? 33.465  1.290   -18.241 1.00 97.21  ? 170 LEU A O   1 
ATOM 1068 C CB  . LEU A 1 128 ? 34.121  -1.540  -16.959 1.00 97.21  ? 170 LEU A CB  1 
ATOM 1069 C CG  . LEU A 1 128 ? 33.238  -1.954  -15.786 1.00 97.21  ? 170 LEU A CG  1 
ATOM 1070 C CD1 . LEU A 1 128 ? 34.083  -2.052  -14.529 1.00 97.21  ? 170 LEU A CD1 1 
ATOM 1071 C CD2 . LEU A 1 128 ? 32.125  -0.927  -15.579 1.00 97.21  ? 170 LEU A CD2 1 
ATOM 1072 N N   . ARG A 1 129 ? 34.834  0.060   -19.517 1.00 97.21  ? 171 ARG A N   1 
ATOM 1073 C CA  . ARG A 1 129 ? 35.482  1.197   -20.117 1.00 97.21  ? 171 ARG A CA  1 
ATOM 1074 C C   . ARG A 1 129 ? 34.376  2.084   -20.708 1.00 97.21  ? 171 ARG A C   1 
ATOM 1075 O O   . ARG A 1 129 ? 34.198  3.230   -20.296 1.00 97.21  ? 171 ARG A O   1 
ATOM 1076 C CB  . ARG A 1 129 ? 36.447  0.686   -21.195 1.00 97.21  ? 171 ARG A CB  1 
ATOM 1077 C CG  . ARG A 1 129 ? 37.603  -0.195  -20.666 1.00 97.21  ? 171 ARG A CG  1 
ATOM 1078 C CD  . ARG A 1 129 ? 38.305  -0.974  -21.803 1.00 97.21  ? 171 ARG A CD  1 
ATOM 1079 N NE  . ARG A 1 129 ? 39.766  -1.030  -21.643 1.00 97.21  ? 171 ARG A NE  1 
ATOM 1080 C CZ  . ARG A 1 129 ? 40.635  -1.340  -22.613 1.00 97.21  ? 171 ARG A CZ  1 
ATOM 1081 N NH1 . ARG A 1 129 ? 40.210  -1.655  -23.837 1.00 97.21  ? 171 ARG A NH1 1 
ATOM 1082 N NH2 . ARG A 1 129 ? 41.943  -1.230  -22.389 1.00 97.21  ? 171 ARG A NH2 1 
ATOM 1083 N N   . GLN A 1 130 ? 33.550  1.480   -21.558 1.00 97.21  ? 172 GLN A N   1 
ATOM 1084 C CA  . GLN A 1 130 ? 32.439  2.161   -22.215 1.00 97.21  ? 172 GLN A CA  1 
ATOM 1085 C C   . GLN A 1 130 ? 31.473  2.741   -21.188 1.00 97.21  ? 172 GLN A C   1 
ATOM 1086 O O   . GLN A 1 130 ? 30.791  3.733   -21.449 1.00 97.21  ? 172 GLN A O   1 
ATOM 1087 C CB  . GLN A 1 130 ? 31.695  1.165   -23.105 1.00 97.21  ? 172 GLN A CB  1 
ATOM 1088 C CG  . GLN A 1 130 ? 31.424  1.661   -24.522 1.00 97.21  ? 172 GLN A CG  1 
ATOM 1089 C CD  . GLN A 1 130 ? 30.046  2.299   -24.696 1.00 97.21  ? 172 GLN A CD  1 
ATOM 1090 O OE1 . GLN A 1 130 ? 29.869  3.498   -24.479 1.00 97.21  ? 172 GLN A OE1 1 
ATOM 1091 N NE2 . GLN A 1 130 ? 29.069  1.496   -25.107 1.00 97.21  ? 172 GLN A NE2 1 
ATOM 1092 N N   . ARG A 1 131 ? 31.422  2.105   -20.022 1.00 97.21  ? 173 ARG A N   1 
ATOM 1093 C CA  . ARG A 1 131 ? 30.539  2.530   -18.943 1.00 97.21  ? 173 ARG A CA  1 
ATOM 1094 C C   . ARG A 1 131 ? 31.112  3.655   -18.073 1.00 97.21  ? 173 ARG A C   1 
ATOM 1095 O O   . ARG A 1 131 ? 30.678  4.806   -18.174 1.00 97.21  ? 173 ARG A O   1 
ATOM 1096 C CB  . ARG A 1 131 ? 30.121  1.308   -18.095 1.00 97.21  ? 173 ARG A CB  1 
ATOM 1097 C CG  . ARG A 1 131 ? 29.212  0.313   -18.858 1.00 97.21  ? 173 ARG A CG  1 
ATOM 1098 C CD  . ARG A 1 131 ? 28.743  -0.901  -18.031 1.00 97.21  ? 173 ARG A CD  1 
ATOM 1099 N NE  . ARG A 1 131 ? 27.480  -1.459  -18.548 1.00 97.21  ? 173 ARG A NE  1 
ATOM 1100 C CZ  . ARG A 1 131 ? 26.698  -2.331  -17.900 1.00 97.21  ? 173 ARG A CZ  1 
ATOM 1101 N NH1 . ARG A 1 131 ? 27.037  -2.782  -16.693 1.00 97.21  ? 173 ARG A NH1 1 
ATOM 1102 N NH2 . ARG A 1 131 ? 25.519  -2.685  -18.416 1.00 97.21  ? 173 ARG A NH2 1 
ATOM 1103 N N   . LEU A 1 132 ? 32.099  3.334   -17.243 1.00 97.21  ? 174 LEU A N   1 
ATOM 1104 C CA  . LEU A 1 132 ? 32.705  4.318   -16.358 1.00 97.21  ? 174 LEU A CA  1 
ATOM 1105 C C   . LEU A 1 132 ? 33.143  5.617   -17.022 1.00 97.21  ? 174 LEU A C   1 
ATOM 1106 O O   . LEU A 1 132 ? 33.022  6.689   -16.435 1.00 97.21  ? 174 LEU A O   1 
ATOM 1107 C CB  . LEU A 1 132 ? 33.884  3.709   -15.625 1.00 97.21  ? 174 LEU A CB  1 
ATOM 1108 C CG  . LEU A 1 132 ? 34.480  4.707   -14.648 1.00 97.21  ? 174 LEU A CG  1 
ATOM 1109 C CD1 . LEU A 1 132 ? 33.450  5.068   -13.597 1.00 97.21  ? 174 LEU A CD1 1 
ATOM 1110 C CD2 . LEU A 1 132 ? 35.706  4.125   -14.013 1.00 97.21  ? 174 LEU A CD2 1 
ATOM 1111 N N   . ALA A 1 133 ? 33.676  5.515   -18.230 1.00 97.21  ? 175 ALA A N   1 
ATOM 1112 C CA  . ALA A 1 133 ? 34.126  6.694   -18.958 1.00 97.21  ? 175 ALA A CA  1 
ATOM 1113 C C   . ALA A 1 133 ? 32.996  7.713   -19.118 1.00 97.21  ? 175 ALA A C   1 
ATOM 1114 O O   . ALA A 1 133 ? 33.117  8.862   -18.687 1.00 97.21  ? 175 ALA A O   1 
ATOM 1115 C CB  . ALA A 1 133 ? 34.677  6.291   -20.315 1.00 97.21  ? 175 ALA A CB  1 
ATOM 1116 N N   . ALA A 1 134 ? 31.890  7.274   -19.712 1.00 97.21  ? 176 ALA A N   1 
ATOM 1117 C CA  . ALA A 1 134 ? 30.737  8.140   -19.927 1.00 97.21  ? 176 ALA A CA  1 
ATOM 1118 C C   . ALA A 1 134 ? 30.234  8.714   -18.614 1.00 97.21  ? 176 ALA A C   1 
ATOM 1119 O O   . ALA A 1 134 ? 29.646  9.795   -18.589 1.00 97.21  ? 176 ALA A O   1 
ATOM 1120 C CB  . ALA A 1 134 ? 29.627  7.380   -20.623 1.00 97.21  ? 176 ALA A CB  1 
ATOM 1121 N N   . ARG A 1 135 ? 30.460  7.977   -17.530 1.00 97.21  ? 177 ARG A N   1 
ATOM 1122 C CA  . ARG A 1 135 ? 30.049  8.420   -16.210 1.00 97.21  ? 177 ARG A CA  1 
ATOM 1123 C C   . ARG A 1 135 ? 30.674  9.770   -15.924 1.00 97.21  ? 177 ARG A C   1 
ATOM 1124 O O   . ARG A 1 135 ? 30.035  10.673  -15.386 1.00 97.21  ? 177 ARG A O   1 
ATOM 1125 C CB  . ARG A 1 135 ? 30.528  7.441   -15.146 1.00 97.21  ? 177 ARG A CB  1 
ATOM 1126 C CG  . ARG A 1 135 ? 29.474  6.501   -14.621 1.00 97.21  ? 177 ARG A CG  1 
ATOM 1127 C CD  . ARG A 1 135 ? 29.910  5.954   -13.269 1.00 97.21  ? 177 ARG A CD  1 
ATOM 1128 N NE  . ARG A 1 135 ? 28.896  5.101   -12.658 1.00 97.21  ? 177 ARG A NE  1 
ATOM 1129 C CZ  . ARG A 1 135 ? 28.974  3.777   -12.601 1.00 97.21  ? 177 ARG A CZ  1 
ATOM 1130 N NH1 . ARG A 1 135 ? 30.024  3.146   -13.115 1.00 97.21  ? 177 ARG A NH1 1 
ATOM 1131 N NH2 . ARG A 1 135 ? 27.995  3.083   -12.032 1.00 97.21  ? 177 ARG A NH2 1 
ATOM 1132 N N   . LEU A 1 136 ? 31.930  9.914   -16.314 1.00 97.21  ? 178 LEU A N   1 
ATOM 1133 C CA  . LEU A 1 136 ? 32.635  11.153  -16.069 1.00 97.21  ? 178 LEU A CA  1 
ATOM 1134 C C   . LEU A 1 136 ? 32.236  12.259  -17.010 1.00 97.21  ? 178 LEU A C   1 
ATOM 1135 O O   . LEU A 1 136 ? 32.402  13.432  -16.685 1.00 97.21  ? 178 LEU A O   1 
ATOM 1136 C CB  . LEU A 1 136 ? 34.127  10.920  -16.108 1.00 97.21  ? 178 LEU A CB  1 
ATOM 1137 C CG  . LEU A 1 136 ? 34.466  9.732   -15.215 1.00 97.21  ? 178 LEU A CG  1 
ATOM 1138 C CD1 . LEU A 1 136 ? 35.949  9.733   -15.002 1.00 97.21  ? 178 LEU A CD1 1 
ATOM 1139 C CD2 . LEU A 1 136 ? 33.732  9.814   -13.871 1.00 97.21  ? 178 LEU A CD2 1 
ATOM 1140 N N   . GLU A 1 137 ? 31.729  11.896  -18.183 1.00 97.21  ? 179 GLU A N   1 
ATOM 1141 C CA  . GLU A 1 137 ? 31.275  12.908  -19.122 1.00 97.21  ? 179 GLU A CA  1 
ATOM 1142 C C   . GLU A 1 137 ? 30.079  13.565  -18.453 1.00 97.21  ? 179 GLU A C   1 
ATOM 1143 O O   . GLU A 1 137 ? 29.827  14.756  -18.627 1.00 97.21  ? 179 GLU A O   1 
ATOM 1144 C CB  . GLU A 1 137 ? 30.854  12.282  -20.448 1.00 97.21  ? 179 GLU A CB  1 
ATOM 1145 C CG  . GLU A 1 137 ? 30.171  13.272  -21.385 1.00 97.21  ? 179 GLU A CG  1 
ATOM 1146 C CD  . GLU A 1 137 ? 30.705  13.215  -22.805 1.00 97.21  ? 179 GLU A CD  1 
ATOM 1147 O OE1 . GLU A 1 137 ? 31.861  13.645  -23.023 1.00 97.21  ? 179 GLU A OE1 1 
ATOM 1148 O OE2 . GLU A 1 137 ? 29.966  12.754  -23.706 1.00 97.21  ? 179 GLU A OE2 1 
ATOM 1149 N N   . ALA A 1 138 ? 29.356  12.773  -17.668 1.00 97.21  ? 180 ALA A N   1 
ATOM 1150 C CA  . ALA A 1 138 ? 28.201  13.273  -16.946 1.00 97.21  ? 180 ALA A CA  1 
ATOM 1151 C C   . ALA A 1 138 ? 28.677  14.229  -15.867 1.00 97.21  ? 180 ALA A C   1 
ATOM 1152 O O   . ALA A 1 138 ? 27.913  15.046  -15.380 1.00 97.21  ? 180 ALA A O   1 
ATOM 1153 C CB  . ALA A 1 138 ? 27.427  12.129  -16.329 1.00 97.21  ? 180 ALA A CB  1 
ATOM 1154 N N   . LEU A 1 139 ? 29.946  14.128  -15.497 1.00 97.21  ? 181 LEU A N   1 
ATOM 1155 C CA  . LEU A 1 139 ? 30.485  15.010  -14.480 1.00 97.21  ? 181 LEU A CA  1 
ATOM 1156 C C   . LEU A 1 139 ? 30.725  16.414  -15.016 1.00 97.21  ? 181 LEU A C   1 
ATOM 1157 O O   . LEU A 1 139 ? 30.305  17.394  -14.405 1.00 97.21  ? 181 LEU A O   1 
ATOM 1158 C CB  . LEU A 1 139 ? 31.768  14.436  -13.898 1.00 97.21  ? 181 LEU A CB  1 
ATOM 1159 C CG  . LEU A 1 139 ? 32.222  15.161  -12.635 1.00 97.21  ? 181 LEU A CG  1 
ATOM 1160 C CD1 . LEU A 1 139 ? 31.097  15.153  -11.603 1.00 97.21  ? 181 LEU A CD1 1 
ATOM 1161 C CD2 . LEU A 1 139 ? 33.465  14.495  -12.083 1.00 97.21  ? 181 LEU A CD2 1 
ATOM 1162 N N   . LYS A 1 140 ? 31.431  16.506  -16.137 1.00 97.21  ? 182 LYS A N   1 
ATOM 1163 C CA  . LYS A 1 140 ? 31.717  17.789  -16.776 1.00 97.21  ? 182 LYS A CA  1 
ATOM 1164 C C   . LYS A 1 140 ? 30.404  18.461  -17.148 1.00 97.21  ? 182 LYS A C   1 
ATOM 1165 O O   . LYS A 1 140 ? 30.137  19.598  -16.754 1.00 97.21  ? 182 LYS A O   1 
ATOM 1166 C CB  . LYS A 1 140 ? 32.532  17.575  -18.051 1.00 97.21  ? 182 LYS A CB  1 
ATOM 1167 C CG  . LYS A 1 140 ? 34.004  17.913  -17.939 1.00 97.21  ? 182 LYS A CG  1 
ATOM 1168 C CD  . LYS A 1 140 ? 34.686  17.833  -19.308 1.00 97.21  ? 182 LYS A CD  1 
ATOM 1169 C CE  . LYS A 1 140 ? 34.121  18.871  -20.281 1.00 97.21  ? 182 LYS A CE  1 
ATOM 1170 N NZ  . LYS A 1 140 ? 34.813  18.860  -21.603 1.00 97.21  ? 182 LYS A NZ  1 
ATOM 1171 N N   . GLU A 1 141 ? 29.600  17.742  -17.927 1.00 97.21  ? 183 GLU A N   1 
ATOM 1172 C CA  . GLU A 1 141 ? 28.300  18.220  -18.371 1.00 97.21  ? 183 GLU A CA  1 
ATOM 1173 C C   . GLU A 1 141 ? 27.463  18.656  -17.169 1.00 97.21  ? 183 GLU A C   1 
ATOM 1174 O O   . GLU A 1 141 ? 26.814  19.701  -17.215 1.00 97.21  ? 183 GLU A O   1 
ATOM 1175 C CB  . GLU A 1 141 ? 27.595  17.123  -19.184 1.00 97.21  ? 183 GLU A CB  1 
ATOM 1176 C CG  . GLU A 1 141 ? 26.083  17.290  -19.374 1.00 97.21  ? 183 GLU A CG  1 
ATOM 1177 C CD  . GLU A 1 141 ? 25.256  16.729  -18.209 1.00 97.21  ? 183 GLU A CD  1 
ATOM 1178 O OE1 . GLU A 1 141 ? 25.726  15.790  -17.526 1.00 97.21  ? 183 GLU A OE1 1 
ATOM 1179 O OE2 . GLU A 1 141 ? 24.129  17.224  -17.974 1.00 97.21  ? 183 GLU A OE2 1 
ATOM 1180 N N   . ASN A 1 142 ? 27.503  17.882  -16.084 1.00 97.21  ? 184 ASN A N   1 
ATOM 1181 C CA  . ASN A 1 142 ? 26.737  18.241  -14.896 1.00 97.21  ? 184 ASN A CA  1 
ATOM 1182 C C   . ASN A 1 142 ? 27.380  19.355  -14.108 1.00 97.21  ? 184 ASN A C   1 
ATOM 1183 O O   . ASN A 1 142 ? 26.689  20.093  -13.412 1.00 97.21  ? 184 ASN A O   1 
ATOM 1184 C CB  . ASN A 1 142 ? 26.466  17.044  -14.000 1.00 97.21  ? 184 ASN A CB  1 
ATOM 1185 C CG  . ASN A 1 142 ? 25.085  16.476  -14.215 1.00 97.21  ? 184 ASN A CG  1 
ATOM 1186 O OD1 . ASN A 1 142 ? 24.083  17.168  -14.020 1.00 97.21  ? 184 ASN A OD1 1 
ATOM 1187 N ND2 . ASN A 1 142 ? 25.020  15.223  -14.654 1.00 97.21  ? 184 ASN A ND2 1 
ATOM 1188 N N   . GLY A 1 143 ? 28.698  19.487  -14.230 1.00 97.21  ? 185 GLY A N   1 
ATOM 1189 C CA  . GLY A 1 143 ? 29.396  20.560  -13.547 1.00 97.21  ? 185 GLY A CA  1 
ATOM 1190 C C   . GLY A 1 143 ? 28.874  21.872  -14.114 1.00 97.21  ? 185 GLY A C   1 
ATOM 1191 O O   . GLY A 1 143 ? 28.645  22.841  -13.382 1.00 97.21  ? 185 GLY A O   1 
ATOM 1192 N N   . GLY A 1 144 ? 28.630  21.870  -15.424 1.00 97.21  ? 186 GLY A N   1 
ATOM 1193 C CA  . GLY A 1 144 ? 28.114  23.044  -16.106 1.00 97.21  ? 186 GLY A CA  1 
ATOM 1194 C C   . GLY A 1 144 ? 26.715  23.411  -15.646 1.00 97.21  ? 186 GLY A C   1 
ATOM 1195 O O   . GLY A 1 144 ? 26.362  24.586  -15.609 1.00 97.21  ? 186 GLY A O   1 
ATOM 1196 N N   . ALA A 1 145 ? 25.922  22.405  -15.288 1.00 132.74 ? 187 ALA A N   1 
ATOM 1197 C CA  . ALA A 1 145 ? 24.561  22.629  -14.819 1.00 132.74 ? 187 ALA A CA  1 
ATOM 1198 C C   . ALA A 1 145 ? 24.590  23.446  -13.539 1.00 132.74 ? 187 ALA A C   1 
ATOM 1199 O O   . ALA A 1 145 ? 23.993  24.514  -13.465 1.00 132.74 ? 187 ALA A O   1 
ATOM 1200 C CB  . ALA A 1 145 ? 23.853  21.305  -14.580 1.00 132.74 ? 187 ALA A CB  1 
ATOM 1201 N N   . ARG A 1 146 ? 25.327  22.957  -12.548 1.00 132.74 ? 188 ARG A N   1 
ATOM 1202 C CA  . ARG A 1 146 ? 25.437  23.637  -11.268 1.00 132.74 ? 188 ARG A CA  1 
ATOM 1203 C C   . ARG A 1 146 ? 26.050  25.010  -11.416 1.00 132.74 ? 188 ARG A C   1 
ATOM 1204 O O   . ARG A 1 146 ? 25.526  25.979  -10.882 1.00 132.74 ? 188 ARG A O   1 
ATOM 1205 C CB  . ARG A 1 146 ? 26.267  22.814  -10.294 1.00 132.74 ? 188 ARG A CB  1 
ATOM 1206 C CG  . ARG A 1 146 ? 25.516  21.661  -9.668  1.00 132.74 ? 188 ARG A CG  1 
ATOM 1207 C CD  . ARG A 1 146 ? 25.131  20.587  -10.665 1.00 132.74 ? 188 ARG A CD  1 
ATOM 1208 N NE  . ARG A 1 146 ? 24.712  19.362  -9.986  1.00 132.74 ? 188 ARG A NE  1 
ATOM 1209 C CZ  . ARG A 1 146 ? 25.512  18.623  -9.214  1.00 132.74 ? 188 ARG A CZ  1 
ATOM 1210 N NH1 . ARG A 1 146 ? 26.784  18.964  -9.017  1.00 132.74 ? 188 ARG A NH1 1 
ATOM 1211 N NH2 . ARG A 1 146 ? 25.028  17.583  -8.564  1.00 132.74 ? 188 ARG A NH2 1 
ATOM 1212 N N   . LEU A 1 147 ? 27.163  25.090  -12.136 1.00 132.74 ? 189 LEU A N   1 
ATOM 1213 C CA  . LEU A 1 147 ? 27.829  26.367  -12.344 1.00 132.74 ? 189 LEU A CA  1 
ATOM 1214 C C   . LEU A 1 147 ? 26.843  27.353  -12.937 1.00 132.74 ? 189 LEU A C   1 
ATOM 1215 O O   . LEU A 1 147 ? 26.698  28.465  -12.448 1.00 132.74 ? 189 LEU A O   1 
ATOM 1216 C CB  . LEU A 1 147 ? 29.031  26.213  -13.274 1.00 132.74 ? 189 LEU A CB  1 
ATOM 1217 C CG  . LEU A 1 147 ? 30.130  27.285  -13.230 1.00 132.74 ? 189 LEU A CG  1 
ATOM 1218 C CD1 . LEU A 1 147 ? 31.247  26.872  -14.163 1.00 132.74 ? 189 LEU A CD1 1 
ATOM 1219 C CD2 . LEU A 1 147 ? 29.616  28.664  -13.608 1.00 132.74 ? 189 LEU A CD2 1 
ATOM 1220 N N   . ALA A 1 148 ? 26.128  26.919  -13.966 1.00 132.74 ? 190 ALA A N   1 
ATOM 1221 C CA  . ALA A 1 148 ? 25.148  27.772  -14.624 1.00 132.74 ? 190 ALA A CA  1 
ATOM 1222 C C   . ALA A 1 148 ? 24.055  28.172  -13.645 1.00 132.74 ? 190 ALA A C   1 
ATOM 1223 O O   . ALA A 1 148 ? 23.628  29.322  -13.615 1.00 132.74 ? 190 ALA A O   1 
ATOM 1224 C CB  . ALA A 1 148 ? 24.548  27.060  -15.816 1.00 132.74 ? 190 ALA A CB  1 
ATOM 1225 N N   . GLU A 1 149 ? 23.632  27.214  -12.829 1.00 132.74 ? 191 GLU A N   1 
ATOM 1226 C CA  . GLU A 1 149 ? 22.595  27.434  -11.829 1.00 132.74 ? 191 GLU A CA  1 
ATOM 1227 C C   . GLU A 1 149 ? 23.119  28.370  -10.749 1.00 132.74 ? 191 GLU A C   1 
ATOM 1228 O O   . GLU A 1 149 ? 22.376  29.170  -10.183 1.00 132.74 ? 191 GLU A O   1 
ATOM 1229 C CB  . GLU A 1 149 ? 22.199  26.087  -11.224 1.00 132.74 ? 191 GLU A CB  1 
ATOM 1230 C CG  . GLU A 1 149 ? 20.974  26.100  -10.321 1.00 132.74 ? 191 GLU A CG  1 
ATOM 1231 C CD  . GLU A 1 149 ? 20.529  24.695  -9.906  1.00 132.74 ? 191 GLU A CD  1 
ATOM 1232 O OE1 . GLU A 1 149 ? 21.194  23.699  -10.279 1.00 132.74 ? 191 GLU A OE1 1 
ATOM 1233 O OE2 . GLU A 1 149 ? 19.497  24.587  -9.208  1.00 132.74 ? 191 GLU A OE2 1 
ATOM 1234 N N   . TYR A 1 150 ? 24.425  28.303  -10.524 1.00 132.74 ? 192 TYR A N   1 
ATOM 1235 C CA  . TYR A 1 150 ? 25.077  29.117  -9.518  1.00 132.74 ? 192 TYR A CA  1 
ATOM 1236 C C   . TYR A 1 150 ? 25.251  30.552  -9.955  1.00 132.74 ? 192 TYR A C   1 
ATOM 1237 O O   . TYR A 1 150 ? 24.707  31.466  -9.335  1.00 132.74 ? 192 TYR A O   1 
ATOM 1238 C CB  . TYR A 1 150 ? 26.429  28.526  -9.146  1.00 132.74 ? 192 TYR A CB  1 
ATOM 1239 C CG  . TYR A 1 150 ? 27.155  29.344  -8.110  1.00 132.74 ? 192 TYR A CG  1 
ATOM 1240 C CD1 . TYR A 1 150 ? 26.631  29.505  -6.832  1.00 132.74 ? 192 TYR A CD1 1 
ATOM 1241 C CD2 . TYR A 1 150 ? 28.360  29.962  -8.410  1.00 132.74 ? 192 TYR A CD2 1 
ATOM 1242 C CE1 . TYR A 1 150 ? 27.299  30.277  -5.876  1.00 132.74 ? 192 TYR A CE1 1 
ATOM 1243 C CE2 . TYR A 1 150 ? 29.028  30.726  -7.465  1.00 132.74 ? 192 TYR A CE2 1 
ATOM 1244 C CZ  . TYR A 1 150 ? 28.493  30.875  -6.217  1.00 132.74 ? 192 TYR A CZ  1 
ATOM 1245 O OH  . TYR A 1 150 ? 29.180  31.665  -5.325  1.00 132.74 ? 192 TYR A OH  1 
ATOM 1246 N N   . HIS A 1 151 ? 26.051  30.747  -10.997 1.00 132.74 ? 193 HIS A N   1 
ATOM 1247 C CA  . HIS A 1 151 ? 26.306  32.069  -11.535 1.00 132.74 ? 193 HIS A CA  1 
ATOM 1248 C C   . HIS A 1 151 ? 25.025  32.877  -11.580 1.00 132.74 ? 193 HIS A C   1 
ATOM 1249 O O   . HIS A 1 151 ? 25.004  34.050  -11.211 1.00 132.74 ? 193 HIS A O   1 
ATOM 1250 C CB  . HIS A 1 151 ? 26.883  31.971  -12.939 1.00 132.74 ? 193 HIS A CB  1 
ATOM 1251 C CG  . HIS A 1 151 ? 26.851  33.267  -13.681 1.00 132.74 ? 193 HIS A CG  1 
ATOM 1252 N ND1 . HIS A 1 151 ? 25.712  33.741  -14.294 1.00 132.74 ? 193 HIS A ND1 1 
ATOM 1253 C CD2 . HIS A 1 151 ? 27.799  34.219  -13.851 1.00 132.74 ? 193 HIS A CD2 1 
ATOM 1254 C CE1 . HIS A 1 151 ? 25.959  34.933  -14.808 1.00 132.74 ? 193 HIS A CE1 1 
ATOM 1255 N NE2 . HIS A 1 151 ? 27.216  35.247  -14.553 1.00 132.74 ? 193 HIS A NE2 1 
ATOM 1256 N N   . ALA A 1 152 ? 23.970  32.237  -12.069 1.00 132.74 ? 194 ALA A N   1 
ATOM 1257 C CA  . ALA A 1 152 ? 22.670  32.869  -12.169 1.00 132.74 ? 194 ALA A CA  1 
ATOM 1258 C C   . ALA A 1 152 ? 22.299  33.464  -10.822 1.00 132.74 ? 194 ALA A C   1 
ATOM 1259 O O   . ALA A 1 152 ? 22.005  34.654  -10.722 1.00 132.74 ? 194 ALA A O   1 
ATOM 1260 C CB  . ALA A 1 152 ? 21.635  31.853  -12.596 1.00 132.74 ? 194 ALA A CB  1 
ATOM 1261 N N   . LYS A 1 153 ? 22.360  32.640  -9.782  1.00 132.74 ? 195 LYS A N   1 
ATOM 1262 C CA  . LYS A 1 153 ? 22.022  33.091  -8.440  1.00 132.74 ? 195 LYS A CA  1 
ATOM 1263 C C   . LYS A 1 153 ? 22.957  34.181  -7.922  1.00 132.74 ? 195 LYS A C   1 
ATOM 1264 O O   . LYS A 1 153 ? 22.509  35.141  -7.291  1.00 132.74 ? 195 LYS A O   1 
ATOM 1265 C CB  . LYS A 1 153 ? 21.960  31.905  -7.475  1.00 132.74 ? 195 LYS A CB  1 
ATOM 1266 C CG  . LYS A 1 153 ? 20.771  30.986  -7.735  1.00 132.74 ? 195 LYS A CG  1 
ATOM 1267 C CD  . LYS A 1 153 ? 20.627  29.910  -6.676  1.00 132.74 ? 195 LYS A CD  1 
ATOM 1268 C CE  . LYS A 1 153 ? 19.357  29.088  -6.891  1.00 132.74 ? 195 LYS A CE  1 
ATOM 1269 N NZ  . LYS A 1 153 ? 19.244  27.970  -5.908  1.00 132.74 ? 195 LYS A NZ  1 
ATOM 1270 N N   . ALA A 1 154 ? 24.243  34.059  -8.233  1.00 132.74 ? 196 ALA A N   1 
ATOM 1271 C CA  . ALA A 1 154 ? 25.220  35.046  -7.800  1.00 132.74 ? 196 ALA A CA  1 
ATOM 1272 C C   . ALA A 1 154 ? 24.813  36.394  -8.356  1.00 132.74 ? 196 ALA A C   1 
ATOM 1273 O O   . ALA A 1 154 ? 24.654  37.364  -7.617  1.00 132.74 ? 196 ALA A O   1 
ATOM 1274 C CB  . ALA A 1 154 ? 26.587  34.673  -8.312  1.00 132.74 ? 196 ALA A CB  1 
ATOM 1275 N N   . THR A 1 155 ? 24.603  36.416  -9.668  1.00 132.74 ? 197 THR A N   1 
ATOM 1276 C CA  . THR A 1 155 ? 24.209  37.612  -10.395 1.00 132.74 ? 197 THR A CA  1 
ATOM 1277 C C   . THR A 1 155 ? 22.974  38.264  -9.783  1.00 132.74 ? 197 THR A C   1 
ATOM 1278 O O   . THR A 1 155 ? 22.974  39.457  -9.473  1.00 132.74 ? 197 THR A O   1 
ATOM 1279 C CB  . THR A 1 155 ? 23.949  37.274  -11.876 1.00 132.74 ? 197 THR A CB  1 
ATOM 1280 O OG1 . THR A 1 155 ? 25.121  36.670  -12.434 1.00 132.74 ? 197 THR A OG1 1 
ATOM 1281 C CG2 . THR A 1 155 ? 23.618  38.522  -12.670 1.00 132.74 ? 197 THR A CG2 1 
ATOM 1282 N N   . GLU A 1 156 ? 21.937  37.461  -9.584  1.00 132.74 ? 198 GLU A N   1 
ATOM 1283 C CA  . GLU A 1 156 ? 20.691  37.928  -9.008  1.00 132.74 ? 198 GLU A CA  1 
ATOM 1284 C C   . GLU A 1 156 ? 20.951  38.646  -7.696  1.00 132.74 ? 198 GLU A C   1 
ATOM 1285 O O   . GLU A 1 156 ? 20.417  39.723  -7.454  1.00 132.74 ? 198 GLU A O   1 
ATOM 1286 C CB  . GLU A 1 156 ? 19.772  36.738  -8.767  1.00 132.74 ? 198 GLU A CB  1 
ATOM 1287 C CG  . GLU A 1 156 ? 18.443  37.094  -8.136  1.00 132.74 ? 198 GLU A CG  1 
ATOM 1288 C CD  . GLU A 1 156 ? 17.529  35.894  -7.983  1.00 132.74 ? 198 GLU A CD  1 
ATOM 1289 O OE1 . GLU A 1 156 ? 17.306  35.178  -8.987  1.00 132.74 ? 198 GLU A OE1 1 
ATOM 1290 O OE2 . GLU A 1 156 ? 17.029  35.671  -6.859  1.00 132.74 ? 198 GLU A OE2 1 
ATOM 1291 N N   . HIS A 1 157 ? 21.814  38.062  -6.874  1.00 132.74 ? 199 HIS A N   1 
ATOM 1292 C CA  . HIS A 1 157 ? 22.152  38.637  -5.584  1.00 132.74 ? 199 HIS A CA  1 
ATOM 1293 C C   . HIS A 1 157 ? 22.662  40.043  -5.658  1.00 132.74 ? 199 HIS A C   1 
ATOM 1294 O O   . HIS A 1 157 ? 22.278  40.899  -4.869  1.00 132.74 ? 199 HIS A O   1 
ATOM 1295 C CB  . HIS A 1 157 ? 23.196  37.790  -4.885  1.00 132.74 ? 199 HIS A CB  1 
ATOM 1296 C CG  . HIS A 1 157 ? 22.606  36.819  -3.931  1.00 132.74 ? 199 HIS A CG  1 
ATOM 1297 N ND1 . HIS A 1 157 ? 21.441  36.137  -4.209  1.00 132.74 ? 199 HIS A ND1 1 
ATOM 1298 C CD2 . HIS A 1 157 ? 22.963  36.466  -2.677  1.00 132.74 ? 199 HIS A CD2 1 
ATOM 1299 C CE1 . HIS A 1 157 ? 21.102  35.409  -3.158  1.00 132.74 ? 199 HIS A CE1 1 
ATOM 1300 N NE2 . HIS A 1 157 ? 22.010  35.592  -2.217  1.00 132.74 ? 199 HIS A NE2 1 
ATOM 1301 N N   . LEU A 1 158 ? 23.543  40.276  -6.614  1.00 132.74 ? 200 LEU A N   1 
ATOM 1302 C CA  . LEU A 1 158 ? 24.138  41.586  -6.779  1.00 132.74 ? 200 LEU A CA  1 
ATOM 1303 C C   . LEU A 1 158 ? 23.097  42.598  -7.226  1.00 132.74 ? 200 LEU A C   1 
ATOM 1304 O O   . LEU A 1 158 ? 23.210  43.792  -6.958  1.00 132.74 ? 200 LEU A O   1 
ATOM 1305 C CB  . LEU A 1 158 ? 25.275  41.504  -7.789  1.00 132.74 ? 200 LEU A CB  1 
ATOM 1306 C CG  . LEU A 1 158 ? 26.108  40.220  -7.711  1.00 132.74 ? 200 LEU A CG  1 
ATOM 1307 C CD1 . LEU A 1 158 ? 27.365  40.396  -8.543  1.00 132.74 ? 200 LEU A CD1 1 
ATOM 1308 C CD2 . LEU A 1 158 ? 26.464  39.868  -6.268  1.00 132.74 ? 200 LEU A CD2 1 
ATOM 1309 N N   . SER A 1 159 ? 22.046  42.093  -7.855  1.00 132.74 ? 201 SER A N   1 
ATOM 1310 C CA  . SER A 1 159 ? 20.972  42.929  -8.357  1.00 132.74 ? 201 SER A CA  1 
ATOM 1311 C C   . SER A 1 159 ? 19.877  43.190  -7.319  1.00 132.74 ? 201 SER A C   1 
ATOM 1312 O O   . SER A 1 159 ? 19.135  44.167  -7.430  1.00 132.74 ? 201 SER A O   1 
ATOM 1313 C CB  . SER A 1 159 ? 20.390  42.280  -9.610  1.00 132.74 ? 201 SER A CB  1 
ATOM 1314 O OG  . SER A 1 159 ? 21.432  41.873  -10.485 1.00 132.74 ? 201 SER A OG  1 
ATOM 1315 N N   . THR A 1 160 ? 19.786  42.325  -6.310  1.00 132.74 ? 202 THR A N   1 
ATOM 1316 C CA  . THR A 1 160 ? 18.782  42.469  -5.255  1.00 132.74 ? 202 THR A CA  1 
ATOM 1317 C C   . THR A 1 160 ? 19.138  43.647  -4.357  1.00 132.74 ? 202 THR A C   1 
ATOM 1318 O O   . THR A 1 160 ? 18.261  44.308  -3.801  1.00 132.74 ? 202 THR A O   1 
ATOM 1319 C CB  . THR A 1 160 ? 18.698  41.210  -4.346  1.00 132.74 ? 202 THR A CB  1 
ATOM 1320 O OG1 . THR A 1 160 ? 19.936  41.021  -3.651  1.00 132.74 ? 202 THR A OG1 1 
ATOM 1321 C CG2 . THR A 1 160 ? 18.388  39.972  -5.166  1.00 132.74 ? 202 THR A CG2 1 
ATOM 1322 N N   . LEU A 1 161 ? 20.438  43.907  -4.246  1.00 132.74 ? 203 LEU A N   1 
ATOM 1323 C CA  . LEU A 1 161 ? 20.975  44.979  -3.410  1.00 132.74 ? 203 LEU A CA  1 
ATOM 1324 C C   . LEU A 1 161 ? 20.356  46.325  -3.732  1.00 132.74 ? 203 LEU A C   1 
ATOM 1325 O O   . LEU A 1 161 ? 20.097  47.137  -2.847  1.00 132.74 ? 203 LEU A O   1 
ATOM 1326 C CB  . LEU A 1 161 ? 22.483  45.083  -3.623  1.00 132.74 ? 203 LEU A CB  1 
ATOM 1327 C CG  . LEU A 1 161 ? 23.252  43.763  -3.644  1.00 132.74 ? 203 LEU A CG  1 
ATOM 1328 C CD1 . LEU A 1 161 ? 24.712  44.023  -3.973  1.00 132.74 ? 203 LEU A CD1 1 
ATOM 1329 C CD2 . LEU A 1 161 ? 23.100  43.054  -2.308  1.00 132.74 ? 203 LEU A CD2 1 
ATOM 1330 N N   . SER A 1 162 ? 20.152  46.562  -5.021  1.00 132.74 ? 204 SER A N   1 
ATOM 1331 C CA  . SER A 1 162 ? 19.573  47.810  -5.498  1.00 132.74 ? 204 SER A CA  1 
ATOM 1332 C C   . SER A 1 162 ? 18.242  48.124  -4.820  1.00 132.74 ? 204 SER A C   1 
ATOM 1333 O O   . SER A 1 162 ? 17.986  49.275  -4.477  1.00 132.74 ? 204 SER A O   1 
ATOM 1334 C CB  . SER A 1 162 ? 19.387  47.759  -7.017  1.00 132.74 ? 204 SER A CB  1 
ATOM 1335 O OG  . SER A 1 162 ? 18.505  46.712  -7.387  1.00 132.74 ? 204 SER A OG  1 
ATOM 1336 N N   . GLU A 1 163 ? 17.412  47.098  -4.626  1.00 132.74 ? 205 GLU A N   1 
ATOM 1337 C CA  . GLU A 1 163 ? 16.105  47.252  -3.984  1.00 132.74 ? 205 GLU A CA  1 
ATOM 1338 C C   . GLU A 1 163 ? 16.173  47.264  -2.463  1.00 132.74 ? 205 GLU A C   1 
ATOM 1339 O O   . GLU A 1 163 ? 15.247  47.744  -1.807  1.00 132.74 ? 205 GLU A O   1 
ATOM 1340 C CB  . GLU A 1 163 ? 15.124  46.144  -4.435  1.00 132.74 ? 205 GLU A CB  1 
ATOM 1341 C CG  . GLU A 1 163 ? 15.462  44.690  -3.982  1.00 132.74 ? 205 GLU A CG  1 
ATOM 1342 C CD  . GLU A 1 163 ? 14.810  44.238  -2.655  1.00 132.74 ? 205 GLU A CD  1 
ATOM 1343 O OE1 . GLU A 1 163 ? 14.083  45.027  -2.009  1.00 132.74 ? 205 GLU A OE1 1 
ATOM 1344 O OE2 . GLU A 1 163 ? 15.024  43.068  -2.261  1.00 132.74 ? 205 GLU A OE2 1 
ATOM 1345 N N   . LYS A 1 164 ? 17.245  46.703  -1.911  1.00 132.74 ? 206 LYS A N   1 
ATOM 1346 C CA  . LYS A 1 164 ? 17.416  46.614  -0.467  1.00 132.74 ? 206 LYS A CA  1 
ATOM 1347 C C   . LYS A 1 164 ? 18.057  47.855  0.134   1.00 132.74 ? 206 LYS A C   1 
ATOM 1348 O O   . LYS A 1 164 ? 17.555  48.426  1.102   1.00 132.74 ? 206 LYS A O   1 
ATOM 1349 C CB  . LYS A 1 164 ? 18.232  45.349  -0.130  1.00 132.74 ? 206 LYS A CB  1 
ATOM 1350 C CG  . LYS A 1 164 ? 18.520  45.121  1.354   1.00 132.74 ? 206 LYS A CG  1 
ATOM 1351 C CD  . LYS A 1 164 ? 19.771  45.878  1.813   1.00 132.74 ? 206 LYS A CD  1 
ATOM 1352 C CE  . LYS A 1 164 ? 19.629  46.412  3.237   1.00 132.74 ? 206 LYS A CE  1 
ATOM 1353 N NZ  . LYS A 1 164 ? 20.714  47.372  3.602   1.00 132.74 ? 206 LYS A NZ  1 
ATOM 1354 N N   . ALA A 1 165 ? 19.206  48.226  -0.410  1.00 132.74 ? 207 ALA A N   1 
ATOM 1355 C CA  . ALA A 1 165 ? 19.932  49.390  0.066   1.00 132.74 ? 207 ALA A CA  1 
ATOM 1356 C C   . ALA A 1 165 ? 18.996  50.589  0.241   1.00 132.74 ? 207 ALA A C   1 
ATOM 1357 O O   . ALA A 1 165 ? 19.012  51.241  1.278   1.00 132.74 ? 207 ALA A O   1 
ATOM 1358 C CB  . ALA A 1 165 ? 21.045  49.729  -0.907  1.00 132.74 ? 207 ALA A CB  1 
ATOM 1359 N N   . LYS A 1 166 ? 18.088  50.776  -0.719  1.00 132.74 ? 208 LYS A N   1 
ATOM 1360 C CA  . LYS A 1 166 ? 17.139  51.901  -0.738  1.00 132.74 ? 208 LYS A CA  1 
ATOM 1361 C C   . LYS A 1 166 ? 16.236  52.127  0.489   1.00 132.74 ? 208 LYS A C   1 
ATOM 1362 O O   . LYS A 1 166 ? 16.298  53.197  1.106   1.00 132.74 ? 208 LYS A O   1 
ATOM 1363 C CB  . LYS A 1 166 ? 16.304  51.869  -2.040  1.00 132.74 ? 208 LYS A CB  1 
ATOM 1364 C CG  . LYS A 1 166 ? 16.182  53.224  -2.782  1.00 132.74 ? 208 LYS A CG  1 
ATOM 1365 C CD  . LYS A 1 166 ? 16.556  53.073  -4.279  1.00 132.74 ? 208 LYS A CD  1 
ATOM 1366 C CE  . LYS A 1 166 ? 16.264  54.322  -5.128  1.00 132.74 ? 208 LYS A CE  1 
ATOM 1367 N NZ  . LYS A 1 166 ? 16.285  53.957  -6.582  1.00 132.74 ? 208 LYS A NZ  1 
ATOM 1368 N N   . PRO A 1 167 ? 15.367  51.154  0.848   1.00 200.00 ? 209 PRO A N   1 
ATOM 1369 C CA  . PRO A 1 167 ? 14.505  51.371  2.016   1.00 200.00 ? 209 PRO A CA  1 
ATOM 1370 C C   . PRO A 1 167 ? 15.285  51.569  3.307   1.00 200.00 ? 209 PRO A C   1 
ATOM 1371 O O   . PRO A 1 167 ? 14.954  52.448  4.102   1.00 200.00 ? 209 PRO A O   1 
ATOM 1372 C CB  . PRO A 1 167 ? 13.650  50.101  2.061   1.00 200.00 ? 209 PRO A CB  1 
ATOM 1373 C CG  . PRO A 1 167 ? 14.538  49.071  1.455   1.00 200.00 ? 209 PRO A CG  1 
ATOM 1374 C CD  . PRO A 1 167 ? 15.116  49.819  0.275   1.00 200.00 ? 209 PRO A CD  1 
ATOM 1375 N N   . ALA A 1 168 ? 16.341  50.775  3.486   1.00 200.00 ? 210 ALA A N   1 
ATOM 1376 C CA  . ALA A 1 168 ? 17.183  50.854  4.673   1.00 200.00 ? 210 ALA A CA  1 
ATOM 1377 C C   . ALA A 1 168 ? 17.759  52.254  4.810   1.00 200.00 ? 210 ALA A C   1 
ATOM 1378 O O   . ALA A 1 168 ? 17.884  52.778  5.917   1.00 200.00 ? 210 ALA A O   1 
ATOM 1379 C CB  . ALA A 1 168 ? 18.313  49.837  4.574   1.00 200.00 ? 210 ALA A CB  1 
ATOM 1380 N N   . LEU A 1 169 ? 18.019  52.891  3.672   1.00 200.00 ? 211 LEU A N   1 
ATOM 1381 C CA  . LEU A 1 169 ? 18.601  54.226  3.668   1.00 200.00 ? 211 LEU A CA  1 
ATOM 1382 C C   . LEU A 1 169 ? 17.670  55.369  4.052   1.00 200.00 ? 211 LEU A C   1 
ATOM 1383 O O   . LEU A 1 169 ? 18.031  56.533  3.943   1.00 200.00 ? 211 LEU A O   1 
ATOM 1384 C CB  . LEU A 1 169 ? 19.279  54.515  2.334   1.00 200.00 ? 211 LEU A CB  1 
ATOM 1385 C CG  . LEU A 1 169 ? 20.389  53.515  1.996   1.00 200.00 ? 211 LEU A CG  1 
ATOM 1386 C CD1 . LEU A 1 169 ? 21.243  54.067  0.874   1.00 200.00 ? 211 LEU A CD1 1 
ATOM 1387 C CD2 . LEU A 1 169 ? 21.240  53.196  3.224   1.00 200.00 ? 211 LEU A CD2 1 
ATOM 1388 N N   . GLU A 1 170 ? 16.455  55.051  4.466   1.00 200.00 ? 212 GLU A N   1 
ATOM 1389 C CA  . GLU A 1 170 ? 15.561  56.101  4.908   1.00 200.00 ? 212 GLU A CA  1 
ATOM 1390 C C   . GLU A 1 170 ? 15.789  56.244  6.417   1.00 200.00 ? 212 GLU A C   1 
ATOM 1391 O O   . GLU A 1 170 ? 15.568  57.317  6.978   1.00 200.00 ? 212 GLU A O   1 
ATOM 1392 C CB  . GLU A 1 170 ? 14.100  55.760  4.595   1.00 200.00 ? 212 GLU A CB  1 
ATOM 1393 C CG  . GLU A 1 170 ? 13.783  55.687  3.101   1.00 200.00 ? 212 GLU A CG  1 
ATOM 1394 C CD  . GLU A 1 170 ? 14.161  56.959  2.353   1.00 200.00 ? 212 GLU A CD  1 
ATOM 1395 O OE1 . GLU A 1 170 ? 13.720  58.056  2.762   1.00 200.00 ? 212 GLU A OE1 1 
ATOM 1396 O OE2 . GLU A 1 170 ? 14.899  56.857  1.350   1.00 200.00 ? 212 GLU A OE2 1 
ATOM 1397 N N   . ASP A 1 171 ? 16.346  55.183  7.023   1.00 200.00 ? 213 ASP A N   1 
ATOM 1398 C CA  . ASP A 1 171 ? 16.637  55.083  8.471   1.00 200.00 ? 213 ASP A CA  1 
ATOM 1399 C C   . ASP A 1 171 ? 17.392  56.274  9.063   1.00 200.00 ? 213 ASP A C   1 
ATOM 1400 O O   . ASP A 1 171 ? 16.808  57.069  9.800   1.00 200.00 ? 213 ASP A O   1 
ATOM 1401 C CB  . ASP A 1 171 ? 17.397  53.764  8.787   1.00 200.00 ? 213 ASP A CB  1 
ATOM 1402 C CG  . ASP A 1 171 ? 17.705  53.572  10.291  1.00 200.00 ? 213 ASP A CG  1 
ATOM 1403 O OD1 . ASP A 1 171 ? 16.777  53.259  11.071  1.00 200.00 ? 213 ASP A OD1 1 
ATOM 1404 O OD2 . ASP A 1 171 ? 18.888  53.695  10.683  1.00 200.00 ? 213 ASP A OD2 1 
ATOM 1405 N N   . LEU A 1 172 ? 18.681  56.396  8.750   1.00 200.00 ? 214 LEU A N   1 
ATOM 1406 C CA  . LEU A 1 172 ? 19.495  57.492  9.280   1.00 200.00 ? 214 LEU A CA  1 
ATOM 1407 C C   . LEU A 1 172 ? 19.143  58.902  8.777   1.00 200.00 ? 214 LEU A C   1 
ATOM 1408 O O   . LEU A 1 172 ? 19.026  59.824  9.589   1.00 200.00 ? 214 LEU A O   1 
ATOM 1409 C CB  . LEU A 1 172 ? 20.981  57.207  9.052   1.00 200.00 ? 214 LEU A CB  1 
ATOM 1410 C CG  . LEU A 1 172 ? 21.655  56.263  10.042  1.00 200.00 ? 214 LEU A CG  1 
ATOM 1411 C CD1 . LEU A 1 172 ? 22.755  55.501  9.341   1.00 200.00 ? 214 LEU A CD1 1 
ATOM 1412 C CD2 . LEU A 1 172 ? 22.183  57.060  11.221  1.00 200.00 ? 214 LEU A CD2 1 
ATOM 1413 N N   . ARG A 1 173 ? 18.925  59.055  7.465   1.00 200.00 ? 215 ARG A N   1 
ATOM 1414 C CA  . ARG A 1 173 ? 18.614  60.356  6.849   1.00 200.00 ? 215 ARG A CA  1 
ATOM 1415 C C   . ARG A 1 173 ? 17.456  61.076  7.510   1.00 200.00 ? 215 ARG A C   1 
ATOM 1416 O O   . ARG A 1 173 ? 17.433  62.305  7.604   1.00 200.00 ? 215 ARG A O   1 
ATOM 1417 C CB  . ARG A 1 173 ? 18.293  60.201  5.363   1.00 200.00 ? 215 ARG A CB  1 
ATOM 1418 C CG  . ARG A 1 173 ? 18.169  61.533  4.643   1.00 200.00 ? 215 ARG A CG  1 
ATOM 1419 C CD  . ARG A 1 173 ? 16.943  61.594  3.768   1.00 200.00 ? 215 ARG A CD  1 
ATOM 1420 N NE  . ARG A 1 173 ? 17.085  60.770  2.576   1.00 200.00 ? 215 ARG A NE  1 
ATOM 1421 C CZ  . ARG A 1 173 ? 16.171  60.691  1.617   1.00 200.00 ? 215 ARG A CZ  1 
ATOM 1422 N NH1 . ARG A 1 173 ? 15.045  61.384  1.713   1.00 200.00 ? 215 ARG A NH1 1 
ATOM 1423 N NH2 . ARG A 1 173 ? 16.392  59.942  0.548   1.00 200.00 ? 215 ARG A NH2 1 
ATOM 1424 N N   . GLN A 1 174 ? 16.458  60.299  7.896   1.00 200.00 ? 216 GLN A N   1 
ATOM 1425 C CA  . GLN A 1 174 ? 15.296  60.852  8.550   1.00 200.00 ? 216 GLN A CA  1 
ATOM 1426 C C   . GLN A 1 174 ? 15.313  60.551  10.044  1.00 200.00 ? 216 GLN A C   1 
ATOM 1427 O O   . GLN A 1 174 ? 14.657  61.236  10.783  1.00 200.00 ? 216 GLN A O   1 
ATOM 1428 C CB  . GLN A 1 174 ? 14.004  60.374  7.863   1.00 200.00 ? 216 GLN A CB  1 
ATOM 1429 C CG  . GLN A 1 174 ? 13.867  60.876  6.410   1.00 200.00 ? 216 GLN A CG  1 
ATOM 1430 C CD  . GLN A 1 174 ? 12.494  60.599  5.811   1.00 200.00 ? 216 GLN A CD  1 
ATOM 1431 O OE1 . GLN A 1 174 ? 11.474  60.618  6.514   1.00 200.00 ? 216 GLN A OE1 1 
ATOM 1432 N NE2 . GLN A 1 174 ? 12.458  60.372  4.502   1.00 200.00 ? 216 GLN A NE2 1 
ATOM 1433 N N   . GLY A 1 175 ? 16.145  59.605  10.488  1.00 200.00 ? 217 GLY A N   1 
ATOM 1434 C CA  . GLY A 1 175 ? 16.232  59.254  11.906  1.00 200.00 ? 217 GLY A CA  1 
ATOM 1435 C C   . GLY A 1 175 ? 16.585  60.433  12.793  1.00 200.00 ? 217 GLY A C   1 
ATOM 1436 O O   . GLY A 1 175 ? 16.491  60.369  14.024  1.00 200.00 ? 217 GLY A O   1 
ATOM 1437 N N   . LEU A 1 176 ? 16.995  61.515  12.142  1.00 200.00 ? 218 LEU A N   1 
ATOM 1438 C CA  . LEU A 1 176 ? 17.358  62.753  12.807  1.00 200.00 ? 218 LEU A CA  1 
ATOM 1439 C C   . LEU A 1 176 ? 16.079  63.591  12.937  1.00 200.00 ? 218 LEU A C   1 
ATOM 1440 O O   . LEU A 1 176 ? 16.126  64.743  13.374  1.00 200.00 ? 218 LEU A O   1 
ATOM 1441 C CB  . LEU A 1 176 ? 18.401  63.489  11.971  1.00 200.00 ? 218 LEU A CB  1 
ATOM 1442 C CG  . LEU A 1 176 ? 19.387  62.559  11.255  1.00 200.00 ? 218 LEU A CG  1 
ATOM 1443 C CD1 . LEU A 1 176 ? 20.327  63.361  10.362  1.00 200.00 ? 218 LEU A CD1 1 
ATOM 1444 C CD2 . LEU A 1 176 ? 20.146  61.712  12.274  1.00 200.00 ? 218 LEU A CD2 1 
ATOM 1445 N N   . LEU A 1 177 ? 14.946  62.988  12.559  1.00 200.00 ? 219 LEU A N   1 
ATOM 1446 C CA  . LEU A 1 177 ? 13.612  63.606  12.629  1.00 200.00 ? 219 LEU A CA  1 
ATOM 1447 C C   . LEU A 1 177 ? 12.838  62.840  13.726  1.00 200.00 ? 219 LEU A C   1 
ATOM 1448 O O   . LEU A 1 177 ? 12.487  63.431  14.750  1.00 200.00 ? 219 LEU A O   1 
ATOM 1449 C CB  . LEU A 1 177 ? 12.865  63.552  11.266  1.00 200.00 ? 219 LEU A CB  1 
ATOM 1450 C CG  . LEU A 1 177 ? 12.108  64.745  10.638  1.00 200.00 ? 219 LEU A CG  1 
ATOM 1451 C CD1 . LEU A 1 177 ? 11.333  64.253  9.416   1.00 200.00 ? 219 LEU A CD1 1 
ATOM 1452 C CD2 . LEU A 1 177 ? 11.151  65.423  11.612  1.00 200.00 ? 219 LEU A CD2 1 
ATOM 1453 N N   . PRO A 1 178 ? 12.620  61.509  13.575  1.00 185.44 ? 220 PRO A N   1 
ATOM 1454 C CA  . PRO A 1 178 ? 11.887  60.837  14.649  1.00 185.44 ? 220 PRO A CA  1 
ATOM 1455 C C   . PRO A 1 178 ? 12.697  60.358  15.854  1.00 185.44 ? 220 PRO A C   1 
ATOM 1456 O O   . PRO A 1 178 ? 12.500  59.231  16.316  1.00 185.44 ? 220 PRO A O   1 
ATOM 1457 C CB  . PRO A 1 178 ? 11.240  59.660  13.923  1.00 185.44 ? 220 PRO A CB  1 
ATOM 1458 C CG  . PRO A 1 178 ? 12.273  59.281  12.967  1.00 185.44 ? 220 PRO A CG  1 
ATOM 1459 C CD  . PRO A 1 178 ? 12.639  60.629  12.389  1.00 185.44 ? 220 PRO A CD  1 
ATOM 1460 N N   . VAL A 1 179 ? 13.602  61.184  16.375  1.00 185.44 ? 221 VAL A N   1 
ATOM 1461 C CA  . VAL A 1 179 ? 14.321  60.761  17.571  1.00 185.44 ? 221 VAL A CA  1 
ATOM 1462 C C   . VAL A 1 179 ? 13.336  60.974  18.738  1.00 185.44 ? 221 VAL A C   1 
ATOM 1463 O O   . VAL A 1 179 ? 13.717  60.932  19.909  1.00 185.44 ? 221 VAL A O   1 
ATOM 1464 C CB  . VAL A 1 179 ? 15.650  61.523  17.802  1.00 185.44 ? 221 VAL A CB  1 
ATOM 1465 C CG1 . VAL A 1 179 ? 16.477  60.803  18.866  1.00 185.44 ? 221 VAL A CG1 1 
ATOM 1466 C CG2 . VAL A 1 179 ? 16.440  61.624  16.516  1.00 185.44 ? 221 VAL A CG2 1 
ATOM 1467 N N   . LEU A 1 180 ? 12.067  61.209  18.369  1.00 185.44 ? 222 LEU A N   1 
ATOM 1468 C CA  . LEU A 1 180 ? 10.938  61.403  19.278  1.00 185.44 ? 222 LEU A CA  1 
ATOM 1469 C C   . LEU A 1 180 ? 11.053  60.316  20.324  1.00 185.44 ? 222 LEU A C   1 
ATOM 1470 O O   . LEU A 1 180 ? 11.548  59.219  20.048  1.00 185.44 ? 222 LEU A O   1 
ATOM 1471 C CB  . LEU A 1 180 ? 9.616   61.236  18.508  1.00 185.44 ? 222 LEU A CB  1 
ATOM 1472 C CG  . LEU A 1 180 ? 8.258   61.766  18.996  1.00 185.44 ? 222 LEU A CG  1 
ATOM 1473 C CD1 . LEU A 1 180 ? 7.213   61.480  17.927  1.00 185.44 ? 222 LEU A CD1 1 
ATOM 1474 C CD2 . LEU A 1 180 ? 7.831   61.150  20.319  1.00 185.44 ? 222 LEU A CD2 1 
ATOM 1475 N N   . GLU A 1 181 ? 10.581  60.605  21.524  1.00 185.44 ? 223 GLU A N   1 
ATOM 1476 C CA  . GLU A 1 181 ? 10.706  59.633  22.590  1.00 185.44 ? 223 GLU A CA  1 
ATOM 1477 C C   . GLU A 1 181 ? 9.417   59.270  23.320  1.00 185.44 ? 223 GLU A C   1 
ATOM 1478 O O   . GLU A 1 181 ? 8.312   59.514  22.822  1.00 185.44 ? 223 GLU A O   1 
ATOM 1479 C CB  . GLU A 1 181 ? 11.811  60.107  23.548  1.00 185.44 ? 223 GLU A CB  1 
ATOM 1480 C CG  . GLU A 1 181 ? 13.199  60.083  22.879  1.00 185.44 ? 223 GLU A CG  1 
ATOM 1481 C CD  . GLU A 1 181 ? 14.288  60.821  23.642  1.00 185.44 ? 223 GLU A CD  1 
ATOM 1482 O OE1 . GLU A 1 181 ? 14.163  61.004  24.872  1.00 185.44 ? 223 GLU A OE1 1 
ATOM 1483 O OE2 . GLU A 1 181 ? 15.290  61.203  22.999  1.00 185.44 ? 223 GLU A OE2 1 
ATOM 1484 N N   . SER A 1 182 ? 9.565   58.586  24.451  1.00 185.44 ? 224 SER A N   1 
ATOM 1485 C CA  . SER A 1 182 ? 8.406   58.192  25.240  1.00 185.44 ? 224 SER A CA  1 
ATOM 1486 C C   . SER A 1 182 ? 8.157   59.173  26.373  1.00 185.44 ? 224 SER A C   1 
ATOM 1487 O O   . SER A 1 182 ? 7.006   59.509  26.657  1.00 185.44 ? 224 SER A O   1 
ATOM 1488 C CB  . SER A 1 182 ? 8.545   56.767  25.778  1.00 185.44 ? 224 SER A CB  1 
ATOM 1489 O OG  . SER A 1 182 ? 9.564   56.687  26.753  1.00 185.44 ? 224 SER A OG  1 
ATOM 1490 N N   . PHE A 1 183 ? 9.236   59.666  26.976  1.00 185.44 ? 225 PHE A N   1 
ATOM 1491 C CA  . PHE A 1 183 ? 9.156   60.614  28.081  1.00 185.44 ? 225 PHE A CA  1 
ATOM 1492 C C   . PHE A 1 183 ? 8.032   60.312  29.062  1.00 185.44 ? 225 PHE A C   1 
ATOM 1493 O O   . PHE A 1 183 ? 6.913   60.815  28.914  1.00 185.44 ? 225 PHE A O   1 
ATOM 1494 C CB  . PHE A 1 183 ? 8.980   62.052  27.589  1.00 185.44 ? 225 PHE A CB  1 
ATOM 1495 C CG  . PHE A 1 183 ? 8.803   63.024  28.710  1.00 185.44 ? 225 PHE A CG  1 
ATOM 1496 C CD1 . PHE A 1 183 ? 9.871   63.325  29.541  1.00 185.44 ? 225 PHE A CD1 1 
ATOM 1497 C CD2 . PHE A 1 183 ? 7.549   63.553  29.009  1.00 185.44 ? 225 PHE A CD2 1 
ATOM 1498 C CE1 . PHE A 1 183 ? 9.702   64.123  30.657  1.00 185.44 ? 225 PHE A CE1 1 
ATOM 1499 C CE2 . PHE A 1 183 ? 7.367   64.353  30.123  1.00 185.44 ? 225 PHE A CE2 1 
ATOM 1500 C CZ  . PHE A 1 183 ? 8.447   64.637  30.949  1.00 185.44 ? 225 PHE A CZ  1 
ATOM 1501 N N   . LYS A 1 184 ? 8.325   59.469  30.042  1.00 185.44 ? 226 LYS A N   1 
ATOM 1502 C CA  . LYS A 1 184 ? 7.347   59.122  31.066  1.00 185.44 ? 226 LYS A CA  1 
ATOM 1503 C C   . LYS A 1 184 ? 7.551   60.143  32.178  1.00 185.44 ? 226 LYS A C   1 
ATOM 1504 O O   . LYS A 1 184 ? 8.621   60.178  32.785  1.00 185.44 ? 226 LYS A O   1 
ATOM 1505 C CB  . LYS A 1 184 ? 7.619   57.711  31.627  1.00 185.44 ? 226 LYS A CB  1 
ATOM 1506 C CG  . LYS A 1 184 ? 7.696   56.573  30.592  1.00 185.44 ? 226 LYS A CG  1 
ATOM 1507 C CD  . LYS A 1 184 ? 8.170   55.258  31.244  1.00 185.44 ? 226 LYS A CD  1 
ATOM 1508 C CE  . LYS A 1 184 ? 8.275   54.103  30.239  1.00 185.44 ? 226 LYS A CE  1 
ATOM 1509 N NZ  . LYS A 1 184 ? 8.799   52.838  30.855  1.00 185.44 ? 226 LYS A NZ  1 
ATOM 1510 N N   . VAL A 1 185 ? 6.540   60.967  32.439  1.00 185.44 ? 227 VAL A N   1 
ATOM 1511 C CA  . VAL A 1 185 ? 6.596   61.986  33.485  1.00 185.44 ? 227 VAL A CA  1 
ATOM 1512 C C   . VAL A 1 185 ? 7.460   61.548  34.678  1.00 185.44 ? 227 VAL A C   1 
ATOM 1513 O O   . VAL A 1 185 ? 8.240   62.330  35.205  1.00 185.44 ? 227 VAL A O   1 
ATOM 1514 C CB  . VAL A 1 185 ? 5.179   62.290  33.951  1.00 185.44 ? 227 VAL A CB  1 
ATOM 1515 C CG1 . VAL A 1 185 ? 4.931   61.727  35.306  1.00 185.44 ? 227 VAL A CG1 1 
ATOM 1516 C CG2 . VAL A 1 185 ? 4.920   63.752  33.893  1.00 185.44 ? 227 VAL A CG2 1 
ATOM 1517 N N   . SER A 1 186 ? 7.345   60.261  35.009  1.00 133.17 ? 228 SER A N   1 
ATOM 1518 C CA  . SER A 1 186 ? 8.050   59.549  36.083  1.00 133.17 ? 228 SER A CA  1 
ATOM 1519 C C   . SER A 1 186 ? 7.130   59.291  37.264  1.00 133.17 ? 228 SER A C   1 
ATOM 1520 O O   . SER A 1 186 ? 6.452   58.272  37.314  1.00 133.17 ? 228 SER A O   1 
ATOM 1521 C CB  . SER A 1 186 ? 9.397   60.194  36.497  1.00 133.17 ? 228 SER A CB  1 
ATOM 1522 O OG  . SER A 1 186 ? 9.260   61.373  37.266  1.00 133.17 ? 228 SER A OG  1 
ATOM 1523 N N   . PHE A 1 187 ? 7.100   60.214  38.206  1.00 133.17 ? 229 PHE A N   1 
ATOM 1524 C CA  . PHE A 1 187 ? 6.250   60.114  39.382  1.00 133.17 ? 229 PHE A CA  1 
ATOM 1525 C C   . PHE A 1 187 ? 4.847   59.598  39.056  1.00 133.17 ? 229 PHE A C   1 
ATOM 1526 O O   . PHE A 1 187 ? 4.331   58.735  39.748  1.00 133.17 ? 229 PHE A O   1 
ATOM 1527 C CB  . PHE A 1 187 ? 6.151   61.493  39.995  1.00 133.17 ? 229 PHE A CB  1 
ATOM 1528 C CG  . PHE A 1 187 ? 5.939   62.560  38.979  1.00 133.17 ? 229 PHE A CG  1 
ATOM 1529 C CD1 . PHE A 1 187 ? 7.004   63.033  38.217  1.00 133.17 ? 229 PHE A CD1 1 
ATOM 1530 C CD2 . PHE A 1 187 ? 4.664   63.036  38.718  1.00 133.17 ? 229 PHE A CD2 1 
ATOM 1531 C CE1 . PHE A 1 187 ? 6.804   63.961  37.206  1.00 133.17 ? 229 PHE A CE1 1 
ATOM 1532 C CE2 . PHE A 1 187 ? 4.452   63.965  37.709  1.00 133.17 ? 229 PHE A CE2 1 
ATOM 1533 C CZ  . PHE A 1 187 ? 5.525   64.428  36.950  1.00 133.17 ? 229 PHE A CZ  1 
ATOM 1534 N N   . LEU A 1 188 ? 4.234   60.117  38.000  1.00 133.17 ? 230 LEU A N   1 
ATOM 1535 C CA  . LEU A 1 188 ? 2.898   59.676  37.627  1.00 133.17 ? 230 LEU A CA  1 
ATOM 1536 C C   . LEU A 1 188 ? 2.911   58.184  37.409  1.00 133.17 ? 230 LEU A C   1 
ATOM 1537 O O   . LEU A 1 188 ? 2.020   57.467  37.858  1.00 133.17 ? 230 LEU A O   1 
ATOM 1538 C CB  . LEU A 1 188 ? 2.455   60.360  36.351  1.00 133.17 ? 230 LEU A CB  1 
ATOM 1539 C CG  . LEU A 1 188 ? 1.334   59.674  35.590  1.00 133.17 ? 230 LEU A CG  1 
ATOM 1540 C CD1 . LEU A 1 188 ? 0.012   59.971  36.258  1.00 133.17 ? 230 LEU A CD1 1 
ATOM 1541 C CD2 . LEU A 1 188 ? 1.335   60.171  34.169  1.00 133.17 ? 230 LEU A CD2 1 
ATOM 1542 N N   . SER A 1 189 ? 3.938   57.726  36.711  1.00 133.17 ? 231 SER A N   1 
ATOM 1543 C CA  . SER A 1 189 ? 4.098   56.318  36.441  1.00 133.17 ? 231 SER A CA  1 
ATOM 1544 C C   . SER A 1 189 ? 3.999   55.545  37.753  1.00 133.17 ? 231 SER A C   1 
ATOM 1545 O O   . SER A 1 189 ? 3.599   54.387  37.768  1.00 133.17 ? 231 SER A O   1 
ATOM 1546 C CB  . SER A 1 189 ? 5.444   56.075  35.777  1.00 133.17 ? 231 SER A CB  1 
ATOM 1547 O OG  . SER A 1 189 ? 5.669   54.695  35.593  1.00 133.17 ? 231 SER A OG  1 
ATOM 1548 N N   . ALA A 1 190 ? 4.343   56.202  38.857  1.00 133.17 ? 232 ALA A N   1 
ATOM 1549 C CA  . ALA A 1 190 ? 4.262   55.574  40.172  1.00 133.17 ? 232 ALA A CA  1 
ATOM 1550 C C   . ALA A 1 190 ? 2.810   55.279  40.514  1.00 133.17 ? 232 ALA A C   1 
ATOM 1551 O O   . ALA A 1 190 ? 2.499   54.231  41.066  1.00 133.17 ? 232 ALA A O   1 
ATOM 1552 C CB  . ALA A 1 190 ? 4.877   56.468  41.231  1.00 133.17 ? 232 ALA A CB  1 
ATOM 1553 N N   . LEU A 1 191 ? 1.925   56.213  40.190  1.00 133.17 ? 233 LEU A N   1 
ATOM 1554 C CA  . LEU A 1 191 ? 0.510   56.019  40.449  1.00 133.17 ? 233 LEU A CA  1 
ATOM 1555 C C   . LEU A 1 191 ? 0.009   54.892  39.591  1.00 133.17 ? 233 LEU A C   1 
ATOM 1556 O O   . LEU A 1 191 ? -0.852  54.124  40.010  1.00 133.17 ? 233 LEU A O   1 
ATOM 1557 C CB  . LEU A 1 191 ? -0.281  57.276  40.136  1.00 133.17 ? 233 LEU A CB  1 
ATOM 1558 C CG  . LEU A 1 191 ? -0.187  58.308  41.247  1.00 133.17 ? 233 LEU A CG  1 
ATOM 1559 C CD1 . LEU A 1 191 ? -0.658  57.679  42.548  1.00 133.17 ? 233 LEU A CD1 1 
ATOM 1560 C CD2 . LEU A 1 191 ? 1.236   58.815  41.364  1.00 133.17 ? 233 LEU A CD2 1 
ATOM 1561 N N   . GLU A 1 192 ? 0.553   54.816  38.379  1.00 133.17 ? 234 GLU A N   1 
ATOM 1562 C CA  . GLU A 1 192 ? 0.190   53.775  37.425  1.00 133.17 ? 234 GLU A CA  1 
ATOM 1563 C C   . GLU A 1 192 ? 0.273   52.395  38.084  1.00 133.17 ? 234 GLU A C   1 
ATOM 1564 O O   . GLU A 1 192 ? -0.652  51.592  37.961  1.00 133.17 ? 234 GLU A O   1 
ATOM 1565 C CB  . GLU A 1 192 ? 1.093   53.837  36.180  1.00 133.17 ? 234 GLU A CB  1 
ATOM 1566 C CG  . GLU A 1 192 ? 0.772   54.971  35.192  1.00 133.17 ? 234 GLU A CG  1 
ATOM 1567 C CD  . GLU A 1 192 ? 0.069   54.488  33.917  1.00 133.17 ? 234 GLU A CD  1 
ATOM 1568 O OE1 . GLU A 1 192 ? 0.542   53.508  33.294  1.00 133.17 ? 234 GLU A OE1 1 
ATOM 1569 O OE2 . GLU A 1 192 ? -0.952  55.100  33.529  1.00 133.17 ? 234 GLU A OE2 1 
ATOM 1570 N N   . GLU A 1 193 ? 1.352   52.148  38.825  1.00 133.17 ? 235 GLU A N   1 
ATOM 1571 C CA  . GLU A 1 193 ? 1.538   50.870  39.518  1.00 133.17 ? 235 GLU A CA  1 
ATOM 1572 C C   . GLU A 1 193 ? 0.710   50.905  40.817  1.00 133.17 ? 235 GLU A C   1 
ATOM 1573 O O   . GLU A 1 193 ? -0.110  50.022  41.082  1.00 133.17 ? 235 GLU A O   1 
ATOM 1574 C CB  . GLU A 1 193 ? 3.047   50.625  39.790  1.00 133.17 ? 235 GLU A CB  1 
ATOM 1575 C CG  . GLU A 1 193 ? 3.441   49.153  40.110  1.00 133.17 ? 235 GLU A CG  1 
ATOM 1576 C CD  . GLU A 1 193 ? 4.952   48.850  40.002  1.00 133.17 ? 235 GLU A CD  1 
ATOM 1577 O OE1 . GLU A 1 193 ? 5.667   49.542  39.240  1.00 133.17 ? 235 GLU A OE1 1 
ATOM 1578 O OE2 . GLU A 1 193 ? 5.422   47.893  40.667  1.00 133.17 ? 235 GLU A OE2 1 
ATOM 1579 N N   . TYR A 1 194 ? 0.838   52.017  41.530  1.00 133.17 ? 236 TYR A N   1 
ATOM 1580 C CA  . TYR A 1 194 ? 0.164   52.263  42.796  1.00 133.17 ? 236 TYR A CA  1 
ATOM 1581 C C   . TYR A 1 194 ? -1.280  51.763  42.908  1.00 133.17 ? 236 TYR A C   1 
ATOM 1582 O O   . TYR A 1 194 ? -1.559  50.757  43.558  1.00 133.17 ? 236 TYR A O   1 
ATOM 1583 C CB  . TYR A 1 194 ? 0.211   53.756  43.083  1.00 133.17 ? 236 TYR A CB  1 
ATOM 1584 C CG  . TYR A 1 194 ? -0.424  54.090  44.379  1.00 133.17 ? 236 TYR A CG  1 
ATOM 1585 C CD1 . TYR A 1 194 ? 0.140   53.653  45.564  1.00 133.17 ? 236 TYR A CD1 1 
ATOM 1586 C CD2 . TYR A 1 194 ? -1.624  54.773  44.423  1.00 133.17 ? 236 TYR A CD2 1 
ATOM 1587 C CE1 . TYR A 1 194 ? -0.466  53.890  46.760  1.00 133.17 ? 236 TYR A CE1 1 
ATOM 1588 C CE2 . TYR A 1 194 ? -2.244  55.015  45.619  1.00 133.17 ? 236 TYR A CE2 1 
ATOM 1589 C CZ  . TYR A 1 194 ? -1.660  54.563  46.783  1.00 133.17 ? 236 TYR A CZ  1 
ATOM 1590 O OH  . TYR A 1 194 ? -2.262  54.789  47.987  1.00 133.17 ? 236 TYR A OH  1 
ATOM 1591 N N   . THR A 1 195 ? -2.187  52.488  42.272  1.00 133.17 ? 237 THR A N   1 
ATOM 1592 C CA  . THR A 1 195 ? -3.602  52.158  42.281  1.00 133.17 ? 237 THR A CA  1 
ATOM 1593 C C   . THR A 1 195 ? -3.945  50.779  41.720  1.00 133.17 ? 237 THR A C   1 
ATOM 1594 O O   . THR A 1 195 ? -5.031  50.254  41.968  1.00 133.17 ? 237 THR A O   1 
ATOM 1595 C CB  . THR A 1 195 ? -4.390  53.231  41.536  1.00 133.17 ? 237 THR A CB  1 
ATOM 1596 O OG1 . THR A 1 195 ? -3.778  53.461  40.261  1.00 133.17 ? 237 THR A OG1 1 
ATOM 1597 C CG2 . THR A 1 195 ? -4.386  54.537  42.338  1.00 133.17 ? 237 THR A CG2 1 
ATOM 1598 N N   . LYS A 1 196 ? -3.014  50.190  40.978  1.00 133.17 ? 238 LYS A N   1 
ATOM 1599 C CA  . LYS A 1 196 ? -3.225  48.872  40.389  1.00 133.17 ? 238 LYS A CA  1 
ATOM 1600 C C   . LYS A 1 196 ? -3.352  47.799  41.459  1.00 133.17 ? 238 LYS A C   1 
ATOM 1601 O O   . LYS A 1 196 ? -4.309  47.021  41.456  1.00 133.17 ? 238 LYS A O   1 
ATOM 1602 C CB  . LYS A 1 196 ? -2.086  48.513  39.427  1.00 133.17 ? 238 LYS A CB  1 
ATOM 1603 C CG  . LYS A 1 196 ? -2.314  47.222  38.638  1.00 133.17 ? 238 LYS A CG  1 
ATOM 1604 C CD  . LYS A 1 196 ? -1.161  46.899  37.684  1.00 133.17 ? 238 LYS A CD  1 
ATOM 1605 C CE  . LYS A 1 196 ? -1.488  45.694  36.794  1.00 133.17 ? 238 LYS A CE  1 
ATOM 1606 N NZ  . LYS A 1 196 ? -0.339  45.266  35.945  1.00 133.17 ? 238 LYS A NZ  1 
ATOM 1607 N N   . LYS A 1 197 ? -2.384  47.763  42.372  1.00 133.17 ? 239 LYS A N   1 
ATOM 1608 C CA  . LYS A 1 197 ? -2.389  46.777  43.447  1.00 133.17 ? 239 LYS A CA  1 
ATOM 1609 C C   . LYS A 1 197 ? -3.644  46.867  44.307  1.00 133.17 ? 239 LYS A C   1 
ATOM 1610 O O   . LYS A 1 197 ? -4.188  45.843  44.728  1.00 133.17 ? 239 LYS A O   1 
ATOM 1611 C CB  . LYS A 1 197 ? -1.121  46.884  44.309  1.00 133.17 ? 239 LYS A CB  1 
ATOM 1612 C CG  . LYS A 1 197 ? 0.138   46.296  43.649  1.00 133.17 ? 239 LYS A CG  1 
ATOM 1613 C CD  . LYS A 1 197 ? 1.335   46.231  44.609  1.00 133.17 ? 239 LYS A CD  1 
ATOM 1614 C CE  . LYS A 1 197 ? 2.545   45.523  43.977  1.00 133.17 ? 239 LYS A CE  1 
ATOM 1615 N NZ  . LYS A 1 197 ? 3.719   45.452  44.901  1.00 133.17 ? 239 LYS A NZ  1 
ATOM 1616 N N   . LEU A 1 198 ? -4.156  48.085  44.465  1.00 133.17 ? 240 LEU A N   1 
ATOM 1617 C CA  . LEU A 1 198 ? -5.356  48.340  45.262  1.00 133.17 ? 240 LEU A CA  1 
ATOM 1618 C C   . LEU A 1 198 ? -6.488  47.369  44.931  1.00 133.17 ? 240 LEU A C   1 
ATOM 1619 O O   . LEU A 1 198 ? -7.338  47.066  45.776  1.00 133.17 ? 240 LEU A O   1 
ATOM 1620 C CB  . LEU A 1 198 ? -5.851  49.772  45.033  1.00 133.17 ? 240 LEU A CB  1 
ATOM 1621 C CG  . LEU A 1 198 ? -4.829  50.909  45.028  1.00 133.17 ? 240 LEU A CG  1 
ATOM 1622 C CD1 . LEU A 1 198 ? -5.567  52.223  44.954  1.00 133.17 ? 240 LEU A CD1 1 
ATOM 1623 C CD2 . LEU A 1 198 ? -3.940  50.865  46.248  1.00 133.17 ? 240 LEU A CD2 1 
ATOM 1624 N N   . ASN A 1 199 ? -6.496  46.882  43.697  1.00 133.17 ? 241 ASN A N   1 
ATOM 1625 C CA  . ASN A 1 199 ? -7.526  45.957  43.274  1.00 133.17 ? 241 ASN A CA  1 
ATOM 1626 C C   . ASN A 1 199 ? -7.007  44.551  42.989  1.00 133.17 ? 241 ASN A C   1 
ATOM 1627 O O   . ASN A 1 199 ? -7.764  43.593  43.129  1.00 133.17 ? 241 ASN A O   1 
ATOM 1628 C CB  . ASN A 1 199 ? -8.286  46.518  42.073  1.00 133.17 ? 241 ASN A CB  1 
ATOM 1629 C CG  . ASN A 1 199 ? -8.882  47.892  42.352  1.00 133.17 ? 241 ASN A CG  1 
ATOM 1630 O OD1 . ASN A 1 199 ? -9.700  48.057  43.262  1.00 133.17 ? 241 ASN A OD1 1 
ATOM 1631 N ND2 . ASN A 1 199 ? -8.457  48.888  41.584  1.00 133.17 ? 241 ASN A ND2 1 
ATOM 1632 N N   . THR A 1 200 ? -5.727  44.412  42.624  1.00 133.17 ? 242 THR A N   1 
ATOM 1633 C CA  . THR A 1 200 ? -5.171  43.077  42.347  1.00 133.17 ? 242 THR A CA  1 
ATOM 1634 C C   . THR A 1 200 ? -5.023  42.226  43.613  1.00 133.17 ? 242 THR A C   1 
ATOM 1635 O O   . THR A 1 200 ? -4.640  41.052  43.541  1.00 133.17 ? 242 THR A O   1 
ATOM 1636 C CB  . THR A 1 200 ? -3.824  43.106  41.577  1.00 133.17 ? 242 THR A CB  1 
ATOM 1637 O OG1 . THR A 1 200 ? -2.896  43.959  42.257  1.00 133.17 ? 242 THR A OG1 1 
ATOM 1638 C CG2 . THR A 1 200 ? -4.024  43.574  40.141  1.00 133.17 ? 242 THR A CG2 1 
ATOM 1639 N N   . GLN A 1 201 ? -5.318  42.830  44.766  1.00 133.17 ? 243 GLN A N   1 
ATOM 1640 C CA  . GLN A 1 201 ? -5.270  42.132  46.053  1.00 133.17 ? 243 GLN A CA  1 
ATOM 1641 C C   . GLN A 1 201 ? -6.445  42.599  46.918  1.00 133.17 ? 243 GLN A C   1 
ATOM 1642 O O   . GLN A 1 201 ? -7.601  42.458  46.445  1.00 133.17 ? 243 GLN A O   1 
ATOM 1643 C CB  . GLN A 1 201 ? -3.930  42.356  46.780  1.00 133.17 ? 243 GLN A CB  1 
ATOM 1644 C CG  . GLN A 1 201 ? -3.125  41.064  47.086  1.00 133.17 ? 243 GLN A CG  1 
ATOM 1645 C CD  . GLN A 1 201 ? -3.412  40.447  48.465  1.00 133.17 ? 243 GLN A CD  1 
ATOM 1646 O OE1 . GLN A 1 201 ? -2.766  40.794  49.466  1.00 133.17 ? 243 GLN A OE1 1 
ATOM 1647 N NE2 . GLN A 1 201 ? -4.344  39.497  48.509  1.00 133.17 ? 243 GLN A NE2 1 
ATOM 1648 N N   . MET B 1 1   ? 21.347  61.945  22.097  1.00 166.13 ? 43  MET B N   1 
ATOM 1649 C CA  . MET B 1 1   ? 22.462  61.020  22.446  1.00 166.13 ? 43  MET B CA  1 
ATOM 1650 C C   . MET B 1 1   ? 23.396  60.873  21.243  1.00 166.13 ? 43  MET B C   1 
ATOM 1651 O O   . MET B 1 1   ? 24.235  61.733  20.992  1.00 166.13 ? 43  MET B O   1 
ATOM 1652 C CB  . MET B 1 1   ? 21.897  59.654  22.866  1.00 166.13 ? 43  MET B CB  1 
ATOM 1653 C CG  . MET B 1 1   ? 20.793  59.704  23.932  1.00 166.13 ? 43  MET B CG  1 
ATOM 1654 S SD  . MET B 1 1   ? 21.159  60.729  25.390  1.00 166.13 ? 43  MET B SD  1 
ATOM 1655 C CE  . MET B 1 1   ? 22.494  59.805  26.178  1.00 166.13 ? 43  MET B CE  1 
ATOM 1656 N N   . LEU B 1 2   ? 23.249  59.769  20.520  1.00 166.13 ? 44  LEU B N   1 
ATOM 1657 C CA  . LEU B 1 2   ? 24.040  59.490  19.332  1.00 166.13 ? 44  LEU B CA  1 
ATOM 1658 C C   . LEU B 1 2   ? 23.050  58.923  18.340  1.00 166.13 ? 44  LEU B C   1 
ATOM 1659 O O   . LEU B 1 2   ? 23.149  57.763  17.983  1.00 166.13 ? 44  LEU B O   1 
ATOM 1660 C CB  . LEU B 1 2   ? 25.108  58.423  19.622  1.00 166.13 ? 44  LEU B CB  1 
ATOM 1661 C CG  . LEU B 1 2   ? 26.585  58.794  19.806  1.00 166.13 ? 44  LEU B CG  1 
ATOM 1662 C CD1 . LEU B 1 2   ? 27.399  57.527  20.036  1.00 166.13 ? 44  LEU B CD1 1 
ATOM 1663 C CD2 . LEU B 1 2   ? 27.109  59.538  18.584  1.00 166.13 ? 44  LEU B CD2 1 
ATOM 1664 N N   . LYS B 1 3   ? 22.076  59.722  17.912  1.00 166.13 ? 45  LYS B N   1 
ATOM 1665 C CA  . LYS B 1 3   ? 21.088  59.225  16.953  1.00 166.13 ? 45  LYS B CA  1 
ATOM 1666 C C   . LYS B 1 3   ? 21.791  58.817  15.674  1.00 166.13 ? 45  LYS B C   1 
ATOM 1667 O O   . LYS B 1 3   ? 21.216  58.130  14.837  1.00 166.13 ? 45  LYS B O   1 
ATOM 1668 C CB  . LYS B 1 3   ? 20.047  60.277  16.606  1.00 166.13 ? 45  LYS B CB  1 
ATOM 1669 C CG  . LYS B 1 3   ? 19.575  61.055  17.776  1.00 166.13 ? 45  LYS B CG  1 
ATOM 1670 C CD  . LYS B 1 3   ? 19.692  62.506  17.447  1.00 166.13 ? 45  LYS B CD  1 
ATOM 1671 C CE  . LYS B 1 3   ? 19.719  63.338  18.697  1.00 166.13 ? 45  LYS B CE  1 
ATOM 1672 N NZ  . LYS B 1 3   ? 20.094  64.726  18.327  1.00 166.13 ? 45  LYS B NZ  1 
ATOM 1673 N N   . LEU B 1 4   ? 23.024  59.284  15.512  1.00 166.13 ? 46  LEU B N   1 
ATOM 1674 C CA  . LEU B 1 4   ? 23.828  58.957  14.349  1.00 166.13 ? 46  LEU B CA  1 
ATOM 1675 C C   . LEU B 1 4   ? 24.452  57.591  14.559  1.00 166.13 ? 46  LEU B C   1 
ATOM 1676 O O   . LEU B 1 4   ? 24.945  56.990  13.626  1.00 166.13 ? 46  LEU B O   1 
ATOM 1677 C CB  . LEU B 1 4   ? 24.936  59.978  14.182  1.00 166.13 ? 46  LEU B CB  1 
ATOM 1678 C CG  . LEU B 1 4   ? 24.517  61.438  14.174  1.00 166.13 ? 46  LEU B CG  1 
ATOM 1679 C CD1 . LEU B 1 4   ? 25.735  62.278  13.870  1.00 166.13 ? 46  LEU B CD1 1 
ATOM 1680 C CD2 . LEU B 1 4   ? 23.438  61.644  13.136  1.00 166.13 ? 46  LEU B CD2 1 
ATOM 1681 N N   . LEU B 1 5   ? 24.465  57.133  15.805  1.00 166.13 ? 47  LEU B N   1 
ATOM 1682 C CA  . LEU B 1 5   ? 25.008  55.826  16.163  1.00 166.13 ? 47  LEU B CA  1 
ATOM 1683 C C   . LEU B 1 5   ? 24.563  54.758  15.175  1.00 166.13 ? 47  LEU B C   1 
ATOM 1684 O O   . LEU B 1 5   ? 25.323  53.837  14.876  1.00 166.13 ? 47  LEU B O   1 
ATOM 1685 C CB  . LEU B 1 5   ? 24.546  55.431  17.568  1.00 166.13 ? 47  LEU B CB  1 
ATOM 1686 C CG  . LEU B 1 5   ? 24.974  54.108  18.198  1.00 166.13 ? 47  LEU B CG  1 
ATOM 1687 C CD1 . LEU B 1 5   ? 26.450  54.170  18.546  1.00 166.13 ? 47  LEU B CD1 1 
ATOM 1688 C CD2 . LEU B 1 5   ? 24.131  53.836  19.440  1.00 166.13 ? 47  LEU B CD2 1 
ATOM 1689 N N   . ASP B 1 6   ? 23.358  54.927  14.624  1.00 166.13 ? 48  ASP B N   1 
ATOM 1690 C CA  . ASP B 1 6   ? 22.814  53.966  13.661  1.00 166.13 ? 48  ASP B CA  1 
ATOM 1691 C C   . ASP B 1 6   ? 23.565  53.946  12.333  1.00 166.13 ? 48  ASP B C   1 
ATOM 1692 O O   . ASP B 1 6   ? 23.088  53.365  11.353  1.00 166.13 ? 48  ASP B O   1 
ATOM 1693 C CB  . ASP B 1 6   ? 21.303  54.144  13.415  1.00 166.13 ? 48  ASP B CB  1 
ATOM 1694 C CG  . ASP B 1 6   ? 20.731  55.390  14.054  1.00 166.13 ? 48  ASP B CG  1 
ATOM 1695 O OD1 . ASP B 1 6   ? 20.841  55.538  15.292  1.00 166.13 ? 48  ASP B OD1 1 
ATOM 1696 O OD2 . ASP B 1 6   ? 20.140  56.211  13.324  1.00 166.13 ? 48  ASP B OD2 1 
ATOM 1697 N N   . ASN B 1 7   ? 24.728  54.598  12.300  1.00 166.13 ? 49  ASN B N   1 
ATOM 1698 C CA  . ASN B 1 7   ? 25.571  54.626  11.111  1.00 166.13 ? 49  ASN B CA  1 
ATOM 1699 C C   . ASN B 1 7   ? 26.152  53.215  10.952  1.00 166.13 ? 49  ASN B C   1 
ATOM 1700 O O   . ASN B 1 7   ? 26.175  52.662  9.855   1.00 166.13 ? 49  ASN B O   1 
ATOM 1701 C CB  . ASN B 1 7   ? 26.706  55.663  11.261  1.00 166.13 ? 49  ASN B CB  1 
ATOM 1702 C CG  . ASN B 1 7   ? 26.197  57.108  11.371  1.00 166.13 ? 49  ASN B CG  1 
ATOM 1703 O OD1 . ASN B 1 7   ? 25.106  57.440  10.904  1.00 166.13 ? 49  ASN B OD1 1 
ATOM 1704 N ND2 . ASN B 1 7   ? 26.977  57.961  12.033  1.00 166.13 ? 49  ASN B ND2 1 
ATOM 1705 N N   . TRP B 1 8   ? 26.584  52.631  12.069  1.00 199.51 ? 50  TRP B N   1 
ATOM 1706 C CA  . TRP B 1 8   ? 27.140  51.280  12.082  1.00 199.51 ? 50  TRP B CA  1 
ATOM 1707 C C   . TRP B 1 8   ? 26.067  50.256  11.723  1.00 199.51 ? 50  TRP B C   1 
ATOM 1708 O O   . TRP B 1 8   ? 26.382  49.158  11.264  1.00 199.51 ? 50  TRP B O   1 
ATOM 1709 C CB  . TRP B 1 8   ? 27.727  50.957  13.457  1.00 199.51 ? 50  TRP B CB  1 
ATOM 1710 C CG  . TRP B 1 8   ? 29.001  51.683  13.765  1.00 199.51 ? 50  TRP B CG  1 
ATOM 1711 C CD1 . TRP B 1 8   ? 29.134  52.879  14.412  1.00 199.51 ? 50  TRP B CD1 1 
ATOM 1712 C CD2 . TRP B 1 8   ? 30.335  51.235  13.470  1.00 199.51 ? 50  TRP B CD2 1 
ATOM 1713 N NE1 . TRP B 1 8   ? 30.464  53.202  14.544  1.00 199.51 ? 50  TRP B NE1 1 
ATOM 1714 C CE2 . TRP B 1 8   ? 31.224  52.210  13.975  1.00 199.51 ? 50  TRP B CE2 1 
ATOM 1715 C CE3 . TRP B 1 8   ? 30.866  50.101  12.829  1.00 199.51 ? 50  TRP B CE3 1 
ATOM 1716 C CZ2 . TRP B 1 8   ? 32.620  52.088  13.862  1.00 199.51 ? 50  TRP B CZ2 1 
ATOM 1717 C CZ3 . TRP B 1 8   ? 32.256  49.980  12.716  1.00 199.51 ? 50  TRP B CZ3 1 
ATOM 1718 C CH2 . TRP B 1 8   ? 33.115  50.970  13.232  1.00 199.51 ? 50  TRP B CH2 1 
ATOM 1719 N N   . ASP B 1 9   ? 24.806  50.623  11.967  1.00 199.51 ? 51  ASP B N   1 
ATOM 1720 C CA  . ASP B 1 9   ? 23.642  49.786  11.654  1.00 199.51 ? 51  ASP B CA  1 
ATOM 1721 C C   . ASP B 1 9   ? 23.590  49.578  10.142  1.00 199.51 ? 51  ASP B C   1 
ATOM 1722 O O   . ASP B 1 9   ? 23.300  48.481  9.660   1.00 199.51 ? 51  ASP B O   1 
ATOM 1723 C CB  . ASP B 1 9   ? 22.328  50.489  12.065  1.00 199.51 ? 51  ASP B CB  1 
ATOM 1724 C CG  . ASP B 1 9   ? 21.939  50.263  13.526  1.00 199.51 ? 51  ASP B CG  1 
ATOM 1725 O OD1 . ASP B 1 9   ? 22.830  50.099  14.387  1.00 199.51 ? 51  ASP B OD1 1 
ATOM 1726 O OD2 . ASP B 1 9   ? 20.720  50.276  13.815  1.00 199.51 ? 51  ASP B OD2 1 
ATOM 1727 N N   . SER B 1 10  ? 23.845  50.662  9.408   1.00 199.51 ? 52  SER B N   1 
ATOM 1728 C CA  . SER B 1 10  ? 23.818  50.659  7.948   1.00 199.51 ? 52  SER B CA  1 
ATOM 1729 C C   . SER B 1 10  ? 25.064  50.051  7.306   1.00 199.51 ? 52  SER B C   1 
ATOM 1730 O O   . SER B 1 10  ? 24.998  49.507  6.204   1.00 199.51 ? 52  SER B O   1 
ATOM 1731 C CB  . SER B 1 10  ? 23.580  52.079  7.418   1.00 199.51 ? 52  SER B CB  1 
ATOM 1732 O OG  . SER B 1 10  ? 24.496  53.003  7.980   1.00 199.51 ? 52  SER B OG  1 
ATOM 1733 N N   . VAL B 1 11  ? 26.196  50.145  7.995   1.00 199.51 ? 53  VAL B N   1 
ATOM 1734 C CA  . VAL B 1 11  ? 27.446  49.592  7.494   1.00 199.51 ? 53  VAL B CA  1 
ATOM 1735 C C   . VAL B 1 11  ? 27.365  48.062  7.527   1.00 199.51 ? 53  VAL B C   1 
ATOM 1736 O O   . VAL B 1 11  ? 27.654  47.390  6.536   1.00 199.51 ? 53  VAL B O   1 
ATOM 1737 C CB  . VAL B 1 11  ? 28.629  50.071  8.363   1.00 199.51 ? 53  VAL B CB  1 
ATOM 1738 C CG1 . VAL B 1 11  ? 29.926  49.532  7.829   1.00 199.51 ? 53  VAL B CG1 1 
ATOM 1739 C CG2 . VAL B 1 11  ? 28.675  51.585  8.392   1.00 199.51 ? 53  VAL B CG2 1 
ATOM 1740 N N   . THR B 1 12  ? 26.885  47.538  8.651   1.00 189.78 ? 54  THR B N   1 
ATOM 1741 C CA  . THR B 1 12  ? 26.752  46.098  8.872   1.00 189.78 ? 54  THR B CA  1 
ATOM 1742 C C   . THR B 1 12  ? 25.691  45.371  8.030   1.00 189.78 ? 54  THR B C   1 
ATOM 1743 O O   . THR B 1 12  ? 26.004  44.369  7.379   1.00 189.78 ? 54  THR B O   1 
ATOM 1744 C CB  . THR B 1 12  ? 26.507  45.794  10.368  1.00 189.78 ? 54  THR B CB  1 
ATOM 1745 O OG1 . THR B 1 12  ? 25.384  46.552  10.835  1.00 189.78 ? 54  THR B OG1 1 
ATOM 1746 C CG2 . THR B 1 12  ? 27.740  46.148  11.196  1.00 189.78 ? 54  THR B CG2 1 
ATOM 1747 N N   . SER B 1 13  ? 24.446  45.854  8.049   1.00 189.78 ? 55  SER B N   1 
ATOM 1748 C CA  . SER B 1 13  ? 23.373  45.216  7.274   1.00 189.78 ? 55  SER B CA  1 
ATOM 1749 C C   . SER B 1 13  ? 23.506  45.383  5.758   1.00 189.78 ? 55  SER B C   1 
ATOM 1750 O O   . SER B 1 13  ? 22.636  44.940  5.006   1.00 189.78 ? 55  SER B O   1 
ATOM 1751 C CB  . SER B 1 13  ? 21.979  45.671  7.746   1.00 189.78 ? 55  SER B CB  1 
ATOM 1752 O OG  . SER B 1 13  ? 21.539  44.939  8.883   1.00 189.78 ? 55  SER B OG  1 
ATOM 1753 N N   . THR B 1 14  ? 24.616  45.968  5.310   1.00 189.78 ? 56  THR B N   1 
ATOM 1754 C CA  . THR B 1 14  ? 24.859  46.174  3.886   1.00 189.78 ? 56  THR B CA  1 
ATOM 1755 C C   . THR B 1 14  ? 26.042  45.350  3.379   1.00 189.78 ? 56  THR B C   1 
ATOM 1756 O O   . THR B 1 14  ? 25.872  44.433  2.576   1.00 189.78 ? 56  THR B O   1 
ATOM 1757 C CB  . THR B 1 14  ? 25.120  47.656  3.581   1.00 189.78 ? 56  THR B CB  1 
ATOM 1758 O OG1 . THR B 1 14  ? 23.956  48.420  3.908   1.00 189.78 ? 56  THR B OG1 1 
ATOM 1759 C CG2 . THR B 1 14  ? 25.449  47.846  2.109   1.00 189.78 ? 56  THR B CG2 1 
ATOM 1760 N N   . PHE B 1 15  ? 27.235  45.671  3.870   1.00 189.78 ? 57  PHE B N   1 
ATOM 1761 C CA  . PHE B 1 15  ? 28.447  44.981  3.447   1.00 189.78 ? 57  PHE B CA  1 
ATOM 1762 C C   . PHE B 1 15  ? 28.515  43.539  3.887   1.00 189.78 ? 57  PHE B C   1 
ATOM 1763 O O   . PHE B 1 15  ? 28.346  42.630  3.077   1.00 189.78 ? 57  PHE B O   1 
ATOM 1764 C CB  . PHE B 1 15  ? 29.677  45.719  3.949   1.00 189.78 ? 57  PHE B CB  1 
ATOM 1765 C CG  . PHE B 1 15  ? 29.748  47.130  3.481   1.00 189.78 ? 57  PHE B CG  1 
ATOM 1766 C CD1 . PHE B 1 15  ? 30.253  47.430  2.221   1.00 189.78 ? 57  PHE B CD1 1 
ATOM 1767 C CD2 . PHE B 1 15  ? 29.266  48.160  4.277   1.00 189.78 ? 57  PHE B CD2 1 
ATOM 1768 C CE1 . PHE B 1 15  ? 30.272  48.742  1.758   1.00 189.78 ? 57  PHE B CE1 1 
ATOM 1769 C CE2 . PHE B 1 15  ? 29.281  49.473  3.828   1.00 189.78 ? 57  PHE B CE2 1 
ATOM 1770 C CZ  . PHE B 1 15  ? 29.785  49.765  2.564   1.00 189.78 ? 57  PHE B CZ  1 
ATOM 1771 N N   . SER B 1 16  ? 28.765  43.337  5.176   1.00 189.78 ? 58  SER B N   1 
ATOM 1772 C CA  . SER B 1 16  ? 28.869  41.995  5.728   1.00 189.78 ? 58  SER B CA  1 
ATOM 1773 C C   . SER B 1 16  ? 27.611  41.170  5.508   1.00 189.78 ? 58  SER B C   1 
ATOM 1774 O O   . SER B 1 16  ? 27.652  39.945  5.607   1.00 189.78 ? 58  SER B O   1 
ATOM 1775 C CB  . SER B 1 16  ? 29.191  42.049  7.223   1.00 189.78 ? 58  SER B CB  1 
ATOM 1776 O OG  . SER B 1 16  ? 29.232  40.749  7.793   1.00 189.78 ? 58  SER B OG  1 
ATOM 1777 N N   . LYS B 1 17  ? 26.500  41.832  5.188   1.00 189.78 ? 59  LYS B N   1 
ATOM 1778 C CA  . LYS B 1 17  ? 25.245  41.116  4.983   1.00 189.78 ? 59  LYS B CA  1 
ATOM 1779 C C   . LYS B 1 17  ? 25.191  40.283  3.708   1.00 189.78 ? 59  LYS B C   1 
ATOM 1780 O O   . LYS B 1 17  ? 24.933  39.082  3.782   1.00 189.78 ? 59  LYS B O   1 
ATOM 1781 C CB  . LYS B 1 17  ? 24.039  42.056  5.037   1.00 189.78 ? 59  LYS B CB  1 
ATOM 1782 C CG  . LYS B 1 17  ? 22.721  41.333  5.359   1.00 189.78 ? 59  LYS B CG  1 
ATOM 1783 C CD  . LYS B 1 17  ? 21.501  42.222  5.152   1.00 189.78 ? 59  LYS B CD  1 
ATOM 1784 C CE  . LYS B 1 17  ? 20.206  41.524  5.557   1.00 189.78 ? 59  LYS B CE  1 
ATOM 1785 N NZ  . LYS B 1 17  ? 19.017  42.327  5.140   1.00 189.78 ? 59  LYS B NZ  1 
ATOM 1786 N N   . LEU B 1 18  ? 25.430  40.900  2.548   1.00 189.78 ? 60  LEU B N   1 
ATOM 1787 C CA  . LEU B 1 18  ? 25.377  40.160  1.281   1.00 189.78 ? 60  LEU B CA  1 
ATOM 1788 C C   . LEU B 1 18  ? 26.211  38.893  1.320   1.00 189.78 ? 60  LEU B C   1 
ATOM 1789 O O   . LEU B 1 18  ? 25.896  37.912  0.648   1.00 189.78 ? 60  LEU B O   1 
ATOM 1790 C CB  . LEU B 1 18  ? 25.817  41.021  0.093   1.00 189.78 ? 60  LEU B CB  1 
ATOM 1791 C CG  . LEU B 1 18  ? 25.864  40.272  -1.250  1.00 189.78 ? 60  LEU B CG  1 
ATOM 1792 C CD1 . LEU B 1 18  ? 24.483  39.757  -1.655  1.00 189.78 ? 60  LEU B CD1 1 
ATOM 1793 C CD2 . LEU B 1 18  ? 26.434  41.169  -2.328  1.00 189.78 ? 60  LEU B CD2 1 
ATOM 1794 N N   . ARG B 1 19  ? 27.290  38.943  2.093   1.00 189.78 ? 61  ARG B N   1 
ATOM 1795 C CA  . ARG B 1 19  ? 28.202  37.822  2.274   1.00 189.78 ? 61  ARG B CA  1 
ATOM 1796 C C   . ARG B 1 19  ? 27.447  36.564  2.720   1.00 189.78 ? 61  ARG B C   1 
ATOM 1797 O O   . ARG B 1 19  ? 27.608  35.483  2.146   1.00 189.78 ? 61  ARG B O   1 
ATOM 1798 C CB  . ARG B 1 19  ? 29.263  38.240  3.309   1.00 189.78 ? 61  ARG B CB  1 
ATOM 1799 C CG  . ARG B 1 19  ? 29.840  37.127  4.166   1.00 189.78 ? 61  ARG B CG  1 
ATOM 1800 C CD  . ARG B 1 19  ? 29.835  37.527  5.636   1.00 189.78 ? 61  ARG B CD  1 
ATOM 1801 N NE  . ARG B 1 19  ? 30.143  36.398  6.512   1.00 189.78 ? 61  ARG B NE  1 
ATOM 1802 C CZ  . ARG B 1 19  ? 30.222  36.473  7.838   1.00 189.78 ? 61  ARG B CZ  1 
ATOM 1803 N NH1 . ARG B 1 19  ? 30.015  37.628  8.459   1.00 189.78 ? 61  ARG B NH1 1 
ATOM 1804 N NH2 . ARG B 1 19  ? 30.515  35.390  8.549   1.00 189.78 ? 61  ARG B NH2 1 
ATOM 1805 N N   . GLU B 1 20  ? 26.591  36.739  3.719   1.00 189.78 ? 62  GLU B N   1 
ATOM 1806 C CA  . GLU B 1 20  ? 25.790  35.662  4.282   1.00 189.78 ? 62  GLU B CA  1 
ATOM 1807 C C   . GLU B 1 20  ? 24.791  35.122  3.244   1.00 189.78 ? 62  GLU B C   1 
ATOM 1808 O O   . GLU B 1 20  ? 24.427  33.943  3.264   1.00 189.78 ? 62  GLU B O   1 
ATOM 1809 C CB  . GLU B 1 20  ? 25.119  36.171  5.569   1.00 189.78 ? 62  GLU B CB  1 
ATOM 1810 C CG  . GLU B 1 20  ? 26.153  36.600  6.643   1.00 189.78 ? 62  GLU B CG  1 
ATOM 1811 C CD  . GLU B 1 20  ? 25.575  37.449  7.775   1.00 189.78 ? 62  GLU B CD  1 
ATOM 1812 O OE1 . GLU B 1 20  ? 24.466  37.137  8.265   1.00 189.78 ? 62  GLU B OE1 1 
ATOM 1813 O OE2 . GLU B 1 20  ? 26.246  38.427  8.182   1.00 189.78 ? 62  GLU B OE2 1 
ATOM 1814 N N   . GLN B 1 21  ? 24.428  35.979  2.291   1.00 189.78 ? 63  GLN B N   1 
ATOM 1815 C CA  . GLN B 1 21  ? 23.517  35.619  1.207   1.00 189.78 ? 63  GLN B CA  1 
ATOM 1816 C C   . GLN B 1 21  ? 24.259  34.650  0.273   1.00 189.78 ? 63  GLN B C   1 
ATOM 1817 O O   . GLN B 1 21  ? 23.644  33.903  -0.485  1.00 189.78 ? 63  GLN B O   1 
ATOM 1818 C CB  . GLN B 1 21  ? 23.096  36.884  0.438   1.00 189.78 ? 63  GLN B CB  1 
ATOM 1819 C CG  . GLN B 1 21  ? 22.298  37.932  1.234   1.00 189.78 ? 63  GLN B CG  1 
ATOM 1820 C CD  . GLN B 1 21  ? 20.784  37.742  1.152   1.00 189.78 ? 63  GLN B CD  1 
ATOM 1821 O OE1 . GLN B 1 21  ? 20.116  38.319  0.288   1.00 189.78 ? 63  GLN B OE1 1 
ATOM 1822 N NE2 . GLN B 1 21  ? 20.235  36.962  2.076   1.00 189.78 ? 63  GLN B NE2 1 
ATOM 1823 N N   . LEU B 1 22  ? 25.589  34.692  0.329   1.00 189.78 ? 64  LEU B N   1 
ATOM 1824 C CA  . LEU B 1 22  ? 26.433  33.816  -0.476  1.00 189.78 ? 64  LEU B CA  1 
ATOM 1825 C C   . LEU B 1 22  ? 26.806  32.523  0.239   1.00 189.78 ? 64  LEU B C   1 
ATOM 1826 O O   . LEU B 1 22  ? 27.576  31.735  -0.281  1.00 189.78 ? 64  LEU B O   1 
ATOM 1827 C CB  . LEU B 1 22  ? 27.687  34.547  -0.946  1.00 189.78 ? 64  LEU B CB  1 
ATOM 1828 C CG  . LEU B 1 22  ? 27.551  35.222  -2.311  1.00 189.78 ? 64  LEU B CG  1 
ATOM 1829 C CD1 . LEU B 1 22  ? 26.470  36.295  -2.299  1.00 189.78 ? 64  LEU B CD1 1 
ATOM 1830 C CD2 . LEU B 1 22  ? 28.888  35.813  -2.686  1.00 189.78 ? 64  LEU B CD2 1 
ATOM 1831 N N   . GLY B 1 23  ? 26.301  32.329  1.451   1.00 189.78 ? 65  GLY B N   1 
ATOM 1832 C CA  . GLY B 1 23  ? 26.552  31.086  2.161   1.00 189.78 ? 65  GLY B CA  1 
ATOM 1833 C C   . GLY B 1 23  ? 26.095  29.967  1.236   1.00 189.78 ? 65  GLY B C   1 
ATOM 1834 O O   . GLY B 1 23  ? 26.640  28.865  1.284   1.00 189.78 ? 65  GLY B O   1 
ATOM 1835 N N   . PRO B 1 24  ? 25.022  30.201  0.446   1.00 152.44 ? 66  PRO B N   1 
ATOM 1836 C CA  . PRO B 1 24  ? 24.483  29.240  -0.511  1.00 152.44 ? 66  PRO B CA  1 
ATOM 1837 C C   . PRO B 1 24  ? 25.540  28.780  -1.489  1.00 152.44 ? 66  PRO B C   1 
ATOM 1838 O O   . PRO B 1 24  ? 25.297  27.891  -2.295  1.00 152.44 ? 66  PRO B O   1 
ATOM 1839 C CB  . PRO B 1 24  ? 23.407  30.050  -1.207  1.00 152.44 ? 66  PRO B CB  1 
ATOM 1840 C CG  . PRO B 1 24  ? 22.788  30.726  -0.064  1.00 152.44 ? 66  PRO B CG  1 
ATOM 1841 C CD  . PRO B 1 24  ? 23.980  31.207  0.748   1.00 152.44 ? 66  PRO B CD  1 
ATOM 1842 N N   . VAL B 1 25  ? 26.691  29.441  -1.459  1.00 152.44 ? 67  VAL B N   1 
ATOM 1843 C CA  . VAL B 1 25  ? 27.812  29.055  -2.296  1.00 152.44 ? 67  VAL B CA  1 
ATOM 1844 C C   . VAL B 1 25  ? 28.043  27.621  -1.834  1.00 152.44 ? 67  VAL B C   1 
ATOM 1845 O O   . VAL B 1 25  ? 28.002  26.678  -2.625  1.00 152.44 ? 67  VAL B O   1 
ATOM 1846 C CB  . VAL B 1 25  ? 29.071  29.929  -1.985  1.00 152.44 ? 67  VAL B CB  1 
ATOM 1847 C CG1 . VAL B 1 25  ? 30.324  29.280  -2.506  1.00 152.44 ? 67  VAL B CG1 1 
ATOM 1848 C CG2 . VAL B 1 25  ? 28.937  31.297  -2.603  1.00 152.44 ? 67  VAL B CG2 1 
ATOM 1849 N N   . THR B 1 26  ? 28.151  27.478  -0.515  1.00 152.44 ? 68  THR B N   1 
ATOM 1850 C CA  . THR B 1 26  ? 28.359  26.194  0.137   1.00 152.44 ? 68  THR B CA  1 
ATOM 1851 C C   . THR B 1 26  ? 27.091  25.321  0.063   1.00 152.44 ? 68  THR B C   1 
ATOM 1852 O O   . THR B 1 26  ? 27.172  24.096  0.176   1.00 152.44 ? 68  THR B O   1 
ATOM 1853 C CB  . THR B 1 26  ? 28.791  26.407  1.618   1.00 152.44 ? 68  THR B CB  1 
ATOM 1854 O OG1 . THR B 1 26  ? 29.710  27.509  1.699   1.00 152.44 ? 68  THR B OG1 1 
ATOM 1855 C CG2 . THR B 1 26  ? 29.478  25.161  2.156   1.00 152.44 ? 68  THR B CG2 1 
ATOM 1856 N N   . GLN B 1 27  ? 25.939  25.956  -0.173  1.00 152.44 ? 69  GLN B N   1 
ATOM 1857 C CA  . GLN B 1 27  ? 24.638  25.270  -0.272  1.00 152.44 ? 69  GLN B CA  1 
ATOM 1858 C C   . GLN B 1 27  ? 24.363  24.627  -1.631  1.00 152.44 ? 69  GLN B C   1 
ATOM 1859 O O   . GLN B 1 27  ? 23.918  23.485  -1.712  1.00 152.44 ? 69  GLN B O   1 
ATOM 1860 C CB  . GLN B 1 27  ? 23.474  26.245  0.006   1.00 152.44 ? 69  GLN B CB  1 
ATOM 1861 C CG  . GLN B 1 27  ? 22.121  25.804  -0.635  1.00 152.44 ? 69  GLN B CG  1 
ATOM 1862 C CD  . GLN B 1 27  ? 21.031  26.886  -0.678  1.00 152.44 ? 69  GLN B CD  1 
ATOM 1863 O OE1 . GLN B 1 27  ? 21.077  27.808  -1.501  1.00 152.44 ? 69  GLN B OE1 1 
ATOM 1864 N NE2 . GLN B 1 27  ? 20.010  26.729  0.169   1.00 152.44 ? 69  GLN B NE2 1 
ATOM 1865 N N   . GLU B 1 28  ? 24.487  25.428  -2.681  1.00 152.44 ? 70  GLU B N   1 
ATOM 1866 C CA  . GLU B 1 28  ? 24.224  24.979  -4.036  1.00 152.44 ? 70  GLU B CA  1 
ATOM 1867 C C   . GLU B 1 28  ? 25.430  24.349  -4.692  1.00 152.44 ? 70  GLU B C   1 
ATOM 1868 O O   . GLU B 1 28  ? 25.320  23.286  -5.287  1.00 152.44 ? 70  GLU B O   1 
ATOM 1869 C CB  . GLU B 1 28  ? 23.756  26.143  -4.909  1.00 152.44 ? 70  GLU B CB  1 
ATOM 1870 C CG  . GLU B 1 28  ? 23.418  25.734  -6.343  1.00 152.44 ? 70  GLU B CG  1 
ATOM 1871 C CD  . GLU B 1 28  ? 23.954  26.703  -7.379  1.00 152.44 ? 70  GLU B CD  1 
ATOM 1872 O OE1 . GLU B 1 28  ? 23.852  27.929  -7.160  1.00 152.44 ? 70  GLU B OE1 1 
ATOM 1873 O OE2 . GLU B 1 28  ? 24.475  26.234  -8.413  1.00 152.44 ? 70  GLU B OE2 1 
ATOM 1874 N N   . PHE B 1 29  ? 26.567  25.035  -4.628  1.00 152.44 ? 71  PHE B N   1 
ATOM 1875 C CA  . PHE B 1 29  ? 27.784  24.532  -5.251  1.00 152.44 ? 71  PHE B CA  1 
ATOM 1876 C C   . PHE B 1 29  ? 28.416  23.322  -4.559  1.00 152.44 ? 71  PHE B C   1 
ATOM 1877 O O   . PHE B 1 29  ? 28.200  22.195  -4.995  1.00 152.44 ? 71  PHE B O   1 
ATOM 1878 C CB  . PHE B 1 29  ? 28.811  25.661  -5.448  1.00 152.44 ? 71  PHE B CB  1 
ATOM 1879 C CG  . PHE B 1 29  ? 29.035  26.045  -6.898  1.00 152.44 ? 71  PHE B CG  1 
ATOM 1880 C CD1 . PHE B 1 29  ? 28.204  25.556  -7.904  1.00 152.44 ? 71  PHE B CD1 1 
ATOM 1881 C CD2 . PHE B 1 29  ? 30.091  26.887  -7.256  1.00 152.44 ? 71  PHE B CD2 1 
ATOM 1882 C CE1 . PHE B 1 29  ? 28.422  25.892  -9.240  1.00 152.44 ? 71  PHE B CE1 1 
ATOM 1883 C CE2 . PHE B 1 29  ? 30.316  27.231  -8.596  1.00 152.44 ? 71  PHE B CE2 1 
ATOM 1884 C CZ  . PHE B 1 29  ? 29.479  26.733  -9.586  1.00 152.44 ? 71  PHE B CZ  1 
ATOM 1885 N N   . TRP B 1 30  ? 29.154  23.544  -3.471  1.00 152.44 ? 72  TRP B N   1 
ATOM 1886 C CA  . TRP B 1 30  ? 29.831  22.452  -2.757  1.00 152.44 ? 72  TRP B CA  1 
ATOM 1887 C C   . TRP B 1 30  ? 28.884  21.342  -2.318  1.00 152.44 ? 72  TRP B C   1 
ATOM 1888 O O   . TRP B 1 30  ? 29.257  20.173  -2.312  1.00 152.44 ? 72  TRP B O   1 
ATOM 1889 C CB  . TRP B 1 30  ? 30.622  22.986  -1.549  1.00 152.44 ? 72  TRP B CB  1 
ATOM 1890 C CG  . TRP B 1 30  ? 31.750  22.079  -1.056  1.00 152.44 ? 72  TRP B CG  1 
ATOM 1891 C CD1 . TRP B 1 30  ? 31.637  20.796  -0.597  1.00 152.44 ? 72  TRP B CD1 1 
ATOM 1892 C CD2 . TRP B 1 30  ? 33.145  22.415  -0.955  1.00 152.44 ? 72  TRP B CD2 1 
ATOM 1893 N NE1 . TRP B 1 30  ? 32.867  20.315  -0.218  1.00 152.44 ? 72  TRP B NE1 1 
ATOM 1894 C CE2 . TRP B 1 30  ? 33.810  21.286  -0.425  1.00 152.44 ? 72  TRP B CE2 1 
ATOM 1895 C CE3 . TRP B 1 30  ? 33.895  23.560  -1.259  1.00 152.44 ? 72  TRP B CE3 1 
ATOM 1896 C CZ2 . TRP B 1 30  ? 35.189  21.269  -0.193  1.00 152.44 ? 72  TRP B CZ2 1 
ATOM 1897 C CZ3 . TRP B 1 30  ? 35.270  23.544  -1.028  1.00 152.44 ? 72  TRP B CZ3 1 
ATOM 1898 C CH2 . TRP B 1 30  ? 35.900  22.404  -0.500  1.00 152.44 ? 72  TRP B CH2 1 
ATOM 1899 N N   . ASP B 1 31  ? 27.657  21.701  -1.968  1.00 152.44 ? 73  ASP B N   1 
ATOM 1900 C CA  . ASP B 1 31  ? 26.693  20.705  -1.536  1.00 152.44 ? 73  ASP B CA  1 
ATOM 1901 C C   . ASP B 1 31  ? 26.318  19.819  -2.719  1.00 152.44 ? 73  ASP B C   1 
ATOM 1902 O O   . ASP B 1 31  ? 26.400  18.600  -2.632  1.00 152.44 ? 73  ASP B O   1 
ATOM 1903 C CB  . ASP B 1 31  ? 25.465  21.393  -0.965  1.00 152.44 ? 73  ASP B CB  1 
ATOM 1904 C CG  . ASP B 1 31  ? 24.674  20.507  -0.037  1.00 152.44 ? 73  ASP B CG  1 
ATOM 1905 O OD1 . ASP B 1 31  ? 25.027  20.449  1.160   1.00 152.44 ? 73  ASP B OD1 1 
ATOM 1906 O OD2 . ASP B 1 31  ? 23.692  19.888  -0.498  1.00 152.44 ? 73  ASP B OD2 1 
ATOM 1907 N N   . ASN B 1 32  ? 25.949  20.439  -3.834  1.00 152.44 ? 74  ASN B N   1 
ATOM 1908 C CA  . ASN B 1 32  ? 25.587  19.697  -5.037  1.00 152.44 ? 74  ASN B CA  1 
ATOM 1909 C C   . ASN B 1 32  ? 26.854  19.050  -5.596  1.00 152.44 ? 74  ASN B C   1 
ATOM 1910 O O   . ASN B 1 32  ? 26.808  18.014  -6.259  1.00 152.44 ? 74  ASN B O   1 
ATOM 1911 C CB  . ASN B 1 32  ? 24.985  20.648  -6.073  1.00 152.44 ? 74  ASN B CB  1 
ATOM 1912 C CG  . ASN B 1 32  ? 23.729  20.096  -6.725  1.00 152.44 ? 74  ASN B CG  1 
ATOM 1913 O OD1 . ASN B 1 32  ? 23.243  19.023  -6.364  1.00 152.44 ? 74  ASN B OD1 1 
ATOM 1914 N ND2 . ASN B 1 32  ? 23.195  20.832  -7.695  1.00 152.44 ? 74  ASN B ND2 1 
ATOM 1915 N N   . LEU B 1 33  ? 27.990  19.651  -5.264  1.00 152.44 ? 75  LEU B N   1 
ATOM 1916 C CA  . LEU B 1 33  ? 29.295  19.186  -5.701  1.00 152.44 ? 75  LEU B CA  1 
ATOM 1917 C C   . LEU B 1 33  ? 29.479  17.814  -5.097  1.00 152.44 ? 75  LEU B C   1 
ATOM 1918 O O   . LEU B 1 33  ? 29.457  16.802  -5.789  1.00 152.44 ? 75  LEU B O   1 
ATOM 1919 C CB  . LEU B 1 33  ? 30.367  20.129  -5.152  1.00 152.44 ? 75  LEU B CB  1 
ATOM 1920 C CG  . LEU B 1 33  ? 31.724  20.301  -5.821  1.00 152.44 ? 75  LEU B CG  1 
ATOM 1921 C CD1 . LEU B 1 33  ? 32.475  18.989  -5.870  1.00 152.44 ? 75  LEU B CD1 1 
ATOM 1922 C CD2 . LEU B 1 33  ? 31.509  20.867  -7.204  1.00 152.44 ? 75  LEU B CD2 1 
ATOM 1923 N N   . GLU B 1 34  ? 29.605  17.809  -3.778  1.00 152.44 ? 76  GLU B N   1 
ATOM 1924 C CA  . GLU B 1 34  ? 29.786  16.608  -2.990  1.00 152.44 ? 76  GLU B CA  1 
ATOM 1925 C C   . GLU B 1 34  ? 28.663  15.600  -3.274  1.00 152.44 ? 76  GLU B C   1 
ATOM 1926 O O   . GLU B 1 34  ? 28.922  14.405  -3.436  1.00 152.44 ? 76  GLU B O   1 
ATOM 1927 C CB  . GLU B 1 34  ? 29.801  17.004  -1.510  1.00 152.44 ? 76  GLU B CB  1 
ATOM 1928 C CG  . GLU B 1 34  ? 30.570  16.070  -0.590  1.00 152.44 ? 76  GLU B CG  1 
ATOM 1929 C CD  . GLU B 1 34  ? 30.780  16.650  0.809   1.00 152.44 ? 76  GLU B CD  1 
ATOM 1930 O OE1 . GLU B 1 34  ? 31.264  17.799  0.921   1.00 152.44 ? 76  GLU B OE1 1 
ATOM 1931 O OE2 . GLU B 1 34  ? 30.477  15.951  1.802   1.00 152.44 ? 76  GLU B OE2 1 
ATOM 1932 N N   . LYS B 1 35  ? 27.440  16.111  -3.429  1.00 152.44 ? 77  LYS B N   1 
ATOM 1933 C CA  . LYS B 1 35  ? 26.257  15.281  -3.684  1.00 152.44 ? 77  LYS B CA  1 
ATOM 1934 C C   . LYS B 1 35  ? 26.404  14.332  -4.861  1.00 152.44 ? 77  LYS B C   1 
ATOM 1935 O O   . LYS B 1 35  ? 26.201  13.125  -4.720  1.00 152.44 ? 77  LYS B O   1 
ATOM 1936 C CB  . LYS B 1 35  ? 25.011  16.148  -3.897  1.00 152.44 ? 77  LYS B CB  1 
ATOM 1937 C CG  . LYS B 1 35  ? 23.748  15.349  -4.246  1.00 152.44 ? 77  LYS B CG  1 
ATOM 1938 C CD  . LYS B 1 35  ? 22.507  16.241  -4.274  1.00 152.44 ? 77  LYS B CD  1 
ATOM 1939 C CE  . LYS B 1 35  ? 21.229  15.437  -4.521  1.00 152.44 ? 77  LYS B CE  1 
ATOM 1940 N NZ  . LYS B 1 35  ? 20.008  16.297  -4.421  1.00 152.44 ? 77  LYS B NZ  1 
ATOM 1941 N N   . GLU B 1 36  ? 26.684  14.876  -6.039  1.00 152.44 ? 78  GLU B N   1 
ATOM 1942 C CA  . GLU B 1 36  ? 26.848  14.010  -7.188  1.00 152.44 ? 78  GLU B CA  1 
ATOM 1943 C C   . GLU B 1 36  ? 28.183  13.295  -7.122  1.00 152.44 ? 78  GLU B C   1 
ATOM 1944 O O   . GLU B 1 36  ? 28.219  12.074  -7.149  1.00 152.44 ? 78  GLU B O   1 
ATOM 1945 C CB  . GLU B 1 36  ? 26.673  14.764  -8.497  1.00 152.44 ? 78  GLU B CB  1 
ATOM 1946 C CG  . GLU B 1 36  ? 25.246  14.691  -9.023  1.00 152.44 ? 78  GLU B CG  1 
ATOM 1947 C CD  . GLU B 1 36  ? 25.075  15.337  -10.390 1.00 152.44 ? 78  GLU B CD  1 
ATOM 1948 O OE1 . GLU B 1 36  ? 26.071  15.869  -10.943 1.00 152.44 ? 78  GLU B OE1 1 
ATOM 1949 O OE2 . GLU B 1 36  ? 23.937  15.320  -10.905 1.00 152.44 ? 78  GLU B OE2 1 
ATOM 1950 N N   . THR B 1 37  ? 29.264  14.058  -6.975  1.00 152.44 ? 79  THR B N   1 
ATOM 1951 C CA  . THR B 1 37  ? 30.622  13.515  -6.888  1.00 152.44 ? 79  THR B CA  1 
ATOM 1952 C C   . THR B 1 37  ? 30.684  12.154  -6.201  1.00 152.44 ? 79  THR B C   1 
ATOM 1953 O O   . THR B 1 37  ? 30.881  11.131  -6.853  1.00 152.44 ? 79  THR B O   1 
ATOM 1954 C CB  . THR B 1 37  ? 31.559  14.499  -6.143  1.00 152.44 ? 79  THR B CB  1 
ATOM 1955 O OG1 . THR B 1 37  ? 31.754  15.669  -6.947  1.00 152.44 ? 79  THR B OG1 1 
ATOM 1956 C CG2 . THR B 1 37  ? 32.909  13.860  -5.839  1.00 152.44 ? 79  THR B CG2 1 
ATOM 1957 N N   . GLU B 1 38  ? 30.480  12.142  -4.891  1.00 152.44 ? 80  GLU B N   1 
ATOM 1958 C CA  . GLU B 1 38  ? 30.517  10.899  -4.145  1.00 152.44 ? 80  GLU B CA  1 
ATOM 1959 C C   . GLU B 1 38  ? 29.237  10.102  -4.396  1.00 152.44 ? 80  GLU B C   1 
ATOM 1960 O O   . GLU B 1 38  ? 29.225  8.877   -4.274  1.00 152.44 ? 80  GLU B O   1 
ATOM 1961 C CB  . GLU B 1 38  ? 30.695  11.200  -2.656  1.00 152.44 ? 80  GLU B CB  1 
ATOM 1962 C CG  . GLU B 1 38  ? 31.169  10.017  -1.828  1.00 152.44 ? 80  GLU B CG  1 
ATOM 1963 C CD  . GLU B 1 38  ? 31.915  10.442  -0.569  1.00 152.44 ? 80  GLU B CD  1 
ATOM 1964 O OE1 . GLU B 1 38  ? 32.881  11.232  -0.683  1.00 152.44 ? 80  GLU B OE1 1 
ATOM 1965 O OE2 . GLU B 1 38  ? 31.545  9.971   0.531   1.00 152.44 ? 80  GLU B OE2 1 
ATOM 1966 N N   . GLY B 1 39  ? 28.179  10.802  -4.800  1.00 152.44 ? 81  GLY B N   1 
ATOM 1967 C CA  . GLY B 1 39  ? 26.904  10.157  -5.061  1.00 152.44 ? 81  GLY B CA  1 
ATOM 1968 C C   . GLY B 1 39  ? 26.925  9.219   -6.251  1.00 152.44 ? 81  GLY B C   1 
ATOM 1969 O O   . GLY B 1 39  ? 26.294  8.168   -6.232  1.00 152.44 ? 81  GLY B O   1 
ATOM 1970 N N   . LEU B 1 40  ? 27.680  9.579   -7.278  1.00 152.44 ? 82  LEU B N   1 
ATOM 1971 C CA  . LEU B 1 40  ? 27.770  8.758   -8.473  1.00 152.44 ? 82  LEU B CA  1 
ATOM 1972 C C   . LEU B 1 40  ? 28.836  7.747   -8.188  1.00 152.44 ? 82  LEU B C   1 
ATOM 1973 O O   . LEU B 1 40  ? 28.809  6.634   -8.696  1.00 152.44 ? 82  LEU B O   1 
ATOM 1974 C CB  . LEU B 1 40  ? 28.182  9.604   -9.664  1.00 152.44 ? 82  LEU B CB  1 
ATOM 1975 C CG  . LEU B 1 40  ? 27.354  10.878  -9.797  1.00 152.44 ? 82  LEU B CG  1 
ATOM 1976 C CD1 . LEU B 1 40  ? 27.818  11.680  -11.007 1.00 152.44 ? 82  LEU B CD1 1 
ATOM 1977 C CD2 . LEU B 1 40  ? 25.869  10.523  -9.877  1.00 152.44 ? 82  LEU B CD2 1 
ATOM 1978 N N   . ARG B 1 41  ? 29.804  8.182   -7.394  1.00 152.44 ? 83  ARG B N   1 
ATOM 1979 C CA  . ARG B 1 41  ? 30.896  7.344   -6.966  1.00 152.44 ? 83  ARG B CA  1 
ATOM 1980 C C   . ARG B 1 41  ? 30.230  6.105   -6.409  1.00 152.44 ? 83  ARG B C   1 
ATOM 1981 O O   . ARG B 1 41  ? 30.628  4.980   -6.695  1.00 152.44 ? 83  ARG B O   1 
ATOM 1982 C CB  . ARG B 1 41  ? 31.651  8.062   -5.865  1.00 152.44 ? 83  ARG B CB  1 
ATOM 1983 C CG  . ARG B 1 41  ? 32.695  7.233   -5.211  1.00 152.44 ? 83  ARG B CG  1 
ATOM 1984 C CD  . ARG B 1 41  ? 33.300  7.973   -4.052  1.00 152.44 ? 83  ARG B CD  1 
ATOM 1985 N NE  . ARG B 1 41  ? 34.362  7.191   -3.435  1.00 152.44 ? 83  ARG B NE  1 
ATOM 1986 C CZ  . ARG B 1 41  ? 34.839  7.401   -2.213  1.00 152.44 ? 83  ARG B CZ  1 
ATOM 1987 N NH1 . ARG B 1 41  ? 34.353  8.376   -1.455  1.00 152.44 ? 83  ARG B NH1 1 
ATOM 1988 N NH2 . ARG B 1 41  ? 35.812  6.630   -1.747  1.00 152.44 ? 83  ARG B NH2 1 
ATOM 1989 N N   . GLN B 1 42  ? 29.157  6.344   -5.663  1.00 152.44 ? 84  GLN B N   1 
ATOM 1990 C CA  . GLN B 1 42  ? 28.365  5.287   -5.065  1.00 152.44 ? 84  GLN B CA  1 
ATOM 1991 C C   . GLN B 1 42  ? 27.833  4.382   -6.174  1.00 152.44 ? 84  GLN B C   1 
ATOM 1992 O O   . GLN B 1 42  ? 27.993  3.164   -6.114  1.00 152.44 ? 84  GLN B O   1 
ATOM 1993 C CB  . GLN B 1 42  ? 27.199  5.894   -4.275  1.00 152.44 ? 84  GLN B CB  1 
ATOM 1994 C CG  . GLN B 1 42  ? 26.224  4.874   -3.681  1.00 152.44 ? 84  GLN B CG  1 
ATOM 1995 C CD  . GLN B 1 42  ? 25.113  5.512   -2.846  1.00 152.44 ? 84  GLN B CD  1 
ATOM 1996 O OE1 . GLN B 1 42  ? 24.857  6.715   -2.937  1.00 152.44 ? 84  GLN B OE1 1 
ATOM 1997 N NE2 . GLN B 1 42  ? 24.452  4.699   -2.025  1.00 152.44 ? 84  GLN B NE2 1 
ATOM 1998 N N   . GLU B 1 43  ? 27.221  4.980   -7.197  1.00 152.44 ? 85  GLU B N   1 
ATOM 1999 C CA  . GLU B 1 43  ? 26.679  4.196   -8.305  1.00 152.44 ? 85  GLU B CA  1 
ATOM 2000 C C   . GLU B 1 43  ? 27.797  3.480   -9.049  1.00 152.44 ? 85  GLU B C   1 
ATOM 2001 O O   . GLU B 1 43  ? 27.583  2.421   -9.633  1.00 152.44 ? 85  GLU B O   1 
ATOM 2002 C CB  . GLU B 1 43  ? 25.855  5.077   -9.265  1.00 152.44 ? 85  GLU B CB  1 
ATOM 2003 C CG  . GLU B 1 43  ? 25.017  4.288   -10.302 1.00 152.44 ? 85  GLU B CG  1 
ATOM 2004 C CD  . GLU B 1 43  ? 23.828  5.074   -10.877 1.00 152.44 ? 85  GLU B CD  1 
ATOM 2005 O OE1 . GLU B 1 43  ? 23.937  6.308   -11.045 1.00 152.44 ? 85  GLU B OE1 1 
ATOM 2006 O OE2 . GLU B 1 43  ? 22.778  4.451   -11.164 1.00 152.44 ? 85  GLU B OE2 1 
ATOM 2007 N N   . MET B 1 44  ? 29.003  4.025   -8.966  1.00 152.44 ? 86  MET B N   1 
ATOM 2008 C CA  . MET B 1 44  ? 30.142  3.433   -9.636  1.00 152.44 ? 86  MET B CA  1 
ATOM 2009 C C   . MET B 1 44  ? 30.592  2.157   -8.958  1.00 152.44 ? 86  MET B C   1 
ATOM 2010 O O   . MET B 1 44  ? 30.486  1.077   -9.534  1.00 152.44 ? 86  MET B O   1 
ATOM 2011 C CB  . MET B 1 44  ? 31.295  4.427   -9.715  1.00 152.44 ? 86  MET B CB  1 
ATOM 2012 C CG  . MET B 1 44  ? 32.558  3.821   -10.284 1.00 152.44 ? 86  MET B CG  1 
ATOM 2013 S SD  . MET B 1 44  ? 32.188  2.525   -11.487 1.00 152.44 ? 86  MET B SD  1 
ATOM 2014 C CE  . MET B 1 44  ? 33.119  1.116   -10.791 1.00 152.44 ? 86  MET B CE  1 
ATOM 2015 N N   . SER B 1 45  ? 31.103  2.296   -7.740  1.00 152.44 ? 87  SER B N   1 
ATOM 2016 C CA  . SER B 1 45  ? 31.584  1.174   -6.944  1.00 152.44 ? 87  SER B CA  1 
ATOM 2017 C C   . SER B 1 45  ? 30.703  -0.046  -7.113  1.00 152.44 ? 87  SER B C   1 
ATOM 2018 O O   . SER B 1 45  ? 31.175  -1.179  -7.114  1.00 152.44 ? 87  SER B O   1 
ATOM 2019 C CB  . SER B 1 45  ? 31.630  1.568   -5.472  1.00 152.44 ? 87  SER B CB  1 
ATOM 2020 O OG  . SER B 1 45  ? 31.982  0.460   -4.666  1.00 152.44 ? 87  SER B OG  1 
ATOM 2021 N N   . LYS B 1 46  ? 29.416  0.218   -7.279  1.00 76.30  ? 88  LYS B N   1 
ATOM 2022 C CA  . LYS B 1 46  ? 28.415  -0.813  -7.476  1.00 76.30  ? 88  LYS B CA  1 
ATOM 2023 C C   . LYS B 1 46  ? 28.930  -1.880  -8.434  1.00 76.30  ? 88  LYS B C   1 
ATOM 2024 O O   . LYS B 1 46  ? 28.954  -3.070  -8.109  1.00 76.30  ? 88  LYS B O   1 
ATOM 2025 C CB  . LYS B 1 46  ? 27.154  -0.165  -8.051  1.00 76.30  ? 88  LYS B CB  1 
ATOM 2026 C CG  . LYS B 1 46  ? 26.054  -1.135  -8.451  1.00 76.30  ? 88  LYS B CG  1 
ATOM 2027 C CD  . LYS B 1 46  ? 24.815  -0.401  -8.981  1.00 76.30  ? 88  LYS B CD  1 
ATOM 2028 C CE  . LYS B 1 46  ? 23.683  -1.386  -9.306  1.00 76.30  ? 88  LYS B CE  1 
ATOM 2029 N NZ  . LYS B 1 46  ? 22.366  -0.746  -9.634  1.00 76.30  ? 88  LYS B NZ  1 
ATOM 2030 N N   . ASP B 1 47  ? 29.400  -1.425  -9.590  1.00 76.30  ? 89  ASP B N   1 
ATOM 2031 C CA  . ASP B 1 47  ? 29.907  -2.312  -10.622 1.00 76.30  ? 89  ASP B CA  1 
ATOM 2032 C C   . ASP B 1 47  ? 30.936  -3.284  -10.137 1.00 76.30  ? 89  ASP B C   1 
ATOM 2033 O O   . ASP B 1 47  ? 30.773  -4.488  -10.290 1.00 76.30  ? 89  ASP B O   1 
ATOM 2034 C CB  . ASP B 1 47  ? 30.483  -1.510  -11.775 1.00 76.30  ? 89  ASP B CB  1 
ATOM 2035 C CG  . ASP B 1 47  ? 29.439  -0.683  -12.470 1.00 76.30  ? 89  ASP B CG  1 
ATOM 2036 O OD1 . ASP B 1 47  ? 28.721  0.068   -11.774 1.00 76.30  ? 89  ASP B OD1 1 
ATOM 2037 O OD2 . ASP B 1 47  ? 29.326  -0.791  -13.707 1.00 76.30  ? 89  ASP B OD2 1 
ATOM 2038 N N   . LEU B 1 48  ? 31.990  -2.755  -9.535  1.00 76.30  ? 90  LEU B N   1 
ATOM 2039 C CA  . LEU B 1 48  ? 33.062  -3.594  -9.044  1.00 76.30  ? 90  LEU B CA  1 
ATOM 2040 C C   . LEU B 1 48  ? 32.513  -4.805  -8.299  1.00 76.30  ? 90  LEU B C   1 
ATOM 2041 O O   . LEU B 1 48  ? 32.944  -5.932  -8.545  1.00 76.30  ? 90  LEU B O   1 
ATOM 2042 C CB  . LEU B 1 48  ? 34.008  -2.802  -8.146  1.00 76.30  ? 90  LEU B CB  1 
ATOM 2043 C CG  . LEU B 1 48  ? 35.406  -3.428  -8.116  1.00 76.30  ? 90  LEU B CG  1 
ATOM 2044 C CD1 . LEU B 1 48  ? 36.155  -3.011  -9.376  1.00 76.30  ? 90  LEU B CD1 1 
ATOM 2045 C CD2 . LEU B 1 48  ? 36.159  -3.015  -6.872  1.00 76.30  ? 90  LEU B CD2 1 
ATOM 2046 N N   . GLU B 1 49  ? 31.513  -4.591  -7.449  1.00 76.30  ? 91  GLU B N   1 
ATOM 2047 C CA  . GLU B 1 49  ? 30.959  -5.712  -6.720  1.00 76.30  ? 91  GLU B CA  1 
ATOM 2048 C C   . GLU B 1 49  ? 30.138  -6.604  -7.636  1.00 76.30  ? 91  GLU B C   1 
ATOM 2049 O O   . GLU B 1 49  ? 30.120  -7.824  -7.472  1.00 76.30  ? 91  GLU B O   1 
ATOM 2050 C CB  . GLU B 1 49  ? 30.135  -5.252  -5.525  1.00 76.30  ? 91  GLU B CB  1 
ATOM 2051 C CG  . GLU B 1 49  ? 29.880  -6.393  -4.526  1.00 76.30  ? 91  GLU B CG  1 
ATOM 2052 C CD  . GLU B 1 49  ? 29.334  -5.925  -3.176  1.00 76.30  ? 91  GLU B CD  1 
ATOM 2053 O OE1 . GLU B 1 49  ? 30.027  -5.133  -2.483  1.00 76.30  ? 91  GLU B OE1 1 
ATOM 2054 O OE2 . GLU B 1 49  ? 28.220  -6.378  -2.801  1.00 76.30  ? 91  GLU B OE2 1 
ATOM 2055 N N   . GLU B 1 50  ? 29.489  -5.996  -8.623  1.00 76.30  ? 92  GLU B N   1 
ATOM 2056 C CA  . GLU B 1 50  ? 28.674  -6.750  -9.575  1.00 76.30  ? 92  GLU B CA  1 
ATOM 2057 C C   . GLU B 1 50  ? 29.548  -7.666  -10.389 1.00 76.30  ? 92  GLU B C   1 
ATOM 2058 O O   . GLU B 1 50  ? 29.413  -8.890  -10.362 1.00 76.30  ? 92  GLU B O   1 
ATOM 2059 C CB  . GLU B 1 50  ? 27.995  -5.818  -10.560 1.00 76.30  ? 92  GLU B CB  1 
ATOM 2060 C CG  . GLU B 1 50  ? 27.140  -4.774  -9.942  1.00 76.30  ? 92  GLU B CG  1 
ATOM 2061 C CD  . GLU B 1 50  ? 26.449  -3.953  -10.994 1.00 76.30  ? 92  GLU B CD  1 
ATOM 2062 O OE1 . GLU B 1 50  ? 25.371  -4.384  -11.473 1.00 76.30  ? 92  GLU B OE1 1 
ATOM 2063 O OE2 . GLU B 1 50  ? 26.996  -2.887  -11.357 1.00 76.30  ? 92  GLU B OE2 1 
ATOM 2064 N N   . VAL B 1 51  ? 30.400  -7.029  -11.176 1.00 76.30  ? 93  VAL B N   1 
ATOM 2065 C CA  . VAL B 1 51  ? 31.326  -7.716  -12.041 1.00 76.30  ? 93  VAL B CA  1 
ATOM 2066 C C   . VAL B 1 51  ? 31.983  -8.818  -11.251 1.00 76.30  ? 93  VAL B C   1 
ATOM 2067 O O   . VAL B 1 51  ? 31.997  -9.970  -11.676 1.00 76.30  ? 93  VAL B O   1 
ATOM 2068 C CB  . VAL B 1 51  ? 32.377  -6.734  -12.584 1.00 76.30  ? 93  VAL B CB  1 
ATOM 2069 C CG1 . VAL B 1 51  ? 31.671  -5.535  -13.197 1.00 76.30  ? 93  VAL B CG1 1 
ATOM 2070 C CG2 . VAL B 1 51  ? 33.331  -6.275  -11.489 1.00 76.30  ? 93  VAL B CG2 1 
ATOM 2071 N N   . LYS B 1 52  ? 32.385  -8.458  -10.036 1.00 76.30  ? 94  LYS B N   1 
ATOM 2072 C CA  . LYS B 1 52  ? 33.043  -9.349  -9.101  1.00 76.30  ? 94  LYS B CA  1 
ATOM 2073 C C   . LYS B 1 52  ? 32.348  -10.686 -9.166  1.00 76.30  ? 94  LYS B C   1 
ATOM 2074 O O   . LYS B 1 52  ? 32.969  -11.714 -9.385  1.00 76.30  ? 94  LYS B O   1 
ATOM 2075 C CB  . LYS B 1 52  ? 32.897  -8.775  -7.700  1.00 76.30  ? 94  LYS B CB  1 
ATOM 2076 C CG  . LYS B 1 52  ? 33.821  -9.359  -6.673  1.00 76.30  ? 94  LYS B CG  1 
ATOM 2077 C CD  . LYS B 1 52  ? 34.624  -8.247  -5.997  1.00 76.30  ? 94  LYS B CD  1 
ATOM 2078 C CE  . LYS B 1 52  ? 35.656  -8.804  -5.016  1.00 76.30  ? 94  LYS B CE  1 
ATOM 2079 N NZ  . LYS B 1 52  ? 36.531  -7.766  -4.385  1.00 76.30  ? 94  LYS B NZ  1 
ATOM 2080 N N   . ALA B 1 53  ? 31.033  -10.642 -9.031  1.00 76.30  ? 95  ALA B N   1 
ATOM 2081 C CA  . ALA B 1 53  ? 30.228  -11.837 -9.093  1.00 76.30  ? 95  ALA B CA  1 
ATOM 2082 C C   . ALA B 1 53  ? 30.540  -12.560 -10.389 1.00 76.30  ? 95  ALA B C   1 
ATOM 2083 O O   . ALA B 1 53  ? 31.217  -13.580 -10.380 1.00 76.30  ? 95  ALA B O   1 
ATOM 2084 C CB  . ALA B 1 53  ? 28.763  -11.470 -9.025  1.00 76.30  ? 95  ALA B CB  1 
ATOM 2085 N N   . LYS B 1 54  ? 30.144  -11.955 -11.502 1.00 76.30  ? 96  LYS B N   1 
ATOM 2086 C CA  . LYS B 1 54  ? 30.359  -12.537 -12.823 1.00 76.30  ? 96  LYS B CA  1 
ATOM 2087 C C   . LYS B 1 54  ? 31.804  -12.945 -13.095 1.00 76.30  ? 96  LYS B C   1 
ATOM 2088 O O   . LYS B 1 54  ? 32.069  -13.793 -13.939 1.00 76.30  ? 96  LYS B O   1 
ATOM 2089 C CB  . LYS B 1 54  ? 29.866  -11.569 -13.906 1.00 76.30  ? 96  LYS B CB  1 
ATOM 2090 C CG  . LYS B 1 54  ? 28.332  -11.464 -13.985 1.00 76.30  ? 96  LYS B CG  1 
ATOM 2091 C CD  . LYS B 1 54  ? 27.822  -10.611 -15.164 1.00 76.30  ? 96  LYS B CD  1 
ATOM 2092 C CE  . LYS B 1 54  ? 26.345  -10.904 -15.468 1.00 76.30  ? 96  LYS B CE  1 
ATOM 2093 N NZ  . LYS B 1 54  ? 25.749  -10.067 -16.557 1.00 76.30  ? 96  LYS B NZ  1 
ATOM 2094 N N   . VAL B 1 55  ? 32.716  -12.414 -12.296 1.00 76.30  ? 97  VAL B N   1 
ATOM 2095 C CA  . VAL B 1 55  ? 34.134  -12.680 -12.438 1.00 76.30  ? 97  VAL B CA  1 
ATOM 2096 C C   . VAL B 1 55  ? 34.625  -13.843 -11.586 1.00 76.30  ? 97  VAL B C   1 
ATOM 2097 O O   . VAL B 1 55  ? 35.441  -14.664 -12.013 1.00 76.30  ? 97  VAL B O   1 
ATOM 2098 C CB  . VAL B 1 55  ? 34.906  -11.441 -12.038 1.00 76.30  ? 97  VAL B CB  1 
ATOM 2099 C CG1 . VAL B 1 55  ? 36.384  -11.738 -11.981 1.00 76.30  ? 97  VAL B CG1 1 
ATOM 2100 C CG2 . VAL B 1 55  ? 34.593  -10.317 -13.005 1.00 76.30  ? 97  VAL B CG2 1 
ATOM 2101 N N   . GLN B 1 56  ? 34.109  -13.902 -10.369 1.00 76.30  ? 98  GLN B N   1 
ATOM 2102 C CA  . GLN B 1 56  ? 34.491  -14.926 -9.426  1.00 76.30  ? 98  GLN B CA  1 
ATOM 2103 C C   . GLN B 1 56  ? 34.497  -16.337 -9.958  1.00 76.30  ? 98  GLN B C   1 
ATOM 2104 O O   . GLN B 1 56  ? 35.460  -17.064 -9.757  1.00 76.30  ? 98  GLN B O   1 
ATOM 2105 C CB  . GLN B 1 56  ? 33.627  -14.850 -8.177  1.00 76.30  ? 98  GLN B CB  1 
ATOM 2106 C CG  . GLN B 1 56  ? 34.365  -14.276 -6.980  1.00 76.30  ? 98  GLN B CG  1 
ATOM 2107 C CD  . GLN B 1 56  ? 35.586  -15.098 -6.588  1.00 76.30  ? 98  GLN B CD  1 
ATOM 2108 O OE1 . GLN B 1 56  ? 35.636  -15.676 -5.493  1.00 76.30  ? 98  GLN B OE1 1 
ATOM 2109 N NE2 . GLN B 1 56  ? 36.584  -15.137 -7.469  1.00 76.30  ? 98  GLN B NE2 1 
ATOM 2110 N N   . PRO B 1 57  ? 33.423  -16.746 -10.631 1.00 101.52 ? 99  PRO B N   1 
ATOM 2111 C CA  . PRO B 1 57  ? 33.328  -18.091 -11.186 1.00 101.52 ? 99  PRO B CA  1 
ATOM 2112 C C   . PRO B 1 57  ? 34.585  -18.480 -11.937 1.00 101.52 ? 99  PRO B C   1 
ATOM 2113 O O   . PRO B 1 57  ? 35.182  -19.522 -11.687 1.00 101.52 ? 99  PRO B O   1 
ATOM 2114 C CB  . PRO B 1 57  ? 32.133  -17.975 -12.139 1.00 101.52 ? 99  PRO B CB  1 
ATOM 2115 C CG  . PRO B 1 57  ? 32.037  -16.506 -12.423 1.00 101.52 ? 99  PRO B CG  1 
ATOM 2116 C CD  . PRO B 1 57  ? 32.280  -15.942 -11.081 1.00 101.52 ? 99  PRO B CD  1 
ATOM 2117 N N   . TYR B 1 58  ? 34.987  -17.613 -12.854 1.00 101.52 ? 100 TYR B N   1 
ATOM 2118 C CA  . TYR B 1 58  ? 36.154  -17.866 -13.656 1.00 101.52 ? 100 TYR B CA  1 
ATOM 2119 C C   . TYR B 1 58  ? 37.401  -17.846 -12.821 1.00 101.52 ? 100 TYR B C   1 
ATOM 2120 O O   . TYR B 1 58  ? 38.140  -18.829 -12.784 1.00 101.52 ? 100 TYR B O   1 
ATOM 2121 C CB  . TYR B 1 58  ? 36.204  -16.873 -14.810 1.00 101.52 ? 100 TYR B CB  1 
ATOM 2122 C CG  . TYR B 1 58  ? 35.084  -17.141 -15.788 1.00 101.52 ? 100 TYR B CG  1 
ATOM 2123 C CD1 . TYR B 1 58  ? 34.821  -18.445 -16.214 1.00 101.52 ? 100 TYR B CD1 1 
ATOM 2124 C CD2 . TYR B 1 58  ? 34.265  -16.116 -16.257 1.00 101.52 ? 100 TYR B CD2 1 
ATOM 2125 C CE1 . TYR B 1 58  ? 33.771  -18.730 -17.080 1.00 101.52 ? 100 TYR B CE1 1 
ATOM 2126 C CE2 . TYR B 1 58  ? 33.207  -16.388 -17.128 1.00 101.52 ? 100 TYR B CE2 1 
ATOM 2127 C CZ  . TYR B 1 58  ? 32.966  -17.697 -17.534 1.00 101.52 ? 100 TYR B CZ  1 
ATOM 2128 O OH  . TYR B 1 58  ? 31.923  -17.977 -18.391 1.00 101.52 ? 100 TYR B OH  1 
ATOM 2129 N N   . LEU B 1 59  ? 37.574  -16.773 -12.065 1.00 101.52 ? 101 LEU B N   1 
ATOM 2130 C CA  . LEU B 1 59  ? 38.743  -16.655 -11.222 1.00 101.52 ? 101 LEU B CA  1 
ATOM 2131 C C   . LEU B 1 59  ? 38.957  -17.912 -10.385 1.00 101.52 ? 101 LEU B C   1 
ATOM 2132 O O   . LEU B 1 59  ? 40.061  -18.441 -10.314 1.00 101.52 ? 101 LEU B O   1 
ATOM 2133 C CB  . LEU B 1 59  ? 38.605  -15.439 -10.320 1.00 101.52 ? 101 LEU B CB  1 
ATOM 2134 C CG  . LEU B 1 59  ? 39.744  -15.255 -9.316  1.00 101.52 ? 101 LEU B CG  1 
ATOM 2135 C CD1 . LEU B 1 59  ? 41.106  -15.325 -10.003 1.00 101.52 ? 101 LEU B CD1 1 
ATOM 2136 C CD2 . LEU B 1 59  ? 39.562  -13.934 -8.599  1.00 101.52 ? 101 LEU B CD2 1 
ATOM 2137 N N   . ASP B 1 60  ? 37.878  -18.421 -9.810  1.00 101.52 ? 102 ASP B N   1 
ATOM 2138 C CA  . ASP B 1 60  ? 37.949  -19.610 -8.981  1.00 101.52 ? 102 ASP B CA  1 
ATOM 2139 C C   . ASP B 1 60  ? 38.237  -20.856 -9.794  1.00 101.52 ? 102 ASP B C   1 
ATOM 2140 O O   . ASP B 1 60  ? 39.103  -21.642 -9.430  1.00 101.52 ? 102 ASP B O   1 
ATOM 2141 C CB  . ASP B 1 60  ? 36.657  -19.785 -8.194  1.00 101.52 ? 102 ASP B CB  1 
ATOM 2142 C CG  . ASP B 1 60  ? 36.556  -18.826 -7.029  1.00 101.52 ? 102 ASP B CG  1 
ATOM 2143 O OD1 . ASP B 1 60  ? 37.607  -18.497 -6.437  1.00 101.52 ? 102 ASP B OD1 1 
ATOM 2144 O OD2 . ASP B 1 60  ? 35.425  -18.407 -6.701  1.00 101.52 ? 102 ASP B OD2 1 
ATOM 2145 N N   . ASP B 1 61  ? 37.508  -21.024 -10.896 1.00 101.52 ? 103 ASP B N   1 
ATOM 2146 C CA  . ASP B 1 61  ? 37.674  -22.172 -11.794 1.00 101.52 ? 103 ASP B CA  1 
ATOM 2147 C C   . ASP B 1 61  ? 39.164  -22.289 -12.042 1.00 101.52 ? 103 ASP B C   1 
ATOM 2148 O O   . ASP B 1 61  ? 39.764  -23.357 -11.976 1.00 101.52 ? 103 ASP B O   1 
ATOM 2149 C CB  . ASP B 1 61  ? 36.948  -21.882 -13.125 1.00 101.52 ? 103 ASP B CB  1 
ATOM 2150 C CG  . ASP B 1 61  ? 37.005  -23.050 -14.130 1.00 101.52 ? 103 ASP B CG  1 
ATOM 2151 O OD1 . ASP B 1 61  ? 37.851  -23.965 -13.996 1.00 101.52 ? 103 ASP B OD1 1 
ATOM 2152 O OD2 . ASP B 1 61  ? 36.194  -23.034 -15.085 1.00 101.52 ? 103 ASP B OD2 1 
ATOM 2153 N N   . PHE B 1 62  ? 39.744  -21.127 -12.249 1.00 101.52 ? 104 PHE B N   1 
ATOM 2154 C CA  . PHE B 1 62  ? 41.140  -20.969 -12.513 1.00 101.52 ? 104 PHE B CA  1 
ATOM 2155 C C   . PHE B 1 62  ? 41.958  -21.345 -11.295 1.00 101.52 ? 104 PHE B C   1 
ATOM 2156 O O   . PHE B 1 62  ? 42.830  -22.211 -11.351 1.00 101.52 ? 104 PHE B O   1 
ATOM 2157 C CB  . PHE B 1 62  ? 41.342  -19.511 -12.839 1.00 101.52 ? 104 PHE B CB  1 
ATOM 2158 C CG  . PHE B 1 62  ? 42.683  -19.198 -13.344 1.00 101.52 ? 104 PHE B CG  1 
ATOM 2159 C CD1 . PHE B 1 62  ? 42.999  -19.425 -14.681 1.00 101.52 ? 104 PHE B CD1 1 
ATOM 2160 C CD2 . PHE B 1 62  ? 43.629  -18.635 -12.507 1.00 101.52 ? 104 PHE B CD2 1 
ATOM 2161 C CE1 . PHE B 1 62  ? 44.244  -19.090 -15.181 1.00 101.52 ? 104 PHE B CE1 1 
ATOM 2162 C CE2 . PHE B 1 62  ? 44.876  -18.296 -12.996 1.00 101.52 ? 104 PHE B CE2 1 
ATOM 2163 C CZ  . PHE B 1 62  ? 45.186  -18.523 -14.342 1.00 101.52 ? 104 PHE B CZ  1 
ATOM 2164 N N   . GLN B 1 63  ? 41.632  -20.707 -10.183 1.00 101.52 ? 105 GLN B N   1 
ATOM 2165 C CA  . GLN B 1 63  ? 42.320  -20.930 -8.935  1.00 101.52 ? 105 GLN B CA  1 
ATOM 2166 C C   . GLN B 1 63  ? 42.532  -22.404 -8.608  1.00 101.52 ? 105 GLN B C   1 
ATOM 2167 O O   . GLN B 1 63  ? 43.672  -22.847 -8.434  1.00 101.52 ? 105 GLN B O   1 
ATOM 2168 C CB  . GLN B 1 63  ? 41.562  -20.234 -7.817  1.00 101.52 ? 105 GLN B CB  1 
ATOM 2169 C CG  . GLN B 1 63  ? 42.359  -20.149 -6.560  1.00 101.52 ? 105 GLN B CG  1 
ATOM 2170 C CD  . GLN B 1 63  ? 43.706  -19.478 -6.768  1.00 101.52 ? 105 GLN B CD  1 
ATOM 2171 O OE1 . GLN B 1 63  ? 44.095  -19.145 -7.895  1.00 101.52 ? 105 GLN B OE1 1 
ATOM 2172 N NE2 . GLN B 1 63  ? 44.425  -19.265 -5.672  1.00 101.52 ? 105 GLN B NE2 1 
ATOM 2173 N N   . LYS B 1 64  ? 41.431  -23.157 -8.581  1.00 101.52 ? 106 LYS B N   1 
ATOM 2174 C CA  . LYS B 1 64  ? 41.447  -24.595 -8.295  1.00 101.52 ? 106 LYS B CA  1 
ATOM 2175 C C   . LYS B 1 64  ? 42.485  -25.316 -9.144  1.00 101.52 ? 106 LYS B C   1 
ATOM 2176 O O   . LYS B 1 64  ? 43.149  -26.252 -8.689  1.00 101.52 ? 106 LYS B O   1 
ATOM 2177 C CB  . LYS B 1 64  ? 40.071  -25.220 -8.571  1.00 101.52 ? 106 LYS B CB  1 
ATOM 2178 C CG  . LYS B 1 64  ? 39.000  -24.941 -7.515  1.00 101.52 ? 106 LYS B CG  1 
ATOM 2179 C CD  . LYS B 1 64  ? 37.725  -25.765 -7.771  1.00 101.52 ? 106 LYS B CD  1 
ATOM 2180 C CE  . LYS B 1 64  ? 36.764  -25.747 -6.565  1.00 101.52 ? 106 LYS B CE  1 
ATOM 2181 N NZ  . LYS B 1 64  ? 35.539  -26.609 -6.723  1.00 101.52 ? 106 LYS B NZ  1 
ATOM 2182 N N   . LYS B 1 65  ? 42.627  -24.854 -10.377 1.00 101.52 ? 107 LYS B N   1 
ATOM 2183 C CA  . LYS B 1 65  ? 43.560  -25.445 -11.312 1.00 101.52 ? 107 LYS B CA  1 
ATOM 2184 C C   . LYS B 1 65  ? 45.014  -25.103 -10.991 1.00 101.52 ? 107 LYS B C   1 
ATOM 2185 O O   . LYS B 1 65  ? 45.822  -26.000 -10.786 1.00 101.52 ? 107 LYS B O   1 
ATOM 2186 C CB  . LYS B 1 65  ? 43.196  -25.007 -12.729 1.00 101.52 ? 107 LYS B CB  1 
ATOM 2187 C CG  . LYS B 1 65  ? 43.340  -26.100 -13.769 1.00 101.52 ? 107 LYS B CG  1 
ATOM 2188 C CD  . LYS B 1 65  ? 43.010  -25.604 -15.176 1.00 101.52 ? 107 LYS B CD  1 
ATOM 2189 C CE  . LYS B 1 65  ? 41.515  -25.369 -15.392 1.00 101.52 ? 107 LYS B CE  1 
ATOM 2190 N NZ  . LYS B 1 65  ? 41.217  -24.890 -16.787 1.00 101.52 ? 107 LYS B NZ  1 
ATOM 2191 N N   . TRP B 1 66  ? 45.336  -23.813 -10.916 1.00 101.52 ? 108 TRP B N   1 
ATOM 2192 C CA  . TRP B 1 66  ? 46.704  -23.358 -10.637 1.00 101.52 ? 108 TRP B CA  1 
ATOM 2193 C C   . TRP B 1 66  ? 47.383  -24.179 -9.572  1.00 101.52 ? 108 TRP B C   1 
ATOM 2194 O O   . TRP B 1 66  ? 48.537  -24.559 -9.696  1.00 101.52 ? 108 TRP B O   1 
ATOM 2195 C CB  . TRP B 1 66  ? 46.695  -21.880 -10.242 1.00 101.52 ? 108 TRP B CB  1 
ATOM 2196 C CG  . TRP B 1 66  ? 47.798  -21.423 -9.289  1.00 101.52 ? 108 TRP B CG  1 
ATOM 2197 C CD1 . TRP B 1 66  ? 47.706  -21.337 -7.935  1.00 101.52 ? 108 TRP B CD1 1 
ATOM 2198 C CD2 . TRP B 1 66  ? 49.104  -20.886 -9.630  1.00 101.52 ? 108 TRP B CD2 1 
ATOM 2199 N NE1 . TRP B 1 66  ? 48.845  -20.770 -7.407  1.00 101.52 ? 108 TRP B NE1 1 
ATOM 2200 C CE2 . TRP B 1 66  ? 49.718  -20.485 -8.423  1.00 101.52 ? 108 TRP B CE2 1 
ATOM 2201 C CE3 . TRP B 1 66  ? 49.804  -20.697 -10.832 1.00 101.52 ? 108 TRP B CE3 1 
ATOM 2202 C CZ2 . TRP B 1 66  ? 51.004  -19.908 -8.380  1.00 101.52 ? 108 TRP B CZ2 1 
ATOM 2203 C CZ3 . TRP B 1 66  ? 51.089  -20.119 -10.785 1.00 101.52 ? 108 TRP B CZ3 1 
ATOM 2204 C CH2 . TRP B 1 66  ? 51.667  -19.733 -9.567  1.00 101.52 ? 108 TRP B CH2 1 
ATOM 2205 N N   . GLN B 1 67  ? 46.638  -24.455 -8.522  1.00 101.52 ? 109 GLN B N   1 
ATOM 2206 C CA  . GLN B 1 67  ? 47.157  -25.242 -7.437  1.00 101.52 ? 109 GLN B CA  1 
ATOM 2207 C C   . GLN B 1 67  ? 47.448  -26.619 -7.967  1.00 101.52 ? 109 GLN B C   1 
ATOM 2208 O O   . GLN B 1 67  ? 48.573  -27.094 -7.856  1.00 101.52 ? 109 GLN B O   1 
ATOM 2209 C CB  . GLN B 1 67  ? 46.137  -25.305 -6.310  1.00 101.52 ? 109 GLN B CB  1 
ATOM 2210 C CG  . GLN B 1 67  ? 45.797  -23.936 -5.723  1.00 101.52 ? 109 GLN B CG  1 
ATOM 2211 C CD  . GLN B 1 67  ? 47.015  -23.201 -5.161  1.00 101.52 ? 109 GLN B CD  1 
ATOM 2212 O OE1 . GLN B 1 67  ? 48.147  -23.685 -5.244  1.00 101.52 ? 109 GLN B OE1 1 
ATOM 2213 N NE2 . GLN B 1 67  ? 46.783  -22.026 -4.584  1.00 101.52 ? 109 GLN B NE2 1 
ATOM 2214 N N   . GLU B 1 68  ? 46.441  -27.223 -8.600  1.00 101.52 ? 110 GLU B N   1 
ATOM 2215 C CA  . GLU B 1 68  ? 46.573  -28.555 -9.185  1.00 101.52 ? 110 GLU B CA  1 
ATOM 2216 C C   . GLU B 1 68  ? 47.929  -28.671 -9.874  1.00 101.52 ? 110 GLU B C   1 
ATOM 2217 O O   . GLU B 1 68  ? 48.601  -29.691 -9.757  1.00 101.52 ? 110 GLU B O   1 
ATOM 2218 C CB  . GLU B 1 68  ? 45.457  -28.829 -10.208 1.00 101.52 ? 110 GLU B CB  1 
ATOM 2219 C CG  . GLU B 1 68  ? 44.050  -28.934 -9.625  1.00 101.52 ? 110 GLU B CG  1 
ATOM 2220 C CD  . GLU B 1 68  ? 43.507  -30.354 -9.637  1.00 101.52 ? 110 GLU B CD  1 
ATOM 2221 O OE1 . GLU B 1 68  ? 43.616  -31.033 -10.681 1.00 101.52 ? 110 GLU B OE1 1 
ATOM 2222 O OE2 . GLU B 1 68  ? 42.955  -30.791 -8.606  1.00 101.52 ? 110 GLU B OE2 1 
ATOM 2223 N N   . GLU B 1 69  ? 48.367  -27.591 -10.520 1.00 101.52 ? 111 GLU B N   1 
ATOM 2224 C CA  . GLU B 1 69  ? 49.650  -27.616 -11.203 1.00 101.52 ? 111 GLU B CA  1 
ATOM 2225 C C   . GLU B 1 69  ? 50.792  -27.290 -10.266 1.00 101.52 ? 111 GLU B C   1 
ATOM 2226 O O   . GLU B 1 69  ? 51.818  -27.952 -10.299 1.00 101.52 ? 111 GLU B O   1 
ATOM 2227 C CB  . GLU B 1 69  ? 49.670  -26.666 -12.398 1.00 101.52 ? 111 GLU B CB  1 
ATOM 2228 C CG  . GLU B 1 69  ? 50.673  -27.061 -13.502 1.00 101.52 ? 111 GLU B CG  1 
ATOM 2229 C CD  . GLU B 1 69  ? 52.073  -26.442 -13.365 1.00 101.52 ? 111 GLU B CD  1 
ATOM 2230 O OE1 . GLU B 1 69  ? 52.486  -26.066 -12.243 1.00 101.52 ? 111 GLU B OE1 1 
ATOM 2231 O OE2 . GLU B 1 69  ? 52.770  -26.337 -14.403 1.00 101.52 ? 111 GLU B OE2 1 
ATOM 2232 N N   . MET B 1 70  ? 50.640  -26.254 -9.454  1.00 101.52 ? 112 MET B N   1 
ATOM 2233 C CA  . MET B 1 70  ? 51.693  -25.878 -8.525  1.00 101.52 ? 112 MET B CA  1 
ATOM 2234 C C   . MET B 1 70  ? 52.214  -27.088 -7.801  1.00 101.52 ? 112 MET B C   1 
ATOM 2235 O O   . MET B 1 70  ? 53.414  -27.248 -7.630  1.00 101.52 ? 112 MET B O   1 
ATOM 2236 C CB  . MET B 1 70  ? 51.158  -24.939 -7.484  1.00 101.52 ? 112 MET B CB  1 
ATOM 2237 C CG  . MET B 1 70  ? 51.204  -23.519 -7.868  1.00 101.52 ? 112 MET B CG  1 
ATOM 2238 S SD  . MET B 1 70  ? 50.589  -22.640 -6.454  1.00 101.52 ? 112 MET B SD  1 
ATOM 2239 C CE  . MET B 1 70  ? 52.080  -22.110 -5.685  1.00 101.52 ? 112 MET B CE  1 
ATOM 2240 N N   . GLU B 1 71  ? 51.287  -27.932 -7.367  1.00 101.52 ? 113 GLU B N   1 
ATOM 2241 C CA  . GLU B 1 71  ? 51.640  -29.142 -6.656  1.00 101.52 ? 113 GLU B CA  1 
ATOM 2242 C C   . GLU B 1 71  ? 52.618  -29.944 -7.483  1.00 101.52 ? 113 GLU B C   1 
ATOM 2243 O O   . GLU B 1 71  ? 53.524  -30.560 -6.934  1.00 101.52 ? 113 GLU B O   1 
ATOM 2244 C CB  . GLU B 1 71  ? 50.399  -29.963 -6.323  1.00 101.52 ? 113 GLU B CB  1 
ATOM 2245 C CG  . GLU B 1 71  ? 49.637  -29.452 -5.092  1.00 101.52 ? 113 GLU B CG  1 
ATOM 2246 C CD  . GLU B 1 71  ? 48.515  -30.394 -4.632  1.00 101.52 ? 113 GLU B CD  1 
ATOM 2247 O OE1 . GLU B 1 71  ? 48.797  -31.338 -3.854  1.00 101.52 ? 113 GLU B OE1 1 
ATOM 2248 O OE2 . GLU B 1 71  ? 47.348  -30.179 -5.037  1.00 101.52 ? 113 GLU B OE2 1 
ATOM 2249 N N   . LEU B 1 72  ? 52.438  -29.938 -8.802  1.00 101.52 ? 114 LEU B N   1 
ATOM 2250 C CA  . LEU B 1 72  ? 53.368  -30.639 -9.684  1.00 101.52 ? 114 LEU B CA  1 
ATOM 2251 C C   . LEU B 1 72  ? 54.751  -30.106 -9.367  1.00 101.52 ? 114 LEU B C   1 
ATOM 2252 O O   . LEU B 1 72  ? 55.681  -30.873 -9.103  1.00 101.52 ? 114 LEU B O   1 
ATOM 2253 C CB  . LEU B 1 72  ? 53.066  -30.364 -11.169 1.00 101.52 ? 114 LEU B CB  1 
ATOM 2254 C CG  . LEU B 1 72  ? 54.229  -30.078 -12.149 1.00 101.52 ? 114 LEU B CG  1 
ATOM 2255 C CD1 . LEU B 1 72  ? 55.223  -31.248 -12.237 1.00 101.52 ? 114 LEU B CD1 1 
ATOM 2256 C CD2 . LEU B 1 72  ? 53.672  -29.754 -13.534 1.00 101.52 ? 114 LEU B CD2 1 
ATOM 2257 N N   . TYR B 1 73  ? 54.862  -28.780 -9.393  1.00 101.52 ? 115 TYR B N   1 
ATOM 2258 C CA  . TYR B 1 73  ? 56.120  -28.100 -9.132  1.00 101.52 ? 115 TYR B CA  1 
ATOM 2259 C C   . TYR B 1 73  ? 56.704  -28.639 -7.839  1.00 101.52 ? 115 TYR B C   1 
ATOM 2260 O O   . TYR B 1 73  ? 57.667  -29.406 -7.867  1.00 101.52 ? 115 TYR B O   1 
ATOM 2261 C CB  . TYR B 1 73  ? 55.876  -26.592 -9.014  1.00 101.52 ? 115 TYR B CB  1 
ATOM 2262 C CG  . TYR B 1 73  ? 57.037  -25.694 -9.412  1.00 101.52 ? 115 TYR B CG  1 
ATOM 2263 C CD1 . TYR B 1 73  ? 58.109  -25.469 -8.552  1.00 101.52 ? 115 TYR B CD1 1 
ATOM 2264 C CD2 . TYR B 1 73  ? 57.016  -25.001 -10.622 1.00 101.52 ? 115 TYR B CD2 1 
ATOM 2265 C CE1 . TYR B 1 73  ? 59.138  -24.566 -8.888  1.00 101.52 ? 115 TYR B CE1 1 
ATOM 2266 C CE2 . TYR B 1 73  ? 58.036  -24.098 -10.967 1.00 101.52 ? 115 TYR B CE2 1 
ATOM 2267 C CZ  . TYR B 1 73  ? 59.090  -23.881 -10.092 1.00 101.52 ? 115 TYR B CZ  1 
ATOM 2268 O OH  . TYR B 1 73  ? 60.091  -22.979 -10.414 1.00 101.52 ? 115 TYR B OH  1 
ATOM 2269 N N   . ARG B 1 74  ? 56.047  -28.313 -6.725  1.00 101.52 ? 116 ARG B N   1 
ATOM 2270 C CA  . ARG B 1 74  ? 56.485  -28.728 -5.388  1.00 101.52 ? 116 ARG B CA  1 
ATOM 2271 C C   . ARG B 1 74  ? 57.068  -30.122 -5.321  1.00 101.52 ? 116 ARG B C   1 
ATOM 2272 O O   . ARG B 1 74  ? 58.245  -30.292 -5.021  1.00 101.52 ? 116 ARG B O   1 
ATOM 2273 C CB  . ARG B 1 74  ? 55.341  -28.637 -4.354  1.00 101.52 ? 116 ARG B CB  1 
ATOM 2274 C CG  . ARG B 1 74  ? 55.697  -29.226 -2.950  1.00 101.52 ? 116 ARG B CG  1 
ATOM 2275 C CD  . ARG B 1 74  ? 54.500  -29.269 -1.959  1.00 101.52 ? 116 ARG B CD  1 
ATOM 2276 N NE  . ARG B 1 74  ? 54.822  -29.943 -0.689  1.00 101.52 ? 116 ARG B NE  1 
ATOM 2277 C CZ  . ARG B 1 74  ? 54.051  -29.934 0.405   1.00 101.52 ? 116 ARG B CZ  1 
ATOM 2278 N NH1 . ARG B 1 74  ? 52.888  -29.283 0.414   1.00 101.52 ? 116 ARG B NH1 1 
ATOM 2279 N NH2 . ARG B 1 74  ? 54.446  -30.575 1.502   1.00 101.52 ? 116 ARG B NH2 1 
ATOM 2280 N N   . GLN B 1 75  ? 56.233  -31.114 -5.602  1.00 101.52 ? 117 GLN B N   1 
ATOM 2281 C CA  . GLN B 1 75  ? 56.653  -32.504 -5.538  1.00 101.52 ? 117 GLN B CA  1 
ATOM 2282 C C   . GLN B 1 75  ? 57.871  -32.835 -6.360  1.00 101.52 ? 117 GLN B C   1 
ATOM 2283 O O   . GLN B 1 75  ? 58.686  -33.658 -5.951  1.00 101.52 ? 117 GLN B O   1 
ATOM 2284 C CB  . GLN B 1 75  ? 55.504  -33.433 -5.906  1.00 101.52 ? 117 GLN B CB  1 
ATOM 2285 C CG  . GLN B 1 75  ? 54.489  -33.585 -4.784  1.00 101.52 ? 117 GLN B CG  1 
ATOM 2286 C CD  . GLN B 1 75  ? 53.092  -33.166 -5.192  1.00 101.52 ? 117 GLN B CD  1 
ATOM 2287 O OE1 . GLN B 1 75  ? 52.578  -33.598 -6.229  1.00 101.52 ? 117 GLN B OE1 1 
ATOM 2288 N NE2 . GLN B 1 75  ? 52.460  -32.333 -4.369  1.00 101.52 ? 117 GLN B NE2 1 
ATOM 2289 N N   . LYS B 1 76  ? 58.022  -32.184 -7.503  1.00 101.52 ? 118 LYS B N   1 
ATOM 2290 C CA  . LYS B 1 76  ? 59.179  -32.464 -8.321  1.00 101.52 ? 118 LYS B CA  1 
ATOM 2291 C C   . LYS B 1 76  ? 60.424  -31.772 -7.764  1.00 101.52 ? 118 LYS B C   1 
ATOM 2292 O O   . LYS B 1 76  ? 61.495  -31.889 -8.338  1.00 101.52 ? 118 LYS B O   1 
ATOM 2293 C CB  . LYS B 1 76  ? 58.924  -32.057 -9.776  1.00 101.52 ? 118 LYS B CB  1 
ATOM 2294 C CG  . LYS B 1 76  ? 59.241  -33.182 -10.772 1.00 101.52 ? 118 LYS B CG  1 
ATOM 2295 C CD  . LYS B 1 76  ? 59.075  -32.791 -12.250 1.00 101.52 ? 118 LYS B CD  1 
ATOM 2296 C CE  . LYS B 1 76  ? 59.494  -33.942 -13.190 1.00 101.52 ? 118 LYS B CE  1 
ATOM 2297 N NZ  . LYS B 1 76  ? 59.361  -33.640 -14.652 1.00 101.52 ? 118 LYS B NZ  1 
ATOM 2298 N N   . VAL B 1 77  ? 60.304  -31.147 -6.593  1.00 101.52 ? 119 VAL B N   1 
ATOM 2299 C CA  . VAL B 1 77  ? 61.408  -30.407 -5.966  1.00 101.52 ? 119 VAL B CA  1 
ATOM 2300 C C   . VAL B 1 77  ? 61.962  -30.973 -4.673  1.00 101.52 ? 119 VAL B C   1 
ATOM 2301 O O   . VAL B 1 77  ? 63.169  -30.980 -4.454  1.00 101.52 ? 119 VAL B O   1 
ATOM 2302 C CB  . VAL B 1 77  ? 60.964  -28.983 -5.613  1.00 101.52 ? 119 VAL B CB  1 
ATOM 2303 C CG1 . VAL B 1 77  ? 62.058  -28.259 -4.804  1.00 101.52 ? 119 VAL B CG1 1 
ATOM 2304 C CG2 . VAL B 1 77  ? 60.596  -28.230 -6.868  1.00 101.52 ? 119 VAL B CG2 1 
ATOM 2305 N N   . GLU B 1 78  ? 61.058  -31.343 -3.776  1.00 101.52 ? 120 GLU B N   1 
ATOM 2306 C CA  . GLU B 1 78  ? 61.411  -31.886 -2.470  1.00 101.52 ? 120 GLU B CA  1 
ATOM 2307 C C   . GLU B 1 78  ? 62.751  -32.601 -2.329  1.00 101.52 ? 120 GLU B C   1 
ATOM 2308 O O   . GLU B 1 78  ? 63.474  -32.360 -1.359  1.00 101.52 ? 120 GLU B O   1 
ATOM 2309 C CB  . GLU B 1 78  ? 60.288  -32.784 -1.968  1.00 101.52 ? 120 GLU B CB  1 
ATOM 2310 C CG  . GLU B 1 78  ? 59.226  -32.050 -1.156  1.00 101.52 ? 120 GLU B CG  1 
ATOM 2311 C CD  . GLU B 1 78  ? 59.461  -32.153 0.344   1.00 101.52 ? 120 GLU B CD  1 
ATOM 2312 O OE1 . GLU B 1 78  ? 60.640  -32.224 0.765   1.00 101.52 ? 120 GLU B OE1 1 
ATOM 2313 O OE2 . GLU B 1 78  ? 58.465  -32.158 1.103   1.00 101.52 ? 120 GLU B OE2 1 
ATOM 2314 N N   . PRO B 1 79  ? 63.104  -33.495 -3.262  1.00 105.45 ? 121 PRO B N   1 
ATOM 2315 C CA  . PRO B 1 79  ? 64.380  -34.207 -3.175  1.00 105.45 ? 121 PRO B CA  1 
ATOM 2316 C C   . PRO B 1 79  ? 65.590  -33.296 -2.966  1.00 105.45 ? 121 PRO B C   1 
ATOM 2317 O O   . PRO B 1 79  ? 66.571  -33.685 -2.346  1.00 105.45 ? 121 PRO B O   1 
ATOM 2318 C CB  . PRO B 1 79  ? 64.459  -34.952 -4.508  1.00 105.45 ? 121 PRO B CB  1 
ATOM 2319 C CG  . PRO B 1 79  ? 63.505  -34.201 -5.398  1.00 105.45 ? 121 PRO B CG  1 
ATOM 2320 C CD  . PRO B 1 79  ? 62.371  -33.943 -4.464  1.00 105.45 ? 121 PRO B CD  1 
ATOM 2321 N N   . LEU B 1 80  ? 65.522  -32.089 -3.508  1.00 105.45 ? 122 LEU B N   1 
ATOM 2322 C CA  . LEU B 1 80  ? 66.617  -31.146 -3.363  1.00 105.45 ? 122 LEU B CA  1 
ATOM 2323 C C   . LEU B 1 80  ? 66.725  -30.691 -1.924  1.00 105.45 ? 122 LEU B C   1 
ATOM 2324 O O   . LEU B 1 80  ? 67.819  -30.418 -1.432  1.00 105.45 ? 122 LEU B O   1 
ATOM 2325 C CB  . LEU B 1 80  ? 66.404  -29.975 -4.302  1.00 105.45 ? 122 LEU B CB  1 
ATOM 2326 C CG  . LEU B 1 80  ? 66.318  -30.518 -5.732  1.00 105.45 ? 122 LEU B CG  1 
ATOM 2327 C CD1 . LEU B 1 80  ? 66.052  -29.391 -6.707  1.00 105.45 ? 122 LEU B CD1 1 
ATOM 2328 C CD2 . LEU B 1 80  ? 67.599  -31.279 -6.101  1.00 105.45 ? 122 LEU B CD2 1 
ATOM 2329 N N   . ARG B 1 81  ? 65.588  -30.664 -1.238  1.00 105.45 ? 123 ARG B N   1 
ATOM 2330 C CA  . ARG B 1 81  ? 65.575  -30.283 0.160   1.00 105.45 ? 123 ARG B CA  1 
ATOM 2331 C C   . ARG B 1 81  ? 66.507  -31.212 0.903   1.00 105.45 ? 123 ARG B C   1 
ATOM 2332 O O   . ARG B 1 81  ? 67.087  -30.851 1.907   1.00 105.45 ? 123 ARG B O   1 
ATOM 2333 C CB  . ARG B 1 81  ? 64.181  -30.403 0.742   1.00 105.45 ? 123 ARG B CB  1 
ATOM 2334 C CG  . ARG B 1 81  ? 63.136  -29.565 0.060   1.00 105.45 ? 123 ARG B CG  1 
ATOM 2335 C CD  . ARG B 1 81  ? 62.155  -29.119 1.110   1.00 105.45 ? 123 ARG B CD  1 
ATOM 2336 N NE  . ARG B 1 81  ? 60.818  -28.876 0.584   1.00 105.45 ? 123 ARG B NE  1 
ATOM 2337 C CZ  . ARG B 1 81  ? 59.700  -29.114 1.265   1.00 105.45 ? 123 ARG B CZ  1 
ATOM 2338 N NH1 . ARG B 1 81  ? 59.750  -29.595 2.505   1.00 105.45 ? 123 ARG B NH1 1 
ATOM 2339 N NH2 . ARG B 1 81  ? 58.523  -28.909 0.691   1.00 105.45 ? 123 ARG B NH2 1 
ATOM 2340 N N   . ALA B 1 82  ? 66.652  -32.415 0.381   1.00 105.45 ? 124 ALA B N   1 
ATOM 2341 C CA  . ALA B 1 82  ? 67.530  -33.385 0.988   1.00 105.45 ? 124 ALA B CA  1 
ATOM 2342 C C   . ALA B 1 82  ? 68.960  -33.134 0.555   1.00 105.45 ? 124 ALA B C   1 
ATOM 2343 O O   . ALA B 1 82  ? 69.809  -32.854 1.394   1.00 105.45 ? 124 ALA B O   1 
ATOM 2344 C CB  . ALA B 1 82  ? 67.101  -34.766 0.606   1.00 105.45 ? 124 ALA B CB  1 
ATOM 2345 N N   . GLU B 1 83  ? 69.206  -33.166 -0.756  1.00 105.45 ? 125 GLU B N   1 
ATOM 2346 C CA  . GLU B 1 83  ? 70.552  -32.960 -1.290  1.00 105.45 ? 125 GLU B CA  1 
ATOM 2347 C C   . GLU B 1 83  ? 71.197  -31.749 -0.664  1.00 105.45 ? 125 GLU B C   1 
ATOM 2348 O O   . GLU B 1 83  ? 72.416  -31.701 -0.484  1.00 105.45 ? 125 GLU B O   1 
ATOM 2349 C CB  . GLU B 1 83  ? 70.551  -32.818 -2.816  1.00 105.45 ? 125 GLU B CB  1 
ATOM 2350 C CG  . GLU B 1 83  ? 71.970  -32.857 -3.417  1.00 105.45 ? 125 GLU B CG  1 
ATOM 2351 C CD  . GLU B 1 83  ? 72.003  -33.130 -4.920  1.00 105.45 ? 125 GLU B CD  1 
ATOM 2352 O OE1 . GLU B 1 83  ? 71.158  -33.905 -5.423  1.00 105.45 ? 125 GLU B OE1 1 
ATOM 2353 O OE2 . GLU B 1 83  ? 72.901  -32.584 -5.598  1.00 105.45 ? 125 GLU B OE2 1 
ATOM 2354 N N   . LEU B 1 84  ? 70.366  -30.787 -0.288  1.00 105.45 ? 126 LEU B N   1 
ATOM 2355 C CA  . LEU B 1 84  ? 70.872  -29.587 0.326   1.00 105.45 ? 126 LEU B CA  1 
ATOM 2356 C C   . LEU B 1 84  ? 70.883  -29.681 1.840   1.00 105.45 ? 126 LEU B C   1 
ATOM 2357 O O   . LEU B 1 84  ? 71.903  -29.408 2.457   1.00 105.45 ? 126 LEU B O   1 
ATOM 2358 C CB  . LEU B 1 84  ? 70.068  -28.378 -0.139  1.00 105.45 ? 126 LEU B CB  1 
ATOM 2359 C CG  . LEU B 1 84  ? 69.314  -27.517 0.869   1.00 105.45 ? 126 LEU B CG  1 
ATOM 2360 C CD1 . LEU B 1 84  ? 69.029  -26.186 0.242   1.00 105.45 ? 126 LEU B CD1 1 
ATOM 2361 C CD2 . LEU B 1 84  ? 68.044  -28.178 1.317   1.00 105.45 ? 126 LEU B CD2 1 
ATOM 2362 N N   . GLN B 1 85  ? 69.776  -30.129 2.429   1.00 105.45 ? 127 GLN B N   1 
ATOM 2363 C CA  . GLN B 1 85  ? 69.667  -30.216 3.885   1.00 105.45 ? 127 GLN B CA  1 
ATOM 2364 C C   . GLN B 1 85  ? 70.785  -31.021 4.517   1.00 105.45 ? 127 GLN B C   1 
ATOM 2365 O O   . GLN B 1 85  ? 71.244  -30.705 5.617   1.00 105.45 ? 127 GLN B O   1 
ATOM 2366 C CB  . GLN B 1 85  ? 68.320  -30.800 4.291   1.00 105.45 ? 127 GLN B CB  1 
ATOM 2367 C CG  . GLN B 1 85  ? 67.956  -30.602 5.749   1.00 105.45 ? 127 GLN B CG  1 
ATOM 2368 C CD  . GLN B 1 85  ? 66.449  -30.546 5.967   1.00 105.45 ? 127 GLN B CD  1 
ATOM 2369 O OE1 . GLN B 1 85  ? 65.677  -30.349 5.021   1.00 105.45 ? 127 GLN B OE1 1 
ATOM 2370 N NE2 . GLN B 1 85  ? 66.022  -30.704 7.218   1.00 105.45 ? 127 GLN B NE2 1 
ATOM 2371 N N   . GLU B 1 86  ? 71.235  -32.041 3.792   1.00 105.45 ? 128 GLU B N   1 
ATOM 2372 C CA  . GLU B 1 86  ? 72.317  -32.921 4.236   1.00 105.45 ? 128 GLU B CA  1 
ATOM 2373 C C   . GLU B 1 86  ? 73.618  -32.114 4.358   1.00 105.45 ? 128 GLU B C   1 
ATOM 2374 O O   . GLU B 1 86  ? 74.185  -31.982 5.451   1.00 105.45 ? 128 GLU B O   1 
ATOM 2375 C CB  . GLU B 1 86  ? 72.525  -34.086 3.233   1.00 105.45 ? 128 GLU B CB  1 
ATOM 2376 C CG  . GLU B 1 86  ? 72.251  -35.517 3.808   1.00 105.45 ? 128 GLU B CG  1 
ATOM 2377 C CD  . GLU B 1 86  ? 72.816  -36.685 2.953   1.00 105.45 ? 128 GLU B CD  1 
ATOM 2378 O OE1 . GLU B 1 86  ? 73.914  -36.535 2.364   1.00 105.45 ? 128 GLU B OE1 1 
ATOM 2379 O OE2 . GLU B 1 86  ? 72.178  -37.771 2.903   1.00 105.45 ? 128 GLU B OE2 1 
ATOM 2380 N N   . GLY B 1 87  ? 74.065  -31.562 3.228   1.00 105.45 ? 129 GLY B N   1 
ATOM 2381 C CA  . GLY B 1 87  ? 75.288  -30.776 3.189   1.00 105.45 ? 129 GLY B CA  1 
ATOM 2382 C C   . GLY B 1 87  ? 75.293  -29.655 4.210   1.00 105.45 ? 129 GLY B C   1 
ATOM 2383 O O   . GLY B 1 87  ? 76.353  -29.307 4.743   1.00 105.45 ? 129 GLY B O   1 
ATOM 2384 N N   . ALA B 1 88  ? 74.100  -29.121 4.490   1.00 105.45 ? 130 ALA B N   1 
ATOM 2385 C CA  . ALA B 1 88  ? 73.898  -28.035 5.451   1.00 105.45 ? 130 ALA B CA  1 
ATOM 2386 C C   . ALA B 1 88  ? 74.252  -28.463 6.869   1.00 105.45 ? 130 ALA B C   1 
ATOM 2387 O O   . ALA B 1 88  ? 75.090  -27.840 7.518   1.00 105.45 ? 130 ALA B O   1 
ATOM 2388 C CB  . ALA B 1 88  ? 72.460  -27.555 5.405   1.00 105.45 ? 130 ALA B CB  1 
ATOM 2389 N N   . ARG B 1 89  ? 73.587  -29.502 7.361   1.00 105.45 ? 131 ARG B N   1 
ATOM 2390 C CA  . ARG B 1 89  ? 73.853  -30.005 8.707   1.00 105.45 ? 131 ARG B CA  1 
ATOM 2391 C C   . ARG B 1 89  ? 75.331  -30.368 8.884   1.00 105.45 ? 131 ARG B C   1 
ATOM 2392 O O   . ARG B 1 89  ? 75.871  -30.234 9.980   1.00 105.45 ? 131 ARG B O   1 
ATOM 2393 C CB  . ARG B 1 89  ? 72.976  -31.231 9.008   1.00 105.45 ? 131 ARG B CB  1 
ATOM 2394 C CG  . ARG B 1 89  ? 73.175  -31.881 10.397  1.00 105.45 ? 131 ARG B CG  1 
ATOM 2395 C CD  . ARG B 1 89  ? 72.325  -33.172 10.546  1.00 105.45 ? 131 ARG B CD  1 
ATOM 2396 N NE  . ARG B 1 89  ? 72.440  -33.821 11.864  1.00 105.45 ? 131 ARG B NE  1 
ATOM 2397 C CZ  . ARG B 1 89  ? 71.862  -34.980 12.206  1.00 105.45 ? 131 ARG B CZ  1 
ATOM 2398 N NH1 . ARG B 1 89  ? 71.113  -35.658 11.337  1.00 105.45 ? 131 ARG B NH1 1 
ATOM 2399 N NH2 . ARG B 1 89  ? 72.012  -35.459 13.439  1.00 105.45 ? 131 ARG B NH2 1 
ATOM 2400 N N   . GLN B 1 90  ? 75.980  -30.797 7.799   1.00 105.45 ? 132 GLN B N   1 
ATOM 2401 C CA  . GLN B 1 90  ? 77.390  -31.191 7.831   1.00 105.45 ? 132 GLN B CA  1 
ATOM 2402 C C   . GLN B 1 90  ? 78.252  -30.070 8.392   1.00 105.45 ? 132 GLN B C   1 
ATOM 2403 O O   . GLN B 1 90  ? 78.786  -30.175 9.495   1.00 105.45 ? 132 GLN B O   1 
ATOM 2404 C CB  . GLN B 1 90  ? 77.892  -31.584 6.424   1.00 105.45 ? 132 GLN B CB  1 
ATOM 2405 C CG  . GLN B 1 90  ? 78.001  -33.102 6.158   1.00 105.45 ? 132 GLN B CG  1 
ATOM 2406 C CD  . GLN B 1 90  ? 78.690  -33.445 4.829   1.00 105.45 ? 132 GLN B CD  1 
ATOM 2407 O OE1 . GLN B 1 90  ? 79.796  -32.973 4.542   1.00 105.45 ? 132 GLN B OE1 1 
ATOM 2408 N NE2 . GLN B 1 90  ? 78.043  -34.296 4.029   1.00 105.45 ? 132 GLN B NE2 1 
ATOM 2409 N N   . LYS B 1 91  ? 78.342  -28.978 7.645   1.00 105.45 ? 133 LYS B N   1 
ATOM 2410 C CA  . LYS B 1 91  ? 79.142  -27.843 8.056   1.00 105.45 ? 133 LYS B CA  1 
ATOM 2411 C C   . LYS B 1 91  ? 78.689  -27.262 9.393   1.00 105.45 ? 133 LYS B C   1 
ATOM 2412 O O   . LYS B 1 91  ? 79.485  -26.663 10.107  1.00 105.45 ? 133 LYS B O   1 
ATOM 2413 C CB  . LYS B 1 91  ? 79.135  -26.778 6.963   1.00 105.45 ? 133 LYS B CB  1 
ATOM 2414 C CG  . LYS B 1 91  ? 79.598  -27.276 5.588   1.00 105.45 ? 133 LYS B CG  1 
ATOM 2415 C CD  . LYS B 1 91  ? 79.469  -26.174 4.544   1.00 105.45 ? 133 LYS B CD  1 
ATOM 2416 C CE  . LYS B 1 91  ? 79.923  -26.620 3.160   1.00 105.45 ? 133 LYS B CE  1 
ATOM 2417 N NZ  . LYS B 1 91  ? 79.793  -25.513 2.159   1.00 105.45 ? 133 LYS B NZ  1 
ATOM 2418 N N   . LEU B 1 92  ? 77.427  -27.494 9.747   1.00 105.45 ? 134 LEU B N   1 
ATOM 2419 C CA  . LEU B 1 92  ? 76.854  -26.996 10.997  1.00 105.45 ? 134 LEU B CA  1 
ATOM 2420 C C   . LEU B 1 92  ? 77.752  -27.176 12.223  1.00 105.45 ? 134 LEU B C   1 
ATOM 2421 O O   . LEU B 1 92  ? 77.938  -26.243 13.007  1.00 105.45 ? 134 LEU B O   1 
ATOM 2422 C CB  . LEU B 1 92  ? 75.508  -27.664 11.228  1.00 105.45 ? 134 LEU B CB  1 
ATOM 2423 C CG  . LEU B 1 92  ? 74.949  -27.750 12.644  1.00 105.45 ? 134 LEU B CG  1 
ATOM 2424 C CD1 . LEU B 1 92  ? 74.834  -26.381 13.285  1.00 105.45 ? 134 LEU B CD1 1 
ATOM 2425 C CD2 . LEU B 1 92  ? 73.604  -28.430 12.574  1.00 105.45 ? 134 LEU B CD2 1 
ATOM 2426 N N   . HIS B 1 93  ? 78.295  -28.372 12.398  1.00 105.45 ? 135 HIS B N   1 
ATOM 2427 C CA  . HIS B 1 93  ? 79.160  -28.619 13.537  1.00 105.45 ? 135 HIS B CA  1 
ATOM 2428 C C   . HIS B 1 93  ? 80.598  -28.225 13.250  1.00 105.45 ? 135 HIS B C   1 
ATOM 2429 O O   . HIS B 1 93  ? 81.351  -27.892 14.159  1.00 105.45 ? 135 HIS B O   1 
ATOM 2430 C CB  . HIS B 1 93  ? 79.020  -30.058 14.004  1.00 105.45 ? 135 HIS B CB  1 
ATOM 2431 C CG  . HIS B 1 93  ? 77.619  -30.403 14.385  1.00 105.45 ? 135 HIS B CG  1 
ATOM 2432 N ND1 . HIS B 1 93  ? 76.617  -30.567 13.454  1.00 105.45 ? 135 HIS B ND1 1 
ATOM 2433 C CD2 . HIS B 1 93  ? 77.037  -30.553 15.599  1.00 105.45 ? 135 HIS B CD2 1 
ATOM 2434 C CE1 . HIS B 1 93  ? 75.474  -30.800 14.077  1.00 105.45 ? 135 HIS B CE1 1 
ATOM 2435 N NE2 . HIS B 1 93  ? 75.701  -30.796 15.381  1.00 105.45 ? 135 HIS B NE2 1 
ATOM 2436 N N   . GLU B 1 94  ? 80.949  -28.197 11.969  1.00 105.45 ? 136 GLU B N   1 
ATOM 2437 C CA  . GLU B 1 94  ? 82.276  -27.779 11.537  1.00 105.45 ? 136 GLU B CA  1 
ATOM 2438 C C   . GLU B 1 94  ? 82.513  -26.420 12.201  1.00 105.45 ? 136 GLU B C   1 
ATOM 2439 O O   . GLU B 1 94  ? 83.542  -26.176 12.794  1.00 105.45 ? 136 GLU B O   1 
ATOM 2440 C CB  . GLU B 1 94  ? 82.265  -27.654 10.008  1.00 105.45 ? 136 GLU B CB  1 
ATOM 2441 C CG  . GLU B 1 94  ? 83.619  -27.649 9.336   1.00 105.45 ? 136 GLU B CG  1 
ATOM 2442 C CD  . GLU B 1 94  ? 83.567  -28.143 7.886   1.00 105.45 ? 136 GLU B CD  1 
ATOM 2443 O OE1 . GLU B 1 94  ? 82.485  -28.562 7.408   1.00 105.45 ? 136 GLU B OE1 1 
ATOM 2444 O OE2 . GLU B 1 94  ? 84.629  -28.132 7.228   1.00 105.45 ? 136 GLU B OE2 1 
ATOM 2445 N N   . LEU B 1 95  ? 81.435  -25.662 12.308  1.00 105.45 ? 137 LEU B N   1 
ATOM 2446 C CA  . LEU B 1 95  ? 81.468  -24.338 12.882  1.00 105.45 ? 137 LEU B CA  1 
ATOM 2447 C C   . LEU B 1 95  ? 80.976  -24.319 14.330  1.00 105.45 ? 137 LEU B C   1 
ATOM 2448 O O   . LEU B 1 95  ? 81.467  -23.550 15.137  1.00 105.45 ? 137 LEU B O   1 
ATOM 2449 C CB  . LEU B 1 95  ? 80.651  -23.431 11.974  1.00 105.45 ? 137 LEU B CB  1 
ATOM 2450 C CG  . LEU B 1 95  ? 80.868  -23.834 10.503  1.00 105.45 ? 137 LEU B CG  1 
ATOM 2451 C CD1 . LEU B 1 95  ? 79.835  -23.182 9.620   1.00 105.45 ? 137 LEU B CD1 1 
ATOM 2452 C CD2 . LEU B 1 95  ? 82.296  -23.541 10.022  1.00 105.45 ? 137 LEU B CD2 1 
ATOM 2453 N N   . GLN B 1 96  ? 80.039  -25.191 14.676  1.00 105.45 ? 138 GLN B N   1 
ATOM 2454 C CA  . GLN B 1 96  ? 79.531  -25.219 16.042  1.00 105.45 ? 138 GLN B CA  1 
ATOM 2455 C C   . GLN B 1 96  ? 80.627  -25.668 16.985  1.00 105.45 ? 138 GLN B C   1 
ATOM 2456 O O   . GLN B 1 96  ? 80.820  -25.087 18.048  1.00 105.45 ? 138 GLN B O   1 
ATOM 2457 C CB  . GLN B 1 96  ? 78.344  -26.168 16.145  1.00 105.45 ? 138 GLN B CB  1 
ATOM 2458 C CG  . GLN B 1 96  ? 77.625  -26.137 17.476  1.00 105.45 ? 138 GLN B CG  1 
ATOM 2459 C CD  . GLN B 1 96  ? 76.382  -26.991 17.454  1.00 105.45 ? 138 GLN B CD  1 
ATOM 2460 O OE1 . GLN B 1 96  ? 76.200  -27.809 16.554  1.00 105.45 ? 138 GLN B OE1 1 
ATOM 2461 N NE2 . GLN B 1 96  ? 75.507  -26.792 18.428  1.00 105.45 ? 138 GLN B NE2 1 
ATOM 2462 N N   . GLU B 1 97  ? 81.382  -26.666 16.549  1.00 105.45 ? 139 GLU B N   1 
ATOM 2463 C CA  . GLU B 1 97  ? 82.448  -27.218 17.350  1.00 105.45 ? 139 GLU B CA  1 
ATOM 2464 C C   . GLU B 1 97  ? 83.861  -26.716 17.046  1.00 105.45 ? 139 GLU B C   1 
ATOM 2465 O O   . GLU B 1 97  ? 84.722  -26.774 17.921  1.00 105.45 ? 139 GLU B O   1 
ATOM 2466 C CB  . GLU B 1 97  ? 82.305  -28.744 17.396  1.00 105.45 ? 139 GLU B CB  1 
ATOM 2467 C CG  . GLU B 1 97  ? 80.930  -29.131 18.008  1.00 105.45 ? 139 GLU B CG  1 
ATOM 2468 C CD  . GLU B 1 97  ? 80.610  -30.619 18.009  1.00 105.45 ? 139 GLU B CD  1 
ATOM 2469 O OE1 . GLU B 1 97  ? 81.472  -31.437 17.622  1.00 105.45 ? 139 GLU B OE1 1 
ATOM 2470 O OE2 . GLU B 1 97  ? 79.476  -30.966 18.411  1.00 105.45 ? 139 GLU B OE2 1 
ATOM 2471 N N   . LYS B 1 98  ? 84.112  -26.199 15.844  1.00 105.45 ? 140 LYS B N   1 
ATOM 2472 C CA  . LYS B 1 98  ? 85.441  -25.647 15.559  1.00 105.45 ? 140 LYS B CA  1 
ATOM 2473 C C   . LYS B 1 98  ? 85.451  -24.234 16.115  1.00 105.45 ? 140 LYS B C   1 
ATOM 2474 O O   . LYS B 1 98  ? 86.490  -23.725 16.518  1.00 105.45 ? 140 LYS B O   1 
ATOM 2475 C CB  . LYS B 1 98  ? 85.736  -25.604 14.063  1.00 105.45 ? 140 LYS B CB  1 
ATOM 2476 C CG  . LYS B 1 98  ? 87.145  -25.153 13.681  1.00 105.45 ? 140 LYS B CG  1 
ATOM 2477 C CD  . LYS B 1 98  ? 87.327  -25.189 12.156  1.00 105.45 ? 140 LYS B CD  1 
ATOM 2478 C CE  . LYS B 1 98  ? 88.745  -24.795 11.719  1.00 105.45 ? 140 LYS B CE  1 
ATOM 2479 N NZ  . LYS B 1 98  ? 88.876  -24.670 10.228  1.00 105.45 ? 140 LYS B NZ  1 
ATOM 2480 N N   . LEU B 1 99  ? 84.282  -23.605 16.137  1.00 105.45 ? 141 LEU B N   1 
ATOM 2481 C CA  . LEU B 1 99  ? 84.162  -22.257 16.663  1.00 105.45 ? 141 LEU B CA  1 
ATOM 2482 C C   . LEU B 1 99  ? 84.019  -22.277 18.168  1.00 105.45 ? 141 LEU B C   1 
ATOM 2483 O O   . LEU B 1 99  ? 84.632  -21.470 18.852  1.00 105.45 ? 141 LEU B O   1 
ATOM 2484 C CB  . LEU B 1 99  ? 82.951  -21.550 16.081  1.00 105.45 ? 141 LEU B CB  1 
ATOM 2485 C CG  . LEU B 1 99  ? 82.331  -20.478 16.972  1.00 105.45 ? 141 LEU B CG  1 
ATOM 2486 C CD1 . LEU B 1 99  ? 83.202  -19.241 16.966  1.00 105.45 ? 141 LEU B CD1 1 
ATOM 2487 C CD2 . LEU B 1 99  ? 80.937  -20.176 16.492  1.00 105.45 ? 141 LEU B CD2 1 
ATOM 2488 N N   . SER B 1 100 ? 83.210  -23.202 18.678  1.00 105.45 ? 142 SER B N   1 
ATOM 2489 C CA  . SER B 1 100 ? 82.964  -23.314 20.112  1.00 105.45 ? 142 SER B CA  1 
ATOM 2490 C C   . SER B 1 100 ? 84.158  -22.966 21.019  1.00 105.45 ? 142 SER B C   1 
ATOM 2491 O O   . SER B 1 100 ? 84.005  -22.182 21.949  1.00 105.45 ? 142 SER B O   1 
ATOM 2492 C CB  . SER B 1 100 ? 82.426  -24.711 20.450  1.00 105.45 ? 142 SER B CB  1 
ATOM 2493 O OG  . SER B 1 100 ? 81.485  -24.669 21.511  1.00 105.45 ? 142 SER B OG  1 
ATOM 2494 N N   . PRO B 1 101 ? 85.370  -23.476 20.713  1.00 63.88  ? 143 PRO B N   1 
ATOM 2495 C CA  . PRO B 1 101 ? 86.600  -23.231 21.494  1.00 63.88  ? 143 PRO B CA  1 
ATOM 2496 C C   . PRO B 1 101 ? 87.095  -21.791 21.564  1.00 63.88  ? 143 PRO B C   1 
ATOM 2497 O O   . PRO B 1 101 ? 87.693  -21.355 22.550  1.00 63.88  ? 143 PRO B O   1 
ATOM 2498 C CB  . PRO B 1 101 ? 87.624  -24.110 20.779  1.00 63.88  ? 143 PRO B CB  1 
ATOM 2499 C CG  . PRO B 1 101 ? 87.132  -24.130 19.381  1.00 63.88  ? 143 PRO B CG  1 
ATOM 2500 C CD  . PRO B 1 101 ? 85.665  -24.370 19.583  1.00 63.88  ? 143 PRO B CD  1 
ATOM 2501 N N   . LEU B 1 102 ? 86.889  -21.071 20.481  1.00 63.88  ? 144 LEU B N   1 
ATOM 2502 C CA  . LEU B 1 102 ? 87.322  -19.701 20.414  1.00 63.88  ? 144 LEU B CA  1 
ATOM 2503 C C   . LEU B 1 102 ? 86.314  -18.818 21.140  1.00 63.88  ? 144 LEU B C   1 
ATOM 2504 O O   . LEU B 1 102 ? 86.679  -17.803 21.721  1.00 63.88  ? 144 LEU B O   1 
ATOM 2505 C CB  . LEU B 1 102 ? 87.534  -19.338 18.952  1.00 63.88  ? 144 LEU B CB  1 
ATOM 2506 C CG  . LEU B 1 102 ? 88.389  -20.438 18.284  1.00 63.88  ? 144 LEU B CG  1 
ATOM 2507 C CD1 . LEU B 1 102 ? 88.657  -20.077 16.830  1.00 63.88  ? 144 LEU B CD1 1 
ATOM 2508 C CD2 . LEU B 1 102 ? 89.713  -20.684 19.057  1.00 63.88  ? 144 LEU B CD2 1 
ATOM 2509 N N   . GLY B 1 103 ? 85.065  -19.271 21.205  1.00 63.88  ? 145 GLY B N   1 
ATOM 2510 C CA  . GLY B 1 103 ? 84.046  -18.514 21.913  1.00 63.88  ? 145 GLY B CA  1 
ATOM 2511 C C   . GLY B 1 103 ? 84.361  -18.446 23.405  1.00 63.88  ? 145 GLY B C   1 
ATOM 2512 O O   . GLY B 1 103 ? 83.812  -17.616 24.140  1.00 63.88  ? 145 GLY B O   1 
ATOM 2513 N N   . GLU B 1 104 ? 85.241  -19.334 23.858  1.00 63.88  ? 146 GLU B N   1 
ATOM 2514 C CA  . GLU B 1 104 ? 85.639  -19.369 25.259  1.00 63.88  ? 146 GLU B CA  1 
ATOM 2515 C C   . GLU B 1 104 ? 86.896  -18.527 25.367  1.00 63.88  ? 146 GLU B C   1 
ATOM 2516 O O   . GLU B 1 104 ? 87.096  -17.774 26.327  1.00 63.88  ? 146 GLU B O   1 
ATOM 2517 C CB  . GLU B 1 104 ? 85.921  -20.811 25.680  1.00 63.88  ? 146 GLU B CB  1 
ATOM 2518 C CG  . GLU B 1 104 ? 84.826  -21.799 25.273  1.00 63.88  ? 146 GLU B CG  1 
ATOM 2519 C CD  . GLU B 1 104 ? 83.510  -21.574 26.004  1.00 63.88  ? 146 GLU B CD  1 
ATOM 2520 O OE1 . GLU B 1 104 ? 83.524  -21.595 27.259  1.00 63.88  ? 146 GLU B OE1 1 
ATOM 2521 O OE2 . GLU B 1 104 ? 82.468  -21.399 25.324  1.00 63.88  ? 146 GLU B OE2 1 
ATOM 2522 N N   . GLU B 1 105 ? 87.711  -18.649 24.326  1.00 63.88  ? 147 GLU B N   1 
ATOM 2523 C CA  . GLU B 1 105 ? 88.962  -17.937 24.202  1.00 63.88  ? 147 GLU B CA  1 
ATOM 2524 C C   . GLU B 1 105 ? 88.731  -16.519 24.707  1.00 63.88  ? 147 GLU B C   1 
ATOM 2525 O O   . GLU B 1 105 ? 89.295  -16.105 25.708  1.00 63.88  ? 147 GLU B O   1 
ATOM 2526 C CB  . GLU B 1 105 ? 89.377  -17.959 22.731  1.00 63.88  ? 147 GLU B CB  1 
ATOM 2527 C CG  . GLU B 1 105 ? 90.845  -18.262 22.475  1.00 63.88  ? 147 GLU B CG  1 
ATOM 2528 C CD  . GLU B 1 105 ? 91.688  -17.000 22.380  1.00 63.88  ? 147 GLU B CD  1 
ATOM 2529 O OE1 . GLU B 1 105 ? 91.107  -15.896 22.491  1.00 63.88  ? 147 GLU B OE1 1 
ATOM 2530 O OE2 . GLU B 1 105 ? 92.924  -17.109 22.186  1.00 63.88  ? 147 GLU B OE2 1 
ATOM 2531 N N   . MET B 1 106 ? 87.784  -15.836 24.096  1.00 63.88  ? 148 MET B N   1 
ATOM 2532 C CA  . MET B 1 106 ? 87.475  -14.495 24.514  1.00 63.88  ? 148 MET B CA  1 
ATOM 2533 C C   . MET B 1 106 ? 86.679  -14.539 25.786  1.00 63.88  ? 148 MET B C   1 
ATOM 2534 O O   . MET B 1 106 ? 86.868  -13.687 26.642  1.00 63.88  ? 148 MET B O   1 
ATOM 2535 C CB  . MET B 1 106 ? 86.665  -13.814 23.450  1.00 63.88  ? 148 MET B CB  1 
ATOM 2536 C CG  . MET B 1 106 ? 87.301  -13.913 22.096  1.00 63.88  ? 148 MET B CG  1 
ATOM 2537 S SD  . MET B 1 106 ? 86.089  -13.417 20.863  1.00 63.88  ? 148 MET B SD  1 
ATOM 2538 C CE  . MET B 1 106 ? 86.320  -11.562 20.852  1.00 63.88  ? 148 MET B CE  1 
ATOM 2539 N N   . ARG B 1 107 ? 85.800  -15.536 25.913  1.00 63.88  ? 149 ARG B N   1 
ATOM 2540 C CA  . ARG B 1 107 ? 84.956  -15.674 27.099  1.00 63.88  ? 149 ARG B CA  1 
ATOM 2541 C C   . ARG B 1 107 ? 85.769  -15.372 28.326  1.00 63.88  ? 149 ARG B C   1 
ATOM 2542 O O   . ARG B 1 107 ? 85.289  -14.774 29.284  1.00 63.88  ? 149 ARG B O   1 
ATOM 2543 C CB  . ARG B 1 107 ? 84.380  -17.082 27.215  1.00 63.88  ? 149 ARG B CB  1 
ATOM 2544 C CG  . ARG B 1 107 ? 83.963  -17.480 28.630  1.00 63.88  ? 149 ARG B CG  1 
ATOM 2545 C CD  . ARG B 1 107 ? 83.211  -18.793 28.634  1.00 63.88  ? 149 ARG B CD  1 
ATOM 2546 N NE  . ARG B 1 107 ? 82.022  -18.710 27.781  1.00 63.88  ? 149 ARG B NE  1 
ATOM 2547 C CZ  . ARG B 1 107 ? 81.045  -19.617 27.752  1.00 63.88  ? 149 ARG B CZ  1 
ATOM 2548 N NH1 . ARG B 1 107 ? 81.109  -20.689 28.533  1.00 63.88  ? 149 ARG B NH1 1 
ATOM 2549 N NH2 . ARG B 1 107 ? 79.999  -19.459 26.941  1.00 63.88  ? 149 ARG B NH2 1 
ATOM 2550 N N   . ASP B 1 108 ? 87.029  -15.756 28.273  1.00 63.88  ? 150 ASP B N   1 
ATOM 2551 C CA  . ASP B 1 108 ? 87.885  -15.505 29.394  1.00 63.88  ? 150 ASP B CA  1 
ATOM 2552 C C   . ASP B 1 108 ? 88.795  -14.332 29.096  1.00 63.88  ? 150 ASP B C   1 
ATOM 2553 O O   . ASP B 1 108 ? 89.103  -13.545 29.989  1.00 63.88  ? 150 ASP B O   1 
ATOM 2554 C CB  . ASP B 1 108 ? 88.620  -16.785 29.740  1.00 63.88  ? 150 ASP B CB  1 
ATOM 2555 C CG  . ASP B 1 108 ? 87.657  -17.931 29.988  1.00 63.88  ? 150 ASP B CG  1 
ATOM 2556 O OD1 . ASP B 1 108 ? 87.148  -18.047 31.124  1.00 63.88  ? 150 ASP B OD1 1 
ATOM 2557 O OD2 . ASP B 1 108 ? 87.356  -18.679 29.031  1.00 63.88  ? 150 ASP B OD2 1 
ATOM 2558 N N   . ARG B 1 109 ? 89.127  -14.148 27.819  1.00 63.88  ? 151 ARG B N   1 
ATOM 2559 C CA  . ARG B 1 109 ? 89.995  -13.044 27.408  1.00 63.88  ? 151 ARG B CA  1 
ATOM 2560 C C   . ARG B 1 109 ? 89.444  -11.701 27.847  1.00 63.88  ? 151 ARG B C   1 
ATOM 2561 O O   . ARG B 1 109 ? 90.196  -10.773 28.136  1.00 63.88  ? 151 ARG B O   1 
ATOM 2562 C CB  . ARG B 1 109 ? 90.251  -13.055 25.896  1.00 63.88  ? 151 ARG B CB  1 
ATOM 2563 C CG  . ARG B 1 109 ? 91.457  -13.904 25.480  1.00 63.88  ? 151 ARG B CG  1 
ATOM 2564 C CD  . ARG B 1 109 ? 92.192  -13.310 24.274  1.00 63.88  ? 151 ARG B CD  1 
ATOM 2565 N NE  . ARG B 1 109 ? 93.463  -13.983 23.983  1.00 63.88  ? 151 ARG B NE  1 
ATOM 2566 C CZ  . ARG B 1 109 ? 94.372  -13.552 23.105  1.00 63.88  ? 151 ARG B CZ  1 
ATOM 2567 N NH1 . ARG B 1 109 ? 94.175  -12.433 22.410  1.00 63.88  ? 151 ARG B NH1 1 
ATOM 2568 N NH2 . ARG B 1 109 ? 95.482  -14.254 22.902  1.00 63.88  ? 151 ARG B NH2 1 
ATOM 2569 N N   . ALA B 1 110 ? 88.129  -11.626 27.972  1.00 63.88  ? 152 ALA B N   1 
ATOM 2570 C CA  . ALA B 1 110 ? 87.500  -10.398 28.399  1.00 63.88  ? 152 ALA B CA  1 
ATOM 2571 C C   . ALA B 1 110 ? 87.503  -10.349 29.918  1.00 63.88  ? 152 ALA B C   1 
ATOM 2572 O O   . ALA B 1 110 ? 87.907  -9.350  30.523  1.00 63.88  ? 152 ALA B O   1 
ATOM 2573 C CB  . ALA B 1 110 ? 86.102  -10.346 27.879  1.00 63.88  ? 152 ALA B CB  1 
ATOM 2574 N N   . ARG B 1 111 ? 87.115  -11.469 30.519  1.00 63.88  ? 153 ARG B N   1 
ATOM 2575 C CA  . ARG B 1 111 ? 87.029  -11.608 31.967  1.00 63.88  ? 153 ARG B CA  1 
ATOM 2576 C C   . ARG B 1 111 ? 88.159  -10.921 32.724  1.00 63.88  ? 153 ARG B C   1 
ATOM 2577 O O   . ARG B 1 111 ? 87.914  -10.205 33.692  1.00 63.88  ? 153 ARG B O   1 
ATOM 2578 C CB  . ARG B 1 111 ? 86.953  -13.090 32.332  1.00 63.88  ? 153 ARG B CB  1 
ATOM 2579 C CG  . ARG B 1 111 ? 86.634  -13.385 33.786  1.00 63.88  ? 153 ARG B CG  1 
ATOM 2580 C CD  . ARG B 1 111 ? 86.298  -14.857 33.950  1.00 63.88  ? 153 ARG B CD  1 
ATOM 2581 N NE  . ARG B 1 111 ? 86.253  -15.280 35.350  1.00 63.88  ? 153 ARG B NE  1 
ATOM 2582 C CZ  . ARG B 1 111 ? 86.219  -16.553 35.741  1.00 63.88  ? 153 ARG B CZ  1 
ATOM 2583 N NH1 . ARG B 1 111 ? 86.218  -17.529 34.836  1.00 63.88  ? 153 ARG B NH1 1 
ATOM 2584 N NH2 . ARG B 1 111 ? 86.215  -16.856 37.036  1.00 63.88  ? 153 ARG B NH2 1 
ATOM 2585 N N   . ALA B 1 112 ? 89.383  -11.084 32.239  1.00 63.88  ? 154 ALA B N   1 
ATOM 2586 C CA  . ALA B 1 112 ? 90.541  -10.475 32.874  1.00 63.88  ? 154 ALA B CA  1 
ATOM 2587 C C   . ALA B 1 112 ? 90.363  -8.970  32.995  1.00 63.88  ? 154 ALA B C   1 
ATOM 2588 O O   . ALA B 1 112 ? 90.271  -8.428  34.096  1.00 63.88  ? 154 ALA B O   1 
ATOM 2589 C CB  . ALA B 1 112 ? 91.786  -10.786 32.076  1.00 63.88  ? 154 ALA B CB  1 
ATOM 2590 N N   . HIS B 1 113 ? 90.306  -8.313  31.843  1.00 63.88  ? 155 HIS B N   1 
ATOM 2591 C CA  . HIS B 1 113 ? 90.140  -6.868  31.759  1.00 63.88  ? 155 HIS B CA  1 
ATOM 2592 C C   . HIS B 1 113 ? 89.134  -6.411  32.772  1.00 63.88  ? 155 HIS B C   1 
ATOM 2593 O O   . HIS B 1 113 ? 89.331  -5.432  33.482  1.00 63.88  ? 155 HIS B O   1 
ATOM 2594 C CB  . HIS B 1 113 ? 89.631  -6.504  30.384  1.00 63.88  ? 155 HIS B CB  1 
ATOM 2595 C CG  . HIS B 1 113 ? 90.514  -6.977  29.286  1.00 63.88  ? 155 HIS B CG  1 
ATOM 2596 N ND1 . HIS B 1 113 ? 91.338  -8.075  29.416  1.00 63.88  ? 155 HIS B ND1 1 
ATOM 2597 C CD2 . HIS B 1 113 ? 90.729  -6.487  28.044  1.00 63.88  ? 155 HIS B CD2 1 
ATOM 2598 C CE1 . HIS B 1 113 ? 92.027  -8.238  28.303  1.00 63.88  ? 155 HIS B CE1 1 
ATOM 2599 N NE2 . HIS B 1 113 ? 91.677  -7.288  27.455  1.00 63.88  ? 155 HIS B NE2 1 
ATOM 2600 N N   . VAL B 1 114 ? 88.046  -7.154  32.826  1.00 63.88  ? 156 VAL B N   1 
ATOM 2601 C CA  . VAL B 1 114 ? 86.986  -6.877  33.756  1.00 63.88  ? 156 VAL B CA  1 
ATOM 2602 C C   . VAL B 1 114 ? 87.525  -6.897  35.164  1.00 63.88  ? 156 VAL B C   1 
ATOM 2603 O O   . VAL B 1 114 ? 87.667  -5.850  35.781  1.00 63.88  ? 156 VAL B O   1 
ATOM 2604 C CB  . VAL B 1 114 ? 85.936  -7.942  33.661  1.00 63.88  ? 156 VAL B CB  1 
ATOM 2605 C CG1 . VAL B 1 114 ? 84.894  -7.749  34.739  1.00 63.88  ? 156 VAL B CG1 1 
ATOM 2606 C CG2 . VAL B 1 114 ? 85.340  -7.922  32.290  1.00 63.88  ? 156 VAL B CG2 1 
ATOM 2607 N N   . ASP B 1 115 ? 87.865  -8.093  35.645  1.00 63.88  ? 157 ASP B N   1 
ATOM 2608 C CA  . ASP B 1 115 ? 88.376  -8.266  36.994  1.00 63.88  ? 157 ASP B CA  1 
ATOM 2609 C C   . ASP B 1 115 ? 89.392  -7.204  37.296  1.00 63.88  ? 157 ASP B C   1 
ATOM 2610 O O   . ASP B 1 115 ? 89.542  -6.768  38.431  1.00 63.88  ? 157 ASP B O   1 
ATOM 2611 C CB  . ASP B 1 115 ? 88.963  -9.657  37.170  1.00 63.88  ? 157 ASP B CB  1 
ATOM 2612 C CG  . ASP B 1 115 ? 87.905  -10.736 37.086  1.00 63.88  ? 157 ASP B CG  1 
ATOM 2613 O OD1 . ASP B 1 115 ? 87.142  -10.910 38.062  1.00 63.88  ? 157 ASP B OD1 1 
ATOM 2614 O OD2 . ASP B 1 115 ? 87.820  -11.396 36.033  1.00 63.88  ? 157 ASP B OD2 1 
ATOM 2615 N N   . ALA B 1 116 ? 90.033  -6.732  36.242  1.00 63.88  ? 158 ALA B N   1 
ATOM 2616 C CA  . ALA B 1 116 ? 91.000  -5.681  36.378  1.00 63.88  ? 158 ALA B CA  1 
ATOM 2617 C C   . ALA B 1 116 ? 90.235  -4.424  36.770  1.00 63.88  ? 158 ALA B C   1 
ATOM 2618 O O   . ALA B 1 116 ? 90.273  -3.989  37.922  1.00 63.88  ? 158 ALA B O   1 
ATOM 2619 C CB  . ALA B 1 116 ? 91.717  -5.475  35.065  1.00 63.88  ? 158 ALA B CB  1 
ATOM 2620 N N   . LEU B 1 117 ? 89.467  -3.900  35.827  1.00 63.88  ? 159 LEU B N   1 
ATOM 2621 C CA  . LEU B 1 117 ? 88.709  -2.693  36.065  1.00 63.88  ? 159 LEU B CA  1 
ATOM 2622 C C   . LEU B 1 117 ? 87.846  -2.783  37.302  1.00 63.88  ? 159 LEU B C   1 
ATOM 2623 O O   . LEU B 1 117 ? 87.622  -1.784  37.972  1.00 63.88  ? 159 LEU B O   1 
ATOM 2624 C CB  . LEU B 1 117 ? 87.864  -2.369  34.853  1.00 63.88  ? 159 LEU B CB  1 
ATOM 2625 C CG  . LEU B 1 117 ? 87.074  -1.074  34.973  1.00 63.88  ? 159 LEU B CG  1 
ATOM 2626 C CD1 . LEU B 1 117 ? 87.426  -0.128  33.833  1.00 63.88  ? 159 LEU B CD1 1 
ATOM 2627 C CD2 . LEU B 1 117 ? 85.596  -1.387  34.968  1.00 63.88  ? 159 LEU B CD2 1 
ATOM 2628 N N   . ARG B 1 118 ? 87.416  -3.996  37.624  1.00 63.88  ? 160 ARG B N   1 
ATOM 2629 C CA  . ARG B 1 118 ? 86.579  -4.230  38.788  1.00 63.88  ? 160 ARG B CA  1 
ATOM 2630 C C   . ARG B 1 118 ? 87.292  -3.589  39.941  1.00 63.88  ? 160 ARG B C   1 
ATOM 2631 O O   . ARG B 1 118 ? 86.750  -2.741  40.647  1.00 63.88  ? 160 ARG B O   1 
ATOM 2632 C CB  . ARG B 1 118 ? 86.466  -5.723  39.090  1.00 63.88  ? 160 ARG B CB  1 
ATOM 2633 C CG  . ARG B 1 118 ? 85.698  -6.024  40.387  1.00 63.88  ? 160 ARG B CG  1 
ATOM 2634 C CD  . ARG B 1 118 ? 86.414  -7.044  41.277  1.00 63.88  ? 160 ARG B CD  1 
ATOM 2635 N NE  . ARG B 1 118 ? 85.629  -7.382  42.469  1.00 63.88  ? 160 ARG B NE  1 
ATOM 2636 C CZ  . ARG B 1 118 ? 84.977  -8.533  42.648  1.00 63.88  ? 160 ARG B CZ  1 
ATOM 2637 N NH1 . ARG B 1 118 ? 85.006  -9.486  41.717  1.00 63.88  ? 160 ARG B NH1 1 
ATOM 2638 N NH2 . ARG B 1 118 ? 84.283  -8.733  43.763  1.00 63.88  ? 160 ARG B NH2 1 
ATOM 2639 N N   . THR B 1 119 ? 88.527  -4.026  40.115  1.00 63.88  ? 161 THR B N   1 
ATOM 2640 C CA  . THR B 1 119 ? 89.370  -3.519  41.159  1.00 63.88  ? 161 THR B CA  1 
ATOM 2641 C C   . THR B 1 119 ? 89.554  -2.045  40.887  1.00 63.88  ? 161 THR B C   1 
ATOM 2642 O O   . THR B 1 119 ? 89.407  -1.218  41.777  1.00 63.88  ? 161 THR B O   1 
ATOM 2643 C CB  . THR B 1 119 ? 90.725  -4.189  41.107  1.00 63.88  ? 161 THR B CB  1 
ATOM 2644 O OG1 . THR B 1 119 ? 90.585  -5.492  40.530  1.00 63.88  ? 161 THR B OG1 1 
ATOM 2645 C CG2 . THR B 1 119 ? 91.283  -4.324  42.501  1.00 63.88  ? 161 THR B CG2 1 
ATOM 2646 N N   . HIS B 1 120 ? 89.768  -1.715  39.623  1.00 63.88  ? 162 HIS B N   1 
ATOM 2647 C CA  . HIS B 1 120 ? 89.985  -0.340  39.245  1.00 63.88  ? 162 HIS B CA  1 
ATOM 2648 C C   . HIS B 1 120 ? 88.897  0.636   39.613  1.00 63.88  ? 162 HIS B C   1 
ATOM 2649 O O   . HIS B 1 120 ? 89.162  1.822   39.765  1.00 63.88  ? 162 HIS B O   1 
ATOM 2650 C CB  . HIS B 1 120 ? 90.244  -0.239  37.764  1.00 63.88  ? 162 HIS B CB  1 
ATOM 2651 C CG  . HIS B 1 120 ? 91.582  0.331   37.438  1.00 63.88  ? 162 HIS B CG  1 
ATOM 2652 N ND1 . HIS B 1 120 ? 92.573  -0.399  36.817  1.00 63.88  ? 162 HIS B ND1 1 
ATOM 2653 C CD2 . HIS B 1 120 ? 92.107  1.562   37.661  1.00 63.88  ? 162 HIS B CD2 1 
ATOM 2654 C CE1 . HIS B 1 120 ? 93.650  0.351   36.671  1.00 63.88  ? 162 HIS B CE1 1 
ATOM 2655 N NE2 . HIS B 1 120 ? 93.395  1.544   37.173  1.00 63.88  ? 162 HIS B NE2 1 
ATOM 2656 N N   . LEU B 1 121 ? 87.675  0.151   39.773  1.00 63.88  ? 163 LEU B N   1 
ATOM 2657 C CA  . LEU B 1 121 ? 86.582  1.058   40.087  1.00 63.88  ? 163 LEU B CA  1 
ATOM 2658 C C   . LEU B 1 121 ? 86.101  0.974   41.485  1.00 63.88  ? 163 LEU B C   1 
ATOM 2659 O O   . LEU B 1 121 ? 85.651  1.964   42.047  1.00 63.88  ? 163 LEU B O   1 
ATOM 2660 C CB  . LEU B 1 121 ? 85.406  0.794   39.187  1.00 63.88  ? 163 LEU B CB  1 
ATOM 2661 C CG  . LEU B 1 121 ? 85.824  0.888   37.736  1.00 63.88  ? 163 LEU B CG  1 
ATOM 2662 C CD1 . LEU B 1 121 ? 84.588  1.110   36.908  1.00 63.88  ? 163 LEU B CD1 1 
ATOM 2663 C CD2 . LEU B 1 121 ? 86.801  2.030   37.553  1.00 63.88  ? 163 LEU B CD2 1 
ATOM 2664 N N   . ALA B 1 122 ? 86.206  -0.222  42.040  1.00 63.88  ? 164 ALA B N   1 
ATOM 2665 C CA  . ALA B 1 122 ? 85.779  -0.507  43.400  1.00 63.88  ? 164 ALA B CA  1 
ATOM 2666 C C   . ALA B 1 122 ? 85.859  0.684   44.354  1.00 63.88  ? 164 ALA B C   1 
ATOM 2667 O O   . ALA B 1 122 ? 84.891  1.003   45.040  1.00 63.88  ? 164 ALA B O   1 
ATOM 2668 C CB  . ALA B 1 122 ? 86.569  -1.682  43.955  1.00 63.88  ? 164 ALA B CB  1 
ATOM 2669 N N   . PRO B 1 123 ? 87.005  1.373   44.386  1.00 110.37 ? 165 PRO B N   1 
ATOM 2670 C CA  . PRO B 1 123 ? 87.139  2.522   45.277  1.00 110.37 ? 165 PRO B CA  1 
ATOM 2671 C C   . PRO B 1 123 ? 86.014  3.524   45.125  1.00 110.37 ? 165 PRO B C   1 
ATOM 2672 O O   . PRO B 1 123 ? 85.351  3.900   46.081  1.00 110.37 ? 165 PRO B O   1 
ATOM 2673 C CB  . PRO B 1 123 ? 88.465  3.135   44.830  1.00 110.37 ? 165 PRO B CB  1 
ATOM 2674 C CG  . PRO B 1 123 ? 88.652  2.606   43.416  1.00 110.37 ? 165 PRO B CG  1 
ATOM 2675 C CD  . PRO B 1 123 ? 88.231  1.203   43.591  1.00 110.37 ? 165 PRO B CD  1 
ATOM 2676 N N   . TYR B 1 124 ? 85.812  3.944   43.896  1.00 110.37 ? 166 TYR B N   1 
ATOM 2677 C CA  . TYR B 1 124 ? 84.798  4.913   43.573  1.00 110.37 ? 166 TYR B CA  1 
ATOM 2678 C C   . TYR B 1 124 ? 83.466  4.230   43.723  1.00 110.37 ? 166 TYR B C   1 
ATOM 2679 O O   . TYR B 1 124 ? 82.569  4.716   44.405  1.00 110.37 ? 166 TYR B O   1 
ATOM 2680 C CB  . TYR B 1 124 ? 85.058  5.370   42.152  1.00 110.37 ? 166 TYR B CB  1 
ATOM 2681 C CG  . TYR B 1 124 ? 86.540  5.592   41.920  1.00 110.37 ? 166 TYR B CG  1 
ATOM 2682 C CD1 . TYR B 1 124 ? 87.211  6.635   42.558  1.00 110.37 ? 166 TYR B CD1 1 
ATOM 2683 C CD2 . TYR B 1 124 ? 87.278  4.742   41.096  1.00 110.37 ? 166 TYR B CD2 1 
ATOM 2684 C CE1 . TYR B 1 124 ? 88.578  6.831   42.384  1.00 110.37 ? 166 TYR B CE1 1 
ATOM 2685 C CE2 . TYR B 1 124 ? 88.651  4.928   40.912  1.00 110.37 ? 166 TYR B CE2 1 
ATOM 2686 C CZ  . TYR B 1 124 ? 89.295  5.979   41.562  1.00 110.37 ? 166 TYR B CZ  1 
ATOM 2687 O OH  . TYR B 1 124 ? 90.649  6.192   41.390  1.00 110.37 ? 166 TYR B OH  1 
ATOM 2688 N N   . SER B 1 125 ? 83.397  3.042   43.149  1.00 110.37 ? 167 SER B N   1 
ATOM 2689 C CA  . SER B 1 125 ? 82.219  2.217   43.208  1.00 110.37 ? 167 SER B CA  1 
ATOM 2690 C C   . SER B 1 125 ? 81.706  2.163   44.641  1.00 110.37 ? 167 SER B C   1 
ATOM 2691 O O   . SER B 1 125 ? 80.510  2.127   44.874  1.00 110.37 ? 167 SER B O   1 
ATOM 2692 C CB  . SER B 1 125 ? 82.579  0.828   42.700  1.00 110.37 ? 167 SER B CB  1 
ATOM 2693 O OG  . SER B 1 125 ? 81.726  -0.148  43.249  1.00 110.37 ? 167 SER B OG  1 
ATOM 2694 N N   . ASP B 1 126 ? 82.613  2.272   45.600  1.00 110.37 ? 168 ASP B N   1 
ATOM 2695 C CA  . ASP B 1 126 ? 82.214  2.232   46.988  1.00 110.37 ? 168 ASP B CA  1 
ATOM 2696 C C   . ASP B 1 126 ? 82.133  3.612   47.611  1.00 110.37 ? 168 ASP B C   1 
ATOM 2697 O O   . ASP B 1 126 ? 81.287  3.853   48.470  1.00 110.37 ? 168 ASP B O   1 
ATOM 2698 C CB  . ASP B 1 126 ? 83.144  1.322   47.783  1.00 110.37 ? 168 ASP B CB  1 
ATOM 2699 C CG  . ASP B 1 126 ? 82.383  0.302   48.606  1.00 110.37 ? 168 ASP B CG  1 
ATOM 2700 O OD1 . ASP B 1 126 ? 82.019  0.628   49.756  1.00 110.37 ? 168 ASP B OD1 1 
ATOM 2701 O OD2 . ASP B 1 126 ? 82.136  -0.816  48.099  1.00 110.37 ? 168 ASP B OD2 1 
ATOM 2702 N N   . GLU B 1 127 ? 82.966  4.533   47.136  1.00 110.37 ? 169 GLU B N   1 
ATOM 2703 C CA  . GLU B 1 127 ? 82.971  5.888   47.673  1.00 110.37 ? 169 GLU B CA  1 
ATOM 2704 C C   . GLU B 1 127 ? 81.548  6.399   47.618  1.00 110.37 ? 169 GLU B C   1 
ATOM 2705 O O   . GLU B 1 127 ? 81.075  7.086   48.515  1.00 110.37 ? 169 GLU B O   1 
ATOM 2706 C CB  . GLU B 1 127 ? 83.870  6.806   46.849  1.00 110.37 ? 169 GLU B CB  1 
ATOM 2707 C CG  . GLU B 1 127 ? 83.919  8.225   47.408  1.00 110.37 ? 169 GLU B CG  1 
ATOM 2708 C CD  . GLU B 1 127 ? 84.646  9.202   46.507  1.00 110.37 ? 169 GLU B CD  1 
ATOM 2709 O OE1 . GLU B 1 127 ? 85.852  8.995   46.251  1.00 110.37 ? 169 GLU B OE1 1 
ATOM 2710 O OE2 . GLU B 1 127 ? 84.014  10.192  46.074  1.00 110.37 ? 169 GLU B OE2 1 
ATOM 2711 N N   . LEU B 1 128 ? 80.853  5.993   46.572  1.00 110.37 ? 170 LEU B N   1 
ATOM 2712 C CA  . LEU B 1 128 ? 79.484  6.393   46.389  1.00 110.37 ? 170 LEU B CA  1 
ATOM 2713 C C   . LEU B 1 128 ? 78.581  5.547   47.240  1.00 110.37 ? 170 LEU B C   1 
ATOM 2714 O O   . LEU B 1 128 ? 77.758  6.077   47.975  1.00 110.37 ? 170 LEU B O   1 
ATOM 2715 C CB  . LEU B 1 128 ? 79.113  6.288   44.921  1.00 110.37 ? 170 LEU B CB  1 
ATOM 2716 C CG  . LEU B 1 128 ? 79.577  7.477   44.072  1.00 110.37 ? 170 LEU B CG  1 
ATOM 2717 C CD1 . LEU B 1 128 ? 80.860  8.100   44.625  1.00 110.37 ? 170 LEU B CD1 1 
ATOM 2718 C CD2 . LEU B 1 128 ? 79.750  7.029   42.630  1.00 110.37 ? 170 LEU B CD2 1 
ATOM 2719 N N   . ARG B 1 129 ? 78.778  4.235   47.179  1.00 110.37 ? 171 ARG B N   1 
ATOM 2720 C CA  . ARG B 1 129 ? 77.967  3.304   47.951  1.00 110.37 ? 171 ARG B CA  1 
ATOM 2721 C C   . ARG B 1 129 ? 77.763  3.813   49.366  1.00 110.37 ? 171 ARG B C   1 
ATOM 2722 O O   . ARG B 1 129 ? 76.668  4.238   49.720  1.00 110.37 ? 171 ARG B O   1 
ATOM 2723 C CB  . ARG B 1 129 ? 78.609  1.908   47.981  1.00 110.37 ? 171 ARG B CB  1 
ATOM 2724 C CG  . ARG B 1 129 ? 78.364  1.057   46.727  1.00 110.37 ? 171 ARG B CG  1 
ATOM 2725 C CD  . ARG B 1 129 ? 76.869  0.801   46.507  1.00 110.37 ? 171 ARG B CD  1 
ATOM 2726 N NE  . ARG B 1 129 ? 76.555  0.022   45.303  1.00 110.37 ? 171 ARG B NE  1 
ATOM 2727 C CZ  . ARG B 1 129 ? 75.584  0.330   44.437  1.00 110.37 ? 171 ARG B CZ  1 
ATOM 2728 N NH1 . ARG B 1 129 ? 74.827  1.404   44.617  1.00 110.37 ? 171 ARG B NH1 1 
ATOM 2729 N NH2 . ARG B 1 129 ? 75.282  -0.501  43.452  1.00 110.37 ? 171 ARG B NH2 1 
ATOM 2730 N N   . GLN B 1 130 ? 78.840  3.868   50.138  1.00 110.37 ? 172 GLN B N   1 
ATOM 2731 C CA  . GLN B 1 130 ? 78.746  4.333   51.513  1.00 110.37 ? 172 GLN B CA  1 
ATOM 2732 C C   . GLN B 1 130 ? 78.339  5.816   51.596  1.00 110.37 ? 172 GLN B C   1 
ATOM 2733 O O   . GLN B 1 130 ? 77.706  6.230   52.571  1.00 110.37 ? 172 GLN B O   1 
ATOM 2734 C CB  . GLN B 1 130 ? 80.063  4.064   52.259  1.00 110.37 ? 172 GLN B CB  1 
ATOM 2735 C CG  . GLN B 1 130 ? 80.603  2.602   52.159  1.00 110.37 ? 172 GLN B CG  1 
ATOM 2736 C CD  . GLN B 1 130 ? 80.036  1.622   53.206  1.00 110.37 ? 172 GLN B CD  1 
ATOM 2737 O OE1 . GLN B 1 130 ? 80.156  1.837   54.416  1.00 110.37 ? 172 GLN B OE1 1 
ATOM 2738 N NE2 . GLN B 1 130 ? 79.467  0.516   52.733  1.00 110.37 ? 172 GLN B NE2 1 
ATOM 2739 N N   . ARG B 1 131 ? 78.626  6.589   50.547  1.00 110.37 ? 173 ARG B N   1 
ATOM 2740 C CA  . ARG B 1 131 ? 78.281  8.012   50.544  1.00 110.37 ? 173 ARG B CA  1 
ATOM 2741 C C   . ARG B 1 131 ? 76.776  8.252   50.611  1.00 110.37 ? 173 ARG B C   1 
ATOM 2742 O O   . ARG B 1 131 ? 76.295  8.852   51.567  1.00 110.37 ? 173 ARG B O   1 
ATOM 2743 C CB  . ARG B 1 131 ? 78.891  8.757   49.340  1.00 110.37 ? 173 ARG B CB  1 
ATOM 2744 C CG  . ARG B 1 131 ? 78.591  10.270  49.333  1.00 110.37 ? 173 ARG B CG  1 
ATOM 2745 C CD  . ARG B 1 131 ? 79.740  11.151  48.787  1.00 110.37 ? 173 ARG B CD  1 
ATOM 2746 N NE  . ARG B 1 131 ? 79.486  12.582  49.022  1.00 110.37 ? 173 ARG B NE  1 
ATOM 2747 C CZ  . ARG B 1 131 ? 80.415  13.541  49.027  1.00 110.37 ? 173 ARG B CZ  1 
ATOM 2748 N NH1 . ARG B 1 131 ? 81.692  13.249  48.806  1.00 110.37 ? 173 ARG B NH1 1 
ATOM 2749 N NH2 . ARG B 1 131 ? 80.064  14.802  49.262  1.00 110.37 ? 173 ARG B NH2 1 
ATOM 2750 N N   . LEU B 1 132 ? 76.024  7.775   49.626  1.00 110.37 ? 174 LEU B N   1 
ATOM 2751 C CA  . LEU B 1 132 ? 74.584  7.981   49.661  1.00 110.37 ? 174 LEU B CA  1 
ATOM 2752 C C   . LEU B 1 132 ? 73.967  7.240   50.830  1.00 110.37 ? 174 LEU B C   1 
ATOM 2753 O O   . LEU B 1 132 ? 72.896  7.606   51.293  1.00 110.37 ? 174 LEU B O   1 
ATOM 2754 C CB  . LEU B 1 132 ? 73.914  7.541   48.353  1.00 110.37 ? 174 LEU B CB  1 
ATOM 2755 C CG  . LEU B 1 132 ? 73.459  6.092   48.137  1.00 110.37 ? 174 LEU B CG  1 
ATOM 2756 C CD1 . LEU B 1 132 ? 72.121  5.828   48.820  1.00 110.37 ? 174 LEU B CD1 1 
ATOM 2757 C CD2 . LEU B 1 132 ? 73.297  5.861   46.654  1.00 110.37 ? 174 LEU B CD2 1 
ATOM 2758 N N   . ALA B 1 133 ? 74.640  6.190   51.288  1.00 110.37 ? 175 ALA B N   1 
ATOM 2759 C CA  . ALA B 1 133 ? 74.159  5.380   52.403  1.00 110.37 ? 175 ALA B CA  1 
ATOM 2760 C C   . ALA B 1 133 ? 73.889  6.251   53.604  1.00 110.37 ? 175 ALA B C   1 
ATOM 2761 O O   . ALA B 1 133 ? 72.764  6.334   54.092  1.00 110.37 ? 175 ALA B O   1 
ATOM 2762 C CB  . ALA B 1 133 ? 75.191  4.340   52.761  1.00 110.37 ? 175 ALA B CB  1 
ATOM 2763 N N   . ALA B 1 134 ? 74.948  6.885   54.087  1.00 110.37 ? 176 ALA B N   1 
ATOM 2764 C CA  . ALA B 1 134 ? 74.829  7.769   55.224  1.00 110.37 ? 176 ALA B CA  1 
ATOM 2765 C C   . ALA B 1 134 ? 73.981  8.973   54.809  1.00 110.37 ? 176 ALA B C   1 
ATOM 2766 O O   . ALA B 1 134 ? 73.232  9.499   55.625  1.00 110.37 ? 176 ALA B O   1 
ATOM 2767 C CB  . ALA B 1 134 ? 76.203  8.207   55.705  1.00 110.37 ? 176 ALA B CB  1 
ATOM 2768 N N   . ARG B 1 135 ? 74.063  9.373   53.535  1.00 110.37 ? 177 ARG B N   1 
ATOM 2769 C CA  . ARG B 1 135 ? 73.289  10.515  53.020  1.00 110.37 ? 177 ARG B CA  1 
ATOM 2770 C C   . ARG B 1 135 ? 71.801  10.177  53.005  1.00 110.37 ? 177 ARG B C   1 
ATOM 2771 O O   . ARG B 1 135 ? 70.939  11.058  53.040  1.00 110.37 ? 177 ARG B O   1 
ATOM 2772 C CB  . ARG B 1 135 ? 73.753  10.914  51.607  1.00 110.37 ? 177 ARG B CB  1 
ATOM 2773 C CG  . ARG B 1 135 ? 72.988  12.111  51.015  1.00 110.37 ? 177 ARG B CG  1 
ATOM 2774 C CD  . ARG B 1 135 ? 73.661  12.752  49.783  1.00 110.37 ? 177 ARG B CD  1 
ATOM 2775 N NE  . ARG B 1 135 ? 74.795  13.624  50.114  1.00 110.37 ? 177 ARG B NE  1 
ATOM 2776 C CZ  . ARG B 1 135 ? 75.283  14.578  49.317  1.00 110.37 ? 177 ARG B CZ  1 
ATOM 2777 N NH1 . ARG B 1 135 ? 74.740  14.803  48.125  1.00 110.37 ? 177 ARG B NH1 1 
ATOM 2778 N NH2 . ARG B 1 135 ? 76.330  15.301  49.705  1.00 110.37 ? 177 ARG B NH2 1 
ATOM 2779 N N   . LEU B 1 136 ? 71.514  8.883   53.000  1.00 110.37 ? 178 LEU B N   1 
ATOM 2780 C CA  . LEU B 1 136 ? 70.148  8.394   52.993  1.00 110.37 ? 178 LEU B CA  1 
ATOM 2781 C C   . LEU B 1 136 ? 69.619  8.463   54.414  1.00 110.37 ? 178 LEU B C   1 
ATOM 2782 O O   . LEU B 1 136 ? 68.457  8.801   54.648  1.00 110.37 ? 178 LEU B O   1 
ATOM 2783 C CB  . LEU B 1 136 ? 70.131  6.948   52.521  1.00 110.37 ? 178 LEU B CB  1 
ATOM 2784 C CG  . LEU B 1 136 ? 69.140  6.619   51.417  1.00 110.37 ? 178 LEU B CG  1 
ATOM 2785 C CD1 . LEU B 1 136 ? 69.404  7.499   50.191  1.00 110.37 ? 178 LEU B CD1 1 
ATOM 2786 C CD2 . LEU B 1 136 ? 69.261  5.143   51.089  1.00 110.37 ? 178 LEU B CD2 1 
ATOM 2787 N N   . GLU B 1 137 ? 70.490  8.127   55.360  1.00 110.37 ? 179 GLU B N   1 
ATOM 2788 C CA  . GLU B 1 137 ? 70.136  8.146   56.768  1.00 110.37 ? 179 GLU B CA  1 
ATOM 2789 C C   . GLU B 1 137 ? 69.652  9.513   57.192  1.00 110.37 ? 179 GLU B C   1 
ATOM 2790 O O   . GLU B 1 137 ? 68.768  9.617   58.033  1.00 110.37 ? 179 GLU B O   1 
ATOM 2791 C CB  . GLU B 1 137 ? 71.325  7.734   57.639  1.00 110.37 ? 179 GLU B CB  1 
ATOM 2792 C CG  . GLU B 1 137 ? 71.625  6.240   57.627  1.00 110.37 ? 179 GLU B CG  1 
ATOM 2793 C CD  . GLU B 1 137 ? 70.594  5.404   58.386  1.00 110.37 ? 179 GLU B CD  1 
ATOM 2794 O OE1 . GLU B 1 137 ? 69.398  5.789   58.441  1.00 110.37 ? 179 GLU B OE1 1 
ATOM 2795 O OE2 . GLU B 1 137 ? 70.991  4.349   58.932  1.00 110.37 ? 179 GLU B OE2 1 
ATOM 2796 N N   . ALA B 1 138 ? 70.233  10.553  56.599  1.00 110.37 ? 180 ALA B N   1 
ATOM 2797 C CA  . ALA B 1 138 ? 69.861  11.931  56.907  1.00 110.37 ? 180 ALA B CA  1 
ATOM 2798 C C   . ALA B 1 138 ? 68.407  12.178  56.563  1.00 110.37 ? 180 ALA B C   1 
ATOM 2799 O O   . ALA B 1 138 ? 67.683  12.795  57.333  1.00 110.37 ? 180 ALA B O   1 
ATOM 2800 C CB  . ALA B 1 138 ? 70.749  12.903  56.150  1.00 110.37 ? 180 ALA B CB  1 
ATOM 2801 N N   . LEU B 1 139 ? 67.984  11.670  55.411  1.00 110.37 ? 181 LEU B N   1 
ATOM 2802 C CA  . LEU B 1 139 ? 66.608  11.830  54.970  1.00 110.37 ? 181 LEU B CA  1 
ATOM 2803 C C   . LEU B 1 139 ? 65.675  11.231  56.007  1.00 110.37 ? 181 LEU B C   1 
ATOM 2804 O O   . LEU B 1 139 ? 64.769  11.896  56.499  1.00 110.37 ? 181 LEU B O   1 
ATOM 2805 C CB  . LEU B 1 139 ? 66.397  11.112  53.645  1.00 110.37 ? 181 LEU B CB  1 
ATOM 2806 C CG  . LEU B 1 139 ? 65.043  11.407  53.003  1.00 110.37 ? 181 LEU B CG  1 
ATOM 2807 C CD1 . LEU B 1 139 ? 65.081  12.812  52.403  1.00 110.37 ? 181 LEU B CD1 1 
ATOM 2808 C CD2 . LEU B 1 139 ? 64.715  10.363  51.944  1.00 110.37 ? 181 LEU B CD2 1 
ATOM 2809 N N   . LYS B 1 140 ? 65.902  9.960   56.315  1.00 110.37 ? 182 LYS B N   1 
ATOM 2810 C CA  . LYS B 1 140 ? 65.100  9.250   57.293  1.00 110.37 ? 182 LYS B CA  1 
ATOM 2811 C C   . LYS B 1 140 ? 65.110  10.027  58.607  1.00 110.37 ? 182 LYS B C   1 
ATOM 2812 O O   . LYS B 1 140 ? 64.065  10.430  59.120  1.00 110.37 ? 182 LYS B O   1 
ATOM 2813 C CB  . LYS B 1 140 ? 65.676  7.846   57.487  1.00 110.37 ? 182 LYS B CB  1 
ATOM 2814 C CG  . LYS B 1 140 ? 64.924  7.019   58.500  1.00 110.37 ? 182 LYS B CG  1 
ATOM 2815 C CD  . LYS B 1 140 ? 65.500  5.624   58.660  1.00 110.37 ? 182 LYS B CD  1 
ATOM 2816 C CE  . LYS B 1 140 ? 64.701  4.858   59.710  1.00 110.37 ? 182 LYS B CE  1 
ATOM 2817 N NZ  . LYS B 1 140 ? 65.129  3.444   59.883  1.00 110.37 ? 182 LYS B NZ  1 
ATOM 2818 N N   . GLU B 1 141 ? 66.321  10.318  59.068  1.00 110.37 ? 183 GLU B N   1 
ATOM 2819 C CA  . GLU B 1 141 ? 66.590  11.048  60.305  1.00 110.37 ? 183 GLU B CA  1 
ATOM 2820 C C   . GLU B 1 141 ? 65.862  12.398  60.398  1.00 110.37 ? 183 GLU B C   1 
ATOM 2821 O O   . GLU B 1 141 ? 64.973  12.571  61.237  1.00 110.37 ? 183 GLU B O   1 
ATOM 2822 C CB  . GLU B 1 141 ? 68.103  11.248  60.424  1.00 110.37 ? 183 GLU B CB  1 
ATOM 2823 C CG  . GLU B 1 141 ? 68.611  11.756  61.759  1.00 110.37 ? 183 GLU B CG  1 
ATOM 2824 C CD  . GLU B 1 141 ? 70.132  11.852  61.790  1.00 110.37 ? 183 GLU B CD  1 
ATOM 2825 O OE1 . GLU B 1 141 ? 70.797  10.789  61.756  1.00 110.37 ? 183 GLU B OE1 1 
ATOM 2826 O OE2 . GLU B 1 141 ? 70.658  12.990  61.837  1.00 110.37 ? 183 GLU B OE2 1 
ATOM 2827 N N   . ASN B 1 142 ? 66.248  13.353  59.553  1.00 110.37 ? 184 ASN B N   1 
ATOM 2828 C CA  . ASN B 1 142 ? 65.621  14.674  59.555  1.00 110.37 ? 184 ASN B CA  1 
ATOM 2829 C C   . ASN B 1 142 ? 64.171  14.620  59.061  1.00 110.37 ? 184 ASN B C   1 
ATOM 2830 O O   . ASN B 1 142 ? 63.388  15.549  59.284  1.00 110.37 ? 184 ASN B O   1 
ATOM 2831 C CB  . ASN B 1 142 ? 66.425  15.654  58.695  1.00 110.37 ? 184 ASN B CB  1 
ATOM 2832 C CG  . ASN B 1 142 ? 66.110  15.533  57.212  1.00 110.37 ? 184 ASN B CG  1 
ATOM 2833 O OD1 . ASN B 1 142 ? 65.030  15.921  56.758  1.00 110.37 ? 184 ASN B OD1 1 
ATOM 2834 N ND2 . ASN B 1 142 ? 67.061  15.018  56.446  1.00 110.37 ? 184 ASN B ND2 1 
ATOM 2835 N N   . GLY B 1 143 ? 63.839  13.550  58.343  1.00 110.37 ? 185 GLY B N   1 
ATOM 2836 C CA  . GLY B 1 143 ? 62.492  13.387  57.832  1.00 110.37 ? 185 GLY B CA  1 
ATOM 2837 C C   . GLY B 1 143 ? 61.513  13.341  58.981  1.00 110.37 ? 185 GLY B C   1 
ATOM 2838 O O   . GLY B 1 143 ? 60.670  14.230  59.125  1.00 110.37 ? 185 GLY B O   1 
ATOM 2839 N N   . GLY B 1 144 ? 61.677  12.336  59.839  1.00 110.37 ? 186 GLY B N   1 
ATOM 2840 C CA  . GLY B 1 144 ? 60.808  12.174  60.993  1.00 110.37 ? 186 GLY B CA  1 
ATOM 2841 C C   . GLY B 1 144 ? 60.617  13.454  61.783  1.00 110.37 ? 186 GLY B C   1 
ATOM 2842 O O   . GLY B 1 144 ? 59.582  13.657  62.418  1.00 110.37 ? 186 GLY B O   1 
ATOM 2843 N N   . ALA B 1 145 ? 61.613  14.329  61.718  1.00 145.39 ? 187 ALA B N   1 
ATOM 2844 C CA  . ALA B 1 145 ? 61.561  15.603  62.418  1.00 145.39 ? 187 ALA B CA  1 
ATOM 2845 C C   . ALA B 1 145 ? 60.382  16.429  61.931  1.00 145.39 ? 187 ALA B C   1 
ATOM 2846 O O   . ALA B 1 145 ? 59.526  16.826  62.719  1.00 145.39 ? 187 ALA B O   1 
ATOM 2847 C CB  . ALA B 1 145 ? 62.849  16.361  62.207  1.00 145.39 ? 187 ALA B CB  1 
ATOM 2848 N N   . ARG B 1 146 ? 60.333  16.671  60.625  1.00 145.39 ? 188 ARG B N   1 
ATOM 2849 C CA  . ARG B 1 146 ? 59.256  17.454  60.036  1.00 145.39 ? 188 ARG B CA  1 
ATOM 2850 C C   . ARG B 1 146 ? 57.935  16.706  60.070  1.00 145.39 ? 188 ARG B C   1 
ATOM 2851 O O   . ARG B 1 146 ? 56.864  17.298  59.926  1.00 145.39 ? 188 ARG B O   1 
ATOM 2852 C CB  . ARG B 1 146 ? 59.637  17.876  58.628  1.00 145.39 ? 188 ARG B CB  1 
ATOM 2853 C CG  . ARG B 1 146 ? 60.984  18.545  58.641  1.00 145.39 ? 188 ARG B CG  1 
ATOM 2854 C CD  . ARG B 1 146 ? 61.336  19.194  57.348  1.00 145.39 ? 188 ARG B CD  1 
ATOM 2855 N NE  . ARG B 1 146 ? 62.682  19.740  57.439  1.00 145.39 ? 188 ARG B NE  1 
ATOM 2856 C CZ  . ARG B 1 146 ? 63.286  20.403  56.461  1.00 145.39 ? 188 ARG B CZ  1 
ATOM 2857 N NH1 . ARG B 1 146 ? 62.659  20.610  55.311  1.00 145.39 ? 188 ARG B NH1 1 
ATOM 2858 N NH2 . ARG B 1 146 ? 64.531  20.833  56.620  1.00 145.39 ? 188 ARG B NH2 1 
ATOM 2859 N N   . LEU B 1 147 ? 58.027  15.398  60.283  1.00 145.39 ? 189 LEU B N   1 
ATOM 2860 C CA  . LEU B 1 147 ? 56.861  14.539  60.397  1.00 145.39 ? 189 LEU B CA  1 
ATOM 2861 C C   . LEU B 1 147 ? 56.170  14.989  61.670  1.00 145.39 ? 189 LEU B C   1 
ATOM 2862 O O   . LEU B 1 147 ? 54.977  15.299  61.679  1.00 145.39 ? 189 LEU B O   1 
ATOM 2863 C CB  . LEU B 1 147 ? 57.319  13.083  60.554  1.00 145.39 ? 189 LEU B CB  1 
ATOM 2864 C CG  . LEU B 1 147 ? 56.543  12.153  61.495  1.00 145.39 ? 189 LEU B CG  1 
ATOM 2865 C CD1 . LEU B 1 147 ? 55.488  11.409  60.720  1.00 145.39 ? 189 LEU B CD1 1 
ATOM 2866 C CD2 . LEU B 1 147 ? 57.483  11.175  62.173  1.00 145.39 ? 189 LEU B CD2 1 
ATOM 2867 N N   . ALA B 1 148 ? 56.962  15.047  62.736  1.00 145.39 ? 190 ALA B N   1 
ATOM 2868 C CA  . ALA B 1 148 ? 56.490  15.456  64.049  1.00 145.39 ? 190 ALA B CA  1 
ATOM 2869 C C   . ALA B 1 148 ? 55.729  16.758  63.950  1.00 145.39 ? 190 ALA B C   1 
ATOM 2870 O O   . ALA B 1 148 ? 54.762  16.974  64.670  1.00 145.39 ? 190 ALA B O   1 
ATOM 2871 C CB  . ALA B 1 148 ? 57.658  15.610  64.997  1.00 145.39 ? 190 ALA B CB  1 
ATOM 2872 N N   . GLU B 1 149 ? 56.155  17.605  63.021  1.00 145.39 ? 191 GLU B N   1 
ATOM 2873 C CA  . GLU B 1 149 ? 55.510  18.887  62.824  1.00 145.39 ? 191 GLU B CA  1 
ATOM 2874 C C   . GLU B 1 149 ? 54.072  18.693  62.374  1.00 145.39 ? 191 GLU B C   1 
ATOM 2875 O O   . GLU B 1 149 ? 53.156  19.216  62.998  1.00 145.39 ? 191 GLU B O   1 
ATOM 2876 C CB  . GLU B 1 149 ? 56.294  19.750  61.829  1.00 145.39 ? 191 GLU B CB  1 
ATOM 2877 C CG  . GLU B 1 149 ? 57.704  20.126  62.299  1.00 145.39 ? 191 GLU B CG  1 
ATOM 2878 C CD  . GLU B 1 149 ? 58.349  21.200  61.434  1.00 145.39 ? 191 GLU B CD  1 
ATOM 2879 O OE1 . GLU B 1 149 ? 58.174  22.398  61.745  1.00 145.39 ? 191 GLU B OE1 1 
ATOM 2880 O OE2 . GLU B 1 149 ? 59.028  20.855  60.442  1.00 145.39 ? 191 GLU B OE2 1 
ATOM 2881 N N   . TYR B 1 150 ? 53.861  17.882  61.344  1.00 145.39 ? 192 TYR B N   1 
ATOM 2882 C CA  . TYR B 1 150 ? 52.506  17.663  60.874  1.00 145.39 ? 192 TYR B CA  1 
ATOM 2883 C C   . TYR B 1 150 ? 51.634  16.977  61.922  1.00 145.39 ? 192 TYR B C   1 
ATOM 2884 O O   . TYR B 1 150 ? 50.408  17.020  61.839  1.00 145.39 ? 192 TYR B O   1 
ATOM 2885 C CB  . TYR B 1 150 ? 52.487  16.872  59.579  1.00 145.39 ? 192 TYR B CB  1 
ATOM 2886 C CG  . TYR B 1 150 ? 51.095  16.747  59.037  1.00 145.39 ? 192 TYR B CG  1 
ATOM 2887 C CD1 . TYR B 1 150 ? 50.390  17.879  58.638  1.00 145.39 ? 192 TYR B CD1 1 
ATOM 2888 C CD2 . TYR B 1 150 ? 50.454  15.511  58.981  1.00 145.39 ? 192 TYR B CD2 1 
ATOM 2889 C CE1 . TYR B 1 150 ? 49.081  17.790  58.205  1.00 145.39 ? 192 TYR B CE1 1 
ATOM 2890 C CE2 . TYR B 1 150 ? 49.142  15.409  58.545  1.00 145.39 ? 192 TYR B CE2 1 
ATOM 2891 C CZ  . TYR B 1 150 ? 48.463  16.555  58.158  1.00 145.39 ? 192 TYR B CZ  1 
ATOM 2892 O OH  . TYR B 1 150 ? 47.168  16.477  57.712  1.00 145.39 ? 192 TYR B OH  1 
ATOM 2893 N N   . HIS B 1 151 ? 52.263  16.306  62.881  1.00 145.39 ? 193 HIS B N   1 
ATOM 2894 C CA  . HIS B 1 151 ? 51.503  15.661  63.941  1.00 145.39 ? 193 HIS B CA  1 
ATOM 2895 C C   . HIS B 1 151 ? 51.154  16.720  64.971  1.00 145.39 ? 193 HIS B C   1 
ATOM 2896 O O   . HIS B 1 151 ? 50.026  16.803  65.445  1.00 145.39 ? 193 HIS B O   1 
ATOM 2897 C CB  . HIS B 1 151 ? 52.317  14.577  64.642  1.00 145.39 ? 193 HIS B CB  1 
ATOM 2898 C CG  . HIS B 1 151 ? 52.072  14.528  66.118  1.00 145.39 ? 193 HIS B CG  1 
ATOM 2899 N ND1 . HIS B 1 151 ? 52.740  15.345  67.003  1.00 145.39 ? 193 HIS B ND1 1 
ATOM 2900 C CD2 . HIS B 1 151 ? 51.152  13.855  66.850  1.00 145.39 ? 193 HIS B CD2 1 
ATOM 2901 C CE1 . HIS B 1 151 ? 52.238  15.187  68.215  1.00 145.39 ? 193 HIS B CE1 1 
ATOM 2902 N NE2 . HIS B 1 151 ? 51.274  14.289  68.148  1.00 145.39 ? 193 HIS B NE2 1 
ATOM 2903 N N   . ALA B 1 152 ? 52.177  17.467  65.367  1.00 145.39 ? 194 ALA B N   1 
ATOM 2904 C CA  . ALA B 1 152 ? 52.048  18.516  66.354  1.00 145.39 ? 194 ALA B CA  1 
ATOM 2905 C C   . ALA B 1 152 ? 51.053  19.566  65.893  1.00 145.39 ? 194 ALA B C   1 
ATOM 2906 O O   . ALA B 1 152 ? 50.271  20.073  66.692  1.00 145.39 ? 194 ALA B O   1 
ATOM 2907 C CB  . ALA B 1 152 ? 53.399  19.144  66.607  1.00 145.39 ? 194 ALA B CB  1 
ATOM 2908 N N   . LYS B 1 153 ? 51.048  19.850  64.594  1.00 145.39 ? 195 LYS B N   1 
ATOM 2909 C CA  . LYS B 1 153 ? 50.140  20.849  64.044  1.00 145.39 ? 195 LYS B CA  1 
ATOM 2910 C C   . LYS B 1 153 ? 48.723  20.291  63.917  1.00 145.39 ? 195 LYS B C   1 
ATOM 2911 O O   . LYS B 1 153 ? 47.747  21.033  64.038  1.00 145.39 ? 195 LYS B O   1 
ATOM 2912 C CB  . LYS B 1 153 ? 50.647  21.352  62.690  1.00 145.39 ? 195 LYS B CB  1 
ATOM 2913 C CG  . LYS B 1 153 ? 50.172  22.760  62.326  1.00 145.39 ? 195 LYS B CG  1 
ATOM 2914 C CD  . LYS B 1 153 ? 50.741  23.190  60.978  1.00 145.39 ? 195 LYS B CD  1 
ATOM 2915 C CE  . LYS B 1 153 ? 50.452  24.656  60.642  1.00 145.39 ? 195 LYS B CE  1 
ATOM 2916 N NZ  . LYS B 1 153 ? 50.989  24.999  59.283  1.00 145.39 ? 195 LYS B NZ  1 
ATOM 2917 N N   . ALA B 1 154 ? 48.618  18.983  63.693  1.00 145.39 ? 196 ALA B N   1 
ATOM 2918 C CA  . ALA B 1 154 ? 47.323  18.325  63.561  1.00 145.39 ? 196 ALA B CA  1 
ATOM 2919 C C   . ALA B 1 154 ? 46.665  18.170  64.927  1.00 145.39 ? 196 ALA B C   1 
ATOM 2920 O O   . ALA B 1 154 ? 45.467  18.406  65.079  1.00 145.39 ? 196 ALA B O   1 
ATOM 2921 C CB  . ALA B 1 154 ? 47.487  16.970  62.894  1.00 145.39 ? 196 ALA B CB  1 
ATOM 2922 N N   . THR B 1 155 ? 47.459  17.793  65.921  1.00 145.39 ? 197 THR B N   1 
ATOM 2923 C CA  . THR B 1 155 ? 46.955  17.617  67.275  1.00 145.39 ? 197 THR B CA  1 
ATOM 2924 C C   . THR B 1 155 ? 46.372  18.928  67.799  1.00 145.39 ? 197 THR B C   1 
ATOM 2925 O O   . THR B 1 155 ? 45.406  18.928  68.561  1.00 145.39 ? 197 THR B O   1 
ATOM 2926 C CB  . THR B 1 155 ? 48.056  17.103  68.218  1.00 145.39 ? 197 THR B CB  1 
ATOM 2927 O OG1 . THR B 1 155 ? 49.254  17.856  68.009  1.00 145.39 ? 197 THR B OG1 1 
ATOM 2928 C CG2 . THR B 1 155 ? 48.340  15.638  67.954  1.00 145.39 ? 197 THR B CG2 1 
ATOM 2929 N N   . GLU B 1 156 ? 46.943  20.042  67.350  1.00 145.39 ? 198 GLU B N   1 
ATOM 2930 C CA  . GLU B 1 156 ? 46.475  21.360  67.758  1.00 145.39 ? 198 GLU B CA  1 
ATOM 2931 C C   . GLU B 1 156 ? 45.275  21.758  66.908  1.00 145.39 ? 198 GLU B C   1 
ATOM 2932 O O   . GLU B 1 156 ? 44.287  22.269  67.424  1.00 145.39 ? 198 GLU B O   1 
ATOM 2933 C CB  . GLU B 1 156 ? 47.591  22.397  67.622  1.00 145.39 ? 198 GLU B CB  1 
ATOM 2934 C CG  . GLU B 1 156 ? 47.581  23.470  68.722  1.00 145.39 ? 198 GLU B CG  1 
ATOM 2935 C CD  . GLU B 1 156 ? 48.483  24.667  68.406  1.00 145.39 ? 198 GLU B CD  1 
ATOM 2936 O OE1 . GLU B 1 156 ? 48.602  25.034  67.212  1.00 145.39 ? 198 GLU B OE1 1 
ATOM 2937 O OE2 . GLU B 1 156 ? 49.060  25.255  69.352  1.00 145.39 ? 198 GLU B OE2 1 
ATOM 2938 N N   . HIS B 1 157 ? 45.359  21.515  65.603  1.00 145.39 ? 199 HIS B N   1 
ATOM 2939 C CA  . HIS B 1 157 ? 44.254  21.835  64.713  1.00 145.39 ? 199 HIS B CA  1 
ATOM 2940 C C   . HIS B 1 157 ? 43.061  20.937  65.072  1.00 145.39 ? 199 HIS B C   1 
ATOM 2941 O O   . HIS B 1 157 ? 41.924  21.207  64.681  1.00 145.39 ? 199 HIS B O   1 
ATOM 2942 C CB  . HIS B 1 157 ? 44.678  21.660  63.253  1.00 145.39 ? 199 HIS B CB  1 
ATOM 2943 C CG  . HIS B 1 157 ? 43.615  22.029  62.270  1.00 145.39 ? 199 HIS B CG  1 
ATOM 2944 N ND1 . HIS B 1 157 ? 43.152  21.152  61.314  1.00 145.39 ? 199 HIS B ND1 1 
ATOM 2945 C CD2 . HIS B 1 157 ? 42.884  23.161  62.128  1.00 145.39 ? 199 HIS B CD2 1 
ATOM 2946 C CE1 . HIS B 1 157 ? 42.176  21.720  60.632  1.00 145.39 ? 199 HIS B CE1 1 
ATOM 2947 N NE2 . HIS B 1 157 ? 41.992  22.938  61.107  1.00 145.39 ? 199 HIS B NE2 1 
ATOM 2948 N N   . LEU B 1 158 ? 43.329  19.881  65.838  1.00 145.39 ? 200 LEU B N   1 
ATOM 2949 C CA  . LEU B 1 158 ? 42.282  18.976  66.283  1.00 145.39 ? 200 LEU B CA  1 
ATOM 2950 C C   . LEU B 1 158 ? 41.569  19.574  67.477  1.00 145.39 ? 200 LEU B C   1 
ATOM 2951 O O   . LEU B 1 158 ? 40.346  19.652  67.496  1.00 145.39 ? 200 LEU B O   1 
ATOM 2952 C CB  . LEU B 1 158 ? 42.856  17.618  66.661  1.00 145.39 ? 200 LEU B CB  1 
ATOM 2953 C CG  . LEU B 1 158 ? 42.798  16.566  65.559  1.00 145.39 ? 200 LEU B CG  1 
ATOM 2954 C CD1 . LEU B 1 158 ? 43.342  15.259  66.091  1.00 145.39 ? 200 LEU B CD1 1 
ATOM 2955 C CD2 . LEU B 1 158 ? 41.364  16.388  65.096  1.00 145.39 ? 200 LEU B CD2 1 
ATOM 2956 N N   . SER B 1 159 ? 42.345  20.035  68.452  1.00 145.39 ? 201 SER B N   1 
ATOM 2957 C CA  . SER B 1 159 ? 41.792  20.637  69.661  1.00 145.39 ? 201 SER B CA  1 
ATOM 2958 C C   . SER B 1 159 ? 41.072  21.975  69.406  1.00 145.39 ? 201 SER B C   1 
ATOM 2959 O O   . SER B 1 159 ? 40.269  22.413  70.235  1.00 145.39 ? 201 SER B O   1 
ATOM 2960 C CB  . SER B 1 159 ? 42.891  20.809  70.708  1.00 145.39 ? 201 SER B CB  1 
ATOM 2961 O OG  . SER B 1 159 ? 42.328  21.092  71.974  1.00 145.39 ? 201 SER B OG  1 
ATOM 2962 N N   . THR B 1 160 ? 41.337  22.597  68.251  1.00 145.39 ? 202 THR B N   1 
ATOM 2963 C CA  . THR B 1 160 ? 40.706  23.874  67.871  1.00 145.39 ? 202 THR B CA  1 
ATOM 2964 C C   . THR B 1 160 ? 39.254  23.665  67.430  1.00 145.39 ? 202 THR B C   1 
ATOM 2965 O O   . THR B 1 160 ? 38.538  24.622  67.119  1.00 145.39 ? 202 THR B O   1 
ATOM 2966 C CB  . THR B 1 160 ? 41.456  24.591  66.697  1.00 145.39 ? 202 THR B CB  1 
ATOM 2967 O OG1 . THR B 1 160 ? 41.420  23.780  65.514  1.00 145.39 ? 202 THR B OG1 1 
ATOM 2968 C CG2 . THR B 1 160 ? 42.899  24.891  67.068  1.00 145.39 ? 202 THR B CG2 1 
ATOM 2969 N N   . LEU B 1 161 ? 38.837  22.404  67.401  1.00 145.39 ? 203 LEU B N   1 
ATOM 2970 C CA  . LEU B 1 161 ? 37.494  22.024  66.995  1.00 145.39 ? 203 LEU B CA  1 
ATOM 2971 C C   . LEU B 1 161 ? 36.474  22.186  68.125  1.00 145.39 ? 203 LEU B C   1 
ATOM 2972 O O   . LEU B 1 161 ? 35.351  22.636  67.888  1.00 145.39 ? 203 LEU B O   1 
ATOM 2973 C CB  . LEU B 1 161 ? 37.516  20.579  66.507  1.00 145.39 ? 203 LEU B CB  1 
ATOM 2974 C CG  . LEU B 1 161 ? 36.341  20.093  65.667  1.00 145.39 ? 203 LEU B CG  1 
ATOM 2975 C CD1 . LEU B 1 161 ? 36.201  20.971  64.428  1.00 145.39 ? 203 LEU B CD1 1 
ATOM 2976 C CD2 . LEU B 1 161 ? 36.573  18.639  65.285  1.00 145.39 ? 203 LEU B CD2 1 
ATOM 2977 N N   . SER B 1 162 ? 36.871  21.842  69.353  1.00 145.39 ? 204 SER B N   1 
ATOM 2978 C CA  . SER B 1 162 ? 35.983  21.965  70.514  1.00 145.39 ? 204 SER B CA  1 
ATOM 2979 C C   . SER B 1 162 ? 35.663  23.436  70.756  1.00 145.39 ? 204 SER B C   1 
ATOM 2980 O O   . SER B 1 162 ? 34.886  23.789  71.644  1.00 145.39 ? 204 SER B O   1 
ATOM 2981 C CB  . SER B 1 162 ? 36.626  21.364  71.767  1.00 145.39 ? 204 SER B CB  1 
ATOM 2982 O OG  . SER B 1 162 ? 37.610  22.231  72.303  1.00 145.39 ? 204 SER B OG  1 
ATOM 2983 N N   . GLU B 1 163 ? 36.306  24.282  69.964  1.00 145.39 ? 205 GLU B N   1 
ATOM 2984 C CA  . GLU B 1 163 ? 36.128  25.709  70.032  1.00 145.39 ? 205 GLU B CA  1 
ATOM 2985 C C   . GLU B 1 163 ? 35.116  26.170  68.967  1.00 145.39 ? 205 GLU B C   1 
ATOM 2986 O O   . GLU B 1 163 ? 34.136  26.829  69.310  1.00 145.39 ? 205 GLU B O   1 
ATOM 2987 C CB  . GLU B 1 163 ? 37.497  26.370  69.883  1.00 145.39 ? 205 GLU B CB  1 
ATOM 2988 C CG  . GLU B 1 163 ? 37.532  27.849  70.167  1.00 145.39 ? 205 GLU B CG  1 
ATOM 2989 C CD  . GLU B 1 163 ? 37.543  28.685  68.900  1.00 145.39 ? 205 GLU B CD  1 
ATOM 2990 O OE1 . GLU B 1 163 ? 37.349  28.120  67.796  1.00 145.39 ? 205 GLU B OE1 1 
ATOM 2991 O OE2 . GLU B 1 163 ? 37.755  29.913  69.011  1.00 145.39 ? 205 GLU B OE2 1 
ATOM 2992 N N   . LYS B 1 164 ? 35.290  25.775  67.703  1.00 145.39 ? 206 LYS B N   1 
ATOM 2993 C CA  . LYS B 1 164 ? 34.325  26.203  66.686  1.00 145.39 ? 206 LYS B CA  1 
ATOM 2994 C C   . LYS B 1 164 ? 33.015  25.417  66.766  1.00 145.39 ? 206 LYS B C   1 
ATOM 2995 O O   . LYS B 1 164 ? 32.173  25.488  65.870  1.00 145.39 ? 206 LYS B O   1 
ATOM 2996 C CB  . LYS B 1 164 ? 34.906  26.174  65.266  1.00 145.39 ? 206 LYS B CB  1 
ATOM 2997 C CG  . LYS B 1 164 ? 34.314  27.289  64.380  1.00 145.39 ? 206 LYS B CG  1 
ATOM 2998 C CD  . LYS B 1 164 ? 34.696  27.173  62.908  1.00 145.39 ? 206 LYS B CD  1 
ATOM 2999 C CE  . LYS B 1 164 ? 34.073  28.297  62.066  1.00 145.39 ? 206 LYS B CE  1 
ATOM 3000 N NZ  . LYS B 1 164 ? 34.131  27.997  60.598  1.00 145.39 ? 206 LYS B NZ  1 
ATOM 3001 N N   . ALA B 1 165 ? 32.834  24.710  67.876  1.00 145.39 ? 207 ALA B N   1 
ATOM 3002 C CA  . ALA B 1 165 ? 31.631  23.933  68.111  1.00 145.39 ? 207 ALA B CA  1 
ATOM 3003 C C   . ALA B 1 165 ? 30.506  24.823  68.647  1.00 145.39 ? 207 ALA B C   1 
ATOM 3004 O O   . ALA B 1 165 ? 29.547  25.121  67.934  1.00 145.39 ? 207 ALA B O   1 
ATOM 3005 C CB  . ALA B 1 165 ? 31.927  22.810  69.089  1.00 145.39 ? 207 ALA B CB  1 
ATOM 3006 N N   . LYS B 1 166 ? 30.693  25.327  69.866  1.00 145.39 ? 208 LYS B N   1 
ATOM 3007 C CA  . LYS B 1 166 ? 29.718  26.171  70.565  1.00 145.39 ? 208 LYS B CA  1 
ATOM 3008 C C   . LYS B 1 166 ? 28.893  27.218  69.792  1.00 145.39 ? 208 LYS B C   1 
ATOM 3009 O O   . LYS B 1 166 ? 27.692  27.340  70.023  1.00 145.39 ? 208 LYS B O   1 
ATOM 3010 C CB  . LYS B 1 166 ? 30.387  26.814  71.789  1.00 145.39 ? 208 LYS B CB  1 
ATOM 3011 C CG  . LYS B 1 166 ? 29.436  27.440  72.810  1.00 145.39 ? 208 LYS B CG  1 
ATOM 3012 C CD  . LYS B 1 166 ? 30.223  28.046  73.985  1.00 145.39 ? 208 LYS B CD  1 
ATOM 3013 C CE  . LYS B 1 166 ? 29.323  28.774  74.997  1.00 145.39 ? 208 LYS B CE  1 
ATOM 3014 N NZ  . LYS B 1 166 ? 30.101  29.475  76.078  1.00 145.39 ? 208 LYS B NZ  1 
ATOM 3015 N N   . PRO B 1 167 ? 29.506  27.972  68.857  1.00 82.01  ? 209 PRO B N   1 
ATOM 3016 C CA  . PRO B 1 167 ? 28.682  28.960  68.150  1.00 82.01  ? 209 PRO B CA  1 
ATOM 3017 C C   . PRO B 1 167 ? 27.503  28.349  67.422  1.00 82.01  ? 209 PRO B C   1 
ATOM 3018 O O   . PRO B 1 167 ? 26.365  28.773  67.603  1.00 82.01  ? 209 PRO B O   1 
ATOM 3019 C CB  . PRO B 1 167 ? 29.671  29.594  67.169  1.00 82.01  ? 209 PRO B CB  1 
ATOM 3020 C CG  . PRO B 1 167 ? 30.642  28.487  66.906  1.00 82.01  ? 209 PRO B CG  1 
ATOM 3021 C CD  . PRO B 1 167 ? 30.868  27.954  68.301  1.00 82.01  ? 209 PRO B CD  1 
ATOM 3022 N N   . ALA B 1 168 ? 27.787  27.348  66.601  1.00 82.01  ? 210 ALA B N   1 
ATOM 3023 C CA  . ALA B 1 168 ? 26.761  26.677  65.833  1.00 82.01  ? 210 ALA B CA  1 
ATOM 3024 C C   . ALA B 1 168 ? 25.609  26.240  66.715  1.00 82.01  ? 210 ALA B C   1 
ATOM 3025 O O   . ALA B 1 168 ? 24.458  26.345  66.328  1.00 82.01  ? 210 ALA B O   1 
ATOM 3026 C CB  . ALA B 1 168 ? 27.354  25.499  65.116  1.00 82.01  ? 210 ALA B CB  1 
ATOM 3027 N N   . LEU B 1 169 ? 25.925  25.814  67.928  1.00 82.01  ? 211 LEU B N   1 
ATOM 3028 C CA  . LEU B 1 169 ? 24.913  25.358  68.868  1.00 82.01  ? 211 LEU B CA  1 
ATOM 3029 C C   . LEU B 1 169 ? 23.922  26.471  69.165  1.00 82.01  ? 211 LEU B C   1 
ATOM 3030 O O   . LEU B 1 169 ? 22.711  26.251  69.247  1.00 82.01  ? 211 LEU B O   1 
ATOM 3031 C CB  . LEU B 1 169 ? 25.587  24.921  70.159  1.00 82.01  ? 211 LEU B CB  1 
ATOM 3032 C CG  . LEU B 1 169 ? 26.680  23.869  69.982  1.00 82.01  ? 211 LEU B CG  1 
ATOM 3033 C CD1 . LEU B 1 169 ? 27.473  23.735  71.270  1.00 82.01  ? 211 LEU B CD1 1 
ATOM 3034 C CD2 . LEU B 1 169 ? 26.065  22.538  69.566  1.00 82.01  ? 211 LEU B CD2 1 
ATOM 3035 N N   . GLU B 1 170 ? 24.450  27.678  69.312  1.00 82.01  ? 212 GLU B N   1 
ATOM 3036 C CA  . GLU B 1 170 ? 23.613  28.824  69.599  1.00 82.01  ? 212 GLU B CA  1 
ATOM 3037 C C   . GLU B 1 170 ? 22.807  29.068  68.356  1.00 82.01  ? 212 GLU B C   1 
ATOM 3038 O O   . GLU B 1 170 ? 21.597  29.258  68.423  1.00 82.01  ? 212 GLU B O   1 
ATOM 3039 C CB  . GLU B 1 170 ? 24.467  30.034  69.955  1.00 82.01  ? 212 GLU B CB  1 
ATOM 3040 C CG  . GLU B 1 170 ? 25.584  29.699  70.952  1.00 82.01  ? 212 GLU B CG  1 
ATOM 3041 C CD  . GLU B 1 170 ? 25.224  28.552  71.918  1.00 82.01  ? 212 GLU B CD  1 
ATOM 3042 O OE1 . GLU B 1 170 ? 24.271  28.686  72.723  1.00 82.01  ? 212 GLU B OE1 1 
ATOM 3043 O OE2 . GLU B 1 170 ? 25.900  27.501  71.868  1.00 82.01  ? 212 GLU B OE2 1 
ATOM 3044 N N   . ASP B 1 171 ? 23.481  28.969  67.215  1.00 82.01  ? 213 ASP B N   1 
ATOM 3045 C CA  . ASP B 1 171 ? 22.833  29.139  65.926  1.00 82.01  ? 213 ASP B CA  1 
ATOM 3046 C C   . ASP B 1 171 ? 21.746  28.095  65.824  1.00 82.01  ? 213 ASP B C   1 
ATOM 3047 O O   . ASP B 1 171 ? 20.702  28.336  65.230  1.00 82.01  ? 213 ASP B O   1 
ATOM 3048 C CB  . ASP B 1 171 ? 23.820  28.916  64.784  1.00 82.01  ? 213 ASP B CB  1 
ATOM 3049 C CG  . ASP B 1 171 ? 24.732  30.093  64.564  1.00 82.01  ? 213 ASP B CG  1 
ATOM 3050 O OD1 . ASP B 1 171 ? 24.210  31.190  64.282  1.00 82.01  ? 213 ASP B OD1 1 
ATOM 3051 O OD2 . ASP B 1 171 ? 25.967  29.926  64.665  1.00 82.01  ? 213 ASP B OD2 1 
ATOM 3052 N N   . LEU B 1 172 ? 22.000  26.934  66.423  1.00 82.01  ? 214 LEU B N   1 
ATOM 3053 C CA  . LEU B 1 172 ? 21.054  25.832  66.407  1.00 82.01  ? 214 LEU B CA  1 
ATOM 3054 C C   . LEU B 1 172 ? 19.831  26.343  67.104  1.00 82.01  ? 214 LEU B C   1 
ATOM 3055 O O   . LEU B 1 172 ? 18.776  26.473  66.497  1.00 82.01  ? 214 LEU B O   1 
ATOM 3056 C CB  . LEU B 1 172 ? 21.596  24.634  67.185  1.00 82.01  ? 214 LEU B CB  1 
ATOM 3057 C CG  . LEU B 1 172 ? 20.561  23.558  67.508  1.00 82.01  ? 214 LEU B CG  1 
ATOM 3058 C CD1 . LEU B 1 172 ? 20.162  22.904  66.209  1.00 82.01  ? 214 LEU B CD1 1 
ATOM 3059 C CD2 . LEU B 1 172 ? 21.104  22.525  68.486  1.00 82.01  ? 214 LEU B CD2 1 
ATOM 3060 N N   . ARG B 1 173 ? 20.008  26.681  68.375  1.00 82.01  ? 215 ARG B N   1 
ATOM 3061 C CA  . ARG B 1 173 ? 18.941  27.192  69.202  1.00 82.01  ? 215 ARG B CA  1 
ATOM 3062 C C   . ARG B 1 173 ? 18.100  28.179  68.399  1.00 82.01  ? 215 ARG B C   1 
ATOM 3063 O O   . ARG B 1 173 ? 16.917  27.955  68.148  1.00 82.01  ? 215 ARG B O   1 
ATOM 3064 C CB  . ARG B 1 173 ? 19.549  27.888  70.416  1.00 82.01  ? 215 ARG B CB  1 
ATOM 3065 C CG  . ARG B 1 173 ? 18.517  28.473  71.360  1.00 82.01  ? 215 ARG B CG  1 
ATOM 3066 C CD  . ARG B 1 173 ? 19.132  29.389  72.411  1.00 82.01  ? 215 ARG B CD  1 
ATOM 3067 N NE  . ARG B 1 173 ? 19.790  30.546  71.811  1.00 82.01  ? 215 ARG B NE  1 
ATOM 3068 C CZ  . ARG B 1 173 ? 21.107  30.682  71.724  1.00 82.01  ? 215 ARG B CZ  1 
ATOM 3069 N NH1 . ARG B 1 173 ? 21.889  29.729  72.208  1.00 82.01  ? 215 ARG B NH1 1 
ATOM 3070 N NH2 . ARG B 1 173 ? 21.639  31.753  71.148  1.00 82.01  ? 215 ARG B NH2 1 
ATOM 3071 N N   . GLN B 1 174 ? 18.775  29.203  67.894  1.00 82.01  ? 216 GLN B N   1 
ATOM 3072 C CA  . GLN B 1 174 ? 18.170  30.276  67.110  1.00 82.01  ? 216 GLN B CA  1 
ATOM 3073 C C   . GLN B 1 174 ? 17.272  29.775  65.965  1.00 82.01  ? 216 GLN B C   1 
ATOM 3074 O O   . GLN B 1 174 ? 16.065  30.030  65.947  1.00 82.01  ? 216 GLN B O   1 
ATOM 3075 C CB  . GLN B 1 174 ? 19.299  31.182  66.575  1.00 82.01  ? 216 GLN B CB  1 
ATOM 3076 C CG  . GLN B 1 174 ? 18.891  32.605  66.144  1.00 82.01  ? 216 GLN B CG  1 
ATOM 3077 C CD  . GLN B 1 174 ? 20.089  33.544  65.873  1.00 82.01  ? 216 GLN B CD  1 
ATOM 3078 O OE1 . GLN B 1 174 ? 21.095  33.526  66.601  1.00 82.01  ? 216 GLN B OE1 1 
ATOM 3079 N NE2 . GLN B 1 174 ? 19.963  34.390  64.839  1.00 82.01  ? 216 GLN B NE2 1 
ATOM 3080 N N   . GLY B 1 175 ? 17.861  29.015  65.045  1.00 82.01  ? 217 GLY B N   1 
ATOM 3081 C CA  . GLY B 1 175 ? 17.125  28.494  63.902  1.00 82.01  ? 217 GLY B CA  1 
ATOM 3082 C C   . GLY B 1 175 ? 15.882  27.709  64.259  1.00 82.01  ? 217 GLY B C   1 
ATOM 3083 O O   . GLY B 1 175 ? 14.952  27.600  63.457  1.00 82.01  ? 217 GLY B O   1 
ATOM 3084 N N   . LEU B 1 176 ? 15.878  27.165  65.469  1.00 82.01  ? 218 LEU B N   1 
ATOM 3085 C CA  . LEU B 1 176 ? 14.765  26.382  65.967  1.00 82.01  ? 218 LEU B CA  1 
ATOM 3086 C C   . LEU B 1 176 ? 13.647  27.294  66.388  1.00 82.01  ? 218 LEU B C   1 
ATOM 3087 O O   . LEU B 1 176 ? 12.513  27.127  65.965  1.00 82.01  ? 218 LEU B O   1 
ATOM 3088 C CB  . LEU B 1 176 ? 15.194  25.582  67.189  1.00 82.01  ? 218 LEU B CB  1 
ATOM 3089 C CG  . LEU B 1 176 ? 16.092  24.370  67.000  1.00 82.01  ? 218 LEU B CG  1 
ATOM 3090 C CD1 . LEU B 1 176 ? 16.932  24.469  65.735  1.00 82.01  ? 218 LEU B CD1 1 
ATOM 3091 C CD2 . LEU B 1 176 ? 16.949  24.217  68.238  1.00 82.01  ? 218 LEU B CD2 1 
ATOM 3092 N N   . LEU B 1 177 ? 13.991  28.257  67.237  1.00 82.01  ? 219 LEU B N   1 
ATOM 3093 C CA  . LEU B 1 177 ? 13.059  29.228  67.794  1.00 82.01  ? 219 LEU B CA  1 
ATOM 3094 C C   . LEU B 1 177 ? 12.031  29.819  66.872  1.00 82.01  ? 219 LEU B C   1 
ATOM 3095 O O   . LEU B 1 177 ? 12.308  30.067  65.708  1.00 82.01  ? 219 LEU B O   1 
ATOM 3096 C CB  . LEU B 1 177 ? 13.832  30.385  68.416  1.00 82.01  ? 219 LEU B CB  1 
ATOM 3097 C CG  . LEU B 1 177 ? 14.896  30.025  69.441  1.00 82.01  ? 219 LEU B CG  1 
ATOM 3098 C CD1 . LEU B 1 177 ? 15.265  31.294  70.208  1.00 82.01  ? 219 LEU B CD1 1 
ATOM 3099 C CD2 . LEU B 1 177 ? 14.378  28.937  70.379  1.00 82.01  ? 219 LEU B CD2 1 
ATOM 3100 N N   . PRO B 1 178 ? 10.879  30.209  67.437  1.00 136.59 ? 220 PRO B N   1 
ATOM 3101 C CA  . PRO B 1 178 ? 9.702   30.812  66.798  1.00 136.59 ? 220 PRO B CA  1 
ATOM 3102 C C   . PRO B 1 178 ? 9.985   32.036  65.937  1.00 136.59 ? 220 PRO B C   1 
ATOM 3103 O O   . PRO B 1 178 ? 11.074  32.601  65.978  1.00 136.59 ? 220 PRO B O   1 
ATOM 3104 C CB  . PRO B 1 178 ? 8.850   31.211  68.009  1.00 136.59 ? 220 PRO B CB  1 
ATOM 3105 C CG  . PRO B 1 178 ? 9.869   31.470  69.084  1.00 136.59 ? 220 PRO B CG  1 
ATOM 3106 C CD  . PRO B 1 178 ? 10.725  30.259  68.903  1.00 136.59 ? 220 PRO B CD  1 
ATOM 3107 N N   . VAL B 1 179 ? 8.966   32.448  65.186  1.00 136.59 ? 221 VAL B N   1 
ATOM 3108 C CA  . VAL B 1 179 ? 9.043   33.616  64.311  1.00 136.59 ? 221 VAL B CA  1 
ATOM 3109 C C   . VAL B 1 179 ? 7.751   34.441  64.423  1.00 136.59 ? 221 VAL B C   1 
ATOM 3110 O O   . VAL B 1 179 ? 6.740   34.115  63.801  1.00 136.59 ? 221 VAL B O   1 
ATOM 3111 C CB  . VAL B 1 179 ? 9.236   33.196  62.834  1.00 136.59 ? 221 VAL B CB  1 
ATOM 3112 C CG1 . VAL B 1 179 ? 9.482   34.419  61.967  1.00 136.59 ? 221 VAL B CG1 1 
ATOM 3113 C CG2 . VAL B 1 179 ? 10.388  32.208  62.697  1.00 136.59 ? 221 VAL B CG2 1 
ATOM 3114 N N   . LEU B 1 180 ? 7.791   35.497  65.229  1.00 136.59 ? 222 LEU B N   1 
ATOM 3115 C CA  . LEU B 1 180 ? 6.645   36.382  65.437  1.00 136.59 ? 222 LEU B CA  1 
ATOM 3116 C C   . LEU B 1 180 ? 6.500   37.282  64.210  1.00 136.59 ? 222 LEU B C   1 
ATOM 3117 O O   . LEU B 1 180 ? 6.527   38.507  64.326  1.00 136.59 ? 222 LEU B O   1 
ATOM 3118 C CB  . LEU B 1 180 ? 6.915   37.252  66.667  1.00 136.59 ? 222 LEU B CB  1 
ATOM 3119 C CG  . LEU B 1 180 ? 7.275   36.563  67.984  1.00 136.59 ? 222 LEU B CG  1 
ATOM 3120 C CD1 . LEU B 1 180 ? 7.997   37.520  68.925  1.00 136.59 ? 222 LEU B CD1 1 
ATOM 3121 C CD2 . LEU B 1 180 ? 6.013   36.042  68.613  1.00 136.59 ? 222 LEU B CD2 1 
ATOM 3122 N N   . GLU B 1 181 ? 6.310   36.674  63.046  1.00 136.59 ? 223 GLU B N   1 
ATOM 3123 C CA  . GLU B 1 181 ? 6.219   37.412  61.796  1.00 136.59 ? 223 GLU B CA  1 
ATOM 3124 C C   . GLU B 1 181 ? 5.383   38.679  61.844  1.00 136.59 ? 223 GLU B C   1 
ATOM 3125 O O   . GLU B 1 181 ? 4.153   38.636  61.941  1.00 136.59 ? 223 GLU B O   1 
ATOM 3126 C CB  . GLU B 1 181 ? 5.740   36.505  60.673  1.00 136.59 ? 223 GLU B CB  1 
ATOM 3127 C CG  . GLU B 1 181 ? 5.930   37.104  59.295  1.00 136.59 ? 223 GLU B CG  1 
ATOM 3128 C CD  . GLU B 1 181 ? 5.614   36.115  58.193  1.00 136.59 ? 223 GLU B CD  1 
ATOM 3129 O OE1 . GLU B 1 181 ? 6.383   35.141  58.025  1.00 136.59 ? 223 GLU B OE1 1 
ATOM 3130 O OE2 . GLU B 1 181 ? 4.593   36.308  57.499  1.00 136.59 ? 223 GLU B OE2 1 
ATOM 3131 N N   . SER B 1 182 ? 6.084   39.808  61.792  1.00 136.59 ? 224 SER B N   1 
ATOM 3132 C CA  . SER B 1 182 ? 5.452   41.118  61.811  1.00 136.59 ? 224 SER B CA  1 
ATOM 3133 C C   . SER B 1 182 ? 4.512   41.209  60.620  1.00 136.59 ? 224 SER B C   1 
ATOM 3134 O O   . SER B 1 182 ? 4.816   40.694  59.538  1.00 136.59 ? 224 SER B O   1 
ATOM 3135 C CB  . SER B 1 182 ? 6.518   42.227  61.753  1.00 136.59 ? 224 SER B CB  1 
ATOM 3136 O OG  . SER B 1 182 ? 7.413   42.061  60.661  1.00 136.59 ? 224 SER B OG  1 
ATOM 3137 N N   . PHE B 1 183 ? 3.350   41.818  60.820  1.00 136.59 ? 225 PHE B N   1 
ATOM 3138 C CA  . PHE B 1 183 ? 2.436   41.919  59.710  1.00 136.59 ? 225 PHE B CA  1 
ATOM 3139 C C   . PHE B 1 183 ? 1.919   43.287  59.311  1.00 136.59 ? 225 PHE B C   1 
ATOM 3140 O O   . PHE B 1 183 ? 1.304   44.014  60.096  1.00 136.59 ? 225 PHE B O   1 
ATOM 3141 C CB  . PHE B 1 183 ? 1.300   40.923  59.832  1.00 136.59 ? 225 PHE B CB  1 
ATOM 3142 C CG  . PHE B 1 183 ? 0.638   40.638  58.531  1.00 136.59 ? 225 PHE B CG  1 
ATOM 3143 C CD1 . PHE B 1 183 ? 1.411   40.466  57.379  1.00 136.59 ? 225 PHE B CD1 1 
ATOM 3144 C CD2 . PHE B 1 183 ? -0.745  40.617  58.422  1.00 136.59 ? 225 PHE B CD2 1 
ATOM 3145 C CE1 . PHE B 1 183 ? 0.815   40.268  56.137  1.00 136.59 ? 225 PHE B CE1 1 
ATOM 3146 C CE2 . PHE B 1 183 ? -1.358  40.419  57.180  1.00 136.59 ? 225 PHE B CE2 1 
ATOM 3147 C CZ  . PHE B 1 183 ? -0.572  40.250  56.032  1.00 136.59 ? 225 PHE B CZ  1 
ATOM 3148 N N   . LYS B 1 184 ? 2.166   43.584  58.038  1.00 136.59 ? 226 LYS B N   1 
ATOM 3149 C CA  . LYS B 1 184 ? 1.785   44.830  57.391  1.00 136.59 ? 226 LYS B CA  1 
ATOM 3150 C C   . LYS B 1 184 ? 0.623   44.481  56.469  1.00 136.59 ? 226 LYS B C   1 
ATOM 3151 O O   . LYS B 1 184 ? -0.415  44.022  56.926  1.00 136.59 ? 226 LYS B O   1 
ATOM 3152 C CB  . LYS B 1 184 ? 2.973   45.348  56.562  1.00 136.59 ? 226 LYS B CB  1 
ATOM 3153 C CG  . LYS B 1 184 ? 4.324   45.347  57.284  1.00 136.59 ? 226 LYS B CG  1 
ATOM 3154 C CD  . LYS B 1 184 ? 5.452   45.898  56.405  1.00 136.59 ? 226 LYS B CD  1 
ATOM 3155 C CE  . LYS B 1 184 ? 6.734   46.140  57.215  1.00 136.59 ? 226 LYS B CE  1 
ATOM 3156 N NZ  . LYS B 1 184 ? 7.786   46.857  56.423  1.00 136.59 ? 226 LYS B NZ  1 
ATOM 3157 N N   . VAL B 1 185 ? 0.810   44.723  55.176  1.00 136.59 ? 227 VAL B N   1 
ATOM 3158 C CA  . VAL B 1 185 ? -0.155  44.422  54.131  1.00 136.59 ? 227 VAL B CA  1 
ATOM 3159 C C   . VAL B 1 185 ? 0.517   44.868  52.882  1.00 136.59 ? 227 VAL B C   1 
ATOM 3160 O O   . VAL B 1 185 ? 1.362   45.753  52.912  1.00 136.59 ? 227 VAL B O   1 
ATOM 3161 C CB  . VAL B 1 185 ? -1.471  45.205  54.221  1.00 136.59 ? 227 VAL B CB  1 
ATOM 3162 C CG1 . VAL B 1 185 ? -2.473  44.439  55.025  1.00 136.59 ? 227 VAL B CG1 1 
ATOM 3163 C CG2 . VAL B 1 185 ? -1.257  46.582  54.786  1.00 136.59 ? 227 VAL B CG2 1 
ATOM 3164 N N   . SER B 1 186 ? 0.167   44.246  51.775  1.00 90.93  ? 228 SER B N   1 
ATOM 3165 C CA  . SER B 1 186 ? 0.776   44.653  50.538  1.00 90.93  ? 228 SER B CA  1 
ATOM 3166 C C   . SER B 1 186 ? 0.453   46.134  50.404  1.00 90.93  ? 228 SER B C   1 
ATOM 3167 O O   . SER B 1 186 ? 1.335   46.926  50.158  1.00 90.93  ? 228 SER B O   1 
ATOM 3168 C CB  . SER B 1 186 ? 0.196   43.857  49.376  1.00 90.93  ? 228 SER B CB  1 
ATOM 3169 O OG  . SER B 1 186 ? 0.932   44.087  48.186  1.00 90.93  ? 228 SER B OG  1 
ATOM 3170 N N   . PHE B 1 187 ? -0.764  46.494  50.797  1.00 90.93  ? 229 PHE B N   1 
ATOM 3171 C CA  . PHE B 1 187 ? -1.278  47.861  50.721  1.00 90.93  ? 229 PHE B CA  1 
ATOM 3172 C C   . PHE B 1 187 ? -0.353  48.800  51.428  1.00 90.93  ? 229 PHE B C   1 
ATOM 3173 O O   . PHE B 1 187 ? -0.008  49.862  50.925  1.00 90.93  ? 229 PHE B O   1 
ATOM 3174 C CB  . PHE B 1 187 ? -2.642  47.961  51.393  1.00 90.93  ? 229 PHE B CB  1 
ATOM 3175 C CG  . PHE B 1 187 ? -3.378  46.661  51.462  1.00 90.93  ? 229 PHE B CG  1 
ATOM 3176 C CD1 . PHE B 1 187 ? -3.306  45.741  50.415  1.00 90.93  ? 229 PHE B CD1 1 
ATOM 3177 C CD2 . PHE B 1 187 ? -4.112  46.334  52.590  1.00 90.93  ? 229 PHE B CD2 1 
ATOM 3178 C CE1 . PHE B 1 187 ? -3.945  44.513  50.497  1.00 90.93  ? 229 PHE B CE1 1 
ATOM 3179 C CE2 . PHE B 1 187 ? -4.761  45.104  52.683  1.00 90.93  ? 229 PHE B CE2 1 
ATOM 3180 C CZ  . PHE B 1 187 ? -4.674  44.192  51.635  1.00 90.93  ? 229 PHE B CZ  1 
ATOM 3181 N N   . LEU B 1 188 ? 0.051   48.400  52.615  1.00 90.93  ? 230 LEU B N   1 
ATOM 3182 C CA  . LEU B 1 188 ? 0.944   49.230  53.360  1.00 90.93  ? 230 LEU B CA  1 
ATOM 3183 C C   . LEU B 1 188 ? 2.281   49.212  52.666  1.00 90.93  ? 230 LEU B C   1 
ATOM 3184 O O   . LEU B 1 188 ? 2.846   50.256  52.363  1.00 90.93  ? 230 LEU B O   1 
ATOM 3185 C CB  . LEU B 1 188 ? 1.090   48.722  54.764  1.00 90.93  ? 230 LEU B CB  1 
ATOM 3186 C CG  . LEU B 1 188 ? 1.646   49.869  55.581  1.00 90.93  ? 230 LEU B CG  1 
ATOM 3187 C CD1 . LEU B 1 188 ? 0.793   51.103  55.344  1.00 90.93  ? 230 LEU B CD1 1 
ATOM 3188 C CD2 . LEU B 1 188 ? 1.673   49.488  57.037  1.00 90.93  ? 230 LEU B CD2 1 
ATOM 3189 N N   . SER B 1 189 ? 2.767   48.006  52.403  1.00 90.93  ? 231 SER B N   1 
ATOM 3190 C CA  . SER B 1 189 ? 4.028   47.795  51.716  1.00 90.93  ? 231 SER B CA  1 
ATOM 3191 C C   . SER B 1 189 ? 4.032   48.645  50.463  1.00 90.93  ? 231 SER B C   1 
ATOM 3192 O O   . SER B 1 189 ? 5.038   49.246  50.109  1.00 90.93  ? 231 SER B O   1 
ATOM 3193 C CB  . SER B 1 189 ? 4.151   46.316  51.337  1.00 90.93  ? 231 SER B CB  1 
ATOM 3194 O OG  . SER B 1 189 ? 5.113   46.110  50.318  1.00 90.93  ? 231 SER B OG  1 
ATOM 3195 N N   . ALA B 1 190 ? 2.849   48.782  49.878  1.00 90.93  ? 232 ALA B N   1 
ATOM 3196 C CA  . ALA B 1 190 ? 2.656   49.528  48.651  1.00 90.93  ? 232 ALA B CA  1 
ATOM 3197 C C   . ALA B 1 190 ? 2.960   50.986  48.875  1.00 90.93  ? 232 ALA B C   1 
ATOM 3198 O O   . ALA B 1 190 ? 3.686   51.597  48.103  1.00 90.93  ? 232 ALA B O   1 
ATOM 3199 C CB  . ALA B 1 190 ? 1.243   49.356  48.156  1.00 90.93  ? 232 ALA B CB  1 
ATOM 3200 N N   . LEU B 1 191 ? 2.406   51.535  49.945  1.00 90.93  ? 233 LEU B N   1 
ATOM 3201 C CA  . LEU B 1 191 ? 2.643   52.922  50.267  1.00 90.93  ? 233 LEU B CA  1 
ATOM 3202 C C   . LEU B 1 191 ? 4.110   53.150  50.490  1.00 90.93  ? 233 LEU B C   1 
ATOM 3203 O O   . LEU B 1 191 ? 4.692   54.027  49.866  1.00 90.93  ? 233 LEU B O   1 
ATOM 3204 C CB  . LEU B 1 191 ? 1.857   53.322  51.495  1.00 90.93  ? 233 LEU B CB  1 
ATOM 3205 C CG  . LEU B 1 191 ? 0.422   53.573  51.077  1.00 90.93  ? 233 LEU B CG  1 
ATOM 3206 C CD1 . LEU B 1 191 ? -0.425  53.896  52.283  1.00 90.93  ? 233 LEU B CD1 1 
ATOM 3207 C CD2 . LEU B 1 191 ? 0.404   54.705  50.068  1.00 90.93  ? 233 LEU B CD2 1 
ATOM 3208 N N   . GLU B 1 192 ? 4.709   52.336  51.354  1.00 90.93  ? 234 GLU B N   1 
ATOM 3209 C CA  . GLU B 1 192 ? 6.135   52.451  51.646  1.00 90.93  ? 234 GLU B CA  1 
ATOM 3210 C C   . GLU B 1 192 ? 6.880   52.605  50.329  1.00 90.93  ? 234 GLU B C   1 
ATOM 3211 O O   . GLU B 1 192 ? 7.355   53.684  49.975  1.00 90.93  ? 234 GLU B O   1 
ATOM 3212 C CB  . GLU B 1 192 ? 6.655   51.201  52.382  1.00 90.93  ? 234 GLU B CB  1 
ATOM 3213 C CG  . GLU B 1 192 ? 6.285   51.109  53.864  1.00 90.93  ? 234 GLU B CG  1 
ATOM 3214 C CD  . GLU B 1 192 ? 7.328   50.367  54.707  1.00 90.93  ? 234 GLU B CD  1 
ATOM 3215 O OE1 . GLU B 1 192 ? 7.659   49.213  54.366  1.00 90.93  ? 234 GLU B OE1 1 
ATOM 3216 O OE2 . GLU B 1 192 ? 7.809   50.933  55.718  1.00 90.93  ? 234 GLU B OE2 1 
ATOM 3217 N N   . GLU B 1 193 ? 6.874   51.519  49.573  1.00 90.93  ? 235 GLU B N   1 
ATOM 3218 C CA  . GLU B 1 193 ? 7.511   51.419  48.270  1.00 90.93  ? 235 GLU B CA  1 
ATOM 3219 C C   . GLU B 1 193 ? 7.144   52.602  47.380  1.00 90.93  ? 235 GLU B C   1 
ATOM 3220 O O   . GLU B 1 193 ? 7.993   53.178  46.697  1.00 90.93  ? 235 GLU B O   1 
ATOM 3221 C CB  . GLU B 1 193 ? 7.031   50.114  47.629  1.00 90.93  ? 235 GLU B CB  1 
ATOM 3222 C CG  . GLU B 1 193 ? 7.543   49.818  46.234  1.00 90.93  ? 235 GLU B CG  1 
ATOM 3223 C CD  . GLU B 1 193 ? 6.839   48.620  45.609  1.00 90.93  ? 235 GLU B CD  1 
ATOM 3224 O OE1 . GLU B 1 193 ? 5.586   48.563  45.670  1.00 90.93  ? 235 GLU B OE1 1 
ATOM 3225 O OE2 . GLU B 1 193 ? 7.539   47.738  45.058  1.00 90.93  ? 235 GLU B OE2 1 
ATOM 3226 N N   . TYR B 1 194 ? 5.881   52.993  47.448  1.00 90.93  ? 236 TYR B N   1 
ATOM 3227 C CA  . TYR B 1 194 ? 5.373   54.078  46.639  1.00 90.93  ? 236 TYR B CA  1 
ATOM 3228 C C   . TYR B 1 194 ? 6.074   55.394  46.893  1.00 90.93  ? 236 TYR B C   1 
ATOM 3229 O O   . TYR B 1 194 ? 6.801   55.903  46.044  1.00 90.93  ? 236 TYR B O   1 
ATOM 3230 C CB  . TYR B 1 194 ? 3.881   54.250  46.889  1.00 90.93  ? 236 TYR B CB  1 
ATOM 3231 C CG  . TYR B 1 194 ? 3.336   55.503  46.269  1.00 90.93  ? 236 TYR B CG  1 
ATOM 3232 C CD1 . TYR B 1 194 ? 3.131   55.585  44.895  1.00 90.93  ? 236 TYR B CD1 1 
ATOM 3233 C CD2 . TYR B 1 194 ? 3.065   56.621  47.047  1.00 90.93  ? 236 TYR B CD2 1 
ATOM 3234 C CE1 . TYR B 1 194 ? 2.675   56.752  44.309  1.00 90.93  ? 236 TYR B CE1 1 
ATOM 3235 C CE2 . TYR B 1 194 ? 2.612   57.790  46.471  1.00 90.93  ? 236 TYR B CE2 1 
ATOM 3236 C CZ  . TYR B 1 194 ? 2.418   57.846  45.104  1.00 90.93  ? 236 TYR B CZ  1 
ATOM 3237 O OH  . TYR B 1 194 ? 1.959   59.006  44.540  1.00 90.93  ? 236 TYR B OH  1 
ATOM 3238 N N   . THR B 1 195 ? 5.776   55.977  48.044  1.00 90.93  ? 237 THR B N   1 
ATOM 3239 C CA  . THR B 1 195 ? 6.355   57.242  48.444  1.00 90.93  ? 237 THR B CA  1 
ATOM 3240 C C   . THR B 1 195 ? 7.865   57.206  48.291  1.00 90.93  ? 237 THR B C   1 
ATOM 3241 O O   . THR B 1 195 ? 8.502   58.227  48.059  1.00 90.93  ? 237 THR B O   1 
ATOM 3242 C CB  . THR B 1 195 ? 5.973   57.556  49.886  1.00 90.93  ? 237 THR B CB  1 
ATOM 3243 O OG1 . THR B 1 195 ? 5.644   56.339  50.563  1.00 90.93  ? 237 THR B OG1 1 
ATOM 3244 C CG2 . THR B 1 195 ? 4.775   58.479  49.913  1.00 90.93  ? 237 THR B CG2 1 
ATOM 3245 N N   . LYS B 1 196 ? 8.423   56.007  48.384  1.00 90.93  ? 238 LYS B N   1 
ATOM 3246 C CA  . LYS B 1 196 ? 9.852   55.807  48.235  1.00 90.93  ? 238 LYS B CA  1 
ATOM 3247 C C   . LYS B 1 196 ? 10.303  56.334  46.867  1.00 90.93  ? 238 LYS B C   1 
ATOM 3248 O O   . LYS B 1 196 ? 11.299  57.051  46.757  1.00 90.93  ? 238 LYS B O   1 
ATOM 3249 C CB  . LYS B 1 196 ? 10.150  54.310  48.413  1.00 90.93  ? 238 LYS B CB  1 
ATOM 3250 C CG  . LYS B 1 196 ? 11.304  53.741  47.614  1.00 90.93  ? 238 LYS B CG  1 
ATOM 3251 C CD  . LYS B 1 196 ? 11.474  52.236  47.870  1.00 90.93  ? 238 LYS B CD  1 
ATOM 3252 C CE  . LYS B 1 196 ? 12.536  51.637  46.946  1.00 90.93  ? 238 LYS B CE  1 
ATOM 3253 N NZ  . LYS B 1 196 ? 12.908  50.236  47.299  1.00 90.93  ? 238 LYS B NZ  1 
ATOM 3254 N N   . LYS B 1 197 ? 9.483   56.068  45.858  1.00 90.93  ? 239 LYS B N   1 
ATOM 3255 C CA  . LYS B 1 197 ? 9.757   56.465  44.483  1.00 90.93  ? 239 LYS B CA  1 
ATOM 3256 C C   . LYS B 1 197 ? 9.338   57.888  44.126  1.00 90.93  ? 239 LYS B C   1 
ATOM 3257 O O   . LYS B 1 197 ? 9.614   58.360  43.024  1.00 90.93  ? 239 LYS B O   1 
ATOM 3258 C CB  . LYS B 1 197 ? 9.053   55.492  43.540  1.00 90.93  ? 239 LYS B CB  1 
ATOM 3259 C CG  . LYS B 1 197 ? 9.363   54.026  43.816  1.00 90.93  ? 239 LYS B CG  1 
ATOM 3260 C CD  . LYS B 1 197 ? 8.564   53.102  42.896  1.00 90.93  ? 239 LYS B CD  1 
ATOM 3261 C CE  . LYS B 1 197 ? 8.911   51.627  43.115  1.00 90.93  ? 239 LYS B CE  1 
ATOM 3262 N NZ  . LYS B 1 197 ? 8.106   50.714  42.242  1.00 90.93  ? 239 LYS B NZ  1 
ATOM 3263 N N   . LEU B 1 198 ? 8.674   58.570  45.048  1.00 90.93  ? 240 LEU B N   1 
ATOM 3264 C CA  . LEU B 1 198 ? 8.210   59.926  44.787  1.00 90.93  ? 240 LEU B CA  1 
ATOM 3265 C C   . LEU B 1 198 ? 9.187   61.061  45.113  1.00 90.93  ? 240 LEU B C   1 
ATOM 3266 O O   . LEU B 1 198 ? 8.910   62.229  44.847  1.00 90.93  ? 240 LEU B O   1 
ATOM 3267 C CB  . LEU B 1 198 ? 6.855   60.132  45.467  1.00 90.93  ? 240 LEU B CB  1 
ATOM 3268 C CG  . LEU B 1 198 ? 6.516   61.409  46.235  1.00 90.93  ? 240 LEU B CG  1 
ATOM 3269 C CD1 . LEU B 1 198 ? 5.022   61.500  46.398  1.00 90.93  ? 240 LEU B CD1 1 
ATOM 3270 C CD2 . LEU B 1 198 ? 7.218   61.426  47.586  1.00 90.93  ? 240 LEU B CD2 1 
ATOM 3271 N N   . ASN B 1 199 ? 10.335  60.721  45.675  1.00 90.93  ? 241 ASN B N   1 
ATOM 3272 C CA  . ASN B 1 199 ? 11.321  61.736  46.018  1.00 90.93  ? 241 ASN B CA  1 
ATOM 3273 C C   . ASN B 1 199 ? 12.705  61.389  45.462  1.00 90.93  ? 241 ASN B C   1 
ATOM 3274 O O   . ASN B 1 199 ? 13.706  61.428  46.185  1.00 90.93  ? 241 ASN B O   1 
ATOM 3275 C CB  . ASN B 1 199 ? 11.349  61.917  47.537  1.00 90.93  ? 241 ASN B CB  1 
ATOM 3276 C CG  . ASN B 1 199 ? 11.375  60.593  48.277  1.00 90.93  ? 241 ASN B CG  1 
ATOM 3277 O OD1 . ASN B 1 199 ? 10.498  59.746  48.093  1.00 90.93  ? 241 ASN B OD1 1 
ATOM 3278 N ND2 . ASN B 1 199 ? 12.398  60.393  49.095  1.00 90.93  ? 241 ASN B ND2 1 
ATOM 3279 N N   . THR B 1 200 ? 12.742  61.143  44.149  1.00 90.93  ? 242 THR B N   1 
ATOM 3280 C CA  . THR B 1 200 ? 13.950  60.755  43.409  1.00 90.93  ? 242 THR B CA  1 
ATOM 3281 C C   . THR B 1 200 ? 14.838  61.870  42.848  1.00 90.93  ? 242 THR B C   1 
ATOM 3282 O O   . THR B 1 200 ? 15.948  62.113  43.342  1.00 90.93  ? 242 THR B O   1 
ATOM 3283 C CB  . THR B 1 200 ? 13.578  59.809  42.221  1.00 90.93  ? 242 THR B CB  1 
ATOM 3284 O OG1 . THR B 1 200 ? 12.510  60.383  41.447  1.00 90.93  ? 242 THR B OG1 1 
ATOM 3285 C CG2 . THR B 1 200 ? 13.161  58.439  42.746  1.00 90.93  ? 242 THR B CG2 1 
ATOM 3286 N N   . GLN B 1 201 ? 14.380  62.472  41.751  1.00 90.93  ? 243 GLN B N   1 
ATOM 3287 C CA  . GLN B 1 201 ? 15.121  63.535  41.076  1.00 90.93  ? 243 GLN B CA  1 
ATOM 3288 C C   . GLN B 1 201 ? 14.597  64.927  41.447  1.00 90.93  ? 243 GLN B C   1 
ATOM 3289 O O   . GLN B 1 201 ? 14.937  65.384  42.566  1.00 90.93  ? 243 GLN B O   1 
ATOM 3290 C CB  . GLN B 1 201 ? 15.115  63.298  39.539  1.00 90.93  ? 243 GLN B CB  1 
ATOM 3291 C CG  . GLN B 1 201 ? 16.128  62.201  39.069  1.00 90.93  ? 243 GLN B CG  1 
ATOM 3292 C CD  . GLN B 1 201 ? 15.957  61.727  37.609  1.00 90.93  ? 243 GLN B CD  1 
ATOM 3293 O OE1 . GLN B 1 201 ? 16.506  62.324  36.671  1.00 90.93  ? 243 GLN B OE1 1 
ATOM 3294 N NE2 . GLN B 1 201 ? 15.239  60.615  37.430  1.00 90.93  ? 243 GLN B NE2 1 
ATOM 3295 N N   . MET C 1 1   ? 46.841  -12.832 -8.037  1.00 182.68 ? 43  MET C N   1 
ATOM 3296 C CA  . MET C 1 1   ? 45.727  -12.317 -7.181  1.00 182.68 ? 43  MET C CA  1 
ATOM 3297 C C   . MET C 1 1   ? 45.385  -10.874 -7.533  1.00 182.68 ? 43  MET C C   1 
ATOM 3298 O O   . MET C 1 1   ? 45.778  -9.947  -6.824  1.00 182.68 ? 43  MET C O   1 
ATOM 3299 C CB  . MET C 1 1   ? 46.118  -12.393 -5.700  1.00 182.68 ? 43  MET C CB  1 
ATOM 3300 C CG  . MET C 1 1   ? 45.677  -13.661 -4.995  1.00 182.68 ? 43  MET C CG  1 
ATOM 3301 S SD  . MET C 1 1   ? 43.884  -13.898 -5.131  1.00 182.68 ? 43  MET C SD  1 
ATOM 3302 C CE  . MET C 1 1   ? 43.261  -12.753 -3.877  1.00 182.68 ? 43  MET C CE  1 
ATOM 3303 N N   . LEU C 1 2   ? 44.622  -10.693 -8.605  1.00 182.68 ? 44  LEU C N   1 
ATOM 3304 C CA  . LEU C 1 2   ? 44.240  -9.362  -9.057  1.00 182.68 ? 44  LEU C CA  1 
ATOM 3305 C C   . LEU C 1 2   ? 43.613  -8.474  -8.021  1.00 182.68 ? 44  LEU C C   1 
ATOM 3306 O O   . LEU C 1 2   ? 42.493  -8.712  -7.574  1.00 182.68 ? 44  LEU C O   1 
ATOM 3307 C CB  . LEU C 1 2   ? 43.335  -9.456  -10.262 1.00 182.68 ? 44  LEU C CB  1 
ATOM 3308 C CG  . LEU C 1 2   ? 44.288  -9.629  -11.419 1.00 182.68 ? 44  LEU C CG  1 
ATOM 3309 C CD1 . LEU C 1 2   ? 43.556  -10.193 -12.592 1.00 182.68 ? 44  LEU C CD1 1 
ATOM 3310 C CD2 . LEU C 1 2   ? 44.957  -8.289  -11.693 1.00 182.68 ? 44  LEU C CD2 1 
ATOM 3311 N N   . LYS C 1 3   ? 44.349  -7.436  -7.654  1.00 182.68 ? 45  LYS C N   1 
ATOM 3312 C CA  . LYS C 1 3   ? 43.866  -6.499  -6.669  1.00 182.68 ? 45  LYS C CA  1 
ATOM 3313 C C   . LYS C 1 3   ? 42.999  -5.470  -7.354  1.00 182.68 ? 45  LYS C C   1 
ATOM 3314 O O   . LYS C 1 3   ? 43.459  -4.404  -7.745  1.00 182.68 ? 45  LYS C O   1 
ATOM 3315 C CB  . LYS C 1 3   ? 45.017  -5.813  -5.957  1.00 182.68 ? 45  LYS C CB  1 
ATOM 3316 C CG  . LYS C 1 3   ? 44.547  -5.088  -4.722  1.00 182.68 ? 45  LYS C CG  1 
ATOM 3317 C CD  . LYS C 1 3   ? 45.688  -4.771  -3.777  1.00 182.68 ? 45  LYS C CD  1 
ATOM 3318 C CE  . LYS C 1 3   ? 45.168  -4.207  -2.458  1.00 182.68 ? 45  LYS C CE  1 
ATOM 3319 N NZ  . LYS C 1 3   ? 46.233  -4.071  -1.416  1.00 182.68 ? 45  LYS C NZ  1 
ATOM 3320 N N   . LEU C 1 4   ? 41.738  -5.828  -7.527  1.00 182.68 ? 46  LEU C N   1 
ATOM 3321 C CA  . LEU C 1 4   ? 40.764  -4.959  -8.157  1.00 182.68 ? 46  LEU C CA  1 
ATOM 3322 C C   . LEU C 1 4   ? 40.255  -4.017  -7.075  1.00 182.68 ? 46  LEU C C   1 
ATOM 3323 O O   . LEU C 1 4   ? 39.625  -2.996  -7.353  1.00 182.68 ? 46  LEU C O   1 
ATOM 3324 C CB  . LEU C 1 4   ? 39.630  -5.811  -8.707  1.00 182.68 ? 46  LEU C CB  1 
ATOM 3325 C CG  . LEU C 1 4   ? 40.136  -7.090  -9.376  1.00 182.68 ? 46  LEU C CG  1 
ATOM 3326 C CD1 . LEU C 1 4   ? 38.993  -8.040  -9.639  1.00 182.68 ? 46  LEU C CD1 1 
ATOM 3327 C CD2 . LEU C 1 4   ? 40.889  -6.763  -10.645 1.00 182.68 ? 46  LEU C CD2 1 
ATOM 3328 N N   . LEU C 1 5   ? 40.617  -4.353  -5.843  1.00 182.68 ? 47  LEU C N   1 
ATOM 3329 C CA  . LEU C 1 5   ? 40.259  -3.615  -4.641  1.00 182.68 ? 47  LEU C CA  1 
ATOM 3330 C C   . LEU C 1 5   ? 40.775  -2.181  -4.653  1.00 182.68 ? 47  LEU C C   1 
ATOM 3331 O O   . LEU C 1 5   ? 40.684  -1.457  -3.660  1.00 182.68 ? 47  LEU C O   1 
ATOM 3332 C CB  . LEU C 1 5   ? 40.800  -4.368  -3.439  1.00 182.68 ? 47  LEU C CB  1 
ATOM 3333 C CG  . LEU C 1 5   ? 40.449  -5.854  -3.440  1.00 182.68 ? 47  LEU C CG  1 
ATOM 3334 C CD1 . LEU C 1 5   ? 41.085  -6.505  -2.235  1.00 182.68 ? 47  LEU C CD1 1 
ATOM 3335 C CD2 . LEU C 1 5   ? 38.937  -6.048  -3.428  1.00 182.68 ? 47  LEU C CD2 1 
ATOM 3336 N N   . ASP C 1 6   ? 41.330  -1.779  -5.791  1.00 182.68 ? 48  ASP C N   1 
ATOM 3337 C CA  . ASP C 1 6   ? 41.840  -0.432  -5.964  1.00 182.68 ? 48  ASP C CA  1 
ATOM 3338 C C   . ASP C 1 6   ? 40.667  0.444   -6.363  1.00 182.68 ? 48  ASP C C   1 
ATOM 3339 O O   . ASP C 1 6   ? 40.844  1.511   -6.928  1.00 182.68 ? 48  ASP C O   1 
ATOM 3340 C CB  . ASP C 1 6   ? 42.925  -0.398  -7.047  1.00 182.68 ? 48  ASP C CB  1 
ATOM 3341 C CG  . ASP C 1 6   ? 44.148  -1.252  -6.695  1.00 182.68 ? 48  ASP C CG  1 
ATOM 3342 O OD1 . ASP C 1 6   ? 44.100  -2.011  -5.701  1.00 182.68 ? 48  ASP C OD1 1 
ATOM 3343 O OD2 . ASP C 1 6   ? 45.163  -1.178  -7.422  1.00 182.68 ? 48  ASP C OD2 1 
ATOM 3344 N N   . ASN C 1 7   ? 39.458  -0.020  -6.074  1.00 182.68 ? 49  ASN C N   1 
ATOM 3345 C CA  . ASN C 1 7   ? 38.262  0.731   -6.395  1.00 182.68 ? 49  ASN C CA  1 
ATOM 3346 C C   . ASN C 1 7   ? 38.405  2.175   -5.921  1.00 182.68 ? 49  ASN C C   1 
ATOM 3347 O O   . ASN C 1 7   ? 37.607  3.047   -6.283  1.00 182.68 ? 49  ASN C O   1 
ATOM 3348 C CB  . ASN C 1 7   ? 37.051  0.093   -5.736  1.00 182.68 ? 49  ASN C CB  1 
ATOM 3349 C CG  . ASN C 1 7   ? 35.758  0.493   -6.406  1.00 182.68 ? 49  ASN C CG  1 
ATOM 3350 O OD1 . ASN C 1 7   ? 35.697  1.486   -7.131  1.00 182.68 ? 49  ASN C OD1 1 
ATOM 3351 N ND2 . ASN C 1 7   ? 34.714  -0.289  -6.180  1.00 182.68 ? 49  ASN C ND2 1 
ATOM 3352 N N   . TRP C 1 8   ? 39.389  2.408   -5.054  1.00 173.39 ? 50  TRP C N   1 
ATOM 3353 C CA  . TRP C 1 8   ? 39.668  3.750   -4.574  1.00 173.39 ? 50  TRP C CA  1 
ATOM 3354 C C   . TRP C 1 8   ? 40.299  4.478   -5.763  1.00 173.39 ? 50  TRP C C   1 
ATOM 3355 O O   . TRP C 1 8   ? 39.808  5.516   -6.175  1.00 173.39 ? 50  TRP C O   1 
ATOM 3356 C CB  . TRP C 1 8   ? 40.632  3.748   -3.382  1.00 173.39 ? 50  TRP C CB  1 
ATOM 3357 C CG  . TRP C 1 8   ? 40.240  2.867   -2.190  1.00 173.39 ? 50  TRP C CG  1 
ATOM 3358 C CD1 . TRP C 1 8   ? 40.729  1.630   -1.903  1.00 173.39 ? 50  TRP C CD1 1 
ATOM 3359 C CD2 . TRP C 1 8   ? 39.342  3.196   -1.107  1.00 173.39 ? 50  TRP C CD2 1 
ATOM 3360 N NE1 . TRP C 1 8   ? 40.212  1.164   -0.716  1.00 173.39 ? 50  TRP C NE1 1 
ATOM 3361 C CE2 . TRP C 1 8   ? 39.356  2.105   -0.202  1.00 173.39 ? 50  TRP C CE2 1 
ATOM 3362 C CE3 . TRP C 1 8   ? 38.533  4.302   -0.811  1.00 173.39 ? 50  TRP C CE3 1 
ATOM 3363 C CZ2 . TRP C 1 8   ? 38.594  2.086   0.975   1.00 173.39 ? 50  TRP C CZ2 1 
ATOM 3364 C CZ3 . TRP C 1 8   ? 37.772  4.281   0.366   1.00 173.39 ? 50  TRP C CZ3 1 
ATOM 3365 C CH2 . TRP C 1 8   ? 37.812  3.179   1.241   1.00 173.39 ? 50  TRP C CH2 1 
ATOM 3366 N N   . ASP C 1 9   ? 41.337  3.879   -6.351  1.00 173.39 ? 51  ASP C N   1 
ATOM 3367 C CA  . ASP C 1 9   ? 42.037  4.445   -7.513  1.00 173.39 ? 51  ASP C CA  1 
ATOM 3368 C C   . ASP C 1 9   ? 41.053  4.968   -8.539  1.00 173.39 ? 51  ASP C C   1 
ATOM 3369 O O   . ASP C 1 9   ? 41.223  6.052   -9.088  1.00 173.39 ? 51  ASP C O   1 
ATOM 3370 C CB  . ASP C 1 9   ? 42.925  3.384   -8.170  1.00 173.39 ? 51  ASP C CB  1 
ATOM 3371 C CG  . ASP C 1 9   ? 43.375  3.780   -9.562  1.00 173.39 ? 51  ASP C CG  1 
ATOM 3372 O OD1 . ASP C 1 9   ? 44.282  4.631   -9.673  1.00 173.39 ? 51  ASP C OD1 1 
ATOM 3373 O OD2 . ASP C 1 9   ? 42.788  3.255   -10.535 1.00 173.39 ? 51  ASP C OD2 1 
ATOM 3374 N N   . SER C 1 10  ? 40.017  4.180   -8.778  1.00 173.39 ? 52  SER C N   1 
ATOM 3375 C CA  . SER C 1 10  ? 38.987  4.536   -9.723  1.00 173.39 ? 52  SER C CA  1 
ATOM 3376 C C   . SER C 1 10  ? 38.240  5.794   -9.295  1.00 173.39 ? 52  SER C C   1 
ATOM 3377 O O   . SER C 1 10  ? 38.053  6.708   -10.089 1.00 173.39 ? 52  SER C O   1 
ATOM 3378 C CB  . SER C 1 10  ? 38.019  3.369   -9.853  1.00 173.39 ? 52  SER C CB  1 
ATOM 3379 O OG  . SER C 1 10  ? 36.857  3.772   -10.533 1.00 173.39 ? 52  SER C OG  1 
ATOM 3380 N N   . VAL C 1 11  ? 37.852  5.853   -8.030  1.00 173.39 ? 53  VAL C N   1 
ATOM 3381 C CA  . VAL C 1 11  ? 37.106  6.992   -7.533  1.00 173.39 ? 53  VAL C CA  1 
ATOM 3382 C C   . VAL C 1 11  ? 37.933  8.233   -7.198  1.00 173.39 ? 53  VAL C C   1 
ATOM 3383 O O   . VAL C 1 11  ? 37.572  9.342   -7.568  1.00 173.39 ? 53  VAL C O   1 
ATOM 3384 C CB  . VAL C 1 11  ? 36.229  6.576   -6.350  1.00 173.39 ? 53  VAL C CB  1 
ATOM 3385 C CG1 . VAL C 1 11  ? 35.366  5.383   -6.744  1.00 173.39 ? 53  VAL C CG1 1 
ATOM 3386 C CG2 . VAL C 1 11  ? 37.075  6.231   -5.145  1.00 173.39 ? 53  VAL C CG2 1 
ATOM 3387 N N   . THR C 1 12  ? 39.037  8.036   -6.495  1.00 181.14 ? 54  THR C N   1 
ATOM 3388 C CA  . THR C 1 12  ? 39.929  9.113   -6.086  1.00 181.14 ? 54  THR C CA  1 
ATOM 3389 C C   . THR C 1 12  ? 40.358  10.019  -7.238  1.00 181.14 ? 54  THR C C   1 
ATOM 3390 O O   . THR C 1 12  ? 39.954  11.181  -7.307  1.00 181.14 ? 54  THR C O   1 
ATOM 3391 C CB  . THR C 1 12  ? 41.181  8.530   -5.380  1.00 181.14 ? 54  THR C CB  1 
ATOM 3392 O OG1 . THR C 1 12  ? 41.819  7.576   -6.239  1.00 181.14 ? 54  THR C OG1 1 
ATOM 3393 C CG2 . THR C 1 12  ? 40.784  7.843   -4.071  1.00 181.14 ? 54  THR C CG2 1 
ATOM 3394 N N   . SER C 1 13  ? 41.137  9.460   -8.159  1.00 181.14 ? 55  SER C N   1 
ATOM 3395 C CA  . SER C 1 13  ? 41.651  10.186  -9.320  1.00 181.14 ? 55  SER C CA  1 
ATOM 3396 C C   . SER C 1 13  ? 40.561  10.895  -10.116 1.00 181.14 ? 55  SER C C   1 
ATOM 3397 O O   . SER C 1 13  ? 40.821  11.881  -10.808 1.00 181.14 ? 55  SER C O   1 
ATOM 3398 C CB  . SER C 1 13  ? 42.397  9.211   -10.232 1.00 181.14 ? 55  SER C CB  1 
ATOM 3399 O OG  . SER C 1 13  ? 41.539  8.146   -10.608 1.00 181.14 ? 55  SER C OG  1 
ATOM 3400 N N   . THR C 1 14  ? 39.338  10.399  -9.980  1.00 181.14 ? 56  THR C N   1 
ATOM 3401 C CA  . THR C 1 14  ? 38.198  10.951  -10.696 1.00 181.14 ? 56  THR C CA  1 
ATOM 3402 C C   . THR C 1 14  ? 37.410  11.991  -9.914  1.00 181.14 ? 56  THR C C   1 
ATOM 3403 O O   . THR C 1 14  ? 37.382  13.174  -10.258 1.00 181.14 ? 56  THR C O   1 
ATOM 3404 C CB  . THR C 1 14  ? 37.232  9.827   -11.090 1.00 181.14 ? 56  THR C CB  1 
ATOM 3405 O OG1 . THR C 1 14  ? 36.823  9.108   -9.918  1.00 181.14 ? 56  THR C OG1 1 
ATOM 3406 C CG2 . THR C 1 14  ? 37.912  8.870   -12.038 1.00 181.14 ? 56  THR C CG2 1 
ATOM 3407 N N   . PHE C 1 15  ? 36.747  11.516  -8.870  1.00 181.14 ? 57  PHE C N   1 
ATOM 3408 C CA  . PHE C 1 15  ? 35.903  12.332  -8.030  1.00 181.14 ? 57  PHE C CA  1 
ATOM 3409 C C   . PHE C 1 15  ? 36.628  13.300  -7.110  1.00 181.14 ? 57  PHE C C   1 
ATOM 3410 O O   . PHE C 1 15  ? 36.347  14.497  -7.126  1.00 181.14 ? 57  PHE C O   1 
ATOM 3411 C CB  . PHE C 1 15  ? 34.978  11.418  -7.222  1.00 181.14 ? 57  PHE C CB  1 
ATOM 3412 C CG  . PHE C 1 15  ? 34.203  10.432  -8.068  1.00 181.14 ? 57  PHE C CG  1 
ATOM 3413 C CD1 . PHE C 1 15  ? 33.299  10.873  -9.028  1.00 181.14 ? 57  PHE C CD1 1 
ATOM 3414 C CD2 . PHE C 1 15  ? 34.386  9.065   -7.909  1.00 181.14 ? 57  PHE C CD2 1 
ATOM 3415 C CE1 . PHE C 1 15  ? 32.585  9.960   -9.818  1.00 181.14 ? 57  PHE C CE1 1 
ATOM 3416 C CE2 . PHE C 1 15  ? 33.678  8.145   -8.695  1.00 181.14 ? 57  PHE C CE2 1 
ATOM 3417 C CZ  . PHE C 1 15  ? 32.776  8.596   -9.649  1.00 181.14 ? 57  PHE C CZ  1 
ATOM 3418 N N   . SER C 1 16  ? 37.572  12.792  -6.329  1.00 181.14 ? 58  SER C N   1 
ATOM 3419 C CA  . SER C 1 16  ? 38.299  13.630  -5.383  1.00 181.14 ? 58  SER C CA  1 
ATOM 3420 C C   . SER C 1 16  ? 38.939  14.877  -5.985  1.00 181.14 ? 58  SER C C   1 
ATOM 3421 O O   . SER C 1 16  ? 38.853  15.954  -5.398  1.00 181.14 ? 58  SER C O   1 
ATOM 3422 C CB  . SER C 1 16  ? 39.348  12.818  -4.631  1.00 181.14 ? 58  SER C CB  1 
ATOM 3423 O OG  . SER C 1 16  ? 39.915  13.586  -3.583  1.00 181.14 ? 58  SER C OG  1 
ATOM 3424 N N   . LYS C 1 17  ? 39.546  14.745  -7.163  1.00 181.14 ? 59  LYS C N   1 
ATOM 3425 C CA  . LYS C 1 17  ? 40.193  15.889  -7.801  1.00 181.14 ? 59  LYS C CA  1 
ATOM 3426 C C   . LYS C 1 17  ? 39.243  17.053  -8.014  1.00 181.14 ? 59  LYS C C   1 
ATOM 3427 O O   . LYS C 1 17  ? 39.536  18.176  -7.625  1.00 181.14 ? 59  LYS C O   1 
ATOM 3428 C CB  . LYS C 1 17  ? 40.815  15.518  -9.151  1.00 181.14 ? 59  LYS C CB  1 
ATOM 3429 C CG  . LYS C 1 17  ? 41.369  16.748  -9.883  1.00 181.14 ? 59  LYS C CG  1 
ATOM 3430 C CD  . LYS C 1 17  ? 42.023  16.454  -11.222 1.00 181.14 ? 59  LYS C CD  1 
ATOM 3431 C CE  . LYS C 1 17  ? 42.596  17.740  -11.826 1.00 181.14 ? 59  LYS C CE  1 
ATOM 3432 N NZ  . LYS C 1 17  ? 43.369  17.522  -13.083 1.00 181.14 ? 59  LYS C NZ  1 
ATOM 3433 N N   . LEU C 1 18  ? 38.098  16.781  -8.626  1.00 181.14 ? 60  LEU C N   1 
ATOM 3434 C CA  . LEU C 1 18  ? 37.129  17.828  -8.909  1.00 181.14 ? 60  LEU C CA  1 
ATOM 3435 C C   . LEU C 1 18  ? 36.732  18.642  -7.686  1.00 181.14 ? 60  LEU C C   1 
ATOM 3436 O O   . LEU C 1 18  ? 36.495  19.841  -7.789  1.00 181.14 ? 60  LEU C O   1 
ATOM 3437 C CB  . LEU C 1 18  ? 35.877  17.243  -9.554  1.00 181.14 ? 60  LEU C CB  1 
ATOM 3438 C CG  . LEU C 1 18  ? 34.931  18.302  -10.118 1.00 181.14 ? 60  LEU C CG  1 
ATOM 3439 C CD1 . LEU C 1 18  ? 35.609  19.046  -11.262 1.00 181.14 ? 60  LEU C CD1 1 
ATOM 3440 C CD2 . LEU C 1 18  ? 33.645  17.657  -10.580 1.00 181.14 ? 60  LEU C CD2 1 
ATOM 3441 N N   . ARG C 1 19  ? 36.648  17.981  -6.538  1.00 181.14 ? 61  ARG C N   1 
ATOM 3442 C CA  . ARG C 1 19  ? 36.268  18.637  -5.292  1.00 181.14 ? 61  ARG C CA  1 
ATOM 3443 C C   . ARG C 1 19  ? 37.396  19.439  -4.651  1.00 181.14 ? 61  ARG C C   1 
ATOM 3444 O O   . ARG C 1 19  ? 37.254  20.640  -4.411  1.00 181.14 ? 61  ARG C O   1 
ATOM 3445 C CB  . ARG C 1 19  ? 35.748  17.593  -4.302  1.00 181.14 ? 61  ARG C CB  1 
ATOM 3446 C CG  . ARG C 1 19  ? 35.672  18.065  -2.860  1.00 181.14 ? 61  ARG C CG  1 
ATOM 3447 C CD  . ARG C 1 19  ? 35.481  16.886  -1.932  1.00 181.14 ? 61  ARG C CD  1 
ATOM 3448 N NE  . ARG C 1 19  ? 36.116  17.103  -0.635  1.00 181.14 ? 61  ARG C NE  1 
ATOM 3449 C CZ  . ARG C 1 19  ? 36.262  16.163  0.295   1.00 181.14 ? 61  ARG C CZ  1 
ATOM 3450 N NH1 . ARG C 1 19  ? 35.817  14.930  0.078   1.00 181.14 ? 61  ARG C NH1 1 
ATOM 3451 N NH2 . ARG C 1 19  ? 36.859  16.453  1.444   1.00 181.14 ? 61  ARG C NH2 1 
ATOM 3452 N N   . GLU C 1 20  ? 38.497  18.758  -4.350  1.00 181.14 ? 62  GLU C N   1 
ATOM 3453 C CA  . GLU C 1 20  ? 39.652  19.388  -3.718  1.00 181.14 ? 62  GLU C CA  1 
ATOM 3454 C C   . GLU C 1 20  ? 40.235  20.477  -4.618  1.00 181.14 ? 62  GLU C C   1 
ATOM 3455 O O   . GLU C 1 20  ? 40.644  21.539  -4.143  1.00 181.14 ? 62  GLU C O   1 
ATOM 3456 C CB  . GLU C 1 20  ? 40.706  18.326  -3.369  1.00 181.14 ? 62  GLU C CB  1 
ATOM 3457 C CG  . GLU C 1 20  ? 41.726  18.765  -2.309  1.00 181.14 ? 62  GLU C CG  1 
ATOM 3458 C CD  . GLU C 1 20  ? 42.341  17.601  -1.524  1.00 181.14 ? 62  GLU C CD  1 
ATOM 3459 O OE1 . GLU C 1 20  ? 41.696  16.536  -1.406  1.00 181.14 ? 62  GLU C OE1 1 
ATOM 3460 O OE2 . GLU C 1 20  ? 43.468  17.762  -1.001  1.00 181.14 ? 62  GLU C OE2 1 
ATOM 3461 N N   . GLN C 1 21  ? 40.199  20.235  -5.924  1.00 181.14 ? 63  GLN C N   1 
ATOM 3462 C CA  . GLN C 1 21  ? 40.723  21.190  -6.889  1.00 181.14 ? 63  GLN C CA  1 
ATOM 3463 C C   . GLN C 1 21  ? 39.761  22.343  -7.155  1.00 181.14 ? 63  GLN C C   1 
ATOM 3464 O O   . GLN C 1 21  ? 40.120  23.311  -7.825  1.00 181.14 ? 63  GLN C O   1 
ATOM 3465 C CB  . GLN C 1 21  ? 41.100  20.482  -8.190  1.00 181.14 ? 63  GLN C CB  1 
ATOM 3466 C CG  . GLN C 1 21  ? 42.265  19.508  -8.069  1.00 181.14 ? 63  GLN C CG  1 
ATOM 3467 C CD  . GLN C 1 21  ? 43.603  20.201  -7.903  1.00 181.14 ? 63  GLN C CD  1 
ATOM 3468 O OE1 . GLN C 1 21  ? 43.895  21.187  -8.585  1.00 181.14 ? 63  GLN C OE1 1 
ATOM 3469 N NE2 . GLN C 1 21  ? 44.433  19.676  -7.005  1.00 181.14 ? 63  GLN C NE2 1 
ATOM 3470 N N   . LEU C 1 22  ? 38.537  22.240  -6.646  1.00 181.14 ? 64  LEU C N   1 
ATOM 3471 C CA  . LEU C 1 22  ? 37.588  23.322  -6.832  1.00 181.14 ? 64  LEU C CA  1 
ATOM 3472 C C   . LEU C 1 22  ? 37.583  24.225  -5.609  1.00 181.14 ? 64  LEU C C   1 
ATOM 3473 O O   . LEU C 1 22  ? 36.709  25.071  -5.436  1.00 181.14 ? 64  LEU C O   1 
ATOM 3474 C CB  . LEU C 1 22  ? 36.197  22.810  -7.152  1.00 181.14 ? 64  LEU C CB  1 
ATOM 3475 C CG  . LEU C 1 22  ? 35.426  23.895  -7.901  1.00 181.14 ? 64  LEU C CG  1 
ATOM 3476 C CD1 . LEU C 1 22  ? 36.302  24.547  -8.978  1.00 181.14 ? 64  LEU C CD1 1 
ATOM 3477 C CD2 . LEU C 1 22  ? 34.183  23.292  -8.500  1.00 181.14 ? 64  LEU C CD2 1 
ATOM 3478 N N   . GLY C 1 23  ? 38.608  24.039  -4.783  1.00 181.14 ? 65  GLY C N   1 
ATOM 3479 C CA  . GLY C 1 23  ? 38.799  24.843  -3.595  1.00 181.14 ? 65  GLY C CA  1 
ATOM 3480 C C   . GLY C 1 23  ? 39.179  26.276  -3.929  1.00 181.14 ? 65  GLY C C   1 
ATOM 3481 O O   . GLY C 1 23  ? 39.009  27.139  -3.072  1.00 181.14 ? 65  GLY C O   1 
ATOM 3482 N N   . PRO C 1 24  ? 39.731  26.572  -5.129  1.00 168.93 ? 66  PRO C N   1 
ATOM 3483 C CA  . PRO C 1 24  ? 40.089  27.948  -5.475  1.00 168.93 ? 66  PRO C CA  1 
ATOM 3484 C C   . PRO C 1 24  ? 38.893  28.884  -5.415  1.00 168.93 ? 66  PRO C C   1 
ATOM 3485 O O   . PRO C 1 24  ? 39.019  30.081  -5.657  1.00 168.93 ? 66  PRO C O   1 
ATOM 3486 C CB  . PRO C 1 24  ? 40.606  27.816  -6.910  1.00 168.93 ? 66  PRO C CB  1 
ATOM 3487 C CG  . PRO C 1 24  ? 40.010  26.526  -7.389  1.00 168.93 ? 66  PRO C CG  1 
ATOM 3488 C CD  . PRO C 1 24  ? 40.222  25.680  -6.187  1.00 168.93 ? 66  PRO C CD  1 
ATOM 3489 N N   . VAL C 1 25  ? 37.728  28.308  -5.140  1.00 168.93 ? 67  VAL C N   1 
ATOM 3490 C CA  . VAL C 1 25  ? 36.488  29.048  -5.012  1.00 168.93 ? 67  VAL C CA  1 
ATOM 3491 C C   . VAL C 1 25  ? 36.589  30.120  -3.918  1.00 168.93 ? 67  VAL C C   1 
ATOM 3492 O O   . VAL C 1 25  ? 36.574  31.314  -4.215  1.00 168.93 ? 67  VAL C O   1 
ATOM 3493 C CB  . VAL C 1 25  ? 35.301  28.070  -4.738  1.00 168.93 ? 67  VAL C CB  1 
ATOM 3494 C CG1 . VAL C 1 25  ? 35.617  27.118  -3.578  1.00 168.93 ? 67  VAL C CG1 1 
ATOM 3495 C CG2 . VAL C 1 25  ? 34.023  28.838  -4.480  1.00 168.93 ? 67  VAL C CG2 1 
ATOM 3496 N N   . THR C 1 26  ? 36.739  29.691  -2.665  1.00 168.93 ? 68  THR C N   1 
ATOM 3497 C CA  . THR C 1 26  ? 36.843  30.611  -1.532  1.00 168.93 ? 68  THR C CA  1 
ATOM 3498 C C   . THR C 1 26  ? 38.091  31.479  -1.667  1.00 168.93 ? 68  THR C C   1 
ATOM 3499 O O   . THR C 1 26  ? 38.151  32.598  -1.152  1.00 168.93 ? 68  THR C O   1 
ATOM 3500 C CB  . THR C 1 26  ? 36.864  29.847  -0.182  1.00 168.93 ? 68  THR C CB  1 
ATOM 3501 O OG1 . THR C 1 26  ? 37.027  30.774  0.899   1.00 168.93 ? 68  THR C OG1 1 
ATOM 3502 C CG2 . THR C 1 26  ? 37.994  28.824  -0.152  1.00 168.93 ? 68  THR C CG2 1 
ATOM 3503 N N   . GLN C 1 27  ? 39.076  30.945  -2.381  1.00 168.93 ? 69  GLN C N   1 
ATOM 3504 C CA  . GLN C 1 27  ? 40.327  31.637  -2.637  1.00 168.93 ? 69  GLN C CA  1 
ATOM 3505 C C   . GLN C 1 27  ? 40.034  32.895  -3.452  1.00 168.93 ? 69  GLN C C   1 
ATOM 3506 O O   . GLN C 1 27  ? 40.030  34.005  -2.915  1.00 168.93 ? 69  GLN C O   1 
ATOM 3507 C CB  . GLN C 1 27  ? 41.283  30.722  -3.418  1.00 168.93 ? 69  GLN C CB  1 
ATOM 3508 C CG  . GLN C 1 27  ? 42.553  31.409  -3.919  1.00 168.93 ? 69  GLN C CG  1 
ATOM 3509 C CD  . GLN C 1 27  ? 43.301  30.598  -4.965  1.00 168.93 ? 69  GLN C CD  1 
ATOM 3510 O OE1 . GLN C 1 27  ? 42.702  29.850  -5.738  1.00 168.93 ? 69  GLN C OE1 1 
ATOM 3511 N NE2 . GLN C 1 27  ? 44.621  30.758  -5.000  1.00 168.93 ? 69  GLN C NE2 1 
ATOM 3512 N N   . GLU C 1 28  ? 39.743  32.705  -4.738  1.00 168.93 ? 70  GLU C N   1 
ATOM 3513 C CA  . GLU C 1 28  ? 39.466  33.818  -5.640  1.00 168.93 ? 70  GLU C CA  1 
ATOM 3514 C C   . GLU C 1 28  ? 38.213  34.603  -5.295  1.00 168.93 ? 70  GLU C C   1 
ATOM 3515 O O   . GLU C 1 28  ? 38.162  35.812  -5.488  1.00 168.93 ? 70  GLU C O   1 
ATOM 3516 C CB  . GLU C 1 28  ? 39.418  33.352  -7.098  1.00 168.93 ? 70  GLU C CB  1 
ATOM 3517 C CG  . GLU C 1 28  ? 40.761  32.862  -7.631  1.00 168.93 ? 70  GLU C CG  1 
ATOM 3518 C CD  . GLU C 1 28  ? 40.910  33.046  -9.133  1.00 168.93 ? 70  GLU C CD  1 
ATOM 3519 O OE1 . GLU C 1 28  ? 39.881  32.995  -9.848  1.00 168.93 ? 70  GLU C OE1 1 
ATOM 3520 O OE2 . GLU C 1 28  ? 42.057  33.244  -9.598  1.00 168.93 ? 70  GLU C OE2 1 
ATOM 3521 N N   . PHE C 1 29  ? 37.200  33.923  -4.783  1.00 168.93 ? 71  PHE C N   1 
ATOM 3522 C CA  . PHE C 1 29  ? 35.979  34.607  -4.425  1.00 168.93 ? 71  PHE C CA  1 
ATOM 3523 C C   . PHE C 1 29  ? 36.032  35.229  -3.053  1.00 168.93 ? 71  PHE C C   1 
ATOM 3524 O O   . PHE C 1 29  ? 36.352  36.404  -2.924  1.00 168.93 ? 71  PHE C O   1 
ATOM 3525 C CB  . PHE C 1 29  ? 34.776  33.680  -4.546  1.00 168.93 ? 71  PHE C CB  1 
ATOM 3526 C CG  . PHE C 1 29  ? 33.986  33.899  -5.789  1.00 168.93 ? 71  PHE C CG  1 
ATOM 3527 C CD1 . PHE C 1 29  ? 34.541  34.591  -6.863  1.00 168.93 ? 71  PHE C CD1 1 
ATOM 3528 C CD2 . PHE C 1 29  ? 32.681  33.440  -5.885  1.00 168.93 ? 71  PHE C CD2 1 
ATOM 3529 C CE1 . PHE C 1 29  ? 33.813  34.819  -8.012  1.00 168.93 ? 71  PHE C CE1 1 
ATOM 3530 C CE2 . PHE C 1 29  ? 31.942  33.662  -7.034  1.00 168.93 ? 71  PHE C CE2 1 
ATOM 3531 C CZ  . PHE C 1 29  ? 32.509  34.358  -8.100  1.00 168.93 ? 71  PHE C CZ  1 
ATOM 3532 N N   . TRP C 1 30  ? 35.788  34.411  -2.034  1.00 168.93 ? 72  TRP C N   1 
ATOM 3533 C CA  . TRP C 1 30  ? 35.747  34.866  -0.653  1.00 168.93 ? 72  TRP C CA  1 
ATOM 3534 C C   . TRP C 1 30  ? 36.822  35.878  -0.285  1.00 168.93 ? 72  TRP C C   1 
ATOM 3535 O O   . TRP C 1 30  ? 36.503  37.013  0.058   1.00 168.93 ? 72  TRP C O   1 
ATOM 3536 C CB  . TRP C 1 30  ? 35.754  33.660  0.296   1.00 168.93 ? 72  TRP C CB  1 
ATOM 3537 C CG  . TRP C 1 30  ? 34.633  33.646  1.330   1.00 168.93 ? 72  TRP C CG  1 
ATOM 3538 C CD1 . TRP C 1 30  ? 34.695  34.114  2.611   1.00 168.93 ? 72  TRP C CD1 1 
ATOM 3539 C CD2 . TRP C 1 30  ? 33.307  33.091  1.178   1.00 168.93 ? 72  TRP C CD2 1 
ATOM 3540 N NE1 . TRP C 1 30  ? 33.506  33.886  3.267   1.00 168.93 ? 72  TRP C NE1 1 
ATOM 3541 C CE2 . TRP C 1 30  ? 32.637  33.259  2.413   1.00 168.93 ? 72  TRP C CE2 1 
ATOM 3542 C CE3 . TRP C 1 30  ? 32.624  32.469  0.122   1.00 168.93 ? 72  TRP C CE3 1 
ATOM 3543 C CZ2 . TRP C 1 30  ? 31.316  32.828  2.623   1.00 168.93 ? 72  TRP C CZ2 1 
ATOM 3544 C CZ3 . TRP C 1 30  ? 31.310  32.040  0.334   1.00 168.93 ? 72  TRP C CZ3 1 
ATOM 3545 C CH2 . TRP C 1 30  ? 30.673  32.222  1.576   1.00 168.93 ? 72  TRP C CH2 1 
ATOM 3546 N N   . ASP C 1 31  ? 38.088  35.515  -0.430  1.00 168.93 ? 73  ASP C N   1 
ATOM 3547 C CA  . ASP C 1 31  ? 39.135  36.451  -0.076  1.00 168.93 ? 73  ASP C CA  1 
ATOM 3548 C C   . ASP C 1 31  ? 39.149  37.720  -0.909  1.00 168.93 ? 73  ASP C C   1 
ATOM 3549 O O   . ASP C 1 31  ? 39.625  38.749  -0.442  1.00 168.93 ? 73  ASP C O   1 
ATOM 3550 C CB  . ASP C 1 31  ? 40.494  35.771  -0.013  1.00 168.93 ? 73  ASP C CB  1 
ATOM 3551 C CG  . ASP C 1 31  ? 40.765  35.170  1.356   1.00 168.93 ? 73  ASP C CG  1 
ATOM 3552 O OD1 . ASP C 1 31  ? 40.229  34.078  1.648   1.00 168.93 ? 73  ASP C OD1 1 
ATOM 3553 O OD2 . ASP C 1 31  ? 41.493  35.806  2.150   1.00 168.93 ? 73  ASP C OD2 1 
ATOM 3554 N N   . ASN C 1 32  ? 38.614  37.661  -2.126  1.00 168.93 ? 74  ASN C N   1 
ATOM 3555 C CA  . ASN C 1 32  ? 38.528  38.854  -2.967  1.00 168.93 ? 74  ASN C CA  1 
ATOM 3556 C C   . ASN C 1 32  ? 37.368  39.681  -2.444  1.00 168.93 ? 74  ASN C C   1 
ATOM 3557 O O   . ASN C 1 32  ? 37.418  40.912  -2.421  1.00 168.93 ? 74  ASN C O   1 
ATOM 3558 C CB  . ASN C 1 32  ? 38.237  38.493  -4.426  1.00 168.93 ? 74  ASN C CB  1 
ATOM 3559 C CG  . ASN C 1 32  ? 39.493  38.299  -5.246  1.00 168.93 ? 74  ASN C CG  1 
ATOM 3560 O OD1 . ASN C 1 32  ? 40.599  38.227  -4.708  1.00 168.93 ? 74  ASN C OD1 1 
ATOM 3561 N ND2 . ASN C 1 32  ? 39.327  38.196  -6.561  1.00 168.93 ? 74  ASN C ND2 1 
ATOM 3562 N N   . LEU C 1 33  ? 36.327  38.973  -2.018  1.00 168.93 ? 75  LEU C N   1 
ATOM 3563 C CA  . LEU C 1 33  ? 35.119  39.582  -1.491  1.00 168.93 ? 75  LEU C CA  1 
ATOM 3564 C C   . LEU C 1 33  ? 35.431  40.297  -0.201  1.00 168.93 ? 75  LEU C C   1 
ATOM 3565 O O   . LEU C 1 33  ? 35.507  41.512  -0.176  1.00 168.93 ? 75  LEU C O   1 
ATOM 3566 C CB  . LEU C 1 33  ? 34.048  38.517  -1.233  1.00 168.93 ? 75  LEU C CB  1 
ATOM 3567 C CG  . LEU C 1 33  ? 33.784  37.484  -2.333  1.00 168.93 ? 75  LEU C CG  1 
ATOM 3568 C CD1 . LEU C 1 33  ? 32.596  36.613  -1.955  1.00 168.93 ? 75  LEU C CD1 1 
ATOM 3569 C CD2 . LEU C 1 33  ? 33.580  38.161  -3.680  1.00 168.93 ? 75  LEU C CD2 1 
ATOM 3570 N N   . GLU C 1 34  ? 35.649  39.533  0.862   1.00 168.93 ? 76  GLU C N   1 
ATOM 3571 C CA  . GLU C 1 34  ? 35.963  40.107  2.162   1.00 168.93 ? 76  GLU C CA  1 
ATOM 3572 C C   . GLU C 1 34  ? 37.044  41.189  2.053   1.00 168.93 ? 76  GLU C C   1 
ATOM 3573 O O   . GLU C 1 34  ? 37.061  42.129  2.846   1.00 168.93 ? 76  GLU C O   1 
ATOM 3574 C CB  . GLU C 1 34  ? 36.389  39.006  3.139   1.00 168.93 ? 76  GLU C CB  1 
ATOM 3575 C CG  . GLU C 1 34  ? 36.540  39.473  4.590   1.00 168.93 ? 76  GLU C CG  1 
ATOM 3576 C CD  . GLU C 1 34  ? 37.977  39.409  5.110   1.00 168.93 ? 76  GLU C CD  1 
ATOM 3577 O OE1 . GLU C 1 34  ? 38.928  39.377  4.291   1.00 168.93 ? 76  GLU C OE1 1 
ATOM 3578 O OE2 . GLU C 1 34  ? 38.152  39.401  6.351   1.00 168.93 ? 76  GLU C OE2 1 
ATOM 3579 N N   . LYS C 1 35  ? 37.913  41.069  1.047   1.00 168.93 ? 77  LYS C N   1 
ATOM 3580 C CA  . LYS C 1 35  ? 38.987  42.039  0.817   1.00 168.93 ? 77  LYS C CA  1 
ATOM 3581 C C   . LYS C 1 35  ? 38.426  43.361  0.309   1.00 168.93 ? 77  LYS C C   1 
ATOM 3582 O O   . LYS C 1 35  ? 38.945  44.424  0.635   1.00 168.93 ? 77  LYS C O   1 
ATOM 3583 C CB  . LYS C 1 35  ? 40.002  41.497  -0.192  1.00 168.93 ? 77  LYS C CB  1 
ATOM 3584 C CG  . LYS C 1 35  ? 41.268  42.337  -0.336  1.00 168.93 ? 77  LYS C CG  1 
ATOM 3585 C CD  . LYS C 1 35  ? 42.267  41.691  -1.296  1.00 168.93 ? 77  LYS C CD  1 
ATOM 3586 C CE  . LYS C 1 35  ? 43.577  42.484  -1.373  1.00 168.93 ? 77  LYS C CE  1 
ATOM 3587 N NZ  . LYS C 1 35  ? 44.586  41.864  -2.293  1.00 168.93 ? 77  LYS C NZ  1 
ATOM 3588 N N   . GLU C 1 36  ? 37.401  43.294  -0.531  1.00 168.93 ? 78  GLU C N   1 
ATOM 3589 C CA  . GLU C 1 36  ? 36.783  44.508  -1.043  1.00 168.93 ? 78  GLU C CA  1 
ATOM 3590 C C   . GLU C 1 36  ? 35.650  44.957  -0.130  1.00 168.93 ? 78  GLU C C   1 
ATOM 3591 O O   . GLU C 1 36  ? 35.525  46.141  0.166   1.00 168.93 ? 78  GLU C O   1 
ATOM 3592 C CB  . GLU C 1 36  ? 36.288  44.308  -2.464  1.00 168.93 ? 78  GLU C CB  1 
ATOM 3593 C CG  . GLU C 1 36  ? 37.416  44.123  -3.446  1.00 168.93 ? 78  GLU C CG  1 
ATOM 3594 C CD  . GLU C 1 36  ? 37.030  44.528  -4.843  1.00 168.93 ? 78  GLU C CD  1 
ATOM 3595 O OE1 . GLU C 1 36  ? 36.349  43.741  -5.524  1.00 168.93 ? 78  GLU C OE1 1 
ATOM 3596 O OE2 . GLU C 1 36  ? 37.415  45.644  -5.257  1.00 168.93 ? 78  GLU C OE2 1 
ATOM 3597 N N   . THR C 1 37  ? 34.851  43.993  0.325   1.00 168.93 ? 79  THR C N   1 
ATOM 3598 C CA  . THR C 1 37  ? 33.719  44.208  1.229   1.00 168.93 ? 79  THR C CA  1 
ATOM 3599 C C   . THR C 1 37  ? 34.151  45.031  2.437   1.00 168.93 ? 79  THR C C   1 
ATOM 3600 O O   . THR C 1 37  ? 33.887  46.234  2.502   1.00 168.93 ? 79  THR C O   1 
ATOM 3601 C CB  . THR C 1 37  ? 33.141  42.846  1.747   1.00 168.93 ? 79  THR C CB  1 
ATOM 3602 O OG1 . THR C 1 37  ? 32.741  42.029  0.640   1.00 168.93 ? 79  THR C OG1 1 
ATOM 3603 C CG2 . THR C 1 37  ? 31.922  43.071  2.647   1.00 168.93 ? 79  THR C CG2 1 
ATOM 3604 N N   . GLU C 1 38  ? 34.813  44.378  3.389   1.00 168.93 ? 80  GLU C N   1 
ATOM 3605 C CA  . GLU C 1 38  ? 35.282  45.060  4.590   1.00 168.93 ? 80  GLU C CA  1 
ATOM 3606 C C   . GLU C 1 38  ? 36.321  46.120  4.175   1.00 168.93 ? 80  GLU C C   1 
ATOM 3607 O O   . GLU C 1 38  ? 36.427  47.165  4.816   1.00 168.93 ? 80  GLU C O   1 
ATOM 3608 C CB  . GLU C 1 38  ? 35.843  44.039  5.610   1.00 168.93 ? 80  GLU C CB  1 
ATOM 3609 C CG  . GLU C 1 38  ? 35.652  44.419  7.098   1.00 168.93 ? 80  GLU C CG  1 
ATOM 3610 C CD  . GLU C 1 38  ? 35.978  43.282  8.086   1.00 168.93 ? 80  GLU C CD  1 
ATOM 3611 O OE1 . GLU C 1 38  ? 35.065  42.496  8.423   1.00 168.93 ? 80  GLU C OE1 1 
ATOM 3612 O OE2 . GLU C 1 38  ? 37.139  43.185  8.549   1.00 168.93 ? 80  GLU C OE2 1 
ATOM 3613 N N   . GLY C 1 39  ? 36.971  45.899  3.026   1.00 168.93 ? 81  GLY C N   1 
ATOM 3614 C CA  . GLY C 1 39  ? 37.975  46.827  2.510   1.00 168.93 ? 81  GLY C CA  1 
ATOM 3615 C C   . GLY C 1 39  ? 37.428  48.189  2.109   1.00 168.93 ? 81  GLY C C   1 
ATOM 3616 O O   . GLY C 1 39  ? 38.160  49.182  2.083   1.00 168.93 ? 81  GLY C O   1 
ATOM 3617 N N   . LEU C 1 40  ? 36.151  48.224  1.744   1.00 168.93 ? 82  LEU C N   1 
ATOM 3618 C CA  . LEU C 1 40  ? 35.497  49.467  1.377   1.00 168.93 ? 82  LEU C CA  1 
ATOM 3619 C C   . LEU C 1 40  ? 34.696  49.905  2.592   1.00 168.93 ? 82  LEU C C   1 
ATOM 3620 O O   . LEU C 1 40  ? 34.398  51.084  2.758   1.00 168.93 ? 82  LEU C O   1 
ATOM 3621 C CB  . LEU C 1 40  ? 34.591  49.273  0.163   1.00 168.93 ? 82  LEU C CB  1 
ATOM 3622 C CG  . LEU C 1 40  ? 35.328  48.892  -1.123  1.00 168.93 ? 82  LEU C CG  1 
ATOM 3623 C CD1 . LEU C 1 40  ? 34.343  48.753  -2.272  1.00 168.93 ? 82  LEU C CD1 1 
ATOM 3624 C CD2 . LEU C 1 40  ? 36.387  49.934  -1.447  1.00 168.93 ? 82  LEU C CD2 1 
ATOM 3625 N N   . ARG C 1 41  ? 34.374  48.937  3.449   1.00 168.93 ? 83  ARG C N   1 
ATOM 3626 C CA  . ARG C 1 41  ? 33.636  49.188  4.685   1.00 168.93 ? 83  ARG C CA  1 
ATOM 3627 C C   . ARG C 1 41  ? 34.513  50.012  5.624   1.00 168.93 ? 83  ARG C C   1 
ATOM 3628 O O   . ARG C 1 41  ? 34.016  50.722  6.498   1.00 168.93 ? 83  ARG C O   1 
ATOM 3629 C CB  . ARG C 1 41  ? 33.265  47.862  5.365   1.00 168.93 ? 83  ARG C CB  1 
ATOM 3630 C CG  . ARG C 1 41  ? 32.791  48.023  6.800   1.00 168.93 ? 83  ARG C CG  1 
ATOM 3631 C CD  . ARG C 1 41  ? 32.385  46.718  7.462   1.00 168.93 ? 83  ARG C CD  1 
ATOM 3632 N NE  . ARG C 1 41  ? 31.865  46.973  8.804   1.00 168.93 ? 83  ARG C NE  1 
ATOM 3633 C CZ  . ARG C 1 41  ? 31.518  46.033  9.679   1.00 168.93 ? 83  ARG C CZ  1 
ATOM 3634 N NH1 . ARG C 1 41  ? 31.627  44.747  9.369   1.00 168.93 ? 83  ARG C NH1 1 
ATOM 3635 N NH2 . ARG C 1 41  ? 31.050  46.388  10.870  1.00 168.93 ? 83  ARG C NH2 1 
ATOM 3636 N N   . GLN C 1 42  ? 35.824  49.874  5.450   1.00 168.93 ? 84  GLN C N   1 
ATOM 3637 C CA  . GLN C 1 42  ? 36.811  50.597  6.248   1.00 168.93 ? 84  GLN C CA  1 
ATOM 3638 C C   . GLN C 1 42  ? 36.963  52.007  5.693   1.00 168.93 ? 84  GLN C C   1 
ATOM 3639 O O   . GLN C 1 42  ? 37.145  52.966  6.446   1.00 168.93 ? 84  GLN C O   1 
ATOM 3640 C CB  . GLN C 1 42  ? 38.165  49.873  6.197   1.00 168.93 ? 84  GLN C CB  1 
ATOM 3641 C CG  . GLN C 1 42  ? 39.311  50.552  6.968   1.00 168.93 ? 84  GLN C CG  1 
ATOM 3642 C CD  . GLN C 1 42  ? 40.648  49.816  6.825   1.00 168.93 ? 84  GLN C CD  1 
ATOM 3643 O OE1 . GLN C 1 42  ? 40.774  48.647  7.206   1.00 168.93 ? 84  GLN C OE1 1 
ATOM 3644 N NE2 . GLN C 1 42  ? 41.653  50.505  6.284   1.00 168.93 ? 84  GLN C NE2 1 
ATOM 3645 N N   . GLU C 1 43  ? 36.906  52.123  4.370   1.00 168.93 ? 85  GLU C N   1 
ATOM 3646 C CA  . GLU C 1 43  ? 37.034  53.412  3.713   1.00 168.93 ? 85  GLU C CA  1 
ATOM 3647 C C   . GLU C 1 43  ? 35.815  54.253  4.059   1.00 168.93 ? 85  GLU C C   1 
ATOM 3648 O O   . GLU C 1 43  ? 35.925  55.454  4.277   1.00 168.93 ? 85  GLU C O   1 
ATOM 3649 C CB  . GLU C 1 43  ? 37.151  53.222  2.198   1.00 168.93 ? 85  GLU C CB  1 
ATOM 3650 C CG  . GLU C 1 43  ? 37.985  54.284  1.497   1.00 168.93 ? 85  GLU C CG  1 
ATOM 3651 C CD  . GLU C 1 43  ? 38.585  53.791  0.188   1.00 168.93 ? 85  GLU C CD  1 
ATOM 3652 O OE1 . GLU C 1 43  ? 37.889  53.831  -0.850  1.00 168.93 ? 85  GLU C OE1 1 
ATOM 3653 O OE2 . GLU C 1 43  ? 39.761  53.368  0.197   1.00 168.93 ? 85  GLU C OE2 1 
ATOM 3654 N N   . MET C 1 44  ? 34.669  53.593  4.180   1.00 168.93 ? 86  MET C N   1 
ATOM 3655 C CA  . MET C 1 44  ? 33.424  54.266  4.508   1.00 168.93 ? 86  MET C CA  1 
ATOM 3656 C C   . MET C 1 44  ? 33.314  54.672  5.952   1.00 168.93 ? 86  MET C C   1 
ATOM 3657 O O   . MET C 1 44  ? 32.875  55.774  6.246   1.00 168.93 ? 86  MET C O   1 
ATOM 3658 C CB  . MET C 1 44  ? 32.223  53.406  4.145   1.00 168.93 ? 86  MET C CB  1 
ATOM 3659 C CG  . MET C 1 44  ? 31.826  53.580  2.714   1.00 168.93 ? 86  MET C CG  1 
ATOM 3660 S SD  . MET C 1 44  ? 32.010  55.316  2.275   1.00 168.93 ? 86  MET C SD  1 
ATOM 3661 C CE  . MET C 1 44  ? 30.326  55.843  2.249   1.00 168.93 ? 86  MET C CE  1 
ATOM 3662 N N   . SER C 1 45  ? 33.665  53.768  6.858   1.00 168.93 ? 87  SER C N   1 
ATOM 3663 C CA  . SER C 1 45  ? 33.588  54.089  8.273   1.00 168.93 ? 87  SER C CA  1 
ATOM 3664 C C   . SER C 1 45  ? 34.525  55.250  8.556   1.00 168.93 ? 87  SER C C   1 
ATOM 3665 O O   . SER C 1 45  ? 34.267  56.053  9.449   1.00 168.93 ? 87  SER C O   1 
ATOM 3666 C CB  . SER C 1 45  ? 33.944  52.884  9.144   1.00 168.93 ? 87  SER C CB  1 
ATOM 3667 O OG  . SER C 1 45  ? 35.301  52.517  8.987   1.00 168.93 ? 87  SER C OG  1 
ATOM 3668 N N   . LYS C 1 46  ? 35.605  55.348  7.781   1.00 86.56  ? 88  LYS C N   1 
ATOM 3669 C CA  . LYS C 1 46  ? 36.552  56.445  7.957   1.00 86.56  ? 88  LYS C CA  1 
ATOM 3670 C C   . LYS C 1 46  ? 36.068  57.661  7.172   1.00 86.56  ? 88  LYS C C   1 
ATOM 3671 O O   . LYS C 1 46  ? 36.329  58.802  7.561   1.00 86.56  ? 88  LYS C O   1 
ATOM 3672 C CB  . LYS C 1 46  ? 37.972  56.059  7.519   1.00 86.56  ? 88  LYS C CB  1 
ATOM 3673 C CG  . LYS C 1 46  ? 39.076  57.012  8.055   1.00 86.56  ? 88  LYS C CG  1 
ATOM 3674 C CD  . LYS C 1 46  ? 40.502  56.547  7.673   1.00 86.56  ? 88  LYS C CD  1 
ATOM 3675 C CE  . LYS C 1 46  ? 41.634  57.376  8.341   1.00 86.56  ? 88  LYS C CE  1 
ATOM 3676 N NZ  . LYS C 1 46  ? 43.011  56.950  7.887   1.00 86.56  ? 88  LYS C NZ  1 
ATOM 3677 N N   . ASP C 1 47  ? 35.356  57.412  6.076   1.00 86.56  ? 89  ASP C N   1 
ATOM 3678 C CA  . ASP C 1 47  ? 34.823  58.490  5.248   1.00 86.56  ? 89  ASP C CA  1 
ATOM 3679 C C   . ASP C 1 47  ? 33.693  59.177  6.019   1.00 86.56  ? 89  ASP C C   1 
ATOM 3680 O O   . ASP C 1 47  ? 33.511  60.393  5.930   1.00 86.56  ? 89  ASP C O   1 
ATOM 3681 C CB  . ASP C 1 47  ? 34.288  57.926  3.928   1.00 86.56  ? 89  ASP C CB  1 
ATOM 3682 C CG  . ASP C 1 47  ? 34.134  58.985  2.855   1.00 86.56  ? 89  ASP C CG  1 
ATOM 3683 O OD1 . ASP C 1 47  ? 33.122  59.715  2.874   1.00 86.56  ? 89  ASP C OD1 1 
ATOM 3684 O OD2 . ASP C 1 47  ? 35.026  59.077  1.985   1.00 86.56  ? 89  ASP C OD2 1 
ATOM 3685 N N   . LEU C 1 48  ? 32.975  58.382  6.811   1.00 86.56  ? 90  LEU C N   1 
ATOM 3686 C CA  . LEU C 1 48  ? 31.851  58.842  7.624   1.00 86.56  ? 90  LEU C CA  1 
ATOM 3687 C C   . LEU C 1 48  ? 32.321  59.673  8.807   1.00 86.56  ? 90  LEU C C   1 
ATOM 3688 O O   . LEU C 1 48  ? 31.671  60.643  9.198   1.00 86.56  ? 90  LEU C O   1 
ATOM 3689 C CB  . LEU C 1 48  ? 31.061  57.631  8.141   1.00 86.56  ? 90  LEU C CB  1 
ATOM 3690 C CG  . LEU C 1 48  ? 30.589  57.631  9.601   1.00 86.56  ? 90  LEU C CG  1 
ATOM 3691 C CD1 . LEU C 1 48  ? 29.379  58.536  9.763   1.00 86.56  ? 90  LEU C CD1 1 
ATOM 3692 C CD2 . LEU C 1 48  ? 30.259  56.220  10.044  1.00 86.56  ? 90  LEU C CD2 1 
ATOM 3693 N N   . GLU C 1 49  ? 33.441  59.263  9.390   1.00 86.56  ? 91  GLU C N   1 
ATOM 3694 C CA  . GLU C 1 49  ? 34.003  59.939  10.548  1.00 86.56  ? 91  GLU C CA  1 
ATOM 3695 C C   . GLU C 1 49  ? 34.044  61.440  10.339  1.00 86.56  ? 91  GLU C C   1 
ATOM 3696 O O   . GLU C 1 49  ? 33.362  62.178  11.041  1.00 86.56  ? 91  GLU C O   1 
ATOM 3697 C CB  . GLU C 1 49  ? 35.411  59.412  10.842  1.00 86.56  ? 91  GLU C CB  1 
ATOM 3698 C CG  . GLU C 1 49  ? 35.854  59.568  12.299  1.00 86.56  ? 91  GLU C CG  1 
ATOM 3699 C CD  . GLU C 1 49  ? 35.154  58.598  13.265  1.00 86.56  ? 91  GLU C CD  1 
ATOM 3700 O OE1 . GLU C 1 49  ? 34.139  57.961  12.882  1.00 86.56  ? 91  GLU C OE1 1 
ATOM 3701 O OE2 . GLU C 1 49  ? 35.626  58.470  14.419  1.00 86.56  ? 91  GLU C OE2 1 
ATOM 3702 N N   . GLU C 1 50  ? 34.798  61.869  9.328   1.00 86.56  ? 92  GLU C N   1 
ATOM 3703 C CA  . GLU C 1 50  ? 34.948  63.287  8.988   1.00 86.56  ? 92  GLU C CA  1 
ATOM 3704 C C   . GLU C 1 50  ? 33.604  63.970  9.023   1.00 86.56  ? 92  GLU C C   1 
ATOM 3705 O O   . GLU C 1 50  ? 33.474  65.101  9.469   1.00 86.56  ? 92  GLU C O   1 
ATOM 3706 C CB  . GLU C 1 50  ? 35.474  63.453  7.565   1.00 86.56  ? 92  GLU C CB  1 
ATOM 3707 C CG  . GLU C 1 50  ? 36.720  62.670  7.232   1.00 86.56  ? 92  GLU C CG  1 
ATOM 3708 C CD  . GLU C 1 50  ? 37.172  62.893  5.794   1.00 86.56  ? 92  GLU C CD  1 
ATOM 3709 O OE1 . GLU C 1 50  ? 36.303  63.101  4.909   1.00 86.56  ? 92  GLU C OE1 1 
ATOM 3710 O OE2 . GLU C 1 50  ? 38.403  62.863  5.554   1.00 86.56  ? 92  GLU C OE2 1 
ATOM 3711 N N   . VAL C 1 51  ? 32.616  63.278  8.480   1.00 86.56  ? 93  VAL C N   1 
ATOM 3712 C CA  . VAL C 1 51  ? 31.267  63.786  8.435   1.00 86.56  ? 93  VAL C CA  1 
ATOM 3713 C C   . VAL C 1 51  ? 30.823  64.031  9.849   1.00 86.56  ? 93  VAL C C   1 
ATOM 3714 O O   . VAL C 1 51  ? 30.632  65.175  10.252  1.00 86.56  ? 93  VAL C O   1 
ATOM 3715 C CB  . VAL C 1 51  ? 30.331  62.774  7.813   1.00 86.56  ? 93  VAL C CB  1 
ATOM 3716 C CG1 . VAL C 1 51  ? 28.919  63.324  7.789   1.00 86.56  ? 93  VAL C CG1 1 
ATOM 3717 C CG2 . VAL C 1 51  ? 30.828  62.405  6.431   1.00 86.56  ? 93  VAL C CG2 1 
ATOM 3718 N N   . LYS C 1 52  ? 30.688  62.947  10.606  1.00 86.56  ? 94  LYS C N   1 
ATOM 3719 C CA  . LYS C 1 52  ? 30.279  63.039  11.994  1.00 86.56  ? 94  LYS C CA  1 
ATOM 3720 C C   . LYS C 1 52  ? 31.137  64.085  12.711  1.00 86.56  ? 94  LYS C C   1 
ATOM 3721 O O   . LYS C 1 52  ? 30.674  64.753  13.631  1.00 86.56  ? 94  LYS C O   1 
ATOM 3722 C CB  . LYS C 1 52  ? 30.424  61.678  12.689  1.00 86.56  ? 94  LYS C CB  1 
ATOM 3723 C CG  . LYS C 1 52  ? 29.110  60.919  12.932  1.00 86.56  ? 94  LYS C CG  1 
ATOM 3724 C CD  . LYS C 1 52  ? 29.259  59.868  14.059  1.00 86.56  ? 94  LYS C CD  1 
ATOM 3725 C CE  . LYS C 1 52  ? 27.924  59.219  14.439  1.00 86.56  ? 94  LYS C CE  1 
ATOM 3726 N NZ  . LYS C 1 52  ? 27.918  58.328  15.642  1.00 86.56  ? 94  LYS C NZ  1 
ATOM 3727 N N   . ALA C 1 53  ? 32.360  64.277  12.223  1.00 86.56  ? 95  ALA C N   1 
ATOM 3728 C CA  . ALA C 1 53  ? 33.297  65.226  12.815  1.00 86.56  ? 95  ALA C CA  1 
ATOM 3729 C C   . ALA C 1 53  ? 32.963  66.659  12.449  1.00 86.56  ? 95  ALA C C   1 
ATOM 3730 O O   . ALA C 1 53  ? 33.008  67.549  13.294  1.00 86.56  ? 95  ALA C O   1 
ATOM 3731 C CB  . ALA C 1 53  ? 34.721  64.895  12.389  1.00 86.56  ? 95  ALA C CB  1 
ATOM 3732 N N   . LYS C 1 54  ? 32.591  66.869  11.194  1.00 86.56  ? 96  LYS C N   1 
ATOM 3733 C CA  . LYS C 1 54  ? 32.264  68.204  10.727  1.00 86.56  ? 96  LYS C CA  1 
ATOM 3734 C C   . LYS C 1 54  ? 30.894  68.629  11.225  1.00 86.56  ? 96  LYS C C   1 
ATOM 3735 O O   . LYS C 1 54  ? 30.439  69.735  10.937  1.00 86.56  ? 96  LYS C O   1 
ATOM 3736 C CB  . LYS C 1 54  ? 32.297  68.263  9.195   1.00 86.56  ? 96  LYS C CB  1 
ATOM 3737 C CG  . LYS C 1 54  ? 33.692  68.328  8.559   1.00 86.56  ? 96  LYS C CG  1 
ATOM 3738 C CD  . LYS C 1 54  ? 33.577  68.477  7.034   1.00 86.56  ? 96  LYS C CD  1 
ATOM 3739 C CE  . LYS C 1 54  ? 34.930  68.582  6.333   1.00 86.56  ? 96  LYS C CE  1 
ATOM 3740 N NZ  . LYS C 1 54  ? 34.790  68.502  4.837   1.00 86.56  ? 96  LYS C NZ  1 
ATOM 3741 N N   . VAL C 1 55  ? 30.260  67.775  12.019  1.00 86.56  ? 97  VAL C N   1 
ATOM 3742 C CA  . VAL C 1 55  ? 28.934  68.082  12.506  1.00 86.56  ? 97  VAL C CA  1 
ATOM 3743 C C   . VAL C 1 55  ? 28.770  68.027  13.995  1.00 86.56  ? 97  VAL C C   1 
ATOM 3744 O O   . VAL C 1 55  ? 28.033  68.822  14.567  1.00 86.56  ? 97  VAL C O   1 
ATOM 3745 C CB  . VAL C 1 55  ? 27.926  67.118  11.926  1.00 86.56  ? 97  VAL C CB  1 
ATOM 3746 C CG1 . VAL C 1 55  ? 26.541  67.541  12.325  1.00 86.56  ? 97  VAL C CG1 1 
ATOM 3747 C CG2 . VAL C 1 55  ? 28.075  67.044  10.417  1.00 86.56  ? 97  VAL C CG2 1 
ATOM 3748 N N   . GLN C 1 56  ? 29.410  67.044  14.610  1.00 86.56  ? 98  GLN C N   1 
ATOM 3749 C CA  . GLN C 1 56  ? 29.306  66.865  16.043  1.00 86.56  ? 98  GLN C CA  1 
ATOM 3750 C C   . GLN C 1 56  ? 29.142  68.159  16.807  1.00 86.56  ? 98  GLN C C   1 
ATOM 3751 O O   . GLN C 1 56  ? 28.079  68.427  17.328  1.00 86.56  ? 98  GLN C O   1 
ATOM 3752 C CB  . GLN C 1 56  ? 30.478  66.066  16.612  1.00 86.56  ? 98  GLN C CB  1 
ATOM 3753 C CG  . GLN C 1 56  ? 30.561  66.128  18.142  1.00 86.56  ? 98  GLN C CG  1 
ATOM 3754 C CD  . GLN C 1 56  ? 29.208  65.890  18.806  1.00 86.56  ? 98  GLN C CD  1 
ATOM 3755 O OE1 . GLN C 1 56  ? 28.663  66.773  19.457  1.00 86.56  ? 98  GLN C OE1 1 
ATOM 3756 N NE2 . GLN C 1 56  ? 28.650  64.706  18.614  1.00 86.56  ? 98  GLN C NE2 1 
ATOM 3757 N N   . PRO C 1 57  ? 30.174  69.014  16.806  1.00 102.83 ? 99  PRO C N   1 
ATOM 3758 C CA  . PRO C 1 57  ? 30.060  70.278  17.540  1.00 102.83 ? 99  PRO C CA  1 
ATOM 3759 C C   . PRO C 1 57  ? 28.789  71.012  17.170  1.00 102.83 ? 99  PRO C C   1 
ATOM 3760 O O   . PRO C 1 57  ? 28.111  71.573  18.031  1.00 102.83 ? 99  PRO C O   1 
ATOM 3761 C CB  . PRO C 1 57  ? 31.299  71.036  17.085  1.00 102.83 ? 99  PRO C CB  1 
ATOM 3762 C CG  . PRO C 1 57  ? 31.537  70.497  15.702  1.00 102.83 ? 99  PRO C CG  1 
ATOM 3763 C CD  . PRO C 1 57  ? 31.341  69.032  15.914  1.00 102.83 ? 99  PRO C CD  1 
ATOM 3764 N N   . TYR C 1 58  ? 28.441  70.976  15.893  1.00 102.83 ? 100 TYR C N   1 
ATOM 3765 C CA  . TYR C 1 58  ? 27.240  71.640  15.500  1.00 102.83 ? 100 TYR C CA  1 
ATOM 3766 C C   . TYR C 1 58  ? 26.084  70.985  16.235  1.00 102.83 ? 100 TYR C C   1 
ATOM 3767 O O   . TYR C 1 58  ? 25.349  71.637  16.956  1.00 102.83 ? 100 TYR C O   1 
ATOM 3768 C CB  . TYR C 1 58  ? 26.991  71.581  14.001  1.00 102.83 ? 100 TYR C CB  1 
ATOM 3769 C CG  . TYR C 1 58  ? 25.635  72.123  13.832  1.00 102.83 ? 100 TYR C CG  1 
ATOM 3770 C CD1 . TYR C 1 58  ? 25.360  73.404  14.290  1.00 102.83 ? 100 TYR C CD1 1 
ATOM 3771 C CD2 . TYR C 1 58  ? 24.566  71.283  13.563  1.00 102.83 ? 100 TYR C CD2 1 
ATOM 3772 C CE1 . TYR C 1 58  ? 24.080  73.820  14.523  1.00 102.83 ? 100 TYR C CE1 1 
ATOM 3773 C CE2 . TYR C 1 58  ? 23.271  71.690  13.792  1.00 102.83 ? 100 TYR C CE2 1 
ATOM 3774 C CZ  . TYR C 1 58  ? 23.035  72.958  14.283  1.00 102.83 ? 100 TYR C CZ  1 
ATOM 3775 O OH  . TYR C 1 58  ? 21.754  73.351  14.587  1.00 102.83 ? 100 TYR C OH  1 
ATOM 3776 N N   . LEU C 1 59  ? 25.891  69.701  15.989  1.00 102.83 ? 101 LEU C N   1 
ATOM 3777 C CA  . LEU C 1 59  ? 24.832  68.954  16.633  1.00 102.83 ? 101 LEU C CA  1 
ATOM 3778 C C   . LEU C 1 59  ? 24.840  69.283  18.098  1.00 102.83 ? 101 LEU C C   1 
ATOM 3779 O O   . LEU C 1 59  ? 23.816  69.604  18.670  1.00 102.83 ? 101 LEU C O   1 
ATOM 3780 C CB  . LEU C 1 59  ? 25.087  67.465  16.466  1.00 102.83 ? 101 LEU C CB  1 
ATOM 3781 C CG  . LEU C 1 59  ? 24.948  66.604  17.723  1.00 102.83 ? 101 LEU C CG  1 
ATOM 3782 C CD1 . LEU C 1 59  ? 23.485  66.485  18.109  1.00 102.83 ? 101 LEU C CD1 1 
ATOM 3783 C CD2 . LEU C 1 59  ? 25.557  65.240  17.484  1.00 102.83 ? 101 LEU C CD2 1 
ATOM 3784 N N   . ASP C 1 60  ? 26.015  69.126  18.690  1.00 102.83 ? 102 ASP C N   1 
ATOM 3785 C CA  . ASP C 1 60  ? 26.270  69.392  20.089  1.00 102.83 ? 102 ASP C CA  1 
ATOM 3786 C C   . ASP C 1 60  ? 25.374  70.501  20.549  1.00 102.83 ? 102 ASP C C   1 
ATOM 3787 O O   . ASP C 1 60  ? 24.694  70.384  21.559  1.00 102.83 ? 102 ASP C O   1 
ATOM 3788 C CB  . ASP C 1 60  ? 27.708  69.848  20.275  1.00 102.83 ? 102 ASP C CB  1 
ATOM 3789 C CG  . ASP C 1 60  ? 28.529  68.866  21.051  1.00 102.83 ? 102 ASP C CG  1 
ATOM 3790 O OD1 . ASP C 1 60  ? 27.946  68.112  21.858  1.00 102.83 ? 102 ASP C OD1 1 
ATOM 3791 O OD2 . ASP C 1 60  ? 29.757  68.829  20.836  1.00 102.83 ? 102 ASP C OD2 1 
ATOM 3792 N N   . ASP C 1 61  ? 25.361  71.566  19.758  1.00 102.83 ? 103 ASP C N   1 
ATOM 3793 C CA  . ASP C 1 61  ? 24.547  72.734  20.016  1.00 102.83 ? 103 ASP C CA  1 
ATOM 3794 C C   . ASP C 1 61  ? 23.205  72.259  20.528  1.00 102.83 ? 103 ASP C C   1 
ATOM 3795 O O   . ASP C 1 61  ? 22.791  72.578  21.637  1.00 102.83 ? 103 ASP C O   1 
ATOM 3796 C CB  . ASP C 1 61  ? 24.380  73.496  18.698  1.00 102.83 ? 103 ASP C CB  1 
ATOM 3797 C CG  . ASP C 1 61  ? 23.393  74.637  18.778  1.00 102.83 ? 103 ASP C CG  1 
ATOM 3798 O OD1 . ASP C 1 61  ? 22.897  74.976  19.873  1.00 102.83 ? 103 ASP C OD1 1 
ATOM 3799 O OD2 . ASP C 1 61  ? 23.114  75.215  17.710  1.00 102.83 ? 103 ASP C OD2 1 
ATOM 3800 N N   . PHE C 1 62  ? 22.568  71.425  19.735  1.00 102.83 ? 104 PHE C N   1 
ATOM 3801 C CA  . PHE C 1 62  ? 21.282  70.899  20.096  1.00 102.83 ? 104 PHE C CA  1 
ATOM 3802 C C   . PHE C 1 62  ? 21.163  70.274  21.480  1.00 102.83 ? 104 PHE C C   1 
ATOM 3803 O O   . PHE C 1 62  ? 20.155  70.452  22.142  1.00 102.83 ? 104 PHE C O   1 
ATOM 3804 C CB  . PHE C 1 62  ? 20.833  69.919  19.043  1.00 102.83 ? 104 PHE C CB  1 
ATOM 3805 C CG  . PHE C 1 62  ? 19.417  69.537  19.182  1.00 102.83 ? 104 PHE C CG  1 
ATOM 3806 C CD1 . PHE C 1 62  ? 19.032  68.632  20.153  1.00 102.83 ? 104 PHE C CD1 1 
ATOM 3807 C CD2 . PHE C 1 62  ? 18.449  70.110  18.368  1.00 102.83 ? 104 PHE C CD2 1 
ATOM 3808 C CE1 . PHE C 1 62  ? 17.708  68.306  20.322  1.00 102.83 ? 104 PHE C CE1 1 
ATOM 3809 C CE2 . PHE C 1 62  ? 17.114  69.785  18.528  1.00 102.83 ? 104 PHE C CE2 1 
ATOM 3810 C CZ  . PHE C 1 62  ? 16.742  68.884  19.504  1.00 102.83 ? 104 PHE C CZ  1 
ATOM 3811 N N   . GLN C 1 63  ? 22.163  69.521  21.912  1.00 102.83 ? 105 GLN C N   1 
ATOM 3812 C CA  . GLN C 1 63  ? 22.094  68.891  23.229  1.00 102.83 ? 105 GLN C CA  1 
ATOM 3813 C C   . GLN C 1 63  ? 21.772  69.913  24.304  1.00 102.83 ? 105 GLN C C   1 
ATOM 3814 O O   . GLN C 1 63  ? 20.897  69.701  25.134  1.00 102.83 ? 105 GLN C O   1 
ATOM 3815 C CB  . GLN C 1 63  ? 23.404  68.169  23.577  1.00 102.83 ? 105 GLN C CB  1 
ATOM 3816 C CG  . GLN C 1 63  ? 23.525  66.723  23.042  1.00 102.83 ? 105 GLN C CG  1 
ATOM 3817 C CD  . GLN C 1 63  ? 24.640  65.894  23.727  1.00 102.83 ? 105 GLN C CD  1 
ATOM 3818 O OE1 . GLN C 1 63  ? 25.759  66.379  23.940  1.00 102.83 ? 105 GLN C OE1 1 
ATOM 3819 N NE2 . GLN C 1 63  ? 24.327  64.637  24.067  1.00 102.83 ? 105 GLN C NE2 1 
ATOM 3820 N N   . LYS C 1 64  ? 22.482  71.031  24.278  1.00 102.83 ? 106 LYS C N   1 
ATOM 3821 C CA  . LYS C 1 64  ? 22.238  72.086  25.247  1.00 102.83 ? 106 LYS C CA  1 
ATOM 3822 C C   . LYS C 1 64  ? 20.842  72.612  25.006  1.00 102.83 ? 106 LYS C C   1 
ATOM 3823 O O   . LYS C 1 64  ? 20.205  73.138  25.910  1.00 102.83 ? 106 LYS C O   1 
ATOM 3824 C CB  . LYS C 1 64  ? 23.246  73.221  25.084  1.00 102.83 ? 106 LYS C CB  1 
ATOM 3825 C CG  . LYS C 1 64  ? 23.064  74.391  26.073  1.00 102.83 ? 106 LYS C CG  1 
ATOM 3826 C CD  . LYS C 1 64  ? 24.078  75.527  25.804  1.00 102.83 ? 106 LYS C CD  1 
ATOM 3827 C CE  . LYS C 1 64  ? 23.958  76.707  26.784  1.00 102.83 ? 106 LYS C CE  1 
ATOM 3828 N NZ  . LYS C 1 64  ? 24.972  77.781  26.502  1.00 102.83 ? 106 LYS C NZ  1 
ATOM 3829 N N   . LYS C 1 65  ? 20.378  72.497  23.770  1.00 102.83 ? 107 LYS C N   1 
ATOM 3830 C CA  . LYS C 1 65  ? 19.044  72.956  23.444  1.00 102.83 ? 107 LYS C CA  1 
ATOM 3831 C C   . LYS C 1 65  ? 18.017  72.119  24.205  1.00 102.83 ? 107 LYS C C   1 
ATOM 3832 O O   . LYS C 1 65  ? 17.065  72.663  24.760  1.00 102.83 ? 107 LYS C O   1 
ATOM 3833 C CB  . LYS C 1 65  ? 18.806  72.888  21.930  1.00 102.83 ? 107 LYS C CB  1 
ATOM 3834 C CG  . LYS C 1 65  ? 19.561  73.946  21.095  1.00 102.83 ? 107 LYS C CG  1 
ATOM 3835 C CD  . LYS C 1 65  ? 19.048  75.371  21.380  1.00 102.83 ? 107 LYS C CD  1 
ATOM 3836 C CE  . LYS C 1 65  ? 19.797  76.483  20.608  1.00 102.83 ? 107 LYS C CE  1 
ATOM 3837 N NZ  . LYS C 1 65  ? 19.502  76.571  19.142  1.00 102.83 ? 107 LYS C NZ  1 
ATOM 3838 N N   . TRP C 1 66  ? 18.231  70.806  24.276  1.00 102.83 ? 108 TRP C N   1 
ATOM 3839 C CA  . TRP C 1 66  ? 17.295  69.932  24.998  1.00 102.83 ? 108 TRP C CA  1 
ATOM 3840 C C   . TRP C 1 66  ? 17.388  70.288  26.473  1.00 102.83 ? 108 TRP C C   1 
ATOM 3841 O O   . TRP C 1 66  ? 16.375  70.457  27.151  1.00 102.83 ? 108 TRP C O   1 
ATOM 3842 C CB  . TRP C 1 66  ? 17.631  68.436  24.788  1.00 102.83 ? 108 TRP C CB  1 
ATOM 3843 C CG  . TRP C 1 66  ? 16.531  67.444  25.260  1.00 102.83 ? 108 TRP C CG  1 
ATOM 3844 C CD1 . TRP C 1 66  ? 15.261  67.752  25.678  1.00 102.83 ? 108 TRP C CD1 1 
ATOM 3845 C CD2 . TRP C 1 66  ? 16.629  65.996  25.363  1.00 102.83 ? 108 TRP C CD2 1 
ATOM 3846 N NE1 . TRP C 1 66  ? 14.575  66.610  26.034  1.00 102.83 ? 108 TRP C NE1 1 
ATOM 3847 C CE2 . TRP C 1 66  ? 15.391  65.516  25.853  1.00 102.83 ? 108 TRP C CE2 1 
ATOM 3848 C CE3 . TRP C 1 66  ? 17.654  65.061  25.092  1.00 102.83 ? 108 TRP C CE3 1 
ATOM 3849 C CZ2 . TRP C 1 66  ? 15.136  64.144  26.081  1.00 102.83 ? 108 TRP C CZ2 1 
ATOM 3850 C CZ3 . TRP C 1 66  ? 17.397  63.689  25.320  1.00 102.83 ? 108 TRP C CZ3 1 
ATOM 3851 C CH2 . TRP C 1 66  ? 16.150  63.251  25.809  1.00 102.83 ? 108 TRP C CH2 1 
ATOM 3852 N N   . GLN C 1 67  ? 18.623  70.458  26.934  1.00 102.83 ? 109 GLN C N   1 
ATOM 3853 C CA  . GLN C 1 67  ? 18.918  70.817  28.315  1.00 102.83 ? 109 GLN C CA  1 
ATOM 3854 C C   . GLN C 1 67  ? 18.148  72.057  28.729  1.00 102.83 ? 109 GLN C C   1 
ATOM 3855 O O   . GLN C 1 67  ? 17.780  72.223  29.893  1.00 102.83 ? 109 GLN C O   1 
ATOM 3856 C CB  . GLN C 1 67  ? 20.413  71.107  28.460  1.00 102.83 ? 109 GLN C CB  1 
ATOM 3857 C CG  . GLN C 1 67  ? 21.311  69.897  28.296  1.00 102.83 ? 109 GLN C CG  1 
ATOM 3858 C CD  . GLN C 1 67  ? 21.170  68.920  29.448  1.00 102.83 ? 109 GLN C CD  1 
ATOM 3859 O OE1 . GLN C 1 67  ? 21.951  68.957  30.408  1.00 102.83 ? 109 GLN C OE1 1 
ATOM 3860 N NE2 . GLN C 1 67  ? 20.161  68.053  29.373  1.00 102.83 ? 109 GLN C NE2 1 
ATOM 3861 N N   . GLU C 1 68  ? 17.920  72.929  27.756  1.00 102.83 ? 110 GLU C N   1 
ATOM 3862 C CA  . GLU C 1 68  ? 17.221  74.182  27.984  1.00 102.83 ? 110 GLU C CA  1 
ATOM 3863 C C   . GLU C 1 68  ? 15.752  73.983  28.318  1.00 102.83 ? 110 GLU C C   1 
ATOM 3864 O O   . GLU C 1 68  ? 15.273  74.449  29.352  1.00 102.83 ? 110 GLU C O   1 
ATOM 3865 C CB  . GLU C 1 68  ? 17.376  75.101  26.764  1.00 102.83 ? 110 GLU C CB  1 
ATOM 3866 C CG  . GLU C 1 68  ? 16.847  76.521  26.967  1.00 102.83 ? 110 GLU C CG  1 
ATOM 3867 C CD  . GLU C 1 68  ? 17.274  77.476  25.863  1.00 102.83 ? 110 GLU C CD  1 
ATOM 3868 O OE1 . GLU C 1 68  ? 16.938  77.217  24.684  1.00 102.83 ? 110 GLU C OE1 1 
ATOM 3869 O OE2 . GLU C 1 68  ? 17.942  78.490  26.179  1.00 102.83 ? 110 GLU C OE2 1 
ATOM 3870 N N   . GLU C 1 69  ? 15.042  73.286  27.445  1.00 102.83 ? 111 GLU C N   1 
ATOM 3871 C CA  . GLU C 1 69  ? 13.628  73.037  27.650  1.00 102.83 ? 111 GLU C CA  1 
ATOM 3872 C C   . GLU C 1 69  ? 13.429  72.221  28.916  1.00 102.83 ? 111 GLU C C   1 
ATOM 3873 O O   . GLU C 1 69  ? 12.584  72.531  29.756  1.00 102.83 ? 111 GLU C O   1 
ATOM 3874 C CB  . GLU C 1 69  ? 13.081  72.255  26.461  1.00 102.83 ? 111 GLU C CB  1 
ATOM 3875 C CG  . GLU C 1 69  ? 13.366  72.887  25.108  1.00 102.83 ? 111 GLU C CG  1 
ATOM 3876 C CD  . GLU C 1 69  ? 12.712  74.242  24.939  1.00 102.83 ? 111 GLU C CD  1 
ATOM 3877 O OE1 . GLU C 1 69  ? 11.615  74.445  25.488  1.00 102.83 ? 111 GLU C OE1 1 
ATOM 3878 O OE2 . GLU C 1 69  ? 13.294  75.106  24.256  1.00 102.83 ? 111 GLU C OE2 1 
ATOM 3879 N N   . MET C 1 70  ? 14.268  71.204  29.053  1.00 102.83 ? 112 MET C N   1 
ATOM 3880 C CA  . MET C 1 70  ? 14.225  70.285  30.173  1.00 102.83 ? 112 MET C CA  1 
ATOM 3881 C C   . MET C 1 70  ? 14.026  70.903  31.549  1.00 102.83 ? 112 MET C C   1 
ATOM 3882 O O   . MET C 1 70  ? 13.026  70.631  32.212  1.00 102.83 ? 112 MET C O   1 
ATOM 3883 C CB  . MET C 1 70  ? 15.483  69.428  30.185  1.00 102.83 ? 112 MET C CB  1 
ATOM 3884 C CG  . MET C 1 70  ? 15.312  68.191  31.018  1.00 102.83 ? 112 MET C CG  1 
ATOM 3885 S SD  . MET C 1 70  ? 13.721  67.465  30.594  1.00 102.83 ? 112 MET C SD  1 
ATOM 3886 C CE  . MET C 1 70  ? 14.214  66.168  29.445  1.00 102.83 ? 112 MET C CE  1 
ATOM 3887 N N   . GLU C 1 71  ? 15.005  71.691  31.992  1.00 102.83 ? 113 GLU C N   1 
ATOM 3888 C CA  . GLU C 1 71  ? 14.946  72.333  33.304  1.00 102.83 ? 113 GLU C CA  1 
ATOM 3889 C C   . GLU C 1 71  ? 13.641  73.073  33.548  1.00 102.83 ? 113 GLU C C   1 
ATOM 3890 O O   . GLU C 1 71  ? 13.021  72.907  34.590  1.00 102.83 ? 113 GLU C O   1 
ATOM 3891 C CB  . GLU C 1 71  ? 16.134  73.283  33.510  1.00 102.83 ? 113 GLU C CB  1 
ATOM 3892 C CG  . GLU C 1 71  ? 17.470  72.596  33.820  1.00 102.83 ? 113 GLU C CG  1 
ATOM 3893 C CD  . GLU C 1 71  ? 17.586  72.077  35.254  1.00 102.83 ? 113 GLU C CD  1 
ATOM 3894 O OE1 . GLU C 1 71  ? 16.652  72.280  36.058  1.00 102.83 ? 113 GLU C OE1 1 
ATOM 3895 O OE2 . GLU C 1 71  ? 18.630  71.469  35.582  1.00 102.83 ? 113 GLU C OE2 1 
ATOM 3896 N N   . LEU C 1 72  ? 13.201  73.837  32.557  1.00 102.83 ? 114 LEU C N   1 
ATOM 3897 C CA  . LEU C 1 72  ? 11.971  74.611  32.660  1.00 102.83 ? 114 LEU C CA  1 
ATOM 3898 C C   . LEU C 1 72  ? 10.777  73.747  33.082  1.00 102.83 ? 114 LEU C C   1 
ATOM 3899 O O   . LEU C 1 72  ? 9.996   74.118  33.967  1.00 102.83 ? 114 LEU C O   1 
ATOM 3900 C CB  . LEU C 1 72  ? 11.698  75.279  31.319  1.00 102.83 ? 114 LEU C CB  1 
ATOM 3901 C CG  . LEU C 1 72  ? 10.565  76.297  31.304  1.00 102.83 ? 114 LEU C CG  1 
ATOM 3902 C CD1 . LEU C 1 72  ? 10.846  77.397  32.317  1.00 102.83 ? 114 LEU C CD1 1 
ATOM 3903 C CD2 . LEU C 1 72  ? 10.433  76.862  29.910  1.00 102.83 ? 114 LEU C CD2 1 
ATOM 3904 N N   . TYR C 1 73  ? 10.650  72.591  32.444  1.00 102.83 ? 115 TYR C N   1 
ATOM 3905 C CA  . TYR C 1 73  ? 9.574   71.667  32.754  1.00 102.83 ? 115 TYR C CA  1 
ATOM 3906 C C   . TYR C 1 73  ? 9.843   71.114  34.133  1.00 102.83 ? 115 TYR C C   1 
ATOM 3907 O O   . TYR C 1 73  ? 8.969   71.113  35.000  1.00 102.83 ? 115 TYR C O   1 
ATOM 3908 C CB  . TYR C 1 73  ? 9.568   70.551  31.731  1.00 102.83 ? 115 TYR C CB  1 
ATOM 3909 C CG  . TYR C 1 73  ? 8.689   69.377  32.070  1.00 102.83 ? 115 TYR C CG  1 
ATOM 3910 C CD1 . TYR C 1 73  ? 7.363   69.319  31.634  1.00 102.83 ? 115 TYR C CD1 1 
ATOM 3911 C CD2 . TYR C 1 73  ? 9.209   68.279  32.755  1.00 102.83 ? 115 TYR C CD2 1 
ATOM 3912 C CE1 . TYR C 1 73  ? 6.582   68.189  31.860  1.00 102.83 ? 115 TYR C CE1 1 
ATOM 3913 C CE2 . TYR C 1 73  ? 8.442   67.151  32.991  1.00 102.83 ? 115 TYR C CE2 1 
ATOM 3914 C CZ  . TYR C 1 73  ? 7.133   67.107  32.536  1.00 102.83 ? 115 TYR C CZ  1 
ATOM 3915 O OH  . TYR C 1 73  ? 6.403   65.958  32.731  1.00 102.83 ? 115 TYR C OH  1 
ATOM 3916 N N   . ARG C 1 74  ? 11.088  70.700  34.336  1.00 102.83 ? 116 ARG C N   1 
ATOM 3917 C CA  . ARG C 1 74  ? 11.541  70.163  35.601  1.00 102.83 ? 116 ARG C CA  1 
ATOM 3918 C C   . ARG C 1 74  ? 11.174  71.172  36.686  1.00 102.83 ? 116 ARG C C   1 
ATOM 3919 O O   . ARG C 1 74  ? 11.089  70.831  37.859  1.00 102.83 ? 116 ARG C O   1 
ATOM 3920 C CB  . ARG C 1 74  ? 13.051  69.947  35.519  1.00 102.83 ? 116 ARG C CB  1 
ATOM 3921 C CG  . ARG C 1 74  ? 13.682  69.224  36.690  1.00 102.83 ? 116 ARG C CG  1 
ATOM 3922 C CD  . ARG C 1 74  ? 15.047  68.639  36.301  1.00 102.83 ? 116 ARG C CD  1 
ATOM 3923 N NE  . ARG C 1 74  ? 14.926  67.509  35.373  1.00 102.83 ? 116 ARG C NE  1 
ATOM 3924 C CZ  . ARG C 1 74  ? 15.863  66.578  35.180  1.00 102.83 ? 116 ARG C CZ  1 
ATOM 3925 N NH1 . ARG C 1 74  ? 17.017  66.622  35.835  1.00 102.83 ? 116 ARG C NH1 1 
ATOM 3926 N NH2 . ARG C 1 74  ? 15.631  65.567  34.353  1.00 102.83 ? 116 ARG C NH2 1 
ATOM 3927 N N   . GLN C 1 75  ? 10.886  72.400  36.263  1.00 102.83 ? 117 GLN C N   1 
ATOM 3928 C CA  . GLN C 1 75  ? 10.512  73.462  37.176  1.00 102.83 ? 117 GLN C CA  1 
ATOM 3929 C C   . GLN C 1 75  ? 9.043   73.610  37.456  1.00 102.83 ? 117 GLN C C   1 
ATOM 3930 O O   . GLN C 1 75  ? 8.624   73.562  38.610  1.00 102.83 ? 117 GLN C O   1 
ATOM 3931 C CB  . GLN C 1 75  ? 11.095  74.791  36.718  1.00 102.83 ? 117 GLN C CB  1 
ATOM 3932 C CG  . GLN C 1 75  ? 12.586  74.814  36.920  1.00 102.83 ? 117 GLN C CG  1 
ATOM 3933 C CD  . GLN C 1 75  ? 12.984  74.031  38.168  1.00 102.83 ? 117 GLN C CD  1 
ATOM 3934 O OE1 . GLN C 1 75  ? 12.617  74.398  39.290  1.00 102.83 ? 117 GLN C OE1 1 
ATOM 3935 N NE2 . GLN C 1 75  ? 13.680  72.911  37.973  1.00 102.83 ? 117 GLN C NE2 1 
ATOM 3936 N N   . LYS C 1 76  ? 8.266   73.830  36.407  1.00 102.83 ? 118 LYS C N   1 
ATOM 3937 C CA  . LYS C 1 76  ? 6.830   73.993  36.556  1.00 102.83 ? 118 LYS C CA  1 
ATOM 3938 C C   . LYS C 1 76  ? 6.229   72.820  37.330  1.00 102.83 ? 118 LYS C C   1 
ATOM 3939 O O   . LYS C 1 76  ? 5.361   72.986  38.187  1.00 102.83 ? 118 LYS C O   1 
ATOM 3940 C CB  . LYS C 1 76  ? 6.189   74.111  35.169  1.00 102.83 ? 118 LYS C CB  1 
ATOM 3941 C CG  . LYS C 1 76  ? 4.669   74.252  35.174  1.00 102.83 ? 118 LYS C CG  1 
ATOM 3942 C CD  . LYS C 1 76  ? 4.201   75.538  35.853  1.00 102.83 ? 118 LYS C CD  1 
ATOM 3943 C CE  . LYS C 1 76  ? 2.680   75.558  36.017  1.00 102.83 ? 118 LYS C CE  1 
ATOM 3944 N NZ  . LYS C 1 76  ? 2.178   74.458  36.903  1.00 102.83 ? 118 LYS C NZ  1 
ATOM 3945 N N   . VAL C 1 77  ? 6.767   71.643  37.065  1.00 102.83 ? 119 VAL C N   1 
ATOM 3946 C CA  . VAL C 1 77  ? 6.295   70.436  37.688  1.00 102.83 ? 119 VAL C CA  1 
ATOM 3947 C C   . VAL C 1 77  ? 6.768   70.277  39.117  1.00 102.83 ? 119 VAL C C   1 
ATOM 3948 O O   . VAL C 1 77  ? 6.016   69.822  39.972  1.00 102.83 ? 119 VAL C O   1 
ATOM 3949 C CB  . VAL C 1 77  ? 6.724   69.254  36.857  1.00 102.83 ? 119 VAL C CB  1 
ATOM 3950 C CG1 . VAL C 1 77  ? 6.146   67.989  37.419  1.00 102.83 ? 119 VAL C CG1 1 
ATOM 3951 C CG2 . VAL C 1 77  ? 6.276   69.464  35.422  1.00 102.83 ? 119 VAL C CG2 1 
ATOM 3952 N N   . GLU C 1 78  ? 7.991   70.712  39.386  1.00 102.83 ? 120 GLU C N   1 
ATOM 3953 C CA  . GLU C 1 78  ? 8.578   70.624  40.719  1.00 102.83 ? 120 GLU C CA  1 
ATOM 3954 C C   . GLU C 1 78  ? 7.668   70.841  41.930  1.00 102.83 ? 120 GLU C C   1 
ATOM 3955 O O   . GLU C 1 78  ? 7.781   70.124  42.917  1.00 102.83 ? 120 GLU C O   1 
ATOM 3956 C CB  . GLU C 1 78  ? 9.760   71.580  40.828  1.00 102.83 ? 120 GLU C CB  1 
ATOM 3957 C CG  . GLU C 1 78  ? 11.112  70.894  40.863  1.00 102.83 ? 120 GLU C CG  1 
ATOM 3958 C CD  . GLU C 1 78  ? 11.358  70.100  42.138  1.00 102.83 ? 120 GLU C CD  1 
ATOM 3959 O OE1 . GLU C 1 78  ? 10.584  70.251  43.110  1.00 102.83 ? 120 GLU C OE1 1 
ATOM 3960 O OE2 . GLU C 1 78  ? 12.344  69.326  42.168  1.00 102.83 ? 120 GLU C OE2 1 
ATOM 3961 N N   . PRO C 1 79  ? 6.777   71.851  41.882  1.00 72.25  ? 121 PRO C N   1 
ATOM 3962 C CA  . PRO C 1 79  ? 5.832   72.200  42.961  1.00 72.25  ? 121 PRO C CA  1 
ATOM 3963 C C   . PRO C 1 79  ? 4.747   71.164  43.219  1.00 72.25  ? 121 PRO C C   1 
ATOM 3964 O O   . PRO C 1 79  ? 4.329   70.920  44.355  1.00 72.25  ? 121 PRO C O   1 
ATOM 3965 C CB  . PRO C 1 79  ? 5.174   73.479  42.435  1.00 72.25  ? 121 PRO C CB  1 
ATOM 3966 C CG  . PRO C 1 79  ? 6.178   74.040  41.465  1.00 72.25  ? 121 PRO C CG  1 
ATOM 3967 C CD  . PRO C 1 79  ? 6.660   72.813  40.773  1.00 72.25  ? 121 PRO C CD  1 
ATOM 3968 N N   . LEU C 1 80  ? 4.257   70.613  42.123  1.00 72.25  ? 122 LEU C N   1 
ATOM 3969 C CA  . LEU C 1 80  ? 3.206   69.624  42.144  1.00 72.25  ? 122 LEU C CA  1 
ATOM 3970 C C   . LEU C 1 80  ? 3.747   68.424  42.888  1.00 72.25  ? 122 LEU C C   1 
ATOM 3971 O O   . LEU C 1 80  ? 3.018   67.726  43.576  1.00 72.25  ? 122 LEU C O   1 
ATOM 3972 C CB  . LEU C 1 80  ? 2.840   69.290  40.709  1.00 72.25  ? 122 LEU C CB  1 
ATOM 3973 C CG  . LEU C 1 80  ? 3.070   70.509  39.803  1.00 72.25  ? 122 LEU C CG  1 
ATOM 3974 C CD1 . LEU C 1 80  ? 2.699   70.183  38.392  1.00 72.25  ? 122 LEU C CD1 1 
ATOM 3975 C CD2 . LEU C 1 80  ? 2.304   71.732  40.291  1.00 72.25  ? 122 LEU C CD2 1 
ATOM 3976 N N   . ARG C 1 81  ? 5.063   68.267  42.820  1.00 72.25  ? 123 ARG C N   1 
ATOM 3977 C CA  . ARG C 1 81  ? 5.756   67.186  43.497  1.00 72.25  ? 123 ARG C CA  1 
ATOM 3978 C C   . ARG C 1 81  ? 5.475   67.217  44.993  1.00 72.25  ? 123 ARG C C   1 
ATOM 3979 O O   . ARG C 1 81  ? 4.894   66.280  45.511  1.00 72.25  ? 123 ARG C O   1 
ATOM 3980 C CB  . ARG C 1 81  ? 7.262   67.288  43.264  1.00 72.25  ? 123 ARG C CB  1 
ATOM 3981 C CG  . ARG C 1 81  ? 8.069   66.308  44.087  1.00 72.25  ? 123 ARG C CG  1 
ATOM 3982 C CD  . ARG C 1 81  ? 9.538   66.673  44.111  1.00 72.25  ? 123 ARG C CD  1 
ATOM 3983 N NE  . ARG C 1 81  ? 10.311  65.691  44.865  1.00 72.25  ? 123 ARG C NE  1 
ATOM 3984 C CZ  . ARG C 1 81  ? 11.634  65.713  45.003  1.00 72.25  ? 123 ARG C CZ  1 
ATOM 3985 N NH1 . ARG C 1 81  ? 12.363  66.673  44.444  1.00 72.25  ? 123 ARG C NH1 1 
ATOM 3986 N NH2 . ARG C 1 81  ? 12.232  64.761  45.698  1.00 72.25  ? 123 ARG C NH2 1 
ATOM 3987 N N   . ALA C 1 82  ? 5.881   68.291  45.672  1.00 72.25  ? 124 ALA C N   1 
ATOM 3988 C CA  . ALA C 1 82  ? 5.683   68.444  47.121  1.00 72.25  ? 124 ALA C CA  1 
ATOM 3989 C C   . ALA C 1 82  ? 4.239   68.206  47.545  1.00 72.25  ? 124 ALA C C   1 
ATOM 3990 O O   . ALA C 1 82  ? 3.960   67.594  48.583  1.00 72.25  ? 124 ALA C O   1 
ATOM 3991 C CB  . ALA C 1 82  ? 6.138   69.825  47.568  1.00 72.25  ? 124 ALA C CB  1 
ATOM 3992 N N   . GLU C 1 83  ? 3.329   68.705  46.723  1.00 72.25  ? 125 GLU C N   1 
ATOM 3993 C CA  . GLU C 1 83  ? 1.907   68.560  46.949  1.00 72.25  ? 125 GLU C CA  1 
ATOM 3994 C C   . GLU C 1 83  ? 1.557   67.080  47.042  1.00 72.25  ? 125 GLU C C   1 
ATOM 3995 O O   . GLU C 1 83  ? 0.657   66.681  47.781  1.00 72.25  ? 125 GLU C O   1 
ATOM 3996 C CB  . GLU C 1 83  ? 1.184   69.210  45.786  1.00 72.25  ? 125 GLU C CB  1 
ATOM 3997 C CG  . GLU C 1 83  ? -0.253  68.792  45.626  1.00 72.25  ? 125 GLU C CG  1 
ATOM 3998 C CD  . GLU C 1 83  ? -0.754  69.025  44.214  1.00 72.25  ? 125 GLU C CD  1 
ATOM 3999 O OE1 . GLU C 1 83  ? -0.287  68.303  43.300  1.00 72.25  ? 125 GLU C OE1 1 
ATOM 4000 O OE2 . GLU C 1 83  ? -1.601  69.931  44.023  1.00 72.25  ? 125 GLU C OE2 1 
ATOM 4001 N N   . LEU C 1 84  ? 2.291   66.279  46.284  1.00 72.25  ? 126 LEU C N   1 
ATOM 4002 C CA  . LEU C 1 84  ? 2.093   64.849  46.253  1.00 72.25  ? 126 LEU C CA  1 
ATOM 4003 C C   . LEU C 1 84  ? 3.113   64.184  47.142  1.00 72.25  ? 126 LEU C C   1 
ATOM 4004 O O   . LEU C 1 84  ? 2.860   63.132  47.714  1.00 72.25  ? 126 LEU C O   1 
ATOM 4005 C CB  . LEU C 1 84  ? 2.290   64.370  44.831  1.00 72.25  ? 126 LEU C CB  1 
ATOM 4006 C CG  . LEU C 1 84  ? 1.639   65.354  43.878  1.00 72.25  ? 126 LEU C CG  1 
ATOM 4007 C CD1 . LEU C 1 84  ? 2.145   65.137  42.490  1.00 72.25  ? 126 LEU C CD1 1 
ATOM 4008 C CD2 . LEU C 1 84  ? 0.140   65.246  43.967  1.00 72.25  ? 126 LEU C CD2 1 
ATOM 4009 N N   . GLN C 1 85  ? 4.245   64.852  47.305  1.00 72.25  ? 127 GLN C N   1 
ATOM 4010 C CA  . GLN C 1 85  ? 5.345   64.339  48.090  1.00 72.25  ? 127 GLN C CA  1 
ATOM 4011 C C   . GLN C 1 85  ? 4.947   64.299  49.536  1.00 72.25  ? 127 GLN C C   1 
ATOM 4012 O O   . GLN C 1 85  ? 4.638   63.240  50.071  1.00 72.25  ? 127 GLN C O   1 
ATOM 4013 C CB  . GLN C 1 85  ? 6.570   65.219  47.923  1.00 72.25  ? 127 GLN C CB  1 
ATOM 4014 C CG  . GLN C 1 85  ? 7.799   64.667  48.592  1.00 72.25  ? 127 GLN C CG  1 
ATOM 4015 C CD  . GLN C 1 85  ? 8.893   65.697  48.715  1.00 72.25  ? 127 GLN C CD  1 
ATOM 4016 O OE1 . GLN C 1 85  ? 9.677   65.659  49.660  1.00 72.25  ? 127 GLN C OE1 1 
ATOM 4017 N NE2 . GLN C 1 85  ? 8.948   66.640  47.771  1.00 72.25  ? 127 GLN C NE2 1 
ATOM 4018 N N   . GLU C 1 86  ? 4.940   65.460  50.172  1.00 72.25  ? 128 GLU C N   1 
ATOM 4019 C CA  . GLU C 1 86  ? 4.553   65.512  51.558  1.00 72.25  ? 128 GLU C CA  1 
ATOM 4020 C C   . GLU C 1 86  ? 3.074   65.153  51.659  1.00 72.25  ? 128 GLU C C   1 
ATOM 4021 O O   . GLU C 1 86  ? 2.657   64.494  52.615  1.00 72.25  ? 128 GLU C O   1 
ATOM 4022 C CB  . GLU C 1 86  ? 4.846   66.886  52.135  1.00 72.25  ? 128 GLU C CB  1 
ATOM 4023 C CG  . GLU C 1 86  ? 4.727   66.923  53.647  1.00 72.25  ? 128 GLU C CG  1 
ATOM 4024 C CD  . GLU C 1 86  ? 5.372   68.153  54.265  1.00 72.25  ? 128 GLU C CD  1 
ATOM 4025 O OE1 . GLU C 1 86  ? 5.213   69.264  53.706  1.00 72.25  ? 128 GLU C OE1 1 
ATOM 4026 O OE2 . GLU C 1 86  ? 6.037   68.008  55.314  1.00 72.25  ? 128 GLU C OE2 1 
ATOM 4027 N N   . GLY C 1 87  ? 2.324   65.480  50.604  1.00 72.25  ? 129 GLY C N   1 
ATOM 4028 C CA  . GLY C 1 87  ? 0.896   65.192  50.553  1.00 72.25  ? 129 GLY C CA  1 
ATOM 4029 C C   . GLY C 1 87  ? 0.550   63.739  50.832  1.00 72.25  ? 129 GLY C C   1 
ATOM 4030 O O   . GLY C 1 87  ? -0.470  63.441  51.456  1.00 72.25  ? 129 GLY C O   1 
ATOM 4031 N N   . ALA C 1 88  ? 1.407   62.830  50.382  1.00 72.25  ? 130 ALA C N   1 
ATOM 4032 C CA  . ALA C 1 88  ? 1.190   61.411  50.600  1.00 72.25  ? 130 ALA C CA  1 
ATOM 4033 C C   . ALA C 1 88  ? 1.731   60.996  51.969  1.00 72.25  ? 130 ALA C C   1 
ATOM 4034 O O   . ALA C 1 88  ? 1.005   60.412  52.779  1.00 72.25  ? 130 ALA C O   1 
ATOM 4035 C CB  . ALA C 1 88  ? 1.861   60.620  49.510  1.00 72.25  ? 130 ALA C CB  1 
ATOM 4036 N N   . ARG C 1 89  ? 3.005   61.315  52.212  1.00 72.25  ? 131 ARG C N   1 
ATOM 4037 C CA  . ARG C 1 89  ? 3.706   61.009  53.463  1.00 72.25  ? 131 ARG C CA  1 
ATOM 4038 C C   . ARG C 1 89  ? 2.781   61.053  54.648  1.00 72.25  ? 131 ARG C C   1 
ATOM 4039 O O   . ARG C 1 89  ? 2.796   60.173  55.501  1.00 72.25  ? 131 ARG C O   1 
ATOM 4040 C CB  . ARG C 1 89  ? 4.813   62.035  53.707  1.00 72.25  ? 131 ARG C CB  1 
ATOM 4041 C CG  . ARG C 1 89  ? 5.989   61.934  52.762  1.00 72.25  ? 131 ARG C CG  1 
ATOM 4042 C CD  . ARG C 1 89  ? 6.933   63.131  52.889  1.00 72.25  ? 131 ARG C CD  1 
ATOM 4043 N NE  . ARG C 1 89  ? 8.266   62.846  52.354  1.00 72.25  ? 131 ARG C NE  1 
ATOM 4044 C CZ  . ARG C 1 89  ? 9.187   63.767  52.081  1.00 72.25  ? 131 ARG C CZ  1 
ATOM 4045 N NH1 . ARG C 1 89  ? 8.935   65.057  52.282  1.00 72.25  ? 131 ARG C NH1 1 
ATOM 4046 N NH2 . ARG C 1 89  ? 10.385  63.389  51.652  1.00 72.25  ? 131 ARG C NH2 1 
ATOM 4047 N N   . GLN C 1 90  ? 1.967   62.098  54.664  1.00 72.25  ? 132 GLN C N   1 
ATOM 4048 C CA  . GLN C 1 90  ? 1.005   62.345  55.720  1.00 72.25  ? 132 GLN C CA  1 
ATOM 4049 C C   . GLN C 1 90  ? 0.002   61.238  55.906  1.00 72.25  ? 132 GLN C C   1 
ATOM 4050 O O   . GLN C 1 90  ? -0.025  60.595  56.947  1.00 72.25  ? 132 GLN C O   1 
ATOM 4051 C CB  . GLN C 1 90  ? 0.265   63.651  55.454  1.00 72.25  ? 132 GLN C CB  1 
ATOM 4052 C CG  . GLN C 1 90  ? 1.144   64.888  55.563  1.00 72.25  ? 132 GLN C CG  1 
ATOM 4053 C CD  . GLN C 1 90  ? 1.506   65.250  57.003  1.00 72.25  ? 132 GLN C CD  1 
ATOM 4054 O OE1 . GLN C 1 90  ? 2.016   64.421  57.765  1.00 72.25  ? 132 GLN C OE1 1 
ATOM 4055 N NE2 . GLN C 1 90  ? 1.258   66.507  57.373  1.00 72.25  ? 132 GLN C NE2 1 
ATOM 4056 N N   . LYS C 1 91  ? -0.821  61.009  54.897  1.00 72.25  ? 133 LYS C N   1 
ATOM 4057 C CA  . LYS C 1 91  ? -1.835  59.979  54.998  1.00 72.25  ? 133 LYS C CA  1 
ATOM 4058 C C   . LYS C 1 91  ? -1.217  58.640  55.369  1.00 72.25  ? 133 LYS C C   1 
ATOM 4059 O O   . LYS C 1 91  ? -1.808  57.853  56.104  1.00 72.25  ? 133 LYS C O   1 
ATOM 4060 C CB  . LYS C 1 91  ? -2.654  59.927  53.707  1.00 72.25  ? 133 LYS C CB  1 
ATOM 4061 C CG  . LYS C 1 91  ? -3.357  61.279  53.426  1.00 72.25  ? 133 LYS C CG  1 
ATOM 4062 C CD  . LYS C 1 91  ? -4.424  61.235  52.321  1.00 72.25  ? 133 LYS C CD  1 
ATOM 4063 C CE  . LYS C 1 91  ? -5.214  62.564  52.242  1.00 72.25  ? 133 LYS C CE  1 
ATOM 4064 N NZ  . LYS C 1 91  ? -6.375  62.551  51.284  1.00 72.25  ? 133 LYS C NZ  1 
ATOM 4065 N N   . LEU C 1 92  ? 0.039   58.459  54.990  1.00 72.25  ? 134 LEU C N   1 
ATOM 4066 C CA  . LEU C 1 92  ? 0.734   57.222  55.290  1.00 72.25  ? 134 LEU C CA  1 
ATOM 4067 C C   . LEU C 1 92  ? 1.170   57.262  56.732  1.00 72.25  ? 134 LEU C C   1 
ATOM 4068 O O   . LEU C 1 92  ? 1.047   56.279  57.450  1.00 72.25  ? 134 LEU C O   1 
ATOM 4069 C CB  . LEU C 1 92  ? 1.949   57.074  54.397  1.00 72.25  ? 134 LEU C CB  1 
ATOM 4070 C CG  . LEU C 1 92  ? 1.710   57.549  52.964  1.00 72.25  ? 134 LEU C CG  1 
ATOM 4071 C CD1 . LEU C 1 92  ? 2.757   56.943  52.063  1.00 72.25  ? 134 LEU C CD1 1 
ATOM 4072 C CD2 . LEU C 1 92  ? 0.328   57.164  52.468  1.00 72.25  ? 134 LEU C CD2 1 
ATOM 4073 N N   . HIS C 1 93  ? 1.655   58.424  57.147  1.00 72.25  ? 135 HIS C N   1 
ATOM 4074 C CA  . HIS C 1 93  ? 2.111   58.653  58.515  1.00 72.25  ? 135 HIS C CA  1 
ATOM 4075 C C   . HIS C 1 93  ? 0.990   58.302  59.486  1.00 72.25  ? 135 HIS C C   1 
ATOM 4076 O O   . HIS C 1 93  ? 1.140   57.426  60.337  1.00 72.25  ? 135 HIS C O   1 
ATOM 4077 C CB  . HIS C 1 93  ? 2.453   60.129  58.708  1.00 72.25  ? 135 HIS C CB  1 
ATOM 4078 C CG  . HIS C 1 93  ? 3.903   60.401  58.961  1.00 72.25  ? 135 HIS C CG  1 
ATOM 4079 N ND1 . HIS C 1 93  ? 4.440   60.462  60.231  1.00 72.25  ? 135 HIS C ND1 1 
ATOM 4080 C CD2 . HIS C 1 93  ? 4.909   60.709  58.112  1.00 72.25  ? 135 HIS C CD2 1 
ATOM 4081 C CE1 . HIS C 1 93  ? 5.715   60.803  60.153  1.00 72.25  ? 135 HIS C CE1 1 
ATOM 4082 N NE2 . HIS C 1 93  ? 6.024   60.959  58.878  1.00 72.25  ? 135 HIS C NE2 1 
ATOM 4083 N N   . GLU C 1 94  ? -0.132  59.010  59.344  1.00 72.25  ? 136 GLU C N   1 
ATOM 4084 C CA  . GLU C 1 94  ? -1.311  58.818  60.187  1.00 72.25  ? 136 GLU C CA  1 
ATOM 4085 C C   . GLU C 1 94  ? -1.580  57.343  60.296  1.00 72.25  ? 136 GLU C C   1 
ATOM 4086 O O   . GLU C 1 94  ? -1.581  56.766  61.376  1.00 72.25  ? 136 GLU C O   1 
ATOM 4087 C CB  . GLU C 1 94  ? -2.565  59.435  59.545  1.00 72.25  ? 136 GLU C CB  1 
ATOM 4088 C CG  . GLU C 1 94  ? -2.554  60.939  59.275  1.00 72.25  ? 136 GLU C CG  1 
ATOM 4089 C CD  . GLU C 1 94  ? -3.838  61.443  58.582  1.00 72.25  ? 136 GLU C CD  1 
ATOM 4090 O OE1 . GLU C 1 94  ? -4.500  60.654  57.859  1.00 72.25  ? 136 GLU C OE1 1 
ATOM 4091 O OE2 . GLU C 1 94  ? -4.178  62.639  58.760  1.00 72.25  ? 136 GLU C OE2 1 
ATOM 4092 N N   . LEU C 1 95  ? -1.772  56.745  59.132  1.00 72.25  ? 137 LEU C N   1 
ATOM 4093 C CA  . LEU C 1 95  ? -2.080  55.348  59.026  1.00 72.25  ? 137 LEU C CA  1 
ATOM 4094 C C   . LEU C 1 95  ? -1.332  54.497  60.003  1.00 72.25  ? 137 LEU C C   1 
ATOM 4095 O O   . LEU C 1 95  ? -1.936  53.915  60.894  1.00 72.25  ? 137 LEU C O   1 
ATOM 4096 C CB  . LEU C 1 95  ? -1.801  54.853  57.623  1.00 72.25  ? 137 LEU C CB  1 
ATOM 4097 C CG  . LEU C 1 95  ? -2.211  53.399  57.452  1.00 72.25  ? 137 LEU C CG  1 
ATOM 4098 C CD1 . LEU C 1 95  ? -3.620  53.191  57.973  1.00 72.25  ? 137 LEU C CD1 1 
ATOM 4099 C CD2 . LEU C 1 95  ? -2.124  53.038  55.998  1.00 72.25  ? 137 LEU C CD2 1 
ATOM 4100 N N   . GLN C 1 96  ? -0.016  54.436  59.841  1.00 72.25  ? 138 GLN C N   1 
ATOM 4101 C CA  . GLN C 1 96  ? 0.802   53.614  60.713  1.00 72.25  ? 138 GLN C CA  1 
ATOM 4102 C C   . GLN C 1 96  ? 0.441   53.883  62.155  1.00 72.25  ? 138 GLN C C   1 
ATOM 4103 O O   . GLN C 1 96  ? 0.266   52.941  62.916  1.00 72.25  ? 138 GLN C O   1 
ATOM 4104 C CB  . GLN C 1 96  ? 2.311   53.815  60.459  1.00 72.25  ? 138 GLN C CB  1 
ATOM 4105 C CG  . GLN C 1 96  ? 3.201   52.555  60.755  1.00 72.25  ? 138 GLN C CG  1 
ATOM 4106 C CD  . GLN C 1 96  ? 4.708   52.681  60.337  1.00 72.25  ? 138 GLN C CD  1 
ATOM 4107 O OE1 . GLN C 1 96  ? 5.101   53.574  59.578  1.00 72.25  ? 138 GLN C OE1 1 
ATOM 4108 N NE2 . GLN C 1 96  ? 5.539   51.766  60.842  1.00 72.25  ? 138 GLN C NE2 1 
ATOM 4109 N N   . GLU C 1 97  ? 0.239   55.147  62.522  1.00 72.25  ? 139 GLU C N   1 
ATOM 4110 C CA  . GLU C 1 97  ? -0.127  55.427  63.907  1.00 72.25  ? 139 GLU C CA  1 
ATOM 4111 C C   . GLU C 1 97  ? -1.534  54.912  64.200  1.00 72.25  ? 139 GLU C C   1 
ATOM 4112 O O   . GLU C 1 97  ? -1.831  54.526  65.328  1.00 72.25  ? 139 GLU C O   1 
ATOM 4113 C CB  . GLU C 1 97  ? -0.019  56.912  64.267  1.00 72.25  ? 139 GLU C CB  1 
ATOM 4114 C CG  . GLU C 1 97  ? 0.012   57.167  65.802  1.00 72.25  ? 139 GLU C CG  1 
ATOM 4115 C CD  . GLU C 1 97  ? -1.108  58.098  66.328  1.00 72.25  ? 139 GLU C CD  1 
ATOM 4116 O OE1 . GLU C 1 97  ? -1.363  59.161  65.709  1.00 72.25  ? 139 GLU C OE1 1 
ATOM 4117 O OE2 . GLU C 1 97  ? -1.714  57.778  67.385  1.00 72.25  ? 139 GLU C OE2 1 
ATOM 4118 N N   . LYS C 1 98  ? -2.407  54.903  63.201  1.00 72.25  ? 140 LYS C N   1 
ATOM 4119 C CA  . LYS C 1 98  ? -3.733  54.383  63.451  1.00 72.25  ? 140 LYS C CA  1 
ATOM 4120 C C   . LYS C 1 98  ? -3.668  52.877  63.314  1.00 72.25  ? 140 LYS C C   1 
ATOM 4121 O O   . LYS C 1 98  ? -4.677  52.188  63.377  1.00 72.25  ? 140 LYS C O   1 
ATOM 4122 C CB  . LYS C 1 98  ? -4.754  54.966  62.489  1.00 72.25  ? 140 LYS C CB  1 
ATOM 4123 C CG  . LYS C 1 98  ? -6.168  54.907  63.060  1.00 72.25  ? 140 LYS C CG  1 
ATOM 4124 C CD  . LYS C 1 98  ? -7.226  55.500  62.129  1.00 72.25  ? 140 LYS C CD  1 
ATOM 4125 C CE  . LYS C 1 98  ? -8.625  55.483  62.774  1.00 72.25  ? 140 LYS C CE  1 
ATOM 4126 N NZ  . LYS C 1 98  ? -9.698  55.881  61.815  1.00 72.25  ? 140 LYS C NZ  1 
ATOM 4127 N N   . LEU C 1 99  ? -2.464  52.364  63.116  1.00 72.25  ? 141 LEU C N   1 
ATOM 4128 C CA  . LEU C 1 99  ? -2.281  50.937  62.976  1.00 72.25  ? 141 LEU C CA  1 
ATOM 4129 C C   . LEU C 1 99  ? -1.616  50.295  64.166  1.00 72.25  ? 141 LEU C C   1 
ATOM 4130 O O   . LEU C 1 99  ? -1.303  49.113  64.150  1.00 72.25  ? 141 LEU C O   1 
ATOM 4131 C CB  . LEU C 1 99  ? -1.518  50.629  61.702  1.00 72.25  ? 141 LEU C CB  1 
ATOM 4132 C CG  . LEU C 1 99  ? -2.265  51.138  60.473  1.00 72.25  ? 141 LEU C CG  1 
ATOM 4133 C CD1 . LEU C 1 99  ? -1.718  50.467  59.250  1.00 72.25  ? 141 LEU C CD1 1 
ATOM 4134 C CD2 . LEU C 1 99  ? -3.751  50.861  60.590  1.00 72.25  ? 141 LEU C CD2 1 
ATOM 4135 N N   . SER C 1 100 ? -1.381  51.089  65.199  1.00 72.25  ? 142 SER C N   1 
ATOM 4136 C CA  . SER C 1 100 ? -0.796  50.552  66.414  1.00 72.25  ? 142 SER C CA  1 
ATOM 4137 C C   . SER C 1 100 ? -1.813  49.738  67.233  1.00 72.25  ? 142 SER C C   1 
ATOM 4138 O O   . SER C 1 100 ? -1.408  49.009  68.146  1.00 72.25  ? 142 SER C O   1 
ATOM 4139 C CB  . SER C 1 100 ? -0.139  51.648  67.264  1.00 72.25  ? 142 SER C CB  1 
ATOM 4140 O OG  . SER C 1 100 ? -1.097  52.546  67.801  1.00 72.25  ? 142 SER C OG  1 
ATOM 4141 N N   . PRO C 1 101 ? -3.142  49.896  66.967  1.00 78.45  ? 143 PRO C N   1 
ATOM 4142 C CA  . PRO C 1 101 ? -4.138  49.120  67.720  1.00 78.45  ? 143 PRO C CA  1 
ATOM 4143 C C   . PRO C 1 101 ? -3.879  47.638  67.488  1.00 78.45  ? 143 PRO C C   1 
ATOM 4144 O O   . PRO C 1 101 ? -4.015  46.796  68.384  1.00 78.45  ? 143 PRO C O   1 
ATOM 4145 C CB  . PRO C 1 101 ? -5.462  49.555  67.071  1.00 78.45  ? 143 PRO C CB  1 
ATOM 4146 C CG  . PRO C 1 101 ? -5.047  50.117  65.729  1.00 78.45  ? 143 PRO C CG  1 
ATOM 4147 C CD  . PRO C 1 101 ? -3.844  50.877  66.119  1.00 78.45  ? 143 PRO C CD  1 
ATOM 4148 N N   . LEU C 1 102 ? -3.406  47.372  66.281  1.00 78.45  ? 144 LEU C N   1 
ATOM 4149 C CA  . LEU C 1 102 ? -3.074  46.045  65.820  1.00 78.45  ? 144 LEU C CA  1 
ATOM 4150 C C   . LEU C 1 102 ? -1.981  45.484  66.725  1.00 78.45  ? 144 LEU C C   1 
ATOM 4151 O O   . LEU C 1 102 ? -1.802  44.279  66.822  1.00 78.45  ? 144 LEU C O   1 
ATOM 4152 C CB  . LEU C 1 102 ? -2.591  46.155  64.379  1.00 78.45  ? 144 LEU C CB  1 
ATOM 4153 C CG  . LEU C 1 102 ? -3.627  46.622  63.343  1.00 78.45  ? 144 LEU C CG  1 
ATOM 4154 C CD1 . LEU C 1 102 ? -4.905  47.158  63.960  1.00 78.45  ? 144 LEU C CD1 1 
ATOM 4155 C CD2 . LEU C 1 102 ? -3.011  47.643  62.430  1.00 78.45  ? 144 LEU C CD2 1 
ATOM 4156 N N   . GLY C 1 103 ? -1.257  46.382  67.390  1.00 78.45  ? 145 GLY C N   1 
ATOM 4157 C CA  . GLY C 1 103 ? -0.208  45.990  68.314  1.00 78.45  ? 145 GLY C CA  1 
ATOM 4158 C C   . GLY C 1 103 ? -0.789  45.156  69.438  1.00 78.45  ? 145 GLY C C   1 
ATOM 4159 O O   . GLY C 1 103 ? -0.690  43.931  69.399  1.00 78.45  ? 145 GLY C O   1 
ATOM 4160 N N   . GLU C 1 104 ? -1.419  45.804  70.421  1.00 78.45  ? 146 GLU C N   1 
ATOM 4161 C CA  . GLU C 1 104 ? -2.035  45.084  71.546  1.00 78.45  ? 146 GLU C CA  1 
ATOM 4162 C C   . GLU C 1 104 ? -2.985  44.003  71.021  1.00 78.45  ? 146 GLU C C   1 
ATOM 4163 O O   . GLU C 1 104 ? -3.190  42.976  71.665  1.00 78.45  ? 146 GLU C O   1 
ATOM 4164 C CB  . GLU C 1 104 ? -2.815  46.039  72.486  1.00 78.45  ? 146 GLU C CB  1 
ATOM 4165 C CG  . GLU C 1 104 ? -3.360  45.373  73.804  1.00 78.45  ? 146 GLU C CG  1 
ATOM 4166 C CD  . GLU C 1 104 ? -4.318  46.259  74.643  1.00 78.45  ? 146 GLU C CD  1 
ATOM 4167 O OE1 . GLU C 1 104 ? -5.522  46.345  74.292  1.00 78.45  ? 146 GLU C OE1 1 
ATOM 4168 O OE2 . GLU C 1 104 ? -3.882  46.833  75.677  1.00 78.45  ? 146 GLU C OE2 1 
ATOM 4169 N N   . GLU C 1 105 ? -3.569  44.238  69.851  1.00 78.45  ? 147 GLU C N   1 
ATOM 4170 C CA  . GLU C 1 105 ? -4.489  43.262  69.277  1.00 78.45  ? 147 GLU C CA  1 
ATOM 4171 C C   . GLU C 1 105 ? -3.741  42.032  68.779  1.00 78.45  ? 147 GLU C C   1 
ATOM 4172 O O   . GLU C 1 105 ? -3.654  41.016  69.474  1.00 78.45  ? 147 GLU C O   1 
ATOM 4173 C CB  . GLU C 1 105 ? -5.299  43.898  68.141  1.00 78.45  ? 147 GLU C CB  1 
ATOM 4174 C CG  . GLU C 1 105 ? -6.802  44.035  68.454  1.00 78.45  ? 147 GLU C CG  1 
ATOM 4175 C CD  . GLU C 1 105 ? -7.587  44.827  67.398  1.00 78.45  ? 147 GLU C CD  1 
ATOM 4176 O OE1 . GLU C 1 105 ? -7.020  45.125  66.314  1.00 78.45  ? 147 GLU C OE1 1 
ATOM 4177 O OE2 . GLU C 1 105 ? -8.776  45.149  67.671  1.00 78.45  ? 147 GLU C OE2 1 
ATOM 4178 N N   . MET C 1 106 ? -3.209  42.154  67.568  1.00 78.45  ? 148 MET C N   1 
ATOM 4179 C CA  . MET C 1 106 ? -2.448  41.107  66.919  1.00 78.45  ? 148 MET C CA  1 
ATOM 4180 C C   . MET C 1 106 ? -1.538  40.463  67.950  1.00 78.45  ? 148 MET C C   1 
ATOM 4181 O O   . MET C 1 106 ? -1.823  39.371  68.422  1.00 78.45  ? 148 MET C O   1 
ATOM 4182 C CB  . MET C 1 106 ? -1.629  41.732  65.778  1.00 78.45  ? 148 MET C CB  1 
ATOM 4183 C CG  . MET C 1 106 ? -0.676  40.809  65.021  1.00 78.45  ? 148 MET C CG  1 
ATOM 4184 S SD  . MET C 1 106 ? 0.308   41.661  63.714  1.00 78.45  ? 148 MET C SD  1 
ATOM 4185 C CE  . MET C 1 106 ? 1.062   40.236  62.837  1.00 78.45  ? 148 MET C CE  1 
ATOM 4186 N N   . ARG C 1 107 ? -0.549  41.224  68.410  1.00 78.45  ? 149 ARG C N   1 
ATOM 4187 C CA  . ARG C 1 107 ? 0.427   40.726  69.378  1.00 78.45  ? 149 ARG C CA  1 
ATOM 4188 C C   . ARG C 1 107 ? -0.157  40.029  70.599  1.00 78.45  ? 149 ARG C C   1 
ATOM 4189 O O   . ARG C 1 107 ? -0.046  38.811  70.712  1.00 78.45  ? 149 ARG C O   1 
ATOM 4190 C CB  . ARG C 1 107 ? 1.424   41.828  69.799  1.00 78.45  ? 149 ARG C CB  1 
ATOM 4191 C CG  . ARG C 1 107 ? 2.684   41.313  70.558  1.00 78.45  ? 149 ARG C CG  1 
ATOM 4192 C CD  . ARG C 1 107 ? 3.839   42.368  70.673  1.00 78.45  ? 149 ARG C CD  1 
ATOM 4193 N NE  . ARG C 1 107 ? 5.124   41.794  71.132  1.00 78.45  ? 149 ARG C NE  1 
ATOM 4194 C CZ  . ARG C 1 107 ? 6.318   42.403  71.065  1.00 78.45  ? 149 ARG C CZ  1 
ATOM 4195 N NH1 . ARG C 1 107 ? 6.427   43.632  70.560  1.00 78.45  ? 149 ARG C NH1 1 
ATOM 4196 N NH2 . ARG C 1 107 ? 7.417   41.780  71.504  1.00 78.45  ? 149 ARG C NH2 1 
ATOM 4197 N N   . ASP C 1 108 ? -0.794  40.774  71.498  1.00 78.45  ? 150 ASP C N   1 
ATOM 4198 C CA  . ASP C 1 108 ? -1.350  40.144  72.691  1.00 78.45  ? 150 ASP C CA  1 
ATOM 4199 C C   . ASP C 1 108 ? -2.218  38.946  72.352  1.00 78.45  ? 150 ASP C C   1 
ATOM 4200 O O   . ASP C 1 108 ? -2.312  38.008  73.141  1.00 78.45  ? 150 ASP C O   1 
ATOM 4201 C CB  . ASP C 1 108 ? -2.132  41.137  73.554  1.00 78.45  ? 150 ASP C CB  1 
ATOM 4202 C CG  . ASP C 1 108 ? -1.356  41.580  74.790  1.00 78.45  ? 150 ASP C CG  1 
ATOM 4203 O OD1 . ASP C 1 108 ? -0.528  42.510  74.671  1.00 78.45  ? 150 ASP C OD1 1 
ATOM 4204 O OD2 . ASP C 1 108 ? -1.578  41.006  75.883  1.00 78.45  ? 150 ASP C OD2 1 
ATOM 4205 N N   . ARG C 1 109 ? -2.822  38.962  71.169  1.00 78.45  ? 151 ARG C N   1 
ATOM 4206 C CA  . ARG C 1 109 ? -3.655  37.845  70.763  1.00 78.45  ? 151 ARG C CA  1 
ATOM 4207 C C   . ARG C 1 109 ? -2.805  36.632  70.391  1.00 78.45  ? 151 ARG C C   1 
ATOM 4208 O O   . ARG C 1 109 ? -2.981  35.540  70.934  1.00 78.45  ? 151 ARG C O   1 
ATOM 4209 C CB  . ARG C 1 109 ? -4.561  38.235  69.593  1.00 78.45  ? 151 ARG C CB  1 
ATOM 4210 C CG  . ARG C 1 109 ? -5.274  37.038  69.004  1.00 78.45  ? 151 ARG C CG  1 
ATOM 4211 C CD  . ARG C 1 109 ? -6.665  37.346  68.493  1.00 78.45  ? 151 ARG C CD  1 
ATOM 4212 N NE  . ARG C 1 109 ? -7.344  36.098  68.148  1.00 78.45  ? 151 ARG C NE  1 
ATOM 4213 C CZ  . ARG C 1 109 ? -8.281  35.519  68.897  1.00 78.45  ? 151 ARG C CZ  1 
ATOM 4214 N NH1 . ARG C 1 109 ? -8.673  36.081  70.036  1.00 78.45  ? 151 ARG C NH1 1 
ATOM 4215 N NH2 . ARG C 1 109 ? -8.774  34.337  68.547  1.00 78.45  ? 151 ARG C NH2 1 
ATOM 4216 N N   . ALA C 1 110 ? -1.881  36.851  69.464  1.00 78.45  ? 152 ALA C N   1 
ATOM 4217 C CA  . ALA C 1 110 ? -0.987  35.814  68.967  1.00 78.45  ? 152 ALA C CA  1 
ATOM 4218 C C   . ALA C 1 110 ? -0.111  35.276  70.062  1.00 78.45  ? 152 ALA C C   1 
ATOM 4219 O O   . ALA C 1 110 ? 0.024   34.062  70.228  1.00 78.45  ? 152 ALA C O   1 
ATOM 4220 C CB  . ALA C 1 110 ? -0.125  36.371  67.875  1.00 78.45  ? 152 ALA C CB  1 
ATOM 4221 N N   . ARG C 1 111 ? 0.593   36.218  70.682  1.00 78.45  ? 153 ARG C N   1 
ATOM 4222 C CA  . ARG C 1 111 ? 1.492   35.998  71.795  1.00 78.45  ? 153 ARG C CA  1 
ATOM 4223 C C   . ARG C 1 111 ? 1.424   34.570  72.271  1.00 78.45  ? 153 ARG C C   1 
ATOM 4224 O O   . ARG C 1 111 ? 2.274   33.747  71.954  1.00 78.45  ? 153 ARG C O   1 
ATOM 4225 C CB  . ARG C 1 111 ? 1.084   36.942  72.936  1.00 78.45  ? 153 ARG C CB  1 
ATOM 4226 C CG  . ARG C 1 111 ? 1.667   36.612  74.315  1.00 78.45  ? 153 ARG C CG  1 
ATOM 4227 C CD  . ARG C 1 111 ? 1.051   37.477  75.446  1.00 78.45  ? 153 ARG C CD  1 
ATOM 4228 N NE  . ARG C 1 111 ? 1.627   37.164  76.765  1.00 78.45  ? 153 ARG C NE  1 
ATOM 4229 C CZ  . ARG C 1 111 ? 1.457   37.883  77.881  1.00 78.45  ? 153 ARG C CZ  1 
ATOM 4230 N NH1 . ARG C 1 111 ? 0.707   38.989  77.886  1.00 78.45  ? 153 ARG C NH1 1 
ATOM 4231 N NH2 . ARG C 1 111 ? 2.074   37.505  79.002  1.00 78.45  ? 153 ARG C NH2 1 
ATOM 4232 N N   . ALA C 1 112 ? 0.302   34.265  72.900  1.00 78.45  ? 154 ALA C N   1 
ATOM 4233 C CA  . ALA C 1 112 ? 0.064   32.959  73.461  1.00 78.45  ? 154 ALA C CA  1 
ATOM 4234 C C   . ALA C 1 112 ? 0.341   31.814  72.509  1.00 78.45  ? 154 ALA C C   1 
ATOM 4235 O O   . ALA C 1 112 ? 1.324   31.107  72.668  1.00 78.45  ? 154 ALA C O   1 
ATOM 4236 C CB  . ALA C 1 112 ? -1.331  32.879  73.991  1.00 78.45  ? 154 ALA C CB  1 
ATOM 4237 N N   . HIS C 1 113 ? -0.510  31.646  71.509  1.00 78.45  ? 155 HIS C N   1 
ATOM 4238 C CA  . HIS C 1 113 ? -0.329  30.558  70.569  1.00 78.45  ? 155 HIS C CA  1 
ATOM 4239 C C   . HIS C 1 113 ? 1.105   30.462  70.107  1.00 78.45  ? 155 HIS C C   1 
ATOM 4240 O O   . HIS C 1 113 ? 1.658   29.372  70.019  1.00 78.45  ? 155 HIS C O   1 
ATOM 4241 C CB  . HIS C 1 113 ? -1.282  30.717  69.402  1.00 78.45  ? 155 HIS C CB  1 
ATOM 4242 C CG  . HIS C 1 113 ? -2.713  30.727  69.795  1.00 78.45  ? 155 HIS C CG  1 
ATOM 4243 N ND1 . HIS C 1 113 ? -3.501  31.859  69.742  1.00 78.45  ? 155 HIS C ND1 1 
ATOM 4244 C CD2 . HIS C 1 113 ? -3.503  29.743  70.307  1.00 78.45  ? 155 HIS C CD2 1 
ATOM 4245 C CE1 . HIS C 1 113 ? -4.710  31.571  70.196  1.00 78.45  ? 155 HIS C CE1 1 
ATOM 4246 N NE2 . HIS C 1 113 ? -4.742  30.300  70.547  1.00 78.45  ? 155 HIS C NE2 1 
ATOM 4247 N N   . VAL C 1 114 ? 1.736   31.613  69.918  1.00 78.45  ? 156 VAL C N   1 
ATOM 4248 C CA  . VAL C 1 114 ? 3.119   31.659  69.486  1.00 78.45  ? 156 VAL C CA  1 
ATOM 4249 C C   . VAL C 1 114 ? 3.969   30.858  70.435  1.00 78.45  ? 156 VAL C C   1 
ATOM 4250 O O   . VAL C 1 114 ? 4.716   29.967  70.042  1.00 78.45  ? 156 VAL C O   1 
ATOM 4251 C CB  . VAL C 1 114 ? 3.668   33.062  69.564  1.00 78.45  ? 156 VAL C CB  1 
ATOM 4252 C CG1 . VAL C 1 114 ? 5.095   33.072  69.090  1.00 78.45  ? 156 VAL C CG1 1 
ATOM 4253 C CG2 . VAL C 1 114 ? 2.804   34.009  68.785  1.00 78.45  ? 156 VAL C CG2 1 
ATOM 4254 N N   . ASP C 1 115 ? 3.861   31.232  71.698  1.00 78.45  ? 157 ASP C N   1 
ATOM 4255 C CA  . ASP C 1 115 ? 4.600   30.607  72.776  1.00 78.45  ? 157 ASP C CA  1 
ATOM 4256 C C   . ASP C 1 115 ? 4.429   29.092  72.808  1.00 78.45  ? 157 ASP C C   1 
ATOM 4257 O O   . ASP C 1 115 ? 5.360   28.365  73.148  1.00 78.45  ? 157 ASP C O   1 
ATOM 4258 C CB  . ASP C 1 115 ? 4.133   31.214  74.100  1.00 78.45  ? 157 ASP C CB  1 
ATOM 4259 C CG  . ASP C 1 115 ? 5.012   30.821  75.271  1.00 78.45  ? 157 ASP C CG  1 
ATOM 4260 O OD1 . ASP C 1 115 ? 4.909   29.664  75.741  1.00 78.45  ? 157 ASP C OD1 1 
ATOM 4261 O OD2 . ASP C 1 115 ? 5.795   31.684  75.732  1.00 78.45  ? 157 ASP C OD2 1 
ATOM 4262 N N   . ALA C 1 116 ? 3.237   28.620  72.460  1.00 78.45  ? 158 ALA C N   1 
ATOM 4263 C CA  . ALA C 1 116 ? 2.948   27.194  72.463  1.00 78.45  ? 158 ALA C CA  1 
ATOM 4264 C C   . ALA C 1 116 ? 4.134   26.421  71.937  1.00 78.45  ? 158 ALA C C   1 
ATOM 4265 O O   . ALA C 1 116 ? 4.622   25.495  72.565  1.00 78.45  ? 158 ALA C O   1 
ATOM 4266 C CB  . ALA C 1 116 ? 1.725   26.907  71.608  1.00 78.45  ? 158 ALA C CB  1 
ATOM 4267 N N   . LEU C 1 117 ? 4.650   26.871  70.809  1.00 78.45  ? 159 LEU C N   1 
ATOM 4268 C CA  . LEU C 1 117 ? 5.774   26.201  70.222  1.00 78.45  ? 159 LEU C CA  1 
ATOM 4269 C C   . LEU C 1 117 ? 7.022   26.392  71.038  1.00 78.45  ? 159 LEU C C   1 
ATOM 4270 O O   . LEU C 1 117 ? 7.759   25.438  71.226  1.00 78.45  ? 159 LEU C O   1 
ATOM 4271 C CB  . LEU C 1 117 ? 5.949   26.637  68.782  1.00 78.45  ? 159 LEU C CB  1 
ATOM 4272 C CG  . LEU C 1 117 ? 4.669   26.321  68.006  1.00 78.45  ? 159 LEU C CG  1 
ATOM 4273 C CD1 . LEU C 1 117 ? 4.997   26.241  66.533  1.00 78.45  ? 159 LEU C CD1 1 
ATOM 4274 C CD2 . LEU C 1 117 ? 4.051   25.001  68.470  1.00 78.45  ? 159 LEU C CD2 1 
ATOM 4275 N N   . ARG C 1 118 ? 7.220   27.595  71.582  1.00 78.45  ? 160 ARG C N   1 
ATOM 4276 C CA  . ARG C 1 118 ? 8.389   27.881  72.429  1.00 78.45  ? 160 ARG C CA  1 
ATOM 4277 C C   . ARG C 1 118 ? 8.573   26.675  73.320  1.00 78.45  ? 160 ARG C C   1 
ATOM 4278 O O   . ARG C 1 118 ? 9.660   26.129  73.455  1.00 78.45  ? 160 ARG C O   1 
ATOM 4279 C CB  . ARG C 1 118 ? 8.149   29.109  73.342  1.00 78.45  ? 160 ARG C CB  1 
ATOM 4280 C CG  . ARG C 1 118 ? 9.136   29.226  74.567  1.00 78.45  ? 160 ARG C CG  1 
ATOM 4281 C CD  . ARG C 1 118 ? 8.767   30.316  75.633  1.00 78.45  ? 160 ARG C CD  1 
ATOM 4282 N NE  . ARG C 1 118 ? 9.805   30.508  76.672  1.00 78.45  ? 160 ARG C NE  1 
ATOM 4283 C CZ  . ARG C 1 118 ? 9.867   31.532  77.541  1.00 78.45  ? 160 ARG C CZ  1 
ATOM 4284 N NH1 . ARG C 1 118 ? 8.944   32.496  77.542  1.00 78.45  ? 160 ARG C NH1 1 
ATOM 4285 N NH2 . ARG C 1 118 ? 10.901  31.631  78.380  1.00 78.45  ? 160 ARG C NH2 1 
ATOM 4286 N N   . THR C 1 119 ? 7.451   26.228  73.857  1.00 78.45  ? 161 THR C N   1 
ATOM 4287 C CA  . THR C 1 119 ? 7.414   25.100  74.753  1.00 78.45  ? 161 THR C CA  1 
ATOM 4288 C C   . THR C 1 119 ? 7.357   23.768  74.029  1.00 78.45  ? 161 THR C C   1 
ATOM 4289 O O   . THR C 1 119 ? 7.962   22.796  74.468  1.00 78.45  ? 161 THR C O   1 
ATOM 4290 C CB  . THR C 1 119 ? 6.239   25.260  75.704  1.00 78.45  ? 161 THR C CB  1 
ATOM 4291 O OG1 . THR C 1 119 ? 5.119   25.784  74.978  1.00 78.45  ? 161 THR C OG1 1 
ATOM 4292 C CG2 . THR C 1 119 ? 6.602   26.233  76.825  1.00 78.45  ? 161 THR C CG2 1 
ATOM 4293 N N   . HIS C 1 120 ? 6.655   23.725  72.908  1.00 78.45  ? 162 HIS C N   1 
ATOM 4294 C CA  . HIS C 1 120 ? 6.565   22.493  72.153  1.00 78.45  ? 162 HIS C CA  1 
ATOM 4295 C C   . HIS C 1 120 ? 7.868   22.220  71.441  1.00 78.45  ? 162 HIS C C   1 
ATOM 4296 O O   . HIS C 1 120 ? 8.050   21.156  70.867  1.00 78.45  ? 162 HIS C O   1 
ATOM 4297 C CB  . HIS C 1 120 ? 5.430   22.564  71.147  1.00 78.45  ? 162 HIS C CB  1 
ATOM 4298 C CG  . HIS C 1 120 ? 4.209   21.821  71.579  1.00 78.45  ? 162 HIS C CG  1 
ATOM 4299 N ND1 . HIS C 1 120 ? 4.278   20.609  72.231  1.00 78.45  ? 162 HIS C ND1 1 
ATOM 4300 C CD2 . HIS C 1 120 ? 2.892   22.115  71.472  1.00 78.45  ? 162 HIS C CD2 1 
ATOM 4301 C CE1 . HIS C 1 120 ? 3.056   20.190  72.511  1.00 78.45  ? 162 HIS C CE1 1 
ATOM 4302 N NE2 . HIS C 1 120 ? 2.196   21.086  72.059  1.00 78.45  ? 162 HIS C NE2 1 
ATOM 4303 N N   . LEU C 1 121 ? 8.794   23.168  71.537  1.00 78.45  ? 163 LEU C N   1 
ATOM 4304 C CA  . LEU C 1 121 ? 10.091  23.066  70.892  1.00 78.45  ? 163 LEU C CA  1 
ATOM 4305 C C   . LEU C 1 121 ? 11.201  22.775  71.853  1.00 78.45  ? 163 LEU C C   1 
ATOM 4306 O O   . LEU C 1 121 ? 11.893  21.771  71.727  1.00 78.45  ? 163 LEU C O   1 
ATOM 4307 C CB  . LEU C 1 121 ? 10.451  24.375  70.213  1.00 78.45  ? 163 LEU C CB  1 
ATOM 4308 C CG  . LEU C 1 121 ? 9.895   24.640  68.831  1.00 78.45  ? 163 LEU C CG  1 
ATOM 4309 C CD1 . LEU C 1 121 ? 10.743  25.730  68.193  1.00 78.45  ? 163 LEU C CD1 1 
ATOM 4310 C CD2 . LEU C 1 121 ? 9.951   23.368  67.999  1.00 78.45  ? 163 LEU C CD2 1 
ATOM 4311 N N   . ALA C 1 122 ? 11.385  23.712  72.783  1.00 78.45  ? 164 ALA C N   1 
ATOM 4312 C CA  . ALA C 1 122 ? 12.427  23.678  73.813  1.00 78.45  ? 164 ALA C CA  1 
ATOM 4313 C C   . ALA C 1 122 ? 13.066  22.332  74.115  1.00 78.45  ? 164 ALA C C   1 
ATOM 4314 O O   . ALA C 1 122 ? 14.292  22.234  74.208  1.00 78.45  ? 164 ALA C O   1 
ATOM 4315 C CB  . ALA C 1 122 ? 11.928  24.320  75.095  1.00 78.45  ? 164 ALA C CB  1 
ATOM 4316 N N   . PRO C 1 123 ? 12.243  21.290  74.326  1.00 97.21  ? 165 PRO C N   1 
ATOM 4317 C CA  . PRO C 1 123 ? 12.803  19.970  74.615  1.00 97.21  ? 165 PRO C CA  1 
ATOM 4318 C C   . PRO C 1 123 ? 13.681  19.476  73.479  1.00 97.21  ? 165 PRO C C   1 
ATOM 4319 O O   . PRO C 1 123 ? 14.783  18.992  73.701  1.00 97.21  ? 165 PRO C O   1 
ATOM 4320 C CB  . PRO C 1 123 ? 11.555  19.099  74.756  1.00 97.21  ? 165 PRO C CB  1 
ATOM 4321 C CG  . PRO C 1 123 ? 10.503  19.846  73.955  1.00 97.21  ? 165 PRO C CG  1 
ATOM 4322 C CD  . PRO C 1 123 ? 10.772  21.241  74.399  1.00 97.21  ? 165 PRO C CD  1 
ATOM 4323 N N   . TYR C 1 124 ? 13.183  19.608  72.258  1.00 97.21  ? 166 TYR C N   1 
ATOM 4324 C CA  . TYR C 1 124 ? 13.923  19.163  71.102  1.00 97.21  ? 166 TYR C CA  1 
ATOM 4325 C C   . TYR C 1 124 ? 15.249  19.852  70.945  1.00 97.21  ? 166 TYR C C   1 
ATOM 4326 O O   . TYR C 1 124 ? 16.232  19.207  70.618  1.00 97.21  ? 166 TYR C O   1 
ATOM 4327 C CB  . TYR C 1 124 ? 13.066  19.270  69.851  1.00 97.21  ? 166 TYR C CB  1 
ATOM 4328 C CG  . TYR C 1 124 ? 12.038  18.164  69.779  1.00 97.21  ? 166 TYR C CG  1 
ATOM 4329 C CD1 . TYR C 1 124 ? 12.148  17.047  70.605  1.00 97.21  ? 166 TYR C CD1 1 
ATOM 4330 C CD2 . TYR C 1 124 ? 10.974  18.211  68.878  1.00 97.21  ? 166 TYR C CD2 1 
ATOM 4331 C CE1 . TYR C 1 124 ? 11.232  15.999  70.542  1.00 97.21  ? 166 TYR C CE1 1 
ATOM 4332 C CE2 . TYR C 1 124 ? 10.043  17.162  68.803  1.00 97.21  ? 166 TYR C CE2 1 
ATOM 4333 C CZ  . TYR C 1 124 ? 10.183  16.058  69.644  1.00 97.21  ? 166 TYR C CZ  1 
ATOM 4334 O OH  . TYR C 1 124 ? 9.293   15.004  69.605  1.00 97.21  ? 166 TYR C OH  1 
ATOM 4335 N N   . SER C 1 125 ? 15.286  21.154  71.188  1.00 97.21  ? 167 SER C N   1 
ATOM 4336 C CA  . SER C 1 125 ? 16.540  21.877  71.106  1.00 97.21  ? 167 SER C CA  1 
ATOM 4337 C C   . SER C 1 125 ? 17.447  21.093  72.024  1.00 97.21  ? 167 SER C C   1 
ATOM 4338 O O   . SER C 1 125 ? 18.393  20.455  71.580  1.00 97.21  ? 167 SER C O   1 
ATOM 4339 C CB  . SER C 1 125 ? 16.372  23.287  71.653  1.00 97.21  ? 167 SER C CB  1 
ATOM 4340 O OG  . SER C 1 125 ? 15.383  23.988  70.926  1.00 97.21  ? 167 SER C OG  1 
ATOM 4341 N N   . ASP C 1 126 ? 17.038  21.026  73.284  1.00 97.21  ? 168 ASP C N   1 
ATOM 4342 C CA  . ASP C 1 126 ? 17.773  20.299  74.306  1.00 97.21  ? 168 ASP C CA  1 
ATOM 4343 C C   . ASP C 1 126 ? 18.155  18.905  73.850  1.00 97.21  ? 168 ASP C C   1 
ATOM 4344 O O   . ASP C 1 126 ? 19.271  18.459  74.080  1.00 97.21  ? 168 ASP C O   1 
ATOM 4345 C CB  . ASP C 1 126 ? 16.926  20.154  75.570  1.00 97.21  ? 168 ASP C CB  1 
ATOM 4346 C CG  . ASP C 1 126 ? 17.083  21.316  76.531  1.00 97.21  ? 168 ASP C CG  1 
ATOM 4347 O OD1 . ASP C 1 126 ? 17.732  22.332  76.183  1.00 97.21  ? 168 ASP C OD1 1 
ATOM 4348 O OD2 . ASP C 1 126 ? 16.544  21.198  77.656  1.00 97.21  ? 168 ASP C OD2 1 
ATOM 4349 N N   . GLU C 1 127 ? 17.233  18.232  73.171  1.00 97.21  ? 169 GLU C N   1 
ATOM 4350 C CA  . GLU C 1 127 ? 17.461  16.866  72.715  1.00 97.21  ? 169 GLU C CA  1 
ATOM 4351 C C   . GLU C 1 127 ? 18.559  16.804  71.680  1.00 97.21  ? 169 GLU C C   1 
ATOM 4352 O O   . GLU C 1 127 ? 19.448  15.970  71.771  1.00 97.21  ? 169 GLU C O   1 
ATOM 4353 C CB  . GLU C 1 127 ? 16.164  16.252  72.155  1.00 97.21  ? 169 GLU C CB  1 
ATOM 4354 C CG  . GLU C 1 127 ? 16.240  14.737  71.834  1.00 97.21  ? 169 GLU C CG  1 
ATOM 4355 C CD  . GLU C 1 127 ? 14.869  14.087  71.550  1.00 97.21  ? 169 GLU C CD  1 
ATOM 4356 O OE1 . GLU C 1 127 ? 14.156  13.711  72.512  1.00 97.21  ? 169 GLU C OE1 1 
ATOM 4357 O OE2 . GLU C 1 127 ? 14.510  13.927  70.362  1.00 97.21  ? 169 GLU C OE2 1 
ATOM 4358 N N   . LEU C 1 128 ? 18.517  17.721  70.722  1.00 97.21  ? 170 LEU C N   1 
ATOM 4359 C CA  . LEU C 1 128 ? 19.509  17.744  69.666  1.00 97.21  ? 170 LEU C CA  1 
ATOM 4360 C C   . LEU C 1 128 ? 20.836  18.266  70.103  1.00 97.21  ? 170 LEU C C   1 
ATOM 4361 O O   . LEU C 1 128 ? 21.877  17.796  69.665  1.00 97.21  ? 170 LEU C O   1 
ATOM 4362 C CB  . LEU C 1 128 ? 19.032  18.558  68.478  1.00 97.21  ? 170 LEU C CB  1 
ATOM 4363 C CG  . LEU C 1 128 ? 18.514  17.648  67.369  1.00 97.21  ? 170 LEU C CG  1 
ATOM 4364 C CD1 . LEU C 1 128 ? 18.406  18.438  66.077  1.00 97.21  ? 170 LEU C CD1 1 
ATOM 4365 C CD2 . LEU C 1 128 ? 19.466  16.468  67.172  1.00 97.21  ? 170 LEU C CD2 1 
ATOM 4366 N N   . ARG C 1 129 ? 20.788  19.293  70.925  1.00 97.21  ? 171 ARG C N   1 
ATOM 4367 C CA  . ARG C 1 129 ? 21.987  19.900  71.442  1.00 97.21  ? 171 ARG C CA  1 
ATOM 4368 C C   . ARG C 1 129 ? 22.836  18.772  72.047  1.00 97.21  ? 171 ARG C C   1 
ATOM 4369 O O   . ARG C 1 129 ? 23.949  18.508  71.595  1.00 97.21  ? 171 ARG C O   1 
ATOM 4370 C CB  . ARG C 1 129 ? 21.583  20.942  72.493  1.00 97.21  ? 171 ARG C CB  1 
ATOM 4371 C CG  . ARG C 1 129 ? 20.745  22.123  71.947  1.00 97.21  ? 171 ARG C CG  1 
ATOM 4372 C CD  . ARG C 1 129 ? 20.061  22.922  73.082  1.00 97.21  ? 171 ARG C CD  1 
ATOM 4373 N NE  . ARG C 1 129 ? 20.081  24.374  72.853  1.00 97.21  ? 171 ARG C NE  1 
ATOM 4374 C CZ  . ARG C 1 129 ? 19.867  25.304  73.792  1.00 97.21  ? 171 ARG C CZ  1 
ATOM 4375 N NH1 . ARG C 1 129 ? 19.586  24.956  75.048  1.00 97.21  ? 171 ARG C NH1 1 
ATOM 4376 N NH2 . ARG C 1 129 ? 20.041  26.592  73.499  1.00 97.21  ? 171 ARG C NH2 1 
ATOM 4377 N N   . GLN C 1 130 ? 22.226  18.023  72.962  1.00 97.21  ? 172 GLN C N   1 
ATOM 4378 C CA  . GLN C 1 130 ? 22.873  16.906  73.642  1.00 97.21  ? 172 GLN C CA  1 
ATOM 4379 C C   . GLN C 1 130 ? 23.348  15.861  72.640  1.00 97.21  ? 172 GLN C C   1 
ATOM 4380 O O   . GLN C 1 130 ? 24.311  15.134  72.890  1.00 97.21  ? 172 GLN C O   1 
ATOM 4381 C CB  . GLN C 1 130 ? 21.878  16.264  74.611  1.00 97.21  ? 172 GLN C CB  1 
ATOM 4382 C CG  . GLN C 1 130 ? 22.424  16.030  76.016  1.00 97.21  ? 172 GLN C CG  1 
ATOM 4383 C CD  . GLN C 1 130 ? 22.989  14.626  76.229  1.00 97.21  ? 172 GLN C CD  1 
ATOM 4384 O OE1 . GLN C 1 130 ? 24.165  14.369  75.969  1.00 97.21  ? 172 GLN C OE1 1 
ATOM 4385 N NE2 . GLN C 1 130 ? 22.152  13.719  76.722  1.00 97.21  ? 172 GLN C NE2 1 
ATOM 4386 N N   . ARG C 1 131 ? 22.656  15.793  71.506  1.00 97.21  ? 173 ARG C N   1 
ATOM 4387 C CA  . ARG C 1 131 ? 22.980  14.838  70.454  1.00 97.21  ? 173 ARG C CA  1 
ATOM 4388 C C   . ARG C 1 131 ? 24.094  15.302  69.509  1.00 97.21  ? 173 ARG C C   1 
ATOM 4389 O O   . ARG C 1 131 ? 25.222  14.806  69.580  1.00 97.21  ? 173 ARG C O   1 
ATOM 4390 C CB  . ARG C 1 131 ? 21.698  14.454  69.682  1.00 97.21  ? 173 ARG C CB  1 
ATOM 4391 C CG  . ARG C 1 131 ? 20.689  13.642  70.532  1.00 97.21  ? 173 ARG C CG  1 
ATOM 4392 C CD  . ARG C 1 131 ? 19.413  13.207  69.783  1.00 97.21  ? 173 ARG C CD  1 
ATOM 4393 N NE  . ARG C 1 131 ? 18.809  12.005  70.385  1.00 97.21  ? 173 ARG C NE  1 
ATOM 4394 C CZ  . ARG C 1 131 ? 17.864  11.247  69.815  1.00 97.21  ? 173 ARG C CZ  1 
ATOM 4395 N NH1 . ARG C 1 131 ? 17.377  11.556  68.614  1.00 97.21  ? 173 ARG C NH1 1 
ATOM 4396 N NH2 . ARG C 1 131 ? 17.468  10.116  70.403  1.00 97.21  ? 173 ARG C NH2 1 
ATOM 4397 N N   . LEU C 1 132 ? 23.791  16.267  68.646  1.00 97.21  ? 174 LEU C N   1 
ATOM 4398 C CA  . LEU C 1 132 ? 24.766  16.772  67.690  1.00 97.21  ? 174 LEU C CA  1 
ATOM 4399 C C   . LEU C 1 132 ? 26.117  17.163  68.275  1.00 97.21  ? 174 LEU C C   1 
ATOM 4400 O O   . LEU C 1 132 ? 27.152  16.951  67.648  1.00 97.21  ? 174 LEU C O   1 
ATOM 4401 C CB  . LEU C 1 132 ? 24.191  17.950  66.928  1.00 97.21  ? 174 LEU C CB  1 
ATOM 4402 C CG  . LEU C 1 132 ? 25.175  18.440  65.880  1.00 97.21  ? 174 LEU C CG  1 
ATOM 4403 C CD1 . LEU C 1 132 ? 25.427  17.342  64.866  1.00 97.21  ? 174 LEU C CD1 1 
ATOM 4404 C CD2 . LEU C 1 132 ? 24.635  19.667  65.212  1.00 97.21  ? 174 LEU C CD2 1 
ATOM 4405 N N   . ALA C 1 133 ? 26.102  17.756  69.458  1.00 97.21  ? 175 ALA C N   1 
ATOM 4406 C CA  . ALA C 1 133 ? 27.338  18.169  70.111  1.00 97.21  ? 175 ALA C CA  1 
ATOM 4407 C C   . ALA C 1 133 ? 28.297  16.989  70.281  1.00 97.21  ? 175 ALA C C   1 
ATOM 4408 O O   . ALA C 1 133 ? 29.429  17.022  69.795  1.00 97.21  ? 175 ALA C O   1 
ATOM 4409 C CB  . ALA C 1 133 ? 27.030  18.805  71.456  1.00 97.21  ? 175 ALA C CB  1 
ATOM 4410 N N   . ALA C 1 134 ? 27.824  15.940  70.947  1.00 97.21  ? 176 ALA C N   1 
ATOM 4411 C CA  . ALA C 1 134 ? 28.632  14.749  71.180  1.00 97.21  ? 176 ALA C CA  1 
ATOM 4412 C C   . ALA C 1 134 ? 29.114  14.152  69.870  1.00 97.21  ? 176 ALA C C   1 
ATOM 4413 O O   . ALA C 1 134 ? 30.157  13.501  69.826  1.00 97.21  ? 176 ALA C O   1 
ATOM 4414 C CB  . ALA C 1 134 ? 27.843  13.719  71.963  1.00 97.21  ? 176 ALA C CB  1 
ATOM 4415 N N   . ARG C 1 135 ? 28.341  14.371  68.809  1.00 97.21  ? 177 ARG C N   1 
ATOM 4416 C CA  . ARG C 1 135 ? 28.698  13.874  67.493  1.00 97.21  ? 177 ARG C CA  1 
ATOM 4417 C C   . ARG C 1 135 ? 30.067  14.404  67.118  1.00 97.21  ? 177 ARG C C   1 
ATOM 4418 O O   . ARG C 1 135 ? 30.906  13.688  66.573  1.00 97.21  ? 177 ARG C O   1 
ATOM 4419 C CB  . ARG C 1 135 ? 27.700  14.360  66.451  1.00 97.21  ? 177 ARG C CB  1 
ATOM 4420 C CG  . ARG C 1 135 ? 26.678  13.340  66.020  1.00 97.21  ? 177 ARG C CG  1 
ATOM 4421 C CD  . ARG C 1 135 ? 26.094  13.745  64.673  1.00 97.21  ? 177 ARG C CD  1 
ATOM 4422 N NE  . ARG C 1 135 ? 25.157  12.756  64.151  1.00 97.21  ? 177 ARG C NE  1 
ATOM 4423 C CZ  . ARG C 1 135 ? 23.838  12.909  64.148  1.00 97.21  ? 177 ARG C CZ  1 
ATOM 4424 N NH1 . ARG C 1 135 ? 23.293  14.018  64.637  1.00 97.21  ? 177 ARG C NH1 1 
ATOM 4425 N NH2 . ARG C 1 135 ? 23.064  11.948  63.659  1.00 97.21  ? 177 ARG C NH2 1 
ATOM 4426 N N   . LEU C 1 136 ? 30.300  15.666  67.439  1.00 97.21  ? 178 LEU C N   1 
ATOM 4427 C CA  . LEU C 1 136 ? 31.565  16.284  67.106  1.00 97.21  ? 178 LEU C CA  1 
ATOM 4428 C C   . LEU C 1 136 ? 32.689  15.865  68.016  1.00 97.21  ? 178 LEU C C   1 
ATOM 4429 O O   . LEU C 1 136 ? 33.853  15.946  67.632  1.00 97.21  ? 178 LEU C O   1 
ATOM 4430 C CB  . LEU C 1 136 ? 31.419  17.788  67.082  1.00 97.21  ? 178 LEU C CB  1 
ATOM 4431 C CG  . LEU C 1 136 ? 30.212  18.155  66.226  1.00 97.21  ? 178 LEU C CG  1 
ATOM 4432 C CD1 . LEU C 1 136 ? 30.288  19.623  65.941  1.00 97.21  ? 178 LEU C CD1 1 
ATOM 4433 C CD2 . LEU C 1 136 ? 30.189  17.356  64.917  1.00 97.21  ? 178 LEU C CD2 1 
ATOM 4434 N N   . GLU C 1 137 ? 32.353  15.435  69.227  1.00 97.21  ? 179 GLU C N   1 
ATOM 4435 C CA  . GLU C 1 137 ? 33.380  14.966  70.142  1.00 97.21  ? 179 GLU C CA  1 
ATOM 4436 C C   . GLU C 1 137 ? 33.936  13.703  69.504  1.00 97.21  ? 179 GLU C C   1 
ATOM 4437 O O   . GLU C 1 137 ? 35.117  13.390  69.638  1.00 97.21  ? 179 GLU C O   1 
ATOM 4438 C CB  . GLU C 1 137 ? 32.793  14.644  71.513  1.00 97.21  ? 179 GLU C CB  1 
ATOM 4439 C CG  . GLU C 1 137 ? 33.785  13.948  72.438  1.00 97.21  ? 179 GLU C CG  1 
ATOM 4440 C CD  . GLU C 1 137 ? 33.825  14.550  73.831  1.00 97.21  ? 179 GLU C CD  1 
ATOM 4441 O OE1 . GLU C 1 137 ? 34.330  15.687  73.973  1.00 97.21  ? 179 GLU C OE1 1 
ATOM 4442 O OE2 . GLU C 1 137 ? 33.365  13.882  74.787  1.00 97.21  ? 179 GLU C OE2 1 
ATOM 4443 N N   . ALA C 1 138 ? 33.068  12.993  68.791  1.00 97.21  ? 180 ALA C N   1 
ATOM 4444 C CA  . ALA C 1 138 ? 33.467  11.778  68.105  1.00 97.21  ? 180 ALA C CA  1 
ATOM 4445 C C   . ALA C 1 138 ? 34.397  12.146  66.963  1.00 97.21  ? 180 ALA C C   1 
ATOM 4446 O O   . ALA C 1 138 ? 35.146  11.313  66.479  1.00 97.21  ? 180 ALA C O   1 
ATOM 4447 C CB  . ALA C 1 138 ? 32.253  11.045  67.577  1.00 97.21  ? 180 ALA C CB  1 
ATOM 4448 N N   . LEU C 1 139 ? 34.352  13.400  66.536  1.00 97.21  ? 181 LEU C N   1 
ATOM 4449 C CA  . LEU C 1 139 ? 35.215  13.838  65.456  1.00 97.21  ? 181 LEU C CA  1 
ATOM 4450 C C   . LEU C 1 139 ? 36.653  14.020  65.918  1.00 97.21  ? 181 LEU C C   1 
ATOM 4451 O O   . LEU C 1 139 ? 37.578  13.514  65.286  1.00 97.21  ? 181 LEU C O   1 
ATOM 4452 C CB  . LEU C 1 139 ? 34.688  15.125  64.838  1.00 97.21  ? 181 LEU C CB  1 
ATOM 4453 C CG  . LEU C 1 139 ? 35.378  15.476  63.524  1.00 97.21  ? 181 LEU C CG  1 
ATOM 4454 C CD1 . LEU C 1 139 ? 35.258  14.307  62.549  1.00 97.21  ? 181 LEU C CD1 1 
ATOM 4455 C CD2 . LEU C 1 139 ? 34.759  16.729  62.941  1.00 97.21  ? 181 LEU C CD2 1 
ATOM 4456 N N   . LYS C 1 140 ? 36.838  14.770  66.998  1.00 97.21  ? 182 LYS C N   1 
ATOM 4457 C CA  . LYS C 1 140 ? 38.163  15.009  67.565  1.00 97.21  ? 182 LYS C CA  1 
ATOM 4458 C C   . LYS C 1 140 ? 38.776  13.677  67.971  1.00 97.21  ? 182 LYS C C   1 
ATOM 4459 O O   . LYS C 1 140 ? 39.876  13.325  67.541  1.00 97.21  ? 182 LYS C O   1 
ATOM 4460 C CB  . LYS C 1 140 ? 38.056  15.893  68.807  1.00 97.21  ? 182 LYS C CB  1 
ATOM 4461 C CG  . LYS C 1 140 ? 38.472  17.336  68.608  1.00 97.21  ? 182 LYS C CG  1 
ATOM 4462 C CD  . LYS C 1 140 ? 38.495  18.084  69.944  1.00 97.21  ? 182 LYS C CD  1 
ATOM 4463 C CE  . LYS C 1 140 ? 39.543  17.505  70.897  1.00 97.21  ? 182 LYS C CE  1 
ATOM 4464 N NZ  . LYS C 1 140 ? 39.633  18.257  72.183  1.00 97.21  ? 182 LYS C NZ  1 
ATOM 4465 N N   . GLU C 1 141 ? 38.049  12.954  68.819  1.00 97.21  ? 183 GLU C N   1 
ATOM 4466 C CA  . GLU C 1 141 ? 38.473  11.650  69.305  1.00 97.21  ? 183 GLU C CA  1 
ATOM 4467 C C   . GLU C 1 141 ? 38.804  10.734  68.128  1.00 97.21  ? 183 GLU C C   1 
ATOM 4468 O O   . GLU C 1 141 ? 39.811  10.027  68.159  1.00 97.21  ? 183 GLU C O   1 
ATOM 4469 C CB  . GLU C 1 141 ? 37.376  11.050  70.199  1.00 97.21  ? 183 GLU C CB  1 
ATOM 4470 C CG  . GLU C 1 141 ? 37.466  9.541   70.455  1.00 97.21  ? 183 GLU C CG  1 
ATOM 4471 C CD  . GLU C 1 141 ? 36.805  8.695   69.358  1.00 97.21  ? 183 GLU C CD  1 
ATOM 4472 O OE1 . GLU C 1 141 ? 35.863  9.188   68.695  1.00 97.21  ? 183 GLU C OE1 1 
ATOM 4473 O OE2 . GLU C 1 141 ? 37.223  7.531   69.157  1.00 97.21  ? 183 GLU C OE2 1 
ATOM 4474 N N   . ASN C 1 142 ? 37.984  10.769  67.077  1.00 97.21  ? 184 ASN C N   1 
ATOM 4475 C CA  . ASN C 1 142 ? 38.242  9.929   65.913  1.00 97.21  ? 184 ASN C CA  1 
ATOM 4476 C C   . ASN C 1 142 ? 39.353  10.468  65.047  1.00 97.21  ? 184 ASN C C   1 
ATOM 4477 O O   . ASN C 1 142 ? 40.017  9.703   64.354  1.00 97.21  ? 184 ASN C O   1 
ATOM 4478 C CB  . ASN C 1 142 ? 36.991  9.688   65.085  1.00 97.21  ? 184 ASN C CB  1 
ATOM 4479 C CG  . ASN C 1 142 ? 36.356  8.355   65.392  1.00 97.21  ? 184 ASN C CG  1 
ATOM 4480 O OD1 . ASN C 1 142 ? 36.980  7.306   65.216  1.00 97.21  ? 184 ASN C OD1 1 
ATOM 4481 N ND2 . ASN C 1 142 ? 35.123  8.384   65.888  1.00 97.21  ? 184 ASN C ND2 1 
ATOM 4482 N N   . GLY C 1 143 ? 39.566  11.780  65.098  1.00 97.21  ? 185 GLY C N   1 
ATOM 4483 C CA  . GLY C 1 143 ? 40.644  12.381  64.335  1.00 97.21  ? 185 GLY C CA  1 
ATOM 4484 C C   . GLY C 1 143 ? 41.949  11.809  64.869  1.00 97.21  ? 185 GLY C C   1 
ATOM 4485 O O   . GLY C 1 143 ? 42.868  11.489  64.107  1.00 97.21  ? 185 GLY C O   1 
ATOM 4486 N N   . GLY C 1 144 ? 41.994  11.627  66.188  1.00 97.21  ? 186 GLY C N   1 
ATOM 4487 C CA  . GLY C 1 144 ? 43.167  11.074  66.842  1.00 97.21  ? 186 GLY C CA  1 
ATOM 4488 C C   . GLY C 1 144 ? 43.432  9.636   66.436  1.00 97.21  ? 186 GLY C C   1 
ATOM 4489 O O   . GLY C 1 144 ? 44.582  9.213   66.365  1.00 97.21  ? 186 GLY C O   1 
ATOM 4490 N N   . ALA C 1 145 ? 42.367  8.888   66.162  1.00 132.74 ? 187 ALA C N   1 
ATOM 4491 C CA  . ALA C 1 145 ? 42.491  7.496   65.750  1.00 132.74 ? 187 ALA C CA  1 
ATOM 4492 C C   . ALA C 1 145 ? 43.248  7.417   64.436  1.00 132.74 ? 187 ALA C C   1 
ATOM 4493 O O   . ALA C 1 145 ? 44.275  6.755   64.345  1.00 132.74 ? 187 ALA C O   1 
ATOM 4494 C CB  . ALA C 1 145 ? 41.119  6.857   65.605  1.00 132.74 ? 187 ALA C CB  1 
ATOM 4495 N N   . ARG C 1 146 ? 42.756  8.135   63.432  1.00 132.74 ? 188 ARG C N   1 
ATOM 4496 C CA  . ARG C 1 146 ? 43.380  8.145   62.120  1.00 132.74 ? 188 ARG C CA  1 
ATOM 4497 C C   . ARG C 1 146 ? 44.792  8.682   62.177  1.00 132.74 ? 188 ARG C C   1 
ATOM 4498 O O   . ARG C 1 146 ? 45.703  8.078   61.628  1.00 132.74 ? 188 ARG C O   1 
ATOM 4499 C CB  . ARG C 1 146 ? 42.562  8.977   61.144  1.00 132.74 ? 188 ARG C CB  1 
ATOM 4500 C CG  . ARG C 1 146 ? 41.340  8.267   60.606  1.00 132.74 ? 188 ARG C CG  1 
ATOM 4501 C CD  . ARG C 1 146 ? 40.293  7.993   61.667  1.00 132.74 ? 188 ARG C CD  1 
ATOM 4502 N NE  . ARG C 1 146 ? 39.016  7.616   61.064  1.00 132.74 ? 188 ARG C NE  1 
ATOM 4503 C CZ  . ARG C 1 146 ? 38.289  8.422   60.287  1.00 132.74 ? 188 ARG C CZ  1 
ATOM 4504 N NH1 . ARG C 1 146 ? 38.692  9.661   60.013  1.00 132.74 ? 188 ARG C NH1 1 
ATOM 4505 N NH2 . ARG C 1 146 ? 37.193  7.970   59.707  1.00 132.74 ? 188 ARG C NH2 1 
ATOM 4506 N N   . LEU C 1 147 ? 44.968  9.821   62.838  1.00 132.74 ? 189 LEU C N   1 
ATOM 4507 C CA  . LEU C 1 147 ? 46.290  10.419  62.957  1.00 132.74 ? 189 LEU C CA  1 
ATOM 4508 C C   . LEU C 1 147 ? 47.244  9.405   63.554  1.00 132.74 ? 189 LEU C C   1 
ATOM 4509 O O   . LEU C 1 147 ? 48.322  9.172   63.024  1.00 132.74 ? 189 LEU C O   1 
ATOM 4510 C CB  . LEU C 1 147 ? 46.248  11.670  63.833  1.00 132.74 ? 189 LEU C CB  1 
ATOM 4511 C CG  . LEU C 1 147 ? 47.378  12.700  63.688  1.00 132.74 ? 189 LEU C CG  1 
ATOM 4512 C CD1 . LEU C 1 147 ? 47.073  13.882  64.582  1.00 132.74 ? 189 LEU C CD1 1 
ATOM 4513 C CD2 . LEU C 1 147 ? 48.741  12.124  64.030  1.00 132.74 ? 189 LEU C CD2 1 
ATOM 4514 N N   . ALA C 1 148 ? 46.819  8.765   64.634  1.00 132.74 ? 190 ALA C N   1 
ATOM 4515 C CA  . ALA C 1 148 ? 47.644  7.768   65.302  1.00 132.74 ? 190 ALA C CA  1 
ATOM 4516 C C   . ALA C 1 148 ? 47.935  6.609   64.361  1.00 132.74 ? 190 ALA C C   1 
ATOM 4517 O O   . ALA C 1 148 ? 49.056  6.114   64.301  1.00 132.74 ? 190 ALA C O   1 
ATOM 4518 C CB  . ALA C 1 148 ? 46.956  7.267   66.552  1.00 132.74 ? 190 ALA C CB  1 
ATOM 4519 N N   . GLU C 1 149 ? 46.918  6.206   63.609  1.00 132.74 ? 191 GLU C N   1 
ATOM 4520 C CA  . GLU C 1 149 ? 47.031  5.113   62.652  1.00 132.74 ? 191 GLU C CA  1 
ATOM 4521 C C   . GLU C 1 149 ? 47.944  5.530   61.508  1.00 132.74 ? 191 GLU C C   1 
ATOM 4522 O O   . GLU C 1 149 ? 48.673  4.715   60.945  1.00 132.74 ? 191 GLU C O   1 
ATOM 4523 C CB  . GLU C 1 149 ? 45.637  4.769   62.127  1.00 132.74 ? 191 GLU C CB  1 
ATOM 4524 C CG  . GLU C 1 149 ? 45.538  3.505   61.286  1.00 132.74 ? 191 GLU C CG  1 
ATOM 4525 C CD  . GLU C 1 149 ? 44.092  3.126   60.955  1.00 132.74 ? 191 GLU C CD  1 
ATOM 4526 O OE1 . GLU C 1 149 ? 43.154  3.865   61.338  1.00 132.74 ? 191 GLU C OE1 1 
ATOM 4527 O OE2 . GLU C 1 149 ? 43.893  2.070   60.314  1.00 132.74 ? 191 GLU C OE2 1 
ATOM 4528 N N   . TYR C 1 150 ? 47.941  6.826   61.223  1.00 132.74 ? 192 TYR C N   1 
ATOM 4529 C CA  . TYR C 1 150 ? 48.743  7.381   60.151  1.00 132.74 ? 192 TYR C CA  1 
ATOM 4530 C C   . TYR C 1 150 ? 50.205  7.490   60.516  1.00 132.74 ? 192 TYR C C   1 
ATOM 4531 O O   . TYR C 1 150 ? 51.056  6.865   59.884  1.00 132.74 ? 192 TYR C O   1 
ATOM 4532 C CB  . TYR C 1 150 ? 48.214  8.747   59.740  1.00 132.74 ? 192 TYR C CB  1 
ATOM 4533 C CG  . TYR C 1 150 ? 49.023  9.374   58.634  1.00 132.74 ? 192 TYR C CG  1 
ATOM 4534 C CD1 . TYR C 1 150 ? 49.094  8.783   57.378  1.00 132.74 ? 192 TYR C CD1 1 
ATOM 4535 C CD2 . TYR C 1 150 ? 49.722  10.553  58.848  1.00 132.74 ? 192 TYR C CD2 1 
ATOM 4536 C CE1 . TYR C 1 150 ? 49.857  9.359   56.357  1.00 132.74 ? 192 TYR C CE1 1 
ATOM 4537 C CE2 . TYR C 1 150 ? 50.478  11.130  57.838  1.00 132.74 ? 192 TYR C CE2 1 
ATOM 4538 C CZ  . TYR C 1 150 ? 50.537  10.530  56.613  1.00 132.74 ? 192 TYR C CZ  1 
ATOM 4539 O OH  . TYR C 1 150 ? 51.323  11.127  55.654  1.00 132.74 ? 192 TYR C OH  1 
ATOM 4540 N N   . HIS C 1 151 ? 50.494  8.324   61.508  1.00 132.74 ? 193 HIS C N   1 
ATOM 4541 C CA  . HIS C 1 151 ? 51.852  8.525   61.974  1.00 132.74 ? 193 HIS C CA  1 
ATOM 4542 C C   . HIS C 1 151 ? 52.586  7.202   62.046  1.00 132.74 ? 193 HIS C C   1 
ATOM 4543 O O   . HIS C 1 151 ? 53.738  7.095   61.628  1.00 132.74 ? 193 HIS C O   1 
ATOM 4544 C CB  . HIS C 1 151 ? 51.852  9.172   63.351  1.00 132.74 ? 193 HIS C CB  1 
ATOM 4545 C CG  . HIS C 1 151 ? 53.177  9.097   64.036  1.00 132.74 ? 193 HIS C CG  1 
ATOM 4546 N ND1 . HIS C 1 151 ? 53.614  7.962   64.683  1.00 132.74 ? 193 HIS C ND1 1 
ATOM 4547 C CD2 . HIS C 1 151 ? 54.189  9.994   64.118  1.00 132.74 ? 193 HIS C CD2 1 
ATOM 4548 C CE1 . HIS C 1 151 ? 54.841  8.162   65.131  1.00 132.74 ? 193 HIS C CE1 1 
ATOM 4549 N NE2 . HIS C 1 151 ? 55.214  9.385   64.801  1.00 132.74 ? 193 HIS C NE2 1 
ATOM 4550 N N   . ALA C 1 152 ? 51.911  6.211   62.614  1.00 132.74 ? 194 ALA C N   1 
ATOM 4551 C CA  . ALA C 1 152 ? 52.472  4.882   62.750  1.00 132.74 ? 194 ALA C CA  1 
ATOM 4552 C C   . ALA C 1 152 ? 52.981  4.414   61.398  1.00 132.74 ? 194 ALA C C   1 
ATOM 4553 O O   . ALA C 1 152 ? 54.146  4.046   61.260  1.00 132.74 ? 194 ALA C O   1 
ATOM 4554 C CB  . ALA C 1 152 ? 51.419  3.929   63.271  1.00 132.74 ? 194 ALA C CB  1 
ATOM 4555 N N   . LYS C 1 153 ? 52.114  4.475   60.393  1.00 132.74 ? 195 LYS C N   1 
ATOM 4556 C CA  . LYS C 1 153 ? 52.482  4.050   59.051  1.00 132.74 ? 195 LYS C CA  1 
ATOM 4557 C C   . LYS C 1 153 ? 53.598  4.893   58.440  1.00 132.74 ? 195 LYS C C   1 
ATOM 4558 O O   . LYS C 1 153 ? 54.501  4.361   57.790  1.00 132.74 ? 195 LYS C O   1 
ATOM 4559 C CB  . LYS C 1 153 ? 51.251  4.013   58.143  1.00 132.74 ? 195 LYS C CB  1 
ATOM 4560 C CG  . LYS C 1 153 ? 50.279  2.894   58.501  1.00 132.74 ? 195 LYS C CG  1 
ATOM 4561 C CD  . LYS C 1 153 ? 49.148  2.765   57.498  1.00 132.74 ? 195 LYS C CD  1 
ATOM 4562 C CE  . LYS C 1 153 ? 48.266  1.557   57.811  1.00 132.74 ? 195 LYS C CE  1 
ATOM 4563 N NZ  . LYS C 1 153 ? 47.099  1.465   56.885  1.00 132.74 ? 195 LYS C NZ  1 
ATOM 4564 N N   . ALA C 1 154 ? 53.565  6.197   58.693  1.00 132.74 ? 196 ALA C N   1 
ATOM 4565 C CA  . ALA C 1 154 ? 54.584  7.093   58.170  1.00 132.74 ? 196 ALA C CA  1 
ATOM 4566 C C   . ALA C 1 154 ? 55.931  6.633   58.685  1.00 132.74 ? 196 ALA C C   1 
ATOM 4567 O O   . ALA C 1 154 ? 56.855  6.383   57.913  1.00 132.74 ? 196 ALA C O   1 
ATOM 4568 C CB  . ALA C 1 154 ? 54.314  8.502   58.630  1.00 132.74 ? 196 ALA C CB  1 
ATOM 4569 N N   . THR C 1 155 ? 56.003  6.483   60.004  1.00 132.74 ? 197 THR C N   1 
ATOM 4570 C CA  . THR C 1 155 ? 57.207  6.053   60.696  1.00 132.74 ? 197 THR C CA  1 
ATOM 4571 C C   . THR C 1 155 ? 57.758  4.755   60.117  1.00 132.74 ? 197 THR C C   1 
ATOM 4572 O O   . THR C 1 155 ? 58.933  4.670   59.756  1.00 132.74 ? 197 THR C O   1 
ATOM 4573 C CB  . THR C 1 155 ? 56.924  5.883   62.201  1.00 132.74 ? 197 THR C CB  1 
ATOM 4574 O OG1 . THR C 1 155 ? 56.414  7.113   62.727  1.00 132.74 ? 197 THR C OG1 1 
ATOM 4575 C CG2 . THR C 1 155 ? 58.187  5.516   62.955  1.00 132.74 ? 197 THR C CG2 1 
ATOM 4576 N N   . GLU C 1 156 ? 56.889  3.759   60.005  1.00 132.74 ? 198 GLU C N   1 
ATOM 4577 C CA  . GLU C 1 156 ? 57.257  2.462   59.470  1.00 132.74 ? 198 GLU C CA  1 
ATOM 4578 C C   . GLU C 1 156 ? 57.926  2.618   58.117  1.00 132.74 ? 198 GLU C C   1 
ATOM 4579 O O   . GLU C 1 156 ? 58.959  2.011   57.855  1.00 132.74 ? 198 GLU C O   1 
ATOM 4580 C CB  . GLU C 1 156 ? 56.006  1.605   59.327  1.00 132.74 ? 198 GLU C CB  1 
ATOM 4581 C CG  . GLU C 1 156 ? 56.256  0.230   58.747  1.00 132.74 ? 198 GLU C CG  1 
ATOM 4582 C CD  . GLU C 1 156 ? 55.000  -0.618  58.692  1.00 132.74 ? 198 GLU C CD  1 
ATOM 4583 O OE1 . GLU C 1 156 ? 54.320  -0.751  59.736  1.00 132.74 ? 198 GLU C OE1 1 
ATOM 4584 O OE2 . GLU C 1 156 ? 54.697  -1.155  57.605  1.00 132.74 ? 198 GLU C OE2 1 
ATOM 4585 N N   . HIS C 1 157 ? 57.355  3.475   57.280  1.00 132.74 ? 199 HIS C N   1 
ATOM 4586 C CA  . HIS C 1 157 ? 57.887  3.719   55.951  1.00 132.74 ? 199 HIS C CA  1 
ATOM 4587 C C   . HIS C 1 157 ? 59.322  4.147   55.938  1.00 132.74 ? 199 HIS C C   1 
ATOM 4588 O O   . HIS C 1 157 ? 60.117  3.677   55.132  1.00 132.74 ? 199 HIS C O   1 
ATOM 4589 C CB  . HIS C 1 157 ? 57.070  4.777   55.240  1.00 132.74 ? 199 HIS C CB  1 
ATOM 4590 C CG  . HIS C 1 157 ? 56.023  4.202   54.359  1.00 132.74 ? 199 HIS C CG  1 
ATOM 4591 N ND1 . HIS C 1 157 ? 55.289  3.094   54.724  1.00 132.74 ? 199 HIS C ND1 1 
ATOM 4592 C CD2 . HIS C 1 157 ? 55.633  4.521   53.106  1.00 132.74 ? 199 HIS C CD2 1 
ATOM 4593 C CE1 . HIS C 1 157 ? 54.495  2.750   53.724  1.00 132.74 ? 199 HIS C CE1 1 
ATOM 4594 N NE2 . HIS C 1 157 ? 54.685  3.601   52.732  1.00 132.74 ? 199 HIS C NE2 1 
ATOM 4595 N N   . LEU C 1 158 ? 59.649  5.056   56.839  1.00 132.74 ? 200 LEU C N   1 
ATOM 4596 C CA  . LEU C 1 158 ? 60.997  5.580   56.917  1.00 132.74 ? 200 LEU C CA  1 
ATOM 4597 C C   . LEU C 1 158 ? 61.968  4.503   57.370  1.00 132.74 ? 200 LEU C C   1 
ATOM 4598 O O   . LEU C 1 158 ? 63.153  4.532   57.044  1.00 132.74 ? 200 LEU C O   1 
ATOM 4599 C CB  . LEU C 1 158 ? 61.027  6.765   57.873  1.00 132.74 ? 200 LEU C CB  1 
ATOM 4600 C CG  . LEU C 1 158 ? 59.791  7.668   57.810  1.00 132.74 ? 200 LEU C CG  1 
ATOM 4601 C CD1 . LEU C 1 158 ? 60.077  8.950   58.571  1.00 132.74 ? 200 LEU C CD1 1 
ATOM 4602 C CD2 . LEU C 1 158 ? 59.393  7.977   56.369  1.00 132.74 ? 200 LEU C CD2 1 
ATOM 4603 N N   . SER C 1 159 ? 61.434  3.514   58.071  1.00 132.74 ? 201 SER C N   1 
ATOM 4604 C CA  . SER C 1 159 ? 62.230  2.416   58.588  1.00 132.74 ? 201 SER C CA  1 
ATOM 4605 C C   . SER C 1 159 ? 62.379  1.261   57.594  1.00 132.74 ? 201 SER C C   1 
ATOM 4606 O O   . SER C 1 159 ? 63.316  0.468   57.698  1.00 132.74 ? 201 SER C O   1 
ATOM 4607 C CB  . SER C 1 159 ? 61.608  1.933   59.895  1.00 132.74 ? 201 SER C CB  1 
ATOM 4608 O OG  . SER C 1 159 ? 61.302  3.036   60.735  1.00 132.74 ? 201 SER C OG  1 
ATOM 4609 N N   . THR C 1 160 ? 61.464  1.175   56.630  1.00 132.74 ? 202 THR C N   1 
ATOM 4610 C CA  . THR C 1 160 ? 61.501  0.116   55.620  1.00 132.74 ? 202 THR C CA  1 
ATOM 4611 C C   . THR C 1 160 ? 62.655  0.360   54.655  1.00 132.74 ? 202 THR C C   1 
ATOM 4612 O O   . THR C 1 160 ? 63.238  -0.580  54.114  1.00 132.74 ? 202 THR C O   1 
ATOM 4613 C CB  . THR C 1 160 ? 60.199  0.065   54.772  1.00 132.74 ? 202 THR C CB  1 
ATOM 4614 O OG1 . THR C 1 160 ? 60.048  1.278   54.026  1.00 132.74 ? 202 THR C OG1 1 
ATOM 4615 C CG2 . THR C 1 160 ? 58.985  -0.133  55.660  1.00 132.74 ? 202 THR C CG2 1 
ATOM 4616 N N   . LEU C 1 161 ? 62.983  1.636   54.469  1.00 132.74 ? 203 LEU C N   1 
ATOM 4617 C CA  . LEU C 1 161 ? 64.044  2.069   53.561  1.00 132.74 ? 203 LEU C CA  1 
ATOM 4618 C C   . LEU C 1 161 ? 65.366  1.387   53.854  1.00 132.74 ? 203 LEU C C   1 
ATOM 4619 O O   . LEU C 1 161 ? 66.119  1.040   52.948  1.00 132.74 ? 203 LEU C O   1 
ATOM 4620 C CB  . LEU C 1 161 ? 64.243  3.576   53.696  1.00 132.74 ? 203 LEU C CB  1 
ATOM 4621 C CG  . LEU C 1 161 ? 62.972  4.422   53.737  1.00 132.74 ? 203 LEU C CG  1 
ATOM 4622 C CD1 . LEU C 1 161 ? 63.330  5.878   53.982  1.00 132.74 ? 203 LEU C CD1 1 
ATOM 4623 C CD2 . LEU C 1 161 ? 62.194  4.251   52.442  1.00 132.74 ? 203 LEU C CD2 1 
ATOM 4624 N N   . SER C 1 162 ? 65.651  1.229   55.140  1.00 132.74 ? 204 SER C N   1 
ATOM 4625 C CA  . SER C 1 162 ? 66.884  0.600   55.589  1.00 132.74 ? 204 SER C CA  1 
ATOM 4626 C C   . SER C 1 162 ? 67.090  -0.777  54.964  1.00 132.74 ? 204 SER C C   1 
ATOM 4627 O O   . SER C 1 162 ? 68.207  -1.116  54.584  1.00 132.74 ? 204 SER C O   1 
ATOM 4628 C CB  . SER C 1 162 ? 66.894  0.488   57.116  1.00 132.74 ? 204 SER C CB  1 
ATOM 4629 O OG  . SER C 1 162 ? 65.817  -0.312  57.575  1.00 132.74 ? 204 SER C OG  1 
ATOM 4630 N N   . GLU C 1 163 ? 66.010  -1.553  54.856  1.00 132.74 ? 205 GLU C N   1 
ATOM 4631 C CA  . GLU C 1 163 ? 66.060  -2.895  54.273  1.00 132.74 ? 205 GLU C CA  1 
ATOM 4632 C C   . GLU C 1 163 ? 66.004  -2.899  52.751  1.00 132.74 ? 205 GLU C C   1 
ATOM 4633 O O   . GLU C 1 163 ? 66.400  -3.881  52.121  1.00 132.74 ? 205 GLU C O   1 
ATOM 4634 C CB  . GLU C 1 163 ? 64.920  -3.787  54.820  1.00 132.74 ? 205 GLU C CB  1 
ATOM 4635 C CG  . GLU C 1 163 ? 63.468  -3.385  54.415  1.00 132.74 ? 205 GLU C CG  1 
ATOM 4636 C CD  . GLU C 1 163 ? 62.918  -4.070  53.143  1.00 132.74 ? 205 GLU C CD  1 
ATOM 4637 O OE1 . GLU C 1 163 ? 63.633  -4.871  52.499  1.00 132.74 ? 205 GLU C OE1 1 
ATOM 4638 O OE2 . GLU C 1 163 ? 61.745  -3.805  52.790  1.00 132.74 ? 205 GLU C OE2 1 
ATOM 4639 N N   . LYS C 1 164 ? 65.480  -1.822  52.173  1.00 132.74 ? 206 LYS C N   1 
ATOM 4640 C CA  . LYS C 1 164 ? 65.334  -1.713  50.727  1.00 132.74 ? 206 LYS C CA  1 
ATOM 4641 C C   . LYS C 1 164 ? 66.580  -1.175  50.042  1.00 132.74 ? 206 LYS C C   1 
ATOM 4642 O O   . LYS C 1 164 ? 67.076  -1.755  49.075  1.00 132.74 ? 206 LYS C O   1 
ATOM 4643 C CB  . LYS C 1 164 ? 64.103  -0.840  50.407  1.00 132.74 ? 206 LYS C CB  1 
ATOM 4644 C CG  . LYS C 1 164 ? 63.823  -0.608  48.922  1.00 132.74 ? 206 LYS C CG  1 
ATOM 4645 C CD  . LYS C 1 164 ? 64.628  0.573   48.369  1.00 132.74 ? 206 LYS C CD  1 
ATOM 4646 C CE  . LYS C 1 164 ? 65.086  0.334   46.932  1.00 132.74 ? 206 LYS C CE  1 
ATOM 4647 N NZ  . LYS C 1 164 ? 66.088  1.342   46.472  1.00 132.74 ? 206 LYS C NZ  1 
ATOM 4648 N N   . ALA C 1 165 ? 67.041  -0.026  50.512  1.00 132.74 ? 207 ALA C N   1 
ATOM 4649 C CA  . ALA C 1 165 ? 68.221  0.607   49.951  1.00 132.74 ? 207 ALA C CA  1 
ATOM 4650 C C   . ALA C 1 165 ? 69.355  -0.406  49.769  1.00 132.74 ? 207 ALA C C   1 
ATOM 4651 O O   . ALA C 1 165 ? 69.958  -0.476  48.705  1.00 132.74 ? 207 ALA C O   1 
ATOM 4652 C CB  . ALA C 1 165 ? 68.668  1.742   50.852  1.00 132.74 ? 207 ALA C CB  1 
ATOM 4653 N N   . LYS C 1 166 ? 69.535  -1.278  50.763  1.00 132.74 ? 208 LYS C N   1 
ATOM 4654 C CA  . LYS C 1 166 ? 70.603  -2.290  50.779  1.00 132.74 ? 208 LYS C CA  1 
ATOM 4655 C C   . LYS C 1 166 ? 70.720  -3.260  49.589  1.00 132.74 ? 208 LYS C C   1 
ATOM 4656 O O   . LYS C 1 166 ? 71.762  -3.291  48.924  1.00 132.74 ? 208 LYS C O   1 
ATOM 4657 C CB  . LYS C 1 166 ? 70.585  -3.060  52.121  1.00 132.74 ? 208 LYS C CB  1 
ATOM 4658 C CG  . LYS C 1 166 ? 71.964  -3.228  52.808  1.00 132.74 ? 208 LYS C CG  1 
ATOM 4659 C CD  . LYS C 1 166 ? 71.904  -2.776  54.290  1.00 132.74 ? 208 LYS C CD  1 
ATOM 4660 C CE  . LYS C 1 166 ? 73.173  -3.102  55.097  1.00 132.74 ? 208 LYS C CE  1 
ATOM 4661 N NZ  . LYS C 1 166 ? 72.878  -2.992  56.562  1.00 132.74 ? 208 LYS C NZ  1 
ATOM 4662 N N   . PRO C 1 167 ? 69.683  -4.086  49.316  1.00 200.00 ? 209 PRO C N   1 
ATOM 4663 C CA  . PRO C 1 167 ? 69.796  -5.013  48.184  1.00 200.00 ? 209 PRO C CA  1 
ATOM 4664 C C   . PRO C 1 167 ? 69.978  -4.306  46.849  1.00 200.00 ? 209 PRO C C   1 
ATOM 4665 O O   . PRO C 1 167 ? 70.799  -4.725  46.033  1.00 200.00 ? 209 PRO C O   1 
ATOM 4666 C CB  . PRO C 1 167 ? 68.479  -5.792  48.236  1.00 200.00 ? 209 PRO C CB  1 
ATOM 4667 C CG  . PRO C 1 167 ? 67.531  -4.818  48.843  1.00 200.00 ? 209 PRO C CG  1 
ATOM 4668 C CD  . PRO C 1 167 ? 68.365  -4.231  49.959  1.00 200.00 ? 209 PRO C CD  1 
ATOM 4669 N N   . ALA C 1 168 ? 69.238  -3.215  46.653  1.00 200.00 ? 210 ALA C N   1 
ATOM 4670 C CA  . ALA C 1 168 ? 69.309  -2.435  45.424  1.00 200.00 ? 210 ALA C CA  1 
ATOM 4671 C C   . ALA C 1 168 ? 70.732  -1.950  45.198  1.00 200.00 ? 210 ALA C C   1 
ATOM 4672 O O   . ALA C 1 168 ? 71.210  -1.907  44.064  1.00 200.00 ? 210 ALA C O   1 
ATOM 4673 C CB  . ALA C 1 168 ? 68.364  -1.243  45.512  1.00 200.00 ? 210 ALA C CB  1 
ATOM 4674 N N   . LEU C 1 169 ? 71.435  -1.675  46.292  1.00 200.00 ? 211 LEU C N   1 
ATOM 4675 C CA  . LEU C 1 169 ? 72.800  -1.174  46.209  1.00 200.00 ? 211 LEU C CA  1 
ATOM 4676 C C   . LEU C 1 169 ? 73.869  -2.187  45.822  1.00 200.00 ? 211 LEU C C   1 
ATOM 4677 O O   . LEU C 1 169 ? 75.055  -1.891  45.862  1.00 200.00 ? 211 LEU C O   1 
ATOM 4678 C CB  . LEU C 1 169 ? 73.189  -0.453  47.495  1.00 200.00 ? 211 LEU C CB  1 
ATOM 4679 C CG  . LEU C 1 169 ? 72.271  0.729   47.821  1.00 200.00 ? 211 LEU C CG  1 
ATOM 4680 C CD1 . LEU C 1 169 ? 72.922  1.600   48.875  1.00 200.00 ? 211 LEU C CD1 1 
ATOM 4681 C CD2 . LEU C 1 169 ? 71.944  1.539   46.568  1.00 200.00 ? 211 LEU C CD2 1 
ATOM 4682 N N   . GLU C 1 170 ? 73.463  -3.399  45.482  1.00 200.00 ? 212 GLU C N   1 
ATOM 4683 C CA  . GLU C 1 170 ? 74.439  -4.373  45.039  1.00 200.00 ? 212 GLU C CA  1 
ATOM 4684 C C   . GLU C 1 170 ? 74.524  -4.225  43.516  1.00 200.00 ? 212 GLU C C   1 
ATOM 4685 O O   . GLU C 1 170 ? 75.555  -4.534  42.920  1.00 200.00 ? 212 GLU C O   1 
ATOM 4686 C CB  . GLU C 1 170 ? 74.030  -5.796  45.438  1.00 200.00 ? 212 GLU C CB  1 
ATOM 4687 C CG  . GLU C 1 170 ? 74.009  -6.038  46.947  1.00 200.00 ? 212 GLU C CG  1 
ATOM 4688 C CD  . GLU C 1 170 ? 75.334  -5.702  47.619  1.00 200.00 ? 212 GLU C CD  1 
ATOM 4689 O OE1 . GLU C 1 170 ? 76.384  -6.226  47.184  1.00 200.00 ? 212 GLU C OE1 1 
ATOM 4690 O OE2 . GLU C 1 170 ? 75.321  -4.913  48.588  1.00 200.00 ? 212 GLU C OE2 1 
ATOM 4691 N N   . ASP C 1 171 ? 73.469  -3.634  42.930  1.00 200.00 ? 213 ASP C N   1 
ATOM 4692 C CA  . ASP C 1 171 ? 73.319  -3.405  41.475  1.00 200.00 ? 213 ASP C CA  1 
ATOM 4693 C C   . ASP C 1 171 ? 74.522  -2.750  40.795  1.00 200.00 ? 213 ASP C C   1 
ATOM 4694 O O   . ASP C 1 171 ? 75.247  -3.414  40.054  1.00 200.00 ? 213 ASP C O   1 
ATOM 4695 C CB  . ASP C 1 171 ? 72.032  -2.584  41.181  1.00 200.00 ? 213 ASP C CB  1 
ATOM 4696 C CG  . ASP C 1 171 ? 71.788  -2.335  39.673  1.00 200.00 ? 213 ASP C CG  1 
ATOM 4697 O OD1 . ASP C 1 171 ? 71.386  -3.278  38.954  1.00 200.00 ? 213 ASP C OD1 1 
ATOM 4698 O OD2 . ASP C 1 171 ? 71.960  -1.181  39.219  1.00 200.00 ? 213 ASP C OD2 1 
ATOM 4699 N N   . LEU C 1 172 ? 74.732  -1.458  41.039  1.00 200.00 ? 214 LEU C N   1 
ATOM 4700 C CA  . LEU C 1 172 ? 75.846  -0.736  40.422  1.00 200.00 ? 214 LEU C CA  1 
ATOM 4701 C C   . LEU C 1 172 ? 77.256  -1.147  40.880  1.00 200.00 ? 214 LEU C C   1 
ATOM 4702 O O   . LEU C 1 172 ? 78.131  -1.356  40.035  1.00 200.00 ? 214 LEU C O   1 
ATOM 4703 C CB  . LEU C 1 172 ? 75.657  0.774   40.590  1.00 200.00 ? 214 LEU C CB  1 
ATOM 4704 C CG  . LEU C 1 172 ? 74.708  1.456   39.610  1.00 200.00 ? 214 LEU C CG  1 
ATOM 4705 C CD1 . LEU C 1 172 ? 74.044  2.630   40.289  1.00 200.00 ? 214 LEU C CD1 1 
ATOM 4706 C CD2 . LEU C 1 172 ? 75.478  1.880   38.373  1.00 200.00 ? 214 LEU C CD2 1 
ATOM 4707 N N   . ARG C 1 173 ? 77.457  -1.312  42.193  1.00 200.00 ? 215 ARG C N   1 
ATOM 4708 C CA  . ARG C 1 173 ? 78.766  -1.671  42.766  1.00 200.00 ? 215 ARG C CA  1 
ATOM 4709 C C   . ARG C 1 173 ? 79.387  -2.899  42.131  1.00 200.00 ? 215 ARG C C   1 
ATOM 4710 O O   . ARG C 1 173 ? 80.607  -2.999  41.985  1.00 200.00 ? 215 ARG C O   1 
ATOM 4711 C CB  . ARG C 1 173 ? 78.662  -1.913  44.271  1.00 200.00 ? 215 ARG C CB  1 
ATOM 4712 C CG  . ARG C 1 173 ? 80.017  -2.082  44.937  1.00 200.00 ? 215 ARG C CG  1 
ATOM 4713 C CD  . ARG C 1 173 ? 80.049  -3.268  45.868  1.00 200.00 ? 215 ARG C CD  1 
ATOM 4714 N NE  . ARG C 1 173 ? 79.291  -3.022  47.086  1.00 200.00 ? 215 ARG C NE  1 
ATOM 4715 C CZ  . ARG C 1 173 ? 79.205  -3.884  48.091  1.00 200.00 ? 215 ARG C CZ  1 
ATOM 4716 N NH1 . ARG C 1 173 ? 79.827  -5.053  48.020  1.00 200.00 ? 215 ARG C NH1 1 
ATOM 4717 N NH2 . ARG C 1 173 ? 78.520  -3.570  49.180  1.00 200.00 ? 215 ARG C NH2 1 
ATOM 4718 N N   . GLN C 1 174 ? 78.537  -3.866  41.829  1.00 200.00 ? 216 GLN C N   1 
ATOM 4719 C CA  . GLN C 1 174 ? 78.992  -5.088  41.209  1.00 200.00 ? 216 GLN C CA  1 
ATOM 4720 C C   . GLN C 1 174 ? 78.623  -5.122  39.731  1.00 200.00 ? 216 GLN C C   1 
ATOM 4721 O O   . GLN C 1 174 ? 79.234  -5.851  38.995  1.00 200.00 ? 216 GLN C O   1 
ATOM 4722 C CB  . GLN C 1 174 ? 78.474  -6.316  41.979  1.00 200.00 ? 216 GLN C CB  1 
ATOM 4723 C CG  . GLN C 1 174 ? 79.034  -6.415  43.413  1.00 200.00 ? 216 GLN C CG  1 
ATOM 4724 C CD  . GLN C 1 174 ? 78.708  -7.740  44.091  1.00 200.00 ? 216 GLN C CD  1 
ATOM 4725 O OE1 . GLN C 1 174 ? 78.636  -8.791  43.438  1.00 200.00 ? 216 GLN C OE1 1 
ATOM 4726 N NE2 . GLN C 1 174 ? 78.540  -7.702  45.408  1.00 200.00 ? 216 GLN C NE2 1 
ATOM 4727 N N   . GLY C 1 175 ? 77.706  -4.257  39.288  1.00 200.00 ? 217 GLY C N   1 
ATOM 4728 C CA  . GLY C 1 175 ? 77.295  -4.215  37.885  1.00 200.00 ? 217 GLY C CA  1 
ATOM 4729 C C   . GLY C 1 175 ? 78.450  -3.974  36.931  1.00 200.00 ? 217 GLY C C   1 
ATOM 4730 O O   . GLY C 1 175 ? 78.323  -4.121  35.710  1.00 200.00 ? 217 GLY C O   1 
ATOM 4731 N N   . LEU C 1 176 ? 79.582  -3.599  37.513  1.00 200.00 ? 218 LEU C N   1 
ATOM 4732 C CA  . LEU C 1 176 ? 80.807  -3.341  36.777  1.00 200.00 ? 218 LEU C CA  1 
ATOM 4733 C C   . LEU C 1 176 ? 81.563  -4.672  36.673  1.00 200.00 ? 218 LEU C C   1 
ATOM 4734 O O   . LEU C 1 176 ? 82.695  -4.714  36.184  1.00 200.00 ? 218 LEU C O   1 
ATOM 4735 C CB  . LEU C 1 176 ? 81.639  -2.306  37.528  1.00 200.00 ? 218 LEU C CB  1 
ATOM 4736 C CG  . LEU C 1 176 ? 80.801  -1.235  38.235  1.00 200.00 ? 218 LEU C CG  1 
ATOM 4737 C CD1 . LEU C 1 176 ? 81.696  -0.303  39.045  1.00 200.00 ? 218 LEU C CD1 1 
ATOM 4738 C CD2 . LEU C 1 176 ? 79.952  -0.475  37.218  1.00 200.00 ? 218 LEU C CD2 1 
ATOM 4739 N N   . LEU C 1 177 ? 80.915  -5.749  37.132  1.00 200.00 ? 219 LEU C N   1 
ATOM 4740 C CA  . LEU C 1 177 ? 81.452  -7.119  37.101  1.00 200.00 ? 219 LEU C CA  1 
ATOM 4741 C C   . LEU C 1 177 ? 80.593  -7.896  36.078  1.00 200.00 ? 219 LEU C C   1 
ATOM 4742 O O   . LEU C 1 177 ? 81.115  -8.329  35.047  1.00 200.00 ? 219 LEU C O   1 
ATOM 4743 C CB  . LEU C 1 177 ? 81.419  -7.797  38.500  1.00 200.00 ? 219 LEU C CB  1 
ATOM 4744 C CG  . LEU C 1 177 ? 82.595  -8.594  39.111  1.00 200.00 ? 219 LEU C CG  1 
ATOM 4745 C CD1 . LEU C 1 177 ? 82.117  -9.281  40.390  1.00 200.00 ? 219 LEU C CD1 1 
ATOM 4746 C CD2 . LEU C 1 177 ? 83.171  -9.633  38.156  1.00 200.00 ? 219 LEU C CD2 1 
ATOM 4747 N N   . PRO C 1 178 ? 79.260  -8.028  36.297  1.00 185.44 ? 220 PRO C N   1 
ATOM 4748 C CA  . PRO C 1 178 ? 78.498  -8.769  35.291  1.00 185.44 ? 220 PRO C CA  1 
ATOM 4749 C C   . PRO C 1 178 ? 78.010  -7.989  34.070  1.00 185.44 ? 220 PRO C C   1 
ATOM 4750 O O   . PRO C 1 178 ? 76.854  -8.140  33.668  1.00 185.44 ? 220 PRO C O   1 
ATOM 4751 C CB  . PRO C 1 178 ? 77.321  -9.311  36.099  1.00 185.44 ? 220 PRO C CB  1 
ATOM 4752 C CG  . PRO C 1 178 ? 77.047  -8.214  37.019  1.00 185.44 ? 220 PRO C CG  1 
ATOM 4753 C CD  . PRO C 1 178 ? 78.439  -7.902  37.518  1.00 185.44 ? 220 PRO C CD  1 
ATOM 4754 N N   . VAL C 1 179 ? 78.861  -7.159  33.470  1.00 185.44 ? 221 VAL C N   1 
ATOM 4755 C CA  . VAL C 1 179 ? 78.425  -6.473  32.259  1.00 185.44 ? 221 VAL C CA  1 
ATOM 4756 C C   . VAL C 1 179 ? 78.527  -7.522  31.134  1.00 185.44 ? 221 VAL C C   1 
ATOM 4757 O O   . VAL C 1 179 ? 78.452  -7.193  29.949  1.00 185.44 ? 221 VAL C O   1 
ATOM 4758 C CB  . VAL C 1 179 ? 79.250  -5.203  31.930  1.00 185.44 ? 221 VAL C CB  1 
ATOM 4759 C CG1 . VAL C 1 179 ? 78.529  -4.385  30.860  1.00 185.44 ? 221 VAL C CG1 1 
ATOM 4760 C CG2 . VAL C 1 179 ? 79.455  -4.362  33.171  1.00 185.44 ? 221 VAL C CG2 1 
ATOM 4761 N N   . LEU C 1 180 ? 78.706  -8.784  31.554  1.00 185.44 ? 222 LEU C N   1 
ATOM 4762 C CA  . LEU C 1 180 ? 78.793  -9.963  30.694  1.00 185.44 ? 222 LEU C CA  1 
ATOM 4763 C C   . LEU C 1 180 ? 77.666  -9.833  29.692  1.00 185.44 ? 222 LEU C C   1 
ATOM 4764 O O   . LEU C 1 180 ? 76.613  -9.261  29.991  1.00 185.44 ? 222 LEU C O   1 
ATOM 4765 C CB  . LEU C 1 180 ? 78.587  -11.236 31.534  1.00 185.44 ? 222 LEU C CB  1 
ATOM 4766 C CG  . LEU C 1 180 ? 79.015  -12.644 31.090  1.00 185.44 ? 222 LEU C CG  1 
ATOM 4767 C CD1 . LEU C 1 180 ? 78.720  -13.620 32.221  1.00 185.44 ? 222 LEU C CD1 1 
ATOM 4768 C CD2 . LEU C 1 180 ? 78.315  -13.095 29.818  1.00 185.44 ? 222 LEU C CD2 1 
ATOM 4769 N N   . GLU C 1 181 ? 77.872  -10.376 28.505  1.00 185.44 ? 223 GLU C N   1 
ATOM 4770 C CA  . GLU C 1 181 ? 76.860  -10.243 27.478  1.00 185.44 ? 223 GLU C CA  1 
ATOM 4771 C C   . GLU C 1 181 ? 76.390  -11.541 26.828  1.00 185.44 ? 223 GLU C C   1 
ATOM 4772 O O   . GLU C 1 181 ? 76.594  -12.634 27.369  1.00 185.44 ? 223 GLU C O   1 
ATOM 4773 C CB  . GLU C 1 181 ? 77.351  -9.214  26.447  1.00 185.44 ? 223 GLU C CB  1 
ATOM 4774 C CG  . GLU C 1 181 ? 77.437  -7.797  27.048  1.00 185.44 ? 223 GLU C CG  1 
ATOM 4775 C CD  . GLU C 1 181 ? 78.200  -6.790  26.201  1.00 185.44 ? 223 GLU C CD  1 
ATOM 4776 O OE1 . GLU C 1 181 ? 78.318  -6.983  24.971  1.00 185.44 ? 223 GLU C OE1 1 
ATOM 4777 O OE2 . GLU C 1 181 ? 78.668  -5.784  26.776  1.00 185.44 ? 223 GLU C OE2 1 
ATOM 4778 N N   . SER C 1 182 ? 75.664  -11.405 25.723  1.00 185.44 ? 224 SER C N   1 
ATOM 4779 C CA  . SER C 1 182 ? 75.168  -12.574 25.009  1.00 185.44 ? 224 SER C CA  1 
ATOM 4780 C C   . SER C 1 182 ? 76.079  -12.933 23.848  1.00 185.44 ? 224 SER C C   1 
ATOM 4781 O O   . SER C 1 182 ? 76.335  -14.114 23.606  1.00 185.44 ? 224 SER C O   1 
ATOM 4782 C CB  . SER C 1 182 ? 73.730  -12.376 24.528  1.00 185.44 ? 224 SER C CB  1 
ATOM 4783 O OG  . SER C 1 182 ? 73.662  -11.401 23.509  1.00 185.44 ? 224 SER C OG  1 
ATOM 4784 N N   . PHE C 1 183 ? 76.604  -11.914 23.172  1.00 185.44 ? 225 PHE C N   1 
ATOM 4785 C CA  . PHE C 1 183 ? 77.494  -12.101 22.032  1.00 185.44 ? 225 PHE C CA  1 
ATOM 4786 C C   . PHE C 1 183 ? 77.082  -13.250 21.121  1.00 185.44 ? 225 PHE C C   1 
ATOM 4787 O O   . PHE C 1 183 ? 77.527  -14.389 21.301  1.00 185.44 ? 225 PHE C O   1 
ATOM 4788 C CB  . PHE C 1 183 ? 78.941  -12.339 22.468  1.00 185.44 ? 225 PHE C CB  1 
ATOM 4789 C CG  . PHE C 1 183 ? 79.848  -12.625 21.316  1.00 185.44 ? 225 PHE C CG  1 
ATOM 4790 C CD1 . PHE C 1 183 ? 80.170  -11.617 20.421  1.00 185.44 ? 225 PHE C CD1 1 
ATOM 4791 C CD2 . PHE C 1 183 ? 80.290  -13.921 21.055  1.00 185.44 ? 225 PHE C CD2 1 
ATOM 4792 C CE1 . PHE C 1 183 ? 80.904  -11.884 19.281  1.00 185.44 ? 225 PHE C CE1 1 
ATOM 4793 C CE2 . PHE C 1 183 ? 81.025  -14.201 19.918  1.00 185.44 ? 225 PHE C CE2 1 
ATOM 4794 C CZ  . PHE C 1 183 ? 81.331  -13.179 19.028  1.00 185.44 ? 225 PHE C CZ  1 
ATOM 4795 N N   . LYS C 1 184 ? 76.213  -12.953 20.166  1.00 185.44 ? 226 LYS C N   1 
ATOM 4796 C CA  . LYS C 1 184 ? 75.763  -13.955 19.207  1.00 185.44 ? 226 LYS C CA  1 
ATOM 4797 C C   . LYS C 1 184 ? 76.741  -13.864 18.043  1.00 185.44 ? 226 LYS C C   1 
ATOM 4798 O O   . LYS C 1 184 ? 76.809  -12.827 17.383  1.00 185.44 ? 226 LYS C O   1 
ATOM 4799 C CB  . LYS C 1 184 ? 74.345  -13.627 18.696  1.00 185.44 ? 226 LYS C CB  1 
ATOM 4800 C CG  . LYS C 1 184 ? 73.263  -13.435 19.775  1.00 185.44 ? 226 LYS C CG  1 
ATOM 4801 C CD  . LYS C 1 184 ? 71.948  -12.914 19.159  1.00 185.44 ? 226 LYS C CD  1 
ATOM 4802 C CE  . LYS C 1 184 ? 70.849  -12.695 20.207  1.00 185.44 ? 226 LYS C CE  1 
ATOM 4803 N NZ  . LYS C 1 184 ? 69.589  -12.126 19.622  1.00 185.44 ? 226 LYS C NZ  1 
ATOM 4804 N N   . VAL C 1 185 ? 77.493  -14.933 17.796  1.00 185.44 ? 227 VAL C N   1 
ATOM 4805 C CA  . VAL C 1 185 ? 78.464  -14.986 16.705  1.00 185.44 ? 227 VAL C CA  1 
ATOM 4806 C C   . VAL C 1 185 ? 78.021  -14.154 15.491  1.00 185.44 ? 227 VAL C C   1 
ATOM 4807 O O   . VAL C 1 185 ? 78.820  -13.447 14.893  1.00 185.44 ? 227 VAL C O   1 
ATOM 4808 C CB  . VAL C 1 185 ? 78.664  -16.438 16.296  1.00 185.44 ? 227 VAL C CB  1 
ATOM 4809 C CG1 . VAL C 1 185 ? 78.026  -16.715 14.980  1.00 185.44 ? 227 VAL C CG1 1 
ATOM 4810 C CG2 . VAL C 1 185 ? 80.110  -16.781 16.302  1.00 185.44 ? 227 VAL C CG2 1 
ATOM 4811 N N   . SER C 1 186 ? 76.715  -14.208 15.223  1.00 133.17 ? 228 SER C N   1 
ATOM 4812 C CA  . SER C 1 186 ? 75.995  -13.512 14.148  1.00 133.17 ? 228 SER C CA  1 
ATOM 4813 C C   . SER C 1 186 ? 75.630  -14.469 13.026  1.00 133.17 ? 228 SER C C   1 
ATOM 4814 O O   . SER C 1 186 ? 74.573  -15.087 13.054  1.00 133.17 ? 228 SER C O   1 
ATOM 4815 C CB  . SER C 1 186 ? 76.696  -12.226 13.640  1.00 133.17 ? 228 SER C CB  1 
ATOM 4816 O OG  . SER C 1 186 ? 77.828  -12.468 12.828  1.00 133.17 ? 228 SER C OG  1 
ATOM 4817 N N   . PHE C 1 187 ? 76.505  -14.597 12.047  1.00 133.17 ? 229 PHE C N   1 
ATOM 4818 C CA  . PHE C 1 187 ? 76.302  -15.493 10.919  1.00 133.17 ? 229 PHE C CA  1 
ATOM 4819 C C   . PHE C 1 187 ? 75.723  -16.847 11.336  1.00 133.17 ? 229 PHE C C   1 
ATOM 4820 O O   . PHE C 1 187 ? 74.800  -17.342 10.709  1.00 133.17 ? 229 PHE C O   1 
ATOM 4821 C CB  . PHE C 1 187 ? 77.643  -15.702 10.252  1.00 133.17 ? 229 PHE C CB  1 
ATOM 4822 C CG  . PHE C 1 187 ? 78.743  -15.930 11.229  1.00 133.17 ? 229 PHE C CG  1 
ATOM 4823 C CD1 . PHE C 1 187 ? 79.311  -14.860 11.917  1.00 133.17 ? 229 PHE C CD1 1 
ATOM 4824 C CD2 . PHE C 1 187 ? 79.157  -17.217 11.531  1.00 133.17 ? 229 PHE C CD2 1 
ATOM 4825 C CE1 . PHE C 1 187 ? 80.272  -15.068 12.895  1.00 133.17 ? 229 PHE C CE1 1 
ATOM 4826 C CE2 . PHE C 1 187 ? 80.118  -17.437 12.508  1.00 133.17 ? 229 PHE C CE2 1 
ATOM 4827 C CZ  . PHE C 1 187 ? 80.676  -16.359 13.192  1.00 133.17 ? 229 PHE C CZ  1 
ATOM 4828 N N   . LEU C 1 188 ? 76.255  -17.440 12.397  1.00 133.17 ? 230 LEU C N   1 
ATOM 4829 C CA  . LEU C 1 188 ? 75.756  -18.729 12.854  1.00 133.17 ? 230 LEU C CA  1 
ATOM 4830 C C   . LEU C 1 188 ? 74.279  -18.617 13.136  1.00 133.17 ? 230 LEU C C   1 
ATOM 4831 O O   . LEU C 1 188 ? 73.492  -19.484 12.763  1.00 133.17 ? 230 LEU C O   1 
ATOM 4832 C CB  . LEU C 1 188 ? 76.472  -19.152 14.119  1.00 133.17 ? 230 LEU C CB  1 
ATOM 4833 C CG  . LEU C 1 188 ? 75.760  -20.194 14.963  1.00 133.17 ? 230 LEU C CG  1 
ATOM 4834 C CD1 . LEU C 1 188 ? 75.950  -21.561 14.348  1.00 133.17 ? 230 LEU C CD1 1 
ATOM 4835 C CD2 . LEU C 1 188 ? 76.322  -20.156 16.359  1.00 133.17 ? 230 LEU C CD2 1 
ATOM 4836 N N   . SER C 1 189 ? 73.913  -17.534 13.803  1.00 133.17 ? 231 SER C N   1 
ATOM 4837 C CA  . SER C 1 189 ? 72.531  -17.278 14.126  1.00 133.17 ? 231 SER C CA  1 
ATOM 4838 C C   . SER C 1 189 ? 71.693  -17.392 12.856  1.00 133.17 ? 231 SER C C   1 
ATOM 4839 O O   . SER C 1 189 ? 70.515  -17.723 12.911  1.00 133.17 ? 231 SER C O   1 
ATOM 4840 C CB  . SER C 1 189 ? 72.396  -15.891 14.733  1.00 133.17 ? 231 SER C CB  1 
ATOM 4841 O OG  . SER C 1 189 ? 71.041  -15.576 14.966  1.00 133.17 ? 231 SER C OG  1 
ATOM 4842 N N   . ALA C 1 190 ? 72.316  -17.139 11.708  1.00 133.17 ? 232 ALA C N   1 
ATOM 4843 C CA  . ALA C 1 190 ? 71.624  -17.244 10.428  1.00 133.17 ? 232 ALA C CA  1 
ATOM 4844 C C   . ALA C 1 190 ? 71.231  -18.690 10.170  1.00 133.17 ? 232 ALA C C   1 
ATOM 4845 O O   . ALA C 1 190 ? 70.143  -18.964 9.681   1.00 133.17 ? 232 ALA C O   1 
ATOM 4846 C CB  . ALA C 1 190 ? 72.502  -16.732 9.302   1.00 133.17 ? 232 ALA C CB  1 
ATOM 4847 N N   . LEU C 1 191 ? 72.127  -19.613 10.496  1.00 133.17 ? 233 LEU C N   1 
ATOM 4848 C CA  . LEU C 1 191 ? 71.841  -21.024 10.315  1.00 133.17 ? 233 LEU C CA  1 
ATOM 4849 C C   . LEU C 1 191 ? 70.729  -21.417 11.246  1.00 133.17 ? 233 LEU C C   1 
ATOM 4850 O O   . LEU C 1 191 ? 69.894  -22.250 10.903  1.00 133.17 ? 233 LEU C O   1 
ATOM 4851 C CB  . LEU C 1 191 ? 73.064  -21.873 10.611  1.00 133.17 ? 233 LEU C CB  1 
ATOM 4852 C CG  . LEU C 1 191 ? 74.047  -21.892 9.453   1.00 133.17 ? 233 LEU C CG  1 
ATOM 4853 C CD1 . LEU C 1 191 ? 73.332  -22.385 8.205   1.00 133.17 ? 233 LEU C CD1 1 
ATOM 4854 C CD2 . LEU C 1 191 ? 74.628  -20.508 9.244   1.00 133.17 ? 233 LEU C CD2 1 
ATOM 4855 N N   . GLU C 1 192 ? 70.740  -20.814 12.432  1.00 133.17 ? 234 GLU C N   1 
ATOM 4856 C CA  . GLU C 1 192 ? 69.726  -21.070 13.447  1.00 133.17 ? 234 GLU C CA  1 
ATOM 4857 C C   . GLU C 1 192 ? 68.324  -20.937 12.846  1.00 133.17 ? 234 GLU C C   1 
ATOM 4858 O O   . GLU C 1 192 ? 67.476  -21.806 13.049  1.00 133.17 ? 234 GLU C O   1 
ATOM 4859 C CB  . GLU C 1 192 ? 69.897  -20.116 14.642  1.00 133.17 ? 234 GLU C CB  1 
ATOM 4860 C CG  . GLU C 1 192 ? 71.056  -20.457 15.594  1.00 133.17 ? 234 GLU C CG  1 
ATOM 4861 C CD  . GLU C 1 192 ? 70.594  -21.071 16.922  1.00 133.17 ? 234 GLU C CD  1 
ATOM 4862 O OE1 . GLU C 1 192 ? 69.673  -20.512 17.564  1.00 133.17 ? 234 GLU C OE1 1 
ATOM 4863 O OE2 . GLU C 1 192 ? 71.164  -22.107 17.332  1.00 133.17 ? 234 GLU C OE2 1 
ATOM 4864 N N   . GLU C 1 193 ? 68.104  -19.880 12.064  1.00 133.17 ? 235 GLU C N   1 
ATOM 4865 C CA  . GLU C 1 193 ? 66.808  -19.651 11.420  1.00 133.17 ? 235 GLU C CA  1 
ATOM 4866 C C   . GLU C 1 193 ? 66.735  -20.539 10.163  1.00 133.17 ? 235 GLU C C   1 
ATOM 4867 O O   . GLU C 1 193 ? 65.796  -21.317 9.977   1.00 133.17 ? 235 GLU C O   1 
ATOM 4868 C CB  . GLU C 1 193 ? 66.637  -18.145 11.085  1.00 133.17 ? 235 GLU C CB  1 
ATOM 4869 C CG  . GLU C 1 193 ? 65.177  -17.680 10.811  1.00 133.17 ? 235 GLU C CG  1 
ATOM 4870 C CD  . GLU C 1 193 ? 64.966  -16.150 10.858  1.00 133.17 ? 235 GLU C CD  1 
ATOM 4871 O OE1 . GLU C 1 193 ? 65.732  -15.443 11.553  1.00 133.17 ? 235 GLU C OE1 1 
ATOM 4872 O OE2 . GLU C 1 193 ? 64.007  -15.655 10.214  1.00 133.17 ? 235 GLU C OE2 1 
ATOM 4873 N N   . TYR C 1 194 ? 67.818  -20.511 9.396   1.00 133.17 ? 236 TYR C N   1 
ATOM 4874 C CA  . TYR C 1 194 ? 67.966  -21.256 8.155   1.00 133.17 ? 236 TYR C CA  1 
ATOM 4875 C C   . TYR C 1 194 ? 67.380  -22.671 8.136   1.00 133.17 ? 236 TYR C C   1 
ATOM 4876 O O   . TYR C 1 194 ? 66.331  -22.920 7.545   1.00 133.17 ? 236 TYR C O   1 
ATOM 4877 C CB  . TYR C 1 194 ? 69.444  -21.311 7.801   1.00 133.17 ? 236 TYR C CB  1 
ATOM 4878 C CG  . TYR C 1 194 ? 69.681  -22.024 6.524   1.00 133.17 ? 236 TYR C CG  1 
ATOM 4879 C CD1 . TYR C 1 194 ? 69.222  -21.490 5.333   1.00 133.17 ? 236 TYR C CD1 1 
ATOM 4880 C CD2 . TYR C 1 194 ? 70.292  -23.263 6.509   1.00 133.17 ? 236 TYR C CD2 1 
ATOM 4881 C CE1 . TYR C 1 194 ? 69.368  -22.164 4.159   1.00 133.17 ? 236 TYR C CE1 1 
ATOM 4882 C CE2 . TYR C 1 194 ? 70.442  -23.951 5.336   1.00 133.17 ? 236 TYR C CE2 1 
ATOM 4883 C CZ  . TYR C 1 194 ? 69.970  -23.396 4.165   1.00 133.17 ? 236 TYR C CZ  1 
ATOM 4884 O OH  . TYR C 1 194 ? 70.105  -24.065 2.983   1.00 133.17 ? 236 TYR C OH  1 
ATOM 4885 N N   . THR C 1 195 ? 68.081  -23.589 8.783   1.00 133.17 ? 237 THR C N   1 
ATOM 4886 C CA  . THR C 1 195 ? 67.671  -24.981 8.858   1.00 133.17 ? 237 THR C CA  1 
ATOM 4887 C C   . THR C 1 195 ? 66.302  -25.216 9.495   1.00 133.17 ? 237 THR C C   1 
ATOM 4888 O O   . THR C 1 195 ? 65.705  -26.279 9.324   1.00 133.17 ? 237 THR C O   1 
ATOM 4889 C CB  . THR C 1 195 ? 68.731  -25.796 9.593   1.00 133.17 ? 237 THR C CB  1 
ATOM 4890 O OG1 . THR C 1 195 ? 69.054  -25.140 10.825  1.00 133.17 ? 237 THR C OG1 1 
ATOM 4891 C CG2 . THR C 1 195 ? 69.996  -25.906 8.735   1.00 133.17 ? 237 THR C CG2 1 
ATOM 4892 N N   . LYS C 1 196 ? 65.802  -24.218 10.216  1.00 133.17 ? 238 LYS C N   1 
ATOM 4893 C CA  . LYS C 1 196 ? 64.503  -24.323 10.872  1.00 133.17 ? 238 LYS C CA  1 
ATOM 4894 C C   . LYS C 1 196 ? 63.376  -24.436 9.857   1.00 133.17 ? 238 LYS C C   1 
ATOM 4895 O O   . LYS C 1 196 ? 62.546  -25.344 9.941   1.00 133.17 ? 238 LYS C O   1 
ATOM 4896 C CB  . LYS C 1 196 ? 64.255  -23.121 11.792  1.00 133.17 ? 238 LYS C CB  1 
ATOM 4897 C CG  . LYS C 1 196 ? 62.992  -23.236 12.647  1.00 133.17 ? 238 LYS C CG  1 
ATOM 4898 C CD  . LYS C 1 196 ? 62.780  -22.023 13.556  1.00 133.17 ? 238 LYS C CD  1 
ATOM 4899 C CE  . LYS C 1 196 ? 61.601  -22.236 14.513  1.00 133.17 ? 238 LYS C CE  1 
ATOM 4900 N NZ  . LYS C 1 196 ? 61.279  -21.026 15.323  1.00 133.17 ? 238 LYS C NZ  1 
ATOM 4901 N N   . LYS C 1 197 ? 63.353  -23.511 8.901   1.00 133.17 ? 239 LYS C N   1 
ATOM 4902 C CA  . LYS C 1 197 ? 62.319  -23.507 7.871   1.00 133.17 ? 239 LYS C CA  1 
ATOM 4903 C C   . LYS C 1 197 ? 62.297  -24.804 7.071   1.00 133.17 ? 239 LYS C C   1 
ATOM 4904 O O   . LYS C 1 197 ? 61.225  -25.305 6.722   1.00 133.17 ? 239 LYS C O   1 
ATOM 4905 C CB  . LYS C 1 197 ? 62.458  -22.289 6.944   1.00 133.17 ? 239 LYS C CB  1 
ATOM 4906 C CG  . LYS C 1 197 ? 61.974  -20.968 7.567   1.00 133.17 ? 239 LYS C CG  1 
ATOM 4907 C CD  . LYS C 1 197 ? 61.933  -19.815 6.553   1.00 133.17 ? 239 LYS C CD  1 
ATOM 4908 C CE  . LYS C 1 197 ? 61.325  -18.537 7.156   1.00 133.17 ? 239 LYS C CE  1 
ATOM 4909 N NZ  . LYS C 1 197 ? 61.278  -17.405 6.179   1.00 133.17 ? 239 LYS C NZ  1 
ATOM 4910 N N   . LEU C 1 198 ? 63.475  -25.394 6.885   1.00 133.17 ? 240 LEU C N   1 
ATOM 4911 C CA  . LEU C 1 198 ? 63.624  -26.642 6.137   1.00 133.17 ? 240 LEU C CA  1 
ATOM 4912 C C   . LEU C 1 198 ? 62.607  -27.698 6.565   1.00 133.17 ? 240 LEU C C   1 
ATOM 4913 O O   . LEU C 1 198 ? 62.217  -28.567 5.777   1.00 133.17 ? 240 LEU C O   1 
ATOM 4914 C CB  . LEU C 1 198 ? 65.035  -27.210 6.327   1.00 133.17 ? 240 LEU C CB  1 
ATOM 4915 C CG  . LEU C 1 198 ? 66.227  -26.258 6.232   1.00 133.17 ? 240 LEU C CG  1 
ATOM 4916 C CD1 . LEU C 1 198 ? 67.499  -27.068 6.284   1.00 133.17 ? 240 LEU C CD1 1 
ATOM 4917 C CD2 . LEU C 1 198 ? 66.177  -25.426 4.973   1.00 133.17 ? 240 LEU C CD2 1 
ATOM 4918 N N   . ASN C 1 199 ? 62.178  -27.620 7.818   1.00 133.17 ? 241 ASN C N   1 
ATOM 4919 C CA  . ASN C 1 199 ? 61.217  -28.573 8.332   1.00 133.17 ? 241 ASN C CA  1 
ATOM 4920 C C   . ASN C 1 199 ? 59.857  -27.959 8.652   1.00 133.17 ? 241 ASN C C   1 
ATOM 4921 O O   . ASN C 1 199 ? 58.852  -28.664 8.592   1.00 133.17 ? 241 ASN C O   1 
ATOM 4922 C CB  . ASN C 1 199 ? 61.789  -29.308 9.543   1.00 133.17 ? 241 ASN C CB  1 
ATOM 4923 C CG  . ASN C 1 199 ? 63.112  -29.997 9.233   1.00 133.17 ? 241 ASN C CG  1 
ATOM 4924 O OD1 . ASN C 1 199 ? 63.188  -30.865 8.358   1.00 133.17 ? 241 ASN C OD1 1 
ATOM 4925 N ND2 . ASN C 1 199 ? 64.165  -29.597 9.935   1.00 133.17 ? 241 ASN C ND2 1 
ATOM 4926 N N   . THR C 1 200 ? 59.809  -26.658 8.960   1.00 133.17 ? 242 THR C N   1 
ATOM 4927 C CA  . THR C 1 200 ? 58.522  -26.011 9.268   1.00 133.17 ? 242 THR C CA  1 
ATOM 4928 C C   . THR C 1 200 ? 57.623  -25.872 8.034   1.00 133.17 ? 242 THR C C   1 
ATOM 4929 O O   . THR C 1 200 ? 56.477  -25.417 8.139   1.00 133.17 ? 242 THR C O   1 
ATOM 4930 C CB  . THR C 1 200 ? 58.664  -24.634 9.969   1.00 133.17 ? 242 THR C CB  1 
ATOM 4931 O OG1 . THR C 1 200 ? 59.535  -23.791 9.207   1.00 133.17 ? 242 THR C OG1 1 
ATOM 4932 C CG2 . THR C 1 200 ? 59.186  -24.795 11.391  1.00 133.17 ? 242 THR C CG2 1 
ATOM 4933 N N   . GLN C 1 201 ? 58.154  -26.255 6.872   1.00 133.17 ? 243 GLN C N   1 
ATOM 4934 C CA  . GLN C 1 201 ? 57.401  -26.226 5.616   1.00 133.17 ? 243 GLN C CA  1 
ATOM 4935 C C   . GLN C 1 201 ? 57.759  -27.465 4.790   1.00 133.17 ? 243 GLN C C   1 
ATOM 4936 O O   . GLN C 1 201 ? 57.575  -28.588 5.325   1.00 133.17 ? 243 GLN C O   1 
ATOM 4937 C CB  . GLN C 1 201 ? 57.667  -24.937 4.815   1.00 133.17 ? 243 GLN C CB  1 
ATOM 4938 C CG  . GLN C 1 201 ? 56.410  -24.072 4.527   1.00 133.17 ? 243 GLN C CG  1 
ATOM 4939 C CD  . GLN C 1 201 ? 55.714  -24.385 3.192   1.00 133.17 ? 243 GLN C CD  1 
ATOM 4940 O OE1 . GLN C 1 201 ? 56.050  -23.808 2.146   1.00 133.17 ? 243 GLN C OE1 1 
ATOM 4941 N NE2 . GLN C 1 201 ? 54.711  -25.260 3.235   1.00 133.17 ? 243 GLN C NE2 1 
ATOM 4942 N N   . MET D 1 1   ? 79.795  0.254   27.347  1.00 166.13 ? 43  MET D N   1 
ATOM 4943 C CA  . MET D 1 1   ? 78.920  1.404   26.985  1.00 166.13 ? 43  MET D CA  1 
ATOM 4944 C C   . MET D 1 1   ? 78.883  2.400   28.146  1.00 166.13 ? 43  MET D C   1 
ATOM 4945 O O   . MET D 1 1   ? 79.800  3.197   28.318  1.00 166.13 ? 43  MET D O   1 
ATOM 4946 C CB  . MET D 1 1   ? 77.506  0.902   26.653  1.00 166.13 ? 43  MET D CB  1 
ATOM 4947 C CG  . MET D 1 1   ? 77.443  -0.251  25.642  1.00 166.13 ? 43  MET D CG  1 
ATOM 4948 S SD  . MET D 1 1   ? 78.418  -0.014  24.124  1.00 166.13 ? 43  MET D SD  1 
ATOM 4949 C CE  . MET D 1 1   ? 77.536  1.335   23.313  1.00 166.13 ? 43  MET D CE  1 
ATOM 4950 N N   . LEU D 1 2   ? 77.807  2.352   28.923  1.00 166.13 ? 44  LEU D N   1 
ATOM 4951 C CA  . LEU D 1 2   ? 77.629  3.212   30.082  1.00 166.13 ? 44  LEU D CA  1 
ATOM 4952 C C   . LEU D 1 2   ? 77.054  2.305   31.145  1.00 166.13 ? 44  LEU D C   1 
ATOM 4953 O O   . LEU D 1 2   ? 75.919  2.489   31.547  1.00 166.13 ? 44  LEU D O   1 
ATOM 4954 C CB  . LEU D 1 2   ? 76.612  4.327   29.787  1.00 166.13 ? 44  LEU D CB  1 
ATOM 4955 C CG  . LEU D 1 2   ? 77.058  5.769   29.515  1.00 166.13 ? 44  LEU D CG  1 
ATOM 4956 C CD1 . LEU D 1 2   ? 75.830  6.645   29.301  1.00 166.13 ? 44  LEU D CD1 1 
ATOM 4957 C CD2 . LEU D 1 2   ? 77.887  6.305   30.676  1.00 166.13 ? 44  LEU D CD2 1 
ATOM 4958 N N   . LYS D 1 3   ? 77.815  1.306   31.585  1.00 166.13 ? 45  LYS D N   1 
ATOM 4959 C CA  . LYS D 1 3   ? 77.308  0.395   32.612  1.00 166.13 ? 45  LYS D CA  1 
ATOM 4960 C C   . LYS D 1 3   ? 77.000  1.179   33.872  1.00 166.13 ? 45  LYS D C   1 
ATOM 4961 O O   . LYS D 1 3   ? 76.322  0.685   34.765  1.00 166.13 ? 45  LYS D O   1 
ATOM 4962 C CB  . LYS D 1 3   ? 78.314  -0.689  32.963  1.00 166.13 ? 45  LYS D CB  1 
ATOM 4963 C CG  . LYS D 1 3   ? 79.008  -1.260  31.785  1.00 166.13 ? 45  LYS D CG  1 
ATOM 4964 C CD  . LYS D 1 3   ? 80.477  -1.214  32.044  1.00 166.13 ? 45  LYS D CD  1 
ATOM 4965 C CE  . LYS D 1 3   ? 81.250  -1.295  30.758  1.00 166.13 ? 45  LYS D CE  1 
ATOM 4966 N NZ  . LYS D 1 3   ? 82.673  -0.986  31.048  1.00 166.13 ? 45  LYS D NZ  1 
ATOM 4967 N N   . LEU D 1 4   ? 77.544  2.389   33.952  1.00 166.13 ? 46  LEU D N   1 
ATOM 4968 C CA  . LEU D 1 4   ? 77.318  3.264   35.088  1.00 166.13 ? 46  LEU D CA  1 
ATOM 4969 C C   . LEU D 1 4   ? 75.981  3.957   34.908  1.00 166.13 ? 46  LEU D C   1 
ATOM 4970 O O   . LEU D 1 4   ? 75.454  4.527   35.841  1.00 166.13 ? 46  LEU D O   1 
ATOM 4971 C CB  . LEU D 1 4   ? 78.407  4.316   35.156  1.00 166.13 ? 46  LEU D CB  1 
ATOM 4972 C CG  . LEU D 1 4   ? 79.840  3.812   35.120  1.00 166.13 ? 46  LEU D CG  1 
ATOM 4973 C CD1 . LEU D 1 4   ? 80.761  4.991   35.327  1.00 166.13 ? 46  LEU D CD1 1 
ATOM 4974 C CD2 . LEU D 1 4   ? 80.032  2.772   36.200  1.00 166.13 ? 46  LEU D CD2 1 
ATOM 4975 N N   . LEU D 1 5   ? 75.467  3.939   33.684  1.00 166.13 ? 47  LEU D N   1 
ATOM 4976 C CA  . LEU D 1 5   ? 74.178  4.541   33.357  1.00 166.13 ? 47  LEU D CA  1 
ATOM 4977 C C   . LEU D 1 5   ? 73.134  4.207   34.412  1.00 166.13 ? 47  LEU D C   1 
ATOM 4978 O O   . LEU D 1 5   ? 72.273  5.033   34.713  1.00 166.13 ? 47  LEU D O   1 
ATOM 4979 C CB  . LEU D 1 5   ? 73.692  4.039   31.995  1.00 166.13 ? 47  LEU D CB  1 
ATOM 4980 C CG  . LEU D 1 5   ? 72.368  4.515   31.404  1.00 166.13 ? 47  LEU D CG  1 
ATOM 4981 C CD1 . LEU D 1 5   ? 72.498  5.967   30.982  1.00 166.13 ? 47  LEU D CD1 1 
ATOM 4982 C CD2 . LEU D 1 5   ? 71.991  3.633   30.218  1.00 166.13 ? 47  LEU D CD2 1 
ATOM 4983 N N   . ASP D 1 6   ? 73.259  3.021   35.013  1.00 166.13 ? 48  ASP D N   1 
ATOM 4984 C CA  . ASP D 1 6   ? 72.315  2.580   36.043  1.00 166.13 ? 48  ASP D CA  1 
ATOM 4985 C C   . ASP D 1 6   ? 72.400  3.391   37.332  1.00 166.13 ? 48  ASP D C   1 
ATOM 4986 O O   . ASP D 1 6   ? 71.839  2.995   38.359  1.00 166.13 ? 48  ASP D O   1 
ATOM 4987 C CB  . ASP D 1 6   ? 72.418  1.074   36.355  1.00 166.13 ? 48  ASP D CB  1 
ATOM 4988 C CG  . ASP D 1 6   ? 73.598  0.400   35.690  1.00 166.13 ? 48  ASP D CG  1 
ATOM 4989 O OD1 . ASP D 1 6   ? 73.694  0.444   34.443  1.00 166.13 ? 48  ASP D OD1 1 
ATOM 4990 O OD2 . ASP D 1 6   ? 74.417  -0.204  36.412  1.00 166.13 ? 48  ASP D OD2 1 
ATOM 4991 N N   . ASN D 1 7   ? 73.118  4.514   37.280  1.00 166.13 ? 49  ASN D N   1 
ATOM 4992 C CA  . ASN D 1 7   ? 73.249  5.408   38.424  1.00 166.13 ? 49  ASN D CA  1 
ATOM 4993 C C   . ASN D 1 7   ? 71.883  6.078   38.616  1.00 166.13 ? 49  ASN D C   1 
ATOM 4994 O O   . ASN D 1 7   ? 71.384  6.185   39.733  1.00 166.13 ? 49  ASN D O   1 
ATOM 4995 C CB  . ASN D 1 7   ? 74.341  6.471   38.173  1.00 166.13 ? 49  ASN D CB  1 
ATOM 4996 C CG  . ASN D 1 7   ? 75.748  5.873   38.025  1.00 166.13 ? 49  ASN D CG  1 
ATOM 4997 O OD1 . ASN D 1 7   ? 76.039  4.787   38.529  1.00 166.13 ? 49  ASN D OD1 1 
ATOM 4998 N ND2 . ASN D 1 7   ? 76.612  6.570   37.288  1.00 166.13 ? 49  ASN D ND2 1 
ATOM 4999 N N   . TRP D 1 8   ? 71.273  6.492   37.505  1.00 199.51 ? 50  TRP D N   1 
ATOM 5000 C CA  . TRP D 1 8   ? 69.956  7.126   37.525  1.00 199.51 ? 50  TRP D CA  1 
ATOM 5001 C C   . TRP D 1 8   ? 68.891  6.133   37.980  1.00 199.51 ? 50  TRP D C   1 
ATOM 5002 O O   . TRP D 1 8   ? 67.835  6.533   38.471  1.00 199.51 ? 50  TRP D O   1 
ATOM 5003 C CB  . TRP D 1 8   ? 69.604  7.666   36.138  1.00 199.51 ? 50  TRP D CB  1 
ATOM 5004 C CG  . TRP D 1 8   ? 70.386  8.879   35.736  1.00 199.51 ? 50  TRP D CG  1 
ATOM 5005 C CD1 . TRP D 1 8   ? 71.556  8.911   35.032  1.00 199.51 ? 50  TRP D CD1 1 
ATOM 5006 C CD2 . TRP D 1 8   ? 70.029  10.250  35.985  1.00 199.51 ? 50  TRP D CD2 1 
ATOM 5007 N NE1 . TRP D 1 8   ? 71.948  10.212  34.821  1.00 199.51 ? 50  TRP D NE1 1 
ATOM 5008 C CE2 . TRP D 1 8   ? 71.028  11.055  35.395  1.00 199.51 ? 50  TRP D CE2 1 
ATOM 5009 C CE3 . TRP D 1 8   ? 68.958  10.876  36.648  1.00 199.51 ? 50  TRP D CE3 1 
ATOM 5010 C CZ2 . TRP D 1 8   ? 70.992  12.460  35.445  1.00 199.51 ? 50  TRP D CZ2 1 
ATOM 5011 C CZ3 . TRP D 1 8   ? 68.922  12.275  36.698  1.00 199.51 ? 50  TRP D CZ3 1 
ATOM 5012 C CH2 . TRP D 1 8   ? 69.934  13.049  36.098  1.00 199.51 ? 50  TRP D CH2 1 
ATOM 5013 N N   . ASP D 1 9   ? 69.174  4.842   37.782  1.00 199.51 ? 51  ASP D N   1 
ATOM 5014 C CA  . ASP D 1 9   ? 68.287  3.746   38.188  1.00 199.51 ? 51  ASP D CA  1 
ATOM 5015 C C   . ASP D 1 9   ? 68.147  3.776   39.709  1.00 199.51 ? 51  ASP D C   1 
ATOM 5016 O O   . ASP D 1 9   ? 67.059  3.574   40.252  1.00 199.51 ? 51  ASP D O   1 
ATOM 5017 C CB  . ASP D 1 9   ? 68.894  2.375   37.812  1.00 199.51 ? 51  ASP D CB  1 
ATOM 5018 C CG  . ASP D 1 9   ? 68.578  1.933   36.383  1.00 199.51 ? 51  ASP D CG  1 
ATOM 5019 O OD1 . ASP D 1 9   ? 68.425  2.791   35.487  1.00 199.51 ? 51  ASP D OD1 1 
ATOM 5020 O OD2 . ASP D 1 9   ? 68.508  0.703   36.154  1.00 199.51 ? 51  ASP D OD2 1 
ATOM 5021 N N   . SER D 1 10  ? 69.277  4.000   40.381  1.00 199.51 ? 52  SER D N   1 
ATOM 5022 C CA  . SER D 1 10  ? 69.341  4.041   41.840  1.00 199.51 ? 52  SER D CA  1 
ATOM 5023 C C   . SER D 1 10  ? 68.835  5.349   42.446  1.00 199.51 ? 52  SER D C   1 
ATOM 5024 O O   . SER D 1 10  ? 68.340  5.367   43.573  1.00 199.51 ? 52  SER D O   1 
ATOM 5025 C CB  . SER D 1 10  ? 70.768  3.744   42.318  1.00 199.51 ? 52  SER D CB  1 
ATOM 5026 O OG  . SER D 1 10  ? 71.715  4.577   41.672  1.00 199.51 ? 52  SER D OG  1 
ATOM 5027 N N   . VAL D 1 11  ? 68.961  6.441   41.699  1.00 199.51 ? 53  VAL D N   1 
ATOM 5028 C CA  . VAL D 1 11  ? 68.504  7.743   42.162  1.00 199.51 ? 53  VAL D CA  1 
ATOM 5029 C C   . VAL D 1 11  ? 66.972  7.751   42.200  1.00 199.51 ? 53  VAL D C   1 
ATOM 5030 O O   . VAL D 1 11  ? 66.365  8.125   43.204  1.00 199.51 ? 53  VAL D O   1 
ATOM 5031 C CB  . VAL D 1 11  ? 69.009  8.854   41.216  1.00 199.51 ? 53  VAL D CB  1 
ATOM 5032 C CG1 . VAL D 1 11  ? 68.570  10.204  41.709  1.00 199.51 ? 53  VAL D CG1 1 
ATOM 5033 C CG2 . VAL D 1 11  ? 70.520  8.809   41.118  1.00 199.51 ? 53  VAL D CG2 1 
ATOM 5034 N N   . THR D 1 12  ? 66.370  7.252   41.125  1.00 189.78 ? 54  THR D N   1 
ATOM 5035 C CA  . THR D 1 12  ? 64.916  7.194   40.974  1.00 189.78 ? 54  THR D CA  1 
ATOM 5036 C C   . THR D 1 12  ? 64.170  6.218   41.898  1.00 189.78 ? 54  THR D C   1 
ATOM 5037 O O   . THR D 1 12  ? 63.219  6.620   42.576  1.00 189.78 ? 54  THR D O   1 
ATOM 5038 C CB  . THR D 1 12  ? 64.529  6.898   39.506  1.00 189.78 ? 54  THR D CB  1 
ATOM 5039 O OG1 . THR D 1 12  ? 65.199  5.712   39.062  1.00 189.78 ? 54  THR D OG1 1 
ATOM 5040 C CG2 . THR D 1 12  ? 64.914  8.069   38.604  1.00 189.78 ? 54  THR D CG2 1 
ATOM 5041 N N   . SER D 1 13  ? 64.580  4.947   41.919  1.00 189.78 ? 55  SER D N   1 
ATOM 5042 C CA  . SER D 1 13  ? 63.918  3.951   42.773  1.00 189.78 ? 55  SER D CA  1 
ATOM 5043 C C   . SER D 1 13  ? 64.163  4.144   44.272  1.00 189.78 ? 55  SER D C   1 
ATOM 5044 O O   . SER D 1 13  ? 63.707  3.337   45.084  1.00 189.78 ? 55  SER D O   1 
ATOM 5045 C CB  . SER D 1 13  ? 64.271  2.512   42.350  1.00 189.78 ? 55  SER D CB  1 
ATOM 5046 O OG  . SER D 1 13  ? 63.463  2.064   41.269  1.00 189.78 ? 55  SER D OG  1 
ATOM 5047 N N   . THR D 1 14  ? 64.831  5.237   44.639  1.00 189.78 ? 56  THR D N   1 
ATOM 5048 C CA  . THR D 1 14  ? 65.117  5.533   46.039  1.00 189.78 ? 56  THR D CA  1 
ATOM 5049 C C   . THR D 1 14  ? 64.386  6.785   46.523  1.00 189.78 ? 56  THR D C   1 
ATOM 5050 O O   . THR D 1 14  ? 63.499  6.707   47.372  1.00 189.78 ? 56  THR D O   1 
ATOM 5051 C CB  . THR D 1 14  ? 66.624  5.720   46.265  1.00 189.78 ? 56  THR D CB  1 
ATOM 5052 O OG1 . THR D 1 14  ? 67.304  4.499   45.962  1.00 189.78 ? 56  THR D OG1 1 
ATOM 5053 C CG2 . THR D 1 14  ? 66.900  6.105   47.709  1.00 189.78 ? 56  THR D CG2 1 
ATOM 5054 N N   . PHE D 1 15  ? 64.751  7.933   45.960  1.00 189.78 ? 57  PHE D N   1 
ATOM 5055 C CA  . PHE D 1 15  ? 64.152  9.202   46.353  1.00 189.78 ? 57  PHE D CA  1 
ATOM 5056 C C   . PHE D 1 15  ? 62.697  9.335   45.974  1.00 189.78 ? 57  PHE D C   1 
ATOM 5057 O O   . PHE D 1 15  ? 61.819  9.257   46.830  1.00 189.78 ? 57  PHE D O   1 
ATOM 5058 C CB  . PHE D 1 15  ? 64.934  10.361  45.760  1.00 189.78 ? 57  PHE D CB  1 
ATOM 5059 C CG  . PHE D 1 15  ? 66.368  10.370  46.161  1.00 189.78 ? 57  PHE D CG  1 
ATOM 5060 C CD1 . PHE D 1 15  ? 66.754  10.915  47.381  1.00 189.78 ? 57  PHE D CD1 1 
ATOM 5061 C CD2 . PHE D 1 15  ? 67.330  9.792   45.345  1.00 189.78 ? 57  PHE D CD2 1 
ATOM 5062 C CE1 . PHE D 1 15  ? 68.085  10.877  47.784  1.00 189.78 ? 57  PHE D CE1 1 
ATOM 5063 C CE2 . PHE D 1 15  ? 68.661  9.750   45.735  1.00 189.78 ? 57  PHE D CE2 1 
ATOM 5064 C CZ  . PHE D 1 15  ? 69.040  10.294  46.959  1.00 189.78 ? 57  PHE D CZ  1 
ATOM 5065 N N   . SER D 1 16  ? 62.450  9.536   44.684  1.00 189.78 ? 58  SER D N   1 
ATOM 5066 C CA  . SER D 1 16  ? 61.092  9.694   44.187  1.00 189.78 ? 58  SER D CA  1 
ATOM 5067 C C   . SER D 1 16  ? 60.207  8.498   44.505  1.00 189.78 ? 58  SER D C   1 
ATOM 5068 O O   . SER D 1 16  ? 58.983  8.607   44.458  1.00 189.78 ? 58  SER D O   1 
ATOM 5069 C CB  . SER D 1 16  ? 61.094  9.942   42.677  1.00 189.78 ? 58  SER D CB  1 
ATOM 5070 O OG  . SER D 1 16  ? 59.773  10.034  42.164  1.00 189.78 ? 58  SER D OG  1 
ATOM 5071 N N   . LYS D 1 17  ? 60.819  7.366   44.849  1.00 189.78 ? 59  LYS D N   1 
ATOM 5072 C CA  . LYS D 1 17  ? 60.043  6.166   45.147  1.00 189.78 ? 59  LYS D CA  1 
ATOM 5073 C C   . LYS D 1 17  ? 59.269  6.221   46.458  1.00 189.78 ? 59  LYS D C   1 
ATOM 5074 O O   . LYS D 1 17  ? 58.053  6.031   46.450  1.00 189.78 ? 59  LYS D O   1 
ATOM 5075 C CB  . LYS D 1 17  ? 60.909  4.906   45.111  1.00 189.78 ? 59  LYS D CB  1 
ATOM 5076 C CG  . LYS D 1 17  ? 60.098  3.619   44.886  1.00 189.78 ? 59  LYS D CG  1 
ATOM 5077 C CD  . LYS D 1 17  ? 60.925  2.360   45.113  1.00 189.78 ? 59  LYS D CD  1 
ATOM 5078 C CE  . LYS D 1 17  ? 60.136  1.091   44.803  1.00 189.78 ? 59  LYS D CE  1 
ATOM 5079 N NZ  . LYS D 1 17  ? 60.888  -0.123  45.242  1.00 189.78 ? 59  LYS D NZ  1 
ATOM 5080 N N   . LEU D 1 18  ? 59.952  6.476   47.577  1.00 189.78 ? 60  LEU D N   1 
ATOM 5081 C CA  . LEU D 1 18  ? 59.270  6.526   48.876  1.00 189.78 ? 60  LEU D CA  1 
ATOM 5082 C C   . LEU D 1 18  ? 58.052  7.431   48.852  1.00 189.78 ? 60  LEU D C   1 
ATOM 5083 O O   . LEU D 1 18  ? 57.087  7.206   49.581  1.00 189.78 ? 60  LEU D O   1 
ATOM 5084 C CB  . LEU D 1 18  ? 60.209  6.969   50.002  1.00 189.78 ? 60  LEU D CB  1 
ATOM 5085 C CG  . LEU D 1 18  ? 59.527  7.122   51.373  1.00 189.78 ? 60  LEU D CG  1 
ATOM 5086 C CD1 . LEU D 1 18  ? 58.954  5.795   51.867  1.00 189.78 ? 60  LEU D CD1 1 
ATOM 5087 C CD2 . LEU D 1 18  ? 60.505  7.688   52.381  1.00 189.78 ? 60  LEU D CD2 1 
ATOM 5088 N N   . ARG D 1 19  ? 58.127  8.468   48.026  1.00 189.78 ? 61  ARG D N   1 
ATOM 5089 C CA  . ARG D 1 19  ? 57.053  9.435   47.850  1.00 189.78 ? 61  ARG D CA  1 
ATOM 5090 C C   . ARG D 1 19  ? 55.735  8.736   47.497  1.00 189.78 ? 61  ARG D C   1 
ATOM 5091 O O   . ARG D 1 19  ? 54.692  8.988   48.109  1.00 189.78 ? 61  ARG D O   1 
ATOM 5092 C CB  . ARG D 1 19  ? 57.482  10.421  46.747  1.00 189.78 ? 61  ARG D CB  1 
ATOM 5093 C CG  . ARG D 1 19  ? 56.365  11.022  45.912  1.00 189.78 ? 61  ARG D CG  1 
ATOM 5094 C CD  . ARG D 1 19  ? 56.695  10.926  44.428  1.00 189.78 ? 61  ARG D CD  1 
ATOM 5095 N NE  . ARG D 1 19  ? 55.546  11.259  43.588  1.00 189.78 ? 61  ARG D NE  1 
ATOM 5096 C CZ  . ARG D 1 19  ? 55.563  11.272  42.258  1.00 189.78 ? 61  ARG D CZ  1 
ATOM 5097 N NH1 . ARG D 1 19  ? 56.674  10.968  41.598  1.00 189.78 ? 61  ARG D NH1 1 
ATOM 5098 N NH2 . ARG D 1 19  ? 54.467  11.595  41.582  1.00 189.78 ? 61  ARG D NH2 1 
ATOM 5099 N N   . GLU D 1 20  ? 55.814  7.826   46.534  1.00 189.78 ? 62  GLU D N   1 
ATOM 5100 C CA  . GLU D 1 20  ? 54.668  7.065   46.059  1.00 189.78 ? 62  GLU D CA  1 
ATOM 5101 C C   . GLU D 1 20  ? 54.121  6.149   47.167  1.00 189.78 ? 62  GLU D C   1 
ATOM 5102 O O   . GLU D 1 20  ? 52.923  5.855   47.217  1.00 189.78 ? 62  GLU D O   1 
ATOM 5103 C CB  . GLU D 1 20  ? 55.077  6.306   44.785  1.00 189.78 ? 62  GLU D CB  1 
ATOM 5104 C CG  . GLU D 1 20  ? 55.514  7.262   43.644  1.00 189.78 ? 62  GLU D CG  1 
ATOM 5105 C CD  . GLU D 1 20  ? 56.275  6.583   42.506  1.00 189.78 ? 62  GLU D CD  1 
ATOM 5106 O OE1 . GLU D 1 20  ? 55.877  5.473   42.085  1.00 189.78 ? 62  GLU D OE1 1 
ATOM 5107 O OE2 . GLU D 1 20  ? 57.269  7.175   42.024  1.00 189.78 ? 62  GLU D OE2 1 
ATOM 5108 N N   . GLN D 1 21  ? 54.999  5.780   48.098  1.00 189.78 ? 63  GLN D N   1 
ATOM 5109 C CA  . GLN D 1 21  ? 54.639  4.944   49.240  1.00 189.78 ? 63  GLN D CA  1 
ATOM 5110 C C   . GLN D 1 21  ? 53.758  5.784   50.179  1.00 189.78 ? 63  GLN D C   1 
ATOM 5111 O O   . GLN D 1 21  ? 53.013  5.250   50.998  1.00 189.78 ? 63  GLN D O   1 
ATOM 5112 C CB  . GLN D 1 21  ? 55.912  4.485   49.973  1.00 189.78 ? 63  GLN D CB  1 
ATOM 5113 C CG  . GLN D 1 21  ? 56.875  3.590   49.172  1.00 189.78 ? 63  GLN D CG  1 
ATOM 5114 C CD  . GLN D 1 21  ? 56.603  2.095   49.336  1.00 189.78 ? 63  GLN D CD  1 
ATOM 5115 O OE1 . GLN D 1 21  ? 57.180  1.435   50.206  1.00 189.78 ? 63  GLN D OE1 1 
ATOM 5116 N NE2 . GLN D 1 21  ? 55.750  1.551   48.475  1.00 189.78 ? 63  GLN D NE2 1 
ATOM 5117 N N   . LEU D 1 22  ? 53.873  7.105   50.056  1.00 189.78 ? 64  LEU D N   1 
ATOM 5118 C CA  . LEU D 1 22  ? 53.085  8.036   50.856  1.00 189.78 ? 64  LEU D CA  1 
ATOM 5119 C C   . LEU D 1 22  ? 51.784  8.451   50.181  1.00 189.78 ? 64  LEU D C   1 
ATOM 5120 O O   . LEU D 1 22  ? 51.066  9.290   50.697  1.00 189.78 ? 64  LEU D O   1 
ATOM 5121 C CB  . LEU D 1 22  ? 53.908  9.265   51.232  1.00 189.78 ? 64  LEU D CB  1 
ATOM 5122 C CG  . LEU D 1 22  ? 54.637  9.153   52.571  1.00 189.78 ? 64  LEU D CG  1 
ATOM 5123 C CD1 . LEU D 1 22  ? 55.645  8.011   52.565  1.00 189.78 ? 64  LEU D CD1 1 
ATOM 5124 C CD2 . LEU D 1 22  ? 55.320  10.468  52.853  1.00 189.78 ? 64  LEU D CD2 1 
ATOM 5125 N N   . GLY D 1 23  ? 51.505  7.903   49.005  1.00 189.78 ? 65  GLY D N   1 
ATOM 5126 C CA  . GLY D 1 23  ? 50.246  8.194   48.339  1.00 189.78 ? 65  GLY D CA  1 
ATOM 5127 C C   . GLY D 1 23  ? 49.148  7.847   49.333  1.00 189.78 ? 65  GLY D C   1 
ATOM 5128 O O   . GLY D 1 23  ? 48.077  8.454   49.307  1.00 189.78 ? 65  GLY D O   1 
ATOM 5129 N N   . PRO D 1 24  ? 49.357  6.800   50.164  1.00 152.44 ? 66  PRO D N   1 
ATOM 5130 C CA  . PRO D 1 24  ? 48.412  6.364   51.187  1.00 152.44 ? 66  PRO D CA  1 
ATOM 5131 C C   . PRO D 1 24  ? 48.059  7.490   52.132  1.00 152.44 ? 66  PRO D C   1 
ATOM 5132 O O   . PRO D 1 24  ? 47.196  7.338   52.987  1.00 152.44 ? 66  PRO D O   1 
ATOM 5133 C CB  . PRO D 1 24  ? 49.191  5.275   51.899  1.00 152.44 ? 66  PRO D CB  1 
ATOM 5134 C CG  . PRO D 1 24  ? 49.777  4.565   50.759  1.00 152.44 ? 66  PRO D CG  1 
ATOM 5135 C CD  . PRO D 1 24  ? 50.286  5.688   49.869  1.00 152.44 ? 66  PRO D CD  1 
ATOM 5136 N N   . VAL D 1 25  ? 48.783  8.598   52.016  1.00 152.44 ? 67  VAL D N   1 
ATOM 5137 C CA  . VAL D 1 25  ? 48.501  9.777   52.813  1.00 152.44 ? 67  VAL D CA  1 
ATOM 5138 C C   . VAL D 1 25  ? 47.062  10.071  52.404  1.00 152.44 ? 67  VAL D C   1 
ATOM 5139 O O   . VAL D 1 25  ? 46.156  10.123  53.237  1.00 152.44 ? 67  VAL D O   1 
ATOM 5140 C CB  . VAL D 1 25  ? 49.430  10.966  52.403  1.00 152.44 ? 67  VAL D CB  1 
ATOM 5141 C CG1 . VAL D 1 25  ? 48.878  12.279  52.890  1.00 152.44 ? 67  VAL D CG1 1 
ATOM 5142 C CG2 . VAL D 1 25  ? 50.815  10.781  52.966  1.00 152.44 ? 67  VAL D CG2 1 
ATOM 5143 N N   . THR D 1 26  ? 46.864  10.126  51.089  1.00 152.44 ? 68  THR D N   1 
ATOM 5144 C CA  . THR D 1 26  ? 45.565  10.379  50.484  1.00 152.44 ? 68  THR D CA  1 
ATOM 5145 C C   . THR D 1 26  ? 44.626  9.170   50.659  1.00 152.44 ? 68  THR D C   1 
ATOM 5146 O O   . THR D 1 26  ? 43.403  9.318   50.596  1.00 152.44 ? 68  THR D O   1 
ATOM 5147 C CB  . THR D 1 26  ? 45.733  10.729  48.976  1.00 152.44 ? 68  THR D CB  1 
ATOM 5148 O OG1 . THR D 1 26  ? 46.881  11.576  48.802  1.00 152.44 ? 68  THR D OG1 1 
ATOM 5149 C CG2 . THR D 1 26  ? 44.505  11.463  48.460  1.00 152.44 ? 68  THR D CG2 1 
ATOM 5150 N N   . GLN D 1 27  ? 45.204  7.994   50.923  1.00 152.44 ? 69  GLN D N   1 
ATOM 5151 C CA  . GLN D 1 27  ? 44.451  6.742   51.115  1.00 152.44 ? 69  GLN D CA  1 
ATOM 5152 C C   . GLN D 1 27  ? 43.857  6.569   52.513  1.00 152.44 ? 69  GLN D C   1 
ATOM 5153 O O   . GLN D 1 27  ? 42.697  6.197   52.666  1.00 152.44 ? 69  GLN D O   1 
ATOM 5154 C CB  . GLN D 1 27  ? 45.344  5.511   50.852  1.00 152.44 ? 69  GLN D CB  1 
ATOM 5155 C CG  . GLN D 1 27  ? 44.857  4.218   51.577  1.00 152.44 ? 69  GLN D CG  1 
ATOM 5156 C CD  . GLN D 1 27  ? 45.876  3.069   51.626  1.00 152.44 ? 69  GLN D CD  1 
ATOM 5157 O OE1 . GLN D 1 27  ? 46.836  3.098   52.405  1.00 152.44 ? 69  GLN D OE1 1 
ATOM 5158 N NE2 . GLN D 1 27  ? 45.621  2.021   50.838  1.00 152.44 ? 69  GLN D NE2 1 
ATOM 5159 N N   . GLU D 1 28  ? 44.712  6.694   53.520  1.00 152.44 ? 70  GLU D N   1 
ATOM 5160 C CA  . GLU D 1 28  ? 44.312  6.521   54.904  1.00 152.44 ? 70  GLU D CA  1 
ATOM 5161 C C   . GLU D 1 28  ? 43.783  7.791   55.527  1.00 152.44 ? 70  GLU D C   1 
ATOM 5162 O O   . GLU D 1 28  ? 42.745  7.772   56.173  1.00 152.44 ? 70  GLU D O   1 
ATOM 5163 C CB  . GLU D 1 28  ? 45.487  6.026   55.747  1.00 152.44 ? 70  GLU D CB  1 
ATOM 5164 C CG  . GLU D 1 28  ? 45.127  5.780   57.213  1.00 152.44 ? 70  GLU D CG  1 
ATOM 5165 C CD  . GLU D 1 28  ? 46.172  6.305   58.178  1.00 152.44 ? 70  GLU D CD  1 
ATOM 5166 O OE1 . GLU D 1 28  ? 47.379  6.120   57.910  1.00 152.44 ? 70  GLU D OE1 1 
ATOM 5167 O OE2 . GLU D 1 28  ? 45.782  6.900   59.204  1.00 152.44 ? 70  GLU D OE2 1 
ATOM 5168 N N   . PHE D 1 29  ? 44.529  8.882   55.378  1.00 152.44 ? 71  PHE D N   1 
ATOM 5169 C CA  . PHE D 1 29  ? 44.126  10.154  55.962  1.00 152.44 ? 71  PHE D CA  1 
ATOM 5170 C C   . PHE D 1 29  ? 42.923  10.824  55.293  1.00 152.44 ? 71  PHE D C   1 
ATOM 5171 O O   . PHE D 1 29  ? 41.807  10.695  55.789  1.00 152.44 ? 71  PHE D O   1 
ATOM 5172 C CB  . PHE D 1 29  ? 45.320  11.120  56.059  1.00 152.44 ? 71  PHE D CB  1 
ATOM 5173 C CG  . PHE D 1 29  ? 45.783  11.388  57.478  1.00 152.44 ? 71  PHE D CG  1 
ATOM 5174 C CD1 . PHE D 1 29  ? 45.295  10.635  58.544  1.00 152.44 ? 71  PHE D CD1 1 
ATOM 5175 C CD2 . PHE D 1 29  ? 46.700  12.408  57.746  1.00 152.44 ? 71  PHE D CD2 1 
ATOM 5176 C CE1 . PHE D 1 29  ? 45.705  10.894  59.851  1.00 152.44 ? 71  PHE D CE1 1 
ATOM 5177 C CE2 . PHE D 1 29  ? 47.118  12.674  59.057  1.00 152.44 ? 71  PHE D CE2 1 
ATOM 5178 C CZ  . PHE D 1 29  ? 46.620  11.915  60.108  1.00 152.44 ? 71  PHE D CZ  1 
ATOM 5179 N N   . TRP D 1 30  ? 43.136  11.496  54.162  1.00 152.44 ? 72  TRP D N   1 
ATOM 5180 C CA  . TRP D 1 30  ? 42.052  12.203  53.464  1.00 152.44 ? 72  TRP D CA  1 
ATOM 5181 C C   . TRP D 1 30  ? 40.871  11.304  53.121  1.00 152.44 ? 72  TRP D C   1 
ATOM 5182 O O   . TRP D 1 30  ? 39.726  11.744  53.148  1.00 152.44 ? 72  TRP D O   1 
ATOM 5183 C CB  . TRP D 1 30  ? 42.574  12.904  52.197  1.00 152.44 ? 72  TRP D CB  1 
ATOM 5184 C CG  . TRP D 1 30  ? 41.710  14.059  51.689  1.00 152.44 ? 72  TRP D CG  1 
ATOM 5185 C CD1 . TRP D 1 30  ? 40.403  14.001  51.293  1.00 152.44 ? 72  TRP D CD1 1 
ATOM 5186 C CD2 . TRP D 1 30  ? 42.120  15.426  51.505  1.00 152.44 ? 72  TRP D CD2 1 
ATOM 5187 N NE1 . TRP D 1 30  ? 39.976  15.239  50.876  1.00 152.44 ? 72  TRP D NE1 1 
ATOM 5188 C CE2 . TRP D 1 30  ? 41.008  16.131  50.993  1.00 152.44 ? 72  TRP D CE2 1 
ATOM 5189 C CE3 . TRP D 1 30  ? 43.319  16.120  51.722  1.00 152.44 ? 72  TRP D CE3 1 
ATOM 5190 C CZ2 . TRP D 1 30  ? 41.058  17.497  50.695  1.00 152.44 ? 72  TRP D CZ2 1 
ATOM 5191 C CZ3 . TRP D 1 30  ? 43.371  17.481  51.425  1.00 152.44 ? 72  TRP D CZ3 1 
ATOM 5192 C CH2 . TRP D 1 30  ? 42.245  18.153  50.917  1.00 152.44 ? 72  TRP D CH2 1 
ATOM 5193 N N   . ASP D 1 31  ? 41.143  10.043  52.816  1.00 152.44 ? 73  ASP D N   1 
ATOM 5194 C CA  . ASP D 1 31  ? 40.074  9.120   52.476  1.00 152.44 ? 73  ASP D CA  1 
ATOM 5195 C C   . ASP D 1 31  ? 39.224  8.854   53.714  1.00 152.44 ? 73  ASP D C   1 
ATOM 5196 O O   . ASP D 1 31  ? 38.009  9.003   53.676  1.00 152.44 ? 73  ASP D O   1 
ATOM 5197 C CB  . ASP D 1 31  ? 40.664  7.829   51.936  1.00 152.44 ? 73  ASP D CB  1 
ATOM 5198 C CG  . ASP D 1 31  ? 39.692  7.049   51.088  1.00 152.44 ? 73  ASP D CG  1 
ATOM 5199 O OD1 . ASP D 1 31  ? 39.598  7.349   49.879  1.00 152.44 ? 73  ASP D OD1 1 
ATOM 5200 O OD2 . ASP D 1 31  ? 39.040  6.128   51.623  1.00 152.44 ? 73  ASP D OD2 1 
ATOM 5201 N N   . ASN D 1 32  ? 39.874  8.501   54.817  1.00 152.44 ? 74  ASN D N   1 
ATOM 5202 C CA  . ASN D 1 32  ? 39.169  8.239   56.068  1.00 152.44 ? 74  ASN D CA  1 
ATOM 5203 C C   . ASN D 1 32  ? 38.622  9.567   56.592  1.00 152.44 ? 74  ASN D C   1 
ATOM 5204 O O   . ASN D 1 32  ? 37.617  9.613   57.301  1.00 152.44 ? 74  ASN D O   1 
ATOM 5205 C CB  . ASN D 1 32  ? 40.132  7.631   57.090  1.00 152.44 ? 74  ASN D CB  1 
ATOM 5206 C CG  . ASN D 1 32  ? 39.540  6.441   57.826  1.00 152.44 ? 74  ASN D CG  1 
ATOM 5207 O OD1 . ASN D 1 32  ? 38.425  6.003   57.536  1.00 152.44 ? 74  ASN D OD1 1 
ATOM 5208 N ND2 . ASN D 1 32  ? 40.289  5.910   58.788  1.00 152.44 ? 74  ASN D ND2 1 
ATOM 5209 N N   . LEU D 1 33  ? 39.271  10.649  56.179  1.00 152.44 ? 75  LEU D N   1 
ATOM 5210 C CA  . LEU D 1 33  ? 38.902  11.998  56.571  1.00 152.44 ? 75  LEU D CA  1 
ATOM 5211 C C   . LEU D 1 33  ? 37.516  12.234  56.020  1.00 152.44 ? 75  LEU D C   1 
ATOM 5212 O O   . LEU D 1 33  ? 36.538  12.305  56.756  1.00 152.44 ? 75  LEU D O   1 
ATOM 5213 C CB  . LEU D 1 33  ? 39.878  12.986  55.930  1.00 152.44 ? 75  LEU D CB  1 
ATOM 5214 C CG  . LEU D 1 33  ? 40.158  14.360  56.523  1.00 152.44 ? 75  LEU D CG  1 
ATOM 5215 C CD1 . LEU D 1 33  ? 38.895  15.188  56.593  1.00 152.44 ? 75  LEU D CD1 1 
ATOM 5216 C CD2 . LEU D 1 33  ? 40.775  14.176  57.889  1.00 152.44 ? 75  LEU D CD2 1 
ATOM 5217 N N   . GLU D 1 34  ? 37.457  12.299  54.698  1.00 152.44 ? 76  GLU D N   1 
ATOM 5218 C CA  . GLU D 1 34  ? 36.232  12.514  53.955  1.00 152.44 ? 76  GLU D CA  1 
ATOM 5219 C C   . GLU D 1 34  ? 35.176  11.467  54.338  1.00 152.44 ? 76  GLU D C   1 
ATOM 5220 O O   . GLU D 1 34  ? 34.007  11.804  54.539  1.00 152.44 ? 76  GLU D O   1 
ATOM 5221 C CB  . GLU D 1 34  ? 36.559  12.437  52.460  1.00 152.44 ? 76  GLU D CB  1 
ATOM 5222 C CG  . GLU D 1 34  ? 35.629  13.217  51.546  1.00 152.44 ? 76  GLU D CG  1 
ATOM 5223 C CD  . GLU D 1 34  ? 36.154  13.327  50.114  1.00 152.44 ? 76  GLU D CD  1 
ATOM 5224 O OE1 . GLU D 1 34  ? 37.322  13.736  49.928  1.00 152.44 ? 76  GLU D OE1 1 
ATOM 5225 O OE2 . GLU D 1 34  ? 35.393  13.020  49.169  1.00 152.44 ? 76  GLU D OE2 1 
ATOM 5226 N N   . LYS D 1 35  ? 35.624  10.225  54.530  1.00 152.44 ? 77  LYS D N   1 
ATOM 5227 C CA  . LYS D 1 35  ? 34.740  9.106   54.879  1.00 152.44 ? 77  LYS D CA  1 
ATOM 5228 C C   . LYS D 1 35  ? 33.857  9.363   56.088  1.00 152.44 ? 77  LYS D C   1 
ATOM 5229 O O   . LYS D 1 35  ? 32.635  9.226   56.010  1.00 152.44 ? 77  LYS D O   1 
ATOM 5230 C CB  . LYS D 1 35  ? 35.544  7.822   55.114  1.00 152.44 ? 77  LYS D CB  1 
ATOM 5231 C CG  . LYS D 1 35  ? 34.691  6.626   55.560  1.00 152.44 ? 77  LYS D CG  1 
ATOM 5232 C CD  . LYS D 1 35  ? 35.511  5.337   55.609  1.00 152.44 ? 77  LYS D CD  1 
ATOM 5233 C CE  . LYS D 1 35  ? 34.648  4.122   55.953  1.00 152.44 ? 77  LYS D CE  1 
ATOM 5234 N NZ  . LYS D 1 35  ? 35.432  2.849   55.876  1.00 152.44 ? 77  LYS D NZ  1 
ATOM 5235 N N   . GLU D 1 36  ? 34.470  9.665   57.226  1.00 152.44 ? 78  GLU D N   1 
ATOM 5236 C CA  . GLU D 1 36  ? 33.670  9.933   58.402  1.00 152.44 ? 78  GLU D CA  1 
ATOM 5237 C C   . GLU D 1 36  ? 33.030  11.303  58.302  1.00 152.44 ? 78  GLU D C   1 
ATOM 5238 O O   . GLU D 1 36  ? 31.815  11.413  58.381  1.00 152.44 ? 78  GLU D O   1 
ATOM 5239 C CB  . GLU D 1 36  ? 34.473  9.774   59.684  1.00 152.44 ? 78  GLU D CB  1 
ATOM 5240 C CG  . GLU D 1 36  ? 34.343  8.380   60.282  1.00 152.44 ? 78  GLU D CG  1 
ATOM 5241 C CD  . GLU D 1 36  ? 35.041  8.235   61.626  1.00 152.44 ? 78  GLU D CD  1 
ATOM 5242 O OE1 . GLU D 1 36  ? 35.655  9.222   62.105  1.00 152.44 ? 78  GLU D OE1 1 
ATOM 5243 O OE2 . GLU D 1 36  ? 34.984  7.125   62.196  1.00 152.44 ? 78  GLU D OE2 1 
ATOM 5244 N N   . THR D 1 37  ? 33.845  12.329  58.069  1.00 152.44 ? 79  THR D N   1 
ATOM 5245 C CA  . THR D 1 37  ? 33.377  13.712  57.940  1.00 152.44 ? 79  THR D CA  1 
ATOM 5246 C C   . THR D 1 37  ? 31.991  13.822  57.311  1.00 152.44 ? 79  THR D C   1 
ATOM 5247 O O   . THR D 1 37  ? 31.013  14.109  57.997  1.00 152.44 ? 79  THR D O   1 
ATOM 5248 C CB  . THR D 1 37  ? 34.377  14.553  57.107  1.00 152.44 ? 79  THR D CB  1 
ATOM 5249 O OG1 . THR D 1 37  ? 35.593  14.716  57.848  1.00 152.44 ? 79  THR D OG1 1 
ATOM 5250 C CG2 . THR D 1 37  ? 33.803  15.923  56.766  1.00 152.44 ? 79  THR D CG2 1 
ATOM 5251 N N   . GLU D 1 38  ? 31.907  13.559  56.014  1.00 152.44 ? 80  GLU D N   1 
ATOM 5252 C CA  . GLU D 1 38  ? 30.634  13.635  55.322  1.00 152.44 ? 80  GLU D CA  1 
ATOM 5253 C C   . GLU D 1 38  ? 29.778  12.417  55.670  1.00 152.44 ? 80  GLU D C   1 
ATOM 5254 O O   . GLU D 1 38  ? 28.550  12.472  55.603  1.00 152.44 ? 80  GLU D O   1 
ATOM 5255 C CB  . GLU D 1 38  ? 30.875  13.725  53.815  1.00 152.44 ? 80  GLU D CB  1 
ATOM 5256 C CG  . GLU D 1 38  ? 29.684  14.230  53.017  1.00 152.44 ? 80  GLU D CG  1 
ATOM 5257 C CD  . GLU D 1 38  ? 30.092  14.890  51.706  1.00 152.44 ? 80  GLU D CD  1 
ATOM 5258 O OE1 . GLU D 1 38  ? 30.940  15.812  51.737  1.00 152.44 ? 80  GLU D OE1 1 
ATOM 5259 O OE2 . GLU D 1 38  ? 29.550  14.498  50.647  1.00 152.44 ? 80  GLU D OE2 1 
ATOM 5260 N N   . GLY D 1 39  ? 30.435  11.339  56.095  1.00 152.44 ? 81  GLY D N   1 
ATOM 5261 C CA  . GLY D 1 39  ? 29.731  10.118  56.446  1.00 152.44 ? 81  GLY D CA  1 
ATOM 5262 C C   . GLY D 1 39  ? 28.852  10.250  57.673  1.00 152.44 ? 81  GLY D C   1 
ATOM 5263 O O   . GLY D 1 39  ? 27.767  9.682   57.732  1.00 152.44 ? 81  GLY D O   1 
ATOM 5264 N N   . LEU D 1 40  ? 29.302  11.029  58.645  1.00 152.44 ? 82  LEU D N   1 
ATOM 5265 C CA  . LEU D 1 40  ? 28.545  11.223  59.869  1.00 152.44 ? 82  LEU D CA  1 
ATOM 5266 C C   . LEU D 1 40  ? 27.584  12.332  59.577  1.00 152.44 ? 82  LEU D C   1 
ATOM 5267 O O   . LEU D 1 40  ? 26.496  12.395  60.134  1.00 152.44 ? 82  LEU D O   1 
ATOM 5268 C CB  . LEU D 1 40  ? 29.467  11.639  61.001  1.00 152.44 ? 82  LEU D CB  1 
ATOM 5269 C CG  . LEU D 1 40  ? 30.697  10.744  61.118  1.00 152.44 ? 82  LEU D CG  1 
ATOM 5270 C CD1 . LEU D 1 40  ? 31.580  11.215  62.267  1.00 152.44 ? 82  LEU D CD1 1 
ATOM 5271 C CD2 . LEU D 1 40  ? 30.262  9.288   61.286  1.00 152.44 ? 82  LEU D CD2 1 
ATOM 5272 N N   . ARG D 1 41  ? 28.036  13.235  58.718  1.00 152.44 ? 83  ARG D N   1 
ATOM 5273 C CA  . ARG D 1 41  ? 27.242  14.354  58.275  1.00 152.44 ? 83  ARG D CA  1 
ATOM 5274 C C   . ARG D 1 41  ? 25.943  13.737  57.806  1.00 152.44 ? 83  ARG D C   1 
ATOM 5275 O O   . ARG D 1 41  ? 24.857  14.214  58.121  1.00 152.44 ? 83  ARG D O   1 
ATOM 5276 C CB  . ARG D 1 41  ? 27.950  15.013  57.108  1.00 152.44 ? 83  ARG D CB  1 
ATOM 5277 C CG  . ARG D 1 41  ? 27.152  16.073  56.440  1.00 152.44 ? 83  ARG D CG  1 
ATOM 5278 C CD  . ARG D 1 41  ? 27.871  16.579  55.222  1.00 152.44 ? 83  ARG D CD  1 
ATOM 5279 N NE  . ARG D 1 41  ? 27.123  17.655  54.588  1.00 152.44 ? 83  ARG D NE  1 
ATOM 5280 C CZ  . ARG D 1 41  ? 27.302  18.062  53.336  1.00 152.44 ? 83  ARG D CZ  1 
ATOM 5281 N NH1 . ARG D 1 41  ? 28.212  17.484  52.561  1.00 152.44 ? 83  ARG D NH1 1 
ATOM 5282 N NH2 . ARG D 1 41  ? 26.567  19.056  52.857  1.00 152.44 ? 83  ARG D NH2 1 
ATOM 5283 N N   . GLN D 1 42  ? 26.085  12.618  57.104  1.00 152.44 ? 84  GLN D N   1 
ATOM 5284 C CA  . GLN D 1 42  ? 24.958  11.863  56.592  1.00 152.44 ? 84  GLN D CA  1 
ATOM 5285 C C   . GLN D 1 42  ? 24.077  11.438  57.764  1.00 152.44 ? 84  GLN D C   1 
ATOM 5286 O O   . GLN D 1 42  ? 22.868  11.667  57.750  1.00 152.44 ? 84  GLN D O   1 
ATOM 5287 C CB  . GLN D 1 42  ? 25.460  10.628  55.834  1.00 152.44 ? 84  GLN D CB  1 
ATOM 5288 C CG  . GLN D 1 42  ? 24.359  9.689   55.334  1.00 152.44 ? 84  GLN D CG  1 
ATOM 5289 C CD  . GLN D 1 42  ? 24.893  8.504   54.527  1.00 152.44 ? 84  GLN D CD  1 
ATOM 5290 O OE1 . GLN D 1 42  ? 26.083  8.182   54.578  1.00 152.44 ? 84  GLN D OE1 1 
ATOM 5291 N NE2 . GLN D 1 42  ? 24.007  7.855   53.776  1.00 152.44 ? 84  GLN D NE2 1 
ATOM 5292 N N   . GLU D 1 43  ? 24.686  10.840  58.789  1.00 152.44 ? 85  GLU D N   1 
ATOM 5293 C CA  . GLU D 1 43  ? 23.925  10.397  59.955  1.00 152.44 ? 85  GLU D CA  1 
ATOM 5294 C C   . GLU D 1 43  ? 23.309  11.589  60.674  1.00 152.44 ? 85  GLU D C   1 
ATOM 5295 O O   . GLU D 1 43  ? 22.268  11.465  61.314  1.00 152.44 ? 85  GLU D O   1 
ATOM 5296 C CB  . GLU D 1 43  ? 24.801  9.568   60.915  1.00 152.44 ? 85  GLU D CB  1 
ATOM 5297 C CG  . GLU D 1 43  ? 24.015  8.827   62.025  1.00 152.44 ? 85  GLU D CG  1 
ATOM 5298 C CD  . GLU D 1 43  ? 24.758  7.621   62.623  1.00 152.44 ? 85  GLU D CD  1 
ATOM 5299 O OE1 . GLU D 1 43  ? 26.003  7.665   62.731  1.00 152.44 ? 85  GLU D OE1 1 
ATOM 5300 O OE2 . GLU D 1 43  ? 24.090  6.624   62.988  1.00 152.44 ? 85  GLU D OE2 1 
ATOM 5301 N N   . MET D 1 44  ? 23.918  12.755  60.509  1.00 152.44 ? 86  MET D N   1 
ATOM 5302 C CA  . MET D 1 44  ? 23.423  13.957  61.147  1.00 152.44 ? 86  MET D CA  1 
ATOM 5303 C C   . MET D 1 44  ? 22.145  14.450  60.505  1.00 152.44 ? 86  MET D C   1 
ATOM 5304 O O   . MET D 1 44  ? 21.089  14.435  61.132  1.00 152.44 ? 86  MET D O   1 
ATOM 5305 C CB  . MET D 1 44  ? 24.484  15.052  61.126  1.00 152.44 ? 86  MET D CB  1 
ATOM 5306 C CG  . MET D 1 44  ? 23.978  16.373  61.659  1.00 152.44 ? 86  MET D CG  1 
ATOM 5307 S SD  . MET D 1 44  ? 22.721  16.137  62.934  1.00 152.44 ? 86  MET D SD  1 
ATOM 5308 C CE  . MET D 1 44  ? 21.336  17.116  62.256  1.00 152.44 ? 86  MET D CE  1 
ATOM 5309 N N   . SER D 1 45  ? 22.256  14.895  59.258  1.00 152.44 ? 87  SER D N   1 
ATOM 5310 C CA  . SER D 1 45  ? 21.127  15.404  58.490  1.00 152.44 ? 87  SER D CA  1 
ATOM 5311 C C   . SER D 1 45  ? 19.868  14.605  58.755  1.00 152.44 ? 87  SER D C   1 
ATOM 5312 O O   . SER D 1 45  ? 18.765  15.143  58.783  1.00 152.44 ? 87  SER D O   1 
ATOM 5313 C CB  . SER D 1 45  ? 21.454  15.358  57.001  1.00 152.44 ? 87  SER D CB  1 
ATOM 5314 O OG  . SER D 1 45  ? 20.332  15.737  56.228  1.00 152.44 ? 87  SER D OG  1 
ATOM 5315 N N   . LYS D 1 46  ? 20.066  13.314  58.972  1.00 76.30  ? 88  LYS D N   1 
ATOM 5316 C CA  . LYS D 1 46  ? 18.990  12.386  59.263  1.00 76.30  ? 88  LYS D CA  1 
ATOM 5317 C C   . LYS D 1 46  ? 18.000  13.007  60.240  1.00 76.30  ? 88  LYS D C   1 
ATOM 5318 O O   . LYS D 1 46  ? 16.799  13.086  59.967  1.00 76.30  ? 88  LYS D O   1 
ATOM 5319 C CB  . LYS D 1 46  ? 19.591  11.117  59.870  1.00 76.30  ? 88  LYS D CB  1 
ATOM 5320 C CG  . LYS D 1 46  ? 18.580  10.096  60.366  1.00 76.30  ? 88  LYS D CG  1 
ATOM 5321 C CD  . LYS D 1 46  ? 19.266  8.842   60.923  1.00 76.30  ? 88  LYS D CD  1 
ATOM 5322 C CE  . LYS D 1 46  ? 18.234  7.786   61.346  1.00 76.30  ? 88  LYS D CE  1 
ATOM 5323 N NZ  . LYS D 1 46  ? 18.812  6.450   61.710  1.00 76.30  ? 88  LYS D NZ  1 
ATOM 5324 N N   . ASP D 1 47  ? 18.534  13.502  61.351  1.00 76.30  ? 89  ASP D N   1 
ATOM 5325 C CA  . ASP D 1 47  ? 17.727  14.108  62.395  1.00 76.30  ? 89  ASP D CA  1 
ATOM 5326 C C   . ASP D 1 47  ? 16.793  15.169  61.903  1.00 76.30  ? 89  ASP D C   1 
ATOM 5327 O O   . ASP D 1 47  ? 15.590  15.085  62.116  1.00 76.30  ? 89  ASP D O   1 
ATOM 5328 C CB  . ASP D 1 47  ? 18.613  14.689  63.482  1.00 76.30  ? 89  ASP D CB  1 
ATOM 5329 C CG  . ASP D 1 47  ? 19.411  13.631  64.190  1.00 76.30  ? 89  ASP D CG  1 
ATOM 5330 O OD1 . ASP D 1 47  ? 20.086  12.838  63.498  1.00 76.30  ? 89  ASP D OD1 1 
ATOM 5331 O OD2 . ASP D 1 47  ? 19.354  13.582  65.435  1.00 76.30  ? 89  ASP D OD2 1 
ATOM 5332 N N   . LEU D 1 48  ? 17.353  16.161  61.228  1.00 76.30  ? 90  LEU D N   1 
ATOM 5333 C CA  . LEU D 1 48  ? 16.554  17.257  60.722  1.00 76.30  ? 90  LEU D CA  1 
ATOM 5334 C C   . LEU D 1 48  ? 15.281  16.747  60.058  1.00 76.30  ? 90  LEU D C   1 
ATOM 5335 O O   . LEU D 1 48  ? 14.193  17.255  60.332  1.00 76.30  ? 90  LEU D O   1 
ATOM 5336 C CB  . LEU D 1 48  ? 17.356  18.112  59.745  1.00 76.30  ? 90  LEU D CB  1 
ATOM 5337 C CG  . LEU D 1 48  ? 16.810  19.542  59.674  1.00 76.30  ? 90  LEU D CG  1 
ATOM 5338 C CD1 . LEU D 1 48  ? 17.328  20.322  60.876  1.00 76.30  ? 90  LEU D CD1 1 
ATOM 5339 C CD2 . LEU D 1 48  ? 17.207  20.210  58.377  1.00 76.30  ? 90  LEU D CD2 1 
ATOM 5340 N N   . GLU D 1 49  ? 15.397  15.698  59.250  1.00 76.30  ? 91  GLU D N   1 
ATOM 5341 C CA  . GLU D 1 49  ? 14.214  15.178  58.599  1.00 76.30  ? 91  GLU D CA  1 
ATOM 5342 C C   . GLU D 1 49  ? 13.320  14.454  59.592  1.00 76.30  ? 91  GLU D C   1 
ATOM 5343 O O   . GLU D 1 49  ? 12.095  14.501  59.483  1.00 76.30  ? 91  GLU D O   1 
ATOM 5344 C CB  . GLU D 1 49  ? 14.570  14.273  57.427  1.00 76.30  ? 91  GLU D CB  1 
ATOM 5345 C CG  . GLU D 1 49  ? 13.371  14.040  56.492  1.00 76.30  ? 91  GLU D CG  1 
ATOM 5346 C CD  . GLU D 1 49  ? 13.744  13.406  55.151  1.00 76.30  ? 91  GLU D CD  1 
ATOM 5347 O OE1 . GLU D 1 49  ? 14.541  14.018  54.391  1.00 76.30  ? 91  GLU D OE1 1 
ATOM 5348 O OE2 . GLU D 1 49  ? 13.211  12.304  54.852  1.00 76.30  ? 91  GLU D OE2 1 
ATOM 5349 N N   . GLU D 1 50  ? 13.936  13.817  60.582  1.00 76.30  ? 92  GLU D N   1 
ATOM 5350 C CA  . GLU D 1 50  ? 13.182  13.093  61.605  1.00 76.30  ? 92  GLU D CA  1 
ATOM 5351 C C   . GLU D 1 50  ? 12.356  14.056  62.415  1.00 76.30  ? 92  GLU D C   1 
ATOM 5352 O O   . GLU D 1 50  ? 11.126  13.993  62.448  1.00 76.30  ? 92  GLU D O   1 
ATOM 5353 C CB  . GLU D 1 50  ? 14.118  12.406  62.580  1.00 76.30  ? 92  GLU D CB  1 
ATOM 5354 C CG  . GLU D 1 50  ? 15.082  11.463  61.960  1.00 76.30  ? 92  GLU D CG  1 
ATOM 5355 C CD  . GLU D 1 50  ? 15.910  10.774  63.007  1.00 76.30  ? 92  GLU D CD  1 
ATOM 5356 O OE1 . GLU D 1 50  ? 15.441  9.747   63.557  1.00 76.30  ? 92  GLU D OE1 1 
ATOM 5357 O OE2 . GLU D 1 50  ? 17.022  11.274  63.296  1.00 76.30  ? 92  GLU D OE2 1 
ATOM 5358 N N   . VAL D 1 51  ? 13.076  14.905  63.130  1.00 76.30  ? 93  VAL D N   1 
ATOM 5359 C CA  . VAL D 1 51  ? 12.484  15.909  63.978  1.00 76.30  ? 93  VAL D CA  1 
ATOM 5360 C C   . VAL D 1 51  ? 11.386  16.593  63.206  1.00 76.30  ? 93  VAL D C   1 
ATOM 5361 O O   . VAL D 1 51  ? 10.258  16.694  63.680  1.00 76.30  ? 93  VAL D O   1 
ATOM 5362 C CB  . VAL D 1 51  ? 13.549  16.924  64.425  1.00 76.30  ? 93  VAL D CB  1 
ATOM 5363 C CG1 . VAL D 1 51  ? 14.733  16.177  65.019  1.00 76.30  ? 93  VAL D CG1 1 
ATOM 5364 C CG2 . VAL D 1 51  ? 14.010  17.797  63.266  1.00 76.30  ? 93  VAL D CG2 1 
ATOM 5365 N N   . LYS D 1 52  ? 11.711  16.916  61.958  1.00 76.30  ? 94  LYS D N   1 
ATOM 5366 C CA  . LYS D 1 52  ? 10.817  17.581  61.032  1.00 76.30  ? 94  LYS D CA  1 
ATOM 5367 C C   . LYS D 1 52  ? 9.447   16.970  61.190  1.00 76.30  ? 94  LYS D C   1 
ATOM 5368 O O   . LYS D 1 52  ? 8.467   17.661  61.423  1.00 76.30  ? 94  LYS D O   1 
ATOM 5369 C CB  . LYS D 1 52  ? 11.315  17.337  59.616  1.00 76.30  ? 94  LYS D CB  1 
ATOM 5370 C CG  . LYS D 1 52  ? 10.738  18.245  58.572  1.00 76.30  ? 94  LYS D CG  1 
ATOM 5371 C CD  . LYS D 1 52  ? 11.861  18.949  57.809  1.00 76.30  ? 94  LYS D CD  1 
ATOM 5372 C CE  . LYS D 1 52  ? 11.319  19.965  56.804  1.00 76.30  ? 94  LYS D CE  1 
ATOM 5373 N NZ  . LYS D 1 52  ? 12.374  20.747  56.086  1.00 76.30  ? 94  LYS D NZ  1 
ATOM 5374 N N   . ALA D 1 53  ? 9.409   15.650  61.117  1.00 76.30  ? 95  ALA D N   1 
ATOM 5375 C CA  . ALA D 1 53  ? 8.175   14.921  61.271  1.00 76.30  ? 95  ALA D CA  1 
ATOM 5376 C C   . ALA D 1 53  ? 7.532   15.335  62.581  1.00 76.30  ? 95  ALA D C   1 
ATOM 5377 O O   . ALA D 1 53  ? 6.553   16.070  62.583  1.00 76.30  ? 95  ALA D O   1 
ATOM 5378 C CB  . ALA D 1 53  ? 8.454   13.435  61.259  1.00 76.30  ? 95  ALA D CB  1 
ATOM 5379 N N   . LYS D 1 54  ? 8.164   14.956  63.684  1.00 76.30  ? 96  LYS D N   1 
ATOM 5380 C CA  . LYS D 1 54  ? 7.658   15.266  65.017  1.00 76.30  ? 96  LYS D CA  1 
ATOM 5381 C C   . LYS D 1 54  ? 7.346   16.744  65.236  1.00 76.30  ? 96  LYS D C   1 
ATOM 5382 O O   . LYS D 1 54  ? 6.555   17.097  66.102  1.00 76.30  ? 96  LYS D O   1 
ATOM 5383 C CB  . LYS D 1 54  ? 8.646   14.767  66.080  1.00 76.30  ? 96  LYS D CB  1 
ATOM 5384 C CG  . LYS D 1 54  ? 8.667   13.235  66.229  1.00 76.30  ? 96  LYS D CG  1 
ATOM 5385 C CD  . LYS D 1 54  ? 9.543   12.731  67.393  1.00 76.30  ? 96  LYS D CD  1 
ATOM 5386 C CE  . LYS D 1 54  ? 9.181   11.289  67.782  1.00 76.30  ? 96  LYS D CE  1 
ATOM 5387 N NZ  . LYS D 1 54  ? 10.032  10.696  68.861  1.00 76.30  ? 96  LYS D NZ  1 
ATOM 5388 N N   . VAL D 1 55  ? 7.890   17.585  64.371  1.00 76.30  ? 97  VAL D N   1 
ATOM 5389 C CA  . VAL D 1 55  ? 7.713   19.021  64.455  1.00 76.30  ? 97  VAL D CA  1 
ATOM 5390 C C   . VAL D 1 55  ? 6.541   19.540  63.631  1.00 76.30  ? 97  VAL D C   1 
ATOM 5391 O O   . VAL D 1 55  ? 5.789   20.422  64.053  1.00 76.30  ? 97  VAL D O   1 
ATOM 5392 C CB  . VAL D 1 55  ? 8.974   19.699  63.963  1.00 76.30  ? 97  VAL D CB  1 
ATOM 5393 C CG1 . VAL D 1 55  ? 8.759   21.188  63.847  1.00 76.30  ? 97  VAL D CG1 1 
ATOM 5394 C CG2 . VAL D 1 55  ? 10.122  19.365  64.894  1.00 76.30  ? 97  VAL D CG2 1 
ATOM 5395 N N   . GLN D 1 56  ? 6.396   18.973  62.445  1.00 76.30  ? 98  GLN D N   1 
ATOM 5396 C CA  . GLN D 1 56  ? 5.353   19.370  61.530  1.00 76.30  ? 98  GLN D CA  1 
ATOM 5397 C C   . GLN D 1 56  ? 3.971   19.484  62.123  1.00 76.30  ? 98  GLN D C   1 
ATOM 5398 O O   . GLN D 1 56  ? 3.291   20.478  61.907  1.00 76.30  ? 98  GLN D O   1 
ATOM 5399 C CB  . GLN D 1 56  ? 5.321   18.446  60.323  1.00 76.30  ? 98  GLN D CB  1 
ATOM 5400 C CG  . GLN D 1 56  ? 5.879   19.093  59.067  1.00 76.30  ? 98  GLN D CG  1 
ATOM 5401 C CD  . GLN D 1 56  ? 5.111   20.341  58.652  1.00 76.30  ? 98  GLN D CD  1 
ATOM 5402 O OE1 . GLN D 1 56  ? 4.486   20.374  57.582  1.00 76.30  ? 98  GLN D OE1 1 
ATOM 5403 N NE2 . GLN D 1 56  ? 5.170   21.379  59.484  1.00 76.30  ? 98  GLN D NE2 1 
ATOM 5404 N N   . PRO D 1 57  ? 3.533   18.469  62.865  1.00 101.52 ? 99  PRO D N   1 
ATOM 5405 C CA  . PRO D 1 57  ? 2.212   18.479  63.482  1.00 101.52 ? 99  PRO D CA  1 
ATOM 5406 C C   . PRO D 1 57  ? 1.931   19.791  64.187  1.00 101.52 ? 99  PRO D C   1 
ATOM 5407 O O   . PRO D 1 57  ? 0.914   20.436  63.954  1.00 101.52 ? 99  PRO D O   1 
ATOM 5408 C CB  . PRO D 1 57  ? 2.304   17.325  64.487  1.00 101.52 ? 99  PRO D CB  1 
ATOM 5409 C CG  . PRO D 1 57  ? 3.777   17.156  64.710  1.00 101.52 ? 99  PRO D CG  1 
ATOM 5410 C CD  . PRO D 1 57  ? 4.290   17.302  63.334  1.00 101.52 ? 99  PRO D CD  1 
ATOM 5411 N N   . TYR D 1 58  ? 2.861   20.183  65.044  1.00 101.52 ? 100 TYR D N   1 
ATOM 5412 C CA  . TYR D 1 58  ? 2.713   21.399  65.798  1.00 101.52 ? 100 TYR D CA  1 
ATOM 5413 C C   . TYR D 1 58  ? 2.765   22.602  64.903  1.00 101.52 ? 100 TYR D C   1 
ATOM 5414 O O   . TYR D 1 58  ? 1.825   23.396  64.873  1.00 101.52 ? 100 TYR D O   1 
ATOM 5415 C CB  . TYR D 1 58  ? 3.760   21.443  66.904  1.00 101.52 ? 100 TYR D CB  1 
ATOM 5416 C CG  . TYR D 1 58  ? 3.474   20.388  67.946  1.00 101.52 ? 100 TYR D CG  1 
ATOM 5417 C CD1 . TYR D 1 58  ? 2.178   20.222  68.442  1.00 101.52 ? 100 TYR D CD1 1 
ATOM 5418 C CD2 . TYR D 1 58  ? 4.471   19.532  68.410  1.00 101.52 ? 100 TYR D CD2 1 
ATOM 5419 C CE1 . TYR D 1 58  ? 1.875   19.232  69.370  1.00 101.52 ? 100 TYR D CE1 1 
ATOM 5420 C CE2 . TYR D 1 58  ? 4.181   18.533  69.342  1.00 101.52 ? 100 TYR D CE2 1 
ATOM 5421 C CZ  . TYR D 1 58  ? 2.880   18.389  69.817  1.00 101.52 ? 100 TYR D CZ  1 
ATOM 5422 O OH  . TYR D 1 58  ? 2.582   17.406  70.735  1.00 101.52 ? 100 TYR D OH  1 
ATOM 5423 N N   . LEU D 1 59  ? 3.809   22.676  64.093  1.00 101.52 ? 101 LEU D N   1 
ATOM 5424 C CA  . LEU D 1 59  ? 3.954   23.796  63.190  1.00 101.52 ? 101 LEU D CA  1 
ATOM 5425 C C   . LEU D 1 59  ? 2.674   24.045  62.399  1.00 101.52 ? 101 LEU D C   1 
ATOM 5426 O O   . LEU D 1 59  ? 2.206   25.174  62.298  1.00 101.52 ? 101 LEU D O   1 
ATOM 5427 C CB  . LEU D 1 59  ? 5.117   23.544  62.243  1.00 101.52 ? 101 LEU D CB  1 
ATOM 5428 C CG  . LEU D 1 59  ? 5.319   24.623  61.177  1.00 101.52 ? 101 LEU D CG  1 
ATOM 5429 C CD1 . LEU D 1 59  ? 5.359   26.017  61.799  1.00 101.52 ? 101 LEU D CD1 1 
ATOM 5430 C CD2 . LEU D 1 59  ? 6.592   24.330  60.413  1.00 101.52 ? 101 LEU D CD2 1 
ATOM 5431 N N   . ASP D 1 60  ? 2.078   22.972  61.901  1.00 101.52 ? 102 ASP D N   1 
ATOM 5432 C CA  . ASP D 1 60  ? 0.858   23.075  61.122  1.00 101.52 ? 102 ASP D CA  1 
ATOM 5433 C C   . ASP D 1 60  ? -0.331  23.474  61.974  1.00 101.52 ? 102 ASP D C   1 
ATOM 5434 O O   . ASP D 1 60  ? -1.082  24.367  61.603  1.00 101.52 ? 102 ASP D O   1 
ATOM 5435 C CB  . ASP D 1 60  ? 0.573   21.761  60.408  1.00 101.52 ? 102 ASP D CB  1 
ATOM 5436 C CG  . ASP D 1 60  ? 1.469   21.549  59.208  1.00 101.52 ? 102 ASP D CG  1 
ATOM 5437 O OD1 . ASP D 1 60  ? 1.829   22.550  58.552  1.00 101.52 ? 102 ASP D OD1 1 
ATOM 5438 O OD2 . ASP D 1 60  ? 1.807   20.381  58.918  1.00 101.52 ? 102 ASP D OD2 1 
ATOM 5439 N N   . ASP D 1 61  ? -0.488  22.808  63.117  1.00 101.52 ? 103 ASP D N   1 
ATOM 5440 C CA  . ASP D 1 61  ? -1.582  23.083  64.055  1.00 101.52 ? 103 ASP D CA  1 
ATOM 5441 C C   . ASP D 1 61  ? -1.602  24.587  64.235  1.00 101.52 ? 103 ASP D C   1 
ATOM 5442 O O   . ASP D 1 61  ? -2.636  25.246  64.186  1.00 101.52 ? 103 ASP D O   1 
ATOM 5443 C CB  . ASP D 1 61  ? -1.272  22.403  65.406  1.00 101.52 ? 103 ASP D CB  1 
ATOM 5444 C CG  . ASP D 1 61  ? -2.387  22.576  66.457  1.00 101.52 ? 103 ASP D CG  1 
ATOM 5445 O OD1 . ASP D 1 61  ? -3.257  23.468  66.322  1.00 101.52 ? 103 ASP D OD1 1 
ATOM 5446 O OD2 . ASP D 1 61  ? -2.372  21.811  67.449  1.00 101.52 ? 103 ASP D OD2 1 
ATOM 5447 N N   . PHE D 1 62  ? -0.400  25.106  64.362  1.00 101.52 ? 104 PHE D N   1 
ATOM 5448 C CA  . PHE D 1 62  ? -0.151  26.501  64.550  1.00 101.52 ? 104 PHE D CA  1 
ATOM 5449 C C   . PHE D 1 62  ? -0.536  27.283  63.311  1.00 101.52 ? 104 PHE D C   1 
ATOM 5450 O O   . PHE D 1 62  ? -1.347  28.206  63.362  1.00 101.52 ? 104 PHE D O   1 
ATOM 5451 C CB  . PHE D 1 62  ? 1.330   26.631  64.801  1.00 101.52 ? 104 PHE D CB  1 
ATOM 5452 C CG  . PHE D 1 62  ? 1.742   27.974  65.226  1.00 101.52 ? 104 PHE D CG  1 
ATOM 5453 C CD1 . PHE D 1 62  ? 1.596   28.364  66.554  1.00 101.52 ? 104 PHE D CD1 1 
ATOM 5454 C CD2 . PHE D 1 62  ? 2.318   28.845  64.320  1.00 101.52 ? 104 PHE D CD2 1 
ATOM 5455 C CE1 . PHE D 1 62  ? 2.024   29.609  66.978  1.00 101.52 ? 104 PHE D CE1 1 
ATOM 5456 C CE2 . PHE D 1 62  ? 2.750   30.091  64.732  1.00 101.52 ? 104 PHE D CE2 1 
ATOM 5457 C CZ  . PHE D 1 62  ? 2.604   30.476  66.069  1.00 101.52 ? 104 PHE D CZ  1 
ATOM 5458 N N   . GLN D 1 63  ? 0.030   26.868  62.189  1.00 101.52 ? 105 GLN D N   1 
ATOM 5459 C CA  . GLN D 1 63  ? -0.212  27.510  60.920  1.00 101.52 ? 105 GLN D CA  1 
ATOM 5460 C C   . GLN D 1 63  ? -1.685  27.793  60.648  1.00 101.52 ? 105 GLN D C   1 
ATOM 5461 O O   . GLN D 1 63  ? -2.070  28.948  60.438  1.00 101.52 ? 105 GLN D O   1 
ATOM 5462 C CB  . GLN D 1 63  ? 0.387   26.661  59.811  1.00 101.52 ? 105 GLN D CB  1 
ATOM 5463 C CG  . GLN D 1 63  ? 0.459   27.392  58.514  1.00 101.52 ? 105 GLN D CG  1 
ATOM 5464 C CD  . GLN D 1 63  ? 1.214   28.705  58.626  1.00 101.52 ? 105 GLN D CD  1 
ATOM 5465 O OE1 . GLN D 1 63  ? 1.621   29.126  59.717  1.00 101.52 ? 105 GLN D OE1 1 
ATOM 5466 N NE2 . GLN D 1 63  ? 1.417   29.359  57.488  1.00 101.52 ? 105 GLN D NE2 1 
ATOM 5467 N N   . LYS D 1 64  ? -2.500  26.739  60.708  1.00 101.52 ? 106 LYS D N   1 
ATOM 5468 C CA  . LYS D 1 64  ? -3.946  26.826  60.485  1.00 101.52 ? 106 LYS D CA  1 
ATOM 5469 C C   . LYS D 1 64  ? -4.567  27.943  61.313  1.00 101.52 ? 106 LYS D C   1 
ATOM 5470 O O   . LYS D 1 64  ? -5.483  28.640  60.867  1.00 101.52 ? 106 LYS D O   1 
ATOM 5471 C CB  . LYS D 1 64  ? -4.635  25.504  60.855  1.00 101.52 ? 106 LYS D CB  1 
ATOM 5472 C CG  . LYS D 1 64  ? -4.467  24.371  59.842  1.00 101.52 ? 106 LYS D CG  1 
ATOM 5473 C CD  . LYS D 1 64  ? -5.350  23.160  60.196  1.00 101.52 ? 106 LYS D CD  1 
ATOM 5474 C CE  . LYS D 1 64  ? -5.443  22.145  59.039  1.00 101.52 ? 106 LYS D CE  1 
ATOM 5475 N NZ  . LYS D 1 64  ? -6.365  20.981  59.294  1.00 101.52 ? 106 LYS D NZ  1 
ATOM 5476 N N   . LYS D 1 65  ? -4.040  28.115  62.516  1.00 101.52 ? 107 LYS D N   1 
ATOM 5477 C CA  . LYS D 1 65  ? -4.533  29.124  63.429  1.00 101.52 ? 107 LYS D CA  1 
ATOM 5478 C C   . LYS D 1 65  ? -4.124  30.538  63.023  1.00 101.52 ? 107 LYS D C   1 
ATOM 5479 O O   . LYS D 1 65  ? -4.982  31.388  62.818  1.00 101.52 ? 107 LYS D O   1 
ATOM 5480 C CB  . LYS D 1 65  ? -4.051  28.800  64.842  1.00 101.52 ? 107 LYS D CB  1 
ATOM 5481 C CG  . LYS D 1 65  ? -5.084  29.057  65.920  1.00 101.52 ? 107 LYS D CG  1 
ATOM 5482 C CD  . LYS D 1 65  ? -4.543  28.764  67.319  1.00 101.52 ? 107 LYS D CD  1 
ATOM 5483 C CE  . LYS D 1 65  ? -4.383  27.269  67.597  1.00 101.52 ? 107 LYS D CE  1 
ATOM 5484 N NZ  . LYS D 1 65  ? -3.858  27.008  68.983  1.00 101.52 ? 107 LYS D NZ  1 
ATOM 5485 N N   . TRP D 1 66  ? -2.823  30.780  62.876  1.00 101.52 ? 108 TRP D N   1 
ATOM 5486 C CA  . TRP D 1 66  ? -2.304  32.104  62.510  1.00 101.52 ? 108 TRP D CA  1 
ATOM 5487 C C   . TRP D 1 66  ? -3.134  32.780  61.450  1.00 101.52 ? 108 TRP D C   1 
ATOM 5488 O O   . TRP D 1 66  ? -3.441  33.959  61.534  1.00 101.52 ? 108 TRP D O   1 
ATOM 5489 C CB  . TRP D 1 66  ? -0.849  31.989  62.052  1.00 101.52 ? 108 TRP D CB  1 
ATOM 5490 C CG  . TRP D 1 66  ? -0.375  33.018  61.027  1.00 101.52 ? 108 TRP D CG  1 
ATOM 5491 C CD1 . TRP D 1 66  ? -0.357  32.858  59.676  1.00 101.52 ? 108 TRP D CD1 1 
ATOM 5492 C CD2 . TRP D 1 66  ? 0.251   34.304  61.279  1.00 101.52 ? 108 TRP D CD2 1 
ATOM 5493 N NE1 . TRP D 1 66  ? 0.249   33.936  59.069  1.00 101.52 ? 108 TRP D NE1 1 
ATOM 5494 C CE2 . TRP D 1 66  ? 0.630   34.837  60.027  1.00 101.52 ? 108 TRP D CE2 1 
ATOM 5495 C CE3 . TRP D 1 66  ? 0.536   35.047  62.436  1.00 101.52 ? 108 TRP D CE3 1 
ATOM 5496 C CZ2 . TRP D 1 66  ? 1.277   36.083  59.896  1.00 101.52 ? 108 TRP D CZ2 1 
ATOM 5497 C CZ3 . TRP D 1 66  ? 1.183   36.292  62.301  1.00 101.52 ? 108 TRP D CZ3 1 
ATOM 5498 C CH2 . TRP D 1 66  ? 1.544   36.789  61.040  1.00 101.52 ? 108 TRP D CH2 1 
ATOM 5499 N N   . GLN D 1 67  ? -3.500  32.005  60.451  1.00 101.52 ? 109 GLN D N   1 
ATOM 5500 C CA  . GLN D 1 67  ? -4.306  32.519  59.378  1.00 101.52 ? 109 GLN D CA  1 
ATOM 5501 C C   . GLN D 1 67  ? -5.638  32.915  59.953  1.00 101.52 ? 109 GLN D C   1 
ATOM 5502 O O   . GLN D 1 67  ? -6.053  34.060  59.808  1.00 101.52 ? 109 GLN D O   1 
ATOM 5503 C CB  . GLN D 1 67  ? -4.480  31.453  58.306  1.00 101.52 ? 109 GLN D CB  1 
ATOM 5504 C CG  . GLN D 1 67  ? -3.161  31.006  57.677  1.00 101.52 ? 109 GLN D CG  1 
ATOM 5505 C CD  . GLN D 1 67  ? -2.385  32.151  57.024  1.00 101.52 ? 109 GLN D CD  1 
ATOM 5506 O OE1 . GLN D 1 67  ? -2.799  33.312  57.072  1.00 101.52 ? 109 GLN D OE1 1 
ATOM 5507 N NE2 . GLN D 1 67  ? -1.253  31.823  56.408  1.00 101.52 ? 109 GLN D NE2 1 
ATOM 5508 N N   . GLU D 1 68  ? -6.268  31.976  60.660  1.00 101.52 ? 110 GLU D N   1 
ATOM 5509 C CA  . GLU D 1 68  ? -7.562  32.213  61.296  1.00 101.52 ? 110 GLU D CA  1 
ATOM 5510 C C   . GLU D 1 68  ? -7.568  33.604  61.922  1.00 101.52 ? 110 GLU D C   1 
ATOM 5511 O O   . GLU D 1 68  ? -8.552  34.329  61.817  1.00 101.52 ? 110 GLU D O   1 
ATOM 5512 C CB  . GLU D 1 68  ? -7.851  31.164  62.383  1.00 101.52 ? 110 GLU D CB  1 
ATOM 5513 C CG  . GLU D 1 68  ? -8.063  29.740  61.875  1.00 101.52 ? 110 GLU D CG  1 
ATOM 5514 C CD  . GLU D 1 68  ? -9.510  29.284  61.976  1.00 101.52 ? 110 GLU D CD  1 
ATOM 5515 O OE1 . GLU D 1 68  ? -10.132 29.481  63.042  1.00 101.52 ? 110 GLU D OE1 1 
ATOM 5516 O OE2 . GLU D 1 68  ? -10.025 28.711  60.993  1.00 101.52 ? 110 GLU D OE2 1 
ATOM 5517 N N   . GLU D 1 69  ? -6.436  34.007  62.498  1.00 101.52 ? 111 GLU D N   1 
ATOM 5518 C CA  . GLU D 1 69  ? -6.356  35.320  63.117  1.00 101.52 ? 111 GLU D CA  1 
ATOM 5519 C C   . GLU D 1 69  ? -6.009  36.396  62.112  1.00 101.52 ? 111 GLU D C   1 
ATOM 5520 O O   . GLU D 1 69  ? -6.609  37.460  62.124  1.00 101.52 ? 111 GLU D O   1 
ATOM 5521 C CB  . GLU D 1 69  ? -5.352  35.339  64.267  1.00 101.52 ? 111 GLU D CB  1 
ATOM 5522 C CG  . GLU D 1 69  ? -5.637  36.414  65.337  1.00 101.52 ? 111 GLU D CG  1 
ATOM 5523 C CD  . GLU D 1 69  ? -4.946  37.767  65.105  1.00 101.52 ? 111 GLU D CD  1 
ATOM 5524 O OE1 . GLU D 1 69  ? -4.600  38.104  63.948  1.00 101.52 ? 111 GLU D OE1 1 
ATOM 5525 O OE2 . GLU D 1 69  ? -4.753  38.504  66.102  1.00 101.52 ? 111 GLU D OE2 1 
ATOM 5526 N N   . MET D 1 70  ? -5.023  36.145  61.264  1.00 101.52 ? 112 MET D N   1 
ATOM 5527 C CA  . MET D 1 70  ? -4.631  37.130  60.269  1.00 101.52 ? 112 MET D CA  1 
ATOM 5528 C C   . MET D 1 70  ? -5.842  37.688  59.574  1.00 101.52 ? 112 MET D C   1 
ATOM 5529 O O   . MET D 1 70  ? -5.941  38.886  59.352  1.00 101.52 ? 112 MET D O   1 
ATOM 5530 C CB  . MET D 1 70  ? -3.774  36.493  59.215  1.00 101.52 ? 112 MET D CB  1 
ATOM 5531 C CG  . MET D 1 70  ? -2.337  36.472  59.534  1.00 101.52 ? 112 MET D CG  1 
ATOM 5532 S SD  . MET D 1 70  ? -1.561  35.742  58.114  1.00 101.52 ? 112 MET D SD  1 
ATOM 5533 C CE  . MET D 1 70  ? -0.984  37.161  57.251  1.00 101.52 ? 112 MET D CE  1 
ATOM 5534 N N   . GLU D 1 71  ? -6.757  36.793  59.223  1.00 101.52 ? 113 GLU D N   1 
ATOM 5535 C CA  . GLU D 1 71  ? -7.976  37.184  58.550  1.00 101.52 ? 113 GLU D CA  1 
ATOM 5536 C C   . GLU D 1 71  ? -8.682  38.245  59.362  1.00 101.52 ? 113 GLU D C   1 
ATOM 5537 O O   . GLU D 1 71  ? -9.270  39.159  58.797  1.00 101.52 ? 113 GLU D O   1 
ATOM 5538 C CB  . GLU D 1 71  ? -8.881  35.979  58.314  1.00 101.52 ? 113 GLU D CB  1 
ATOM 5539 C CG  . GLU D 1 71  ? -8.473  35.132  57.101  1.00 101.52 ? 113 GLU D CG  1 
ATOM 5540 C CD  . GLU D 1 71  ? -9.497  34.048  56.738  1.00 101.52 ? 113 GLU D CD  1 
ATOM 5541 O OE1 . GLU D 1 71  ? -10.459 34.349  55.989  1.00 101.52 ? 113 GLU D OE1 1 
ATOM 5542 O OE2 . GLU D 1 71  ? -9.331  32.890  57.190  1.00 101.52 ? 113 GLU D OE2 1 
ATOM 5543 N N   . LEU D 1 72  ? -8.625  38.126  60.687  1.00 101.52 ? 114 LEU D N   1 
ATOM 5544 C CA  . LEU D 1 72  ? -9.230  39.136  61.552  1.00 101.52 ? 114 LEU D CA  1 
ATOM 5545 C C   . LEU D 1 72  ? -8.634  40.469  61.145  1.00 101.52 ? 114 LEU D C   1 
ATOM 5546 O O   . LEU D 1 72  ? -9.358  41.429  60.869  1.00 101.52 ? 114 LEU D O   1 
ATOM 5547 C CB  . LEU D 1 72  ? -8.903  38.887  63.037  1.00 101.52 ? 114 LEU D CB  1 
ATOM 5548 C CG  . LEU D 1 72  ? -8.506  40.075  63.945  1.00 101.52 ? 114 LEU D CG  1 
ATOM 5549 C CD1 . LEU D 1 72  ? -9.612  41.140  64.036  1.00 101.52 ? 114 LEU D CD1 1 
ATOM 5550 C CD2 . LEU D 1 72  ? -8.150  39.565  65.340  1.00 101.52 ? 114 LEU D CD2 1 
ATOM 5551 N N   . TYR D 1 73  ? -7.304  40.502  61.107  1.00 101.52 ? 115 TYR D N   1 
ATOM 5552 C CA  . TYR D 1 73  ? -6.566  41.704  60.755  1.00 101.52 ? 115 TYR D CA  1 
ATOM 5553 C C   . TYR D 1 73  ? -7.131  42.258  59.460  1.00 101.52 ? 115 TYR D C   1 
ATOM 5554 O O   . TYR D 1 73  ? -7.839  43.265  59.474  1.00 101.52 ? 115 TYR D O   1 
ATOM 5555 C CB  . TYR D 1 73  ? -5.082  41.366  60.583  1.00 101.52 ? 115 TYR D CB  1 
ATOM 5556 C CG  . TYR D 1 73  ? -4.101  42.489  60.884  1.00 101.52 ? 115 TYR D CG  1 
ATOM 5557 C CD1 . TYR D 1 73  ? -3.856  43.505  59.964  1.00 101.52 ? 115 TYR D CD1 1 
ATOM 5558 C CD2 . TYR D 1 73  ? -3.355  42.483  62.062  1.00 101.52 ? 115 TYR D CD2 1 
ATOM 5559 C CE1 . TYR D 1 73  ? -2.881  44.493  60.209  1.00 101.52 ? 115 TYR D CE1 1 
ATOM 5560 C CE2 . TYR D 1 73  ? -2.380  43.463  62.317  1.00 101.52 ? 115 TYR D CE2 1 
ATOM 5561 C CZ  . TYR D 1 73  ? -2.145  44.461  61.383  1.00 101.52 ? 115 TYR D CZ  1 
ATOM 5562 O OH  . TYR D 1 73  ? -1.173  45.420  61.615  1.00 101.52 ? 115 TYR D OH  1 
ATOM 5563 N N   . ARG D 1 74  ? -6.895  41.532  58.366  1.00 101.52 ? 116 ARG D N   1 
ATOM 5564 C CA  . ARG D 1 74  ? -7.346  41.932  57.029  1.00 101.52 ? 116 ARG D CA  1 
ATOM 5565 C C   . ARG D 1 74  ? -8.706  42.592  56.995  1.00 101.52 ? 116 ARG D C   1 
ATOM 5566 O O   . ARG D 1 74  ? -8.823  43.762  56.645  1.00 101.52 ? 116 ARG D O   1 
ATOM 5567 C CB  . ARG D 1 74  ? -7.369  40.738  56.049  1.00 101.52 ? 116 ARG D CB  1 
ATOM 5568 C CG  . ARG D 1 74  ? -8.002  41.062  54.657  1.00 101.52 ? 116 ARG D CG  1 
ATOM 5569 C CD  . ARG D 1 74  ? -8.159  39.825  53.728  1.00 101.52 ? 116 ARG D CD  1 
ATOM 5570 N NE  . ARG D 1 74  ? -8.872  40.128  52.475  1.00 101.52 ? 116 ARG D NE  1 
ATOM 5571 C CZ  . ARG D 1 74  ? -8.958  39.307  51.421  1.00 101.52 ? 116 ARG D CZ  1 
ATOM 5572 N NH1 . ARG D 1 74  ? -8.376  38.109  51.440  1.00 101.52 ? 116 ARG D NH1 1 
ATOM 5573 N NH2 . ARG D 1 74  ? -9.626  39.688  50.335  1.00 101.52 ? 116 ARG D NH2 1 
ATOM 5574 N N   . GLN D 1 75  ? -9.730  41.832  57.360  1.00 101.52 ? 117 GLN D N   1 
ATOM 5575 C CA  . GLN D 1 75  ? -11.096 42.330  57.336  1.00 101.52 ? 117 GLN D CA  1 
ATOM 5576 C C   . GLN D 1 75  ? -11.318 43.602  58.111  1.00 101.52 ? 117 GLN D C   1 
ATOM 5577 O O   . GLN D 1 75  ? -12.111 44.444  57.699  1.00 101.52 ? 117 GLN D O   1 
ATOM 5578 C CB  . GLN D 1 75  ? -12.070 41.256  57.800  1.00 101.52 ? 117 GLN D CB  1 
ATOM 5579 C CG  . GLN D 1 75  ? -12.332 40.201  56.737  1.00 101.52 ? 117 GLN D CG  1 
ATOM 5580 C CD  . GLN D 1 75  ? -11.975 38.802  57.194  1.00 101.52 ? 117 GLN D CD  1 
ATOM 5581 O OE1 . GLN D 1 75  ? -12.387 38.363  58.273  1.00 101.52 ? 117 GLN D OE1 1 
ATOM 5582 N NE2 . GLN D 1 75  ? -11.219 38.084  56.367  1.00 101.52 ? 117 GLN D NE2 1 
ATOM 5583 N N   . LYS D 1 76  ? -10.607 43.767  59.216  1.00 101.52 ? 118 LYS D N   1 
ATOM 5584 C CA  . LYS D 1 76  ? -10.782 44.975  59.988  1.00 101.52 ? 118 LYS D CA  1 
ATOM 5585 C C   . LYS D 1 76  ? -10.047 46.150  59.340  1.00 101.52 ? 118 LYS D C   1 
ATOM 5586 O O   . LYS D 1 76  ? -10.076 47.251  59.866  1.00 101.52 ? 118 LYS D O   1 
ATOM 5587 C CB  . LYS D 1 76  ? -10.323 44.764  61.434  1.00 101.52 ? 118 LYS D CB  1 
ATOM 5588 C CG  . LYS D 1 76  ? -11.380 45.193  62.462  1.00 101.52 ? 118 LYS D CG  1 
ATOM 5589 C CD  . LYS D 1 76  ? -10.931 45.073  63.928  1.00 101.52 ? 118 LYS D CD  1 
ATOM 5590 C CE  . LYS D 1 76  ? -12.011 45.602  64.895  1.00 101.52 ? 118 LYS D CE  1 
ATOM 5591 N NZ  . LYS D 1 76  ? -11.649 45.520  66.348  1.00 101.52 ? 118 LYS D NZ  1 
ATOM 5592 N N   . VAL D 1 77  ? -9.485  45.939  58.150  1.00 101.52 ? 119 VAL D N   1 
ATOM 5593 C CA  . VAL D 1 77  ? -8.713  46.967  57.438  1.00 101.52 ? 119 VAL D CA  1 
ATOM 5594 C C   . VAL D 1 77  ? -9.306  47.493  56.146  1.00 101.52 ? 119 VAL D C   1 
ATOM 5595 O O   . VAL D 1 77  ? -9.255  48.687  55.868  1.00 101.52 ? 119 VAL D O   1 
ATOM 5596 C CB  . VAL D 1 77  ? -7.335  46.424  57.045  1.00 101.52 ? 119 VAL D CB  1 
ATOM 5597 C CG1 . VAL D 1 77  ? -6.588  47.434  56.153  1.00 101.52 ? 119 VAL D CG1 1 
ATOM 5598 C CG2 . VAL D 1 77  ? -6.546  46.070  58.283  1.00 101.52 ? 119 VAL D CG2 1 
ATOM 5599 N N   . GLU D 1 78  ? -9.769  46.572  55.311  1.00 101.52 ? 120 GLU D N   1 
ATOM 5600 C CA  . GLU D 1 78  ? -10.351 46.895  54.015  1.00 101.52 ? 120 GLU D CA  1 
ATOM 5601 C C   . GLU D 1 78  ? -10.994 48.267  53.840  1.00 101.52 ? 120 GLU D C   1 
ATOM 5602 O O   . GLU D 1 78  ? -10.758 48.929  52.826  1.00 101.52 ? 120 GLU D O   1 
ATOM 5603 C CB  . GLU D 1 78  ? -11.334 45.805  53.608  1.00 101.52 ? 120 GLU D CB  1 
ATOM 5604 C CG  . GLU D 1 78  ? -10.700 44.665  52.818  1.00 101.52 ? 120 GLU D CG  1 
ATOM 5605 C CD  . GLU D 1 78  ? -10.860 44.836  51.314  1.00 101.52 ? 120 GLU D CD  1 
ATOM 5606 O OE1 . GLU D 1 78  ? -10.883 45.997  50.839  1.00 101.52 ? 120 GLU D OE1 1 
ATOM 5607 O OE2 . GLU D 1 78  ? -10.957 43.808  50.606  1.00 101.52 ? 120 GLU D OE2 1 
ATOM 5608 N N   . PRO D 1 79  ? -11.822 48.716  54.792  1.00 105.45 ? 121 PRO D N   1 
ATOM 5609 C CA  . PRO D 1 79  ? -12.464 50.026  54.674  1.00 105.45 ? 121 PRO D CA  1 
ATOM 5610 C C   . PRO D 1 79  ? -11.496 51.169  54.367  1.00 105.45 ? 121 PRO D C   1 
ATOM 5611 O O   . PRO D 1 79  ? -11.857 52.142  53.717  1.00 105.45 ? 121 PRO D O   1 
ATOM 5612 C CB  . PRO D 1 79  ? -13.140 50.211  56.033  1.00 105.45 ? 121 PRO D CB  1 
ATOM 5613 C CG  . PRO D 1 79  ? -12.404 49.256  56.935  1.00 105.45 ? 121 PRO D CG  1 
ATOM 5614 C CD  . PRO D 1 79  ? -12.255 48.067  56.047  1.00 105.45 ? 121 PRO D CD  1 
ATOM 5615 N N   . LEU D 1 80  ? -10.271 51.055  54.858  1.00 105.45 ? 122 LEU D N   1 
ATOM 5616 C CA  . LEU D 1 80  ? -9.275  52.084  54.618  1.00 105.45 ? 122 LEU D CA  1 
ATOM 5617 C C   . LEU D 1 80  ? -8.882  52.098  53.157  1.00 105.45 ? 122 LEU D C   1 
ATOM 5618 O O   . LEU D 1 80  ? -8.570  53.150  52.601  1.00 105.45 ? 122 LEU D O   1 
ATOM 5619 C CB  . LEU D 1 80  ? -8.075  51.846  55.514  1.00 105.45 ? 122 LEU D CB  1 
ATOM 5620 C CG  . LEU D 1 80  ? -8.555  51.859  56.969  1.00 105.45 ? 122 LEU D CG  1 
ATOM 5621 C CD1 . LEU D 1 80  ? -7.401  51.572  57.906  1.00 105.45 ? 122 LEU D CD1 1 
ATOM 5622 C CD2 . LEU D 1 80  ? -9.224  53.198  57.308  1.00 105.45 ? 122 LEU D CD2 1 
ATOM 5623 N N   . ARG D 1 81  ? -8.952  50.931  52.527  1.00 105.45 ? 123 ARG D N   1 
ATOM 5624 C CA  . ARG D 1 81  ? -8.638  50.831  51.116  1.00 105.45 ? 123 ARG D CA  1 
ATOM 5625 C C   . ARG D 1 81  ? -9.546  51.781  50.370  1.00 105.45 ? 123 ARG D C   1 
ATOM 5626 O O   . ARG D 1 81  ? -9.199  52.291  49.324  1.00 105.45 ? 123 ARG D O   1 
ATOM 5627 C CB  . ARG D 1 81  ? -8.864  49.421  50.609  1.00 105.45 ? 123 ARG D CB  1 
ATOM 5628 C CG  . ARG D 1 81  ? -8.056  48.361  51.304  1.00 105.45 ? 123 ARG D CG  1 
ATOM 5629 C CD  . ARG D 1 81  ? -7.716  47.308  50.284  1.00 105.45 ? 123 ARG D CD  1 
ATOM 5630 N NE  . ARG D 1 81  ? -7.525  45.984  50.864  1.00 105.45 ? 123 ARG D NE  1 
ATOM 5631 C CZ  . ARG D 1 81  ? -7.858  44.852  50.250  1.00 105.45 ? 123 ARG D CZ  1 
ATOM 5632 N NH1 . ARG D 1 81  ? -8.393  44.873  49.031  1.00 105.45 ? 123 ARG D NH1 1 
ATOM 5633 N NH2 . ARG D 1 81  ? -7.694  43.693  50.871  1.00 105.45 ? 123 ARG D NH2 1 
ATOM 5634 N N   . ALA D 1 82  ? -10.713 52.021  50.936  1.00 105.45 ? 124 ALA D N   1 
ATOM 5635 C CA  . ALA D 1 82  ? -11.658 52.926  50.330  1.00 105.45 ? 124 ALA D CA  1 
ATOM 5636 C C   . ALA D 1 82  ? -11.306 54.357  50.681  1.00 105.45 ? 124 ALA D C   1 
ATOM 5637 O O   . ALA D 1 82  ? -11.018 55.148  49.790  1.00 105.45 ? 124 ALA D O   1 
ATOM 5638 C CB  . ALA D 1 82  ? -13.042 52.597  50.793  1.00 105.45 ? 124 ALA D CB  1 
ATOM 5639 N N   . GLU D 1 83  ? -11.263 54.665  51.979  1.00 105.45 ? 125 GLU D N   1 
ATOM 5640 C CA  . GLU D 1 83  ? -10.956 56.019  52.436  1.00 105.45 ? 125 GLU D CA  1 
ATOM 5641 C C   . GLU D 1 83  ? -9.741  56.562  51.727  1.00 105.45 ? 125 GLU D C   1 
ATOM 5642 O O   . GLU D 1 83  ? -9.632  57.766  51.486  1.00 105.45 ? 125 GLU D O   1 
ATOM 5643 C CB  . GLU D 1 83  ? -10.743 56.081  53.953  1.00 105.45 ? 125 GLU D CB  1 
ATOM 5644 C CG  . GLU D 1 83  ? -10.673 57.526  54.485  1.00 105.45 ? 125 GLU D CG  1 
ATOM 5645 C CD  . GLU D 1 83  ? -10.873 57.645  55.995  1.00 105.45 ? 125 GLU D CD  1 
ATOM 5646 O OE1 . GLU D 1 83  ? -11.671 56.871  56.572  1.00 105.45 ? 125 GLU D OE1 1 
ATOM 5647 O OE2 . GLU D 1 83  ? -10.246 58.539  56.604  1.00 105.45 ? 125 GLU D OE2 1 
ATOM 5648 N N   . LEU D 1 84  ? -8.846  55.659  51.350  1.00 105.45 ? 126 LEU D N   1 
ATOM 5649 C CA  . LEU D 1 84  ? -7.649  56.064  50.660  1.00 105.45 ? 126 LEU D CA  1 
ATOM 5650 C C   . LEU D 1 84  ? -7.813  56.010  49.153  1.00 105.45 ? 126 LEU D C   1 
ATOM 5651 O O   . LEU D 1 84  ? -7.511  56.983  48.476  1.00 105.45 ? 126 LEU D O   1 
ATOM 5652 C CB  . LEU D 1 84  ? -6.468  55.212  51.111  1.00 105.45 ? 126 LEU D CB  1 
ATOM 5653 C CG  . LEU D 1 84  ? -5.699  54.363  50.104  1.00 105.45 ? 126 LEU D CG  1 
ATOM 5654 C CD1 . LEU D 1 84  ? -4.359  54.029  50.685  1.00 105.45 ? 126 LEU D CD1 1 
ATOM 5655 C CD2 . LEU D 1 84  ? -6.452  53.115  49.748  1.00 105.45 ? 126 LEU D CD2 1 
ATOM 5656 N N   . GLN D 1 85  ? -8.350  54.906  48.639  1.00 105.45 ? 127 GLN D N   1 
ATOM 5657 C CA  . GLN D 1 85  ? -8.511  54.735  47.196  1.00 105.45 ? 127 GLN D CA  1 
ATOM 5658 C C   . GLN D 1 85  ? -9.280  55.868  46.546  1.00 105.45 ? 127 GLN D C   1 
ATOM 5659 O O   . GLN D 1 85  ? -8.990  56.256  45.412  1.00 105.45 ? 127 GLN D O   1 
ATOM 5660 C CB  . GLN D 1 85  ? -9.189  53.407  46.882  1.00 105.45 ? 127 GLN D CB  1 
ATOM 5661 C CG  . GLN D 1 85  ? -9.081  52.965  45.436  1.00 105.45 ? 127 GLN D CG  1 
ATOM 5662 C CD  . GLN D 1 85  ? -9.121  51.449  45.290  1.00 105.45 ? 127 GLN D CD  1 
ATOM 5663 O OE1 . GLN D 1 85  ? -8.924  50.711  46.263  1.00 105.45 ? 127 GLN D OE1 1 
ATOM 5664 N NE2 . GLN D 1 85  ? -9.361  50.974  44.070  1.00 105.45 ? 127 GLN D NE2 1 
ATOM 5665 N N   . GLU D 1 86  ? -10.238 56.411  47.292  1.00 105.45 ? 128 GLU D N   1 
ATOM 5666 C CA  . GLU D 1 86  ? -11.074 57.521  46.834  1.00 105.45 ? 128 GLU D CA  1 
ATOM 5667 C C   . GLU D 1 86  ? -10.201 58.765  46.613  1.00 105.45 ? 128 GLU D C   1 
ATOM 5668 O O   . GLU D 1 86  ? -10.088 59.272  45.489  1.00 105.45 ? 128 GLU D O   1 
ATOM 5669 C CB  . GLU D 1 86  ? -12.177 57.844  47.876  1.00 105.45 ? 128 GLU D CB  1 
ATOM 5670 C CG  . GLU D 1 86  ? -13.647 57.629  47.378  1.00 105.45 ? 128 GLU D CG  1 
ATOM 5671 C CD  . GLU D 1 86  ? -14.740 58.301  48.255  1.00 105.45 ? 128 GLU D CD  1 
ATOM 5672 O OE1 . GLU D 1 86  ? -14.500 59.414  48.783  1.00 105.45 ? 128 GLU D OE1 1 
ATOM 5673 O OE2 . GLU D 1 86  ? -15.857 57.731  48.384  1.00 105.45 ? 128 GLU D OE2 1 
ATOM 5674 N N   . GLY D 1 87  ? -9.572  59.230  47.695  1.00 105.45 ? 129 GLY D N   1 
ATOM 5675 C CA  . GLY D 1 87  ? -8.717  60.405  47.639  1.00 105.45 ? 129 GLY D CA  1 
ATOM 5676 C C   . GLY D 1 87  ? -7.646  60.296  46.571  1.00 105.45 ? 129 GLY D C   1 
ATOM 5677 O O   . GLY D 1 87  ? -7.264  61.308  45.972  1.00 105.45 ? 129 GLY D O   1 
ATOM 5678 N N   . ALA D 1 88  ? -7.195  59.062  46.327  1.00 105.45 ? 130 ALA D N   1 
ATOM 5679 C CA  . ALA D 1 88  ? -6.168  58.752  45.330  1.00 105.45 ? 130 ALA D CA  1 
ATOM 5680 C C   . ALA D 1 88  ? -6.641  59.065  43.917  1.00 105.45 ? 130 ALA D C   1 
ATOM 5681 O O   . ALA D 1 88  ? -6.002  59.833  43.201  1.00 105.45 ? 130 ALA D O   1 
ATOM 5682 C CB  . ALA D 1 88  ? -5.769  57.292  45.425  1.00 105.45 ? 130 ALA D CB  1 
ATOM 5683 N N   . ARG D 1 89  ? -7.738  58.440  43.504  1.00 105.45 ? 131 ARG D N   1 
ATOM 5684 C CA  . ARG D 1 89  ? -8.287  58.673  42.170  1.00 105.45 ? 131 ARG D CA  1 
ATOM 5685 C C   . ARG D 1 89  ? -8.573  60.160  41.937  1.00 105.45 ? 131 ARG D C   1 
ATOM 5686 O O   . ARG D 1 89  ? -8.460  60.640  40.811  1.00 105.45 ? 131 ARG D O   1 
ATOM 5687 C CB  . ARG D 1 89  ? -9.574  57.857  41.966  1.00 105.45 ? 131 ARG D CB  1 
ATOM 5688 C CG  . ARG D 1 89  ? -10.275 58.029  40.599  1.00 105.45 ? 131 ARG D CG  1 
ATOM 5689 C CD  . ARG D 1 89  ? -11.618 57.251  40.549  1.00 105.45 ? 131 ARG D CD  1 
ATOM 5690 N NE  . ARG D 1 89  ? -12.320 57.343  39.256  1.00 105.45 ? 131 ARG D NE  1 
ATOM 5691 C CZ  . ARG D 1 89  ? -13.525 56.820  38.994  1.00 105.45 ? 131 ARG D CZ  1 
ATOM 5692 N NH1 . ARG D 1 89  ? -14.204 56.153  39.928  1.00 105.45 ? 131 ARG D NH1 1 
ATOM 5693 N NH2 . ARG D 1 89  ? -14.052 56.940  37.777  1.00 105.45 ? 131 ARG D NH2 1 
ATOM 5694 N N   . GLN D 1 90  ? -8.913  60.883  43.006  1.00 105.45 ? 132 GLN D N   1 
ATOM 5695 C CA  . GLN D 1 90  ? -9.227  62.311  42.923  1.00 105.45 ? 132 GLN D CA  1 
ATOM 5696 C C   . GLN D 1 90  ? -8.086  63.078  42.271  1.00 105.45 ? 132 GLN D C   1 
ATOM 5697 O O   . GLN D 1 90  ? -8.212  63.565  41.149  1.00 105.45 ? 132 GLN D O   1 
ATOM 5698 C CB  . GLN D 1 90  ? -9.525  62.900  44.319  1.00 105.45 ? 132 GLN D CB  1 
ATOM 5699 C CG  . GLN D 1 90  ? -11.020 63.111  44.646  1.00 105.45 ? 132 GLN D CG  1 
ATOM 5700 C CD  . GLN D 1 90  ? -11.261 63.879  45.953  1.00 105.45 ? 132 GLN D CD  1 
ATOM 5701 O OE1 . GLN D 1 90  ? -10.714 64.968  46.165  1.00 105.45 ? 132 GLN D OE1 1 
ATOM 5702 N NE2 . GLN D 1 90  ? -12.109 63.322  46.821  1.00 105.45 ? 132 GLN D NE2 1 
ATOM 5703 N N   . LYS D 1 91  ? -6.957  63.138  42.965  1.00 105.45 ? 133 LYS D N   1 
ATOM 5704 C CA  . LYS D 1 91  ? -5.799  63.849  42.465  1.00 105.45 ? 133 LYS D CA  1 
ATOM 5705 C C   . LYS D 1 91  ? -5.308  63.301  41.128  1.00 105.45 ? 133 LYS D C   1 
ATOM 5706 O O   . LYS D 1 91  ? -4.698  64.026  40.350  1.00 105.45 ? 133 LYS D O   1 
ATOM 5707 C CB  . LYS D 1 91  ? -4.686  63.830  43.510  1.00 105.45 ? 133 LYS D CB  1 
ATOM 5708 C CG  . LYS D 1 91  ? -5.092  64.385  44.881  1.00 105.45 ? 133 LYS D CG  1 
ATOM 5709 C CD  . LYS D 1 91  ? -3.952  64.239  45.881  1.00 105.45 ? 133 LYS D CD  1 
ATOM 5710 C CE  . LYS D 1 91  ? -4.306  64.782  47.259  1.00 105.45 ? 133 LYS D CE  1 
ATOM 5711 N NZ  . LYS D 1 91  ? -3.163  64.634  48.216  1.00 105.45 ? 133 LYS D NZ  1 
ATOM 5712 N N   . LEU D 1 92  ? -5.628  62.040  40.847  1.00 105.45 ? 134 LEU D N   1 
ATOM 5713 C CA  . LEU D 1 92  ? -5.222  61.381  39.606  1.00 105.45 ? 134 LEU D CA  1 
ATOM 5714 C C   . LEU D 1 92  ? -5.407  62.230  38.346  1.00 105.45 ? 134 LEU D C   1 
ATOM 5715 O O   . LEU D 1 92  ? -4.503  62.324  37.514  1.00 105.45 ? 134 LEU D O   1 
ATOM 5716 C CB  . LEU D 1 92  ? -5.976  60.068  39.470  1.00 105.45 ? 134 LEU D CB  1 
ATOM 5717 C CG  . LEU D 1 92  ? -6.159  59.450  38.089  1.00 105.45 ? 134 LEU D CG  1 
ATOM 5718 C CD1 . LEU D 1 92  ? -4.830  59.224  37.395  1.00 105.45 ? 134 LEU D CD1 1 
ATOM 5719 C CD2 . LEU D 1 92  ? -6.911  58.152  38.254  1.00 105.45 ? 134 LEU D CD2 1 
ATOM 5720 N N   . HIS D 1 93  ? -6.577  62.835  38.198  1.00 105.45 ? 135 HIS D N   1 
ATOM 5721 C CA  . HIS D 1 93  ? -6.828  63.659  37.029  1.00 105.45 ? 135 HIS D CA  1 
ATOM 5722 C C   . HIS D 1 93  ? -6.339  65.083  37.228  1.00 105.45 ? 135 HIS D C   1 
ATOM 5723 O O   . HIS D 1 93  ? -6.007  65.772  36.270  1.00 105.45 ? 135 HIS D O   1 
ATOM 5724 C CB  . HIS D 1 93  ? -8.292  63.583  36.633  1.00 105.45 ? 135 HIS D CB  1 
ATOM 5725 C CG  . HIS D 1 93  ? -8.734  62.189  36.337  1.00 105.45 ? 135 HIS D CG  1 
ATOM 5726 N ND1 . HIS D 1 93  ? -8.911  61.242  37.322  1.00 105.45 ? 135 HIS D ND1 1 
ATOM 5727 C CD2 . HIS D 1 93  ? -8.973  61.561  35.161  1.00 105.45 ? 135 HIS D CD2 1 
ATOM 5728 C CE1 . HIS D 1 93  ? -9.238  60.087  36.767  1.00 105.45 ? 135 HIS D CE1 1 
ATOM 5729 N NE2 . HIS D 1 93  ? -9.282  60.253  35.454  1.00 105.45 ? 135 HIS D NE2 1 
ATOM 5730 N N   . GLU D 1 94  ? -6.232  65.491  38.488  1.00 105.45 ? 136 GLU D N   1 
ATOM 5731 C CA  . GLU D 1 94  ? -5.719  66.809  38.836  1.00 105.45 ? 136 GLU D CA  1 
ATOM 5732 C C   . GLU D 1 94  ? -4.381  66.934  38.102  1.00 105.45 ? 136 GLU D C   1 
ATOM 5733 O O   . GLU D 1 94  ? -4.107  67.918  37.449  1.00 105.45 ? 136 GLU D O   1 
ATOM 5734 C CB  . GLU D 1 94  ? -5.524  66.862  40.356  1.00 105.45 ? 136 GLU D CB  1 
ATOM 5735 C CG  . GLU D 1 94  ? -5.410  68.243  40.960  1.00 105.45 ? 136 GLU D CG  1 
ATOM 5736 C CD  . GLU D 1 94  ? -5.838  68.287  42.432  1.00 105.45 ? 136 GLU D CD  1 
ATOM 5737 O OE1 . GLU D 1 94  ? -6.295  67.255  42.980  1.00 105.45 ? 136 GLU D OE1 1 
ATOM 5738 O OE2 . GLU D 1 94  ? -5.736  69.376  43.036  1.00 105.45 ? 136 GLU D OE2 1 
ATOM 5739 N N   . LEU D 1 95  ? -3.692  65.810  38.015  1.00 105.45 ? 137 LEU D N   1 
ATOM 5740 C CA  . LEU D 1 95  ? -2.396  65.737  37.382  1.00 105.45 ? 137 LEU D CA  1 
ATOM 5741 C C   . LEU D 1 95  ? -2.473  65.179  35.961  1.00 105.45 ? 137 LEU D C   1 
ATOM 5742 O O   . LEU D 1 95  ? -1.715  65.585  35.098  1.00 105.45 ? 137 LEU D O   1 
ATOM 5743 C CB  . LEU D 1 95  ? -1.496  64.911  38.289  1.00 105.45 ? 137 LEU D CB  1 
ATOM 5744 C CG  . LEU D 1 95  ? -1.817  65.220  39.763  1.00 105.45 ? 137 LEU D CG  1 
ATOM 5745 C CD1 . LEU D 1 95  ? -1.184  64.192  40.666  1.00 105.45 ? 137 LEU D CD1 1 
ATOM 5746 C CD2 . LEU D 1 95  ? -1.421  66.649  40.161  1.00 105.45 ? 137 LEU D CD2 1 
ATOM 5747 N N   . GLN D 1 96  ? -3.412  64.280  35.700  1.00 105.45 ? 138 GLN D N   1 
ATOM 5748 C CA  . GLN D 1 96  ? -3.532  63.712  34.363  1.00 105.45 ? 138 GLN D CA  1 
ATOM 5749 C C   . GLN D 1 96  ? -3.962  64.787  33.388  1.00 105.45 ? 138 GLN D C   1 
ATOM 5750 O O   . GLN D 1 96  ? -3.421  64.896  32.292  1.00 105.45 ? 138 GLN D O   1 
ATOM 5751 C CB  . GLN D 1 96  ? -4.551  62.579  34.360  1.00 105.45 ? 138 GLN D CB  1 
ATOM 5752 C CG  . GLN D 1 96  ? -4.624  61.799  33.065  1.00 105.45 ? 138 GLN D CG  1 
ATOM 5753 C CD  . GLN D 1 96  ? -5.545  60.611  33.186  1.00 105.45 ? 138 GLN D CD  1 
ATOM 5754 O OE1 . GLN D 1 96  ? -6.329  60.520  34.128  1.00 105.45 ? 138 GLN D OE1 1 
ATOM 5755 N NE2 . GLN D 1 96  ? -5.442  59.682  32.248  1.00 105.45 ? 138 GLN D NE2 1 
ATOM 5756 N N   . GLU D 1 97  ? -4.894  65.620  33.830  1.00 105.45 ? 139 GLU D N   1 
ATOM 5757 C CA  . GLU D 1 97  ? -5.421  66.678  33.002  1.00 105.45 ? 139 GLU D CA  1 
ATOM 5758 C C   . GLU D 1 97  ? -4.825  68.071  33.214  1.00 105.45 ? 139 GLU D C   1 
ATOM 5759 O O   . GLU D 1 97  ? -4.875  68.893  32.302  1.00 105.45 ? 139 GLU D O   1 
ATOM 5760 C CB  . GLU D 1 97  ? -6.953  66.624  33.030  1.00 105.45 ? 139 GLU D CB  1 
ATOM 5761 C CG  . GLU D 1 97  ? -7.446  65.247  32.504  1.00 105.45 ? 139 GLU D CG  1 
ATOM 5762 C CD  . GLU D 1 97  ? -8.948  65.016  32.584  1.00 105.45 ? 139 GLU D CD  1 
ATOM 5763 O OE1 . GLU D 1 97  ? -9.697  65.942  32.964  1.00 105.45 ? 139 GLU D OE1 1 
ATOM 5764 O OE2 . GLU D 1 97  ? -9.377  63.887  32.254  1.00 105.45 ? 139 GLU D OE2 1 
ATOM 5765 N N   . LYS D 1 98  ? -4.239  68.347  34.379  1.00 105.45 ? 140 LYS D N   1 
ATOM 5766 C CA  . LYS D 1 98  ? -3.600  69.653  34.574  1.00 105.45 ? 140 LYS D CA  1 
ATOM 5767 C C   . LYS D 1 98  ? -2.216  69.553  33.957  1.00 105.45 ? 140 LYS D C   1 
ATOM 5768 O O   . LYS D 1 98  ? -1.668  70.540  33.481  1.00 105.45 ? 140 LYS D O   1 
ATOM 5769 C CB  . LYS D 1 98  ? -3.470  70.014  36.050  1.00 105.45 ? 140 LYS D CB  1 
ATOM 5770 C CG  . LYS D 1 98  ? -2.922  71.410  36.343  1.00 105.45 ? 140 LYS D CG  1 
ATOM 5771 C CD  . LYS D 1 98  ? -2.877  71.664  37.857  1.00 105.45 ? 140 LYS D CD  1 
ATOM 5772 C CE  . LYS D 1 98  ? -2.383  73.075  38.206  1.00 105.45 ? 140 LYS D CE  1 
ATOM 5773 N NZ  . LYS D 1 98  ? -2.181  73.267  39.682  1.00 105.45 ? 140 LYS D NZ  1 
ATOM 5774 N N   . LEU D 1 99  ? -1.656  68.349  33.964  1.00 105.45 ? 141 LEU D N   1 
ATOM 5775 C CA  . LEU D 1 99  ? -0.343  68.125  33.386  1.00 105.45 ? 141 LEU D CA  1 
ATOM 5776 C C   . LEU D 1 99  ? -0.442  67.914  31.892  1.00 105.45 ? 141 LEU D C   1 
ATOM 5777 O O   . LEU D 1 99  ? 0.366   68.446  31.144  1.00 105.45 ? 141 LEU D O   1 
ATOM 5778 C CB  . LEU D 1 99  ? 0.320   66.903  33.995  1.00 105.45 ? 141 LEU D CB  1 
ATOM 5779 C CG  . LEU D 1 99  ? 1.312   66.180  33.089  1.00 105.45 ? 141 LEU D CG  1 
ATOM 5780 C CD1 . LEU D 1 99  ? 2.596   66.976  32.999  1.00 105.45 ? 141 LEU D CD1 1 
ATOM 5781 C CD2 . LEU D 1 99  ? 1.556   64.794  33.623  1.00 105.45 ? 141 LEU D CD2 1 
ATOM 5782 N N   . SER D 1 100 ? -1.434  67.139  31.464  1.00 105.45 ? 142 SER D N   1 
ATOM 5783 C CA  . SER D 1 100 ? -1.627  66.834  30.050  1.00 105.45 ? 142 SER D CA  1 
ATOM 5784 C C   . SER D 1 100 ? -1.254  67.962  29.071  1.00 105.45 ? 142 SER D C   1 
ATOM 5785 O O   . SER D 1 100 ? -0.524  67.719  28.116  1.00 105.45 ? 142 SER D O   1 
ATOM 5786 C CB  . SER D 1 100 ? -3.066  66.364  29.800  1.00 105.45 ? 142 SER D CB  1 
ATOM 5787 O OG  . SER D 1 100 ? -3.128  65.374  28.786  1.00 105.45 ? 142 SER D OG  1 
ATOM 5788 N N   . PRO D 1 101 ? -1.679  69.214  29.339  1.00 63.88  ? 143 PRO D N   1 
ATOM 5789 C CA  . PRO D 1 101 ? -1.401  70.390  28.489  1.00 63.88  ? 143 PRO D CA  1 
ATOM 5790 C C   . PRO D 1 101 ? 0.060   70.795  28.332  1.00 63.88  ? 143 PRO D C   1 
ATOM 5791 O O   . PRO D 1 101 ? 0.483   71.320  27.299  1.00 63.88  ? 143 PRO D O   1 
ATOM 5792 C CB  . PRO D 1 101 ? -2.186  71.497  29.191  1.00 63.88  ? 143 PRO D CB  1 
ATOM 5793 C CG  . PRO D 1 101 ? -2.169  71.072  30.611  1.00 63.88  ? 143 PRO D CG  1 
ATOM 5794 C CD  . PRO D 1 101 ? -2.501  69.614  30.492  1.00 63.88  ? 143 PRO D CD  1 
ATOM 5795 N N   . LEU D 1 102 ? 0.817   70.598  29.391  1.00 63.88  ? 144 LEU D N   1 
ATOM 5796 C CA  . LEU D 1 102 ? 2.211   70.951  29.376  1.00 63.88  ? 144 LEU D CA  1 
ATOM 5797 C C   . LEU D 1 102 ? 3.000   69.860  28.663  1.00 63.88  ? 144 LEU D C   1 
ATOM 5798 O O   . LEU D 1 102 ? 4.006   70.137  28.020  1.00 63.88  ? 144 LEU D O   1 
ATOM 5799 C CB  . LEU D 1 102 ? 2.653   71.209  30.809  1.00 63.88  ? 144 LEU D CB  1 
ATOM 5800 C CG  . LEU D 1 102 ? 1.636   72.158  31.482  1.00 63.88  ? 144 LEU D CG  1 
ATOM 5801 C CD1 . LEU D 1 102 ? 2.079   72.471  32.904  1.00 63.88  ? 144 LEU D CD1 1 
ATOM 5802 C CD2 . LEU D 1 102 ? 1.430   73.457  30.656  1.00 63.88  ? 144 LEU D CD2 1 
ATOM 5803 N N   . GLY D 1 103 ? 2.474   68.639  28.679  1.00 63.88  ? 145 GLY D N   1 
ATOM 5804 C CA  . GLY D 1 103 ? 3.138   67.545  27.989  1.00 63.88  ? 145 GLY D CA  1 
ATOM 5805 C C   . GLY D 1 103 ? 3.154   67.786  26.482  1.00 63.88  ? 145 GLY D C   1 
ATOM 5806 O O   . GLY D 1 103 ? 3.916   67.155  25.739  1.00 63.88  ? 145 GLY D O   1 
ATOM 5807 N N   . GLU D 1 104 ? 2.298   68.695  26.026  1.00 63.88  ? 146 GLU D N   1 
ATOM 5808 C CA  . GLU D 1 104 ? 2.220   69.029  24.610  1.00 63.88  ? 146 GLU D CA  1 
ATOM 5809 C C   . GLU D 1 104 ? 3.126   70.228  24.403  1.00 63.88  ? 146 GLU D C   1 
ATOM 5810 O O   . GLU D 1 104 ? 3.844   70.338  23.403  1.00 63.88  ? 146 GLU D O   1 
ATOM 5811 C CB  . GLU D 1 104 ? 0.778   69.376  24.239  1.00 63.88  ? 146 GLU D CB  1 
ATOM 5812 C CG  . GLU D 1 104 ? -0.250  68.361  24.742  1.00 63.88  ? 146 GLU D CG  1 
ATOM 5813 C CD  . GLU D 1 104 ? -0.135  67.002  24.067  1.00 63.88  ? 146 GLU D CD  1 
ATOM 5814 O OE1 . GLU D 1 104 ? -0.214  66.959  22.815  1.00 63.88  ? 146 GLU D OE1 1 
ATOM 5815 O OE2 . GLU D 1 104 ? 0.012   65.984  24.789  1.00 63.88  ? 146 GLU D OE2 1 
ATOM 5816 N N   . GLU D 1 105 ? 3.100   71.096  25.408  1.00 63.88  ? 147 GLU D N   1 
ATOM 5817 C CA  . GLU D 1 105 ? 3.887   72.307  25.439  1.00 63.88  ? 147 GLU D CA  1 
ATOM 5818 C C   . GLU D 1 105 ? 5.264   71.969  24.884  1.00 63.88  ? 147 GLU D C   1 
ATOM 5819 O O   . GLU D 1 105 ? 5.663   72.461  23.839  1.00 63.88  ? 147 GLU D O   1 
ATOM 5820 C CB  . GLU D 1 105 ? 3.957   72.790  26.887  1.00 63.88  ? 147 GLU D CB  1 
ATOM 5821 C CG  . GLU D 1 105 ? 3.751   74.284  27.084  1.00 63.88  ? 147 GLU D CG  1 
ATOM 5822 C CD  . GLU D 1 105 ? 5.062   75.054  27.082  1.00 63.88  ? 147 GLU D CD  1 
ATOM 5823 O OE1 . GLU D 1 105 ? 6.124   74.404  26.952  1.00 63.88  ? 147 GLU D OE1 1 
ATOM 5824 O OE2 . GLU D 1 105 ? 5.033   76.302  27.220  1.00 63.88  ? 147 GLU D OE2 1 
ATOM 5825 N N   . MET D 1 106 ? 5.920   71.013  25.510  1.00 63.88  ? 148 MET D N   1 
ATOM 5826 C CA  . MET D 1 106 ? 7.220   70.606  25.049  1.00 63.88  ? 148 MET D CA  1 
ATOM 5827 C C   . MET D 1 106 ? 7.072   69.756  23.821  1.00 63.88  ? 148 MET D C   1 
ATOM 5828 O O   . MET D 1 106 ? 7.892   69.854  22.920  1.00 63.88  ? 148 MET D O   1 
ATOM 5829 C CB  . MET D 1 106 ? 7.903   69.807  26.121  1.00 63.88  ? 148 MET D CB  1 
ATOM 5830 C CG  . MET D 1 106 ? 7.903   70.510  27.445  1.00 63.88  ? 148 MET D CG  1 
ATOM 5831 S SD  . MET D 1 106 ? 8.387   69.329  28.713  1.00 63.88  ? 148 MET D SD  1 
ATOM 5832 C CE  . MET D 1 106 ? 10.250  69.450  28.631  1.00 63.88  ? 148 MET D CE  1 
ATOM 5833 N N   . ARG D 1 107 ? 6.021   68.932  23.781  1.00 63.88  ? 149 ARG D N   1 
ATOM 5834 C CA  . ARG D 1 107 ? 5.780   68.044  22.645  1.00 63.88  ? 149 ARG D CA  1 
ATOM 5835 C C   . ARG D 1 107 ? 6.071   68.780  21.368  1.00 63.88  ? 149 ARG D C   1 
ATOM 5836 O O   . ARG D 1 107 ? 6.595   68.222  20.409  1.00 63.88  ? 149 ARG D O   1 
ATOM 5837 C CB  . ARG D 1 107 ? 4.338   67.548  22.619  1.00 63.88  ? 149 ARG D CB  1 
ATOM 5838 C CG  . ARG D 1 107 ? 3.851   67.090  21.245  1.00 63.88  ? 149 ARG D CG  1 
ATOM 5839 C CD  . ARG D 1 107 ? 2.499   66.417  21.336  1.00 63.88  ? 149 ARG D CD  1 
ATOM 5840 N NE  . ARG D 1 107 ? 2.553   65.266  22.241  1.00 63.88  ? 149 ARG D NE  1 
ATOM 5841 C CZ  . ARG D 1 107 ? 1.594   64.347  22.358  1.00 63.88  ? 149 ARG D CZ  1 
ATOM 5842 N NH1 . ARG D 1 107 ? 0.493   64.438  21.623  1.00 63.88  ? 149 ARG D NH1 1 
ATOM 5843 N NH2 . ARG D 1 107 ? 1.730   63.332  23.212  1.00 63.88  ? 149 ARG D NH2 1 
ATOM 5844 N N   . ASP D 1 108 ? 5.762   70.062  21.376  1.00 63.88  ? 150 ASP D N   1 
ATOM 5845 C CA  . ASP D 1 108 ? 6.009   70.848  20.204  1.00 63.88  ? 150 ASP D CA  1 
ATOM 5846 C C   . ASP D 1 108 ? 7.244   71.700  20.406  1.00 63.88  ? 150 ASP D C   1 
ATOM 5847 O O   . ASP D 1 108 ? 8.005   71.919  19.465  1.00 63.88  ? 150 ASP D O   1 
ATOM 5848 C CB  . ASP D 1 108 ? 4.758   71.641  19.879  1.00 63.88  ? 150 ASP D CB  1 
ATOM 5849 C CG  . ASP D 1 108 ? 3.549   70.737  19.729  1.00 63.88  ? 150 ASP D CG  1 
ATOM 5850 O OD1 . ASP D 1 108 ? 3.351   70.184  18.626  1.00 63.88  ? 150 ASP D OD1 1 
ATOM 5851 O OD2 . ASP D 1 108 ? 2.830   70.525  20.732  1.00 63.88  ? 150 ASP D OD2 1 
ATOM 5852 N N   . ARG D 1 109 ? 7.506   72.080  21.655  1.00 63.88  ? 151 ARG D N   1 
ATOM 5853 C CA  . ARG D 1 109 ? 8.676   72.899  21.975  1.00 63.88  ? 151 ARG D CA  1 
ATOM 5854 C C   . ARG D 1 109 ? 9.963   72.250  21.505  1.00 63.88  ? 151 ARG D C   1 
ATOM 5855 O O   . ARG D 1 109 ? 10.918  72.931  21.139  1.00 63.88  ? 151 ARG D O   1 
ATOM 5856 C CB  . ARG D 1 109 ? 8.750   73.225  23.471  1.00 63.88  ? 151 ARG D CB  1 
ATOM 5857 C CG  . ARG D 1 109 ? 7.992   74.497  23.865  1.00 63.88  ? 151 ARG D CG  1 
ATOM 5858 C CD  . ARG D 1 109 ? 8.682   75.251  25.006  1.00 63.88  ? 151 ARG D CD  1 
ATOM 5859 N NE  . ARG D 1 109 ? 8.097   76.571  25.263  1.00 63.88  ? 151 ARG D NE  1 
ATOM 5860 C CZ  . ARG D 1 109 ? 8.620   77.493  26.076  1.00 63.88  ? 151 ARG D CZ  1 
ATOM 5861 N NH1 . ARG D 1 109 ? 9.757   77.262  26.730  1.00 63.88  ? 151 ARG D NH1 1 
ATOM 5862 N NH2 . ARG D 1 109 ? 7.992   78.651  26.255  1.00 63.88  ? 151 ARG D NH2 1 
ATOM 5863 N N   . ALA D 1 110 ? 9.957   70.928  21.441  1.00 63.88  ? 152 ALA D N   1 
ATOM 5864 C CA  . ALA D 1 110 ? 11.126  70.208  20.992  1.00 63.88  ? 152 ALA D CA  1 
ATOM 5865 C C   . ALA D 1 110 ? 11.104  70.138  19.474  1.00 63.88  ? 152 ALA D C   1 
ATOM 5866 O O   . ALA D 1 110 ? 12.096  70.454  18.807  1.00 63.88  ? 152 ALA D O   1 
ATOM 5867 C CB  . ALA D 1 110 ? 11.123  68.835  21.577  1.00 63.88  ? 152 ALA D CB  1 
ATOM 5868 N N   . ARG D 1 111 ? 9.937   69.790  18.942  1.00 63.88  ? 153 ARG D N   1 
ATOM 5869 C CA  . ARG D 1 111 ? 9.726   69.645  17.508  1.00 63.88  ? 153 ARG D CA  1 
ATOM 5870 C C   . ARG D 1 111 ? 10.441  70.696  16.667  1.00 63.88  ? 153 ARG D C   1 
ATOM 5871 O O   . ARG D 1 111 ? 11.096  70.364  15.682  1.00 63.88  ? 153 ARG D O   1 
ATOM 5872 C CB  . ARG D 1 111 ? 8.227   69.640  17.212  1.00 63.88  ? 153 ARG D CB  1 
ATOM 5873 C CG  . ARG D 1 111 ? 7.847   69.272  15.790  1.00 63.88  ? 153 ARG D CG  1 
ATOM 5874 C CD  . ARG D 1 111 ? 6.352   69.016  15.707  1.00 63.88  ? 153 ARG D CD  1 
ATOM 5875 N NE  . ARG D 1 111 ? 5.862   68.932  14.331  1.00 63.88  ? 153 ARG D NE  1 
ATOM 5876 C CZ  . ARG D 1 111 ? 4.573   68.955  13.999  1.00 63.88  ? 153 ARG D CZ  1 
ATOM 5877 N NH1 . ARG D 1 111 ? 3.641   69.054  14.944  1.00 63.88  ? 153 ARG D NH1 1 
ATOM 5878 N NH2 . ARG D 1 111 ? 4.210   68.909  12.720  1.00 63.88  ? 153 ARG D NH2 1 
ATOM 5879 N N   . ALA D 1 112 ? 10.370  71.949  17.098  1.00 63.88  ? 154 ALA D N   1 
ATOM 5880 C CA  . ALA D 1 112 ? 11.014  73.038  16.381  1.00 63.88  ? 154 ALA D CA  1 
ATOM 5881 C C   . ALA D 1 112 ? 12.499  72.766  16.203  1.00 63.88  ? 154 ALA D C   1 
ATOM 5882 O O   . ALA D 1 112 ? 12.983  72.591  15.085  1.00 63.88  ? 154 ALA D O   1 
ATOM 5883 C CB  . ALA D 1 112 ? 10.812  74.335  17.130  1.00 63.88  ? 154 ALA D CB  1 
ATOM 5884 N N   . HIS D 1 113 ? 13.205  72.723  17.326  1.00 63.88  ? 155 HIS D N   1 
ATOM 5885 C CA  . HIS D 1 113 ? 14.641  72.476  17.355  1.00 63.88  ? 155 HIS D CA  1 
ATOM 5886 C C   . HIS D 1 113 ? 14.992  71.399  16.373  1.00 63.88  ? 155 HIS D C   1 
ATOM 5887 O O   . HIS D 1 113 ? 15.946  71.505  15.612  1.00 63.88  ? 155 HIS D O   1 
ATOM 5888 C CB  . HIS D 1 113 ? 15.039  72.011  18.736  1.00 63.88  ? 155 HIS D CB  1 
ATOM 5889 C CG  . HIS D 1 113 ? 14.668  72.970  19.809  1.00 63.88  ? 155 HIS D CG  1 
ATOM 5890 N ND1 . HIS D 1 113 ? 13.614  73.851  19.687  1.00 63.88  ? 155 HIS D ND1 1 
ATOM 5891 C CD2 . HIS D 1 113 ? 15.227  73.213  21.016  1.00 63.88  ? 155 HIS D CD2 1 
ATOM 5892 C CE1 . HIS D 1 113 ? 13.543  74.599  20.771  1.00 63.88  ? 155 HIS D CE1 1 
ATOM 5893 N NE2 . HIS D 1 113 ? 14.510  74.233  21.593  1.00 63.88  ? 155 HIS D NE2 1 
ATOM 5894 N N   . VAL D 1 114 ? 14.186  70.356  16.405  1.00 63.88  ? 156 VAL D N   1 
ATOM 5895 C CA  . VAL D 1 114 ? 14.359  69.239  15.517  1.00 63.88  ? 156 VAL D CA  1 
ATOM 5896 C C   . VAL D 1 114 ? 14.304  69.713  14.087  1.00 63.88  ? 156 VAL D C   1 
ATOM 5897 O O   . VAL D 1 114 ? 15.327  69.764  13.418  1.00 63.88  ? 156 VAL D O   1 
ATOM 5898 C CB  . VAL D 1 114 ? 13.241  68.260  15.710  1.00 63.88  ? 156 VAL D CB  1 
ATOM 5899 C CG1 . VAL D 1 114 ? 13.324  67.159  14.677  1.00 63.88  ? 156 VAL D CG1 1 
ATOM 5900 C CG2 . VAL D 1 114 ? 13.291  67.728  17.106  1.00 63.88  ? 156 VAL D CG2 1 
ATOM 5901 N N   . ASP D 1 115 ? 13.108  70.100  13.643  1.00 63.88  ? 157 ASP D N   1 
ATOM 5902 C CA  . ASP D 1 115 ? 12.902  70.557  12.279  1.00 63.88  ? 157 ASP D CA  1 
ATOM 5903 C C   . ASP D 1 115 ? 14.005  71.494  11.881  1.00 63.88  ? 157 ASP D C   1 
ATOM 5904 O O   . ASP D 1 115 ? 14.395  71.565  10.722  1.00 63.88  ? 157 ASP D O   1 
ATOM 5905 C CB  . ASP D 1 115 ? 11.540  71.217  12.136  1.00 63.88  ? 157 ASP D CB  1 
ATOM 5906 C CG  . ASP D 1 115 ? 10.407  70.230  12.319  1.00 63.88  ? 157 ASP D CG  1 
ATOM 5907 O OD1 . ASP D 1 115 ? 10.145  69.434  11.390  1.00 63.88  ? 157 ASP D OD1 1 
ATOM 5908 O OD2 . ASP D 1 115 ? 9.793   70.233  13.402  1.00 63.88  ? 157 ASP D OD2 1 
ATOM 5909 N N   . ALA D 1 116 ? 14.561  72.154  12.881  1.00 63.88  ? 158 ALA D N   1 
ATOM 5910 C CA  . ALA D 1 116 ? 15.658  73.049  12.652  1.00 63.88  ? 158 ALA D CA  1 
ATOM 5911 C C   . ALA D 1 116 ? 16.850  72.194  12.243  1.00 63.88  ? 158 ALA D C   1 
ATOM 5912 O O   . ALA D 1 116 ? 17.232  72.153  11.073  1.00 63.88  ? 158 ALA D O   1 
ATOM 5913 C CB  . ALA D 1 116 ? 15.965  73.813  13.918  1.00 63.88  ? 158 ALA D CB  1 
ATOM 5914 N N   . LEU D 1 117 ? 17.372  71.441  13.199  1.00 63.88  ? 159 LEU D N   1 
ATOM 5915 C CA  . LEU D 1 117 ? 18.522  70.603  12.945  1.00 63.88  ? 159 LEU D CA  1 
ATOM 5916 C C   . LEU D 1 117 ? 18.325  69.690  11.757  1.00 63.88  ? 159 LEU D C   1 
ATOM 5917 O O   . LEU D 1 117 ? 19.277  69.377  11.056  1.00 63.88  ? 159 LEU D O   1 
ATOM 5918 C CB  . LEU D 1 117 ? 18.853  69.797  14.182  1.00 63.88  ? 159 LEU D CB  1 
ATOM 5919 C CG  . LEU D 1 117 ? 20.094  68.927  14.044  1.00 63.88  ? 159 LEU D CG  1 
ATOM 5920 C CD1 . LEU D 1 117 ? 21.111  69.275  15.123  1.00 63.88  ? 159 LEU D CD1 1 
ATOM 5921 C CD2 . LEU D 1 117 ? 19.698  67.472  14.135  1.00 63.88  ? 159 LEU D CD2 1 
ATOM 5922 N N   . ARG D 1 118 ? 17.076  69.318  11.510  1.00 63.88  ? 160 ARG D N   1 
ATOM 5923 C CA  . ARG D 1 118 ? 16.740  68.443  10.400  1.00 63.88  ? 160 ARG D CA  1 
ATOM 5924 C C   . ARG D 1 118 ? 17.367  69.063  9.186   1.00 63.88  ? 160 ARG D C   1 
ATOM 5925 O O   . ARG D 1 118 ? 18.148  68.440  8.471   1.00 63.88  ? 160 ARG D O   1 
ATOM 5926 C CB  . ARG D 1 118 ? 15.231  68.405  10.170  1.00 63.88  ? 160 ARG D CB  1 
ATOM 5927 C CG  . ARG D 1 118 ? 14.827  67.597  8.926   1.00 63.88  ? 160 ARG D CG  1 
ATOM 5928 C CD  . ARG D 1 118 ? 13.809  68.330  8.048   1.00 63.88  ? 160 ARG D CD  1 
ATOM 5929 N NE  . ARG D 1 118 ? 13.371  67.512  6.912   1.00 63.88  ? 160 ARG D NE  1 
ATOM 5930 C CZ  . ARG D 1 118 ? 12.178  66.922  6.815   1.00 63.88  ? 160 ARG D CZ  1 
ATOM 5931 N NH1 . ARG D 1 118 ? 11.272  67.050  7.785   1.00 63.88  ? 160 ARG D NH1 1 
ATOM 5932 N NH2 . ARG D 1 118 ? 11.887  66.190  5.746   1.00 63.88  ? 160 ARG D NH2 1 
ATOM 5933 N N   . THR D 1 119 ? 16.993  70.312  8.971   1.00 63.88  ? 161 THR D N   1 
ATOM 5934 C CA  . THR D 1 119 ? 17.498  71.075  7.866   1.00 63.88  ? 161 THR D CA  1 
ATOM 5935 C C   . THR D 1 119 ? 18.991  71.183  8.064   1.00 63.88  ? 161 THR D C   1 
ATOM 5936 O O   . THR D 1 119 ? 19.766  70.947  7.147   1.00 63.88  ? 161 THR D O   1 
ATOM 5937 C CB  . THR D 1 119 ? 16.910  72.468  7.881   1.00 63.88  ? 161 THR D CB  1 
ATOM 5938 O OG1 . THR D 1 119 ? 15.629  72.432  8.521   1.00 63.88  ? 161 THR D OG1 1 
ATOM 5939 C CG2 . THR D 1 119 ? 16.742  72.968  6.469   1.00 63.88  ? 161 THR D CG2 1 
ATOM 5940 N N   . HIS D 1 120 ? 19.392  71.436  9.300   1.00 63.88  ? 162 HIS D N   1 
ATOM 5941 C CA  . HIS D 1 120 ? 20.793  71.588  9.606   1.00 63.88  ? 162 HIS D CA  1 
ATOM 5942 C C   . HIS D 1 120 ? 21.687  70.429  9.250   1.00 63.88  ? 162 HIS D C   1 
ATOM 5943 O O   . HIS D 1 120 ? 22.878  70.616  9.033   1.00 63.88  ? 162 HIS D O   1 
ATOM 5944 C CB  . HIS D 1 120 ? 20.977  71.909  11.067  1.00 63.88  ? 162 HIS D CB  1 
ATOM 5945 C CG  . HIS D 1 120 ? 21.637  73.225  11.302  1.00 63.88  ? 162 HIS D CG  1 
ATOM 5946 N ND1 . HIS D 1 120 ? 20.995  74.285  11.905  1.00 63.88  ? 162 HIS D ND1 1 
ATOM 5947 C CD2 . HIS D 1 120 ? 22.884  73.665  11.000  1.00 63.88  ? 162 HIS D CD2 1 
ATOM 5948 C CE1 . HIS D 1 120 ? 21.811  75.321  11.965  1.00 63.88  ? 162 HIS D CE1 1 
ATOM 5949 N NE2 . HIS D 1 120 ? 22.963  74.973  11.424  1.00 63.88  ? 162 HIS D NE2 1 
ATOM 5950 N N   . LEU D 1 121 ? 21.126  69.231  9.171   1.00 63.88  ? 163 LEU D N   1 
ATOM 5951 C CA  . LEU D 1 121 ? 21.954  68.073  8.872   1.00 63.88  ? 163 LEU D CA  1 
ATOM 5952 C C   . LEU D 1 121 ? 21.777  67.534  7.504   1.00 63.88  ? 163 LEU D C   1 
ATOM 5953 O O   . LEU D 1 121 ? 22.713  67.000  6.922   1.00 63.88  ? 163 LEU D O   1 
ATOM 5954 C CB  . LEU D 1 121 ? 21.665  66.958  9.839   1.00 63.88  ? 163 LEU D CB  1 
ATOM 5955 C CG  . LEU D 1 121 ? 21.851  67.436  11.262  1.00 63.88  ? 163 LEU D CG  1 
ATOM 5956 C CD1 . LEU D 1 121 ? 22.040  66.229  12.139  1.00 63.88  ? 163 LEU D CD1 1 
ATOM 5957 C CD2 . LEU D 1 121 ? 23.054  68.352  11.347  1.00 63.88  ? 163 LEU D CD2 1 
ATOM 5958 N N   . ALA D 1 122 ? 20.565  67.684  6.997   1.00 63.88  ? 164 ALA D N   1 
ATOM 5959 C CA  . ALA D 1 122 ? 20.193  67.212  5.674   1.00 63.88  ? 164 ALA D CA  1 
ATOM 5960 C C   . ALA D 1 122 ? 21.340  67.177  4.666   1.00 63.88  ? 164 ALA D C   1 
ATOM 5961 O O   . ALA D 1 122 ? 21.571  66.161  4.015   1.00 63.88  ? 164 ALA D O   1 
ATOM 5962 C CB  . ALA D 1 122 ? 19.040  68.043  5.133   1.00 63.88  ? 164 ALA D CB  1 
ATOM 5963 N N   . PRO D 1 123 ? 22.091  68.277  4.547   1.00 110.37 ? 165 PRO D N   1 
ATOM 5964 C CA  . PRO D 1 123 ? 23.203  68.302  3.601   1.00 110.37 ? 165 PRO D CA  1 
ATOM 5965 C C   . PRO D 1 123 ? 24.146  67.127  3.764   1.00 110.37 ? 165 PRO D C   1 
ATOM 5966 O O   . PRO D 1 123 ? 24.438  66.400  2.826   1.00 110.37 ? 165 PRO D O   1 
ATOM 5967 C CB  . PRO D 1 123 ? 23.911  69.608  3.956   1.00 110.37 ? 165 PRO D CB  1 
ATOM 5968 C CG  . PRO D 1 123 ? 23.460  69.892  5.381   1.00 110.37 ? 165 PRO D CG  1 
ATOM 5969 C CD  . PRO D 1 123 ? 22.029  69.547  5.288   1.00 110.37 ? 165 PRO D CD  1 
ATOM 5970 N N   . TYR D 1 124 ? 24.610  66.958  4.982   1.00 110.37 ? 166 TYR D N   1 
ATOM 5971 C CA  . TYR D 1 124 ? 25.534  65.905  5.311   1.00 110.37 ? 166 TYR D CA  1 
ATOM 5972 C C   . TYR D 1 124 ? 24.770  64.610  5.257   1.00 110.37 ? 166 TYR D C   1 
ATOM 5973 O O   . TYR D 1 124 ? 25.172  63.655  4.599   1.00 110.37 ? 166 TYR D O   1 
ATOM 5974 C CB  . TYR D 1 124 ? 26.071  66.203  6.697   1.00 110.37 ? 166 TYR D CB  1 
ATOM 5975 C CG  . TYR D 1 124 ? 26.388  67.678  6.846   1.00 110.37 ? 166 TYR D CG  1 
ATOM 5976 C CD1 . TYR D 1 124 ? 27.436  68.256  6.131   1.00 110.37 ? 166 TYR D CD1 1 
ATOM 5977 C CD2 . TYR D 1 124 ? 25.620  68.503  7.669   1.00 110.37 ? 166 TYR D CD2 1 
ATOM 5978 C CE1 . TYR D 1 124 ? 27.718  69.616  6.229   1.00 110.37 ? 166 TYR D CE1 1 
ATOM 5979 C CE2 . TYR D 1 124 ? 25.893  69.869  7.777   1.00 110.37 ? 166 TYR D CE2 1 
ATOM 5980 C CZ  . TYR D 1 124 ? 26.947  70.419  7.051   1.00 110.37 ? 166 TYR D CZ  1 
ATOM 5981 O OH  . TYR D 1 124 ? 27.245  71.765  7.147   1.00 110.37 ? 166 TYR D OH  1 
ATOM 5982 N N   . SER D 1 125 ? 23.608  64.638  5.885   1.00 110.37 ? 167 SER D N   1 
ATOM 5983 C CA  . SER D 1 125 ? 22.715  63.509  5.920   1.00 110.37 ? 167 SER D CA  1 
ATOM 5984 C C   . SER D 1 125 ? 22.565  62.935  4.518   1.00 110.37 ? 167 SER D C   1 
ATOM 5985 O O   . SER D 1 125 ? 22.450  61.733  4.345   1.00 110.37 ? 167 SER D O   1 
ATOM 5986 C CB  . SER D 1 125 ? 21.374  63.974  6.470   1.00 110.37 ? 167 SER D CB  1 
ATOM 5987 O OG  . SER D 1 125 ? 20.327  63.156  6.007   1.00 110.37 ? 167 SER D OG  1 
ATOM 5988 N N   . ASP D 1 126 ? 22.681  63.788  3.512   1.00 110.37 ? 168 ASP D N   1 
ATOM 5989 C CA  . ASP D 1 126 ? 22.554  63.328  2.148   1.00 110.37 ? 168 ASP D CA  1 
ATOM 5990 C C   . ASP D 1 126 ? 23.896  63.137  1.470   1.00 110.37 ? 168 ASP D C   1 
ATOM 5991 O O   . ASP D 1 126 ? 24.048  62.239  0.643   1.00 110.37 ? 168 ASP D O   1 
ATOM 5992 C CB  . ASP D 1 126 ? 21.662  64.273  1.349   1.00 110.37 ? 168 ASP D CB  1 
ATOM 5993 C CG  . ASP D 1 126 ? 20.563  63.536  0.610   1.00 110.37 ? 168 ASP D CG  1 
ATOM 5994 O OD1 . ASP D 1 126 ? 20.814  63.101  -0.534  1.00 110.37 ? 168 ASP D OD1 1 
ATOM 5995 O OD2 . ASP D 1 126 ? 19.458  63.379  1.177   1.00 110.37 ? 168 ASP D OD2 1 
ATOM 5996 N N   . GLU D 1 127 ? 24.884  63.935  1.863   1.00 110.37 ? 169 GLU D N   1 
ATOM 5997 C CA  . GLU D 1 127 ? 26.211  63.835  1.267   1.00 110.37 ? 169 GLU D CA  1 
ATOM 5998 C C   . GLU D 1 127 ? 26.642  62.388  1.369   1.00 110.37 ? 169 GLU D C   1 
ATOM 5999 O O   . GLU D 1 127 ? 27.258  61.835  0.467   1.00 110.37 ? 169 GLU D O   1 
ATOM 6000 C CB  . GLU D 1 127 ? 27.216  64.715  2.005   1.00 110.37 ? 169 GLU D CB  1 
ATOM 6001 C CG  . GLU D 1 127 ? 28.608  64.654  1.382   1.00 110.37 ? 169 GLU D CG  1 
ATOM 6002 C CD  . GLU D 1 127 ? 29.666  65.363  2.203   1.00 110.37 ? 169 GLU D CD  1 
ATOM 6003 O OE1 . GLU D 1 127 ? 29.540  66.590  2.409   1.00 110.37 ? 169 GLU D OE1 1 
ATOM 6004 O OE2 . GLU D 1 127 ? 30.637  64.695  2.623   1.00 110.37 ? 169 GLU D OE2 1 
ATOM 6005 N N   . LEU D 1 128 ? 26.246  61.768  2.465   1.00 110.37 ? 170 LEU D N   1 
ATOM 6006 C CA  . LEU D 1 128 ? 26.576  60.388  2.697   1.00 110.37 ? 170 LEU D CA  1 
ATOM 6007 C C   . LEU D 1 128 ? 25.641  59.498  1.929   1.00 110.37 ? 170 LEU D C   1 
ATOM 6008 O O   . LEU D 1 128 ? 26.088  58.612  1.213   1.00 110.37 ? 170 LEU D O   1 
ATOM 6009 C CB  . LEU D 1 128 ? 26.518  60.092  4.184   1.00 110.37 ? 170 LEU D CB  1 
ATOM 6010 C CG  . LEU D 1 128 ? 27.770  60.524  4.957   1.00 110.37 ? 170 LEU D CG  1 
ATOM 6011 C CD1 . LEU D 1 128 ? 28.439  61.740  4.315   1.00 110.37 ? 170 LEU D CD1 1 
ATOM 6012 C CD2 . LEU D 1 128 ? 27.400  60.789  6.407   1.00 110.37 ? 170 LEU D CD2 1 
ATOM 6013 N N   . ARG D 1 129 ? 24.346  59.775  2.038   1.00 110.37 ? 171 ARG D N   1 
ATOM 6014 C CA  . ARG D 1 129 ? 23.336  58.985  1.348   1.00 110.37 ? 171 ARG D CA  1 
ATOM 6015 C C   . ARG D 1 129 ? 23.766  58.686  -0.076  1.00 110.37 ? 171 ARG D C   1 
ATOM 6016 O O   . ARG D 1 129 ? 24.111  57.553  -0.394  1.00 110.37 ? 171 ARG D O   1 
ATOM 6017 C CB  . ARG D 1 129 ? 21.979  59.707  1.348   1.00 110.37 ? 171 ARG D CB  1 
ATOM 6018 C CG  . ARG D 1 129 ? 21.174  59.571  2.649   1.00 110.37 ? 171 ARG D CG  1 
ATOM 6019 C CD  . ARG D 1 129 ? 20.844  58.105  2.953   1.00 110.37 ? 171 ARG D CD  1 
ATOM 6020 N NE  . ARG D 1 129 ? 20.106  57.894  4.203   1.00 110.37 ? 171 ARG D NE  1 
ATOM 6021 C CZ  . ARG D 1 129 ? 20.398  56.948  5.102   1.00 110.37 ? 171 ARG D CZ  1 
ATOM 6022 N NH1 . ARG D 1 129 ? 21.417  56.121  4.912   1.00 110.37 ? 171 ARG D NH1 1 
ATOM 6023 N NH2 . ARG D 1 129 ? 19.598  56.742  6.136   1.00 110.37 ? 171 ARG D NH2 1 
ATOM 6024 N N   . GLN D 1 130 ? 23.846  59.721  -0.902  1.00 110.37 ? 172 GLN D N   1 
ATOM 6025 C CA  . GLN D 1 130 ? 24.240  59.536  -2.290  1.00 110.37 ? 172 GLN D CA  1 
ATOM 6026 C C   . GLN D 1 130 ? 25.692  59.039  -2.417  1.00 110.37 ? 172 GLN D C   1 
ATOM 6027 O O   . GLN D 1 130 ? 26.023  58.338  -3.377  1.00 110.37 ? 172 GLN D O   1 
ATOM 6028 C CB  . GLN D 1 130 ? 24.012  60.831  -3.087  1.00 110.37 ? 172 GLN D CB  1 
ATOM 6029 C CG  . GLN D 1 130 ? 22.590  61.460  -2.949  1.00 110.37 ? 172 GLN D CG  1 
ATOM 6030 C CD  . GLN D 1 130 ? 21.531  60.904  -3.923  1.00 110.37 ? 172 GLN D CD  1 
ATOM 6031 O OE1 . GLN D 1 130 ? 21.696  60.955  -5.146  1.00 110.37 ? 172 GLN D OE1 1 
ATOM 6032 N NE2 . GLN D 1 130 ? 20.418  60.424  -3.375  1.00 110.37 ? 172 GLN D NE2 1 
ATOM 6033 N N   . ARG D 1 131 ? 26.528  59.328  -1.419  1.00 110.37 ? 173 ARG D N   1 
ATOM 6034 C CA  . ARG D 1 131 ? 27.928  58.900  -1.461  1.00 110.37 ? 173 ARG D CA  1 
ATOM 6035 C C   . ARG D 1 131 ? 28.078  57.382  -1.465  1.00 110.37 ? 173 ARG D C   1 
ATOM 6036 O O   . ARG D 1 131 ? 28.605  56.822  -2.422  1.00 110.37 ? 173 ARG D O   1 
ATOM 6037 C CB  . ARG D 1 131 ? 28.762  59.520  -0.322  1.00 110.37 ? 173 ARG D CB  1 
ATOM 6038 C CG  . ARG D 1 131 ? 30.254  59.131  -0.367  1.00 110.37 ? 173 ARG D CG  1 
ATOM 6039 C CD  . ARG D 1 131 ? 31.223  60.250  0.083   1.00 110.37 ? 173 ARG D CD  1 
ATOM 6040 N NE  . ARG D 1 131 ? 32.625  59.901  -0.202  1.00 110.37 ? 173 ARG D NE  1 
ATOM 6041 C CZ  . ARG D 1 131 ? 33.634  60.771  -0.295  1.00 110.37 ? 173 ARG D CZ  1 
ATOM 6042 N NH1 . ARG D 1 131 ? 33.426  62.072  -0.124  1.00 110.37 ? 173 ARG D NH1 1 
ATOM 6043 N NH2 . ARG D 1 131 ? 34.861  60.335  -0.567  1.00 110.37 ? 173 ARG D NH2 1 
ATOM 6044 N N   . LEU D 1 132 ? 27.606  56.706  -0.424  1.00 110.37 ? 174 LEU D N   1 
ATOM 6045 C CA  . LEU D 1 132 ? 27.727  55.256  -0.398  1.00 110.37 ? 174 LEU D CA  1 
ATOM 6046 C C   . LEU D 1 132 ? 26.899  54.630  -1.501  1.00 110.37 ? 174 LEU D C   1 
ATOM 6047 O O   . LEU D 1 132 ? 27.181  53.519  -1.927  1.00 110.37 ? 174 LEU D O   1 
ATOM 6048 C CB  . LEU D 1 132 ? 27.311  54.674  0.960   1.00 110.37 ? 174 LEU D CB  1 
ATOM 6049 C CG  . LEU D 1 132 ? 25.850  54.316  1.261   1.00 110.37 ? 174 LEU D CG  1 
ATOM 6050 C CD1 . LEU D 1 132 ? 25.479  52.966  0.657   1.00 110.37 ? 174 LEU D CD1 1 
ATOM 6051 C CD2 . LEU D 1 132 ? 25.680  54.237  2.759   1.00 110.37 ? 174 LEU D CD2 1 
ATOM 6052 N N   . ALA D 1 133 ? 25.868  55.342  -1.945  1.00 110.37 ? 175 ALA D N   1 
ATOM 6053 C CA  . ALA D 1 133 ? 24.981  54.859  -2.999  1.00 110.37 ? 175 ALA D CA  1 
ATOM 6054 C C   . ALA D 1 133 ? 25.778  54.482  -4.222  1.00 110.37 ? 175 ALA D C   1 
ATOM 6055 O O   . ALA D 1 133 ? 25.774  53.333  -4.658  1.00 110.37 ? 175 ALA D O   1 
ATOM 6056 C CB  . ALA D 1 133 ? 23.986  55.933  -3.361  1.00 110.37 ? 175 ALA D CB  1 
ATOM 6057 N N   . ALA D 1 134 ? 26.449  55.479  -4.784  1.00 110.37 ? 176 ALA D N   1 
ATOM 6058 C CA  . ALA D 1 134 ? 27.270  55.255  -5.951  1.00 110.37 ? 176 ALA D CA  1 
ATOM 6059 C C   . ALA D 1 134 ? 28.442  54.357  -5.549  1.00 110.37 ? 176 ALA D C   1 
ATOM 6060 O O   . ALA D 1 134 ? 28.886  53.541  -6.349  1.00 110.37 ? 176 ALA D O   1 
ATOM 6061 C CB  . ALA D 1 134 ? 27.763  56.577  -6.518  1.00 110.37 ? 176 ALA D CB  1 
ATOM 6062 N N   . ARG D 1 135 ? 28.905  54.474  -4.299  1.00 110.37 ? 177 ARG D N   1 
ATOM 6063 C CA  . ARG D 1 135 ? 30.024  53.659  -3.797  1.00 110.37 ? 177 ARG D CA  1 
ATOM 6064 C C   . ARG D 1 135 ? 29.603  52.196  -3.694  1.00 110.37 ? 177 ARG D C   1 
ATOM 6065 O O   . ARG D 1 135 ? 30.431  51.282  -3.726  1.00 110.37 ? 177 ARG D O   1 
ATOM 6066 C CB  . ARG D 1 135 ? 30.514  54.163  -2.427  1.00 110.37 ? 177 ARG D CB  1 
ATOM 6067 C CG  . ARG D 1 135 ? 31.692  53.357  -1.852  1.00 110.37 ? 177 ARG D CG  1 
ATOM 6068 C CD  . ARG D 1 135 ? 32.427  54.047  -0.683  1.00 110.37 ? 177 ARG D CD  1 
ATOM 6069 N NE  . ARG D 1 135 ? 33.346  55.111  -1.108  1.00 110.37 ? 177 ARG D NE  1 
ATOM 6070 C CZ  . ARG D 1 135 ? 34.362  55.578  -0.378  1.00 110.37 ? 177 ARG D CZ  1 
ATOM 6071 N NH1 . ARG D 1 135 ? 34.611  55.079  0.828   1.00 110.37 ? 177 ARG D NH1 1 
ATOM 6072 N NH2 . ARG D 1 135 ? 35.125  56.562  -0.848  1.00 110.37 ? 177 ARG D NH2 1 
ATOM 6073 N N   . LEU D 1 136 ? 28.296  51.986  -3.619  1.00 110.37 ? 178 LEU D N   1 
ATOM 6074 C CA  . LEU D 1 136 ? 27.731  50.654  -3.523  1.00 110.37 ? 178 LEU D CA  1 
ATOM 6075 C C   . LEU D 1 136 ? 27.703  50.056  -4.918  1.00 110.37 ? 178 LEU D C   1 
ATOM 6076 O O   . LEU D 1 136 ? 27.963  48.867  -5.110  1.00 110.37 ? 178 LEU D O   1 
ATOM 6077 C CB  . LEU D 1 136 ? 26.310  50.744  -2.988  1.00 110.37 ? 178 LEU D CB  1 
ATOM 6078 C CG  . LEU D 1 136 ? 25.977  49.826  -1.823  1.00 110.37 ? 178 LEU D CG  1 
ATOM 6079 C CD1 . LEU D 1 136 ? 26.927  50.094  -0.652  1.00 110.37 ? 178 LEU D CD1 1 
ATOM 6080 C CD2 . LEU D 1 136 ? 24.527  50.050  -1.437  1.00 110.37 ? 178 LEU D CD2 1 
ATOM 6081 N N   . GLU D 1 137 ? 27.374  50.901  -5.890  1.00 110.37 ? 179 GLU D N   1 
ATOM 6082 C CA  . GLU D 1 137 ? 27.307  50.481  -7.279  1.00 110.37 ? 179 GLU D CA  1 
ATOM 6083 C C   . GLU D 1 137 ? 28.623  49.898  -7.738  1.00 110.37 ? 179 GLU D C   1 
ATOM 6084 O O   . GLU D 1 137 ? 28.637  48.971  -8.538  1.00 110.37 ? 179 GLU D O   1 
ATOM 6085 C CB  . GLU D 1 137 ? 26.923  51.651  -8.188  1.00 110.37 ? 179 GLU D CB  1 
ATOM 6086 C CG  . GLU D 1 137 ? 25.451  52.039  -8.125  1.00 110.37 ? 179 GLU D CG  1 
ATOM 6087 C CD  . GLU D 1 137 ? 24.523  51.025  -8.795  1.00 110.37 ? 179 GLU D CD  1 
ATOM 6088 O OE1 . GLU D 1 137 ? 24.836  49.807  -8.809  1.00 110.37 ? 179 GLU D OE1 1 
ATOM 6089 O OE2 . GLU D 1 137 ? 23.468  51.458  -9.313  1.00 110.37 ? 179 GLU D OE2 1 
ATOM 6090 N N   . ALA D 1 138 ? 29.721  50.443  -7.220  1.00 110.37 ? 180 ALA D N   1 
ATOM 6091 C CA  . ALA D 1 138 ? 31.059  49.977  -7.570  1.00 110.37 ? 180 ALA D CA  1 
ATOM 6092 C C   . ALA D 1 138 ? 31.239  48.528  -7.166  1.00 110.37 ? 180 ALA D C   1 
ATOM 6093 O O   . ALA D 1 138 ? 31.777  47.734  -7.926  1.00 110.37 ? 180 ALA D O   1 
ATOM 6094 C CB  . ALA D 1 138 ? 32.115  50.840  -6.901  1.00 110.37 ? 180 ALA D CB  1 
ATOM 6095 N N   . LEU D 1 139 ? 30.762  48.190  -5.974  1.00 110.37 ? 181 LEU D N   1 
ATOM 6096 C CA  . LEU D 1 139 ? 30.863  46.829  -5.473  1.00 110.37 ? 181 LEU D CA  1 
ATOM 6097 C C   . LEU D 1 139 ? 30.165  45.886  -6.436  1.00 110.37 ? 181 LEU D C   1 
ATOM 6098 O O   . LEU D 1 139 ? 30.753  44.920  -6.912  1.00 110.37 ? 181 LEU D O   1 
ATOM 6099 C CB  . LEU D 1 139 ? 30.197  46.722  -4.109  1.00 110.37 ? 181 LEU D CB  1 
ATOM 6100 C CG  . LEU D 1 139 ? 30.444  45.384  -3.415  1.00 110.37 ? 181 LEU D CG  1 
ATOM 6101 C CD1 . LEU D 1 139 ? 31.875  45.367  -2.880  1.00 110.37 ? 181 LEU D CD1 1 
ATOM 6102 C CD2 . LEU D 1 139 ? 29.434  45.168  -2.297  1.00 110.37 ? 181 LEU D CD2 1 
ATOM 6103 N N   . LYS D 1 140 ? 28.896  46.173  -6.699  1.00 110.37 ? 182 LYS D N   1 
ATOM 6104 C CA  . LYS D 1 140 ? 28.096  45.370  -7.604  1.00 110.37 ? 182 LYS D CA  1 
ATOM 6105 C C   . LYS D 1 140 ? 28.810  45.273  -8.950  1.00 110.37 ? 182 LYS D C   1 
ATOM 6106 O O   . LYS D 1 140 ? 29.129  44.183  -9.428  1.00 110.37 ? 182 LYS D O   1 
ATOM 6107 C CB  . LYS D 1 140 ? 26.720  46.018  -7.764  1.00 110.37 ? 182 LYS D CB  1 
ATOM 6108 C CG  . LYS D 1 140 ? 25.805  45.270  -8.702  1.00 110.37 ? 182 LYS D CG  1 
ATOM 6109 C CD  . LYS D 1 140 ? 24.439  45.920  -8.829  1.00 110.37 ? 182 LYS D CD  1 
ATOM 6110 C CE  . LYS D 1 140 ? 23.581  45.120  -9.804  1.00 110.37 ? 182 LYS D CE  1 
ATOM 6111 N NZ  . LYS D 1 140 ? 22.187  45.622  -9.935  1.00 110.37 ? 182 LYS D NZ  1 
ATOM 6112 N N   . GLU D 1 141 ? 29.148  46.442  -9.482  1.00 110.37 ? 183 GLU D N   1 
ATOM 6113 C CA  . GLU D 1 141 ? 29.834  46.610  -10.762 1.00 110.37 ? 183 GLU D CA  1 
ATOM 6114 C C   . GLU D 1 141 ? 31.134  45.799  -10.878 1.00 110.37 ? 183 GLU D C   1 
ATOM 6115 O O   . GLU D 1 141 ? 31.217  44.864  -11.679 1.00 110.37 ? 183 GLU D O   1 
ATOM 6116 C CB  . GLU D 1 141 ? 30.114  48.101  -10.963 1.00 110.37 ? 183 GLU D CB  1 
ATOM 6117 C CG  . GLU D 1 141 ? 30.587  48.516  -12.343 1.00 110.37 ? 183 GLU D CG  1 
ATOM 6118 C CD  . GLU D 1 141 ? 30.768  50.025  -12.452 1.00 110.37 ? 183 GLU D CD  1 
ATOM 6119 O OE1 . GLU D 1 141 ? 29.748  50.753  -12.404 1.00 110.37 ? 183 GLU D OE1 1 
ATOM 6120 O OE2 . GLU D 1 141 ? 31.931  50.480  -12.575 1.00 110.37 ? 183 GLU D OE2 1 
ATOM 6121 N N   . ASN D 1 142 ? 32.148  46.167  -10.096 1.00 110.37 ? 184 ASN D N   1 
ATOM 6122 C CA  . ASN D 1 142 ? 33.430  45.464  -10.125 1.00 110.37 ? 184 ASN D CA  1 
ATOM 6123 C C   . ASN D 1 142 ? 33.316  44.044  -9.559  1.00 110.37 ? 184 ASN D C   1 
ATOM 6124 O O   . ASN D 1 142 ? 34.188  43.198  -9.783  1.00 110.37 ? 184 ASN D O   1 
ATOM 6125 C CB  . ASN D 1 142 ? 34.493  46.247  -9.349  1.00 110.37 ? 184 ASN D CB  1 
ATOM 6126 C CG  . ASN D 1 142 ? 34.423  46.009  -7.849  1.00 110.37 ? 184 ASN D CG  1 
ATOM 6127 O OD1 . ASN D 1 142 ? 34.770  44.930  -7.360  1.00 110.37 ? 184 ASN D OD1 1 
ATOM 6128 N ND2 . ASN D 1 142 ? 34.000  47.023  -7.108  1.00 110.37 ? 184 ASN D ND2 1 
ATOM 6129 N N   . GLY D 1 143 ? 32.264  43.809  -8.779  1.00 110.37 ? 185 GLY D N   1 
ATOM 6130 C CA  . GLY D 1 143 ? 32.048  42.499  -8.196  1.00 110.37 ? 185 GLY D CA  1 
ATOM 6131 C C   . GLY D 1 143 ? 31.893  41.473  -9.292  1.00 110.37 ? 185 GLY D C   1 
ATOM 6132 O O   . GLY D 1 143 ? 32.725  40.573  -9.434  1.00 110.37 ? 185 GLY D O   1 
ATOM 6133 N N   . GLY D 1 144 ? 30.860  41.656  -10.112 1.00 110.37 ? 186 GLY D N   1 
ATOM 6134 C CA  . GLY D 1 144 ? 30.595  40.745  -11.214 1.00 110.37 ? 186 GLY D CA  1 
ATOM 6135 C C   . GLY D 1 144 ? 31.824  40.443  -12.049 1.00 110.37 ? 186 GLY D C   1 
ATOM 6136 O O   . GLY D 1 144 ? 31.938  39.369  -12.641 1.00 110.37 ? 186 GLY D O   1 
ATOM 6137 N N   . ALA D 1 145 ? 32.756  41.387  -12.072 1.00 145.39 ? 187 ALA D N   1 
ATOM 6138 C CA  . ALA D 1 145 ? 33.991  41.227  -12.824 1.00 145.39 ? 187 ALA D CA  1 
ATOM 6139 C C   . ALA D 1 145 ? 34.770  40.025  -12.316 1.00 145.39 ? 187 ALA D C   1 
ATOM 6140 O O   . ALA D 1 145 ? 35.081  39.112  -13.078 1.00 145.39 ? 187 ALA D O   1 
ATOM 6141 C CB  . ALA D 1 145 ? 34.830  42.477  -12.709 1.00 145.39 ? 187 ALA D CB  1 
ATOM 6142 N N   . ARG D 1 146 ? 35.070  40.023  -11.021 1.00 145.39 ? 188 ARG D N   1 
ATOM 6143 C CA  . ARG D 1 146 ? 35.817  38.930  -10.415 1.00 145.39 ? 188 ARG D CA  1 
ATOM 6144 C C   . ARG D 1 146 ? 34.994  37.655  -10.351 1.00 145.39 ? 188 ARG D C   1 
ATOM 6145 O O   . ARG D 1 146 ? 35.530  36.559  -10.181 1.00 145.39 ? 188 ARG D O   1 
ATOM 6146 C CB  . ARG D 1 146 ? 36.325  39.350  -9.047  1.00 145.39 ? 188 ARG D CB  1 
ATOM 6147 C CG  . ARG D 1 146 ? 37.068  40.653  -9.155  1.00 145.39 ? 188 ARG D CG  1 
ATOM 6148 C CD  . ARG D 1 146 ? 37.796  41.026  -7.911  1.00 145.39 ? 188 ARG D CD  1 
ATOM 6149 N NE  . ARG D 1 146 ? 38.413  42.331  -8.092  1.00 145.39 ? 188 ARG D NE  1 
ATOM 6150 C CZ  . ARG D 1 146 ? 39.154  42.940  -7.174  1.00 145.39 ? 188 ARG D CZ  1 
ATOM 6151 N NH1 . ARG D 1 146 ? 39.379  42.355  -6.005  1.00 145.39 ? 188 ARG D NH1 1 
ATOM 6152 N NH2 . ARG D 1 146 ? 39.647  44.148  -7.413  1.00 145.39 ? 188 ARG D NH2 1 
ATOM 6153 N N   . LEU D 1 147 ? 33.685  37.814  -10.511 1.00 145.39 ? 189 LEU D N   1 
ATOM 6154 C CA  . LEU D 1 147 ? 32.756  36.697  -10.530 1.00 145.39 ? 189 LEU D CA  1 
ATOM 6155 C C   . LEU D 1 147 ? 33.106  35.923  -11.786 1.00 145.39 ? 189 LEU D C   1 
ATOM 6156 O O   . LEU D 1 147 ? 33.347  34.714  -11.750 1.00 145.39 ? 189 LEU D O   1 
ATOM 6157 C CB  . LEU D 1 147 ? 31.323  37.233  -10.645 1.00 145.39 ? 189 LEU D CB  1 
ATOM 6158 C CG  . LEU D 1 147 ? 30.307  36.471  -11.505 1.00 145.39 ? 189 LEU D CG  1 
ATOM 6159 C CD1 . LEU D 1 147 ? 29.541  35.498  -10.648 1.00 145.39 ? 189 LEU D CD1 1 
ATOM 6160 C CD2 . LEU D 1 147 ? 29.354  37.434  -12.185 1.00 145.39 ? 189 LEU D CD2 1 
ATOM 6161 N N   . ALA D 1 148 ? 33.160  36.660  -12.891 1.00 145.39 ? 190 ALA D N   1 
ATOM 6162 C CA  . ALA D 1 148 ? 33.479  36.104  -14.196 1.00 145.39 ? 190 ALA D CA  1 
ATOM 6163 C C   . ALA D 1 148 ? 34.739  35.273  -14.117 1.00 145.39 ? 190 ALA D C   1 
ATOM 6164 O O   . ALA D 1 148 ? 34.866  34.262  -14.798 1.00 145.39 ? 190 ALA D O   1 
ATOM 6165 C CB  . ALA D 1 148 ? 33.655  37.215  -15.206 1.00 145.39 ? 190 ALA D CB  1 
ATOM 6166 N N   . GLU D 1 149 ? 35.651  35.690  -13.248 1.00 145.39 ? 191 GLU D N   1 
ATOM 6167 C CA  . GLU D 1 149 ? 36.902  34.980  -13.076 1.00 145.39 ? 191 GLU D CA  1 
ATOM 6168 C C   . GLU D 1 149 ? 36.648  33.579  -12.548 1.00 145.39 ? 191 GLU D C   1 
ATOM 6169 O O   . GLU D 1 149 ? 37.088  32.605  -13.149 1.00 145.39 ? 191 GLU D O   1 
ATOM 6170 C CB  . GLU D 1 149 ? 37.854  35.757  -12.160 1.00 145.39 ? 191 GLU D CB  1 
ATOM 6171 C CG  . GLU D 1 149 ? 38.287  37.119  -12.714 1.00 145.39 ? 191 GLU D CG  1 
ATOM 6172 C CD  . GLU D 1 149 ? 39.436  37.739  -11.930 1.00 145.39 ? 191 GLU D CD  1 
ATOM 6173 O OE1 . GLU D 1 149 ? 40.606  37.479  -12.284 1.00 145.39 ? 191 GLU D OE1 1 
ATOM 6174 O OE2 . GLU D 1 149 ? 39.177  38.482  -10.958 1.00 145.39 ? 191 GLU D OE2 1 
ATOM 6175 N N   . TYR D 1 150 ? 35.875  33.464  -11.475 1.00 145.39 ? 192 TYR D N   1 
ATOM 6176 C CA  . TYR D 1 150 ? 35.601  32.148  -10.930 1.00 145.39 ? 192 TYR D CA  1 
ATOM 6177 C C   . TYR D 1 150 ? 34.819  31.270  -11.903 1.00 145.39 ? 192 TYR D C   1 
ATOM 6178 O O   . TYR D 1 150 ? 34.795  30.049  -11.762 1.00 145.39 ? 192 TYR D O   1 
ATOM 6179 C CB  . TYR D 1 150 ? 34.872  32.236  -9.602  1.00 145.39 ? 192 TYR D CB  1 
ATOM 6180 C CG  . TYR D 1 150 ? 34.693  30.880  -8.987  1.00 145.39 ? 192 TYR D CG  1 
ATOM 6181 C CD1 . TYR D 1 150 ? 35.800  30.128  -8.604  1.00 145.39 ? 192 TYR D CD1 1 
ATOM 6182 C CD2 . TYR D 1 150 ? 33.426  30.317  -8.846  1.00 145.39 ? 192 TYR D CD2 1 
ATOM 6183 C CE1 . TYR D 1 150 ? 35.657  28.849  -8.104  1.00 145.39 ? 192 TYR D CE1 1 
ATOM 6184 C CE2 . TYR D 1 150 ? 33.270  29.035  -8.342  1.00 145.39 ? 192 TYR D CE2 1 
ATOM 6185 C CZ  . TYR D 1 150 ? 34.392  28.308  -7.973  1.00 145.39 ? 192 TYR D CZ  1 
ATOM 6186 O OH  . TYR D 1 150 ? 34.262  27.041  -7.461  1.00 145.39 ? 192 TYR D OH  1 
ATOM 6187 N N   . HIS D 1 151 ? 34.141  31.893  -12.861 1.00 145.39 ? 193 HIS D N   1 
ATOM 6188 C CA  . HIS D 1 151 ? 33.404  31.124  -13.853 1.00 145.39 ? 193 HIS D CA  1 
ATOM 6189 C C   . HIS D 1 151 ? 34.393  30.665  -14.910 1.00 145.39 ? 193 HIS D C   1 
ATOM 6190 O O   . HIS D 1 151 ? 34.389  29.514  -15.332 1.00 145.39 ? 193 HIS D O   1 
ATOM 6191 C CB  . HIS D 1 151 ? 32.337  31.967  -14.545 1.00 145.39 ? 193 HIS D CB  1 
ATOM 6192 C CG  . HIS D 1 151 ? 32.205  31.657  -16.004 1.00 145.39 ? 193 HIS D CG  1 
ATOM 6193 N ND1 . HIS D 1 151 ? 33.017  32.234  -16.955 1.00 145.39 ? 193 HIS D ND1 1 
ATOM 6194 C CD2 . HIS D 1 151 ? 31.448  30.746  -16.659 1.00 145.39 ? 193 HIS D CD2 1 
ATOM 6195 C CE1 . HIS D 1 151 ? 32.774  31.687  -18.133 1.00 145.39 ? 193 HIS D CE1 1 
ATOM 6196 N NE2 . HIS D 1 151 ? 31.827  30.782  -17.980 1.00 145.39 ? 193 HIS D NE2 1 
ATOM 6197 N N   . ALA D 1 152 ? 35.177  31.623  -15.388 1.00 145.39 ? 194 ALA D N   1 
ATOM 6198 C CA  . ALA D 1 152 ? 36.170  31.386  -16.413 1.00 145.39 ? 194 ALA D CA  1 
ATOM 6199 C C   . ALA D 1 152 ? 37.182  30.354  -15.950 1.00 145.39 ? 194 ALA D C   1 
ATOM 6200 O O   . ALA D 1 152 ? 37.606  29.507  -16.731 1.00 145.39 ? 194 ALA D O   1 
ATOM 6201 C CB  . ALA D 1 152 ? 36.862  32.685  -16.759 1.00 145.39 ? 194 ALA D CB  1 
ATOM 6202 N N   . LYS D 1 153 ? 37.526  30.392  -14.666 1.00 145.39 ? 195 LYS D N   1 
ATOM 6203 C CA  . LYS D 1 153 ? 38.496  29.453  -14.117 1.00 145.39 ? 195 LYS D CA  1 
ATOM 6204 C C   . LYS D 1 153 ? 37.865  28.079  -13.896 1.00 145.39 ? 195 LYS D C   1 
ATOM 6205 O O   . LYS D 1 153 ? 38.543  27.056  -14.002 1.00 145.39 ? 195 LYS D O   1 
ATOM 6206 C CB  . LYS D 1 153 ? 39.090  29.991  -12.813 1.00 145.39 ? 195 LYS D CB  1 
ATOM 6207 C CG  . LYS D 1 153 ? 40.484  29.451  -12.488 1.00 145.39 ? 195 LYS D CG  1 
ATOM 6208 C CD  . LYS D 1 153 ? 41.008  30.056  -11.189 1.00 145.39 ? 195 LYS D CD  1 
ATOM 6209 C CE  . LYS D 1 153 ? 42.469  29.696  -10.904 1.00 145.39 ? 195 LYS D CE  1 
ATOM 6210 N NZ  . LYS D 1 153 ? 42.905  30.275  -9.590  1.00 145.39 ? 195 LYS D NZ  1 
ATOM 6211 N N   . ALA D 1 154 ? 36.565  28.062  -13.610 1.00 145.39 ? 196 ALA D N   1 
ATOM 6212 C CA  . ALA D 1 154 ? 35.841  26.816  -13.386 1.00 145.39 ? 196 ALA D CA  1 
ATOM 6213 C C   . ALA D 1 154 ? 35.585  26.105  -14.710 1.00 145.39 ? 196 ALA D C   1 
ATOM 6214 O O   . ALA D 1 154 ? 35.745  24.890  -14.813 1.00 145.39 ? 196 ALA D O   1 
ATOM 6215 C CB  . ALA D 1 154 ? 34.530  27.090  -12.669 1.00 145.39 ? 196 ALA D CB  1 
ATOM 6216 N N   . THR D 1 155 ? 35.208  26.873  -15.724 1.00 145.39 ? 197 THR D N   1 
ATOM 6217 C CA  . THR D 1 155 ? 34.940  26.318  -17.043 1.00 145.39 ? 197 THR D CA  1 
ATOM 6218 C C   . THR D 1 155 ? 36.190  25.635  -17.595 1.00 145.39 ? 197 THR D C   1 
ATOM 6219 O O   . THR D 1 155 ? 36.100  24.637  -18.308 1.00 145.39 ? 197 THR D O   1 
ATOM 6220 C CB  . THR D 1 155 ? 34.447  27.403  -18.015 1.00 145.39 ? 197 THR D CB  1 
ATOM 6221 O OG1 . THR D 1 155 ? 35.276  28.563  -17.898 1.00 145.39 ? 197 THR D OG1 1 
ATOM 6222 C CG2 . THR D 1 155 ? 33.014  27.785  -17.701 1.00 145.39 ? 197 THR D CG2 1 
ATOM 6223 N N   . GLU D 1 156 ? 37.355  26.159  -17.224 1.00 145.39 ? 198 GLU D N   1 
ATOM 6224 C CA  . GLU D 1 156 ? 38.623  25.596  -17.666 1.00 145.39 ? 198 GLU D CA  1 
ATOM 6225 C C   . GLU D 1 156 ? 38.991  24.415  -16.776 1.00 145.39 ? 198 GLU D C   1 
ATOM 6226 O O   . GLU D 1 156 ? 39.421  23.376  -17.265 1.00 145.39 ? 198 GLU D O   1 
ATOM 6227 C CB  . GLU D 1 156 ? 39.727  26.654  -17.630 1.00 145.39 ? 198 GLU D CB  1 
ATOM 6228 C CG  . GLU D 1 156 ? 40.746  26.529  -18.774 1.00 145.39 ? 198 GLU D CG  1 
ATOM 6229 C CD  . GLU D 1 156 ? 42.006  27.372  -18.556 1.00 145.39 ? 198 GLU D CD  1 
ATOM 6230 O OE1 . GLU D 1 156 ? 42.434  27.525  -17.386 1.00 145.39 ? 198 GLU D OE1 1 
ATOM 6231 O OE2 . GLU D 1 156 ? 42.581  27.869  -19.554 1.00 145.39 ? 198 GLU D OE2 1 
ATOM 6232 N N   . HIS D 1 157 ? 38.815  24.574  -15.467 1.00 145.39 ? 199 HIS D N   1 
ATOM 6233 C CA  . HIS D 1 157 ? 39.112  23.494  -14.539 1.00 145.39 ? 199 HIS D CA  1 
ATOM 6234 C C   . HIS D 1 157 ? 38.132  22.341  -14.800 1.00 145.39 ? 199 HIS D C   1 
ATOM 6235 O O   . HIS D 1 157 ? 38.355  21.209  -14.366 1.00 145.39 ? 199 HIS D O   1 
ATOM 6236 C CB  . HIS D 1 157 ? 39.030  23.995  -13.095 1.00 145.39 ? 199 HIS D CB  1 
ATOM 6237 C CG  . HIS D 1 157 ? 39.383  22.959  -12.079 1.00 145.39 ? 199 HIS D CG  1 
ATOM 6238 N ND1 . HIS D 1 157 ? 38.527  22.593  -11.064 1.00 145.39 ? 199 HIS D ND1 1 
ATOM 6239 C CD2 . HIS D 1 157 ? 40.477  22.169  -11.951 1.00 145.39 ? 199 HIS D CD2 1 
ATOM 6240 C CE1 . HIS D 1 157 ? 39.070  21.618  -10.360 1.00 145.39 ? 199 HIS D CE1 1 
ATOM 6241 N NE2 . HIS D 1 157 ? 40.252  21.340  -10.879 1.00 145.39 ? 199 HIS D NE2 1 
ATOM 6242 N N   . LEU D 1 158 ? 37.059  22.635  -15.531 1.00 145.39 ? 200 LEU D N   1 
ATOM 6243 C CA  . LEU D 1 158 ? 36.076  21.624  -15.884 1.00 145.39 ? 200 LEU D CA  1 
ATOM 6244 C C   . LEU D 1 158 ? 36.576  20.822  -17.067 1.00 145.39 ? 200 LEU D C   1 
ATOM 6245 O O   . LEU D 1 158 ? 36.583  19.597  -17.029 1.00 145.39 ? 200 LEU D O   1 
ATOM 6246 C CB  . LEU D 1 158 ? 34.736  22.259  -16.230 1.00 145.39 ? 200 LEU D CB  1 
ATOM 6247 C CG  . LEU D 1 158 ? 33.735  22.315  -15.081 1.00 145.39 ? 200 LEU D CG  1 
ATOM 6248 C CD1 . LEU D 1 158 ? 32.438  22.910  -15.581 1.00 145.39 ? 200 LEU D CD1 1 
ATOM 6249 C CD2 . LEU D 1 158 ? 33.498  20.917  -14.541 1.00 145.39 ? 200 LEU D CD2 1 
ATOM 6250 N N   . SER D 1 159 ? 37.034  21.524  -18.098 1.00 145.39 ? 201 SER D N   1 
ATOM 6251 C CA  . SER D 1 159 ? 37.547  20.881  -19.303 1.00 145.39 ? 201 SER D CA  1 
ATOM 6252 C C   . SER D 1 159 ? 38.852  20.095  -19.072 1.00 145.39 ? 201 SER D C   1 
ATOM 6253 O O   . SER D 1 159 ? 39.204  19.230  -19.879 1.00 145.39 ? 201 SER D O   1 
ATOM 6254 C CB  . SER D 1 159 ? 37.732  21.918  -20.409 1.00 145.39 ? 201 SER D CB  1 
ATOM 6255 O OG  . SER D 1 159 ? 37.923  21.281  -21.658 1.00 145.39 ? 201 SER D OG  1 
ATOM 6256 N N   . THR D 1 160 ? 39.541  20.376  -17.960 1.00 145.39 ? 202 THR D N   1 
ATOM 6257 C CA  . THR D 1 160 ? 40.796  19.689  -17.606 1.00 145.39 ? 202 THR D CA  1 
ATOM 6258 C C   . THR D 1 160 ? 40.526  18.274  -17.086 1.00 145.39 ? 202 THR D C   1 
ATOM 6259 O O   . THR D 1 160 ? 41.454  17.518  -16.782 1.00 145.39 ? 202 THR D O   1 
ATOM 6260 C CB  . THR D 1 160 ? 41.609  20.449  -16.503 1.00 145.39 ? 202 THR D CB  1 
ATOM 6261 O OG1 . THR D 1 160 ? 40.853  20.516  -15.285 1.00 145.39 ? 202 THR D OG1 1 
ATOM 6262 C CG2 . THR D 1 160 ? 41.973  21.853  -16.957 1.00 145.39 ? 202 THR D CG2 1 
ATOM 6263 N N   . LEU D 1 161 ? 39.246  17.934  -16.981 1.00 145.39 ? 203 LEU D N   1 
ATOM 6264 C CA  . LEU D 1 161 ? 38.809  16.636  -16.493 1.00 145.39 ? 203 LEU D CA  1 
ATOM 6265 C C   . LEU D 1 161 ? 38.860  15.557  -17.578 1.00 145.39 ? 203 LEU D C   1 
ATOM 6266 O O   . LEU D 1 161 ? 39.256  14.422  -17.306 1.00 145.39 ? 203 LEU D O   1 
ATOM 6267 C CB  . LEU D 1 161 ? 37.392  16.766  -15.944 1.00 145.39 ? 203 LEU D CB  1 
ATOM 6268 C CG  . LEU D 1 161 ? 36.880  15.662  -15.027 1.00 145.39 ? 203 LEU D CG  1 
ATOM 6269 C CD1 . LEU D 1 161 ? 37.805  15.528  -13.822 1.00 145.39 ? 203 LEU D CD1 1 
ATOM 6270 C CD2 . LEU D 1 161 ? 35.460  15.998  -14.594 1.00 145.39 ? 203 LEU D CD2 1 
ATOM 6271 N N   . SER D 1 162 ? 38.482  15.917  -18.808 1.00 145.39 ? 204 SER D N   1 
ATOM 6272 C CA  . SER D 1 162 ? 38.500  14.970  -19.928 1.00 145.39 ? 204 SER D CA  1 
ATOM 6273 C C   . SER D 1 162 ? 39.937  14.553  -20.219 1.00 145.39 ? 204 SER D C   1 
ATOM 6274 O O   . SER D 1 162 ? 40.204  13.716  -21.082 1.00 145.39 ? 204 SER D O   1 
ATOM 6275 C CB  . SER D 1 162 ? 37.879  15.589  -21.184 1.00 145.39 ? 204 SER D CB  1 
ATOM 6276 O OG  . SER D 1 162 ? 38.775  16.494  -21.805 1.00 145.39 ? 204 SER D OG  1 
ATOM 6277 N N   . GLU D 1 163 ? 40.855  15.181  -19.497 1.00 145.39 ? 205 GLU D N   1 
ATOM 6278 C CA  . GLU D 1 163 ? 42.265  14.915  -19.619 1.00 145.39 ? 205 GLU D CA  1 
ATOM 6279 C C   . GLU D 1 163 ? 42.716  13.928  -18.527 1.00 145.39 ? 205 GLU D C   1 
ATOM 6280 O O   . GLU D 1 163 ? 43.302  12.896  -18.850 1.00 145.39 ? 205 GLU D O   1 
ATOM 6281 C CB  . GLU D 1 163 ? 43.009  16.248  -19.566 1.00 145.39 ? 205 GLU D CB  1 
ATOM 6282 C CG  . GLU D 1 163 ? 44.472  16.183  -19.916 1.00 145.39 ? 205 GLU D CG  1 
ATOM 6283 C CD  . GLU D 1 163 ? 45.366  16.203  -18.689 1.00 145.39 ? 205 GLU D CD  1 
ATOM 6284 O OE1 . GLU D 1 163 ? 44.843  16.094  -17.553 1.00 145.39 ? 205 GLU D OE1 1 
ATOM 6285 O OE2 . GLU D 1 163 ? 46.597  16.336  -18.864 1.00 145.39 ? 205 GLU D OE2 1 
ATOM 6286 N N   . LYS D 1 164 ? 42.391  14.184  -17.256 1.00 145.39 ? 206 LYS D N   1 
ATOM 6287 C CA  . LYS D 1 164 ? 42.810  13.243  -16.213 1.00 145.39 ? 206 LYS D CA  1 
ATOM 6288 C C   . LYS D 1 164 ? 41.948  11.980  -16.194 1.00 145.39 ? 206 LYS D C   1 
ATOM 6289 O O   . LYS D 1 164 ? 42.013  11.178  -15.262 1.00 145.39 ? 206 LYS D O   1 
ATOM 6290 C CB  . LYS D 1 164 ? 42.881  13.890  -14.823 1.00 145.39 ? 206 LYS D CB  1 
ATOM 6291 C CG  . LYS D 1 164 ? 44.000  13.275  -13.959 1.00 145.39 ? 206 LYS D CG  1 
ATOM 6292 C CD  . LYS D 1 164 ? 43.975  13.731  -12.504 1.00 145.39 ? 206 LYS D CD  1 
ATOM 6293 C CE  . LYS D 1 164 ? 45.100  13.082  -11.683 1.00 145.39 ? 206 LYS D CE  1 
ATOM 6294 N NZ  . LYS D 1 164 ? 44.872  13.226  -10.208 1.00 145.39 ? 206 LYS D NZ  1 
ATOM 6295 N N   . ALA D 1 165 ? 41.181  11.790  -17.262 1.00 145.39 ? 207 ALA D N   1 
ATOM 6296 C CA  . ALA D 1 165 ? 40.327  10.625  -17.404 1.00 145.39 ? 207 ALA D CA  1 
ATOM 6297 C C   . ALA D 1 165 ? 41.125  9.426   -17.922 1.00 145.39 ? 207 ALA D C   1 
ATOM 6298 O O   . ALA D 1 165 ? 41.401  8.485   -17.177 1.00 145.39 ? 207 ALA D O   1 
ATOM 6299 C CB  . ALA D 1 165 ? 39.178  10.942  -18.345 1.00 145.39 ? 207 ALA D CB  1 
ATOM 6300 N N   . LYS D 1 166 ? 41.581  9.526   -19.170 1.00 145.39 ? 208 LYS D N   1 
ATOM 6301 C CA  . LYS D 1 166 ? 42.335  8.472   -19.857 1.00 145.39 ? 208 LYS D CA  1 
ATOM 6302 C C   . LYS D 1 166 ? 43.368  7.623   -19.091 1.00 145.39 ? 208 LYS D C   1 
ATOM 6303 O O   . LYS D 1 166 ? 43.411  6.407   -19.268 1.00 145.39 ? 208 LYS D O   1 
ATOM 6304 C CB  . LYS D 1 166 ? 42.957  9.044   -21.139 1.00 145.39 ? 208 LYS D CB  1 
ATOM 6305 C CG  . LYS D 1 166 ? 43.480  8.011   -22.139 1.00 145.39 ? 208 LYS D CG  1 
ATOM 6306 C CD  . LYS D 1 166 ? 44.074  8.706   -23.376 1.00 145.39 ? 208 LYS D CD  1 
ATOM 6307 C CE  . LYS D 1 166 ? 44.702  7.718   -24.374 1.00 145.39 ? 208 LYS D CE  1 
ATOM 6308 N NZ  . LYS D 1 166 ? 45.395  8.402   -25.522 1.00 145.39 ? 208 LYS D NZ  1 
ATOM 6309 N N   . PRO D 1 167 ? 44.199  8.233   -18.221 1.00 82.01  ? 209 PRO D N   1 
ATOM 6310 C CA  . PRO D 1 167 ? 45.170  7.385   -17.519 1.00 82.01  ? 209 PRO D CA  1 
ATOM 6311 C C   . PRO D 1 167 ? 44.527  6.280   -16.708 1.00 82.01  ? 209 PRO D C   1 
ATOM 6312 O O   . PRO D 1 167 ? 44.877  5.111   -16.851 1.00 82.01  ? 209 PRO D O   1 
ATOM 6313 C CB  . PRO D 1 167 ? 45.904  8.379   -16.616 1.00 82.01  ? 209 PRO D CB  1 
ATOM 6314 C CG  . PRO D 1 167 ? 44.868  9.425   -16.353 1.00 82.01  ? 209 PRO D CG  1 
ATOM 6315 C CD  . PRO D 1 167 ? 44.284  9.618   -17.732 1.00 82.01  ? 209 PRO D CD  1 
ATOM 6316 N N   . ALA D 1 168 ? 43.584  6.660   -15.858 1.00 82.01  ? 210 ALA D N   1 
ATOM 6317 C CA  . ALA D 1 168 ? 42.892  5.712   -15.012 1.00 82.01  ? 210 ALA D CA  1 
ATOM 6318 C C   . ALA D 1 168 ? 42.349  4.548   -15.817 1.00 82.01  ? 210 ALA D C   1 
ATOM 6319 O O   . ALA D 1 168 ? 42.406  3.412   -15.379 1.00 82.01  ? 210 ALA D O   1 
ATOM 6320 C CB  . ALA D 1 168 ? 41.784  6.407   -14.274 1.00 82.01  ? 210 ALA D CB  1 
ATOM 6321 N N   . LEU D 1 169 ? 41.886  4.833   -17.024 1.00 82.01  ? 211 LEU D N   1 
ATOM 6322 C CA  . LEU D 1 169 ? 41.329  3.807   -17.892 1.00 82.01  ? 211 LEU D CA  1 
ATOM 6323 C C   . LEU D 1 169 ? 42.369  2.739   -18.189 1.00 82.01  ? 211 LEU D C   1 
ATOM 6324 O O   . LEU D 1 169 ? 42.077  1.541   -18.202 1.00 82.01  ? 211 LEU D O   1 
ATOM 6325 C CB  . LEU D 1 169 ? 40.872  4.445   -19.194 1.00 82.01  ? 211 LEU D CB  1 
ATOM 6326 C CG  . LEU D 1 169 ? 39.893  5.605   -19.025 1.00 82.01  ? 211 LEU D CG  1 
ATOM 6327 C CD1 . LEU D 1 169 ? 39.745  6.344   -20.343 1.00 82.01  ? 211 LEU D CD1 1 
ATOM 6328 C CD2 . LEU D 1 169 ? 38.550  5.090   -18.522 1.00 82.01  ? 211 LEU D CD2 1 
ATOM 6329 N N   . GLU D 1 170 ? 43.596  3.187   -18.415 1.00 82.01  ? 212 GLU D N   1 
ATOM 6330 C CA  . GLU D 1 170 ? 44.678  2.272   -18.710 1.00 82.01  ? 212 GLU D CA  1 
ATOM 6331 C C   . GLU D 1 170 ? 44.933  1.511   -17.441 1.00 82.01  ? 212 GLU D C   1 
ATOM 6332 O O   . GLU D 1 170 ? 45.050  0.290   -17.457 1.00 82.01  ? 212 GLU D O   1 
ATOM 6333 C CB  . GLU D 1 170 ? 45.917  3.035   -19.160 1.00 82.01  ? 212 GLU D CB  1 
ATOM 6334 C CG  . GLU D 1 170 ? 45.600  4.122   -20.195 1.00 82.01  ? 212 GLU D CG  1 
ATOM 6335 C CD  . GLU D 1 170 ? 44.390  3.787   -21.091 1.00 82.01  ? 212 GLU D CD  1 
ATOM 6336 O OE1 . GLU D 1 170 ? 44.432  2.791   -21.854 1.00 82.01  ? 212 GLU D OE1 1 
ATOM 6337 O OE2 . GLU D 1 170 ? 43.383  4.525   -21.028 1.00 82.01  ? 212 GLU D OE2 1 
ATOM 6338 N N   . ASP D 1 171 ? 44.926  2.242   -16.331 1.00 82.01  ? 213 ASP D N   1 
ATOM 6339 C CA  . ASP D 1 171 ? 45.119  1.645   -15.021 1.00 82.01  ? 213 ASP D CA  1 
ATOM 6340 C C   . ASP D 1 171 ? 44.020  0.628   -14.820 1.00 82.01  ? 213 ASP D C   1 
ATOM 6341 O O   . ASP D 1 171 ? 44.229  -0.400  -14.187 1.00 82.01  ? 213 ASP D O   1 
ATOM 6342 C CB  . ASP D 1 171 ? 45.006  2.696   -13.920 1.00 82.01  ? 213 ASP D CB  1 
ATOM 6343 C CG  . ASP D 1 171 ? 46.242  3.546   -13.797 1.00 82.01  ? 213 ASP D CG  1 
ATOM 6344 O OD1 . ASP D 1 171 ? 47.319  2.973   -13.538 1.00 82.01  ? 213 ASP D OD1 1 
ATOM 6345 O OD2 . ASP D 1 171 ? 46.141  4.782   -13.950 1.00 82.01  ? 213 ASP D OD2 1 
ATOM 6346 N N   . LEU D 1 172 ? 42.849  0.922   -15.379 1.00 82.01  ? 214 LEU D N   1 
ATOM 6347 C CA  . LEU D 1 172 ? 41.697  0.045   -15.268 1.00 82.01  ? 214 LEU D CA  1 
ATOM 6348 C C   . LEU D 1 172 ? 42.104  -1.237  -15.926 1.00 82.01  ? 214 LEU D C   1 
ATOM 6349 O O   . LEU D 1 172 ? 42.202  -2.269  -15.275 1.00 82.01  ? 214 LEU D O   1 
ATOM 6350 C CB  . LEU D 1 172 ? 40.497  0.620   -16.019 1.00 82.01  ? 214 LEU D CB  1 
ATOM 6351 C CG  . LEU D 1 172 ? 39.350  -0.363  -16.243 1.00 82.01  ? 214 LEU D CG  1 
ATOM 6352 C CD1 . LEU D 1 172 ? 38.735  -0.662  -14.899 1.00 82.01  ? 214 LEU D CD1 1 
ATOM 6353 C CD2 . LEU D 1 172 ? 38.305  0.194   -17.200 1.00 82.01  ? 214 LEU D CD2 1 
ATOM 6354 N N   . ARG D 1 173 ? 42.392  -1.140  -17.218 1.00 82.01  ? 215 ARG D N   1 
ATOM 6355 C CA  . ARG D 1 173 ? 42.802  -2.272  -18.014 1.00 82.01  ? 215 ARG D CA  1 
ATOM 6356 C C   . ARG D 1 173 ? 43.776  -3.132  -17.214 1.00 82.01  ? 215 ARG D C   1 
ATOM 6357 O O   . ARG D 1 173 ? 43.497  -4.287  -16.896 1.00 82.01  ? 215 ARG D O   1 
ATOM 6358 C CB  . ARG D 1 173 ? 43.474  -1.763  -19.285 1.00 82.01  ? 215 ARG D CB  1 
ATOM 6359 C CG  . ARG D 1 173 ? 43.955  -2.871  -20.202 1.00 82.01  ? 215 ARG D CG  1 
ATOM 6360 C CD  . ARG D 1 173 ? 44.855  -2.361  -21.321 1.00 82.01  ? 215 ARG D CD  1 
ATOM 6361 N NE  . ARG D 1 173 ? 46.074  -1.745  -20.806 1.00 82.01  ? 215 ARG D NE  1 
ATOM 6362 C CZ  . ARG D 1 173 ? 46.289  -0.436  -20.789 1.00 82.01  ? 215 ARG D CZ  1 
ATOM 6363 N NH1 . ARG D 1 173 ? 45.360  0.378   -21.269 1.00 82.01  ? 215 ARG D NH1 1 
ATOM 6364 N NH2 . ARG D 1 173 ? 47.414  0.058   -20.288 1.00 82.01  ? 215 ARG D NH2 1 
ATOM 6365 N N   . GLN D 1 174 ? 44.859  -2.496  -16.789 1.00 82.01  ? 216 GLN D N   1 
ATOM 6366 C CA  . GLN D 1 174 ? 45.932  -3.127  -16.024 1.00 82.01  ? 216 GLN D CA  1 
ATOM 6367 C C   . GLN D 1 174 ? 45.434  -3.939  -14.815 1.00 82.01  ? 216 GLN D C   1 
ATOM 6368 O O   . GLN D 1 174 ? 45.620  -5.157  -14.749 1.00 82.01  ? 216 GLN D O   1 
ATOM 6369 C CB  . GLN D 1 174 ? 46.924  -2.030  -15.585 1.00 82.01  ? 216 GLN D CB  1 
ATOM 6370 C CG  . GLN D 1 174 ? 48.340  -2.501  -15.197 1.00 82.01  ? 216 GLN D CG  1 
ATOM 6371 C CD  . GLN D 1 174 ? 49.358  -1.349  -15.027 1.00 82.01  ? 216 GLN D CD  1 
ATOM 6372 O OE1 . GLN D 1 174 ? 49.363  -0.379  -15.802 1.00 82.01  ? 216 GLN D OE1 1 
ATOM 6373 N NE2 . GLN D 1 174 ? 50.243  -1.477  -14.026 1.00 82.01  ? 216 GLN D NE2 1 
ATOM 6374 N N   . GLY D 1 175 ? 44.753  -3.264  -13.893 1.00 82.01  ? 217 GLY D N   1 
ATOM 6375 C CA  . GLY D 1 175 ? 44.244  -3.915  -12.693 1.00 82.01  ? 217 GLY D CA  1 
ATOM 6376 C C   . GLY D 1 175 ? 43.374  -5.124  -12.954 1.00 82.01  ? 217 GLY D C   1 
ATOM 6377 O O   . GLY D 1 175 ? 43.250  -6.008  -12.104 1.00 82.01  ? 217 GLY D O   1 
ATOM 6378 N N   . LEU D 1 176 ? 42.775  -5.152  -14.137 1.00 82.01  ? 218 LEU D N   1 
ATOM 6379 C CA  . LEU D 1 176 ? 41.907  -6.239  -14.546 1.00 82.01  ? 218 LEU D CA  1 
ATOM 6380 C C   . LEU D 1 176 ? 42.733  -7.427  -14.951 1.00 82.01  ? 218 LEU D C   1 
ATOM 6381 O O   . LEU D 1 176 ? 42.522  -8.528  -14.466 1.00 82.01  ? 218 LEU D O   1 
ATOM 6382 C CB  . LEU D 1 176 ? 41.077  -5.820  -15.751 1.00 82.01  ? 218 LEU D CB  1 
ATOM 6383 C CG  . LEU D 1 176 ? 39.928  -4.844  -15.553 1.00 82.01  ? 218 LEU D CG  1 
ATOM 6384 C CD1 . LEU D 1 176 ? 40.134  -3.954  -14.336 1.00 82.01  ? 218 LEU D CD1 1 
ATOM 6385 C CD2 . LEU D 1 176 ? 39.767  -4.038  -16.824 1.00 82.01  ? 218 LEU D CD2 1 
ATOM 6386 N N   . LEU D 1 177 ? 43.674  -7.180  -15.857 1.00 82.01  ? 219 LEU D N   1 
ATOM 6387 C CA  . LEU D 1 177 ? 44.563  -8.193  -16.410 1.00 82.01  ? 219 LEU D CA  1 
ATOM 6388 C C   . LEU D 1 177 ? 45.137  -9.210  -15.465 1.00 82.01  ? 219 LEU D C   1 
ATOM 6389 O O   . LEU D 1 177 ? 45.454  -8.895  -14.328 1.00 82.01  ? 219 LEU D O   1 
ATOM 6390 C CB  . LEU D 1 177 ? 45.732  -7.519  -17.119 1.00 82.01  ? 219 LEU D CB  1 
ATOM 6391 C CG  . LEU D 1 177 ? 45.386  -6.485  -18.178 1.00 82.01  ? 219 LEU D CG  1 
ATOM 6392 C CD1 . LEU D 1 177 ? 46.637  -6.227  -19.017 1.00 82.01  ? 219 LEU D CD1 1 
ATOM 6393 C CD2 . LEU D 1 177 ? 44.228  -6.980  -19.041 1.00 82.01  ? 219 LEU D CD2 1 
ATOM 6394 N N   . PRO D 1 178 ? 45.434  -10.408 -15.990 1.00 136.59 ? 220 PRO D N   1 
ATOM 6395 C CA  . PRO D 1 178 ? 45.998  -11.588 -15.321 1.00 136.59 ? 220 PRO D CA  1 
ATOM 6396 C C   . PRO D 1 178 ? 47.275  -11.338 -14.529 1.00 136.59 ? 220 PRO D C   1 
ATOM 6397 O O   . PRO D 1 178 ? 47.898  -10.288 -14.648 1.00 136.59 ? 220 PRO D O   1 
ATOM 6398 C CB  . PRO D 1 178 ? 46.291  -12.517 -16.505 1.00 136.59 ? 220 PRO D CB  1 
ATOM 6399 C CG  . PRO D 1 178 ? 46.557  -11.566 -17.639 1.00 136.59 ? 220 PRO D CG  1 
ATOM 6400 C CD  . PRO D 1 178 ? 45.406  -10.633 -17.447 1.00 136.59 ? 220 PRO D CD  1 
ATOM 6401 N N   . VAL D 1 179 ? 47.663  -12.344 -13.748 1.00 136.59 ? 221 VAL D N   1 
ATOM 6402 C CA  . VAL D 1 179 ? 48.873  -12.296 -12.930 1.00 136.59 ? 221 VAL D CA  1 
ATOM 6403 C C   . VAL D 1 179 ? 49.617  -13.638 -13.015 1.00 136.59 ? 221 VAL D C   1 
ATOM 6404 O O   . VAL D 1 179 ? 49.263  -14.598 -12.330 1.00 136.59 ? 221 VAL D O   1 
ATOM 6405 C CB  . VAL D 1 179 ? 48.534  -12.010 -11.447 1.00 136.59 ? 221 VAL D CB  1 
ATOM 6406 C CG1 . VAL D 1 179 ? 49.808  -11.797 -10.648 1.00 136.59 ? 221 VAL D CG1 1 
ATOM 6407 C CG2 . VAL D 1 179 ? 47.620  -10.796 -11.324 1.00 136.59 ? 221 VAL D CG2 1 
ATOM 6408 N N   . LEU D 1 180 ? 50.634  -13.698 -13.867 1.00 136.59 ? 222 LEU D N   1 
ATOM 6409 C CA  . LEU D 1 180 ? 51.442  -14.903 -14.058 1.00 136.59 ? 222 LEU D CA  1 
ATOM 6410 C C   . LEU D 1 180 ? 52.388  -15.044 -12.866 1.00 136.59 ? 222 LEU D C   1 
ATOM 6411 O O   . LEU D 1 180 ? 53.606  -15.095 -13.036 1.00 136.59 ? 222 LEU D O   1 
ATOM 6412 C CB  . LEU D 1 180 ? 52.268  -14.742 -15.336 1.00 136.59 ? 222 LEU D CB  1 
ATOM 6413 C CG  . LEU D 1 180 ? 51.540  -14.403 -16.638 1.00 136.59 ? 222 LEU D CG  1 
ATOM 6414 C CD1 . LEU D 1 180 ? 52.491  -13.784 -17.654 1.00 136.59 ? 222 LEU D CD1 1 
ATOM 6415 C CD2 . LEU D 1 180 ? 50.919  -15.660 -17.181 1.00 136.59 ? 222 LEU D CD2 1 
ATOM 6416 N N   . GLU D 1 181 ? 51.826  -15.143 -11.668 1.00 136.59 ? 223 GLU D N   1 
ATOM 6417 C CA  . GLU D 1 181 ? 52.615  -15.220 -10.449 1.00 136.59 ? 223 GLU D CA  1 
ATOM 6418 C C   . GLU D 1 181 ? 53.828  -16.131 -10.511 1.00 136.59 ? 223 GLU D C   1 
ATOM 6419 O O   . GLU D 1 181 ? 53.711  -17.359 -10.546 1.00 136.59 ? 223 GLU D O   1 
ATOM 6420 C CB  . GLU D 1 181 ? 51.735  -15.592 -9.265  1.00 136.59 ? 223 GLU D CB  1 
ATOM 6421 C CG  . GLU D 1 181 ? 52.408  -15.374 -7.926  1.00 136.59 ? 223 GLU D CG  1 
ATOM 6422 C CD  . GLU D 1 181 ? 51.455  -15.579 -6.767  1.00 136.59 ? 223 GLU D CD  1 
ATOM 6423 O OE1 . GLU D 1 181 ? 50.535  -14.747 -6.594  1.00 136.59 ? 223 GLU D OE1 1 
ATOM 6424 O OE2 . GLU D 1 181 ? 51.621  -16.577 -6.033  1.00 136.59 ? 223 GLU D OE2 1 
ATOM 6425 N N   . SER D 1 182 ? 54.997  -15.496 -10.543 1.00 136.59 ? 224 SER D N   1 
ATOM 6426 C CA  . SER D 1 182 ? 56.266  -16.205 -10.589 1.00 136.59 ? 224 SER D CA  1 
ATOM 6427 C C   . SER D 1 182 ? 56.359  -17.092 -9.358  1.00 136.59 ? 224 SER D C   1 
ATOM 6428 O O   . SER D 1 182 ? 55.913  -16.708 -8.271  1.00 136.59 ? 224 SER D O   1 
ATOM 6429 C CB  . SER D 1 182 ? 57.436  -15.205 -10.632 1.00 136.59 ? 224 SER D CB  1 
ATOM 6430 O OG  . SER D 1 182 ? 57.372  -14.252 -9.579  1.00 136.59 ? 224 SER D OG  1 
ATOM 6431 N N   . PHE D 1 183 ? 56.891  -18.296 -9.528  1.00 136.59 ? 225 PHE D N   1 
ATOM 6432 C CA  . PHE D 1 183 ? 56.991  -19.162 -8.380  1.00 136.59 ? 225 PHE D CA  1 
ATOM 6433 C C   . PHE D 1 183 ? 58.344  -19.740 -8.016  1.00 136.59 ? 225 PHE D C   1 
ATOM 6434 O O   . PHE D 1 183 ? 58.998  -20.433 -8.801  1.00 136.59 ? 225 PHE D O   1 
ATOM 6435 C CB  . PHE D 1 183 ? 55.927  -20.242 -8.402  1.00 136.59 ? 225 PHE D CB  1 
ATOM 6436 C CG  . PHE D 1 183 ? 55.666  -20.825 -7.059  1.00 136.59 ? 225 PHE D CG  1 
ATOM 6437 C CD1 . PHE D 1 183 ? 55.592  -19.990 -5.940  1.00 136.59 ? 225 PHE D CD1 1 
ATOM 6438 C CD2 . PHE D 1 183 ? 55.571  -22.197 -6.882  1.00 136.59 ? 225 PHE D CD2 1 
ATOM 6439 C CE1 . PHE D 1 183 ? 55.419  -20.515 -4.663  1.00 136.59 ? 225 PHE D CE1 1 
ATOM 6440 C CE2 . PHE D 1 183 ? 55.397  -22.739 -5.604  1.00 136.59 ? 225 PHE D CE2 1 
ATOM 6441 C CZ  . PHE D 1 183 ? 55.327  -21.892 -4.489  1.00 136.59 ? 225 PHE D CZ  1 
ATOM 6442 N N   . LYS D 1 184 ? 58.714  -19.452 -6.771  1.00 136.59 ? 226 LYS D N   1 
ATOM 6443 C CA  . LYS D 1 184 ? 59.965  -19.876 -6.162  1.00 136.59 ? 226 LYS D CA  1 
ATOM 6444 C C   . LYS D 1 184 ? 59.594  -20.971 -5.169  1.00 136.59 ? 226 LYS D C   1 
ATOM 6445 O O   . LYS D 1 184 ? 59.056  -22.000 -5.554  1.00 136.59 ? 226 LYS D O   1 
ATOM 6446 C CB  . LYS D 1 184 ? 60.588  -18.684 -5.415  1.00 136.59 ? 226 LYS D CB  1 
ATOM 6447 C CG  . LYS D 1 184 ? 60.630  -17.370 -6.202  1.00 136.59 ? 226 LYS D CG  1 
ATOM 6448 C CD  . LYS D 1 184 ? 61.285  -16.237 -5.404  1.00 136.59 ? 226 LYS D CD  1 
ATOM 6449 C CE  . LYS D 1 184 ? 61.562  -15.010 -6.286  1.00 136.59 ? 226 LYS D CE  1 
ATOM 6450 N NZ  . LYS D 1 184 ? 62.374  -13.967 -5.578  1.00 136.59 ? 226 LYS D NZ  1 
ATOM 6451 N N   . VAL D 1 185 ? 59.906  -20.739 -3.899  1.00 136.59 ? 227 VAL D N   1 
ATOM 6452 C CA  . VAL D 1 185 ? 59.600  -21.635 -2.796  1.00 136.59 ? 227 VAL D CA  1 
ATOM 6453 C C   . VAL D 1 185 ? 60.141  -20.934 -1.602  1.00 136.59 ? 227 VAL D C   1 
ATOM 6454 O O   . VAL D 1 185 ? 61.070  -20.145 -1.712  1.00 136.59 ? 227 VAL D O   1 
ATOM 6455 C CB  . VAL D 1 185 ? 60.301  -22.998 -2.855  1.00 136.59 ? 227 VAL D CB  1 
ATOM 6456 C CG1 . VAL D 1 185 ? 59.443  -23.989 -3.575  1.00 136.59 ? 227 VAL D CG1 1 
ATOM 6457 C CG2 . VAL D 1 185 ? 61.660  -22.892 -3.490  1.00 136.59 ? 227 VAL D CG2 1 
ATOM 6458 N N   . SER D 1 186 ? 59.552  -21.195 -0.453  1.00 90.93  ? 228 SER D N   1 
ATOM 6459 C CA  . SER D 1 186 ? 60.051  -20.554 0.734   1.00 90.93  ? 228 SER D CA  1 
ATOM 6460 C C   . SER D 1 186 ? 61.516  -20.958 0.818   1.00 90.93  ? 228 SER D C   1 
ATOM 6461 O O   . SER D 1 186 ? 62.367  -20.114 0.986   1.00 90.93  ? 228 SER D O   1 
ATOM 6462 C CB  . SER D 1 186 ? 59.278  -21.031 1.957   1.00 90.93  ? 228 SER D CB  1 
ATOM 6463 O OG  . SER D 1 186 ? 59.605  -20.256 3.098   1.00 90.93  ? 228 SER D OG  1 
ATOM 6464 N N   . PHE D 1 187 ? 61.787  -22.211 0.470   1.00 90.93  ? 229 PHE D N   1 
ATOM 6465 C CA  . PHE D 1 187 ? 63.124  -22.801 0.511   1.00 90.93  ? 229 PHE D CA  1 
ATOM 6466 C C   . PHE D 1 187 ? 64.081  -21.967 -0.281  1.00 90.93  ? 229 PHE D C   1 
ATOM 6467 O O   . PHE D 1 187 ? 65.183  -21.662 0.158   1.00 90.93  ? 229 PHE D O   1 
ATOM 6468 C CB  . PHE D 1 187 ? 63.115  -24.198 -0.097  1.00 90.93  ? 229 PHE D CB  1 
ATOM 6469 C CG  . PHE D 1 187 ? 61.773  -24.858 -0.073  1.00 90.93  ? 229 PHE D CG  1 
ATOM 6470 C CD1 . PHE D 1 187 ? 60.909  -24.683 1.009   1.00 90.93  ? 229 PHE D CD1 1 
ATOM 6471 C CD2 . PHE D 1 187 ? 61.353  -25.623 -1.148  1.00 90.93  ? 229 PHE D CD2 1 
ATOM 6472 C CE1 . PHE D 1 187 ? 59.644  -25.252 1.012   1.00 90.93  ? 229 PHE D CE1 1 
ATOM 6473 C CE2 . PHE D 1 187 ? 60.085  -26.202 -1.155  1.00 90.93  ? 229 PHE D CE2 1 
ATOM 6474 C CZ  . PHE D 1 187 ? 59.229  -26.012 -0.074  1.00 90.93  ? 229 PHE D CZ  1 
ATOM 6475 N N   . LEU D 1 188 ? 63.649  -21.595 -1.468  1.00 90.93  ? 230 LEU D N   1 
ATOM 6476 C CA  . LEU D 1 188 ? 64.493  -20.788 -2.291  1.00 90.93  ? 230 LEU D CA  1 
ATOM 6477 C C   . LEU D 1 188 ? 64.584  -19.422 -1.663  1.00 90.93  ? 230 LEU D C   1 
ATOM 6478 O O   . LEU D 1 188 ? 65.671  -18.906 -1.434  1.00 90.93  ? 230 LEU D O   1 
ATOM 6479 C CB  . LEU D 1 188 ? 63.929  -20.678 -3.677  1.00 90.93  ? 230 LEU D CB  1 
ATOM 6480 C CG  . LEU D 1 188 ? 65.067  -20.229 -4.570  1.00 90.93  ? 230 LEU D CG  1 
ATOM 6481 C CD1 . LEU D 1 188 ? 66.260  -21.142 -4.346  1.00 90.93  ? 230 LEU D CD1 1 
ATOM 6482 C CD2 . LEU D 1 188 ? 64.621  -20.247 -6.007  1.00 90.93  ? 230 LEU D CD2 1 
ATOM 6483 N N   . SER D 1 189 ? 63.421  -18.854 -1.372  1.00 90.93  ? 231 SER D N   1 
ATOM 6484 C CA  . SER D 1 189 ? 63.315  -17.552 -0.739  1.00 90.93  ? 231 SER D CA  1 
ATOM 6485 C C   . SER D 1 189 ? 64.221  -17.540 0.474   1.00 90.93  ? 231 SER D C   1 
ATOM 6486 O O   . SER D 1 189 ? 64.894  -16.556 0.752   1.00 90.93  ? 231 SER D O   1 
ATOM 6487 C CB  . SER D 1 189 ? 61.864  -17.324 -0.302  1.00 90.93  ? 231 SER D CB  1 
ATOM 6488 O OG  . SER D 1 189 ? 61.761  -16.305 0.677   1.00 90.93  ? 231 SER D OG  1 
ATOM 6489 N N   . ALA D 1 190 ? 64.317  -18.701 1.110   1.00 90.93  ? 232 ALA D N   1 
ATOM 6490 C CA  . ALA D 1 190 ? 65.108  -18.880 2.311   1.00 90.93  ? 232 ALA D CA  1 
ATOM 6491 C C   . ALA D 1 190 ? 66.569  -18.674 2.008   1.00 90.93  ? 232 ALA D C   1 
ATOM 6492 O O   . ALA D 1 190 ? 67.255  -17.950 2.716   1.00 90.93  ? 232 ALA D O   1 
ATOM 6493 C CB  . ALA D 1 190 ? 64.879  -20.256 2.882   1.00 90.93  ? 232 ALA D CB  1 
ATOM 6494 N N   . LEU D 1 191 ? 67.035  -19.308 0.944   1.00 90.93  ? 233 LEU D N   1 
ATOM 6495 C CA  . LEU D 1 191 ? 68.416  -19.169 0.550   1.00 90.93  ? 233 LEU D CA  1 
ATOM 6496 C C   . LEU D 1 191 ? 68.717  -17.730 0.246   1.00 90.93  ? 233 LEU D C   1 
ATOM 6497 O O   . LEU D 1 191 ? 69.654  -17.173 0.801   1.00 90.93  ? 233 LEU D O   1 
ATOM 6498 C CB  . LEU D 1 191 ? 68.713  -20.033 -0.654  1.00 90.93  ? 233 LEU D CB  1 
ATOM 6499 C CG  . LEU D 1 191 ? 68.901  -21.460 -0.178  1.00 90.93  ? 233 LEU D CG  1 
ATOM 6500 C CD1 . LEU D 1 191 ? 69.119  -22.380 -1.354  1.00 90.93  ? 233 LEU D CD1 1 
ATOM 6501 C CD2 . LEU D 1 191 ? 70.076  -21.498 0.780   1.00 90.93  ? 233 LEU D CD2 1 
ATOM 6502 N N   . GLU D 1 192 ? 67.899  -17.125 -0.610  1.00 90.93  ? 234 GLU D N   1 
ATOM 6503 C CA  . GLU D 1 192 ? 68.081  -15.723 -0.976  1.00 90.93  ? 234 GLU D CA  1 
ATOM 6504 C C   . GLU D 1 192 ? 68.339  -14.928 0.295   1.00 90.93  ? 234 GLU D C   1 
ATOM 6505 O O   . GLU D 1 192 ? 69.459  -14.502 0.577   1.00 90.93  ? 234 GLU D O   1 
ATOM 6506 C CB  . GLU D 1 192 ? 66.830  -15.165 -1.681  1.00 90.93  ? 234 GLU D CB  1 
ATOM 6507 C CG  . GLU D 1 192 ? 66.648  -15.597 -3.138  1.00 90.93  ? 234 GLU D CG  1 
ATOM 6508 C CD  . GLU D 1 192 ? 65.928  -14.552 -3.998  1.00 90.93  ? 234 GLU D CD  1 
ATOM 6509 O OE1 . GLU D 1 192 ? 64.812  -14.138 -3.623  1.00 90.93  ? 234 GLU D OE1 1 
ATOM 6510 O OE2 . GLU D 1 192 ? 66.473  -14.153 -5.055  1.00 90.93  ? 234 GLU D OE2 1 
ATOM 6511 N N   . GLU D 1 193 ? 67.291  -14.835 1.097   1.00 90.93  ? 235 GLU D N   1 
ATOM 6512 C CA  . GLU D 1 193 ? 67.288  -14.133 2.370   1.00 90.93  ? 235 GLU D CA  1 
ATOM 6513 C C   . GLU D 1 193 ? 68.488  -14.528 3.224   1.00 90.93  ? 235 GLU D C   1 
ATOM 6514 O O   . GLU D 1 193 ? 69.143  -13.684 3.839   1.00 90.93  ? 235 GLU D O   1 
ATOM 6515 C CB  . GLU D 1 193 ? 65.989  -14.505 3.091   1.00 90.93  ? 235 GLU D CB  1 
ATOM 6516 C CG  . GLU D 1 193 ? 65.788  -13.912 4.470   1.00 90.93  ? 235 GLU D CG  1 
ATOM 6517 C CD  . GLU D 1 193 ? 64.582  -14.515 5.181   1.00 90.93  ? 235 GLU D CD  1 
ATOM 6518 O OE1 . GLU D 1 193 ? 64.451  -15.763 5.184   1.00 90.93  ? 235 GLU D OE1 1 
ATOM 6519 O OE2 . GLU D 1 193 ? 63.768  -13.739 5.735   1.00 90.93  ? 235 GLU D OE2 1 
ATOM 6520 N N   . TYR D 1 194 ? 68.803  -15.814 3.201   1.00 90.93  ? 236 TYR D N   1 
ATOM 6521 C CA  . TYR D 1 194 ? 69.894  -16.347 3.986   1.00 90.93  ? 236 TYR D CA  1 
ATOM 6522 C C   . TYR D 1 194 ? 71.235  -15.738 3.640   1.00 90.93  ? 236 TYR D C   1 
ATOM 6523 O O   . TYR D 1 194 ? 71.823  -15.004 4.430   1.00 90.93  ? 236 TYR D O   1 
ATOM 6524 C CB  . TYR D 1 194 ? 69.969  -17.857 3.802   1.00 90.93  ? 236 TYR D CB  1 
ATOM 6525 C CG  . TYR D 1 194 ? 71.216  -18.446 4.392   1.00 90.93  ? 236 TYR D CG  1 
ATOM 6526 C CD1 . TYR D 1 194 ? 71.350  -18.591 5.770   1.00 90.93  ? 236 TYR D CD1 1 
ATOM 6527 C CD2 . TYR D 1 194 ? 72.280  -18.818 3.580   1.00 90.93  ? 236 TYR D CD2 1 
ATOM 6528 C CE1 . TYR D 1 194 ? 72.516  -19.088 6.326   1.00 90.93  ? 236 TYR D CE1 1 
ATOM 6529 C CE2 . TYR D 1 194 ? 73.446  -19.312 4.126   1.00 90.93  ? 236 TYR D CE2 1 
ATOM 6530 C CZ  . TYR D 1 194 ? 73.555  -19.446 5.497   1.00 90.93  ? 236 TYR D CZ  1 
ATOM 6531 O OH  . TYR D 1 194 ? 74.712  -19.946 6.031   1.00 90.93  ? 236 TYR D OH  1 
ATOM 6532 N N   . THR D 1 195 ? 71.745  -16.123 2.481   1.00 90.93  ? 237 THR D N   1 
ATOM 6533 C CA  . THR D 1 195 ? 73.021  -15.639 1.998   1.00 90.93  ? 237 THR D CA  1 
ATOM 6534 C C   . THR D 1 195 ? 73.079  -14.124 2.078   1.00 90.93  ? 237 THR D C   1 
ATOM 6535 O O   . THR D 1 195 ? 74.144  -13.538 2.234   1.00 90.93  ? 237 THR D O   1 
ATOM 6536 C CB  . THR D 1 195 ? 73.245  -16.105 0.564   1.00 90.93  ? 237 THR D CB  1 
ATOM 6537 O OG1 . THR D 1 195 ? 71.981  -16.393 -0.042  1.00 90.93  ? 237 THR D OG1 1 
ATOM 6538 C CG2 . THR D 1 195 ? 74.096  -17.356 0.555   1.00 90.93  ? 237 THR D CG2 1 
ATOM 6539 N N   . LYS D 1 196 ? 71.910  -13.501 2.011   1.00 90.93  ? 238 LYS D N   1 
ATOM 6540 C CA  . LYS D 1 196 ? 71.799  -12.057 2.098   1.00 90.93  ? 238 LYS D CA  1 
ATOM 6541 C C   . LYS D 1 196 ? 72.414  -11.575 3.418   1.00 90.93  ? 238 LYS D C   1 
ATOM 6542 O O   . LYS D 1 196 ? 73.191  -10.619 3.447   1.00 90.93  ? 238 LYS D O   1 
ATOM 6543 C CB  . LYS D 1 196 ? 70.315  -11.680 1.971   1.00 90.93  ? 238 LYS D CB  1 
ATOM 6544 C CG  . LYS D 1 196 ? 69.851  -10.458 2.737   1.00 90.93  ? 238 LYS D CG  1 
ATOM 6545 C CD  . LYS D 1 196 ? 68.347  -10.211 2.539   1.00 90.93  ? 238 LYS D CD  1 
ATOM 6546 C CE  . LYS D 1 196 ? 67.854  -9.074  3.436   1.00 90.93  ? 238 LYS D CE  1 
ATOM 6547 N NZ  . LYS D 1 196 ? 66.461  -8.637  3.127   1.00 90.93  ? 238 LYS D NZ  1 
ATOM 6548 N N   . LYS D 1 197 ? 72.149  -12.330 4.476   1.00 90.93  ? 239 LYS D N   1 
ATOM 6549 C CA  . LYS D 1 197 ? 72.625  -12.017 5.818   1.00 90.93  ? 239 LYS D CA  1 
ATOM 6550 C C   . LYS D 1 197 ? 74.037  -12.502 6.132   1.00 90.93  ? 239 LYS D C   1 
ATOM 6551 O O   . LYS D 1 197 ? 74.575  -12.204 7.197   1.00 90.93  ? 239 LYS D O   1 
ATOM 6552 C CB  . LYS D 1 197 ? 71.659  -12.618 6.836   1.00 90.93  ? 239 LYS D CB  1 
ATOM 6553 C CG  . LYS D 1 197 ? 70.201  -12.234 6.610   1.00 90.93  ? 239 LYS D CG  1 
ATOM 6554 C CD  . LYS D 1 197 ? 69.277  -12.934 7.607   1.00 90.93  ? 239 LYS D CD  1 
ATOM 6555 C CE  . LYS D 1 197 ? 67.816  -12.511 7.436   1.00 90.93  ? 239 LYS D CE  1 
ATOM 6556 N NZ  . LYS D 1 197 ? 66.900  -13.219 8.387   1.00 90.93  ? 239 LYS D NZ  1 
ATOM 6557 N N   . LEU D 1 198 ? 74.636  -13.248 5.215   1.00 90.93  ? 240 LEU D N   1 
ATOM 6558 C CA  . LEU D 1 198 ? 75.974  -13.778 5.438   1.00 90.93  ? 240 LEU D CA  1 
ATOM 6559 C C   . LEU D 1 198 ? 77.147  -12.886 5.015   1.00 90.93  ? 240 LEU D C   1 
ATOM 6560 O O   . LEU D 1 198 ? 78.308  -13.219 5.243   1.00 90.93  ? 240 LEU D O   1 
ATOM 6561 C CB  . LEU D 1 198 ? 76.071  -15.173 4.817   1.00 90.93  ? 240 LEU D CB  1 
ATOM 6562 C CG  . LEU D 1 198 ? 77.289  -15.622 4.011   1.00 90.93  ? 240 LEU D CG  1 
ATOM 6563 C CD1 . LEU D 1 198 ? 77.287  -17.125 3.918   1.00 90.93  ? 240 LEU D CD1 1 
ATOM 6564 C CD2 . LEU D 1 198 ? 77.283  -14.986 2.628   1.00 90.93  ? 240 LEU D CD2 1 
ATOM 6565 N N   . ASN D 1 199 ? 76.847  -11.748 4.413   1.00 90.93  ? 241 ASN D N   1 
ATOM 6566 C CA  . ASN D 1 199 ? 77.899  -10.840 3.978   1.00 90.93  ? 241 ASN D CA  1 
ATOM 6567 C C   . ASN D 1 199 ? 77.658  -9.414  4.480   1.00 90.93  ? 241 ASN D C   1 
ATOM 6568 O O   . ASN D 1 199 ? 77.720  -8.452  3.708   1.00 90.93  ? 241 ASN D O   1 
ATOM 6569 C CB  . ASN D 1 199 ? 78.011  -10.894 2.453   1.00 90.93  ? 241 ASN D CB  1 
ATOM 6570 C CG  . ASN D 1 199 ? 76.657  -10.824 1.772   1.00 90.93  ? 241 ASN D CG  1 
ATOM 6571 O OD1 . ASN D 1 199 ? 75.771  -11.639 2.035   1.00 90.93  ? 241 ASN D OD1 1 
ATOM 6572 N ND2 . ASN D 1 199 ? 76.478  -9.829  0.914   1.00 90.93  ? 241 ASN D ND2 1 
ATOM 6573 N N   . THR D 1 200 ? 77.476  -9.302  5.800   1.00 90.93  ? 242 THR D N   1 
ATOM 6574 C CA  . THR D 1 200 ? 77.193  -8.040  6.496   1.00 90.93  ? 242 THR D CA  1 
ATOM 6575 C C   . THR D 1 200 ? 78.381  -7.194  6.963   1.00 90.93  ? 242 THR D C   1 
ATOM 6576 O O   . THR D 1 200 ? 78.664  -6.125  6.405   1.00 90.93  ? 242 THR D O   1 
ATOM 6577 C CB  . THR D 1 200 ? 76.283  -8.300  7.741   1.00 90.93  ? 242 THR D CB  1 
ATOM 6578 O OG1 . THR D 1 200 ? 76.831  -9.363  8.540   1.00 90.93  ? 242 THR D OG1 1 
ATOM 6579 C CG2 . THR D 1 200 ? 74.869  -8.659  7.298   1.00 90.93  ? 242 THR D CG2 1 
ATOM 6580 N N   . GLN D 1 201 ? 79.007  -7.636  8.054   1.00 90.93  ? 243 GLN D N   1 
ATOM 6581 C CA  . GLN D 1 201 ? 80.141  -6.928  8.644   1.00 90.93  ? 243 GLN D CA  1 
ATOM 6582 C C   . GLN D 1 201 ? 81.482  -7.551  8.239   1.00 90.93  ? 243 GLN D C   1 
ATOM 6583 O O   . GLN D 1 201 ? 81.905  -7.290  7.086   1.00 90.93  ? 243 GLN D O   1 
ATOM 6584 C CB  . GLN D 1 201 ? 79.976  -6.849  10.189  1.00 90.93  ? 243 GLN D CB  1 
ATOM 6585 C CG  . GLN D 1 201 ? 78.961  -5.752  10.656  1.00 90.93  ? 243 GLN D CG  1 
ATOM 6586 C CD  . GLN D 1 201 ? 78.547  -5.827  12.142  1.00 90.93  ? 243 GLN D CD  1 
ATOM 6587 O OE1 . GLN D 1 201 ? 79.217  -5.272  13.025  1.00 90.93  ? 243 GLN D OE1 1 
ATOM 6588 N NE2 . GLN D 1 201 ? 77.405  -6.469  12.405  1.00 90.93  ? 243 GLN D NE2 1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   43  43  MET MET A . n 
A 1 2   LEU 2   44  44  LEU LEU A . n 
A 1 3   LYS 3   45  45  LYS LYS A . n 
A 1 4   LEU 4   46  46  LEU LEU A . n 
A 1 5   LEU 5   47  47  LEU LEU A . n 
A 1 6   ASP 6   48  48  ASP ASP A . n 
A 1 7   ASN 7   49  49  ASN ASN A . n 
A 1 8   TRP 8   50  50  TRP TRP A . n 
A 1 9   ASP 9   51  51  ASP ASP A . n 
A 1 10  SER 10  52  52  SER SER A . n 
A 1 11  VAL 11  53  53  VAL VAL A . n 
A 1 12  THR 12  54  54  THR THR A . n 
A 1 13  SER 13  55  55  SER SER A . n 
A 1 14  THR 14  56  56  THR THR A . n 
A 1 15  PHE 15  57  57  PHE PHE A . n 
A 1 16  SER 16  58  58  SER SER A . n 
A 1 17  LYS 17  59  59  LYS LYS A . n 
A 1 18  LEU 18  60  60  LEU LEU A . n 
A 1 19  ARG 19  61  61  ARG ARG A . n 
A 1 20  GLU 20  62  62  GLU GLU A . n 
A 1 21  GLN 21  63  63  GLN GLN A . n 
A 1 22  LEU 22  64  64  LEU LEU A . n 
A 1 23  GLY 23  65  65  GLY GLY A . n 
A 1 24  PRO 24  66  66  PRO PRO A . n 
A 1 25  VAL 25  67  67  VAL VAL A . n 
A 1 26  THR 26  68  68  THR THR A . n 
A 1 27  GLN 27  69  69  GLN GLN A . n 
A 1 28  GLU 28  70  70  GLU GLU A . n 
A 1 29  PHE 29  71  71  PHE PHE A . n 
A 1 30  TRP 30  72  72  TRP TRP A . n 
A 1 31  ASP 31  73  73  ASP ASP A . n 
A 1 32  ASN 32  74  74  ASN ASN A . n 
A 1 33  LEU 33  75  75  LEU LEU A . n 
A 1 34  GLU 34  76  76  GLU GLU A . n 
A 1 35  LYS 35  77  77  LYS LYS A . n 
A 1 36  GLU 36  78  78  GLU GLU A . n 
A 1 37  THR 37  79  79  THR THR A . n 
A 1 38  GLU 38  80  80  GLU GLU A . n 
A 1 39  GLY 39  81  81  GLY GLY A . n 
A 1 40  LEU 40  82  82  LEU LEU A . n 
A 1 41  ARG 41  83  83  ARG ARG A . n 
A 1 42  GLN 42  84  84  GLN GLN A . n 
A 1 43  GLU 43  85  85  GLU GLU A . n 
A 1 44  MET 44  86  86  MET MET A . n 
A 1 45  SER 45  87  87  SER SER A . n 
A 1 46  LYS 46  88  88  LYS LYS A . n 
A 1 47  ASP 47  89  89  ASP ASP A . n 
A 1 48  LEU 48  90  90  LEU LEU A . n 
A 1 49  GLU 49  91  91  GLU GLU A . n 
A 1 50  GLU 50  92  92  GLU GLU A . n 
A 1 51  VAL 51  93  93  VAL VAL A . n 
A 1 52  LYS 52  94  94  LYS LYS A . n 
A 1 53  ALA 53  95  95  ALA ALA A . n 
A 1 54  LYS 54  96  96  LYS LYS A . n 
A 1 55  VAL 55  97  97  VAL VAL A . n 
A 1 56  GLN 56  98  98  GLN GLN A . n 
A 1 57  PRO 57  99  99  PRO PRO A . n 
A 1 58  TYR 58  100 100 TYR TYR A . n 
A 1 59  LEU 59  101 101 LEU LEU A . n 
A 1 60  ASP 60  102 102 ASP ASP A . n 
A 1 61  ASP 61  103 103 ASP ASP A . n 
A 1 62  PHE 62  104 104 PHE PHE A . n 
A 1 63  GLN 63  105 105 GLN GLN A . n 
A 1 64  LYS 64  106 106 LYS LYS A . n 
A 1 65  LYS 65  107 107 LYS LYS A . n 
A 1 66  TRP 66  108 108 TRP TRP A . n 
A 1 67  GLN 67  109 109 GLN GLN A . n 
A 1 68  GLU 68  110 110 GLU GLU A . n 
A 1 69  GLU 69  111 111 GLU GLU A . n 
A 1 70  MET 70  112 112 MET MET A . n 
A 1 71  GLU 71  113 113 GLU GLU A . n 
A 1 72  LEU 72  114 114 LEU LEU A . n 
A 1 73  TYR 73  115 115 TYR TYR A . n 
A 1 74  ARG 74  116 116 ARG ARG A . n 
A 1 75  GLN 75  117 117 GLN GLN A . n 
A 1 76  LYS 76  118 118 LYS LYS A . n 
A 1 77  VAL 77  119 119 VAL VAL A . n 
A 1 78  GLU 78  120 120 GLU GLU A . n 
A 1 79  PRO 79  121 121 PRO PRO A . n 
A 1 80  LEU 80  122 122 LEU LEU A . n 
A 1 81  ARG 81  123 123 ARG ARG A . n 
A 1 82  ALA 82  124 124 ALA ALA A . n 
A 1 83  GLU 83  125 125 GLU GLU A . n 
A 1 84  LEU 84  126 126 LEU LEU A . n 
A 1 85  GLN 85  127 127 GLN GLN A . n 
A 1 86  GLU 86  128 128 GLU GLU A . n 
A 1 87  GLY 87  129 129 GLY GLY A . n 
A 1 88  ALA 88  130 130 ALA ALA A . n 
A 1 89  ARG 89  131 131 ARG ARG A . n 
A 1 90  GLN 90  132 132 GLN GLN A . n 
A 1 91  LYS 91  133 133 LYS LYS A . n 
A 1 92  LEU 92  134 134 LEU LEU A . n 
A 1 93  HIS 93  135 135 HIS HIS A . n 
A 1 94  GLU 94  136 136 GLU GLU A . n 
A 1 95  LEU 95  137 137 LEU LEU A . n 
A 1 96  GLN 96  138 138 GLN GLN A . n 
A 1 97  GLU 97  139 139 GLU GLU A . n 
A 1 98  LYS 98  140 140 LYS LYS A . n 
A 1 99  LEU 99  141 141 LEU LEU A . n 
A 1 100 SER 100 142 142 SER SER A . n 
A 1 101 PRO 101 143 143 PRO PRO A . n 
A 1 102 LEU 102 144 144 LEU LEU A . n 
A 1 103 GLY 103 145 145 GLY GLY A . n 
A 1 104 GLU 104 146 146 GLU GLU A . n 
A 1 105 GLU 105 147 147 GLU GLU A . n 
A 1 106 MET 106 148 148 MET MET A . n 
A 1 107 ARG 107 149 149 ARG ARG A . n 
A 1 108 ASP 108 150 150 ASP ASP A . n 
A 1 109 ARG 109 151 151 ARG ARG A . n 
A 1 110 ALA 110 152 152 ALA ALA A . n 
A 1 111 ARG 111 153 153 ARG ARG A . n 
A 1 112 ALA 112 154 154 ALA ALA A . n 
A 1 113 HIS 113 155 155 HIS HIS A . n 
A 1 114 VAL 114 156 156 VAL VAL A . n 
A 1 115 ASP 115 157 157 ASP ASP A . n 
A 1 116 ALA 116 158 158 ALA ALA A . n 
A 1 117 LEU 117 159 159 LEU LEU A . n 
A 1 118 ARG 118 160 160 ARG ARG A . n 
A 1 119 THR 119 161 161 THR THR A . n 
A 1 120 HIS 120 162 162 HIS HIS A . n 
A 1 121 LEU 121 163 163 LEU LEU A . n 
A 1 122 ALA 122 164 164 ALA ALA A . n 
A 1 123 PRO 123 165 165 PRO PRO A . n 
A 1 124 TYR 124 166 166 TYR TYR A . n 
A 1 125 SER 125 167 167 SER SER A . n 
A 1 126 ASP 126 168 168 ASP ASP A . n 
A 1 127 GLU 127 169 169 GLU GLU A . n 
A 1 128 LEU 128 170 170 LEU LEU A . n 
A 1 129 ARG 129 171 171 ARG ARG A . n 
A 1 130 GLN 130 172 172 GLN GLN A . n 
A 1 131 ARG 131 173 173 ARG ARG A . n 
A 1 132 LEU 132 174 174 LEU LEU A . n 
A 1 133 ALA 133 175 175 ALA ALA A . n 
A 1 134 ALA 134 176 176 ALA ALA A . n 
A 1 135 ARG 135 177 177 ARG ARG A . n 
A 1 136 LEU 136 178 178 LEU LEU A . n 
A 1 137 GLU 137 179 179 GLU GLU A . n 
A 1 138 ALA 138 180 180 ALA ALA A . n 
A 1 139 LEU 139 181 181 LEU LEU A . n 
A 1 140 LYS 140 182 182 LYS LYS A . n 
A 1 141 GLU 141 183 183 GLU GLU A . n 
A 1 142 ASN 142 184 184 ASN ASN A . n 
A 1 143 GLY 143 185 185 GLY GLY A . n 
A 1 144 GLY 144 186 186 GLY GLY A . n 
A 1 145 ALA 145 187 187 ALA ALA A . n 
A 1 146 ARG 146 188 188 ARG ARG A . n 
A 1 147 LEU 147 189 189 LEU LEU A . n 
A 1 148 ALA 148 190 190 ALA ALA A . n 
A 1 149 GLU 149 191 191 GLU GLU A . n 
A 1 150 TYR 150 192 192 TYR TYR A . n 
A 1 151 HIS 151 193 193 HIS HIS A . n 
A 1 152 ALA 152 194 194 ALA ALA A . n 
A 1 153 LYS 153 195 195 LYS LYS A . n 
A 1 154 ALA 154 196 196 ALA ALA A . n 
A 1 155 THR 155 197 197 THR THR A . n 
A 1 156 GLU 156 198 198 GLU GLU A . n 
A 1 157 HIS 157 199 199 HIS HIS A . n 
A 1 158 LEU 158 200 200 LEU LEU A . n 
A 1 159 SER 159 201 201 SER SER A . n 
A 1 160 THR 160 202 202 THR THR A . n 
A 1 161 LEU 161 203 203 LEU LEU A . n 
A 1 162 SER 162 204 204 SER SER A . n 
A 1 163 GLU 163 205 205 GLU GLU A . n 
A 1 164 LYS 164 206 206 LYS LYS A . n 
A 1 165 ALA 165 207 207 ALA ALA A . n 
A 1 166 LYS 166 208 208 LYS LYS A . n 
A 1 167 PRO 167 209 209 PRO PRO A . n 
A 1 168 ALA 168 210 210 ALA ALA A . n 
A 1 169 LEU 169 211 211 LEU LEU A . n 
A 1 170 GLU 170 212 212 GLU GLU A . n 
A 1 171 ASP 171 213 213 ASP ASP A . n 
A 1 172 LEU 172 214 214 LEU LEU A . n 
A 1 173 ARG 173 215 215 ARG ARG A . n 
A 1 174 GLN 174 216 216 GLN GLN A . n 
A 1 175 GLY 175 217 217 GLY GLY A . n 
A 1 176 LEU 176 218 218 LEU LEU A . n 
A 1 177 LEU 177 219 219 LEU LEU A . n 
A 1 178 PRO 178 220 220 PRO PRO A . n 
A 1 179 VAL 179 221 221 VAL VAL A . n 
A 1 180 LEU 180 222 222 LEU LEU A . n 
A 1 181 GLU 181 223 223 GLU GLU A . n 
A 1 182 SER 182 224 224 SER SER A . n 
A 1 183 PHE 183 225 225 PHE PHE A . n 
A 1 184 LYS 184 226 226 LYS LYS A . n 
A 1 185 VAL 185 227 227 VAL VAL A . n 
A 1 186 SER 186 228 228 SER SER A . n 
A 1 187 PHE 187 229 229 PHE PHE A . n 
A 1 188 LEU 188 230 230 LEU LEU A . n 
A 1 189 SER 189 231 231 SER SER A . n 
A 1 190 ALA 190 232 232 ALA ALA A . n 
A 1 191 LEU 191 233 233 LEU LEU A . n 
A 1 192 GLU 192 234 234 GLU GLU A . n 
A 1 193 GLU 193 235 235 GLU GLU A . n 
A 1 194 TYR 194 236 236 TYR TYR A . n 
A 1 195 THR 195 237 237 THR THR A . n 
A 1 196 LYS 196 238 238 LYS LYS A . n 
A 1 197 LYS 197 239 239 LYS LYS A . n 
A 1 198 LEU 198 240 240 LEU LEU A . n 
A 1 199 ASN 199 241 241 ASN ASN A . n 
A 1 200 THR 200 242 242 THR THR A . n 
A 1 201 GLN 201 243 243 GLN GLN A . n 
B 1 1   MET 1   43  43  MET MET B . n 
B 1 2   LEU 2   44  44  LEU LEU B . n 
B 1 3   LYS 3   45  45  LYS LYS B . n 
B 1 4   LEU 4   46  46  LEU LEU B . n 
B 1 5   LEU 5   47  47  LEU LEU B . n 
B 1 6   ASP 6   48  48  ASP ASP B . n 
B 1 7   ASN 7   49  49  ASN ASN B . n 
B 1 8   TRP 8   50  50  TRP TRP B . n 
B 1 9   ASP 9   51  51  ASP ASP B . n 
B 1 10  SER 10  52  52  SER SER B . n 
B 1 11  VAL 11  53  53  VAL VAL B . n 
B 1 12  THR 12  54  54  THR THR B . n 
B 1 13  SER 13  55  55  SER SER B . n 
B 1 14  THR 14  56  56  THR THR B . n 
B 1 15  PHE 15  57  57  PHE PHE B . n 
B 1 16  SER 16  58  58  SER SER B . n 
B 1 17  LYS 17  59  59  LYS LYS B . n 
B 1 18  LEU 18  60  60  LEU LEU B . n 
B 1 19  ARG 19  61  61  ARG ARG B . n 
B 1 20  GLU 20  62  62  GLU GLU B . n 
B 1 21  GLN 21  63  63  GLN GLN B . n 
B 1 22  LEU 22  64  64  LEU LEU B . n 
B 1 23  GLY 23  65  65  GLY GLY B . n 
B 1 24  PRO 24  66  66  PRO PRO B . n 
B 1 25  VAL 25  67  67  VAL VAL B . n 
B 1 26  THR 26  68  68  THR THR B . n 
B 1 27  GLN 27  69  69  GLN GLN B . n 
B 1 28  GLU 28  70  70  GLU GLU B . n 
B 1 29  PHE 29  71  71  PHE PHE B . n 
B 1 30  TRP 30  72  72  TRP TRP B . n 
B 1 31  ASP 31  73  73  ASP ASP B . n 
B 1 32  ASN 32  74  74  ASN ASN B . n 
B 1 33  LEU 33  75  75  LEU LEU B . n 
B 1 34  GLU 34  76  76  GLU GLU B . n 
B 1 35  LYS 35  77  77  LYS LYS B . n 
B 1 36  GLU 36  78  78  GLU GLU B . n 
B 1 37  THR 37  79  79  THR THR B . n 
B 1 38  GLU 38  80  80  GLU GLU B . n 
B 1 39  GLY 39  81  81  GLY GLY B . n 
B 1 40  LEU 40  82  82  LEU LEU B . n 
B 1 41  ARG 41  83  83  ARG ARG B . n 
B 1 42  GLN 42  84  84  GLN GLN B . n 
B 1 43  GLU 43  85  85  GLU GLU B . n 
B 1 44  MET 44  86  86  MET MET B . n 
B 1 45  SER 45  87  87  SER SER B . n 
B 1 46  LYS 46  88  88  LYS LYS B . n 
B 1 47  ASP 47  89  89  ASP ASP B . n 
B 1 48  LEU 48  90  90  LEU LEU B . n 
B 1 49  GLU 49  91  91  GLU GLU B . n 
B 1 50  GLU 50  92  92  GLU GLU B . n 
B 1 51  VAL 51  93  93  VAL VAL B . n 
B 1 52  LYS 52  94  94  LYS LYS B . n 
B 1 53  ALA 53  95  95  ALA ALA B . n 
B 1 54  LYS 54  96  96  LYS LYS B . n 
B 1 55  VAL 55  97  97  VAL VAL B . n 
B 1 56  GLN 56  98  98  GLN GLN B . n 
B 1 57  PRO 57  99  99  PRO PRO B . n 
B 1 58  TYR 58  100 100 TYR TYR B . n 
B 1 59  LEU 59  101 101 LEU LEU B . n 
B 1 60  ASP 60  102 102 ASP ASP B . n 
B 1 61  ASP 61  103 103 ASP ASP B . n 
B 1 62  PHE 62  104 104 PHE PHE B . n 
B 1 63  GLN 63  105 105 GLN GLN B . n 
B 1 64  LYS 64  106 106 LYS LYS B . n 
B 1 65  LYS 65  107 107 LYS LYS B . n 
B 1 66  TRP 66  108 108 TRP TRP B . n 
B 1 67  GLN 67  109 109 GLN GLN B . n 
B 1 68  GLU 68  110 110 GLU GLU B . n 
B 1 69  GLU 69  111 111 GLU GLU B . n 
B 1 70  MET 70  112 112 MET MET B . n 
B 1 71  GLU 71  113 113 GLU GLU B . n 
B 1 72  LEU 72  114 114 LEU LEU B . n 
B 1 73  TYR 73  115 115 TYR TYR B . n 
B 1 74  ARG 74  116 116 ARG ARG B . n 
B 1 75  GLN 75  117 117 GLN GLN B . n 
B 1 76  LYS 76  118 118 LYS LYS B . n 
B 1 77  VAL 77  119 119 VAL VAL B . n 
B 1 78  GLU 78  120 120 GLU GLU B . n 
B 1 79  PRO 79  121 121 PRO PRO B . n 
B 1 80  LEU 80  122 122 LEU LEU B . n 
B 1 81  ARG 81  123 123 ARG ARG B . n 
B 1 82  ALA 82  124 124 ALA ALA B . n 
B 1 83  GLU 83  125 125 GLU GLU B . n 
B 1 84  LEU 84  126 126 LEU LEU B . n 
B 1 85  GLN 85  127 127 GLN GLN B . n 
B 1 86  GLU 86  128 128 GLU GLU B . n 
B 1 87  GLY 87  129 129 GLY GLY B . n 
B 1 88  ALA 88  130 130 ALA ALA B . n 
B 1 89  ARG 89  131 131 ARG ARG B . n 
B 1 90  GLN 90  132 132 GLN GLN B . n 
B 1 91  LYS 91  133 133 LYS LYS B . n 
B 1 92  LEU 92  134 134 LEU LEU B . n 
B 1 93  HIS 93  135 135 HIS HIS B . n 
B 1 94  GLU 94  136 136 GLU GLU B . n 
B 1 95  LEU 95  137 137 LEU LEU B . n 
B 1 96  GLN 96  138 138 GLN GLN B . n 
B 1 97  GLU 97  139 139 GLU GLU B . n 
B 1 98  LYS 98  140 140 LYS LYS B . n 
B 1 99  LEU 99  141 141 LEU LEU B . n 
B 1 100 SER 100 142 142 SER SER B . n 
B 1 101 PRO 101 143 143 PRO PRO B . n 
B 1 102 LEU 102 144 144 LEU LEU B . n 
B 1 103 GLY 103 145 145 GLY GLY B . n 
B 1 104 GLU 104 146 146 GLU GLU B . n 
B 1 105 GLU 105 147 147 GLU GLU B . n 
B 1 106 MET 106 148 148 MET MET B . n 
B 1 107 ARG 107 149 149 ARG ARG B . n 
B 1 108 ASP 108 150 150 ASP ASP B . n 
B 1 109 ARG 109 151 151 ARG ARG B . n 
B 1 110 ALA 110 152 152 ALA ALA B . n 
B 1 111 ARG 111 153 153 ARG ARG B . n 
B 1 112 ALA 112 154 154 ALA ALA B . n 
B 1 113 HIS 113 155 155 HIS HIS B . n 
B 1 114 VAL 114 156 156 VAL VAL B . n 
B 1 115 ASP 115 157 157 ASP ASP B . n 
B 1 116 ALA 116 158 158 ALA ALA B . n 
B 1 117 LEU 117 159 159 LEU LEU B . n 
B 1 118 ARG 118 160 160 ARG ARG B . n 
B 1 119 THR 119 161 161 THR THR B . n 
B 1 120 HIS 120 162 162 HIS HIS B . n 
B 1 121 LEU 121 163 163 LEU LEU B . n 
B 1 122 ALA 122 164 164 ALA ALA B . n 
B 1 123 PRO 123 165 165 PRO PRO B . n 
B 1 124 TYR 124 166 166 TYR TYR B . n 
B 1 125 SER 125 167 167 SER SER B . n 
B 1 126 ASP 126 168 168 ASP ASP B . n 
B 1 127 GLU 127 169 169 GLU GLU B . n 
B 1 128 LEU 128 170 170 LEU LEU B . n 
B 1 129 ARG 129 171 171 ARG ARG B . n 
B 1 130 GLN 130 172 172 GLN GLN B . n 
B 1 131 ARG 131 173 173 ARG ARG B . n 
B 1 132 LEU 132 174 174 LEU LEU B . n 
B 1 133 ALA 133 175 175 ALA ALA B . n 
B 1 134 ALA 134 176 176 ALA ALA B . n 
B 1 135 ARG 135 177 177 ARG ARG B . n 
B 1 136 LEU 136 178 178 LEU LEU B . n 
B 1 137 GLU 137 179 179 GLU GLU B . n 
B 1 138 ALA 138 180 180 ALA ALA B . n 
B 1 139 LEU 139 181 181 LEU LEU B . n 
B 1 140 LYS 140 182 182 LYS LYS B . n 
B 1 141 GLU 141 183 183 GLU GLU B . n 
B 1 142 ASN 142 184 184 ASN ASN B . n 
B 1 143 GLY 143 185 185 GLY GLY B . n 
B 1 144 GLY 144 186 186 GLY GLY B . n 
B 1 145 ALA 145 187 187 ALA ALA B . n 
B 1 146 ARG 146 188 188 ARG ARG B . n 
B 1 147 LEU 147 189 189 LEU LEU B . n 
B 1 148 ALA 148 190 190 ALA ALA B . n 
B 1 149 GLU 149 191 191 GLU GLU B . n 
B 1 150 TYR 150 192 192 TYR TYR B . n 
B 1 151 HIS 151 193 193 HIS HIS B . n 
B 1 152 ALA 152 194 194 ALA ALA B . n 
B 1 153 LYS 153 195 195 LYS LYS B . n 
B 1 154 ALA 154 196 196 ALA ALA B . n 
B 1 155 THR 155 197 197 THR THR B . n 
B 1 156 GLU 156 198 198 GLU GLU B . n 
B 1 157 HIS 157 199 199 HIS HIS B . n 
B 1 158 LEU 158 200 200 LEU LEU B . n 
B 1 159 SER 159 201 201 SER SER B . n 
B 1 160 THR 160 202 202 THR THR B . n 
B 1 161 LEU 161 203 203 LEU LEU B . n 
B 1 162 SER 162 204 204 SER SER B . n 
B 1 163 GLU 163 205 205 GLU GLU B . n 
B 1 164 LYS 164 206 206 LYS LYS B . n 
B 1 165 ALA 165 207 207 ALA ALA B . n 
B 1 166 LYS 166 208 208 LYS LYS B . n 
B 1 167 PRO 167 209 209 PRO PRO B . n 
B 1 168 ALA 168 210 210 ALA ALA B . n 
B 1 169 LEU 169 211 211 LEU LEU B . n 
B 1 170 GLU 170 212 212 GLU GLU B . n 
B 1 171 ASP 171 213 213 ASP ASP B . n 
B 1 172 LEU 172 214 214 LEU LEU B . n 
B 1 173 ARG 173 215 215 ARG ARG B . n 
B 1 174 GLN 174 216 216 GLN GLN B . n 
B 1 175 GLY 175 217 217 GLY GLY B . n 
B 1 176 LEU 176 218 218 LEU LEU B . n 
B 1 177 LEU 177 219 219 LEU LEU B . n 
B 1 178 PRO 178 220 220 PRO PRO B . n 
B 1 179 VAL 179 221 221 VAL VAL B . n 
B 1 180 LEU 180 222 222 LEU LEU B . n 
B 1 181 GLU 181 223 223 GLU GLU B . n 
B 1 182 SER 182 224 224 SER SER B . n 
B 1 183 PHE 183 225 225 PHE PHE B . n 
B 1 184 LYS 184 226 226 LYS LYS B . n 
B 1 185 VAL 185 227 227 VAL VAL B . n 
B 1 186 SER 186 228 228 SER SER B . n 
B 1 187 PHE 187 229 229 PHE PHE B . n 
B 1 188 LEU 188 230 230 LEU LEU B . n 
B 1 189 SER 189 231 231 SER SER B . n 
B 1 190 ALA 190 232 232 ALA ALA B . n 
B 1 191 LEU 191 233 233 LEU LEU B . n 
B 1 192 GLU 192 234 234 GLU GLU B . n 
B 1 193 GLU 193 235 235 GLU GLU B . n 
B 1 194 TYR 194 236 236 TYR TYR B . n 
B 1 195 THR 195 237 237 THR THR B . n 
B 1 196 LYS 196 238 238 LYS LYS B . n 
B 1 197 LYS 197 239 239 LYS LYS B . n 
B 1 198 LEU 198 240 240 LEU LEU B . n 
B 1 199 ASN 199 241 241 ASN ASN B . n 
B 1 200 THR 200 242 242 THR THR B . n 
B 1 201 GLN 201 243 243 GLN GLN B . n 
C 1 1   MET 1   43  43  MET MET C . n 
C 1 2   LEU 2   44  44  LEU LEU C . n 
C 1 3   LYS 3   45  45  LYS LYS C . n 
C 1 4   LEU 4   46  46  LEU LEU C . n 
C 1 5   LEU 5   47  47  LEU LEU C . n 
C 1 6   ASP 6   48  48  ASP ASP C . n 
C 1 7   ASN 7   49  49  ASN ASN C . n 
C 1 8   TRP 8   50  50  TRP TRP C . n 
C 1 9   ASP 9   51  51  ASP ASP C . n 
C 1 10  SER 10  52  52  SER SER C . n 
C 1 11  VAL 11  53  53  VAL VAL C . n 
C 1 12  THR 12  54  54  THR THR C . n 
C 1 13  SER 13  55  55  SER SER C . n 
C 1 14  THR 14  56  56  THR THR C . n 
C 1 15  PHE 15  57  57  PHE PHE C . n 
C 1 16  SER 16  58  58  SER SER C . n 
C 1 17  LYS 17  59  59  LYS LYS C . n 
C 1 18  LEU 18  60  60  LEU LEU C . n 
C 1 19  ARG 19  61  61  ARG ARG C . n 
C 1 20  GLU 20  62  62  GLU GLU C . n 
C 1 21  GLN 21  63  63  GLN GLN C . n 
C 1 22  LEU 22  64  64  LEU LEU C . n 
C 1 23  GLY 23  65  65  GLY GLY C . n 
C 1 24  PRO 24  66  66  PRO PRO C . n 
C 1 25  VAL 25  67  67  VAL VAL C . n 
C 1 26  THR 26  68  68  THR THR C . n 
C 1 27  GLN 27  69  69  GLN GLN C . n 
C 1 28  GLU 28  70  70  GLU GLU C . n 
C 1 29  PHE 29  71  71  PHE PHE C . n 
C 1 30  TRP 30  72  72  TRP TRP C . n 
C 1 31  ASP 31  73  73  ASP ASP C . n 
C 1 32  ASN 32  74  74  ASN ASN C . n 
C 1 33  LEU 33  75  75  LEU LEU C . n 
C 1 34  GLU 34  76  76  GLU GLU C . n 
C 1 35  LYS 35  77  77  LYS LYS C . n 
C 1 36  GLU 36  78  78  GLU GLU C . n 
C 1 37  THR 37  79  79  THR THR C . n 
C 1 38  GLU 38  80  80  GLU GLU C . n 
C 1 39  GLY 39  81  81  GLY GLY C . n 
C 1 40  LEU 40  82  82  LEU LEU C . n 
C 1 41  ARG 41  83  83  ARG ARG C . n 
C 1 42  GLN 42  84  84  GLN GLN C . n 
C 1 43  GLU 43  85  85  GLU GLU C . n 
C 1 44  MET 44  86  86  MET MET C . n 
C 1 45  SER 45  87  87  SER SER C . n 
C 1 46  LYS 46  88  88  LYS LYS C . n 
C 1 47  ASP 47  89  89  ASP ASP C . n 
C 1 48  LEU 48  90  90  LEU LEU C . n 
C 1 49  GLU 49  91  91  GLU GLU C . n 
C 1 50  GLU 50  92  92  GLU GLU C . n 
C 1 51  VAL 51  93  93  VAL VAL C . n 
C 1 52  LYS 52  94  94  LYS LYS C . n 
C 1 53  ALA 53  95  95  ALA ALA C . n 
C 1 54  LYS 54  96  96  LYS LYS C . n 
C 1 55  VAL 55  97  97  VAL VAL C . n 
C 1 56  GLN 56  98  98  GLN GLN C . n 
C 1 57  PRO 57  99  99  PRO PRO C . n 
C 1 58  TYR 58  100 100 TYR TYR C . n 
C 1 59  LEU 59  101 101 LEU LEU C . n 
C 1 60  ASP 60  102 102 ASP ASP C . n 
C 1 61  ASP 61  103 103 ASP ASP C . n 
C 1 62  PHE 62  104 104 PHE PHE C . n 
C 1 63  GLN 63  105 105 GLN GLN C . n 
C 1 64  LYS 64  106 106 LYS LYS C . n 
C 1 65  LYS 65  107 107 LYS LYS C . n 
C 1 66  TRP 66  108 108 TRP TRP C . n 
C 1 67  GLN 67  109 109 GLN GLN C . n 
C 1 68  GLU 68  110 110 GLU GLU C . n 
C 1 69  GLU 69  111 111 GLU GLU C . n 
C 1 70  MET 70  112 112 MET MET C . n 
C 1 71  GLU 71  113 113 GLU GLU C . n 
C 1 72  LEU 72  114 114 LEU LEU C . n 
C 1 73  TYR 73  115 115 TYR TYR C . n 
C 1 74  ARG 74  116 116 ARG ARG C . n 
C 1 75  GLN 75  117 117 GLN GLN C . n 
C 1 76  LYS 76  118 118 LYS LYS C . n 
C 1 77  VAL 77  119 119 VAL VAL C . n 
C 1 78  GLU 78  120 120 GLU GLU C . n 
C 1 79  PRO 79  121 121 PRO PRO C . n 
C 1 80  LEU 80  122 122 LEU LEU C . n 
C 1 81  ARG 81  123 123 ARG ARG C . n 
C 1 82  ALA 82  124 124 ALA ALA C . n 
C 1 83  GLU 83  125 125 GLU GLU C . n 
C 1 84  LEU 84  126 126 LEU LEU C . n 
C 1 85  GLN 85  127 127 GLN GLN C . n 
C 1 86  GLU 86  128 128 GLU GLU C . n 
C 1 87  GLY 87  129 129 GLY GLY C . n 
C 1 88  ALA 88  130 130 ALA ALA C . n 
C 1 89  ARG 89  131 131 ARG ARG C . n 
C 1 90  GLN 90  132 132 GLN GLN C . n 
C 1 91  LYS 91  133 133 LYS LYS C . n 
C 1 92  LEU 92  134 134 LEU LEU C . n 
C 1 93  HIS 93  135 135 HIS HIS C . n 
C 1 94  GLU 94  136 136 GLU GLU C . n 
C 1 95  LEU 95  137 137 LEU LEU C . n 
C 1 96  GLN 96  138 138 GLN GLN C . n 
C 1 97  GLU 97  139 139 GLU GLU C . n 
C 1 98  LYS 98  140 140 LYS LYS C . n 
C 1 99  LEU 99  141 141 LEU LEU C . n 
C 1 100 SER 100 142 142 SER SER C . n 
C 1 101 PRO 101 143 143 PRO PRO C . n 
C 1 102 LEU 102 144 144 LEU LEU C . n 
C 1 103 GLY 103 145 145 GLY GLY C . n 
C 1 104 GLU 104 146 146 GLU GLU C . n 
C 1 105 GLU 105 147 147 GLU GLU C . n 
C 1 106 MET 106 148 148 MET MET C . n 
C 1 107 ARG 107 149 149 ARG ARG C . n 
C 1 108 ASP 108 150 150 ASP ASP C . n 
C 1 109 ARG 109 151 151 ARG ARG C . n 
C 1 110 ALA 110 152 152 ALA ALA C . n 
C 1 111 ARG 111 153 153 ARG ARG C . n 
C 1 112 ALA 112 154 154 ALA ALA C . n 
C 1 113 HIS 113 155 155 HIS HIS C . n 
C 1 114 VAL 114 156 156 VAL VAL C . n 
C 1 115 ASP 115 157 157 ASP ASP C . n 
C 1 116 ALA 116 158 158 ALA ALA C . n 
C 1 117 LEU 117 159 159 LEU LEU C . n 
C 1 118 ARG 118 160 160 ARG ARG C . n 
C 1 119 THR 119 161 161 THR THR C . n 
C 1 120 HIS 120 162 162 HIS HIS C . n 
C 1 121 LEU 121 163 163 LEU LEU C . n 
C 1 122 ALA 122 164 164 ALA ALA C . n 
C 1 123 PRO 123 165 165 PRO PRO C . n 
C 1 124 TYR 124 166 166 TYR TYR C . n 
C 1 125 SER 125 167 167 SER SER C . n 
C 1 126 ASP 126 168 168 ASP ASP C . n 
C 1 127 GLU 127 169 169 GLU GLU C . n 
C 1 128 LEU 128 170 170 LEU LEU C . n 
C 1 129 ARG 129 171 171 ARG ARG C . n 
C 1 130 GLN 130 172 172 GLN GLN C . n 
C 1 131 ARG 131 173 173 ARG ARG C . n 
C 1 132 LEU 132 174 174 LEU LEU C . n 
C 1 133 ALA 133 175 175 ALA ALA C . n 
C 1 134 ALA 134 176 176 ALA ALA C . n 
C 1 135 ARG 135 177 177 ARG ARG C . n 
C 1 136 LEU 136 178 178 LEU LEU C . n 
C 1 137 GLU 137 179 179 GLU GLU C . n 
C 1 138 ALA 138 180 180 ALA ALA C . n 
C 1 139 LEU 139 181 181 LEU LEU C . n 
C 1 140 LYS 140 182 182 LYS LYS C . n 
C 1 141 GLU 141 183 183 GLU GLU C . n 
C 1 142 ASN 142 184 184 ASN ASN C . n 
C 1 143 GLY 143 185 185 GLY GLY C . n 
C 1 144 GLY 144 186 186 GLY GLY C . n 
C 1 145 ALA 145 187 187 ALA ALA C . n 
C 1 146 ARG 146 188 188 ARG ARG C . n 
C 1 147 LEU 147 189 189 LEU LEU C . n 
C 1 148 ALA 148 190 190 ALA ALA C . n 
C 1 149 GLU 149 191 191 GLU GLU C . n 
C 1 150 TYR 150 192 192 TYR TYR C . n 
C 1 151 HIS 151 193 193 HIS HIS C . n 
C 1 152 ALA 152 194 194 ALA ALA C . n 
C 1 153 LYS 153 195 195 LYS LYS C . n 
C 1 154 ALA 154 196 196 ALA ALA C . n 
C 1 155 THR 155 197 197 THR THR C . n 
C 1 156 GLU 156 198 198 GLU GLU C . n 
C 1 157 HIS 157 199 199 HIS HIS C . n 
C 1 158 LEU 158 200 200 LEU LEU C . n 
C 1 159 SER 159 201 201 SER SER C . n 
C 1 160 THR 160 202 202 THR THR C . n 
C 1 161 LEU 161 203 203 LEU LEU C . n 
C 1 162 SER 162 204 204 SER SER C . n 
C 1 163 GLU 163 205 205 GLU GLU C . n 
C 1 164 LYS 164 206 206 LYS LYS C . n 
C 1 165 ALA 165 207 207 ALA ALA C . n 
C 1 166 LYS 166 208 208 LYS LYS C . n 
C 1 167 PRO 167 209 209 PRO PRO C . n 
C 1 168 ALA 168 210 210 ALA ALA C . n 
C 1 169 LEU 169 211 211 LEU LEU C . n 
C 1 170 GLU 170 212 212 GLU GLU C . n 
C 1 171 ASP 171 213 213 ASP ASP C . n 
C 1 172 LEU 172 214 214 LEU LEU C . n 
C 1 173 ARG 173 215 215 ARG ARG C . n 
C 1 174 GLN 174 216 216 GLN GLN C . n 
C 1 175 GLY 175 217 217 GLY GLY C . n 
C 1 176 LEU 176 218 218 LEU LEU C . n 
C 1 177 LEU 177 219 219 LEU LEU C . n 
C 1 178 PRO 178 220 220 PRO PRO C . n 
C 1 179 VAL 179 221 221 VAL VAL C . n 
C 1 180 LEU 180 222 222 LEU LEU C . n 
C 1 181 GLU 181 223 223 GLU GLU C . n 
C 1 182 SER 182 224 224 SER SER C . n 
C 1 183 PHE 183 225 225 PHE PHE C . n 
C 1 184 LYS 184 226 226 LYS LYS C . n 
C 1 185 VAL 185 227 227 VAL VAL C . n 
C 1 186 SER 186 228 228 SER SER C . n 
C 1 187 PHE 187 229 229 PHE PHE C . n 
C 1 188 LEU 188 230 230 LEU LEU C . n 
C 1 189 SER 189 231 231 SER SER C . n 
C 1 190 ALA 190 232 232 ALA ALA C . n 
C 1 191 LEU 191 233 233 LEU LEU C . n 
C 1 192 GLU 192 234 234 GLU GLU C . n 
C 1 193 GLU 193 235 235 GLU GLU C . n 
C 1 194 TYR 194 236 236 TYR TYR C . n 
C 1 195 THR 195 237 237 THR THR C . n 
C 1 196 LYS 196 238 238 LYS LYS C . n 
C 1 197 LYS 197 239 239 LYS LYS C . n 
C 1 198 LEU 198 240 240 LEU LEU C . n 
C 1 199 ASN 199 241 241 ASN ASN C . n 
C 1 200 THR 200 242 242 THR THR C . n 
C 1 201 GLN 201 243 243 GLN GLN C . n 
D 1 1   MET 1   43  43  MET MET D . n 
D 1 2   LEU 2   44  44  LEU LEU D . n 
D 1 3   LYS 3   45  45  LYS LYS D . n 
D 1 4   LEU 4   46  46  LEU LEU D . n 
D 1 5   LEU 5   47  47  LEU LEU D . n 
D 1 6   ASP 6   48  48  ASP ASP D . n 
D 1 7   ASN 7   49  49  ASN ASN D . n 
D 1 8   TRP 8   50  50  TRP TRP D . n 
D 1 9   ASP 9   51  51  ASP ASP D . n 
D 1 10  SER 10  52  52  SER SER D . n 
D 1 11  VAL 11  53  53  VAL VAL D . n 
D 1 12  THR 12  54  54  THR THR D . n 
D 1 13  SER 13  55  55  SER SER D . n 
D 1 14  THR 14  56  56  THR THR D . n 
D 1 15  PHE 15  57  57  PHE PHE D . n 
D 1 16  SER 16  58  58  SER SER D . n 
D 1 17  LYS 17  59  59  LYS LYS D . n 
D 1 18  LEU 18  60  60  LEU LEU D . n 
D 1 19  ARG 19  61  61  ARG ARG D . n 
D 1 20  GLU 20  62  62  GLU GLU D . n 
D 1 21  GLN 21  63  63  GLN GLN D . n 
D 1 22  LEU 22  64  64  LEU LEU D . n 
D 1 23  GLY 23  65  65  GLY GLY D . n 
D 1 24  PRO 24  66  66  PRO PRO D . n 
D 1 25  VAL 25  67  67  VAL VAL D . n 
D 1 26  THR 26  68  68  THR THR D . n 
D 1 27  GLN 27  69  69  GLN GLN D . n 
D 1 28  GLU 28  70  70  GLU GLU D . n 
D 1 29  PHE 29  71  71  PHE PHE D . n 
D 1 30  TRP 30  72  72  TRP TRP D . n 
D 1 31  ASP 31  73  73  ASP ASP D . n 
D 1 32  ASN 32  74  74  ASN ASN D . n 
D 1 33  LEU 33  75  75  LEU LEU D . n 
D 1 34  GLU 34  76  76  GLU GLU D . n 
D 1 35  LYS 35  77  77  LYS LYS D . n 
D 1 36  GLU 36  78  78  GLU GLU D . n 
D 1 37  THR 37  79  79  THR THR D . n 
D 1 38  GLU 38  80  80  GLU GLU D . n 
D 1 39  GLY 39  81  81  GLY GLY D . n 
D 1 40  LEU 40  82  82  LEU LEU D . n 
D 1 41  ARG 41  83  83  ARG ARG D . n 
D 1 42  GLN 42  84  84  GLN GLN D . n 
D 1 43  GLU 43  85  85  GLU GLU D . n 
D 1 44  MET 44  86  86  MET MET D . n 
D 1 45  SER 45  87  87  SER SER D . n 
D 1 46  LYS 46  88  88  LYS LYS D . n 
D 1 47  ASP 47  89  89  ASP ASP D . n 
D 1 48  LEU 48  90  90  LEU LEU D . n 
D 1 49  GLU 49  91  91  GLU GLU D . n 
D 1 50  GLU 50  92  92  GLU GLU D . n 
D 1 51  VAL 51  93  93  VAL VAL D . n 
D 1 52  LYS 52  94  94  LYS LYS D . n 
D 1 53  ALA 53  95  95  ALA ALA D . n 
D 1 54  LYS 54  96  96  LYS LYS D . n 
D 1 55  VAL 55  97  97  VAL VAL D . n 
D 1 56  GLN 56  98  98  GLN GLN D . n 
D 1 57  PRO 57  99  99  PRO PRO D . n 
D 1 58  TYR 58  100 100 TYR TYR D . n 
D 1 59  LEU 59  101 101 LEU LEU D . n 
D 1 60  ASP 60  102 102 ASP ASP D . n 
D 1 61  ASP 61  103 103 ASP ASP D . n 
D 1 62  PHE 62  104 104 PHE PHE D . n 
D 1 63  GLN 63  105 105 GLN GLN D . n 
D 1 64  LYS 64  106 106 LYS LYS D . n 
D 1 65  LYS 65  107 107 LYS LYS D . n 
D 1 66  TRP 66  108 108 TRP TRP D . n 
D 1 67  GLN 67  109 109 GLN GLN D . n 
D 1 68  GLU 68  110 110 GLU GLU D . n 
D 1 69  GLU 69  111 111 GLU GLU D . n 
D 1 70  MET 70  112 112 MET MET D . n 
D 1 71  GLU 71  113 113 GLU GLU D . n 
D 1 72  LEU 72  114 114 LEU LEU D . n 
D 1 73  TYR 73  115 115 TYR TYR D . n 
D 1 74  ARG 74  116 116 ARG ARG D . n 
D 1 75  GLN 75  117 117 GLN GLN D . n 
D 1 76  LYS 76  118 118 LYS LYS D . n 
D 1 77  VAL 77  119 119 VAL VAL D . n 
D 1 78  GLU 78  120 120 GLU GLU D . n 
D 1 79  PRO 79  121 121 PRO PRO D . n 
D 1 80  LEU 80  122 122 LEU LEU D . n 
D 1 81  ARG 81  123 123 ARG ARG D . n 
D 1 82  ALA 82  124 124 ALA ALA D . n 
D 1 83  GLU 83  125 125 GLU GLU D . n 
D 1 84  LEU 84  126 126 LEU LEU D . n 
D 1 85  GLN 85  127 127 GLN GLN D . n 
D 1 86  GLU 86  128 128 GLU GLU D . n 
D 1 87  GLY 87  129 129 GLY GLY D . n 
D 1 88  ALA 88  130 130 ALA ALA D . n 
D 1 89  ARG 89  131 131 ARG ARG D . n 
D 1 90  GLN 90  132 132 GLN GLN D . n 
D 1 91  LYS 91  133 133 LYS LYS D . n 
D 1 92  LEU 92  134 134 LEU LEU D . n 
D 1 93  HIS 93  135 135 HIS HIS D . n 
D 1 94  GLU 94  136 136 GLU GLU D . n 
D 1 95  LEU 95  137 137 LEU LEU D . n 
D 1 96  GLN 96  138 138 GLN GLN D . n 
D 1 97  GLU 97  139 139 GLU GLU D . n 
D 1 98  LYS 98  140 140 LYS LYS D . n 
D 1 99  LEU 99  141 141 LEU LEU D . n 
D 1 100 SER 100 142 142 SER SER D . n 
D 1 101 PRO 101 143 143 PRO PRO D . n 
D 1 102 LEU 102 144 144 LEU LEU D . n 
D 1 103 GLY 103 145 145 GLY GLY D . n 
D 1 104 GLU 104 146 146 GLU GLU D . n 
D 1 105 GLU 105 147 147 GLU GLU D . n 
D 1 106 MET 106 148 148 MET MET D . n 
D 1 107 ARG 107 149 149 ARG ARG D . n 
D 1 108 ASP 108 150 150 ASP ASP D . n 
D 1 109 ARG 109 151 151 ARG ARG D . n 
D 1 110 ALA 110 152 152 ALA ALA D . n 
D 1 111 ARG 111 153 153 ARG ARG D . n 
D 1 112 ALA 112 154 154 ALA ALA D . n 
D 1 113 HIS 113 155 155 HIS HIS D . n 
D 1 114 VAL 114 156 156 VAL VAL D . n 
D 1 115 ASP 115 157 157 ASP ASP D . n 
D 1 116 ALA 116 158 158 ALA ALA D . n 
D 1 117 LEU 117 159 159 LEU LEU D . n 
D 1 118 ARG 118 160 160 ARG ARG D . n 
D 1 119 THR 119 161 161 THR THR D . n 
D 1 120 HIS 120 162 162 HIS HIS D . n 
D 1 121 LEU 121 163 163 LEU LEU D . n 
D 1 122 ALA 122 164 164 ALA ALA D . n 
D 1 123 PRO 123 165 165 PRO PRO D . n 
D 1 124 TYR 124 166 166 TYR TYR D . n 
D 1 125 SER 125 167 167 SER SER D . n 
D 1 126 ASP 126 168 168 ASP ASP D . n 
D 1 127 GLU 127 169 169 GLU GLU D . n 
D 1 128 LEU 128 170 170 LEU LEU D . n 
D 1 129 ARG 129 171 171 ARG ARG D . n 
D 1 130 GLN 130 172 172 GLN GLN D . n 
D 1 131 ARG 131 173 173 ARG ARG D . n 
D 1 132 LEU 132 174 174 LEU LEU D . n 
D 1 133 ALA 133 175 175 ALA ALA D . n 
D 1 134 ALA 134 176 176 ALA ALA D . n 
D 1 135 ARG 135 177 177 ARG ARG D . n 
D 1 136 LEU 136 178 178 LEU LEU D . n 
D 1 137 GLU 137 179 179 GLU GLU D . n 
D 1 138 ALA 138 180 180 ALA ALA D . n 
D 1 139 LEU 139 181 181 LEU LEU D . n 
D 1 140 LYS 140 182 182 LYS LYS D . n 
D 1 141 GLU 141 183 183 GLU GLU D . n 
D 1 142 ASN 142 184 184 ASN ASN D . n 
D 1 143 GLY 143 185 185 GLY GLY D . n 
D 1 144 GLY 144 186 186 GLY GLY D . n 
D 1 145 ALA 145 187 187 ALA ALA D . n 
D 1 146 ARG 146 188 188 ARG ARG D . n 
D 1 147 LEU 147 189 189 LEU LEU D . n 
D 1 148 ALA 148 190 190 ALA ALA D . n 
D 1 149 GLU 149 191 191 GLU GLU D . n 
D 1 150 TYR 150 192 192 TYR TYR D . n 
D 1 151 HIS 151 193 193 HIS HIS D . n 
D 1 152 ALA 152 194 194 ALA ALA D . n 
D 1 153 LYS 153 195 195 LYS LYS D . n 
D 1 154 ALA 154 196 196 ALA ALA D . n 
D 1 155 THR 155 197 197 THR THR D . n 
D 1 156 GLU 156 198 198 GLU GLU D . n 
D 1 157 HIS 157 199 199 HIS HIS D . n 
D 1 158 LEU 158 200 200 LEU LEU D . n 
D 1 159 SER 159 201 201 SER SER D . n 
D 1 160 THR 160 202 202 THR THR D . n 
D 1 161 LEU 161 203 203 LEU LEU D . n 
D 1 162 SER 162 204 204 SER SER D . n 
D 1 163 GLU 163 205 205 GLU GLU D . n 
D 1 164 LYS 164 206 206 LYS LYS D . n 
D 1 165 ALA 165 207 207 ALA ALA D . n 
D 1 166 LYS 166 208 208 LYS LYS D . n 
D 1 167 PRO 167 209 209 PRO PRO D . n 
D 1 168 ALA 168 210 210 ALA ALA D . n 
D 1 169 LEU 169 211 211 LEU LEU D . n 
D 1 170 GLU 170 212 212 GLU GLU D . n 
D 1 171 ASP 171 213 213 ASP ASP D . n 
D 1 172 LEU 172 214 214 LEU LEU D . n 
D 1 173 ARG 173 215 215 ARG ARG D . n 
D 1 174 GLN 174 216 216 GLN GLN D . n 
D 1 175 GLY 175 217 217 GLY GLY D . n 
D 1 176 LEU 176 218 218 LEU LEU D . n 
D 1 177 LEU 177 219 219 LEU LEU D . n 
D 1 178 PRO 178 220 220 PRO PRO D . n 
D 1 179 VAL 179 221 221 VAL VAL D . n 
D 1 180 LEU 180 222 222 LEU LEU D . n 
D 1 181 GLU 181 223 223 GLU GLU D . n 
D 1 182 SER 182 224 224 SER SER D . n 
D 1 183 PHE 183 225 225 PHE PHE D . n 
D 1 184 LYS 184 226 226 LYS LYS D . n 
D 1 185 VAL 185 227 227 VAL VAL D . n 
D 1 186 SER 186 228 228 SER SER D . n 
D 1 187 PHE 187 229 229 PHE PHE D . n 
D 1 188 LEU 188 230 230 LEU LEU D . n 
D 1 189 SER 189 231 231 SER SER D . n 
D 1 190 ALA 190 232 232 ALA ALA D . n 
D 1 191 LEU 191 233 233 LEU LEU D . n 
D 1 192 GLU 192 234 234 GLU GLU D . n 
D 1 193 GLU 193 235 235 GLU GLU D . n 
D 1 194 TYR 194 236 236 TYR TYR D . n 
D 1 195 THR 195 237 237 THR THR D . n 
D 1 196 LYS 196 238 238 LYS LYS D . n 
D 1 197 LYS 197 239 239 LYS LYS D . n 
D 1 198 LEU 198 240 240 LEU LEU D . n 
D 1 199 ASN 199 241 241 ASN ASN D . n 
D 1 200 THR 200 242 242 THR THR D . n 
D 1 201 GLN 201 243 243 GLN GLN D . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 32020 ? 
1 MORE         -254  ? 
1 'SSA (A^2)'  51470 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1998-02-04 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2018-04-04 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
4 4 'Structure model' Other                       
5 4 'Structure model' 'Refinement description'    
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' diffrn_source        
2 4 'Structure model' pdbx_database_status 
3 4 'Structure model' software             
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_diffrn_source.type'                
2 4 'Structure model' '_pdbx_database_status.process_site' 
3 4 'Structure model' '_software.name'                     
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HASSP    'model building' .           ? 1 
X-PLOR   'model building' 3.843       ? 2 
X-PLOR   refinement       3.843       ? 3 
MOSFLM   'data reduction' .           ? 4 
CCP4     'data scaling'   '(AGROVATA' ? 5 
ROTAVATA 'data scaling'   .           ? 6 
TRUNCATE 'data scaling'   .           ? 7 
HASSP    phasing          .           ? 8 
X-PLOR   phasing          3.843       ? 9 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1  1 NH2 A ARG 149 ? ? 1_555 C   D ASP 150 ? ? 4_555 0.52 
2  1 CB  B PRO 143 ? ? 1_555 NH1 C ARG 160 ? ? 3_645 0.99 
3  1 CZ  A ARG 149 ? ? 1_555 O   D ASP 150 ? ? 4_555 1.01 
4  1 CA  B ARG 151 ? ? 1_555 NH1 C ARG 149 ? ? 3_645 1.09 
5  1 NH2 A ARG 149 ? ? 1_555 O   D ASP 150 ? ? 4_555 1.14 
6  1 OD1 D ASP 150 ? ? 1_555 CD1 D LEU 222 ? ? 4_455 1.18 
7  1 NH2 A ARG 149 ? ? 1_555 N   D ARG 151 ? ? 4_555 1.27 
8  1 CD  B PRO 143 ? ? 1_555 NH2 C ARG 160 ? ? 3_645 1.31 
9  1 CB  B PRO 143 ? ? 1_555 CZ  C ARG 160 ? ? 3_645 1.31 
10 1 CG  B PRO 143 ? ? 1_555 NH2 C ARG 160 ? ? 3_645 1.34 
11 1 CA  B ALA 158 ? ? 1_555 NE2 C GLN 138 ? ? 3_645 1.38 
12 1 CZ  A ARG 149 ? ? 1_555 C   D ASP 150 ? ? 4_555 1.49 
13 1 O   B GLU 147 ? ? 1_555 NH2 C ARG 149 ? ? 3_645 1.50 
14 1 CG  B ARG 151 ? ? 1_555 CZ  C ARG 149 ? ? 3_645 1.70 
15 1 NH1 A ARG 149 ? ? 1_555 O   D ASP 150 ? ? 4_555 1.72 
16 1 CG  B PRO 143 ? ? 1_555 CZ  C ARG 160 ? ? 3_645 1.79 
17 1 CB  B ARG 151 ? ? 1_555 NH1 C ARG 149 ? ? 3_645 1.84 
18 1 N   B ARG 151 ? ? 1_555 NH2 C ARG 149 ? ? 3_645 1.84 
19 1 CG  B PRO 143 ? ? 1_555 NH1 C ARG 160 ? ? 3_645 1.85 
20 1 NE2 A GLN 138 ? ? 1_555 O   D ALA 158 ? ? 4_555 1.85 
21 1 CZ  A ARG 149 ? ? 1_555 N   D ARG 151 ? ? 4_555 1.89 
22 1 NH2 A ARG 149 ? ? 1_555 CA  D ASP 150 ? ? 4_555 1.89 
23 1 C   B ALA 158 ? ? 1_555 NE2 C GLN 138 ? ? 3_645 1.91 
24 1 CB  B PRO 143 ? ? 1_555 NH2 C ARG 160 ? ? 3_645 1.92 
25 1 CA  B ARG 151 ? ? 1_555 CZ  C ARG 149 ? ? 3_645 1.92 
26 1 CZ  A ARG 149 ? ? 1_555 CA  D ARG 151 ? ? 4_555 1.97 
27 1 NH1 A ARG 149 ? ? 1_555 C   D ARG 151 ? ? 4_555 1.97 
28 1 NE  A ARG 149 ? ? 1_555 O   D ASP 150 ? ? 4_555 2.04 
29 1 NH1 A ARG 149 ? ? 1_555 O   D ARG 151 ? ? 4_555 2.06 
30 1 CB  B ARG 151 ? ? 1_555 CZ  C ARG 149 ? ? 3_645 2.07 
31 1 CG  D ASP 150 ? ? 1_555 CD1 D LEU 222 ? ? 4_455 2.09 
32 1 N   B ARG 151 ? ? 1_555 NH1 C ARG 149 ? ? 3_645 2.11 
33 1 CG  B ARG 151 ? ? 1_555 NE  C ARG 149 ? ? 3_645 2.13 
34 1 OG1 B THR 161 ? ? 1_555 OE2 B GLU 234 ? ? 3_645 2.13 
35 1 NE2 B HIS 162 ? ? 1_555 ND1 C HIS 135 ? ? 3_645 2.13 
36 1 O   B ALA 158 ? ? 1_555 NE2 C GLN 138 ? ? 3_645 2.14 
37 1 CD2 B HIS 162 ? ? 1_555 ND1 C HIS 135 ? ? 3_645 2.18 
38 1 CG  B ARG 151 ? ? 1_555 NH1 C ARG 149 ? ? 3_645 2.18 
39 1 CG  B ARG 151 ? ? 1_555 NH2 C ARG 149 ? ? 3_645 2.18 
40 1 NH2 A ARG 149 ? ? 1_555 CA  D ARG 151 ? ? 4_555 2.19 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 C B LEU 219 ? ? N B PRO 220 ? ? CA B PRO 220 ? ? 128.64 119.30 9.34 1.50 Y 
2 1 C D LEU 219 ? ? N D PRO 220 ? ? CA D PRO 220 ? ? 128.62 119.30 9.32 1.50 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LEU A 47  ? ? -60.37  7.18    
2  1 ASN A 49  ? ? -48.61  -15.45  
3  1 THR A 56  ? ? -94.18  -68.41  
4  1 PRO A 66  ? ? -58.47  -3.56   
5  1 GLN A 69  ? ? -63.08  -74.55  
6  1 PHE A 71  ? ? -84.09  -81.87  
7  1 LEU A 75  ? ? -65.77  -73.60  
8  1 THR A 79  ? ? -50.59  -78.43  
9  1 GLN A 127 ? ? -67.88  -76.27  
10 1 GLU A 147 ? ? -71.73  -82.78  
11 1 ARG A 149 ? ? -49.33  -70.55  
12 1 ARG A 153 ? ? -6.12   -71.33  
13 1 ALA A 154 ? ? -49.64  -71.47  
14 1 LEU A 163 ? ? -106.00 -61.69  
15 1 ALA A 164 ? ? -19.13  -48.93  
16 1 ARG A 173 ? ? -83.69  -72.59  
17 1 ASP A 213 ? ? -49.62  -72.69  
18 1 PRO A 220 ? ? -84.90  44.91   
19 1 LEU A 222 ? ? -45.45  150.11  
20 1 GLU A 223 ? ? -126.80 -167.51 
21 1 PHE A 225 ? ? 39.42   87.14   
22 1 VAL A 227 ? ? -32.25  -38.56  
23 1 SER A 228 ? ? 104.87  -90.69  
24 1 TYR A 236 ? ? -38.80  -75.65  
25 1 ASP B 48  ? ? -67.85  11.66   
26 1 SER B 55  ? ? -69.92  5.84    
27 1 PHE B 57  ? ? -67.70  -73.76  
28 1 PRO B 66  ? ? -55.56  -9.50   
29 1 PHE B 71  ? ? -71.04  -79.80  
30 1 THR B 79  ? ? -33.09  -71.78  
31 1 SER B 87  ? ? -38.23  -34.44  
32 1 GLU B 120 ? ? -26.62  -46.06  
33 1 VAL B 156 ? ? -57.73  -70.92  
34 1 ALA B 164 ? ? -29.02  -49.68  
35 1 LEU B 219 ? ? -41.84  151.66  
36 1 GLU B 223 ? ? -43.00  107.88  
37 1 LYS B 226 ? ? -106.99 -120.00 
38 1 TYR B 236 ? ? -60.34  -72.85  
39 1 THR B 242 ? ? -88.13  -76.25  
40 1 LEU C 47  ? ? -60.34  7.12    
41 1 ASN C 49  ? ? -48.66  -15.45  
42 1 THR C 56  ? ? -94.17  -68.40  
43 1 PRO C 66  ? ? -58.44  -3.59   
44 1 GLN C 69  ? ? -63.06  -74.51  
45 1 PHE C 71  ? ? -84.08  -81.85  
46 1 LEU C 75  ? ? -65.76  -73.59  
47 1 THR C 79  ? ? -50.68  -78.34  
48 1 GLN C 127 ? ? -67.86  -76.31  
49 1 GLU C 147 ? ? -71.75  -82.78  
50 1 ARG C 149 ? ? -49.34  -70.56  
51 1 ARG C 153 ? ? -6.10   -71.37  
52 1 ALA C 154 ? ? -49.65  -71.44  
53 1 LEU C 163 ? ? -105.99 -61.67  
54 1 ALA C 164 ? ? -19.13  -48.94  
55 1 ARG C 173 ? ? -83.63  -72.60  
56 1 ASP C 213 ? ? -49.65  -72.66  
57 1 PRO C 220 ? ? -84.91  44.87   
58 1 LEU C 222 ? ? -45.49  150.08  
59 1 GLU C 223 ? ? -126.78 -167.50 
60 1 PHE C 225 ? ? 39.46   87.15   
61 1 VAL C 227 ? ? -32.27  -38.54  
62 1 SER C 228 ? ? 104.89  -90.70  
63 1 TYR C 236 ? ? -38.82  -75.66  
64 1 ASP D 48  ? ? -67.82  11.65   
65 1 SER D 55  ? ? -69.95  5.86    
66 1 PHE D 57  ? ? -67.73  -73.73  
67 1 PRO D 66  ? ? -55.62  -9.44   
68 1 PHE D 71  ? ? -71.04  -79.80  
69 1 THR D 79  ? ? -33.11  -71.80  
70 1 SER D 87  ? ? -38.26  -34.41  
71 1 GLU D 120 ? ? -26.62  -46.09  
72 1 VAL D 156 ? ? -57.78  -70.93  
73 1 ALA D 164 ? ? -29.07  -49.67  
74 1 LEU D 219 ? ? -41.91  151.69  
75 1 GLU D 223 ? ? -42.98  107.87  
76 1 LYS D 226 ? ? -107.00 -119.96 
77 1 TYR D 236 ? ? -60.38  -72.80  
78 1 THR D 242 ? ? -88.10  -76.22  
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1 TYR A 100 ? ? 0.121 'SIDE CHAIN' 
2 1 TYR C 100 ? ? 0.121 'SIDE CHAIN' 
# 



If you find results from this site helpful for your research, please cite one of our papers:

elNémo is maintained by Yves-Henri Sanejouand.
It was developed by Karsten Suhre.
Between 2003 and 2014, it was hosted by IGS (Marseille).
Last modification: October 18th, 2018.