CNRS Nantes University UFIP UFIP
home |  start a new run |  job status |  references&downloads |  examples |  help  

Should you encounter any unexpected behaviour,
please let us know.


***    ***

elNémo ID: 211018171254118551

Job options:

ID        	=	 211018171254118551
JOBID     	=	 
USERID    	=	 ashgang
PRIVAT    	=	 0

NMODES    	=	 5
DQMIN     	=	 -100
DQMAX     	=	 100
DQSTEP    	=	 20
DOGRAPHS  	=	 on

DOPROJMODS	=	 on
DORMSD    	=	 on

NRBL      	=	 0
CUTOFF    	=	 0
CAONLY    	=	 0


Input data for this run:


TITLE     SWISS-MODEL SERVER (https://swissmodel.expasy.org)
TITLE    2 sv-0
EXPDTA    THEORETICAL MODEL (SWISS-MODEL SERVER)
AUTHOR    SWISS-MODEL SERVER (SEE REFERENCE IN JRNL Records)
REVDAT   1   18-OCT-21 1MOD    1       15:09
JRNL        AUTH   A.WATERHOUSE,M.BERTONI,S.BIENERT,G.STUDER,G.TAURIELLO,
JRNL        AUTH 2 R.GUMIENNY,F.T.HEER,T.A.P.DE BEER,C.REMPFER,L.BORDOLI,
JRNL        AUTH 3 R.LEPORE,T.SCHWEDE
JRNL        TITL   SWISS-MODEL: HOMOLOGY MODELLING OF PROTEIN STRUCTURES AND
JRNL        TITL 2 COMPLEXES
JRNL        REF    NUCLEIC.ACIDS.RES..           V.  46 W296  2018
JRNL        PMID   29788355
JRNL        DOI    10.1093/nar/gky427
REMARK   1
REMARK   1 REFERENCE 1
REMARK   1  AUTH   S.BIENERT,A.WATERHOUSE,T.A.P.DE BEER,G.TAURIELLO,G.STUDER,
REMARK   1  AUTH 2 L.BORDOLI,T.SCHWEDE
REMARK   1  TITL   THE SWISS-MODEL REPOSITORY - NEW FEATURES AND FUNCTIONALITY
REMARK   1  REF    NUCLEIC.ACIDS.RES..           V.  45       2017
REMARK   1  REFN                   ISSN 0305-1048
REMARK   1  PMID   27899672
REMARK   1  DOI    10.1093/nar/gkw1132
REMARK   1
REMARK   1 REFERENCE 2
REMARK   1  AUTH   N.GUEX,M.C.PEITSCH,T.SCHWEDE
REMARK   1  TITL   AUTOMATED COMPARATIVE PROTEIN STRUCTURE MODELING WITH
REMARK   1  TITL 2 SWISS-MODEL AND SWISS-PDBVIEWER: A HISTORICAL PERSPECTIVE
REMARK   1  REF    ELECTROPHORESIS               V.  30       2009
REMARK   1  REFN                   ISSN 0173-0835
REMARK   1  PMID   19517507
REMARK   1  DOI    10.1002/elps.200900140
REMARK   1
REMARK   1 REFERENCE 3
REMARK   1  AUTH   G.STUDER,G.TAURIELLO,S.BIENERT,M.BIASINI,N.JOHNER,T.SCHWEDE
REMARK   1  TITL   PROMOD3 - A VERSATILE HOMOLOGY MODELLING TOOLBOX
REMARK   1  REF    PLOS COMP. BIOL.              V.  17       2021
REMARK   1  REFN                   ISSN 
REMARK   1  PMID   33507980
REMARK   1  DOI    https://doi.org/10.1371/journal.pcbi.1008667
REMARK   1
REMARK   1 REFERENCE 4
REMARK   1  AUTH   G.STUDER,C.REMPFER,A.WATERHOUSE,R.GUMIENNY,J.HAAS,T.SCHWEDE
REMARK   1  TITL   QMEANDISCO - DISTANCE CONSTRAINTS APPLIED ON MODEL QUALITY 
REMARK   1  TITL 2 ESTIMATION
REMARK   1  REF    BIOINFORMATICS                V.  36       2020
REMARK   1  REFN                   ISSN 
REMARK   1  PMID   31697312
REMARK   1  DOI    https://doi.org/10.1093/bioinformatics/btz828
REMARK   1
REMARK   1 REFERENCE 5
REMARK   1  AUTH   P.BENKERT,M.BIASINI,T.SCHWEDE
REMARK   1  TITL   TOWARD THE ESTIMATION OF THE ABSOLUTE QUALITY OF INDIVIDUAL
REMARK   1  TITL 2 PROTEIN STRUCTURE MODELS
REMARK   1  REF    BIOINFORMATICS                V.  27       2011
REMARK   1  REFN                   ISSN 1367-4803
REMARK   1  PMID   21134891
REMARK   1  DOI    10.1093/bioinformatics/btq662
REMARK   1
REMARK   1 REFERENCE 6
REMARK   1  AUTH   M.BERTONI,F.KIEFER,M.BIASINI,L.BORDOLI,T.SCHWEDE
REMARK   1  TITL   MODELING PROTEIN QUATERNARY STRUCTURE OF HOMO- AND
REMARK   1  TITL 2 HETERO-OLIGOMERS BEYOND BINARY INTERACTIONS BY HOMOLOGY
REMARK   1  REF    SCI.REP.                      V.   7       2017
REMARK   1  REFN                   ISSN
REMARK   1  PMID   28874689
REMARK   1  DOI    10.1038/s41598-017-09654-8
REMARK   1
REMARK   1 DISCLAIMER
REMARK   1 The SWISS-MODEL SERVER produces theoretical models for proteins.
REMARK   1 The results of any theoretical modelling procedure is
REMARK   1 NON-EXPERIMENTAL and MUST be considered with care. These models may
REMARK   1 contain significant errors. This is especially true for automated
REMARK   1 modeling since there is no human intervention during model
REMARK   1 building. Please read the header section and the logfile carefully
REMARK   1 to know what templates and alignments were used during the model
REMARK   1 building process. All information by the SWISS-MODEL SERVER is
REMARK   1 provided "AS-IS", without any warranty, expressed or implied.
REMARK   2
REMARK   2 COPYRIGHT NOTICE
REMARK   2 This SWISS-MODEL protein model is copyright. It is produced by the
REMARK   2 SWISS-MODEL server, developed by the Computational Structural
REMARK   2 Biology Group at the SIB Swiss Institute of Bioinformatics at the
REMARK   2 Biozentrum, University of Basel (https://swissmodel.expasy.org). This
REMARK   2 model is licensed under the CC BY-SA 4.0 Creative Commons
REMARK   2 Attribution-ShareAlike 4.0 International License
REMARK   2 (https://creativecommons.org/licenses/by-sa/4.0/legalcode), i.e. you
REMARK   2 can copy and redistribute the model in any medium or format,
REMARK   2 transform and build upon the model for any purpose, even
REMARK   2 commercially, under the following terms:
REMARK   2 Attribution - You must give appropriate credit, provide a link to
REMARK   2 the license, and indicate if changes were made. You may do so in any
REMARK   2 reasonable manner, but not in any way that suggests the licensor
REMARK   2 endorses you or your use. When you publish, patent or distribute
REMARK   2 results that were fully or partially based on the model, please cite
REMARK   2 the corresponding papers mentioned under JRNL.
REMARK   2 ShareAlike - If you remix, transform, or build upon the material,
REMARK   2 you must distribute your contributions under the same license as the
REMARK   2 original.
REMARK   2 No additional restrictions - you may not apply legal terms or
REMARK   2 technological measures that legally restrict others from doing
REMARK   2 anything the license permits.
REMARK   2 Find a human-readable summary of (and not a substitute for) the
REMARK   2 CC BY-SA 4.0 license at this link:
REMARK   2 https://creativecommons.org/licenses/by-sa/4.0/
REMARK   3 
REMARK   3 MODEL INFORMATION
REMARK   3  ENGIN   PROMOD3
REMARK   3  VERSN   3.2.0
REMARK   3  OSTAT   homo-dimer
REMARK   3  OSRSN   PREDICTION
REMARK   3  QSPRD   0.925
REMARK   3  GMQE    0.61
REMARK   3  QMNV    4.2.0
REMARK   3  QMNDG   0.58
REMARK   3  MODT    FALSE
REMARK   3 
REMARK   3 TEMPLATE 1
REMARK   3  PDBID   template_upload
REMARK   3  CHAIN   B
REMARK   3  MMCIF   B
REMARK   3  PDBV    2021-10-08
REMARK   3  SMTLE   template_upload.1.B
REMARK   3  SMTLV   2021-10-13
REMARK   3  MTHD    Unknown
REMARK   3  FOUND   BLAST
REMARK   3  GMQE    0.49
REMARK   3  SIM     0.61
REMARK   3  SID     100.00
REMARK   3  OSTAT   homo-dimer
REMARK   3  ALN B TRG MKFSDVLDQAWAEDSGPPTTLGRDLRLVRAAAPELLALDVPADAYGELVGSYRPDRAG
REMARK   3  ALN B TRG AVTAVVLTHDEEQVIGACLRALTDDCDRLLLVDAESEDTTLGTARSAVAHVEHVTRAW
REMARK   3  ALN B TRG TDDFAAQRNAAFEQARPGGWLAHVDADETLSAESRGRLRAVLTALDHVLPGADLVVSP
REMARK   3  ALN B TRG RILDTSRECHTDTRRIVRSDSALRFRGRLHERLYDAHGAQPPSVEVDVVFHHTGYEPE
REMARK   3  ALN B TRG VIARKGKRERYARLVERCLTEEPSNPKWHFYAVRDGLVGRKPGPDEALALFRRLREAH
REMARK   3  ALN B TRG ALYDEAPLSDYEAERCTDSLVLQCELALGFGGGREIADLAPLLHARGRPLEASYYQAF
REMARK   3  ALN B TRG AEFSALLSRSSRLLDQLSEGSRHQLPGNRQLAGRSYDLQALLALTCGRYDEVPLLLGE
REMARK   3  ALN B TRG ARSRQAGSLTTATVESLADRLPSWRDLPQTS
REMARK   3  ALN B TPL MKFSDVLDQAWAEDSGPPTTLGRDLRLVRAAAPELLALDVPADAYGELVGSYRPDRAG
REMARK   3  ALN B TPL AVTAVVLTHDEEQVIGACLRALTDDCDRLLLVDAESEDTTLGTARSAVAHVEHVTRAW
REMARK   3  ALN B TPL TDDFAAQRNAAFEQARPGGWLAHVDADETLSAESRGRLRAVLTALDHVLPGADLVVSP
REMARK   3  ALN B TPL RILDTSRECHTDTRRIVRSDSALRFRGRLHERLYDAHGAQPPSVEVDVVFHHTGYEPE
REMARK   3  ALN B TPL VIARKGKRERYARLVERCLTEEPSNPKWHFYAVRDGLVGRKPGPDEALALFRRLREAH
REMARK   3  ALN B TPL ALYDEAPLSDYEAERCTDSLVLQCELALGFGGGREIADLAPLLHARGRPLEASYYQAF
REMARK   3  ALN B TPL AEFSALLSRSSRLLDQLSEGSRHQLPGNRQLAGRSYDLQALLALTCGRYDEVPLLLGE
REMARK   3  ALN B TPL ARSRQAGSLTTATVESLADRLPSWRDLPQTS
REMARK   3  ALN B OFF 0
ATOM      1  N   MET A   1     -19.907 -11.151  23.795  1.00  0.67           N  
ATOM      2  CA  MET A   1     -20.180 -10.247  22.624  1.00  0.67           C  
ATOM      3  C   MET A   1     -19.230 -10.530  21.475  1.00  0.67           C  
ATOM      4  O   MET A   1     -18.121 -10.995  21.722  1.00  0.67           O  
ATOM      5  CB  MET A   1     -20.047  -8.787  23.135  1.00  0.67           C  
ATOM      6  CG  MET A   1     -20.384  -7.714  22.084  1.00  0.67           C  
ATOM      7  SD  MET A   1     -20.169  -5.995  22.600  1.00  0.67           S  
ATOM      8  CE  MET A   1     -21.229  -6.104  24.050  1.00  0.67           C  
ATOM      9  N   LYS A   2     -19.630 -10.287  20.209  1.00  0.67           N  
ATOM     10  CA  LYS A   2     -18.765 -10.436  19.054  1.00  0.67           C  
ATOM     11  C   LYS A   2     -17.996  -9.160  18.751  1.00  0.67           C  
ATOM     12  O   LYS A   2     -18.371  -8.058  19.146  1.00  0.67           O  
ATOM     13  CB  LYS A   2     -19.576 -10.857  17.798  1.00  0.67           C  
ATOM     14  CG  LYS A   2     -20.356 -12.177  17.961  1.00  0.67           C  
ATOM     15  CD  LYS A   2     -19.391 -13.343  18.212  1.00  0.67           C  
ATOM     16  CE  LYS A   2     -20.011 -14.729  18.361  1.00  0.67           C  
ATOM     17  NZ  LYS A   2     -18.935 -15.663  18.706  1.00  0.67           N  
ATOM     18  N   PHE A   3     -16.861  -9.270  18.032  1.00  0.78           N  
ATOM     19  CA  PHE A   3     -16.059  -8.127  17.618  1.00  0.78           C  
ATOM     20  C   PHE A   3     -16.820  -7.172  16.702  1.00  0.78           C  
ATOM     21  O   PHE A   3     -16.697  -5.953  16.821  1.00  0.78           O  
ATOM     22  CB  PHE A   3     -14.721  -8.596  16.977  1.00  0.78           C  
ATOM     23  CG  PHE A   3     -13.804  -7.461  16.565  1.00  0.78           C  
ATOM     24  CD1 PHE A   3     -13.202  -7.474  15.295  1.00  0.78           C  
ATOM     25  CD2 PHE A   3     -13.549  -6.371  17.419  1.00  0.78           C  
ATOM     26  CE1 PHE A   3     -12.382  -6.418  14.875  1.00  0.78           C  
ATOM     27  CE2 PHE A   3     -12.750  -5.303  16.993  1.00  0.78           C  
ATOM     28  CZ  PHE A   3     -12.162  -5.327  15.724  1.00  0.78           C  
ATOM     29  N   SER A   4     -17.674  -7.698  15.802  1.00  0.79           N  
ATOM     30  CA  SER A   4     -18.575  -6.884  14.994  1.00  0.79           C  
ATOM     31  C   SER A   4     -19.514  -6.017  15.817  1.00  0.79           C  
ATOM     32  O   SER A   4     -19.599  -4.816  15.581  1.00  0.79           O  
ATOM     33  CB  SER A   4     -19.442  -7.754  14.051  1.00  0.79           C  
ATOM     34  OG  SER A   4     -19.985  -8.880  14.748  1.00  0.79           O  
ATOM     35  N   ASP A   5     -20.148  -6.576  16.871  1.00  0.80           N  
ATOM     36  CA  ASP A   5     -21.000  -5.835  17.786  1.00  0.80           C  
ATOM     37  C   ASP A   5     -20.259  -4.680  18.474  1.00  0.80           C  
ATOM     38  O   ASP A   5     -20.782  -3.579  18.649  1.00  0.80           O  
ATOM     39  CB  ASP A   5     -21.520  -6.721  18.951  1.00  0.80           C  
ATOM     40  CG  ASP A   5     -22.157  -8.043  18.568  1.00  0.80           C  
ATOM     41  OD1 ASP A   5     -22.876  -8.109  17.550  1.00  0.80           O  
ATOM     42  OD2 ASP A   5     -21.925  -9.016  19.343  1.00  0.80           O  
ATOM     43  N   VAL A   6     -18.991  -4.914  18.891  1.00  0.83           N  
ATOM     44  CA  VAL A   6     -18.129  -3.901  19.491  1.00  0.83           C  
ATOM     45  C   VAL A   6     -17.847  -2.748  18.539  1.00  0.83           C  
ATOM     46  O   VAL A   6     -17.931  -1.579  18.919  1.00  0.83           O  
ATOM     47  CB  VAL A   6     -16.796  -4.491  19.962  1.00  0.83           C  
ATOM     48  CG1 VAL A   6     -15.850  -3.409  20.517  1.00  0.83           C  
ATOM     49  CG2 VAL A   6     -17.042  -5.517  21.075  1.00  0.83           C  
ATOM     50  N   LEU A   7     -17.531  -3.041  17.261  1.00  0.80           N  
ATOM     51  CA  LEU A   7     -17.323  -2.021  16.248  1.00  0.80           C  
ATOM     52  C   LEU A   7     -18.580  -1.214  15.963  1.00  0.80           C  
ATOM     53  O   LEU A   7     -18.539   0.015  15.955  1.00  0.80           O  
ATOM     54  CB  LEU A   7     -16.786  -2.634  14.933  1.00  0.80           C  
ATOM     55  CG  LEU A   7     -15.365  -3.231  15.028  1.00  0.80           C  
ATOM     56  CD1 LEU A   7     -14.993  -3.885  13.690  1.00  0.80           C  
ATOM     57  CD2 LEU A   7     -14.308  -2.181  15.408  1.00  0.80           C  
ATOM     58  N   ASP A   8     -19.744  -1.874  15.816  1.00  0.77           N  
ATOM     59  CA  ASP A   8     -21.019  -1.216  15.597  1.00  0.77           C  
ATOM     60  C   ASP A   8     -21.380  -0.267  16.735  1.00  0.77           C  
ATOM     61  O   ASP A   8     -21.787   0.871  16.513  1.00  0.77           O  
ATOM     62  CB  ASP A   8     -22.135  -2.277  15.424  1.00  0.77           C  
ATOM     63  CG  ASP A   8     -22.036  -2.987  14.081  1.00  0.77           C  
ATOM     64  OD1 ASP A   8     -21.205  -2.577  13.232  1.00  0.77           O  
ATOM     65  OD2 ASP A   8     -22.837  -3.935  13.883  1.00  0.77           O  
ATOM     66  N   GLN A   9     -21.171  -0.678  18.003  1.00  0.74           N  
ATOM     67  CA  GLN A   9     -21.341   0.203  19.146  1.00  0.74           C  
ATOM     68  C   GLN A   9     -20.360   1.370  19.198  1.00  0.74           C  
ATOM     69  O   GLN A   9     -20.759   2.496  19.481  1.00  0.74           O  
ATOM     70  CB  GLN A   9     -21.342  -0.588  20.472  1.00  0.74           C  
ATOM     71  CG  GLN A   9     -22.584  -1.507  20.568  1.00  0.74           C  
ATOM     72  CD  GLN A   9     -22.743  -2.155  21.940  1.00  0.74           C  
ATOM     73  OE1 GLN A   9     -22.906  -1.497  22.967  1.00  0.74           O  
ATOM     74  NE2 GLN A   9     -22.745  -3.507  21.971  1.00  0.74           N  
ATOM     75  N   ALA A  10     -19.068   1.161  18.865  1.00  0.82           N  
ATOM     76  CA  ALA A  10     -18.092   2.234  18.753  1.00  0.82           C  
ATOM     77  C   ALA A  10     -18.454   3.275  17.691  1.00  0.82           C  
ATOM     78  O   ALA A  10     -18.336   4.486  17.882  1.00  0.82           O  
ATOM     79  CB  ALA A  10     -16.704   1.634  18.440  1.00  0.82           C  
ATOM     80  N   TRP A  11     -18.961   2.837  16.527  1.00  0.67           N  
ATOM     81  CA  TRP A  11     -19.424   3.733  15.485  1.00  0.67           C  
ATOM     82  C   TRP A  11     -20.757   4.393  15.819  1.00  0.67           C  
ATOM     83  O   TRP A  11     -21.054   5.447  15.275  1.00  0.67           O  
ATOM     84  CB  TRP A  11     -19.490   2.997  14.122  1.00  0.67           C  
ATOM     85  CG  TRP A  11     -18.122   2.815  13.466  1.00  0.67           C  
ATOM     86  CD1 TRP A  11     -17.209   1.801  13.590  1.00  0.67           C  
ATOM     87  CD2 TRP A  11     -17.545   3.757  12.542  1.00  0.67           C  
ATOM     88  NE1 TRP A  11     -16.095   2.058  12.823  1.00  0.67           N  
ATOM     89  CE2 TRP A  11     -16.286   3.243  12.162  1.00  0.67           C  
ATOM     90  CE3 TRP A  11     -18.016   4.962  12.024  1.00  0.67           C  
ATOM     91  CZ2 TRP A  11     -15.480   3.918  11.260  1.00  0.67           C  
ATOM     92  CZ3 TRP A  11     -17.204   5.639  11.101  1.00  0.67           C  
ATOM     93  CH2 TRP A  11     -15.952   5.126  10.726  1.00  0.67           C  
ATOM     94  N   ALA A  12     -21.543   3.843  16.765  1.00  0.72           N  
ATOM     95  CA  ALA A  12     -22.834   4.383  17.147  1.00  0.72           C  
ATOM     96  C   ALA A  12     -22.803   5.296  18.375  1.00  0.72           C  
ATOM     97  O   ALA A  12     -23.848   5.750  18.843  1.00  0.72           O  
ATOM     98  CB  ALA A  12     -23.798   3.209  17.418  1.00  0.72           C  
ATOM     99  N   GLU A  13     -21.613   5.629  18.937  1.00  0.62           N  
ATOM    100  CA  GLU A  13     -21.481   6.674  19.950  1.00  0.62           C  
ATOM    101  C   GLU A  13     -21.718   8.066  19.344  1.00  0.62           C  
ATOM    102  O   GLU A  13     -20.779   8.803  19.037  1.00  0.62           O  
ATOM    103  CB  GLU A  13     -20.098   6.679  20.671  1.00  0.62           C  
ATOM    104  CG  GLU A  13     -19.709   5.383  21.426  1.00  0.62           C  
ATOM    105  CD  GLU A  13     -18.326   5.498  22.064  1.00  0.62           C  
ATOM    106  OE1 GLU A  13     -18.085   4.847  23.111  1.00  0.62           O  
ATOM    107  OE2 GLU A  13     -17.479   6.262  21.537  1.00  0.62           O  
ATOM    108  N   ASP A  14     -22.996   8.432  19.130  1.00  0.52           N  
ATOM    109  CA  ASP A  14     -23.380   9.692  18.524  1.00  0.52           C  
ATOM    110  C   ASP A  14     -23.779  10.743  19.563  1.00  0.52           C  
ATOM    111  O   ASP A  14     -23.905  11.933  19.275  1.00  0.52           O  
ATOM    112  CB  ASP A  14     -24.578   9.418  17.575  1.00  0.52           C  
ATOM    113  CG  ASP A  14     -24.131   8.700  16.309  1.00  0.52           C  
ATOM    114  OD1 ASP A  14     -22.924   8.771  15.968  1.00  0.52           O  
ATOM    115  OD2 ASP A  14     -25.023   8.098  15.658  1.00  0.52           O  
ATOM    116  N   SER A  15     -23.948  10.357  20.840  1.00  0.54           N  
ATOM    117  CA  SER A  15     -24.372  11.256  21.900  1.00  0.54           C  
ATOM    118  C   SER A  15     -23.168  11.810  22.646  1.00  0.54           C  
ATOM    119  O   SER A  15     -22.847  11.391  23.754  1.00  0.54           O  
ATOM    120  CB  SER A  15     -25.392  10.589  22.884  1.00  0.54           C  
ATOM    121  OG  SER A  15     -25.363   9.160  22.794  1.00  0.54           O  
ATOM    122  N   GLY A  16     -22.483  12.819  22.057  1.00  0.59           N  
ATOM    123  CA  GLY A  16     -21.377  13.528  22.701  1.00  0.59           C  
ATOM    124  C   GLY A  16     -20.041  13.198  22.084  1.00  0.59           C  
ATOM    125  O   GLY A  16     -19.988  12.579  21.023  1.00  0.59           O  
ATOM    126  N   PRO A  17     -18.922  13.634  22.667  1.00  0.59           N  
ATOM    127  CA  PRO A  17     -17.602  13.146  22.290  1.00  0.59           C  
ATOM    128  C   PRO A  17     -17.479  11.637  22.484  1.00  0.59           C  
ATOM    129  O   PRO A  17     -17.921  11.172  23.537  1.00  0.59           O  
ATOM    130  CB  PRO A  17     -16.623  13.955  23.157  1.00  0.59           C  
ATOM    131  CG  PRO A  17     -17.433  14.386  24.387  1.00  0.59           C  
ATOM    132  CD  PRO A  17     -18.890  14.412  23.907  1.00  0.59           C  
ATOM    133  N   PRO A  18     -16.958  10.850  21.535  1.00  0.72           N  
ATOM    134  CA  PRO A  18     -16.806   9.415  21.707  1.00  0.72           C  
ATOM    135  C   PRO A  18     -15.926   9.073  22.885  1.00  0.72           C  
ATOM    136  O   PRO A  18     -15.086   9.874  23.304  1.00  0.72           O  
ATOM    137  CB  PRO A  18     -16.195   8.937  20.377  1.00  0.72           C  
ATOM    138  CG  PRO A  18     -15.408  10.142  19.862  1.00  0.72           C  
ATOM    139  CD  PRO A  18     -16.238  11.332  20.354  1.00  0.72           C  
ATOM    140  N   THR A  19     -16.083   7.862  23.428  1.00  0.78           N  
ATOM    141  CA  THR A  19     -15.189   7.341  24.440  1.00  0.78           C  
ATOM    142  C   THR A  19     -13.806   7.126  23.854  1.00  0.78           C  
ATOM    143  O   THR A  19     -13.638   7.000  22.643  1.00  0.78           O  
ATOM    144  CB  THR A  19     -15.671   6.038  25.073  1.00  0.78           C  
ATOM    145  OG1 THR A  19     -15.684   4.926  24.177  1.00  0.78           O  
ATOM    146  CG2 THR A  19     -17.063   6.251  25.707  1.00  0.78           C  
ATOM    147  N   THR A  20     -12.742   7.077  24.685  1.00  0.81           N  
ATOM    148  CA  THR A  20     -11.380   6.852  24.189  1.00  0.81           C  
ATOM    149  C   THR A  20     -11.262   5.564  23.399  1.00  0.81           C  
ATOM    150  O   THR A  20     -10.729   5.539  22.299  1.00  0.81           O  
ATOM    151  CB  THR A  20     -10.338   6.820  25.303  1.00  0.81           C  
ATOM    152  OG1 THR A  20     -10.496   7.953  26.142  1.00  0.81           O  
ATOM    153  CG2 THR A  20      -8.917   6.892  24.730  1.00  0.81           C  
ATOM    154  N   LEU A  21     -11.862   4.466  23.898  1.00  0.84           N  
ATOM    155  CA  LEU A  21     -11.952   3.227  23.151  1.00  0.84           C  
ATOM    156  C   LEU A  21     -12.757   3.338  21.860  1.00  0.84           C  
ATOM    157  O   LEU A  21     -12.328   2.860  20.811  1.00  0.84           O  
ATOM    158  CB  LEU A  21     -12.593   2.138  24.041  1.00  0.84           C  
ATOM    159  CG  LEU A  21     -12.702   0.747  23.386  1.00  0.84           C  
ATOM    160  CD1 LEU A  21     -11.334   0.187  22.966  1.00  0.84           C  
ATOM    161  CD2 LEU A  21     -13.397  -0.225  24.341  1.00  0.84           C  
ATOM    162  N   GLY A  22     -13.938   3.995  21.898  1.00  0.85           N  
ATOM    163  CA  GLY A  22     -14.755   4.328  20.736  1.00  0.85           C  
ATOM    164  C   GLY A  22     -14.032   5.037  19.635  1.00  0.85           C  
ATOM    165  O   GLY A  22     -14.082   4.632  18.478  1.00  0.85           O  
ATOM    166  N   ARG A  23     -13.296   6.106  19.975  1.00  0.72           N  
ATOM    167  CA  ARG A  23     -12.488   6.860  19.041  1.00  0.72           C  
ATOM    168  C   ARG A  23     -11.413   6.023  18.372  1.00  0.72           C  
ATOM    169  O   ARG A  23     -11.262   6.022  17.150  1.00  0.72           O  
ATOM    170  CB  ARG A  23     -11.782   7.998  19.816  1.00  0.72           C  
ATOM    171  CG  ARG A  23     -10.883   8.898  18.943  1.00  0.72           C  
ATOM    172  CD  ARG A  23     -10.088   9.922  19.750  1.00  0.72           C  
ATOM    173  NE  ARG A  23      -9.084   9.165  20.553  1.00  0.72           N  
ATOM    174  CZ  ARG A  23      -8.255   9.713  21.442  1.00  0.72           C  
ATOM    175  NH1 ARG A  23      -8.198  11.032  21.620  1.00  0.72           N  
ATOM    176  NH2 ARG A  23      -7.475   8.904  22.149  1.00  0.72           N  
ATOM    177  N   ASP A  24     -10.666   5.264  19.184  1.00  0.85           N  
ATOM    178  CA  ASP A  24      -9.532   4.485  18.767  1.00  0.85           C  
ATOM    179  C   ASP A  24      -9.970   3.259  17.926  1.00  0.85           C  
ATOM    180  O   ASP A  24      -9.319   2.876  16.956  1.00  0.85           O  
ATOM    181  CB  ASP A  24      -8.670   4.186  20.032  1.00  0.85           C  
ATOM    182  CG  ASP A  24      -8.185   5.441  20.786  1.00  0.85           C  
ATOM    183  OD1 ASP A  24      -8.437   6.606  20.368  1.00  0.85           O  
ATOM    184  OD2 ASP A  24      -7.520   5.264  21.837  1.00  0.85           O  
ATOM    185  N   LEU A  25     -11.145   2.645  18.220  1.00  0.85           N  
ATOM    186  CA  LEU A  25     -11.750   1.599  17.394  1.00  0.85           C  
ATOM    187  C   LEU A  25     -12.364   2.089  16.087  1.00  0.85           C  
ATOM    188  O   LEU A  25     -12.472   1.324  15.134  1.00  0.85           O  
ATOM    189  CB  LEU A  25     -12.867   0.836  18.151  1.00  0.85           C  
ATOM    190  CG  LEU A  25     -12.367  -0.128  19.243  1.00  0.85           C  
ATOM    191  CD1 LEU A  25     -13.570  -0.641  20.043  1.00  0.85           C  
ATOM    192  CD2 LEU A  25     -11.576  -1.313  18.662  1.00  0.85           C  
ATOM    193  N   ARG A  26     -12.731   3.382  15.959  1.00  0.72           N  
ATOM    194  CA  ARG A  26     -13.232   3.951  14.707  1.00  0.72           C  
ATOM    195  C   ARG A  26     -12.141   4.083  13.658  1.00  0.72           C  
ATOM    196  O   ARG A  26     -12.403   4.313  12.479  1.00  0.72           O  
ATOM    197  CB  ARG A  26     -13.855   5.351  14.913  1.00  0.72           C  
ATOM    198  CG  ARG A  26     -15.256   5.324  15.552  1.00  0.72           C  
ATOM    199  CD  ARG A  26     -15.723   6.728  15.944  1.00  0.72           C  
ATOM    200  NE  ARG A  26     -17.023   6.601  16.660  1.00  0.72           N  
ATOM    201  CZ  ARG A  26     -17.814   7.625  17.000  1.00  0.72           C  
ATOM    202  NH1 ARG A  26     -17.435   8.890  16.890  1.00  0.72           N  
ATOM    203  NH2 ARG A  26     -19.019   7.357  17.476  1.00  0.72           N  
ATOM    204  N   LEU A  27     -10.869   3.903  14.059  1.00  0.84           N  
ATOM    205  CA  LEU A  27      -9.770   3.786  13.131  1.00  0.84           C  
ATOM    206  C   LEU A  27      -9.794   2.473  12.370  1.00  0.84           C  
ATOM    207  O   LEU A  27      -9.185   2.362  11.310  1.00  0.84           O  
ATOM    208  CB  LEU A  27      -8.422   3.897  13.875  1.00  0.84           C  
ATOM    209  CG  LEU A  27      -8.215   5.258  14.562  1.00  0.84           C  
ATOM    210  CD1 LEU A  27      -6.976   5.216  15.464  1.00  0.84           C  
ATOM    211  CD2 LEU A  27      -8.084   6.370  13.516  1.00  0.84           C  
ATOM    212  N   VAL A  28     -10.520   1.447  12.858  1.00  0.83           N  
ATOM    213  CA  VAL A  28     -10.764   0.224  12.112  1.00  0.83           C  
ATOM    214  C   VAL A  28     -11.746   0.468  10.971  1.00  0.83           C  
ATOM    215  O   VAL A  28     -12.900   0.844  11.168  1.00  0.83           O  
ATOM    216  CB  VAL A  28     -11.269  -0.900  13.009  1.00  0.83           C  
ATOM    217  CG1 VAL A  28     -11.539  -2.174  12.182  1.00  0.83           C  
ATOM    218  CG2 VAL A  28     -10.218  -1.179  14.104  1.00  0.83           C  
ATOM    219  N   ARG A  29     -11.292   0.259   9.721  1.00  0.62           N  
ATOM    220  CA  ARG A  29     -12.076   0.543   8.533  1.00  0.62           C  
ATOM    221  C   ARG A  29     -12.711  -0.711   7.986  1.00  0.62           C  
ATOM    222  O   ARG A  29     -13.807  -0.681   7.433  1.00  0.62           O  
ATOM    223  CB  ARG A  29     -11.145   1.099   7.425  1.00  0.62           C  
ATOM    224  CG  ARG A  29     -10.599   2.509   7.729  1.00  0.62           C  
ATOM    225  CD  ARG A  29     -11.634   3.636   7.621  1.00  0.62           C  
ATOM    226  NE  ARG A  29     -12.055   3.678   6.184  1.00  0.62           N  
ATOM    227  CZ  ARG A  29     -12.954   4.532   5.681  1.00  0.62           C  
ATOM    228  NH1 ARG A  29     -13.545   5.451   6.436  1.00  0.62           N  
ATOM    229  NH2 ARG A  29     -13.263   4.457   4.388  1.00  0.62           N  
ATOM    230  N   ALA A  30     -12.022  -1.847   8.155  1.00  0.75           N  
ATOM    231  CA  ALA A  30     -12.498  -3.128   7.721  1.00  0.75           C  
ATOM    232  C   ALA A  30     -11.774  -4.177   8.531  1.00  0.75           C  
ATOM    233  O   ALA A  30     -10.689  -3.950   9.065  1.00  0.75           O  
ATOM    234  CB  ALA A  30     -12.250  -3.348   6.213  1.00  0.75           C  
ATOM    235  N   ALA A  31     -12.373  -5.365   8.658  1.00  0.81           N  
ATOM    236  CA  ALA A  31     -11.757  -6.469   9.338  1.00  0.81           C  
ATOM    237  C   ALA A  31     -12.261  -7.722   8.678  1.00  0.81           C  
ATOM    238  O   ALA A  31     -13.385  -7.767   8.181  1.00  0.81           O  
ATOM    239  CB  ALA A  31     -12.105  -6.481  10.840  1.00  0.81           C  
ATOM    240  N   ALA A  32     -11.416  -8.764   8.627  1.00  0.83           N  
ATOM    241  CA  ALA A  32     -11.771 -10.040   8.059  1.00  0.83           C  
ATOM    242  C   ALA A  32     -12.967 -10.717   8.757  1.00  0.83           C  
ATOM    243  O   ALA A  32     -13.096 -10.570   9.979  1.00  0.83           O  
ATOM    244  CB  ALA A  32     -10.524 -10.937   8.081  1.00  0.83           C  
ATOM    245  N   PRO A  33     -13.868 -11.437   8.070  1.00  0.79           N  
ATOM    246  CA  PRO A  33     -15.060 -12.044   8.664  1.00  0.79           C  
ATOM    247  C   PRO A  33     -14.792 -12.926   9.864  1.00  0.79           C  
ATOM    248  O   PRO A  33     -15.595 -12.947  10.797  1.00  0.79           O  
ATOM    249  CB  PRO A  33     -15.698 -12.836   7.511  1.00  0.79           C  
ATOM    250  CG  PRO A  33     -15.263 -12.076   6.257  1.00  0.79           C  
ATOM    251  CD  PRO A  33     -13.850 -11.611   6.613  1.00  0.79           C  
ATOM    252  N   GLU A  34     -13.664 -13.651   9.864  1.00  0.75           N  
ATOM    253  CA  GLU A  34     -13.219 -14.520  10.922  1.00  0.75           C  
ATOM    254  C   GLU A  34     -12.965 -13.760  12.211  1.00  0.75           C  
ATOM    255  O   GLU A  34     -13.375 -14.182  13.288  1.00  0.75           O  
ATOM    256  CB  GLU A  34     -11.921 -15.259  10.495  1.00  0.75           C  
ATOM    257  CG  GLU A  34     -12.029 -16.044   9.156  1.00  0.75           C  
ATOM    258  CD  GLU A  34     -11.924 -15.193   7.886  1.00  0.75           C  
ATOM    259  OE1 GLU A  34     -12.058 -15.777   6.786  1.00  0.75           O  
ATOM    260  OE2 GLU A  34     -11.739 -13.954   8.005  1.00  0.75           O  
ATOM    261  N   LEU A  35     -12.320 -12.576  12.122  1.00  0.79           N  
ATOM    262  CA  LEU A  35     -12.106 -11.687  13.251  1.00  0.79           C  
ATOM    263  C   LEU A  35     -13.385 -11.089  13.783  1.00  0.79           C  
ATOM    264  O   LEU A  35     -13.586 -11.009  14.991  1.00  0.79           O  
ATOM    265  CB  LEU A  35     -11.149 -10.522  12.914  1.00  0.79           C  
ATOM    266  CG  LEU A  35      -9.726 -10.984  12.572  1.00  0.79           C  
ATOM    267  CD1 LEU A  35      -8.876  -9.805  12.091  1.00  0.79           C  
ATOM    268  CD2 LEU A  35      -9.032 -11.681  13.751  1.00  0.79           C  
ATOM    269  N   LEU A  36     -14.309 -10.682  12.888  1.00  0.76           N  
ATOM    270  CA  LEU A  36     -15.605 -10.127  13.243  1.00  0.76           C  
ATOM    271  C   LEU A  36     -16.442 -11.087  14.080  1.00  0.76           C  
ATOM    272  O   LEU A  36     -17.170 -10.678  14.983  1.00  0.76           O  
ATOM    273  CB  LEU A  36     -16.374  -9.698  11.967  1.00  0.76           C  
ATOM    274  CG  LEU A  36     -15.752  -8.494  11.222  1.00  0.76           C  
ATOM    275  CD1 LEU A  36     -16.504  -8.220   9.911  1.00  0.76           C  
ATOM    276  CD2 LEU A  36     -15.738  -7.219  12.079  1.00  0.76           C  
ATOM    277  N   ALA A  37     -16.301 -12.402  13.831  1.00  0.76           N  
ATOM    278  CA  ALA A  37     -17.045 -13.432  14.515  1.00  0.76           C  
ATOM    279  C   ALA A  37     -16.396 -13.915  15.815  1.00  0.76           C  
ATOM    280  O   ALA A  37     -16.972 -14.735  16.540  1.00  0.76           O  
ATOM    281  CB  ALA A  37     -17.168 -14.623  13.546  1.00  0.76           C  
ATOM    282  N   LEU A  38     -15.193 -13.413  16.167  1.00  0.75           N  
ATOM    283  CA  LEU A  38     -14.566 -13.693  17.446  1.00  0.75           C  
ATOM    284  C   LEU A  38     -15.285 -13.076  18.633  1.00  0.75           C  
ATOM    285  O   LEU A  38     -15.787 -11.953  18.581  1.00  0.75           O  
ATOM    286  CB  LEU A  38     -13.084 -13.242  17.496  1.00  0.75           C  
ATOM    287  CG  LEU A  38     -12.149 -14.007  16.539  1.00  0.75           C  
ATOM    288  CD1 LEU A  38     -10.730 -13.421  16.586  1.00  0.75           C  
ATOM    289  CD2 LEU A  38     -12.102 -15.510  16.848  1.00  0.75           C  
ATOM    290  N   ASP A  39     -15.328 -13.814  19.755  1.00  0.76           N  
ATOM    291  CA  ASP A  39     -15.818 -13.319  21.020  1.00  0.76           C  
ATOM    292  C   ASP A  39     -14.798 -12.411  21.702  1.00  0.76           C  
ATOM    293  O   ASP A  39     -13.611 -12.717  21.794  1.00  0.76           O  
ATOM    294  CB  ASP A  39     -16.223 -14.492  21.941  1.00  0.76           C  
ATOM    295  CG  ASP A  39     -17.373 -15.178  21.268  1.00  0.76           C  
ATOM    296  OD1 ASP A  39     -18.511 -14.648  21.280  1.00  0.76           O  
ATOM    297  OD2 ASP A  39     -17.156 -16.200  20.577  1.00  0.76           O  
ATOM    298  N   VAL A  40     -15.252 -11.245  22.193  1.00  0.83           N  
ATOM    299  CA  VAL A  40     -14.407 -10.308  22.919  1.00  0.83           C  
ATOM    300  C   VAL A  40     -14.491 -10.592  24.412  1.00  0.83           C  
ATOM    301  O   VAL A  40     -15.473 -11.206  24.839  1.00  0.83           O  
ATOM    302  CB  VAL A  40     -14.770  -8.851  22.635  1.00  0.83           C  
ATOM    303  CG1 VAL A  40     -14.623  -8.599  21.123  1.00  0.83           C  
ATOM    304  CG2 VAL A  40     -16.194  -8.518  23.119  1.00  0.83           C  
ATOM    305  N   PRO A  41     -13.559 -10.187  25.281  1.00  0.83           N  
ATOM    306  CA  PRO A  41     -13.557 -10.662  26.665  1.00  0.83           C  
ATOM    307  C   PRO A  41     -14.402  -9.745  27.540  1.00  0.83           C  
ATOM    308  O   PRO A  41     -13.935  -9.266  28.571  1.00  0.83           O  
ATOM    309  CB  PRO A  41     -12.066 -10.579  27.051  1.00  0.83           C  
ATOM    310  CG  PRO A  41     -11.542  -9.397  26.235  1.00  0.83           C  
ATOM    311  CD  PRO A  41     -12.279  -9.568  24.909  1.00  0.83           C  
ATOM    312  N   ALA A  42     -15.662  -9.512  27.145  1.00  0.81           N  
ATOM    313  CA  ALA A  42     -16.623  -8.765  27.915  1.00  0.81           C  
ATOM    314  C   ALA A  42     -18.019  -9.063  27.407  1.00  0.81           C  
ATOM    315  O   ALA A  42     -18.220  -9.405  26.233  1.00  0.81           O  
ATOM    316  CB  ALA A  42     -16.373  -7.253  27.784  1.00  0.81           C  
ATOM    317  N   ASP A  43     -19.027  -8.896  28.279  1.00  0.70           N  
ATOM    318  CA  ASP A  43     -20.401  -9.151  27.914  1.00  0.70           C  
ATOM    319  C   ASP A  43     -21.072  -7.859  27.496  1.00  0.70           C  
ATOM    320  O   ASP A  43     -22.049  -7.866  26.744  1.00  0.70           O  
ATOM    321  CB  ASP A  43     -21.147  -9.815  29.093  1.00  0.70           C  
ATOM    322  CG  ASP A  43     -20.699 -11.262  29.202  1.00  0.70           C  
ATOM    323  OD1 ASP A  43     -20.559 -11.907  28.125  1.00  0.70           O  
ATOM    324  OD2 ASP A  43     -20.525 -11.750  30.344  1.00  0.70           O  
ATOM    325  N   ALA A  44     -20.500  -6.701  27.878  1.00  0.78           N  
ATOM    326  CA  ALA A  44     -21.037  -5.422  27.484  1.00  0.78           C  
ATOM    327  C   ALA A  44     -19.960  -4.452  27.022  1.00  0.78           C  
ATOM    328  O   ALA A  44     -18.815  -4.446  27.465  1.00  0.78           O  
ATOM    329  CB  ALA A  44     -21.855  -4.826  28.636  1.00  0.78           C  
ATOM    330  N   TYR A  45     -20.311  -3.558  26.072  1.00  0.78           N  
ATOM    331  CA  TYR A  45     -19.397  -2.570  25.525  1.00  0.78           C  
ATOM    332  C   TYR A  45     -18.907  -1.580  26.580  1.00  0.78           C  
ATOM    333  O   TYR A  45     -17.732  -1.225  26.622  1.00  0.78           O  
ATOM    334  CB  TYR A  45     -20.076  -1.855  24.331  1.00  0.78           C  
ATOM    335  CG  TYR A  45     -19.200  -0.822  23.678  1.00  0.78           C  
ATOM    336  CD1 TYR A  45     -19.520   0.541  23.784  1.00  0.78           C  
ATOM    337  CD2 TYR A  45     -18.047  -1.202  22.973  1.00  0.78           C  
ATOM    338  CE1 TYR A  45     -18.692   1.510  23.203  1.00  0.78           C  
ATOM    339  CE2 TYR A  45     -17.215  -0.233  22.395  1.00  0.78           C  
ATOM    340  CZ  TYR A  45     -17.537   1.120  22.517  1.00  0.78           C  
ATOM    341  OH  TYR A  45     -16.678   2.076  21.956  1.00  0.78           O  
ATOM    342  N   GLY A  46     -19.795  -1.154  27.506  1.00  0.81           N  
ATOM    343  CA  GLY A  46     -19.431  -0.277  28.617  1.00  0.81           C  
ATOM    344  C   GLY A  46     -18.385  -0.837  29.552  1.00  0.81           C  
ATOM    345  O   GLY A  46     -17.588  -0.093  30.113  1.00  0.81           O  
ATOM    346  N   GLU A  47     -18.325  -2.175  29.713  1.00  0.75           N  
ATOM    347  CA  GLU A  47     -17.263  -2.844  30.440  1.00  0.75           C  
ATOM    348  C   GLU A  47     -15.922  -2.714  29.744  1.00  0.75           C  
ATOM    349  O   GLU A  47     -14.920  -2.381  30.371  1.00  0.75           O  
ATOM    350  CB  GLU A  47     -17.570  -4.346  30.600  1.00  0.75           C  
ATOM    351  CG  GLU A  47     -18.850  -4.635  31.410  1.00  0.75           C  
ATOM    352  CD  GLU A  47     -19.302  -6.088  31.296  1.00  0.75           C  
ATOM    353  OE1 GLU A  47     -20.224  -6.434  32.072  1.00  0.75           O  
ATOM    354  OE2 GLU A  47     -18.800  -6.833  30.412  1.00  0.75           O  
ATOM    355  N   LEU A  48     -15.884  -2.905  28.403  1.00  0.81           N  
ATOM    356  CA  LEU A  48     -14.690  -2.684  27.603  1.00  0.81           C  
ATOM    357  C   LEU A  48     -14.217  -1.245  27.666  1.00  0.81           C  
ATOM    358  O   LEU A  48     -13.030  -0.982  27.826  1.00  0.81           O  
ATOM    359  CB  LEU A  48     -14.899  -3.035  26.106  1.00  0.81           C  
ATOM    360  CG  LEU A  48     -15.093  -4.529  25.809  1.00  0.81           C  
ATOM    361  CD1 LEU A  48     -15.554  -4.725  24.358  1.00  0.81           C  
ATOM    362  CD2 LEU A  48     -13.809  -5.338  26.057  1.00  0.81           C  
ATOM    363  N   VAL A  49     -15.139  -0.267  27.583  1.00  0.83           N  
ATOM    364  CA  VAL A  49     -14.826   1.146  27.752  1.00  0.83           C  
ATOM    365  C   VAL A  49     -14.255   1.446  29.132  1.00  0.83           C  
ATOM    366  O   VAL A  49     -13.228   2.111  29.266  1.00  0.83           O  
ATOM    367  CB  VAL A  49     -16.075   1.994  27.529  1.00  0.83           C  
ATOM    368  CG1 VAL A  49     -15.833   3.476  27.880  1.00  0.83           C  
ATOM    369  CG2 VAL A  49     -16.509   1.886  26.055  1.00  0.83           C  
ATOM    370  N   GLY A  50     -14.884   0.912  30.201  1.00  0.84           N  
ATOM    371  CA  GLY A  50     -14.452   1.124  31.577  1.00  0.84           C  
ATOM    372  C   GLY A  50     -13.125   0.507  31.929  1.00  0.84           C  
ATOM    373  O   GLY A  50     -12.401   1.012  32.790  1.00  0.84           O  
ATOM    374  N   SER A  51     -12.742  -0.597  31.262  1.00  0.83           N  
ATOM    375  CA  SER A  51     -11.482  -1.276  31.520  1.00  0.83           C  
ATOM    376  C   SER A  51     -10.378  -0.861  30.573  1.00  0.83           C  
ATOM    377  O   SER A  51      -9.215  -1.180  30.808  1.00  0.83           O  
ATOM    378  CB  SER A  51     -11.631  -2.821  31.440  1.00  0.83           C  
ATOM    379  OG  SER A  51     -12.000  -3.268  30.132  1.00  0.83           O  
ATOM    380  N   TYR A  52     -10.693  -0.094  29.507  1.00  0.32           N  
ATOM    381  CA  TYR A  52      -9.709   0.388  28.558  1.00  0.32           C  
ATOM    382  C   TYR A  52      -8.706   1.346  29.186  1.00  0.32           C  
ATOM    383  O   TYR A  52      -9.055   2.317  29.859  1.00  0.32           O  
ATOM    384  CB  TYR A  52     -10.388   1.036  27.315  1.00  0.32           C  
ATOM    385  CG  TYR A  52      -9.411   1.336  26.202  1.00  0.32           C  
ATOM    386  CD1 TYR A  52      -9.301   2.630  25.661  1.00  0.32           C  
ATOM    387  CD2 TYR A  52      -8.597   0.315  25.685  1.00  0.32           C  
ATOM    388  CE1 TYR A  52      -8.382   2.896  24.635  1.00  0.32           C  
ATOM    389  CE2 TYR A  52      -7.688   0.577  24.652  1.00  0.32           C  
ATOM    390  CZ  TYR A  52      -7.571   1.871  24.141  1.00  0.32           C  
ATOM    391  OH  TYR A  52      -6.627   2.161  23.142  1.00  0.32           O  
ATOM    392  N   ARG A  53      -7.410   1.070  28.988  1.00  0.29           N  
ATOM    393  CA  ARG A  53      -6.345   1.902  29.495  1.00  0.29           C  
ATOM    394  C   ARG A  53      -5.370   2.189  28.363  1.00  0.29           C  
ATOM    395  O   ARG A  53      -4.579   1.309  28.018  1.00  0.29           O  
ATOM    396  CB  ARG A  53      -5.615   1.211  30.672  1.00  0.29           C  
ATOM    397  CG  ARG A  53      -6.495   1.025  31.928  1.00  0.29           C  
ATOM    398  CD  ARG A  53      -6.966   2.344  32.560  1.00  0.29           C  
ATOM    399  NE  ARG A  53      -7.872   2.000  33.711  1.00  0.29           N  
ATOM    400  CZ  ARG A  53      -9.200   1.859  33.607  1.00  0.29           C  
ATOM    401  NH1 ARG A  53      -9.860   2.018  32.468  1.00  0.29           N  
ATOM    402  NH2 ARG A  53      -9.915   1.548  34.688  1.00  0.29           N  
ATOM    403  N   PRO A  54      -5.366   3.375  27.749  1.00  0.41           N  
ATOM    404  CA  PRO A  54      -4.544   3.647  26.571  1.00  0.41           C  
ATOM    405  C   PRO A  54      -3.097   3.874  26.949  1.00  0.41           C  
ATOM    406  O   PRO A  54      -2.224   3.822  26.085  1.00  0.41           O  
ATOM    407  CB  PRO A  54      -5.172   4.922  25.974  1.00  0.41           C  
ATOM    408  CG  PRO A  54      -5.872   5.598  27.156  1.00  0.41           C  
ATOM    409  CD  PRO A  54      -6.381   4.409  27.958  1.00  0.41           C  
ATOM    410  N   ASP A  55      -2.834   4.141  28.235  1.00  0.39           N  
ATOM    411  CA  ASP A  55      -1.539   4.304  28.840  1.00  0.39           C  
ATOM    412  C   ASP A  55      -0.790   2.979  28.986  1.00  0.39           C  
ATOM    413  O   ASP A  55       0.436   2.925  28.956  1.00  0.39           O  
ATOM    414  CB  ASP A  55      -1.757   4.996  30.217  1.00  0.39           C  
ATOM    415  CG  ASP A  55      -2.729   4.220  31.104  1.00  0.39           C  
ATOM    416  OD1 ASP A  55      -3.925   4.108  30.715  1.00  0.39           O  
ATOM    417  OD2 ASP A  55      -2.296   3.686  32.155  1.00  0.39           O  
ATOM    418  N   ARG A  56      -1.532   1.857  29.089  1.00  0.35           N  
ATOM    419  CA  ARG A  56      -0.983   0.521  29.218  1.00  0.35           C  
ATOM    420  C   ARG A  56      -0.870  -0.193  27.882  1.00  0.35           C  
ATOM    421  O   ARG A  56      -1.080  -1.400  27.777  1.00  0.35           O  
ATOM    422  CB  ARG A  56      -1.836  -0.341  30.172  1.00  0.35           C  
ATOM    423  CG  ARG A  56      -1.828   0.164  31.624  1.00  0.35           C  
ATOM    424  CD  ARG A  56      -2.436  -0.874  32.562  1.00  0.35           C  
ATOM    425  NE  ARG A  56      -2.346  -0.334  33.951  1.00  0.35           N  
ATOM    426  CZ  ARG A  56      -2.666  -1.042  35.041  1.00  0.35           C  
ATOM    427  NH1 ARG A  56      -3.135  -2.284  34.947  1.00  0.35           N  
ATOM    428  NH2 ARG A  56      -2.518  -0.499  36.246  1.00  0.35           N  
ATOM    429  N   ALA A  57      -0.533   0.548  26.817  1.00  0.51           N  
ATOM    430  CA  ALA A  57      -0.275   0.006  25.504  1.00  0.51           C  
ATOM    431  C   ALA A  57       0.866  -1.007  25.435  1.00  0.51           C  
ATOM    432  O   ALA A  57       1.910  -0.847  26.066  1.00  0.51           O  
ATOM    433  CB  ALA A  57       0.035   1.178  24.555  1.00  0.51           C  
ATOM    434  N   GLY A  58       0.700  -2.085  24.632  1.00  0.52           N  
ATOM    435  CA  GLY A  58       1.811  -2.952  24.255  1.00  0.52           C  
ATOM    436  C   GLY A  58       2.890  -2.229  23.482  1.00  0.52           C  
ATOM    437  O   GLY A  58       2.630  -1.265  22.765  1.00  0.52           O  
ATOM    438  N   ALA A  59       4.150  -2.685  23.603  1.00  0.65           N  
ATOM    439  CA  ALA A  59       5.265  -2.072  22.909  1.00  0.65           C  
ATOM    440  C   ALA A  59       5.174  -2.155  21.388  1.00  0.65           C  
ATOM    441  O   ALA A  59       4.931  -3.214  20.815  1.00  0.65           O  
ATOM    442  CB  ALA A  59       6.597  -2.695  23.378  1.00  0.65           C  
ATOM    443  N   VAL A  60       5.406  -1.037  20.689  1.00  0.65           N  
ATOM    444  CA  VAL A  60       5.377  -0.995  19.240  1.00  0.65           C  
ATOM    445  C   VAL A  60       6.785  -0.768  18.734  1.00  0.65           C  
ATOM    446  O   VAL A  60       7.419   0.260  18.971  1.00  0.65           O  
ATOM    447  CB  VAL A  60       4.441   0.076  18.688  1.00  0.65           C  
ATOM    448  CG1 VAL A  60       4.405   0.015  17.145  1.00  0.65           C  
ATOM    449  CG2 VAL A  60       3.020  -0.135  19.249  1.00  0.65           C  
ATOM    450  N   THR A  61       7.319  -1.751  17.993  1.00  0.67           N  
ATOM    451  CA  THR A  61       8.628  -1.648  17.370  1.00  0.67           C  
ATOM    452  C   THR A  61       8.421  -1.392  15.905  1.00  0.67           C  
ATOM    453  O   THR A  61       7.836  -2.204  15.190  1.00  0.67           O  
ATOM    454  CB  THR A  61       9.471  -2.910  17.493  1.00  0.67           C  
ATOM    455  OG1 THR A  61       9.798  -3.150  18.855  1.00  0.67           O  
ATOM    456  CG2 THR A  61      10.813  -2.793  16.748  1.00  0.67           C  
ATOM    457  N   ALA A  62       8.930  -0.260  15.393  1.00  0.69           N  
ATOM    458  CA  ALA A  62       9.022  -0.061  13.967  1.00  0.69           C  
ATOM    459  C   ALA A  62      10.227  -0.787  13.404  1.00  0.69           C  
ATOM    460  O   ALA A  62      11.344  -0.668  13.905  1.00  0.69           O  
ATOM    461  CB  ALA A  62       9.113   1.422  13.594  1.00  0.69           C  
ATOM    462  N   VAL A  63      10.008  -1.572  12.343  1.00  0.71           N  
ATOM    463  CA  VAL A  63      11.047  -2.312  11.666  1.00  0.71           C  
ATOM    464  C   VAL A  63      11.227  -1.685  10.310  1.00  0.71           C  
ATOM    465  O   VAL A  63      10.324  -1.701   9.473  1.00  0.71           O  
ATOM    466  CB  VAL A  63      10.703  -3.782  11.498  1.00  0.71           C  
ATOM    467  CG1 VAL A  63      11.855  -4.512  10.777  1.00  0.71           C  
ATOM    468  CG2 VAL A  63      10.446  -4.392  12.891  1.00  0.71           C  
ATOM    469  N   VAL A  64      12.412  -1.104  10.068  1.00  0.72           N  
ATOM    470  CA  VAL A  64      12.702  -0.419   8.827  1.00  0.72           C  
ATOM    471  C   VAL A  64      13.800  -1.173   8.119  1.00  0.72           C  
ATOM    472  O   VAL A  64      14.937  -1.254   8.584  1.00  0.72           O  
ATOM    473  CB  VAL A  64      13.107   1.039   9.029  1.00  0.72           C  
ATOM    474  CG1 VAL A  64      13.269   1.733   7.661  1.00  0.72           C  
ATOM    475  CG2 VAL A  64      12.011   1.755   9.846  1.00  0.72           C  
ATOM    476  N   LEU A  65      13.492  -1.764   6.952  1.00  0.67           N  
ATOM    477  CA  LEU A  65      14.508  -2.358   6.100  1.00  0.67           C  
ATOM    478  C   LEU A  65      15.178  -1.253   5.308  1.00  0.67           C  
ATOM    479  O   LEU A  65      14.518  -0.331   4.837  1.00  0.67           O  
ATOM    480  CB  LEU A  65      13.927  -3.404   5.115  1.00  0.67           C  
ATOM    481  CG  LEU A  65      13.846  -4.842   5.666  1.00  0.67           C  
ATOM    482  CD1 LEU A  65      12.976  -4.970   6.925  1.00  0.67           C  
ATOM    483  CD2 LEU A  65      13.322  -5.778   4.568  1.00  0.67           C  
ATOM    484  N   THR A  66      16.514  -1.299   5.158  1.00  0.65           N  
ATOM    485  CA  THR A  66      17.219  -0.176   4.553  1.00  0.65           C  
ATOM    486  C   THR A  66      18.445  -0.635   3.782  1.00  0.65           C  
ATOM    487  O   THR A  66      19.051  -1.662   4.090  1.00  0.65           O  
ATOM    488  CB  THR A  66      17.553   0.912   5.579  1.00  0.65           C  
ATOM    489  OG1 THR A  66      17.898   2.132   4.950  1.00  0.65           O  
ATOM    490  CG2 THR A  66      18.705   0.523   6.509  1.00  0.65           C  
ATOM    491  N   HIS A  67      18.797   0.118   2.721  1.00  0.52           N  
ATOM    492  CA  HIS A  67      19.949  -0.123   1.866  1.00  0.52           C  
ATOM    493  C   HIS A  67      20.174   1.111   1.016  1.00  0.52           C  
ATOM    494  O   HIS A  67      19.477   1.306   0.025  1.00  0.52           O  
ATOM    495  CB  HIS A  67      19.759  -1.318   0.890  1.00  0.52           C  
ATOM    496  CG  HIS A  67      20.974  -1.560   0.043  1.00  0.52           C  
ATOM    497  ND1 HIS A  67      22.074  -2.117   0.647  1.00  0.52           N  
ATOM    498  CD2 HIS A  67      21.307  -1.055  -1.172  1.00  0.52           C  
ATOM    499  CE1 HIS A  67      23.069  -1.931  -0.200  1.00  0.52           C  
ATOM    500  NE2 HIS A  67      22.659  -1.287  -1.321  1.00  0.52           N  
ATOM    501  N   ASP A  68      21.147   1.961   1.397  1.00  0.54           N  
ATOM    502  CA  ASP A  68      21.484   3.192   0.690  1.00  0.54           C  
ATOM    503  C   ASP A  68      20.328   4.208   0.583  1.00  0.54           C  
ATOM    504  O   ASP A  68      19.926   4.643  -0.496  1.00  0.54           O  
ATOM    505  CB  ASP A  68      22.151   2.930  -0.688  1.00  0.54           C  
ATOM    506  CG  ASP A  68      23.384   2.052  -0.572  1.00  0.54           C  
ATOM    507  OD1 ASP A  68      24.108   2.141   0.455  1.00  0.54           O  
ATOM    508  OD2 ASP A  68      23.636   1.286  -1.541  1.00  0.54           O  
ATOM    509  N   GLU A  69      19.752   4.600   1.737  1.00  0.59           N  
ATOM    510  CA  GLU A  69      18.558   5.406   1.860  1.00  0.59           C  
ATOM    511  C   GLU A  69      18.818   6.720   2.592  1.00  0.59           C  
ATOM    512  O   GLU A  69      17.923   7.272   3.242  1.00  0.59           O  
ATOM    513  CB  GLU A  69      17.459   4.626   2.622  1.00  0.59           C  
ATOM    514  CG  GLU A  69      16.973   3.356   1.877  1.00  0.59           C  
ATOM    515  CD  GLU A  69      16.081   3.643   0.668  1.00  0.59           C  
ATOM    516  OE1 GLU A  69      15.629   2.637   0.062  1.00  0.59           O  
ATOM    517  OE2 GLU A  69      15.815   4.836   0.372  1.00  0.59           O  
ATOM    518  N   GLU A  70      20.049   7.287   2.525  1.00  0.56           N  
ATOM    519  CA  GLU A  70      20.474   8.456   3.292  1.00  0.56           C  
ATOM    520  C   GLU A  70      19.561   9.671   3.165  1.00  0.56           C  
ATOM    521  O   GLU A  70      19.328  10.410   4.119  1.00  0.56           O  
ATOM    522  CB  GLU A  70      21.940   8.833   2.943  1.00  0.56           C  
ATOM    523  CG  GLU A  70      22.179   9.318   1.491  1.00  0.56           C  
ATOM    524  CD  GLU A  70      23.638   9.671   1.197  1.00  0.56           C  
ATOM    525  OE1 GLU A  70      23.846  10.254   0.101  1.00  0.56           O  
ATOM    526  OE2 GLU A  70      24.534   9.409   2.053  1.00  0.56           O  
ATOM    527  N   GLN A  71      18.974   9.873   1.977  1.00  0.55           N  
ATOM    528  CA  GLN A  71      18.055  10.947   1.687  1.00  0.55           C  
ATOM    529  C   GLN A  71      16.697  10.863   2.371  1.00  0.55           C  
ATOM    530  O   GLN A  71      16.127  11.880   2.759  1.00  0.55           O  
ATOM    531  CB  GLN A  71      17.941  11.104   0.161  1.00  0.55           C  
ATOM    532  CG  GLN A  71      19.364  11.359  -0.416  1.00  0.55           C  
ATOM    533  CD  GLN A  71      19.361  12.030  -1.787  1.00  0.55           C  
ATOM    534  OE1 GLN A  71      18.435  12.746  -2.158  1.00  0.55           O  
ATOM    535  NE2 GLN A  71      20.440  11.813  -2.575  1.00  0.55           N  
ATOM    536  N   VAL A  72      16.129   9.653   2.544  1.00  0.64           N  
ATOM    537  CA  VAL A  72      14.749   9.524   2.999  1.00  0.64           C  
ATOM    538  C   VAL A  72      14.634   8.992   4.416  1.00  0.64           C  
ATOM    539  O   VAL A  72      13.649   9.262   5.109  1.00  0.64           O  
ATOM    540  CB  VAL A  72      13.923   8.659   2.055  1.00  0.64           C  
ATOM    541  CG1 VAL A  72      13.818   9.366   0.688  1.00  0.64           C  
ATOM    542  CG2 VAL A  72      14.545   7.262   1.894  1.00  0.64           C  
ATOM    543  N   ILE A  73      15.673   8.295   4.934  1.00  0.65           N  
ATOM    544  CA  ILE A  73      15.623   7.587   6.209  1.00  0.65           C  
ATOM    545  C   ILE A  73      15.334   8.484   7.403  1.00  0.65           C  
ATOM    546  O   ILE A  73      14.589   8.130   8.315  1.00  0.65           O  
ATOM    547  CB  ILE A  73      16.883   6.742   6.437  1.00  0.65           C  
ATOM    548  CG1 ILE A  73      16.753   5.748   7.617  1.00  0.65           C  
ATOM    549  CG2 ILE A  73      18.132   7.631   6.633  1.00  0.65           C  
ATOM    550  CD1 ILE A  73      15.677   4.678   7.406  1.00  0.65           C  
ATOM    551  N   GLY A  74      15.880   9.719   7.421  1.00  0.65           N  
ATOM    552  CA  GLY A  74      15.641  10.636   8.526  1.00  0.65           C  
ATOM    553  C   GLY A  74      14.222  11.124   8.638  1.00  0.65           C  
ATOM    554  O   GLY A  74      13.723  11.341   9.736  1.00  0.65           O  
ATOM    555  N   ALA A  75      13.515  11.305   7.506  1.00  0.67           N  
ATOM    556  CA  ALA A  75      12.113  11.668   7.521  1.00  0.67           C  
ATOM    557  C   ALA A  75      11.215  10.536   7.988  1.00  0.67           C  
ATOM    558  O   ALA A  75      10.313  10.752   8.796  1.00  0.67           O  
ATOM    559  CB  ALA A  75      11.692  12.180   6.134  1.00  0.67           C  
ATOM    560  N   CYS A  76      11.496   9.298   7.531  1.00  0.67           N  
ATOM    561  CA  CYS A  76      10.796   8.096   7.953  1.00  0.67           C  
ATOM    562  C   CYS A  76      10.865   7.873   9.460  1.00  0.67           C  
ATOM    563  O   CYS A  76       9.845   7.732  10.130  1.00  0.67           O  
ATOM    564  CB  CYS A  76      11.413   6.881   7.195  1.00  0.67           C  
ATOM    565  SG  CYS A  76      10.817   5.224   7.722  1.00  0.67           S  
ATOM    566  N   LEU A  77      12.076   7.913  10.052  1.00  0.67           N  
ATOM    567  CA  LEU A  77      12.263   7.696  11.474  1.00  0.67           C  
ATOM    568  C   LEU A  77      11.623   8.757  12.349  1.00  0.67           C  
ATOM    569  O   LEU A  77      10.983   8.438  13.347  1.00  0.67           O  
ATOM    570  CB  LEU A  77      13.764   7.574  11.812  1.00  0.67           C  
ATOM    571  CG  LEU A  77      14.472   6.382  11.137  1.00  0.67           C  
ATOM    572  CD1 LEU A  77      15.959   6.402  11.507  1.00  0.67           C  
ATOM    573  CD2 LEU A  77      13.847   5.028  11.501  1.00  0.67           C  
ATOM    574  N   ARG A  78      11.726  10.050  11.971  1.00  0.62           N  
ATOM    575  CA  ARG A  78      11.086  11.143  12.687  1.00  0.62           C  
ATOM    576  C   ARG A  78       9.570  11.053  12.723  1.00  0.62           C  
ATOM    577  O   ARG A  78       8.939  11.515  13.664  1.00  0.62           O  
ATOM    578  CB  ARG A  78      11.462  12.518  12.087  1.00  0.62           C  
ATOM    579  CG  ARG A  78      12.885  12.974  12.455  1.00  0.62           C  
ATOM    580  CD  ARG A  78      13.179  14.425  12.059  1.00  0.62           C  
ATOM    581  NE  ARG A  78      13.245  14.499  10.557  1.00  0.62           N  
ATOM    582  CZ  ARG A  78      14.382  14.505   9.849  1.00  0.62           C  
ATOM    583  NH1 ARG A  78      15.565  14.371  10.438  1.00  0.62           N  
ATOM    584  NH2 ARG A  78      14.331  14.651   8.526  1.00  0.62           N  
ATOM    585  N   ALA A  79       8.940  10.464  11.696  1.00  0.67           N  
ATOM    586  CA  ALA A  79       7.503  10.327  11.657  1.00  0.67           C  
ATOM    587  C   ALA A  79       6.978   9.188  12.523  1.00  0.67           C  
ATOM    588  O   ALA A  79       5.789   9.115  12.817  1.00  0.67           O  
ATOM    589  CB  ALA A  79       7.093  10.132  10.191  1.00  0.67           C  
ATOM    590  N   LEU A  80       7.858   8.274  12.972  1.00  0.64           N  
ATOM    591  CA  LEU A  80       7.457   7.110  13.735  1.00  0.64           C  
ATOM    592  C   LEU A  80       7.682   7.272  15.230  1.00  0.64           C  
ATOM    593  O   LEU A  80       7.288   6.410  16.011  1.00  0.64           O  
ATOM    594  CB  LEU A  80       8.289   5.891  13.263  1.00  0.64           C  
ATOM    595  CG  LEU A  80       8.013   5.457  11.811  1.00  0.64           C  
ATOM    596  CD1 LEU A  80       9.088   4.471  11.335  1.00  0.64           C  
ATOM    597  CD2 LEU A  80       6.611   4.849  11.663  1.00  0.64           C  
ATOM    598  N   THR A  81       8.297   8.382  15.686  1.00  0.61           N  
ATOM    599  CA  THR A  81       8.680   8.598  17.084  1.00  0.61           C  
ATOM    600  C   THR A  81       7.508   8.665  18.042  1.00  0.61           C  
ATOM    601  O   THR A  81       7.557   8.092  19.126  1.00  0.61           O  
ATOM    602  CB  THR A  81       9.548   9.838  17.282  1.00  0.61           C  
ATOM    603  OG1 THR A  81       8.971  10.958  16.629  1.00  0.61           O  
ATOM    604  CG2 THR A  81      10.915   9.597  16.623  1.00  0.61           C  
ATOM    605  N   ASP A  82       6.409   9.339  17.657  1.00  0.50           N  
ATOM    606  CA  ASP A  82       5.219   9.466  18.478  1.00  0.50           C  
ATOM    607  C   ASP A  82       4.451   8.148  18.646  1.00  0.50           C  
ATOM    608  O   ASP A  82       3.789   7.900  19.656  1.00  0.50           O  
ATOM    609  CB  ASP A  82       4.279  10.549  17.884  1.00  0.50           C  
ATOM    610  CG  ASP A  82       4.931  11.921  17.893  1.00  0.50           C  
ATOM    611  OD1 ASP A  82       5.523  12.297  18.934  1.00  0.50           O  
ATOM    612  OD2 ASP A  82       4.800  12.638  16.865  1.00  0.50           O  
ATOM    613  N   ASP A  83       4.525   7.243  17.650  1.00  0.56           N  
ATOM    614  CA  ASP A  83       3.732   6.035  17.654  1.00  0.56           C  
ATOM    615  C   ASP A  83       4.510   4.806  18.088  1.00  0.56           C  
ATOM    616  O   ASP A  83       3.913   3.837  18.550  1.00  0.56           O  
ATOM    617  CB  ASP A  83       3.167   5.806  16.235  1.00  0.56           C  
ATOM    618  CG  ASP A  83       1.952   6.682  16.062  1.00  0.56           C  
ATOM    619  OD1 ASP A  83       0.859   6.221  16.488  1.00  0.56           O  
ATOM    620  OD2 ASP A  83       2.061   7.802  15.512  1.00  0.56           O  
ATOM    621  N   CYS A  84       5.851   4.805  18.028  1.00  0.61           N  
ATOM    622  CA  CYS A  84       6.634   3.597  18.235  1.00  0.61           C  
ATOM    623  C   CYS A  84       7.660   3.759  19.335  1.00  0.61           C  
ATOM    624  O   CYS A  84       8.458   4.689  19.341  1.00  0.61           O  
ATOM    625  CB  CYS A  84       7.362   3.181  16.936  1.00  0.61           C  
ATOM    626  SG  CYS A  84       6.175   2.846  15.586  1.00  0.61           S  
ATOM    627  N   ASP A  85       7.668   2.814  20.297  1.00  0.62           N  
ATOM    628  CA  ASP A  85       8.570   2.779  21.436  1.00  0.62           C  
ATOM    629  C   ASP A  85      10.002   2.500  21.009  1.00  0.62           C  
ATOM    630  O   ASP A  85      10.970   2.944  21.623  1.00  0.62           O  
ATOM    631  CB  ASP A  85       8.137   1.675  22.440  1.00  0.62           C  
ATOM    632  CG  ASP A  85       6.684   1.858  22.791  1.00  0.62           C  
ATOM    633  OD1 ASP A  85       6.332   2.659  23.680  1.00  0.62           O  
ATOM    634  OD2 ASP A  85       5.841   1.262  22.069  1.00  0.62           O  
ATOM    635  N   ARG A  86      10.160   1.717  19.926  1.00  0.62           N  
ATOM    636  CA  ARG A  86      11.458   1.303  19.463  1.00  0.62           C  
ATOM    637  C   ARG A  86      11.546   1.411  17.961  1.00  0.62           C  
ATOM    638  O   ARG A  86      10.608   1.098  17.228  1.00  0.62           O  
ATOM    639  CB  ARG A  86      11.737  -0.151  19.901  1.00  0.62           C  
ATOM    640  CG  ARG A  86      13.232  -0.499  19.997  1.00  0.62           C  
ATOM    641  CD  ARG A  86      13.486  -1.898  20.561  1.00  0.62           C  
ATOM    642  NE  ARG A  86      13.189  -2.870  19.467  1.00  0.62           N  
ATOM    643  CZ  ARG A  86      13.264  -4.195  19.605  1.00  0.62           C  
ATOM    644  NH1 ARG A  86      13.681  -4.764  20.730  1.00  0.62           N  
ATOM    645  NH2 ARG A  86      12.978  -4.986  18.577  1.00  0.62           N  
ATOM    646  N   LEU A  87      12.707   1.862  17.463  1.00  0.72           N  
ATOM    647  CA  LEU A  87      12.982   1.956  16.049  1.00  0.72           C  
ATOM    648  C   LEU A  87      14.130   1.015  15.738  1.00  0.72           C  
ATOM    649  O   LEU A  87      15.239   1.185  16.240  1.00  0.72           O  
ATOM    650  CB  LEU A  87      13.375   3.400  15.648  1.00  0.72           C  
ATOM    651  CG  LEU A  87      12.331   4.485  15.996  1.00  0.72           C  
ATOM    652  CD1 LEU A  87      12.868   5.875  15.629  1.00  0.72           C  
ATOM    653  CD2 LEU A  87      10.978   4.252  15.309  1.00  0.72           C  
ATOM    654  N   LEU A  88      13.875  -0.019  14.916  1.00  0.70           N  
ATOM    655  CA  LEU A  88      14.847  -1.034  14.572  1.00  0.70           C  
ATOM    656  C   LEU A  88      15.128  -0.977  13.089  1.00  0.70           C  
ATOM    657  O   LEU A  88      14.255  -1.200  12.251  1.00  0.70           O  
ATOM    658  CB  LEU A  88      14.313  -2.449  14.923  1.00  0.70           C  
ATOM    659  CG  LEU A  88      15.215  -3.635  14.502  1.00  0.70           C  
ATOM    660  CD1 LEU A  88      16.573  -3.608  15.217  1.00  0.70           C  
ATOM    661  CD2 LEU A  88      14.511  -4.976  14.755  1.00  0.70           C  
ATOM    662  N   LEU A  89      16.384  -0.689  12.720  1.00  0.71           N  
ATOM    663  CA  LEU A  89      16.804  -0.732  11.337  1.00  0.71           C  
ATOM    664  C   LEU A  89      17.409  -2.084  11.044  1.00  0.71           C  
ATOM    665  O   LEU A  89      18.316  -2.553  11.730  1.00  0.71           O  
ATOM    666  CB  LEU A  89      17.819   0.375  10.954  1.00  0.71           C  
ATOM    667  CG  LEU A  89      17.166   1.724  10.586  1.00  0.71           C  
ATOM    668  CD1 LEU A  89      16.303   2.268  11.727  1.00  0.71           C  
ATOM    669  CD2 LEU A  89      18.241   2.744  10.182  1.00  0.71           C  
ATOM    670  N   VAL A  90      16.920  -2.737   9.982  1.00  0.68           N  
ATOM    671  CA  VAL A  90      17.563  -3.905   9.416  1.00  0.68           C  
ATOM    672  C   VAL A  90      18.320  -3.422   8.196  1.00  0.68           C  
ATOM    673  O   VAL A  90      17.751  -3.154   7.137  1.00  0.68           O  
ATOM    674  CB  VAL A  90      16.574  -5.006   9.060  1.00  0.68           C  
ATOM    675  CG1 VAL A  90      17.328  -6.249   8.544  1.00  0.68           C  
ATOM    676  CG2 VAL A  90      15.757  -5.368  10.317  1.00  0.68           C  
ATOM    677  N   ASP A  91      19.646  -3.263   8.349  1.00  0.60           N  
ATOM    678  CA  ASP A  91      20.507  -2.685   7.351  1.00  0.60           C  
ATOM    679  C   ASP A  91      21.076  -3.799   6.503  1.00  0.60           C  
ATOM    680  O   ASP A  91      21.693  -4.738   7.006  1.00  0.60           O  
ATOM    681  CB  ASP A  91      21.629  -1.864   8.034  1.00  0.60           C  
ATOM    682  CG  ASP A  91      22.489  -1.194   6.986  1.00  0.60           C  
ATOM    683  OD1 ASP A  91      21.965  -0.255   6.344  1.00  0.60           O  
ATOM    684  OD2 ASP A  91      23.649  -1.622   6.779  1.00  0.60           O  
ATOM    685  N   ALA A  92      20.886  -3.702   5.178  1.00  0.59           N  
ATOM    686  CA  ALA A  92      21.351  -4.695   4.243  1.00  0.59           C  
ATOM    687  C   ALA A  92      22.739  -4.390   3.704  1.00  0.59           C  
ATOM    688  O   ALA A  92      23.036  -4.723   2.560  1.00  0.59           O  
ATOM    689  CB  ALA A  92      20.337  -4.837   3.096  1.00  0.59           C  
ATOM    690  N   GLU A  93      23.591  -3.759   4.546  1.00  0.48           N  
ATOM    691  CA  GLU A  93      24.964  -3.385   4.259  1.00  0.48           C  
ATOM    692  C   GLU A  93      25.057  -2.097   3.466  1.00  0.48           C  
ATOM    693  O   GLU A  93      25.660  -2.040   2.396  1.00  0.48           O  
ATOM    694  CB  GLU A  93      25.865  -4.514   3.686  1.00  0.48           C  
ATOM    695  CG  GLU A  93      25.953  -5.756   4.607  1.00  0.48           C  
ATOM    696  CD  GLU A  93      26.725  -6.909   3.974  1.00  0.48           C  
ATOM    697  OE1 GLU A  93      27.714  -7.361   4.608  1.00  0.48           O  
ATOM    698  OE2 GLU A  93      26.297  -7.398   2.895  1.00  0.48           O  
ATOM    699  N   SER A  94      24.460  -1.007   3.998  1.00  0.55           N  
ATOM    700  CA  SER A  94      24.509   0.316   3.374  1.00  0.55           C  
ATOM    701  C   SER A  94      25.922   0.859   3.209  1.00  0.55           C  
ATOM    702  O   SER A  94      26.743   0.814   4.129  1.00  0.55           O  
ATOM    703  CB  SER A  94      23.710   1.399   4.137  1.00  0.55           C  
ATOM    704  OG  SER A  94      22.318   1.088   4.196  1.00  0.55           O  
ATOM    705  N   GLU A  95      26.237   1.423   2.030  1.00  0.50           N  
ATOM    706  CA  GLU A  95      27.576   1.903   1.734  1.00  0.50           C  
ATOM    707  C   GLU A  95      27.652   3.420   1.829  1.00  0.50           C  
ATOM    708  O   GLU A  95      28.739   4.001   1.848  1.00  0.50           O  
ATOM    709  CB  GLU A  95      28.019   1.472   0.310  1.00  0.50           C  
ATOM    710  CG  GLU A  95      28.181  -0.061   0.121  1.00  0.50           C  
ATOM    711  CD  GLU A  95      28.758  -0.447  -1.244  1.00  0.50           C  
ATOM    712  OE1 GLU A  95      28.829  -1.674  -1.518  1.00  0.50           O  
ATOM    713  OE2 GLU A  95      29.167   0.461  -2.015  1.00  0.50           O  
ATOM    714  N   ASP A  96      26.494   4.104   1.925  1.00  0.51           N  
ATOM    715  CA  ASP A  96      26.397   5.548   2.022  1.00  0.51           C  
ATOM    716  C   ASP A  96      26.470   6.088   3.464  1.00  0.51           C  
ATOM    717  O   ASP A  96      27.106   5.510   4.346  1.00  0.51           O  
ATOM    718  CB  ASP A  96      25.117   6.008   1.260  1.00  0.51           C  
ATOM    719  CG  ASP A  96      23.794   5.659   1.927  1.00  0.51           C  
ATOM    720  OD1 ASP A  96      23.794   5.020   3.013  1.00  0.51           O  
ATOM    721  OD2 ASP A  96      22.728   6.051   1.393  1.00  0.51           O  
ATOM    722  N   THR A  97      25.792   7.228   3.767  1.00  0.62           N  
ATOM    723  CA  THR A  97      25.705   7.742   5.136  1.00  0.62           C  
ATOM    724  C   THR A  97      24.410   7.382   5.856  1.00  0.62           C  
ATOM    725  O   THR A  97      24.141   7.920   6.927  1.00  0.62           O  
ATOM    726  CB  THR A  97      26.036   9.229   5.333  1.00  0.62           C  
ATOM    727  OG1 THR A  97      25.105  10.131   4.741  1.00  0.62           O  
ATOM    728  CG2 THR A  97      27.367   9.560   4.682  1.00  0.62           C  
ATOM    729  N   THR A  98      23.596   6.409   5.363  1.00  0.62           N  
ATOM    730  CA  THR A  98      22.278   6.012   5.896  1.00  0.62           C  
ATOM    731  C   THR A  98      22.233   5.784   7.390  1.00  0.62           C  
ATOM    732  O   THR A  98      21.403   6.354   8.098  1.00  0.62           O  
ATOM    733  CB  THR A  98      21.749   4.720   5.259  1.00  0.62           C  
ATOM    734  OG1 THR A  98      21.367   4.926   3.923  1.00  0.62           O  
ATOM    735  CG2 THR A  98      20.417   4.240   5.831  1.00  0.62           C  
ATOM    736  N   LEU A  99      23.158   4.973   7.936  1.00  0.59           N  
ATOM    737  CA  LEU A  99      23.262   4.730   9.363  1.00  0.59           C  
ATOM    738  C   LEU A  99      23.609   5.976  10.161  1.00  0.59           C  
ATOM    739  O   LEU A  99      23.107   6.183  11.263  1.00  0.59           O  
ATOM    740  CB  LEU A  99      24.295   3.620   9.664  1.00  0.59           C  
ATOM    741  CG  LEU A  99      23.931   2.234   9.089  1.00  0.59           C  
ATOM    742  CD1 LEU A  99      25.006   1.207   9.472  1.00  0.59           C  
ATOM    743  CD2 LEU A  99      22.553   1.742   9.560  1.00  0.59           C  
ATOM    744  N   GLY A 100      24.459   6.866   9.609  1.00  0.62           N  
ATOM    745  CA  GLY A 100      24.793   8.137  10.243  1.00  0.62           C  
ATOM    746  C   GLY A 100      23.634   9.096  10.260  1.00  0.62           C  
ATOM    747  O   GLY A 100      23.333   9.702  11.283  1.00  0.62           O  
ATOM    748  N   THR A 101      22.909   9.204   9.133  1.00  0.63           N  
ATOM    749  CA  THR A 101      21.684   9.988   9.014  1.00  0.63           C  
ATOM    750  C   THR A 101      20.597   9.501   9.936  1.00  0.63           C  
ATOM    751  O   THR A 101      19.918  10.293  10.582  1.00  0.63           O  
ATOM    752  CB  THR A 101      21.139   9.999   7.595  1.00  0.63           C  
ATOM    753  OG1 THR A 101      22.104  10.608   6.757  1.00  0.63           O  
ATOM    754  CG2 THR A 101      19.871  10.859   7.484  1.00  0.63           C  
ATOM    755  N   ALA A 102      20.415   8.172  10.056  1.00  0.65           N  
ATOM    756  CA  ALA A 102      19.453   7.585  10.963  1.00  0.65           C  
ATOM    757  C   ALA A 102      19.700   7.913  12.431  1.00  0.65           C  
ATOM    758  O   ALA A 102      18.785   8.317  13.144  1.00  0.65           O  
ATOM    759  CB  ALA A 102      19.458   6.058  10.768  1.00  0.65           C  
ATOM    760  N   ARG A 103      20.963   7.803  12.896  1.00  0.56           N  
ATOM    761  CA  ARG A 103      21.363   8.147  14.252  1.00  0.56           C  
ATOM    762  C   ARG A 103      21.180   9.616  14.581  1.00  0.56           C  
ATOM    763  O   ARG A 103      20.740   9.973  15.665  1.00  0.56           O  
ATOM    764  CB  ARG A 103      22.844   7.775  14.489  1.00  0.56           C  
ATOM    765  CG  ARG A 103      23.098   6.257  14.508  1.00  0.56           C  
ATOM    766  CD  ARG A 103      24.590   5.942  14.593  1.00  0.56           C  
ATOM    767  NE  ARG A 103      24.750   4.461  14.474  1.00  0.56           N  
ATOM    768  CZ  ARG A 103      25.920   3.867  14.218  1.00  0.56           C  
ATOM    769  NH1 ARG A 103      27.058   4.553  14.156  1.00  0.56           N  
ATOM    770  NH2 ARG A 103      25.946   2.553  14.024  1.00  0.56           N  
ATOM    771  N   SER A 104      21.502  10.514  13.635  1.00  0.63           N  
ATOM    772  CA  SER A 104      21.371  11.947  13.854  1.00  0.63           C  
ATOM    773  C   SER A 104      19.940  12.443  13.735  1.00  0.63           C  
ATOM    774  O   SER A 104      19.621  13.561  14.130  1.00  0.63           O  
ATOM    775  CB  SER A 104      22.218  12.755  12.840  1.00  0.63           C  
ATOM    776  OG  SER A 104      23.604  12.454  13.004  1.00  0.63           O  
ATOM    777  N   ALA A 105      19.025  11.638  13.159  1.00  0.59           N  
ATOM    778  CA  ALA A 105      17.660  12.048  12.920  1.00  0.59           C  
ATOM    779  C   ALA A 105      16.730  11.935  14.116  1.00  0.59           C  
ATOM    780  O   ALA A 105      15.732  12.655  14.182  1.00  0.59           O  
ATOM    781  CB  ALA A 105      17.075  11.191  11.780  1.00  0.59           C  
ATOM    782  N   VAL A 106      17.026  11.031  15.069  1.00  0.54           N  
ATOM    783  CA  VAL A 106      16.157  10.731  16.195  1.00  0.54           C  
ATOM    784  C   VAL A 106      17.008  10.463  17.420  1.00  0.54           C  
ATOM    785  O   VAL A 106      18.193  10.175  17.326  1.00  0.54           O  
ATOM    786  CB  VAL A 106      15.233   9.526  15.973  1.00  0.54           C  
ATOM    787  CG1 VAL A 106      14.190   9.840  14.883  1.00  0.54           C  
ATOM    788  CG2 VAL A 106      16.049   8.275  15.590  1.00  0.54           C  
ATOM    789  N   ALA A 107      16.419  10.563  18.630  1.00  0.35           N  
ATOM    790  CA  ALA A 107      17.135  10.382  19.883  1.00  0.35           C  
ATOM    791  C   ALA A 107      17.714   8.988  20.123  1.00  0.35           C  
ATOM    792  O   ALA A 107      18.791   8.840  20.691  1.00  0.35           O  
ATOM    793  CB  ALA A 107      16.205  10.733  21.061  1.00  0.35           C  
ATOM    794  N   HIS A 108      16.986   7.931  19.719  1.00  0.48           N  
ATOM    795  CA  HIS A 108      17.445   6.567  19.879  1.00  0.48           C  
ATOM    796  C   HIS A 108      16.991   5.767  18.680  1.00  0.48           C  
ATOM    797  O   HIS A 108      15.848   5.873  18.234  1.00  0.48           O  
ATOM    798  CB  HIS A 108      16.922   5.913  21.187  1.00  0.48           C  
ATOM    799  CG  HIS A 108      17.402   4.506  21.418  1.00  0.48           C  
ATOM    800  ND1 HIS A 108      18.720   4.190  21.152  1.00  0.48           N  
ATOM    801  CD2 HIS A 108      16.725   3.396  21.816  1.00  0.48           C  
ATOM    802  CE1 HIS A 108      18.819   2.896  21.388  1.00  0.48           C  
ATOM    803  NE2 HIS A 108      17.639   2.363  21.792  1.00  0.48           N  
ATOM    804  N   VAL A 109      17.901   4.960  18.116  1.00  0.67           N  
ATOM    805  CA  VAL A 109      17.603   4.061  17.027  1.00  0.67           C  
ATOM    806  C   VAL A 109      18.531   2.868  17.148  1.00  0.67           C  
ATOM    807  O   VAL A 109      19.731   3.003  17.386  1.00  0.67           O  
ATOM    808  CB  VAL A 109      17.680   4.748  15.662  1.00  0.67           C  
ATOM    809  CG1 VAL A 109      19.080   5.319  15.370  1.00  0.67           C  
ATOM    810  CG2 VAL A 109      17.230   3.801  14.544  1.00  0.67           C  
ATOM    811  N   GLU A 110      17.987   1.648  17.005  1.00  0.69           N  
ATOM    812  CA  GLU A 110      18.750   0.422  17.058  1.00  0.69           C  
ATOM    813  C   GLU A 110      18.973  -0.052  15.632  1.00  0.69           C  
ATOM    814  O   GLU A 110      18.132   0.140  14.752  1.00  0.69           O  
ATOM    815  CB  GLU A 110      18.015  -0.659  17.898  1.00  0.69           C  
ATOM    816  CG  GLU A 110      17.772  -0.225  19.371  1.00  0.69           C  
ATOM    817  CD  GLU A 110      16.888  -1.172  20.176  1.00  0.69           C  
ATOM    818  OE1 GLU A 110      16.611  -0.834  21.362  1.00  0.69           O  
ATOM    819  OE2 GLU A 110      16.433  -2.214  19.637  1.00  0.69           O  
ATOM    820  N   HIS A 111      20.129  -0.671  15.332  1.00  0.69           N  
ATOM    821  CA  HIS A 111      20.388  -1.172  13.997  1.00  0.69           C  
ATOM    822  C   HIS A 111      20.998  -2.553  14.069  1.00  0.69           C  
ATOM    823  O   HIS A 111      21.850  -2.842  14.905  1.00  0.69           O  
ATOM    824  CB  HIS A 111      21.271  -0.227  13.119  1.00  0.69           C  
ATOM    825  CG  HIS A 111      22.751  -0.272  13.386  1.00  0.69           C  
ATOM    826  ND1 HIS A 111      23.336   0.507  14.374  1.00  0.69           N  
ATOM    827  CD2 HIS A 111      23.633  -1.208  12.944  1.00  0.69           C  
ATOM    828  CE1 HIS A 111      24.542  -0.000  14.531  1.00  0.69           C  
ATOM    829  NE2 HIS A 111      24.777  -1.028  13.685  1.00  0.69           N  
ATOM    830  N   VAL A 112      20.566  -3.449  13.169  1.00  0.70           N  
ATOM    831  CA  VAL A 112      21.201  -4.736  12.972  1.00  0.70           C  
ATOM    832  C   VAL A 112      21.651  -4.790  11.528  1.00  0.70           C  
ATOM    833  O   VAL A 112      20.867  -4.592  10.601  1.00  0.70           O  
ATOM    834  CB  VAL A 112      20.278  -5.913  13.280  1.00  0.70           C  
ATOM    835  CG1 VAL A 112      20.960  -7.260  12.959  1.00  0.70           C  
ATOM    836  CG2 VAL A 112      19.905  -5.887  14.773  1.00  0.70           C  
ATOM    837  N   THR A 113      22.951  -5.054  11.304  1.00  0.61           N  
ATOM    838  CA  THR A 113      23.522  -5.197   9.969  1.00  0.61           C  
ATOM    839  C   THR A 113      23.449  -6.641   9.548  1.00  0.61           C  
ATOM    840  O   THR A 113      23.875  -7.535  10.276  1.00  0.61           O  
ATOM    841  CB  THR A 113      24.978  -4.761   9.869  1.00  0.61           C  
ATOM    842  OG1 THR A 113      25.122  -3.445  10.377  1.00  0.61           O  
ATOM    843  CG2 THR A 113      25.459  -4.730   8.409  1.00  0.61           C  
ATOM    844  N   ARG A 114      22.890  -6.920   8.359  1.00  0.50           N  
ATOM    845  CA  ARG A 114      22.811  -8.268   7.842  1.00  0.50           C  
ATOM    846  C   ARG A 114      23.042  -8.275   6.358  1.00  0.50           C  
ATOM    847  O   ARG A 114      22.466  -7.486   5.623  1.00  0.50           O  
ATOM    848  CB  ARG A 114      21.417  -8.906   8.045  1.00  0.50           C  
ATOM    849  CG  ARG A 114      21.114  -9.254   9.508  1.00  0.50           C  
ATOM    850  CD  ARG A 114      19.774  -9.959   9.699  1.00  0.50           C  
ATOM    851  NE  ARG A 114      19.891 -11.345   9.125  1.00  0.50           N  
ATOM    852  CZ  ARG A 114      19.111 -11.832   8.152  1.00  0.50           C  
ATOM    853  NH1 ARG A 114      18.339 -11.064   7.397  1.00  0.50           N  
ATOM    854  NH2 ARG A 114      19.094 -13.145   7.930  1.00  0.50           N  
ATOM    855  N   ALA A 115      23.861  -9.220   5.868  1.00  0.52           N  
ATOM    856  CA  ALA A 115      24.110  -9.356   4.451  1.00  0.52           C  
ATOM    857  C   ALA A 115      22.880  -9.624   3.593  1.00  0.52           C  
ATOM    858  O   ALA A 115      21.968 -10.366   3.964  1.00  0.52           O  
ATOM    859  CB  ALA A 115      25.164 -10.448   4.195  1.00  0.52           C  
ATOM    860  N   TRP A 116      22.826  -9.004   2.399  1.00  0.35           N  
ATOM    861  CA  TRP A 116      21.788  -9.277   1.424  1.00  0.35           C  
ATOM    862  C   TRP A 116      21.940 -10.661   0.793  1.00  0.35           C  
ATOM    863  O   TRP A 116      22.909 -10.968   0.106  1.00  0.35           O  
ATOM    864  CB  TRP A 116      21.706  -8.167   0.342  1.00  0.35           C  
ATOM    865  CG  TRP A 116      20.732  -8.431  -0.799  1.00  0.35           C  
ATOM    866  CD1 TRP A 116      21.031  -8.795  -2.083  1.00  0.35           C  
ATOM    867  CD2 TRP A 116      19.297  -8.479  -0.689  1.00  0.35           C  
ATOM    868  NE1 TRP A 116      19.877  -9.041  -2.794  1.00  0.35           N  
ATOM    869  CE2 TRP A 116      18.806  -8.856  -1.957  1.00  0.35           C  
ATOM    870  CE3 TRP A 116      18.430  -8.239   0.379  1.00  0.35           C  
ATOM    871  CZ2 TRP A 116      17.449  -9.018  -2.177  1.00  0.35           C  
ATOM    872  CZ3 TRP A 116      17.055  -8.417   0.155  1.00  0.35           C  
ATOM    873  CH2 TRP A 116      16.575  -8.802  -1.105  1.00  0.35           C  
ATOM    874  N   THR A 117      20.944 -11.541   1.008  1.00  0.41           N  
ATOM    875  CA  THR A 117      21.032 -12.945   0.625  1.00  0.41           C  
ATOM    876  C   THR A 117      20.096 -13.303  -0.507  1.00  0.41           C  
ATOM    877  O   THR A 117      19.803 -14.482  -0.719  1.00  0.41           O  
ATOM    878  CB  THR A 117      20.710 -13.881   1.785  1.00  0.41           C  
ATOM    879  OG1 THR A 117      19.486 -13.523   2.422  1.00  0.41           O  
ATOM    880  CG2 THR A 117      21.822 -13.775   2.836  1.00  0.41           C  
ATOM    881  N   ASP A 118      19.606 -12.296  -1.265  1.00  0.37           N  
ATOM    882  CA  ASP A 118      18.596 -12.458  -2.296  1.00  0.37           C  
ATOM    883  C   ASP A 118      17.258 -12.941  -1.748  1.00  0.37           C  
ATOM    884  O   ASP A 118      16.641 -13.898  -2.228  1.00  0.37           O  
ATOM    885  CB  ASP A 118      19.110 -13.275  -3.507  1.00  0.37           C  
ATOM    886  CG  ASP A 118      19.916 -12.430  -4.471  1.00  0.37           C  
ATOM    887  OD1 ASP A 118      19.815 -11.176  -4.481  1.00  0.37           O  
ATOM    888  OD2 ASP A 118      20.563 -13.041  -5.353  1.00  0.37           O  
ATOM    889  N   ASP A 119      16.785 -12.247  -0.698  1.00  0.37           N  
ATOM    890  CA  ASP A 119      15.594 -12.646   0.001  1.00  0.37           C  
ATOM    891  C   ASP A 119      15.067 -11.494   0.855  1.00  0.37           C  
ATOM    892  O   ASP A 119      15.620 -11.136   1.898  1.00  0.37           O  
ATOM    893  CB  ASP A 119      15.946 -13.885   0.859  1.00  0.37           C  
ATOM    894  CG  ASP A 119      14.725 -14.634   1.336  1.00  0.37           C  
ATOM    895  OD1 ASP A 119      13.695 -13.979   1.627  1.00  0.37           O  
ATOM    896  OD2 ASP A 119      14.825 -15.881   1.426  1.00  0.37           O  
ATOM    897  N   PHE A 120      13.963 -10.861   0.404  1.00  0.35           N  
ATOM    898  CA  PHE A 120      13.271  -9.824   1.149  1.00  0.35           C  
ATOM    899  C   PHE A 120      12.607 -10.363   2.410  1.00  0.35           C  
ATOM    900  O   PHE A 120      12.656  -9.736   3.471  1.00  0.35           O  
ATOM    901  CB  PHE A 120      12.223  -9.093   0.269  1.00  0.35           C  
ATOM    902  CG  PHE A 120      12.882  -8.139  -0.696  1.00  0.35           C  
ATOM    903  CD1 PHE A 120      13.391  -6.914  -0.233  1.00  0.35           C  
ATOM    904  CD2 PHE A 120      12.973  -8.428  -2.069  1.00  0.35           C  
ATOM    905  CE1 PHE A 120      13.994  -6.007  -1.116  1.00  0.35           C  
ATOM    906  CE2 PHE A 120      13.578  -7.528  -2.956  1.00  0.35           C  
ATOM    907  CZ  PHE A 120      14.092  -6.318  -2.478  1.00  0.35           C  
ATOM    908  N   ALA A 121      12.013 -11.572   2.346  1.00  0.54           N  
ATOM    909  CA  ALA A 121      11.403 -12.237   3.475  1.00  0.54           C  
ATOM    910  C   ALA A 121      12.393 -12.554   4.583  1.00  0.54           C  
ATOM    911  O   ALA A 121      12.130 -12.305   5.758  1.00  0.54           O  
ATOM    912  CB  ALA A 121      10.721 -13.533   3.004  1.00  0.54           C  
ATOM    913  N   ALA A 122      13.593 -13.050   4.240  1.00  0.57           N  
ATOM    914  CA  ALA A 122      14.670 -13.280   5.181  1.00  0.57           C  
ATOM    915  C   ALA A 122      15.162 -12.020   5.881  1.00  0.57           C  
ATOM    916  O   ALA A 122      15.563 -12.051   7.044  1.00  0.57           O  
ATOM    917  CB  ALA A 122      15.857 -13.955   4.480  1.00  0.57           C  
ATOM    918  N   GLN A 123      15.170 -10.862   5.194  1.00  0.57           N  
ATOM    919  CA  GLN A 123      15.431  -9.592   5.848  1.00  0.57           C  
ATOM    920  C   GLN A 123      14.344  -9.161   6.815  1.00  0.57           C  
ATOM    921  O   GLN A 123      14.625  -8.779   7.948  1.00  0.57           O  
ATOM    922  CB  GLN A 123      15.715  -8.473   4.822  1.00  0.57           C  
ATOM    923  CG  GLN A 123      17.015  -8.677   4.006  1.00  0.57           C  
ATOM    924  CD  GLN A 123      18.295  -8.672   4.854  1.00  0.57           C  
ATOM    925  OE1 GLN A 123      18.319  -8.601   6.085  1.00  0.57           O  
ATOM    926  NE2 GLN A 123      19.438  -8.789   4.146  1.00  0.57           N  
ATOM    927  N   ARG A 124      13.061  -9.271   6.424  1.00  0.55           N  
ATOM    928  CA  ARG A 124      11.943  -8.963   7.299  1.00  0.55           C  
ATOM    929  C   ARG A 124      11.832  -9.889   8.503  1.00  0.55           C  
ATOM    930  O   ARG A 124      11.546  -9.453   9.618  1.00  0.55           O  
ATOM    931  CB  ARG A 124      10.614  -8.969   6.515  1.00  0.55           C  
ATOM    932  CG  ARG A 124      10.504  -7.835   5.481  1.00  0.55           C  
ATOM    933  CD  ARG A 124       9.099  -7.723   4.886  1.00  0.55           C  
ATOM    934  NE  ARG A 124       9.088  -6.640   3.858  1.00  0.55           N  
ATOM    935  CZ  ARG A 124       8.971  -5.328   4.098  1.00  0.55           C  
ATOM    936  NH1 ARG A 124       8.988  -4.817   5.323  1.00  0.55           N  
ATOM    937  NH2 ARG A 124       8.825  -4.500   3.068  1.00  0.55           N  
ATOM    938  N   ASN A 125      12.086 -11.199   8.310  1.00  0.62           N  
ATOM    939  CA  ASN A 125      12.014 -12.204   9.353  1.00  0.62           C  
ATOM    940  C   ASN A 125      13.069 -12.040  10.447  1.00  0.62           C  
ATOM    941  O   ASN A 125      12.834 -12.416  11.591  1.00  0.62           O  
ATOM    942  CB  ASN A 125      12.062 -13.638   8.767  1.00  0.62           C  
ATOM    943  CG  ASN A 125      10.733 -13.965   8.088  1.00  0.62           C  
ATOM    944  OD1 ASN A 125       9.661 -13.517   8.504  1.00  0.62           O  
ATOM    945  ND2 ASN A 125      10.783 -14.814   7.038  1.00  0.62           N  
ATOM    946  N   ALA A 126      14.224 -11.409  10.149  1.00  0.68           N  
ATOM    947  CA  ALA A 126      15.275 -11.127  11.114  1.00  0.68           C  
ATOM    948  C   ALA A 126      14.843 -10.223  12.264  1.00  0.68           C  
ATOM    949  O   ALA A 126      15.356 -10.272  13.379  1.00  0.68           O  
ATOM    950  CB  ALA A 126      16.438 -10.454  10.372  1.00  0.68           C  
ATOM    951  N   ALA A 127      13.841  -9.363  12.020  1.00  0.66           N  
ATOM    952  CA  ALA A 127      13.287  -8.491  13.023  1.00  0.66           C  
ATOM    953  C   ALA A 127      12.566  -9.210  14.156  1.00  0.66           C  
ATOM    954  O   ALA A 127      12.519  -8.716  15.281  1.00  0.66           O  
ATOM    955  CB  ALA A 127      12.332  -7.519  12.332  1.00  0.66           C  
ATOM    956  N   PHE A 128      12.017 -10.416  13.896  1.00  0.48           N  
ATOM    957  CA  PHE A 128      11.372 -11.250  14.896  1.00  0.48           C  
ATOM    958  C   PHE A 128      12.335 -11.713  15.983  1.00  0.48           C  
ATOM    959  O   PHE A 128      11.971 -11.775  17.153  1.00  0.48           O  
ATOM    960  CB  PHE A 128      10.686 -12.485  14.261  1.00  0.48           C  
ATOM    961  CG  PHE A 128       9.427 -12.102  13.526  1.00  0.48           C  
ATOM    962  CD1 PHE A 128       8.173 -12.200  14.153  1.00  0.48           C  
ATOM    963  CD2 PHE A 128       9.478 -11.686  12.188  1.00  0.48           C  
ATOM    964  CE1 PHE A 128       6.996 -11.923  13.444  1.00  0.48           C  
ATOM    965  CE2 PHE A 128       8.309 -11.414  11.468  1.00  0.48           C  
ATOM    966  CZ  PHE A 128       7.066 -11.541  12.098  1.00  0.48           C  
ATOM    967  N   GLU A 129      13.608 -11.994  15.634  1.00  0.61           N  
ATOM    968  CA  GLU A 129      14.647 -12.398  16.571  1.00  0.61           C  
ATOM    969  C   GLU A 129      15.029 -11.284  17.535  1.00  0.61           C  
ATOM    970  O   GLU A 129      15.527 -11.515  18.633  1.00  0.61           O  
ATOM    971  CB  GLU A 129      15.914 -12.810  15.787  1.00  0.61           C  
ATOM    972  CG  GLU A 129      15.700 -14.028  14.855  1.00  0.61           C  
ATOM    973  CD  GLU A 129      16.878 -14.256  13.906  1.00  0.61           C  
ATOM    974  OE1 GLU A 129      16.784 -15.228  13.113  1.00  0.61           O  
ATOM    975  OE2 GLU A 129      17.849 -13.455  13.929  1.00  0.61           O  
ATOM    976  N   GLN A 130      14.773 -10.022  17.142  1.00  0.68           N  
ATOM    977  CA  GLN A 130      15.100  -8.861  17.941  1.00  0.68           C  
ATOM    978  C   GLN A 130      13.885  -8.319  18.675  1.00  0.68           C  
ATOM    979  O   GLN A 130      13.956  -7.347  19.433  1.00  0.68           O  
ATOM    980  CB  GLN A 130      15.599  -7.737  17.001  1.00  0.68           C  
ATOM    981  CG  GLN A 130      16.777  -8.154  16.091  1.00  0.68           C  
ATOM    982  CD  GLN A 130      17.996  -8.579  16.910  1.00  0.68           C  
ATOM    983  OE1 GLN A 130      18.393  -7.915  17.866  1.00  0.68           O  
ATOM    984  NE2 GLN A 130      18.628  -9.707  16.514  1.00  0.68           N  
ATOM    985  N   ALA A 131      12.701  -8.894  18.431  1.00  0.63           N  
ATOM    986  CA  ALA A 131      11.445  -8.440  18.967  1.00  0.63           C  
ATOM    987  C   ALA A 131      11.287  -8.645  20.473  1.00  0.63           C  
ATOM    988  O   ALA A 131      11.752  -9.623  21.049  1.00  0.63           O  
ATOM    989  CB  ALA A 131      10.315  -9.117  18.181  1.00  0.63           C  
ATOM    990  N   ARG A 132      10.605  -7.712  21.173  1.00  0.54           N  
ATOM    991  CA  ARG A 132      10.264  -7.922  22.572  1.00  0.54           C  
ATOM    992  C   ARG A 132       8.946  -8.682  22.666  1.00  0.54           C  
ATOM    993  O   ARG A 132       8.057  -8.365  21.876  1.00  0.54           O  
ATOM    994  CB  ARG A 132      10.092  -6.591  23.352  1.00  0.54           C  
ATOM    995  CG  ARG A 132      11.397  -5.789  23.494  1.00  0.54           C  
ATOM    996  CD  ARG A 132      11.255  -4.566  24.406  1.00  0.54           C  
ATOM    997  NE  ARG A 132      12.596  -3.887  24.414  1.00  0.54           N  
ATOM    998  CZ  ARG A 132      13.151  -3.261  25.461  1.00  0.54           C  
ATOM    999  NH1 ARG A 132      12.589  -3.256  26.665  1.00  0.54           N  
ATOM   1000  NH2 ARG A 132      14.313  -2.630  25.291  1.00  0.54           N  
ATOM   1001  N   PRO A 133       8.740  -9.651  23.560  1.00  0.41           N  
ATOM   1002  CA  PRO A 133       7.482 -10.388  23.666  1.00  0.41           C  
ATOM   1003  C   PRO A 133       6.328  -9.494  24.086  1.00  0.41           C  
ATOM   1004  O   PRO A 133       6.535  -8.536  24.828  1.00  0.41           O  
ATOM   1005  CB  PRO A 133       7.784 -11.482  24.709  1.00  0.41           C  
ATOM   1006  CG  PRO A 133       8.899 -10.896  25.583  1.00  0.41           C  
ATOM   1007  CD  PRO A 133       9.697 -10.036  24.602  1.00  0.41           C  
ATOM   1008  N   GLY A 134       5.102  -9.773  23.592  1.00  0.34           N  
ATOM   1009  CA  GLY A 134       3.914  -9.036  24.009  1.00  0.34           C  
ATOM   1010  C   GLY A 134       3.730  -7.692  23.353  1.00  0.34           C  
ATOM   1011  O   GLY A 134       3.042  -6.827  23.888  1.00  0.34           O  
ATOM   1012  N   GLY A 135       4.366  -7.458  22.191  1.00  0.68           N  
ATOM   1013  CA  GLY A 135       4.254  -6.196  21.475  1.00  0.68           C  
ATOM   1014  C   GLY A 135       3.919  -6.376  20.024  1.00  0.68           C  
ATOM   1015  O   GLY A 135       3.510  -7.439  19.564  1.00  0.68           O  
ATOM   1016  N   TRP A 136       4.111  -5.306  19.244  1.00  0.60           N  
ATOM   1017  CA  TRP A 136       3.821  -5.274  17.831  1.00  0.60           C  
ATOM   1018  C   TRP A 136       5.069  -4.962  17.042  1.00  0.60           C  
ATOM   1019  O   TRP A 136       5.906  -4.146  17.428  1.00  0.60           O  
ATOM   1020  CB  TRP A 136       2.747  -4.215  17.491  1.00  0.60           C  
ATOM   1021  CG  TRP A 136       1.387  -4.526  18.079  1.00  0.60           C  
ATOM   1022  CD1 TRP A 136       0.871  -4.173  19.295  1.00  0.60           C  
ATOM   1023  CD2 TRP A 136       0.359  -5.269  17.401  1.00  0.60           C  
ATOM   1024  NE1 TRP A 136      -0.426  -4.619  19.405  1.00  0.60           N  
ATOM   1025  CE2 TRP A 136      -0.763  -5.285  18.251  1.00  0.60           C  
ATOM   1026  CE3 TRP A 136       0.328  -5.895  16.158  1.00  0.60           C  
ATOM   1027  CZ2 TRP A 136      -1.940  -5.908  17.862  1.00  0.60           C  
ATOM   1028  CZ3 TRP A 136      -0.854  -6.546  15.772  1.00  0.60           C  
ATOM   1029  CH2 TRP A 136      -1.975  -6.548  16.615  1.00  0.60           C  
ATOM   1030  N   LEU A 137       5.207  -5.612  15.879  1.00  0.63           N  
ATOM   1031  CA  LEU A 137       6.214  -5.288  14.900  1.00  0.63           C  
ATOM   1032  C   LEU A 137       5.542  -4.608  13.736  1.00  0.63           C  
ATOM   1033  O   LEU A 137       4.739  -5.213  13.030  1.00  0.63           O  
ATOM   1034  CB  LEU A 137       6.925  -6.551  14.365  1.00  0.63           C  
ATOM   1035  CG  LEU A 137       7.703  -7.333  15.436  1.00  0.63           C  
ATOM   1036  CD1 LEU A 137       8.323  -8.590  14.817  1.00  0.63           C  
ATOM   1037  CD2 LEU A 137       8.782  -6.463  16.093  1.00  0.63           C  
ATOM   1038  N   ALA A 138       5.858  -3.323  13.508  1.00  0.68           N  
ATOM   1039  CA  ALA A 138       5.325  -2.572  12.398  1.00  0.68           C  
ATOM   1040  C   ALA A 138       6.379  -2.422  11.319  1.00  0.68           C  
ATOM   1041  O   ALA A 138       7.355  -1.689  11.462  1.00  0.68           O  
ATOM   1042  CB  ALA A 138       4.835  -1.190  12.875  1.00  0.68           C  
ATOM   1043  N   HIS A 139       6.205  -3.135  10.192  1.00  0.67           N  
ATOM   1044  CA  HIS A 139       7.141  -3.094   9.086  1.00  0.67           C  
ATOM   1045  C   HIS A 139       6.885  -1.894   8.194  1.00  0.67           C  
ATOM   1046  O   HIS A 139       5.807  -1.737   7.624  1.00  0.67           O  
ATOM   1047  CB  HIS A 139       7.069  -4.386   8.243  1.00  0.67           C  
ATOM   1048  CG  HIS A 139       7.683  -5.567   8.933  1.00  0.67           C  
ATOM   1049  ND1 HIS A 139       8.902  -6.059   8.493  1.00  0.67           N  
ATOM   1050  CD2 HIS A 139       7.267  -6.247  10.034  1.00  0.67           C  
ATOM   1051  CE1 HIS A 139       9.205  -7.022   9.349  1.00  0.67           C  
ATOM   1052  NE2 HIS A 139       8.250  -7.176  10.299  1.00  0.67           N  
ATOM   1053  N   VAL A 140       7.889  -1.014   8.066  1.00  0.68           N  
ATOM   1054  CA  VAL A 140       7.786   0.238   7.335  1.00  0.68           C  
ATOM   1055  C   VAL A 140       8.926   0.268   6.339  1.00  0.68           C  
ATOM   1056  O   VAL A 140      10.062  -0.074   6.672  1.00  0.68           O  
ATOM   1057  CB  VAL A 140       7.851   1.448   8.272  1.00  0.68           C  
ATOM   1058  CG1 VAL A 140       7.662   2.764   7.492  1.00  0.68           C  
ATOM   1059  CG2 VAL A 140       6.750   1.327   9.348  1.00  0.68           C  
ATOM   1060  N   ASP A 141       8.661   0.638   5.073  1.00  0.69           N  
ATOM   1061  CA  ASP A 141       9.711   0.736   4.077  1.00  0.69           C  
ATOM   1062  C   ASP A 141      10.425   2.097   4.237  1.00  0.69           C  
ATOM   1063  O   ASP A 141       9.893   3.049   4.804  1.00  0.69           O  
ATOM   1064  CB  ASP A 141       9.150   0.449   2.653  1.00  0.69           C  
ATOM   1065  CG  ASP A 141       8.607  -0.974   2.501  1.00  0.69           C  
ATOM   1066  OD1 ASP A 141       8.990  -1.880   3.297  1.00  0.69           O  
ATOM   1067  OD2 ASP A 141       7.799  -1.217   1.561  1.00  0.69           O  
ATOM   1068  N   ALA A 142      11.704   2.233   3.824  1.00  0.73           N  
ATOM   1069  CA  ALA A 142      12.524   3.375   4.221  1.00  0.73           C  
ATOM   1070  C   ALA A 142      12.138   4.694   3.568  1.00  0.73           C  
ATOM   1071  O   ALA A 142      12.433   5.769   4.094  1.00  0.73           O  
ATOM   1072  CB  ALA A 142      14.013   3.100   3.940  1.00  0.73           C  
ATOM   1073  N   ASP A 143      11.419   4.627   2.441  1.00  0.62           N  
ATOM   1074  CA  ASP A 143      10.916   5.746   1.695  1.00  0.62           C  
ATOM   1075  C   ASP A 143       9.464   6.070   2.047  1.00  0.62           C  
ATOM   1076  O   ASP A 143       8.838   6.957   1.459  1.00  0.62           O  
ATOM   1077  CB  ASP A 143      11.138   5.478   0.182  1.00  0.62           C  
ATOM   1078  CG  ASP A 143      10.584   4.166  -0.364  1.00  0.62           C  
ATOM   1079  OD1 ASP A 143      10.361   3.197   0.406  1.00  0.62           O  
ATOM   1080  OD2 ASP A 143      10.385   4.130  -1.610  1.00  0.62           O  
ATOM   1081  N   GLU A 144       8.921   5.404   3.084  1.00  0.63           N  
ATOM   1082  CA  GLU A 144       7.609   5.686   3.622  1.00  0.63           C  
ATOM   1083  C   GLU A 144       7.640   6.573   4.852  1.00  0.63           C  
ATOM   1084  O   GLU A 144       8.390   6.371   5.803  1.00  0.63           O  
ATOM   1085  CB  GLU A 144       6.880   4.391   4.007  1.00  0.63           C  
ATOM   1086  CG  GLU A 144       6.539   3.539   2.774  1.00  0.63           C  
ATOM   1087  CD  GLU A 144       5.951   2.198   3.149  1.00  0.63           C  
ATOM   1088  OE1 GLU A 144       5.447   1.521   2.217  1.00  0.63           O  
ATOM   1089  OE2 GLU A 144       5.997   1.777   4.340  1.00  0.63           O  
ATOM   1090  N   THR A 145       6.766   7.592   4.879  1.00  0.63           N  
ATOM   1091  CA  THR A 145       6.664   8.519   6.003  1.00  0.63           C  
ATOM   1092  C   THR A 145       5.248   8.484   6.540  1.00  0.63           C  
ATOM   1093  O   THR A 145       4.295   8.667   5.785  1.00  0.63           O  
ATOM   1094  CB  THR A 145       6.985   9.959   5.603  1.00  0.63           C  
ATOM   1095  OG1 THR A 145       8.296  10.040   5.064  1.00  0.63           O  
ATOM   1096  CG2 THR A 145       6.988  10.904   6.809  1.00  0.63           C  
ATOM   1097  N   LEU A 146       5.041   8.253   7.862  1.00  0.60           N  
ATOM   1098  CA  LEU A 146       3.723   8.343   8.492  1.00  0.60           C  
ATOM   1099  C   LEU A 146       3.114   9.734   8.343  1.00  0.60           C  
ATOM   1100  O   LEU A 146       3.780  10.747   8.559  1.00  0.60           O  
ATOM   1101  CB  LEU A 146       3.798   7.965  10.000  1.00  0.60           C  
ATOM   1102  CG  LEU A 146       2.447   7.880  10.747  1.00  0.60           C  
ATOM   1103  CD1 LEU A 146       1.591   6.712  10.250  1.00  0.60           C  
ATOM   1104  CD2 LEU A 146       2.658   7.735  12.261  1.00  0.60           C  
ATOM   1105  N   SER A 147       1.835   9.836   7.921  1.00  0.60           N  
ATOM   1106  CA  SER A 147       1.196  11.130   7.734  1.00  0.60           C  
ATOM   1107  C   SER A 147       1.002  11.914   9.017  1.00  0.60           C  
ATOM   1108  O   SER A 147       0.851  11.354  10.102  1.00  0.60           O  
ATOM   1109  CB  SER A 147      -0.121  11.103   6.909  1.00  0.60           C  
ATOM   1110  OG  SER A 147      -1.268  10.669   7.649  1.00  0.60           O  
ATOM   1111  N   ALA A 148       0.996  13.259   8.931  1.00  0.52           N  
ATOM   1112  CA  ALA A 148       0.822  14.126  10.079  1.00  0.52           C  
ATOM   1113  C   ALA A 148      -0.527  13.931  10.763  1.00  0.52           C  
ATOM   1114  O   ALA A 148      -0.632  13.921  11.988  1.00  0.52           O  
ATOM   1115  CB  ALA A 148       1.015  15.592   9.647  1.00  0.52           C  
ATOM   1116  N   GLU A 149      -1.575  13.687   9.957  1.00  0.32           N  
ATOM   1117  CA  GLU A 149      -2.920  13.351  10.358  1.00  0.32           C  
ATOM   1118  C   GLU A 149      -2.988  12.004  11.061  1.00  0.32           C  
ATOM   1119  O   GLU A 149      -3.892  11.739  11.853  1.00  0.32           O  
ATOM   1120  CB  GLU A 149      -3.848  13.307   9.109  1.00  0.32           C  
ATOM   1121  CG  GLU A 149      -3.822  14.590   8.229  1.00  0.32           C  
ATOM   1122  CD  GLU A 149      -2.627  14.704   7.277  1.00  0.32           C  
ATOM   1123  OE1 GLU A 149      -2.537  15.743   6.584  1.00  0.32           O  
ATOM   1124  OE2 GLU A 149      -1.784  13.766   7.246  1.00  0.32           O  
ATOM   1125  N   SER A 150      -2.007  11.116  10.797  1.00  0.57           N  
ATOM   1126  CA  SER A 150      -1.981   9.776  11.356  1.00  0.57           C  
ATOM   1127  C   SER A 150      -1.138   9.650  12.591  1.00  0.57           C  
ATOM   1128  O   SER A 150      -1.035   8.567  13.162  1.00  0.57           O  
ATOM   1129  CB  SER A 150      -1.488   8.711  10.369  1.00  0.57           C  
ATOM   1130  OG  SER A 150      -2.370   8.658   9.254  1.00  0.57           O  
ATOM   1131  N   ARG A 151      -0.556  10.762  13.063  1.00  0.31           N  
ATOM   1132  CA  ARG A 151       0.220  10.815  14.283  1.00  0.31           C  
ATOM   1133  C   ARG A 151      -0.566  10.383  15.522  1.00  0.31           C  
ATOM   1134  O   ARG A 151      -1.599  10.956  15.870  1.00  0.31           O  
ATOM   1135  CB  ARG A 151       0.746  12.254  14.483  1.00  0.31           C  
ATOM   1136  CG  ARG A 151       1.691  12.416  15.686  1.00  0.31           C  
ATOM   1137  CD  ARG A 151       2.102  13.864  15.959  1.00  0.31           C  
ATOM   1138  NE  ARG A 151       2.951  14.294  14.808  1.00  0.31           N  
ATOM   1139  CZ  ARG A 151       3.509  15.505  14.708  1.00  0.31           C  
ATOM   1140  NH1 ARG A 151       3.285  16.448  15.616  1.00  0.31           N  
ATOM   1141  NH2 ARG A 151       4.294  15.776  13.669  1.00  0.31           N  
ATOM   1142  N   GLY A 152      -0.103   9.318  16.201  1.00  0.58           N  
ATOM   1143  CA  GLY A 152      -0.696   8.752  17.406  1.00  0.58           C  
ATOM   1144  C   GLY A 152      -1.819   7.794  17.124  1.00  0.58           C  
ATOM   1145  O   GLY A 152      -2.298   7.092  18.014  1.00  0.58           O  
ATOM   1146  N   ARG A 153      -2.261   7.708  15.854  1.00  0.48           N  
ATOM   1147  CA  ARG A 153      -3.319   6.813  15.438  1.00  0.48           C  
ATOM   1148  C   ARG A 153      -2.864   5.375  15.383  1.00  0.48           C  
ATOM   1149  O   ARG A 153      -3.631   4.464  15.693  1.00  0.48           O  
ATOM   1150  CB  ARG A 153      -3.897   7.165  14.047  1.00  0.48           C  
ATOM   1151  CG  ARG A 153      -4.688   8.484  13.996  1.00  0.48           C  
ATOM   1152  CD  ARG A 153      -5.416   8.636  12.655  1.00  0.48           C  
ATOM   1153  NE  ARG A 153      -6.211   9.896  12.696  1.00  0.48           N  
ATOM   1154  CZ  ARG A 153      -6.978  10.295  11.671  1.00  0.48           C  
ATOM   1155  NH1 ARG A 153      -7.118   9.559  10.573  1.00  0.48           N  
ATOM   1156  NH2 ARG A 153      -7.617  11.459  11.766  1.00  0.48           N  
ATOM   1157  N   LEU A 154      -1.601   5.126  14.974  1.00  0.57           N  
ATOM   1158  CA  LEU A 154      -1.068   3.783  14.882  1.00  0.57           C  
ATOM   1159  C   LEU A 154      -0.983   3.134  16.247  1.00  0.57           C  
ATOM   1160  O   LEU A 154      -1.458   2.020  16.452  1.00  0.57           O  
ATOM   1161  CB  LEU A 154       0.324   3.781  14.200  1.00  0.57           C  
ATOM   1162  CG  LEU A 154       1.020   2.407  14.148  1.00  0.57           C  
ATOM   1163  CD1 LEU A 154       0.197   1.397  13.346  1.00  0.57           C  
ATOM   1164  CD2 LEU A 154       2.440   2.524  13.574  1.00  0.57           C  
ATOM   1165  N   ARG A 155      -0.456   3.860  17.246  1.00  0.53           N  
ATOM   1166  CA  ARG A 155      -0.447   3.394  18.616  1.00  0.53           C  
ATOM   1167  C   ARG A 155      -1.838   3.180  19.184  1.00  0.53           C  
ATOM   1168  O   ARG A 155      -2.119   2.147  19.786  1.00  0.53           O  
ATOM   1169  CB  ARG A 155       0.324   4.399  19.498  1.00  0.53           C  
ATOM   1170  CG  ARG A 155       0.329   4.038  21.000  1.00  0.53           C  
ATOM   1171  CD  ARG A 155       1.275   4.890  21.846  1.00  0.53           C  
ATOM   1172  NE  ARG A 155       2.656   4.604  21.368  1.00  0.53           N  
ATOM   1173  CZ  ARG A 155       3.500   3.707  21.885  1.00  0.53           C  
ATOM   1174  NH1 ARG A 155       3.226   2.937  22.928  1.00  0.53           N  
ATOM   1175  NH2 ARG A 155       4.682   3.563  21.312  1.00  0.53           N  
ATOM   1176  N   ALA A 156      -2.763   4.132  18.963  1.00  0.56           N  
ATOM   1177  CA  ALA A 156      -4.115   4.045  19.466  1.00  0.56           C  
ATOM   1178  C   ALA A 156      -4.901   2.841  18.958  1.00  0.56           C  
ATOM   1179  O   ALA A 156      -5.511   2.099  19.730  1.00  0.56           O  
ATOM   1180  CB  ALA A 156      -4.843   5.342  19.075  1.00  0.56           C  
ATOM   1181  N   VAL A 157      -4.854   2.570  17.636  1.00  0.55           N  
ATOM   1182  CA  VAL A 157      -5.547   1.429  17.065  1.00  0.55           C  
ATOM   1183  C   VAL A 157      -4.984   0.089  17.517  1.00  0.55           C  
ATOM   1184  O   VAL A 157      -5.738  -0.826  17.840  1.00  0.55           O  
ATOM   1185  CB  VAL A 157      -5.695   1.528  15.549  1.00  0.55           C  
ATOM   1186  CG1 VAL A 157      -4.374   1.265  14.803  1.00  0.55           C  
ATOM   1187  CG2 VAL A 157      -6.808   0.575  15.075  1.00  0.55           C  
ATOM   1188  N   LEU A 158      -3.643  -0.066  17.613  1.00  0.52           N  
ATOM   1189  CA  LEU A 158      -3.033  -1.293  18.099  1.00  0.52           C  
ATOM   1190  C   LEU A 158      -3.382  -1.593  19.553  1.00  0.52           C  
ATOM   1191  O   LEU A 158      -3.783  -2.706  19.888  1.00  0.52           O  
ATOM   1192  CB  LEU A 158      -1.498  -1.266  17.906  1.00  0.52           C  
ATOM   1193  CG  LEU A 158      -1.032  -1.174  16.435  1.00  0.52           C  
ATOM   1194  CD1 LEU A 158       0.498  -1.066  16.373  1.00  0.52           C  
ATOM   1195  CD2 LEU A 158      -1.513  -2.352  15.577  1.00  0.52           C  
ATOM   1196  N   THR A 159      -3.344  -0.571  20.437  1.00  0.53           N  
ATOM   1197  CA  THR A 159      -3.771  -0.672  21.834  1.00  0.53           C  
ATOM   1198  C   THR A 159      -5.227  -1.060  21.968  1.00  0.53           C  
ATOM   1199  O   THR A 159      -5.607  -1.902  22.783  1.00  0.53           O  
ATOM   1200  CB  THR A 159      -3.598   0.643  22.582  1.00  0.53           C  
ATOM   1201  OG1 THR A 159      -2.258   1.076  22.477  1.00  0.53           O  
ATOM   1202  CG2 THR A 159      -3.865   0.494  24.085  1.00  0.53           C  
ATOM   1203  N   ALA A 160      -6.111  -0.470  21.135  1.00  0.55           N  
ATOM   1204  CA  ALA A 160      -7.505  -0.852  21.083  1.00  0.55           C  
ATOM   1205  C   ALA A 160      -7.723  -2.292  20.635  1.00  0.55           C  
ATOM   1206  O   ALA A 160      -8.493  -3.017  21.261  1.00  0.55           O  
ATOM   1207  CB  ALA A 160      -8.281   0.123  20.182  1.00  0.55           C  
ATOM   1208  N   LEU A 161      -7.007  -2.760  19.589  1.00  0.87           N  
ATOM   1209  CA  LEU A 161      -7.033  -4.139  19.129  1.00  0.87           C  
ATOM   1210  C   LEU A 161      -6.542  -5.143  20.165  1.00  0.87           C  
ATOM   1211  O   LEU A 161      -7.148  -6.198  20.328  1.00  0.87           O  
ATOM   1212  CB  LEU A 161      -6.239  -4.322  17.811  1.00  0.87           C  
ATOM   1213  CG  LEU A 161      -6.866  -3.633  16.576  1.00  0.87           C  
ATOM   1214  CD1 LEU A 161      -5.908  -3.713  15.379  1.00  0.87           C  
ATOM   1215  CD2 LEU A 161      -8.231  -4.225  16.191  1.00  0.87           C  
ATOM   1216  N   ASP A 162      -5.472  -4.835  20.928  1.00  0.87           N  
ATOM   1217  CA  ASP A 162      -5.004  -5.650  22.041  1.00  0.87           C  
ATOM   1218  C   ASP A 162      -6.037  -5.821  23.130  1.00  0.87           C  
ATOM   1219  O   ASP A 162      -6.244  -6.913  23.651  1.00  0.87           O  
ATOM   1220  CB  ASP A 162      -3.742  -4.998  22.668  1.00  0.87           C  
ATOM   1221  CG  ASP A 162      -2.544  -5.270  21.800  1.00  0.87           C  
ATOM   1222  OD1 ASP A 162      -2.661  -6.158  20.917  1.00  0.87           O  
ATOM   1223  OD2 ASP A 162      -1.479  -4.646  22.003  1.00  0.87           O  
ATOM   1224  N   HIS A 163      -6.733  -4.730  23.473  1.00  0.85           N  
ATOM   1225  CA  HIS A 163      -7.806  -4.756  24.440  1.00  0.85           C  
ATOM   1226  C   HIS A 163      -9.021  -5.582  24.022  1.00  0.85           C  
ATOM   1227  O   HIS A 163      -9.552  -6.378  24.793  1.00  0.85           O  
ATOM   1228  CB  HIS A 163      -8.236  -3.302  24.708  1.00  0.85           C  
ATOM   1229  CG  HIS A 163      -9.230  -3.152  25.806  1.00  0.85           C  
ATOM   1230  ND1 HIS A 163      -8.854  -3.459  27.095  1.00  0.85           N  
ATOM   1231  CD2 HIS A 163     -10.510  -2.702  25.778  1.00  0.85           C  
ATOM   1232  CE1 HIS A 163      -9.914  -3.200  27.832  1.00  0.85           C  
ATOM   1233  NE2 HIS A 163     -10.941  -2.735  27.083  1.00  0.85           N  
ATOM   1234  N   VAL A 164      -9.503  -5.435  22.770  1.00  0.88           N  
ATOM   1235  CA  VAL A 164     -10.729  -6.110  22.360  1.00  0.88           C  
ATOM   1236  C   VAL A 164     -10.495  -7.496  21.787  1.00  0.88           C  
ATOM   1237  O   VAL A 164     -11.381  -8.345  21.841  1.00  0.88           O  
ATOM   1238  CB  VAL A 164     -11.563  -5.282  21.384  1.00  0.88           C  
ATOM   1239  CG1 VAL A 164     -11.941  -3.947  22.058  1.00  0.88           C  
ATOM   1240  CG2 VAL A 164     -10.814  -5.032  20.063  1.00  0.88           C  
ATOM   1241  N   LEU A 165      -9.284  -7.796  21.279  1.00  0.85           N  
ATOM   1242  CA  LEU A 165      -8.958  -9.094  20.710  1.00  0.85           C  
ATOM   1243  C   LEU A 165      -7.638  -9.614  21.278  1.00  0.85           C  
ATOM   1244  O   LEU A 165      -6.691  -9.856  20.515  1.00  0.85           O  
ATOM   1245  CB  LEU A 165      -8.843  -9.006  19.163  1.00  0.85           C  
ATOM   1246  CG  LEU A 165     -10.167  -8.740  18.420  1.00  0.85           C  
ATOM   1247  CD1 LEU A 165      -9.884  -8.404  16.950  1.00  0.85           C  
ATOM   1248  CD2 LEU A 165     -11.141  -9.922  18.510  1.00  0.85           C  
ATOM   1249  N   PRO A 166      -7.493  -9.784  22.599  1.00  0.87           N  
ATOM   1250  CA  PRO A 166      -6.252 -10.257  23.201  1.00  0.87           C  
ATOM   1251  C   PRO A 166      -5.818 -11.623  22.687  1.00  0.87           C  
ATOM   1252  O   PRO A 166      -6.575 -12.586  22.762  1.00  0.87           O  
ATOM   1253  CB  PRO A 166      -6.554 -10.259  24.708  1.00  0.87           C  
ATOM   1254  CG  PRO A 166      -8.049 -10.571  24.783  1.00  0.87           C  
ATOM   1255  CD  PRO A 166      -8.606  -9.838  23.561  1.00  0.87           C  
ATOM   1256  N   GLY A 167      -4.590 -11.743  22.145  1.00  0.86           N  
ATOM   1257  CA  GLY A 167      -4.064 -13.031  21.700  1.00  0.86           C  
ATOM   1258  C   GLY A 167      -4.568 -13.514  20.368  1.00  0.86           C  
ATOM   1259  O   GLY A 167      -4.172 -14.578  19.908  1.00  0.86           O  
ATOM   1260  N   ALA A 168      -5.438 -12.752  19.675  1.00  0.87           N  
ATOM   1261  CA  ALA A 168      -5.787 -13.076  18.308  1.00  0.87           C  
ATOM   1262  C   ALA A 168      -4.591 -12.910  17.369  1.00  0.87           C  
ATOM   1263  O   ALA A 168      -3.915 -11.875  17.394  1.00  0.87           O  
ATOM   1264  CB  ALA A 168      -6.978 -12.221  17.828  1.00  0.87           C  
ATOM   1265  N   ASP A 169      -4.308 -13.928  16.520  1.00  0.80           N  
ATOM   1266  CA  ASP A 169      -3.269 -13.845  15.515  1.00  0.80           C  
ATOM   1267  C   ASP A 169      -3.870 -13.147  14.301  1.00  0.80           C  
ATOM   1268  O   ASP A 169      -4.718 -13.674  13.581  1.00  0.80           O  
ATOM   1269  CB  ASP A 169      -2.681 -15.250  15.185  1.00  0.80           C  
ATOM   1270  CG  ASP A 169      -1.241 -15.196  14.692  1.00  0.80           C  
ATOM   1271  OD1 ASP A 169      -0.628 -14.096  14.709  1.00  0.80           O  
ATOM   1272  OD2 ASP A 169      -0.712 -16.274  14.327  1.00  0.80           O  
ATOM   1273  N   LEU A 170      -3.485 -11.880  14.109  1.00  0.85           N  
ATOM   1274  CA  LEU A 170      -4.055 -11.028  13.101  1.00  0.85           C  
ATOM   1275  C   LEU A 170      -2.954 -10.161  12.567  1.00  0.85           C  
ATOM   1276  O   LEU A 170      -1.936  -9.929  13.222  1.00  0.85           O  
ATOM   1277  CB  LEU A 170      -5.239 -10.160  13.632  1.00  0.85           C  
ATOM   1278  CG  LEU A 170      -4.913  -9.070  14.686  1.00  0.85           C  
ATOM   1279  CD1 LEU A 170      -4.498  -7.738  14.041  1.00  0.85           C  
ATOM   1280  CD2 LEU A 170      -6.125  -8.801  15.592  1.00  0.85           C  
ATOM   1281  N   VAL A 171      -3.152  -9.636  11.352  1.00  0.86           N  
ATOM   1282  CA  VAL A 171      -2.248  -8.663  10.779  1.00  0.86           C  
ATOM   1283  C   VAL A 171      -2.985  -7.365  10.574  1.00  0.86           C  
ATOM   1284  O   VAL A 171      -4.165  -7.322  10.230  1.00  0.86           O  
ATOM   1285  CB  VAL A 171      -1.591  -9.116   9.484  1.00  0.86           C  
ATOM   1286  CG1 VAL A 171      -0.653 -10.287   9.815  1.00  0.86           C  
ATOM   1287  CG2 VAL A 171      -2.645  -9.527   8.439  1.00  0.86           C  
ATOM   1288  N   VAL A 172      -2.302  -6.240  10.816  1.00  0.87           N  
ATOM   1289  CA  VAL A 172      -2.894  -4.929  10.655  1.00  0.87           C  
ATOM   1290  C   VAL A 172      -2.343  -4.314   9.391  1.00  0.87           C  
ATOM   1291  O   VAL A 172      -1.140  -4.342   9.116  1.00  0.87           O  
ATOM   1292  CB  VAL A 172      -2.696  -4.011  11.855  1.00  0.87           C  
ATOM   1293  CG1 VAL A 172      -3.382  -2.654  11.631  1.00  0.87           C  
ATOM   1294  CG2 VAL A 172      -3.272  -4.687  13.106  1.00  0.87           C  
ATOM   1295  N   SER A 173      -3.246  -3.761   8.569  1.00  0.86           N  
ATOM   1296  CA  SER A 173      -2.911  -3.157   7.298  1.00  0.86           C  
ATOM   1297  C   SER A 173      -3.148  -1.662   7.348  1.00  0.86           C  
ATOM   1298  O   SER A 173      -4.295  -1.215   7.261  1.00  0.86           O  
ATOM   1299  CB  SER A 173      -3.793  -3.704   6.150  1.00  0.86           C  
ATOM   1300  OG  SER A 173      -3.542  -5.091   5.915  1.00  0.86           O  
ATOM   1301  N   PRO A 174      -2.121  -0.826   7.472  1.00  0.86           N  
ATOM   1302  CA  PRO A 174      -2.221   0.590   7.165  1.00  0.86           C  
ATOM   1303  C   PRO A 174      -2.379   0.862   5.693  1.00  0.86           C  
ATOM   1304  O   PRO A 174      -2.091   0.001   4.861  1.00  0.86           O  
ATOM   1305  CB  PRO A 174      -0.897   1.199   7.656  1.00  0.86           C  
ATOM   1306  CG  PRO A 174      -0.329   0.169   8.627  1.00  0.86           C  
ATOM   1307  CD  PRO A 174      -0.832  -1.161   8.073  1.00  0.86           C  
ATOM   1308  N   ARG A 175      -2.791   2.092   5.374  1.00  0.77           N  
ATOM   1309  CA  ARG A 175      -2.926   2.587   4.032  1.00  0.77           C  
ATOM   1310  C   ARG A 175      -1.629   3.215   3.566  1.00  0.77           C  
ATOM   1311  O   ARG A 175      -0.995   3.985   4.283  1.00  0.77           O  
ATOM   1312  CB  ARG A 175      -4.031   3.668   3.979  1.00  0.77           C  
ATOM   1313  CG  ARG A 175      -5.416   3.131   4.396  1.00  0.77           C  
ATOM   1314  CD  ARG A 175      -6.500   4.202   4.574  1.00  0.77           C  
ATOM   1315  NE  ARG A 175      -6.682   4.880   3.256  1.00  0.77           N  
ATOM   1316  CZ  ARG A 175      -7.259   6.082   3.117  1.00  0.77           C  
ATOM   1317  NH1 ARG A 175      -7.744   6.767   4.151  1.00  0.77           N  
ATOM   1318  NH2 ARG A 175      -7.354   6.604   1.891  1.00  0.77           N  
ATOM   1319  N   ILE A 176      -1.207   2.912   2.331  1.00  0.80           N  
ATOM   1320  CA  ILE A 176      -0.022   3.516   1.745  1.00  0.80           C  
ATOM   1321  C   ILE A 176      -0.470   4.311   0.547  1.00  0.80           C  
ATOM   1322  O   ILE A 176      -1.017   3.766  -0.409  1.00  0.80           O  
ATOM   1323  CB  ILE A 176       1.032   2.496   1.336  1.00  0.80           C  
ATOM   1324  CG1 ILE A 176       1.494   1.689   2.568  1.00  0.80           C  
ATOM   1325  CG2 ILE A 176       2.240   3.200   0.675  1.00  0.80           C  
ATOM   1326  CD1 ILE A 176       2.304   0.447   2.190  1.00  0.80           C  
ATOM   1327  N   LEU A 177      -0.253   5.636   0.589  1.00  0.74           N  
ATOM   1328  CA  LEU A 177      -0.521   6.535  -0.511  1.00  0.74           C  
ATOM   1329  C   LEU A 177       0.767   6.761  -1.256  1.00  0.74           C  
ATOM   1330  O   LEU A 177       1.773   7.140  -0.662  1.00  0.74           O  
ATOM   1331  CB  LEU A 177      -1.025   7.916  -0.018  1.00  0.74           C  
ATOM   1332  CG  LEU A 177      -2.494   7.926   0.441  1.00  0.74           C  
ATOM   1333  CD1 LEU A 177      -2.806   9.230   1.187  1.00  0.74           C  
ATOM   1334  CD2 LEU A 177      -3.450   7.774  -0.749  1.00  0.74           C  
ATOM   1335  N   ASP A 178       0.790   6.523  -2.575  1.00  0.68           N  
ATOM   1336  CA  ASP A 178       1.967   6.790  -3.367  1.00  0.68           C  
ATOM   1337  C   ASP A 178       1.935   8.169  -4.006  1.00  0.68           C  
ATOM   1338  O   ASP A 178       1.065   9.005  -3.760  1.00  0.68           O  
ATOM   1339  CB  ASP A 178       2.258   5.628  -4.355  1.00  0.68           C  
ATOM   1340  CG  ASP A 178       1.329   5.550  -5.554  1.00  0.68           C  
ATOM   1341  OD1 ASP A 178       0.515   6.479  -5.776  1.00  0.68           O  
ATOM   1342  OD2 ASP A 178       1.503   4.580  -6.324  1.00  0.68           O  
ATOM   1343  N   THR A 179       2.920   8.439  -4.875  1.00  0.60           N  
ATOM   1344  CA  THR A 179       3.036   9.704  -5.572  1.00  0.60           C  
ATOM   1345  C   THR A 179       2.047   9.867  -6.707  1.00  0.60           C  
ATOM   1346  O   THR A 179       1.848  10.988  -7.168  1.00  0.60           O  
ATOM   1347  CB  THR A 179       4.430   9.936  -6.136  1.00  0.60           C  
ATOM   1348  OG1 THR A 179       4.875   8.826  -6.905  1.00  0.60           O  
ATOM   1349  CG2 THR A 179       5.411  10.085  -4.970  1.00  0.60           C  
ATOM   1350  N   SER A 180       1.376   8.785  -7.168  1.00  0.57           N  
ATOM   1351  CA  SER A 180       0.376   8.872  -8.232  1.00  0.57           C  
ATOM   1352  C   SER A 180      -1.017   9.021  -7.655  1.00  0.57           C  
ATOM   1353  O   SER A 180      -1.970   9.341  -8.362  1.00  0.57           O  
ATOM   1354  CB  SER A 180       0.423   7.658  -9.221  1.00  0.57           C  
ATOM   1355  OG  SER A 180      -0.175   6.442  -8.759  1.00  0.57           O  
ATOM   1356  N   ARG A 181      -1.117   8.832  -6.320  1.00  0.46           N  
ATOM   1357  CA  ARG A 181      -2.286   8.911  -5.461  1.00  0.46           C  
ATOM   1358  C   ARG A 181      -3.014   7.613  -5.403  1.00  0.46           C  
ATOM   1359  O   ARG A 181      -4.154   7.540  -4.939  1.00  0.46           O  
ATOM   1360  CB  ARG A 181      -3.320   9.996  -5.806  1.00  0.46           C  
ATOM   1361  CG  ARG A 181      -2.673  11.364  -5.746  1.00  0.46           C  
ATOM   1362  CD  ARG A 181      -3.663  12.459  -6.015  1.00  0.46           C  
ATOM   1363  NE  ARG A 181      -2.818  13.618  -5.788  1.00  0.46           N  
ATOM   1364  CZ  ARG A 181      -3.260  14.852  -5.868  1.00  0.46           C  
ATOM   1365  NH1 ARG A 181      -4.548  15.176  -5.870  1.00  0.46           N  
ATOM   1366  NH2 ARG A 181      -2.365  15.809  -5.901  1.00  0.46           N  
ATOM   1367  N   GLU A 182      -2.362   6.528  -5.828  1.00  0.54           N  
ATOM   1368  CA  GLU A 182      -2.906   5.224  -5.618  1.00  0.54           C  
ATOM   1369  C   GLU A 182      -2.814   4.856  -4.145  1.00  0.54           C  
ATOM   1370  O   GLU A 182      -1.865   5.202  -3.438  1.00  0.54           O  
ATOM   1371  CB  GLU A 182      -2.254   4.207  -6.562  1.00  0.54           C  
ATOM   1372  CG  GLU A 182      -3.024   2.872  -6.619  1.00  0.54           C  
ATOM   1373  CD  GLU A 182      -2.489   1.911  -7.677  1.00  0.54           C  
ATOM   1374  OE1 GLU A 182      -3.046   0.785  -7.741  1.00  0.54           O  
ATOM   1375  OE2 GLU A 182      -1.550   2.273  -8.426  1.00  0.54           O  
ATOM   1376  N   CYS A 183      -3.860   4.200  -3.613  1.00  0.71           N  
ATOM   1377  CA  CYS A 183      -3.932   3.907  -2.199  1.00  0.71           C  
ATOM   1378  C   CYS A 183      -3.961   2.415  -1.994  1.00  0.71           C  
ATOM   1379  O   CYS A 183      -4.943   1.736  -2.281  1.00  0.71           O  
ATOM   1380  CB  CYS A 183      -5.166   4.565  -1.527  1.00  0.71           C  
ATOM   1381  SG  CYS A 183      -5.159   4.421   0.297  1.00  0.71           S  
ATOM   1382  N   HIS A 184      -2.868   1.879  -1.436  1.00  0.72           N  
ATOM   1383  CA  HIS A 184      -2.733   0.465  -1.165  1.00  0.72           C  
ATOM   1384  C   HIS A 184      -3.250   0.156   0.226  1.00  0.72           C  
ATOM   1385  O   HIS A 184      -2.725   0.671   1.212  1.00  0.72           O  
ATOM   1386  CB  HIS A 184      -1.257   0.033  -1.264  1.00  0.72           C  
ATOM   1387  CG  HIS A 184      -0.686   0.379  -2.602  1.00  0.72           C  
ATOM   1388  ND1 HIS A 184      -0.942  -0.464  -3.662  1.00  0.72           N  
ATOM   1389  CD2 HIS A 184      -0.069   1.512  -3.030  1.00  0.72           C  
ATOM   1390  CE1 HIS A 184      -0.481   0.177  -4.725  1.00  0.72           C  
ATOM   1391  NE2 HIS A 184       0.060   1.377  -4.396  1.00  0.72           N  
ATOM   1392  N   THR A 185      -4.313  -0.667   0.345  1.00  0.80           N  
ATOM   1393  CA  THR A 185      -5.006  -0.881   1.617  1.00  0.80           C  
ATOM   1394  C   THR A 185      -4.750  -2.237   2.248  1.00  0.80           C  
ATOM   1395  O   THR A 185      -4.773  -2.341   3.468  1.00  0.80           O  
ATOM   1396  CB  THR A 185      -6.517  -0.702   1.495  1.00  0.80           C  
ATOM   1397  OG1 THR A 185      -7.052  -1.500   0.447  1.00  0.80           O  
ATOM   1398  CG2 THR A 185      -6.814   0.768   1.143  1.00  0.80           C  
ATOM   1399  N   ASP A 186      -4.416  -3.298   1.476  1.00  0.79           N  
ATOM   1400  CA  ASP A 186      -4.139  -4.630   2.016  1.00  0.79           C  
ATOM   1401  C   ASP A 186      -2.628  -4.843   2.132  1.00  0.79           C  
ATOM   1402  O   ASP A 186      -2.001  -5.665   1.462  1.00  0.79           O  
ATOM   1403  CB  ASP A 186      -4.825  -5.742   1.167  1.00  0.79           C  
ATOM   1404  CG  ASP A 186      -4.731  -7.115   1.823  1.00  0.79           C  
ATOM   1405  OD1 ASP A 186      -4.774  -7.198   3.079  1.00  0.79           O  
ATOM   1406  OD2 ASP A 186      -4.589  -8.141   1.105  1.00  0.79           O  
ATOM   1407  N   THR A 187      -1.983  -4.032   2.984  1.00  0.80           N  
ATOM   1408  CA  THR A 187      -0.538  -4.039   3.158  1.00  0.80           C  
ATOM   1409  C   THR A 187      -0.017  -5.163   4.036  1.00  0.80           C  
ATOM   1410  O   THR A 187       1.038  -5.724   3.745  1.00  0.80           O  
ATOM   1411  CB  THR A 187      -0.008  -2.707   3.664  1.00  0.80           C  
ATOM   1412  OG1 THR A 187      -0.534  -2.377   4.941  1.00  0.80           O  
ATOM   1413  CG2 THR A 187      -0.421  -1.590   2.701  1.00  0.80           C  
ATOM   1414  N   ARG A 188      -0.735  -5.509   5.132  1.00  0.76           N  
ATOM   1415  CA  ARG A 188      -0.429  -6.588   6.065  1.00  0.76           C  
ATOM   1416  C   ARG A 188       0.956  -6.535   6.679  1.00  0.76           C  
ATOM   1417  O   ARG A 188       1.681  -7.526   6.736  1.00  0.76           O  
ATOM   1418  CB  ARG A 188      -0.653  -7.981   5.439  1.00  0.76           C  
ATOM   1419  CG  ARG A 188      -2.065  -8.156   4.869  1.00  0.76           C  
ATOM   1420  CD  ARG A 188      -2.272  -9.536   4.259  1.00  0.76           C  
ATOM   1421  NE  ARG A 188      -3.678  -9.554   3.783  1.00  0.76           N  
ATOM   1422  CZ  ARG A 188      -4.489 -10.615   3.783  1.00  0.76           C  
ATOM   1423  NH1 ARG A 188      -4.204 -11.720   4.459  1.00  0.76           N  
ATOM   1424  NH2 ARG A 188      -5.612 -10.537   3.080  1.00  0.76           N  
ATOM   1425  N   ARG A 189       1.361  -5.351   7.158  1.00  0.77           N  
ATOM   1426  CA  ARG A 189       2.741  -5.119   7.528  1.00  0.77           C  
ATOM   1427  C   ARG A 189       2.943  -5.055   9.019  1.00  0.77           C  
ATOM   1428  O   ARG A 189       4.067  -4.902   9.494  1.00  0.77           O  
ATOM   1429  CB  ARG A 189       3.206  -3.784   6.923  1.00  0.77           C  
ATOM   1430  CG  ARG A 189       3.374  -3.856   5.399  1.00  0.77           C  
ATOM   1431  CD  ARG A 189       3.997  -2.580   4.857  1.00  0.77           C  
ATOM   1432  NE  ARG A 189       4.147  -2.735   3.380  1.00  0.77           N  
ATOM   1433  CZ  ARG A 189       4.911  -1.864   2.709  1.00  0.77           C  
ATOM   1434  NH1 ARG A 189       5.434  -0.818   3.326  1.00  0.77           N  
ATOM   1435  NH2 ARG A 189       5.208  -2.025   1.428  1.00  0.77           N  
ATOM   1436  N   ILE A 190       1.868  -5.173   9.808  1.00  0.84           N  
ATOM   1437  CA  ILE A 190       1.972  -5.058  11.247  1.00  0.84           C  
ATOM   1438  C   ILE A 190       1.463  -6.336  11.862  1.00  0.84           C  
ATOM   1439  O   ILE A 190       0.372  -6.807  11.549  1.00  0.84           O  
ATOM   1440  CB  ILE A 190       1.196  -3.878  11.795  1.00  0.84           C  
ATOM   1441  CG1 ILE A 190       1.573  -2.559  11.090  1.00  0.84           C  
ATOM   1442  CG2 ILE A 190       1.389  -3.780  13.328  1.00  0.84           C  
ATOM   1443  CD1 ILE A 190       0.616  -1.426  11.451  1.00  0.84           C  
ATOM   1444  N   VAL A 191       2.258  -6.935  12.757  1.00  0.87           N  
ATOM   1445  CA  VAL A 191       1.987  -8.249  13.300  1.00  0.87           C  
ATOM   1446  C   VAL A 191       2.460  -8.266  14.733  1.00  0.87           C  
ATOM   1447  O   VAL A 191       3.340  -7.499  15.120  1.00  0.87           O  
ATOM   1448  CB  VAL A 191       2.681  -9.325  12.467  1.00  0.87           C  
ATOM   1449  CG1 VAL A 191       4.211  -9.123  12.459  1.00  0.87           C  
ATOM   1450  CG2 VAL A 191       2.310 -10.747  12.928  1.00  0.87           C  
ATOM   1451  N   ARG A 192       1.862  -9.112  15.594  1.00  0.80           N  
ATOM   1452  CA  ARG A 192       2.359  -9.328  16.938  1.00  0.80           C  
ATOM   1453  C   ARG A 192       3.766  -9.915  16.951  1.00  0.80           C  
ATOM   1454  O   ARG A 192       4.150 -10.698  16.084  1.00  0.80           O  
ATOM   1455  CB  ARG A 192       1.441 -10.258  17.756  1.00  0.80           C  
ATOM   1456  CG  ARG A 192       0.011  -9.737  17.956  1.00  0.80           C  
ATOM   1457  CD  ARG A 192      -0.809 -10.669  18.866  1.00  0.80           C  
ATOM   1458  NE  ARG A 192      -2.178 -10.085  19.030  1.00  0.80           N  
ATOM   1459  CZ  ARG A 192      -2.408  -8.997  19.771  1.00  0.80           C  
ATOM   1460  NH1 ARG A 192      -1.457  -8.419  20.498  1.00  0.80           N  
ATOM   1461  NH2 ARG A 192      -3.608  -8.428  19.793  1.00  0.80           N  
ATOM   1462  N   SER A 193       4.586  -9.540  17.943  1.00  0.82           N  
ATOM   1463  CA  SER A 193       5.965  -9.985  18.045  1.00  0.82           C  
ATOM   1464  C   SER A 193       6.146 -11.452  18.369  1.00  0.82           C  
ATOM   1465  O   SER A 193       7.143 -12.063  17.991  1.00  0.82           O  
ATOM   1466  CB  SER A 193       6.731  -9.187  19.119  1.00  0.82           C  
ATOM   1467  OG  SER A 193       6.073  -9.198  20.385  1.00  0.82           O  
ATOM   1468  N   ASP A 194       5.170 -12.050  19.062  1.00  0.74           N  
ATOM   1469  CA  ASP A 194       5.178 -13.415  19.522  1.00  0.74           C  
ATOM   1470  C   ASP A 194       4.458 -14.333  18.551  1.00  0.74           C  
ATOM   1471  O   ASP A 194       4.393 -15.548  18.734  1.00  0.74           O  
ATOM   1472  CB  ASP A 194       4.520 -13.472  20.931  1.00  0.74           C  
ATOM   1473  CG  ASP A 194       3.184 -12.740  21.075  1.00  0.74           C  
ATOM   1474  OD1 ASP A 194       2.675 -12.147  20.090  1.00  0.74           O  
ATOM   1475  OD2 ASP A 194       2.681 -12.725  22.225  1.00  0.74           O  
ATOM   1476  N   SER A 195       3.941 -13.764  17.449  1.00  0.75           N  
ATOM   1477  CA  SER A 195       3.271 -14.508  16.401  1.00  0.75           C  
ATOM   1478  C   SER A 195       4.151 -15.537  15.698  1.00  0.75           C  
ATOM   1479  O   SER A 195       5.358 -15.369  15.494  1.00  0.75           O  
ATOM   1480  CB  SER A 195       2.653 -13.583  15.326  1.00  0.75           C  
ATOM   1481  OG  SER A 195       1.932 -14.319  14.338  1.00  0.75           O  
ATOM   1482  N   ALA A 196       3.529 -16.647  15.261  1.00  0.70           N  
ATOM   1483  CA  ALA A 196       4.199 -17.694  14.529  1.00  0.70           C  
ATOM   1484  C   ALA A 196       4.253 -17.400  13.039  1.00  0.70           C  
ATOM   1485  O   ALA A 196       4.973 -18.060  12.291  1.00  0.70           O  
ATOM   1486  CB  ALA A 196       3.470 -19.025  14.775  1.00  0.70           C  
ATOM   1487  N   LEU A 197       3.526 -16.362  12.584  1.00  0.73           N  
ATOM   1488  CA  LEU A 197       3.557 -15.890  11.217  1.00  0.73           C  
ATOM   1489  C   LEU A 197       4.927 -15.423  10.756  1.00  0.73           C  
ATOM   1490  O   LEU A 197       5.692 -14.796  11.490  1.00  0.73           O  
ATOM   1491  CB  LEU A 197       2.599 -14.700  11.014  1.00  0.73           C  
ATOM   1492  CG  LEU A 197       1.119 -14.989  11.315  1.00  0.73           C  
ATOM   1493  CD1 LEU A 197       0.355 -13.663  11.380  1.00  0.73           C  
ATOM   1494  CD2 LEU A 197       0.486 -15.940  10.296  1.00  0.73           C  
ATOM   1495  N   ARG A 198       5.280 -15.702   9.498  1.00  0.69           N  
ATOM   1496  CA  ARG A 198       6.567 -15.324   8.964  1.00  0.69           C  
ATOM   1497  C   ARG A 198       6.370 -14.879   7.544  1.00  0.69           C  
ATOM   1498  O   ARG A 198       5.451 -15.311   6.850  1.00  0.69           O  
ATOM   1499  CB  ARG A 198       7.590 -16.494   9.000  1.00  0.69           C  
ATOM   1500  CG  ARG A 198       8.081 -16.866  10.417  1.00  0.69           C  
ATOM   1501  CD  ARG A 198       8.850 -15.738  11.124  1.00  0.69           C  
ATOM   1502  NE  ARG A 198       9.247 -16.224  12.490  1.00  0.69           N  
ATOM   1503  CZ  ARG A 198       8.492 -16.060  13.588  1.00  0.69           C  
ATOM   1504  NH1 ARG A 198       7.288 -15.509  13.551  1.00  0.69           N  
ATOM   1505  NH2 ARG A 198       8.959 -16.455  14.771  1.00  0.69           N  
ATOM   1506  N   PHE A 199       7.225 -13.951   7.078  1.00  0.76           N  
ATOM   1507  CA  PHE A 199       7.237 -13.537   5.694  1.00  0.76           C  
ATOM   1508  C   PHE A 199       7.671 -14.682   4.789  1.00  0.76           C  
ATOM   1509  O   PHE A 199       8.632 -15.391   5.086  1.00  0.76           O  
ATOM   1510  CB  PHE A 199       8.130 -12.292   5.460  1.00  0.76           C  
ATOM   1511  CG  PHE A 199       7.467 -11.066   6.026  1.00  0.76           C  
ATOM   1512  CD1 PHE A 199       6.595 -10.303   5.229  1.00  0.76           C  
ATOM   1513  CD2 PHE A 199       7.706 -10.659   7.348  1.00  0.76           C  
ATOM   1514  CE1 PHE A 199       5.977  -9.154   5.740  1.00  0.76           C  
ATOM   1515  CE2 PHE A 199       7.093  -9.510   7.862  1.00  0.76           C  
ATOM   1516  CZ  PHE A 199       6.228  -8.756   7.059  1.00  0.76           C  
ATOM   1517  N   ARG A 200       6.958 -14.899   3.670  1.00  0.74           N  
ATOM   1518  CA  ARG A 200       7.268 -15.983   2.759  1.00  0.74           C  
ATOM   1519  C   ARG A 200       7.251 -15.512   1.316  1.00  0.74           C  
ATOM   1520  O   ARG A 200       6.332 -14.827   0.862  1.00  0.74           O  
ATOM   1521  CB  ARG A 200       6.299 -17.173   2.950  1.00  0.74           C  
ATOM   1522  CG  ARG A 200       6.709 -18.454   2.200  1.00  0.74           C  
ATOM   1523  CD  ARG A 200       5.746 -19.618   2.447  1.00  0.74           C  
ATOM   1524  NE  ARG A 200       6.218 -20.761   1.600  1.00  0.74           N  
ATOM   1525  CZ  ARG A 200       5.620 -21.959   1.557  1.00  0.74           C  
ATOM   1526  NH1 ARG A 200       4.635 -22.273   2.397  1.00  0.74           N  
ATOM   1527  NH2 ARG A 200       6.012 -22.841   0.639  1.00  0.74           N  
ATOM   1528  N   GLY A 201       8.305 -15.894   0.566  1.00  0.86           N  
ATOM   1529  CA  GLY A 201       8.583 -15.445  -0.787  1.00  0.86           C  
ATOM   1530  C   GLY A 201       9.766 -14.536  -0.794  1.00  0.86           C  
ATOM   1531  O   GLY A 201       9.786 -13.527  -0.109  1.00  0.86           O  
ATOM   1532  N   ARG A 202      10.796 -14.842  -1.604  1.00  0.80           N  
ATOM   1533  CA  ARG A 202      11.999 -14.023  -1.673  1.00  0.80           C  
ATOM   1534  C   ARG A 202      11.746 -12.624  -2.215  1.00  0.80           C  
ATOM   1535  O   ARG A 202      12.493 -11.692  -1.933  1.00  0.80           O  
ATOM   1536  CB  ARG A 202      13.047 -14.652  -2.613  1.00  0.80           C  
ATOM   1537  CG  ARG A 202      13.604 -16.008  -2.158  1.00  0.80           C  
ATOM   1538  CD  ARG A 202      14.604 -16.531  -3.195  1.00  0.80           C  
ATOM   1539  NE  ARG A 202      15.255 -17.762  -2.675  1.00  0.80           N  
ATOM   1540  CZ  ARG A 202      16.207 -17.800  -1.739  1.00  0.80           C  
ATOM   1541  NH1 ARG A 202      16.780 -16.712  -1.244  1.00  0.80           N  
ATOM   1542  NH2 ARG A 202      16.598 -19.000  -1.324  1.00  0.80           N  
ATOM   1543  N   LEU A 203      10.683 -12.491  -3.025  1.00  0.84           N  
ATOM   1544  CA  LEU A 203      10.216 -11.271  -3.631  1.00  0.84           C  
ATOM   1545  C   LEU A 203       8.700 -11.320  -3.577  1.00  0.84           C  
ATOM   1546  O   LEU A 203       8.111 -12.386  -3.744  1.00  0.84           O  
ATOM   1547  CB  LEU A 203      10.668 -11.222  -5.113  1.00  0.84           C  
ATOM   1548  CG  LEU A 203      10.279  -9.940  -5.872  1.00  0.84           C  
ATOM   1549  CD1 LEU A 203      11.033  -8.709  -5.363  1.00  0.84           C  
ATOM   1550  CD2 LEU A 203      10.496 -10.108  -7.381  1.00  0.84           C  
ATOM   1551  N   HIS A 204       8.020 -10.187  -3.307  1.00  0.79           N  
ATOM   1552  CA  HIS A 204       6.572 -10.128  -3.118  1.00  0.79           C  
ATOM   1553  C   HIS A 204       6.139 -10.955  -1.919  1.00  0.79           C  
ATOM   1554  O   HIS A 204       5.243 -11.810  -1.979  1.00  0.79           O  
ATOM   1555  CB  HIS A 204       5.749 -10.499  -4.375  1.00  0.79           C  
ATOM   1556  CG  HIS A 204       6.218  -9.770  -5.587  1.00  0.79           C  
ATOM   1557  ND1 HIS A 204       6.046  -8.403  -5.678  1.00  0.79           N  
ATOM   1558  CD2 HIS A 204       6.953 -10.224  -6.633  1.00  0.79           C  
ATOM   1559  CE1 HIS A 204       6.696  -8.050  -6.766  1.00  0.79           C  
ATOM   1560  NE2 HIS A 204       7.257  -9.115  -7.390  1.00  0.79           N  
ATOM   1561  N   GLU A 205       6.861 -10.729  -0.811  1.00  0.77           N  
ATOM   1562  CA  GLU A 205       6.716 -11.371   0.460  1.00  0.77           C  
ATOM   1563  C   GLU A 205       5.498 -10.887   1.224  1.00  0.77           C  
ATOM   1564  O   GLU A 205       5.108  -9.721   1.204  1.00  0.77           O  
ATOM   1565  CB  GLU A 205       8.020 -11.225   1.292  1.00  0.77           C  
ATOM   1566  CG  GLU A 205       8.358  -9.821   1.869  1.00  0.77           C  
ATOM   1567  CD  GLU A 205       8.748  -8.718   0.877  1.00  0.77           C  
ATOM   1568  OE1 GLU A 205       8.970  -7.582   1.385  1.00  0.77           O  
ATOM   1569  OE2 GLU A 205       8.846  -8.972  -0.351  1.00  0.77           O  
ATOM   1570  N   ARG A 206       4.835 -11.808   1.935  1.00  0.71           N  
ATOM   1571  CA  ARG A 206       3.714 -11.480   2.788  1.00  0.71           C  
ATOM   1572  C   ARG A 206       3.790 -12.411   3.967  1.00  0.71           C  
ATOM   1573  O   ARG A 206       4.466 -13.433   3.900  1.00  0.71           O  
ATOM   1574  CB  ARG A 206       2.338 -11.677   2.100  1.00  0.71           C  
ATOM   1575  CG  ARG A 206       2.071 -10.720   0.924  1.00  0.71           C  
ATOM   1576  CD  ARG A 206       0.660 -10.884   0.354  1.00  0.71           C  
ATOM   1577  NE  ARG A 206       0.454  -9.808  -0.664  1.00  0.71           N  
ATOM   1578  CZ  ARG A 206      -0.756  -9.441  -1.106  1.00  0.71           C  
ATOM   1579  NH1 ARG A 206      -1.846 -10.151  -0.834  1.00  0.71           N  
ATOM   1580  NH2 ARG A 206      -0.883  -8.336  -1.838  1.00  0.71           N  
ATOM   1581  N   LEU A 207       3.120 -12.064   5.080  1.00  0.80           N  
ATOM   1582  CA  LEU A 207       2.976 -12.922   6.239  1.00  0.80           C  
ATOM   1583  C   LEU A 207       2.087 -14.131   5.999  1.00  0.80           C  
ATOM   1584  O   LEU A 207       0.965 -14.014   5.505  1.00  0.80           O  
ATOM   1585  CB  LEU A 207       2.425 -12.114   7.433  1.00  0.80           C  
ATOM   1586  CG  LEU A 207       3.442 -11.105   7.995  1.00  0.80           C  
ATOM   1587  CD1 LEU A 207       2.727 -10.043   8.828  1.00  0.80           C  
ATOM   1588  CD2 LEU A 207       4.511 -11.802   8.848  1.00  0.80           C  
ATOM   1589  N   TYR A 208       2.581 -15.320   6.379  1.00  0.76           N  
ATOM   1590  CA  TYR A 208       1.851 -16.566   6.290  1.00  0.76           C  
ATOM   1591  C   TYR A 208       2.141 -17.365   7.536  1.00  0.76           C  
ATOM   1592  O   TYR A 208       3.160 -17.153   8.195  1.00  0.76           O  
ATOM   1593  CB  TYR A 208       2.312 -17.444   5.095  1.00  0.76           C  
ATOM   1594  CG  TYR A 208       1.960 -16.796   3.796  1.00  0.76           C  
ATOM   1595  CD1 TYR A 208       0.707 -17.018   3.213  1.00  0.76           C  
ATOM   1596  CD2 TYR A 208       2.868 -15.945   3.150  1.00  0.76           C  
ATOM   1597  CE1 TYR A 208       0.357 -16.359   2.032  1.00  0.76           C  
ATOM   1598  CE2 TYR A 208       2.511 -15.276   1.972  1.00  0.76           C  
ATOM   1599  CZ  TYR A 208       1.233 -15.455   1.443  1.00  0.76           C  
ATOM   1600  OH  TYR A 208       0.765 -14.725   0.341  1.00  0.76           O  
ATOM   1601  N   ASP A 209       1.260 -18.320   7.890  1.00  0.70           N  
ATOM   1602  CA  ASP A 209       1.571 -19.344   8.863  1.00  0.70           C  
ATOM   1603  C   ASP A 209       2.563 -20.379   8.319  1.00  0.70           C  
ATOM   1604  O   ASP A 209       3.038 -20.317   7.182  1.00  0.70           O  
ATOM   1605  CB  ASP A 209       0.295 -19.960   9.516  1.00  0.70           C  
ATOM   1606  CG  ASP A 209      -0.447 -20.993   8.683  1.00  0.70           C  
ATOM   1607  OD1 ASP A 209      -0.033 -21.266   7.529  1.00  0.70           O  
ATOM   1608  OD2 ASP A 209      -1.402 -21.590   9.229  1.00  0.70           O  
ATOM   1609  N   ALA A 210       2.891 -21.389   9.145  1.00  0.65           N  
ATOM   1610  CA  ALA A 210       3.756 -22.486   8.768  1.00  0.65           C  
ATOM   1611  C   ALA A 210       3.233 -23.328   7.603  1.00  0.65           C  
ATOM   1612  O   ALA A 210       4.008 -23.924   6.856  1.00  0.65           O  
ATOM   1613  CB  ALA A 210       3.981 -23.389   9.996  1.00  0.65           C  
ATOM   1614  N   HIS A 211       1.903 -23.362   7.396  1.00  0.65           N  
ATOM   1615  CA  HIS A 211       1.280 -24.166   6.366  1.00  0.65           C  
ATOM   1616  C   HIS A 211       1.030 -23.355   5.109  1.00  0.65           C  
ATOM   1617  O   HIS A 211       0.596 -23.877   4.086  1.00  0.65           O  
ATOM   1618  CB  HIS A 211      -0.070 -24.704   6.878  1.00  0.65           C  
ATOM   1619  CG  HIS A 211       0.117 -25.572   8.080  1.00  0.65           C  
ATOM   1620  ND1 HIS A 211       0.866 -26.728   7.967  1.00  0.65           N  
ATOM   1621  CD2 HIS A 211      -0.283 -25.394   9.366  1.00  0.65           C  
ATOM   1622  CE1 HIS A 211       0.909 -27.231   9.181  1.00  0.65           C  
ATOM   1623  NE2 HIS A 211       0.229 -26.464  10.069  1.00  0.65           N  
ATOM   1624  N   GLY A 212       1.348 -22.045   5.135  1.00  0.83           N  
ATOM   1625  CA  GLY A 212       1.161 -21.148   4.007  1.00  0.83           C  
ATOM   1626  C   GLY A 212      -0.198 -20.527   3.943  1.00  0.83           C  
ATOM   1627  O   GLY A 212      -0.567 -19.986   2.903  1.00  0.83           O  
ATOM   1628  N   ALA A 213      -0.976 -20.567   5.035  1.00  0.85           N  
ATOM   1629  CA  ALA A 213      -2.242 -19.876   5.105  1.00  0.85           C  
ATOM   1630  C   ALA A 213      -2.054 -18.407   5.445  1.00  0.85           C  
ATOM   1631  O   ALA A 213      -1.116 -18.006   6.140  1.00  0.85           O  
ATOM   1632  CB  ALA A 213      -3.179 -20.533   6.130  1.00  0.85           C  
ATOM   1633  N   GLN A 214      -2.941 -17.543   4.925  1.00  0.79           N  
ATOM   1634  CA  GLN A 214      -2.884 -16.123   5.185  1.00  0.79           C  
ATOM   1635  C   GLN A 214      -3.583 -15.784   6.492  1.00  0.79           C  
ATOM   1636  O   GLN A 214      -4.684 -16.267   6.752  1.00  0.79           O  
ATOM   1637  CB  GLN A 214      -3.502 -15.263   4.050  1.00  0.79           C  
ATOM   1638  CG  GLN A 214      -2.498 -15.023   2.905  1.00  0.79           C  
ATOM   1639  CD  GLN A 214      -3.003 -14.100   1.800  1.00  0.79           C  
ATOM   1640  OE1 GLN A 214      -4.025 -13.422   1.899  1.00  0.79           O  
ATOM   1641  NE2 GLN A 214      -2.229 -14.040   0.688  1.00  0.79           N  
ATOM   1642  N   PRO A 215      -3.024 -14.951   7.359  1.00  0.86           N  
ATOM   1643  CA  PRO A 215      -3.713 -14.564   8.575  1.00  0.86           C  
ATOM   1644  C   PRO A 215      -4.854 -13.606   8.284  1.00  0.86           C  
ATOM   1645  O   PRO A 215      -4.782 -12.886   7.279  1.00  0.86           O  
ATOM   1646  CB  PRO A 215      -2.617 -13.873   9.388  1.00  0.86           C  
ATOM   1647  CG  PRO A 215      -1.710 -13.247   8.327  1.00  0.86           C  
ATOM   1648  CD  PRO A 215      -1.729 -14.283   7.210  1.00  0.86           C  
ATOM   1649  N   PRO A 216      -5.902 -13.557   9.095  1.00  0.86           N  
ATOM   1650  CA  PRO A 216      -6.958 -12.575   8.934  1.00  0.86           C  
ATOM   1651  C   PRO A 216      -6.452 -11.159   9.187  1.00  0.86           C  
ATOM   1652  O   PRO A 216      -5.567 -10.946  10.018  1.00  0.86           O  
ATOM   1653  CB  PRO A 216      -8.006 -13.017   9.960  1.00  0.86           C  
ATOM   1654  CG  PRO A 216      -7.205 -13.695  11.074  1.00  0.86           C  
ATOM   1655  CD  PRO A 216      -6.081 -14.381  10.300  1.00  0.86           C  
ATOM   1656  N   SER A 217      -6.970 -10.170   8.440  1.00  0.85           N  
ATOM   1657  CA  SER A 217      -6.439  -8.820   8.436  1.00  0.85           C  
ATOM   1658  C   SER A 217      -7.419  -7.798   8.978  1.00  0.85           C  
ATOM   1659  O   SER A 217      -8.639  -7.958   8.926  1.00  0.85           O  
ATOM   1660  CB  SER A 217      -5.958  -8.366   7.027  1.00  0.85           C  
ATOM   1661  OG  SER A 217      -7.005  -8.427   6.056  1.00  0.85           O  
ATOM   1662  N   VAL A 218      -6.874  -6.708   9.551  1.00  0.85           N  
ATOM   1663  CA  VAL A 218      -7.630  -5.536   9.959  1.00  0.85           C  
ATOM   1664  C   VAL A 218      -7.084  -4.341   9.200  1.00  0.85           C  
ATOM   1665  O   VAL A 218      -5.904  -4.012   9.303  1.00  0.85           O  
ATOM   1666  CB  VAL A 218      -7.530  -5.259  11.462  1.00  0.85           C  
ATOM   1667  CG1 VAL A 218      -8.323  -3.995  11.844  1.00  0.85           C  
ATOM   1668  CG2 VAL A 218      -8.097  -6.459  12.238  1.00  0.85           C  
ATOM   1669  N   GLU A 219      -7.930  -3.644   8.418  1.00  0.79           N  
ATOM   1670  CA  GLU A 219      -7.542  -2.436   7.713  1.00  0.79           C  
ATOM   1671  C   GLU A 219      -7.803  -1.223   8.583  1.00  0.79           C  
ATOM   1672  O   GLU A 219      -8.882  -1.064   9.158  1.00  0.79           O  
ATOM   1673  CB  GLU A 219      -8.302  -2.229   6.385  1.00  0.79           C  
ATOM   1674  CG  GLU A 219      -8.044  -3.318   5.318  1.00  0.79           C  
ATOM   1675  CD  GLU A 219      -8.740  -2.993   3.995  1.00  0.79           C  
ATOM   1676  OE1 GLU A 219      -8.869  -3.925   3.164  1.00  0.79           O  
ATOM   1677  OE2 GLU A 219      -9.130  -1.812   3.790  1.00  0.79           O  
ATOM   1678  N   VAL A 220      -6.805  -0.333   8.722  1.00  0.86           N  
ATOM   1679  CA  VAL A 220      -6.882   0.787   9.648  1.00  0.86           C  
ATOM   1680  C   VAL A 220      -6.681   2.119   8.947  1.00  0.86           C  
ATOM   1681  O   VAL A 220      -5.947   2.237   7.966  1.00  0.86           O  
ATOM   1682  CB  VAL A 220      -5.918   0.664  10.829  1.00  0.86           C  
ATOM   1683  CG1 VAL A 220      -6.284  -0.592  11.642  1.00  0.86           C  
ATOM   1684  CG2 VAL A 220      -4.454   0.592  10.355  1.00  0.86           C  
ATOM   1685  N   ASP A 221      -7.333   3.195   9.449  1.00  0.86           N  
ATOM   1686  CA  ASP A 221      -7.130   4.562   8.990  1.00  0.86           C  
ATOM   1687  C   ASP A 221      -5.848   5.163   9.575  1.00  0.86           C  
ATOM   1688  O   ASP A 221      -5.830   6.125  10.346  1.00  0.86           O  
ATOM   1689  CB  ASP A 221      -8.369   5.462   9.236  1.00  0.86           C  
ATOM   1690  CG  ASP A 221      -8.335   6.651   8.292  1.00  0.86           C  
ATOM   1691  OD1 ASP A 221      -8.268   6.419   7.050  1.00  0.86           O  
ATOM   1692  OD2 ASP A 221      -8.362   7.808   8.778  1.00  0.86           O  
ATOM   1693  N   VAL A 222      -4.725   4.547   9.188  1.00  0.88           N  
ATOM   1694  CA  VAL A 222      -3.381   4.995   9.448  1.00  0.88           C  
ATOM   1695  C   VAL A 222      -2.738   5.073   8.088  1.00  0.88           C  
ATOM   1696  O   VAL A 222      -2.748   4.106   7.331  1.00  0.88           O  
ATOM   1697  CB  VAL A 222      -2.608   4.011  10.315  1.00  0.88           C  
ATOM   1698  CG1 VAL A 222      -1.148   4.463  10.489  1.00  0.88           C  
ATOM   1699  CG2 VAL A 222      -3.293   3.908  11.690  1.00  0.88           C  
ATOM   1700  N   VAL A 223      -2.199   6.245   7.727  1.00  0.85           N  
ATOM   1701  CA  VAL A 223      -1.781   6.540   6.375  1.00  0.85           C  
ATOM   1702  C   VAL A 223      -0.292   6.790   6.359  1.00  0.85           C  
ATOM   1703  O   VAL A 223       0.249   7.591   7.120  1.00  0.85           O  
ATOM   1704  CB  VAL A 223      -2.512   7.755   5.812  1.00  0.85           C  
ATOM   1705  CG1 VAL A 223      -2.026   8.094   4.390  1.00  0.85           C  
ATOM   1706  CG2 VAL A 223      -4.032   7.485   5.811  1.00  0.85           C  
ATOM   1707  N   PHE A 224       0.407   6.104   5.447  1.00  0.81           N  
ATOM   1708  CA  PHE A 224       1.799   6.329   5.153  1.00  0.81           C  
ATOM   1709  C   PHE A 224       1.890   6.921   3.768  1.00  0.81           C  
ATOM   1710  O   PHE A 224       1.200   6.506   2.839  1.00  0.81           O  
ATOM   1711  CB  PHE A 224       2.619   5.015   5.170  1.00  0.81           C  
ATOM   1712  CG  PHE A 224       2.852   4.560   6.581  1.00  0.81           C  
ATOM   1713  CD1 PHE A 224       4.070   4.842   7.217  1.00  0.81           C  
ATOM   1714  CD2 PHE A 224       1.871   3.835   7.279  1.00  0.81           C  
ATOM   1715  CE1 PHE A 224       4.303   4.416   8.529  1.00  0.81           C  
ATOM   1716  CE2 PHE A 224       2.100   3.409   8.595  1.00  0.81           C  
ATOM   1717  CZ  PHE A 224       3.319   3.699   9.220  1.00  0.81           C  
ATOM   1718  N   HIS A 225       2.758   7.927   3.596  1.00  0.77           N  
ATOM   1719  CA  HIS A 225       3.057   8.473   2.290  1.00  0.77           C  
ATOM   1720  C   HIS A 225       4.306   7.821   1.754  1.00  0.77           C  
ATOM   1721  O   HIS A 225       5.369   7.893   2.365  1.00  0.77           O  
ATOM   1722  CB  HIS A 225       3.284   9.995   2.324  1.00  0.77           C  
ATOM   1723  CG  HIS A 225       2.044  10.743   2.691  1.00  0.77           C  
ATOM   1724  ND1 HIS A 225       0.997  10.772   1.795  1.00  0.77           N  
ATOM   1725  CD2 HIS A 225       1.754  11.501   3.780  1.00  0.77           C  
ATOM   1726  CE1 HIS A 225       0.090  11.554   2.346  1.00  0.77           C  
ATOM   1727  NE2 HIS A 225       0.496  12.021   3.552  1.00  0.77           N  
ATOM   1728  N   HIS A 226       4.192   7.179   0.584  1.00  0.73           N  
ATOM   1729  CA  HIS A 226       5.291   6.564  -0.120  1.00  0.73           C  
ATOM   1730  C   HIS A 226       5.885   7.565  -1.076  1.00  0.73           C  
ATOM   1731  O   HIS A 226       5.238   8.002  -2.027  1.00  0.73           O  
ATOM   1732  CB  HIS A 226       4.806   5.334  -0.916  1.00  0.73           C  
ATOM   1733  CG  HIS A 226       5.906   4.592  -1.574  1.00  0.73           C  
ATOM   1734  ND1 HIS A 226       6.898   4.129  -0.756  1.00  0.73           N  
ATOM   1735  CD2 HIS A 226       6.155   4.259  -2.867  1.00  0.73           C  
ATOM   1736  CE1 HIS A 226       7.744   3.506  -1.547  1.00  0.73           C  
ATOM   1737  NE2 HIS A 226       7.343   3.559  -2.843  1.00  0.73           N  
ATOM   1738  N   THR A 227       7.148   7.980  -0.854  1.00  0.72           N  
ATOM   1739  CA  THR A 227       7.754   9.008  -1.694  1.00  0.72           C  
ATOM   1740  C   THR A 227       8.182   8.464  -3.033  1.00  0.72           C  
ATOM   1741  O   THR A 227       8.322   9.223  -3.989  1.00  0.72           O  
ATOM   1742  CB  THR A 227       8.949   9.730  -1.069  1.00  0.72           C  
ATOM   1743  OG1 THR A 227      10.021   8.847  -0.781  1.00  0.72           O  
ATOM   1744  CG2 THR A 227       8.524  10.400   0.246  1.00  0.72           C  
ATOM   1745  N   GLY A 228       8.385   7.128  -3.150  1.00  0.72           N  
ATOM   1746  CA  GLY A 228       8.794   6.495  -4.400  1.00  0.72           C  
ATOM   1747  C   GLY A 228      10.120   6.973  -4.899  1.00  0.72           C  
ATOM   1748  O   GLY A 228      10.333   7.092  -6.104  1.00  0.72           O  
ATOM   1749  N   TYR A 229      11.024   7.315  -3.963  1.00  0.56           N  
ATOM   1750  CA  TYR A 229      12.327   7.861  -4.238  1.00  0.56           C  
ATOM   1751  C   TYR A 229      13.213   6.855  -4.967  1.00  0.56           C  
ATOM   1752  O   TYR A 229      13.956   6.076  -4.385  1.00  0.56           O  
ATOM   1753  CB  TYR A 229      12.942   8.381  -2.907  1.00  0.56           C  
ATOM   1754  CG  TYR A 229      14.284   9.019  -3.091  1.00  0.56           C  
ATOM   1755  CD1 TYR A 229      15.434   8.317  -2.699  1.00  0.56           C  
ATOM   1756  CD2 TYR A 229      14.410  10.301  -3.653  1.00  0.56           C  
ATOM   1757  CE1 TYR A 229      16.703   8.856  -2.930  1.00  0.56           C  
ATOM   1758  CE2 TYR A 229      15.680  10.849  -3.873  1.00  0.56           C  
ATOM   1759  CZ  TYR A 229      16.817  10.110  -3.539  1.00  0.56           C  
ATOM   1760  OH  TYR A 229      18.071  10.573  -3.959  1.00  0.56           O  
ATOM   1761  N   GLU A 230      13.155   6.882  -6.305  1.00  0.54           N  
ATOM   1762  CA  GLU A 230      14.095   6.175  -7.132  1.00  0.54           C  
ATOM   1763  C   GLU A 230      14.790   7.188  -8.010  1.00  0.54           C  
ATOM   1764  O   GLU A 230      14.199   7.662  -8.986  1.00  0.54           O  
ATOM   1765  CB  GLU A 230      13.367   5.141  -8.006  1.00  0.54           C  
ATOM   1766  CG  GLU A 230      13.469   3.727  -7.394  1.00  0.54           C  
ATOM   1767  CD  GLU A 230      12.574   2.731  -8.113  1.00  0.54           C  
ATOM   1768  OE1 GLU A 230      12.002   1.845  -7.418  1.00  0.54           O  
ATOM   1769  OE2 GLU A 230      12.446   2.807  -9.363  1.00  0.54           O  
ATOM   1770  N   PRO A 231      16.033   7.555  -7.749  1.00  0.45           N  
ATOM   1771  CA  PRO A 231      16.700   8.545  -8.558  1.00  0.45           C  
ATOM   1772  C   PRO A 231      17.445   7.779  -9.606  1.00  0.45           C  
ATOM   1773  O   PRO A 231      18.252   6.922  -9.270  1.00  0.45           O  
ATOM   1774  CB  PRO A 231      17.669   9.276  -7.624  1.00  0.45           C  
ATOM   1775  CG  PRO A 231      17.716   8.422  -6.355  1.00  0.45           C  
ATOM   1776  CD  PRO A 231      16.808   7.213  -6.556  1.00  0.45           C  
ATOM   1777  N   GLU A 232      17.145   8.085 -10.878  1.00  0.47           N  
ATOM   1778  CA  GLU A 232      17.960   7.741 -12.021  1.00  0.47           C  
ATOM   1779  C   GLU A 232      17.478   6.492 -12.710  1.00  0.47           C  
ATOM   1780  O   GLU A 232      16.999   5.519 -12.130  1.00  0.47           O  
ATOM   1781  CB  GLU A 232      19.494   7.708 -11.807  1.00  0.47           C  
ATOM   1782  CG  GLU A 232      20.048   9.027 -11.218  1.00  0.47           C  
ATOM   1783  CD  GLU A 232      21.536   8.924 -10.913  1.00  0.47           C  
ATOM   1784  OE1 GLU A 232      22.056   9.894 -10.307  1.00  0.47           O  
ATOM   1785  OE2 GLU A 232      22.153   7.891 -11.283  1.00  0.47           O  
ATOM   1786  N   VAL A 233      17.607   6.513 -14.045  1.00  0.36           N  
ATOM   1787  CA  VAL A 233      17.274   5.436 -14.951  1.00  0.36           C  
ATOM   1788  C   VAL A 233      18.080   4.182 -14.632  1.00  0.36           C  
ATOM   1789  O   VAL A 233      17.576   3.062 -14.686  1.00  0.36           O  
ATOM   1790  CB  VAL A 233      17.508   5.932 -16.375  1.00  0.36           C  
ATOM   1791  CG1 VAL A 233      17.341   4.795 -17.398  1.00  0.36           C  
ATOM   1792  CG2 VAL A 233      16.502   7.069 -16.670  1.00  0.36           C  
ATOM   1793  N   ILE A 234      19.355   4.366 -14.238  1.00  0.39           N  
ATOM   1794  CA  ILE A 234      20.270   3.321 -13.815  1.00  0.39           C  
ATOM   1795  C   ILE A 234      19.810   2.588 -12.559  1.00  0.39           C  
ATOM   1796  O   ILE A 234      19.803   1.358 -12.523  1.00  0.39           O  
ATOM   1797  CB  ILE A 234      21.664   3.915 -13.620  1.00  0.39           C  
ATOM   1798  CG1 ILE A 234      22.178   4.507 -14.959  1.00  0.39           C  
ATOM   1799  CG2 ILE A 234      22.631   2.837 -13.078  1.00  0.39           C  
ATOM   1800  CD1 ILE A 234      23.478   5.308 -14.814  1.00  0.39           C  
ATOM   1801  N   ALA A 235      19.354   3.308 -11.511  1.00  0.42           N  
ATOM   1802  CA  ALA A 235      18.828   2.697 -10.303  1.00  0.42           C  
ATOM   1803  C   ALA A 235      17.569   1.877 -10.547  1.00  0.42           C  
ATOM   1804  O   ALA A 235      17.419   0.756 -10.059  1.00  0.42           O  
ATOM   1805  CB  ALA A 235      18.535   3.789  -9.263  1.00  0.42           C  
ATOM   1806  N   ARG A 236      16.654   2.411 -11.378  1.00  0.40           N  
ATOM   1807  CA  ARG A 236      15.469   1.706 -11.819  1.00  0.40           C  
ATOM   1808  C   ARG A 236      15.786   0.452 -12.628  1.00  0.40           C  
ATOM   1809  O   ARG A 236      15.176  -0.602 -12.450  1.00  0.40           O  
ATOM   1810  CB  ARG A 236      14.604   2.658 -12.671  1.00  0.40           C  
ATOM   1811  CG  ARG A 236      13.191   2.114 -12.958  1.00  0.40           C  
ATOM   1812  CD  ARG A 236      12.347   3.043 -13.831  1.00  0.40           C  
ATOM   1813  NE  ARG A 236      12.096   4.278 -13.029  1.00  0.40           N  
ATOM   1814  CZ  ARG A 236      11.719   5.459 -13.536  1.00  0.40           C  
ATOM   1815  NH1 ARG A 236      11.551   5.644 -14.843  1.00  0.40           N  
ATOM   1816  NH2 ARG A 236      11.505   6.479 -12.710  1.00  0.40           N  
ATOM   1817  N   LYS A 237      16.775   0.528 -13.543  1.00  0.51           N  
ATOM   1818  CA  LYS A 237      17.238  -0.608 -14.316  1.00  0.51           C  
ATOM   1819  C   LYS A 237      17.848  -1.707 -13.457  1.00  0.51           C  
ATOM   1820  O   LYS A 237      17.473  -2.872 -13.581  1.00  0.51           O  
ATOM   1821  CB  LYS A 237      18.257  -0.142 -15.386  1.00  0.51           C  
ATOM   1822  CG  LYS A 237      18.647  -1.232 -16.396  1.00  0.51           C  
ATOM   1823  CD  LYS A 237      19.609  -0.715 -17.480  1.00  0.51           C  
ATOM   1824  CE  LYS A 237      20.061  -1.841 -18.417  1.00  0.51           C  
ATOM   1825  NZ  LYS A 237      21.035  -1.362 -19.420  1.00  0.51           N  
ATOM   1826  N   GLY A 238      18.733  -1.348 -12.499  1.00  0.56           N  
ATOM   1827  CA  GLY A 238      19.342  -2.308 -11.580  1.00  0.56           C  
ATOM   1828  C   GLY A 238      18.366  -2.967 -10.636  1.00  0.56           C  
ATOM   1829  O   GLY A 238      18.527  -4.119 -10.235  1.00  0.56           O  
ATOM   1830  N   LYS A 239      17.281  -2.258 -10.263  1.00  0.57           N  
ATOM   1831  CA  LYS A 239      16.170  -2.844  -9.540  1.00  0.57           C  
ATOM   1832  C   LYS A 239      15.418  -3.886 -10.351  1.00  0.57           C  
ATOM   1833  O   LYS A 239      15.109  -4.966  -9.848  1.00  0.57           O  
ATOM   1834  CB  LYS A 239      15.186  -1.744  -9.074  1.00  0.57           C  
ATOM   1835  CG  LYS A 239      14.019  -2.254  -8.210  1.00  0.57           C  
ATOM   1836  CD  LYS A 239      13.167  -1.096  -7.668  1.00  0.57           C  
ATOM   1837  CE  LYS A 239      12.025  -1.537  -6.749  1.00  0.57           C  
ATOM   1838  NZ  LYS A 239      11.314  -0.355  -6.232  1.00  0.57           N  
ATOM   1839  N   ARG A 240      15.138  -3.602 -11.641  1.00  0.51           N  
ATOM   1840  CA  ARG A 240      14.482  -4.537 -12.539  1.00  0.51           C  
ATOM   1841  C   ARG A 240      15.301  -5.793 -12.791  1.00  0.51           C  
ATOM   1842  O   ARG A 240      14.781  -6.905 -12.716  1.00  0.51           O  
ATOM   1843  CB  ARG A 240      14.175  -3.877 -13.905  1.00  0.51           C  
ATOM   1844  CG  ARG A 240      13.065  -2.809 -13.857  1.00  0.51           C  
ATOM   1845  CD  ARG A 240      12.878  -2.145 -15.225  1.00  0.51           C  
ATOM   1846  NE  ARG A 240      11.801  -1.109 -15.111  1.00  0.51           N  
ATOM   1847  CZ  ARG A 240      11.398  -0.350 -16.140  1.00  0.51           C  
ATOM   1848  NH1 ARG A 240      11.972  -0.432 -17.336  1.00  0.51           N  
ATOM   1849  NH2 ARG A 240      10.410   0.526 -15.965  1.00  0.51           N  
ATOM   1850  N   GLU A 241      16.619  -5.648 -13.039  1.00  0.56           N  
ATOM   1851  CA  GLU A 241      17.543  -6.757 -13.206  1.00  0.56           C  
ATOM   1852  C   GLU A 241      17.643  -7.627 -11.962  1.00  0.56           C  
ATOM   1853  O   GLU A 241      17.637  -8.856 -12.028  1.00  0.56           O  
ATOM   1854  CB  GLU A 241      18.940  -6.223 -13.585  1.00  0.56           C  
ATOM   1855  CG  GLU A 241      18.971  -5.603 -15.004  1.00  0.56           C  
ATOM   1856  CD  GLU A 241      20.287  -4.905 -15.330  1.00  0.56           C  
ATOM   1857  OE1 GLU A 241      20.376  -4.377 -16.471  1.00  0.56           O  
ATOM   1858  OE2 GLU A 241      21.197  -4.869 -14.466  1.00  0.56           O  
ATOM   1859  N   ARG A 242      17.675  -7.004 -10.763  1.00  0.47           N  
ATOM   1860  CA  ARG A 242      17.588  -7.726  -9.508  1.00  0.47           C  
ATOM   1861  C   ARG A 242      16.287  -8.491  -9.337  1.00  0.47           C  
ATOM   1862  O   ARG A 242      16.296  -9.659  -8.960  1.00  0.47           O  
ATOM   1863  CB  ARG A 242      17.737  -6.743  -8.319  1.00  0.47           C  
ATOM   1864  CG  ARG A 242      17.694  -7.402  -6.921  1.00  0.47           C  
ATOM   1865  CD  ARG A 242      18.007  -6.444  -5.763  1.00  0.47           C  
ATOM   1866  NE  ARG A 242      16.891  -5.441  -5.696  1.00  0.47           N  
ATOM   1867  CZ  ARG A 242      17.011  -4.197  -5.211  1.00  0.47           C  
ATOM   1868  NH1 ARG A 242      18.168  -3.715  -4.770  1.00  0.47           N  
ATOM   1869  NH2 ARG A 242      15.935  -3.413  -5.161  1.00  0.47           N  
ATOM   1870  N   TYR A 243      15.128  -7.868  -9.633  1.00  0.53           N  
ATOM   1871  CA  TYR A 243      13.832  -8.517  -9.509  1.00  0.53           C  
ATOM   1872  C   TYR A 243      13.679  -9.692 -10.455  1.00  0.53           C  
ATOM   1873  O   TYR A 243      13.216 -10.754 -10.049  1.00  0.53           O  
ATOM   1874  CB  TYR A 243      12.658  -7.519  -9.710  1.00  0.53           C  
ATOM   1875  CG  TYR A 243      12.362  -6.653  -8.504  1.00  0.53           C  
ATOM   1876  CD1 TYR A 243      13.252  -6.453  -7.425  1.00  0.53           C  
ATOM   1877  CD2 TYR A 243      11.104  -6.025  -8.455  1.00  0.53           C  
ATOM   1878  CE1 TYR A 243      12.885  -5.657  -6.333  1.00  0.53           C  
ATOM   1879  CE2 TYR A 243      10.730  -5.240  -7.356  1.00  0.53           C  
ATOM   1880  CZ  TYR A 243      11.623  -5.064  -6.295  1.00  0.53           C  
ATOM   1881  OH  TYR A 243      11.258  -4.311  -5.166  1.00  0.53           O  
ATOM   1882  N   ALA A 244      14.136  -9.558 -11.717  1.00  0.69           N  
ATOM   1883  CA  ALA A 244      14.150 -10.642 -12.679  1.00  0.69           C  
ATOM   1884  C   ALA A 244      14.968 -11.846 -12.215  1.00  0.69           C  
ATOM   1885  O   ALA A 244      14.481 -12.974 -12.219  1.00  0.69           O  
ATOM   1886  CB  ALA A 244      14.707 -10.101 -14.010  1.00  0.69           C  
ATOM   1887  N   ARG A 245      16.192 -11.610 -11.692  1.00  0.64           N  
ATOM   1888  CA  ARG A 245      17.029 -12.644 -11.104  1.00  0.64           C  
ATOM   1889  C   ARG A 245      16.384 -13.334  -9.903  1.00  0.64           C  
ATOM   1890  O   ARG A 245      16.441 -14.554  -9.740  1.00  0.64           O  
ATOM   1891  CB  ARG A 245      18.375 -12.019 -10.650  1.00  0.64           C  
ATOM   1892  CG  ARG A 245      19.399 -13.047 -10.117  1.00  0.64           C  
ATOM   1893  CD  ARG A 245      20.688 -12.443  -9.538  1.00  0.64           C  
ATOM   1894  NE  ARG A 245      20.360 -11.695  -8.265  1.00  0.64           N  
ATOM   1895  CZ  ARG A 245      20.793 -10.465  -7.969  1.00  0.64           C  
ATOM   1896  NH1 ARG A 245      21.471  -9.725  -8.848  1.00  0.64           N  
ATOM   1897  NH2 ARG A 245      20.545  -9.954  -6.765  1.00  0.64           N  
ATOM   1898  N   LEU A 246      15.721 -12.566  -9.013  1.00  0.69           N  
ATOM   1899  CA  LEU A 246      14.990 -13.124  -7.891  1.00  0.69           C  
ATOM   1900  C   LEU A 246      13.831 -14.006  -8.318  1.00  0.69           C  
ATOM   1901  O   LEU A 246      13.654 -15.101  -7.788  1.00  0.69           O  
ATOM   1902  CB  LEU A 246      14.453 -12.013  -6.957  1.00  0.69           C  
ATOM   1903  CG  LEU A 246      15.545 -11.264  -6.169  1.00  0.69           C  
ATOM   1904  CD1 LEU A 246      14.940 -10.099  -5.374  1.00  0.69           C  
ATOM   1905  CD2 LEU A 246      16.314 -12.194  -5.228  1.00  0.69           C  
ATOM   1906  N   VAL A 247      13.040 -13.580  -9.322  1.00  0.73           N  
ATOM   1907  CA  VAL A 247      11.961 -14.374  -9.889  1.00  0.73           C  
ATOM   1908  C   VAL A 247      12.453 -15.675 -10.516  1.00  0.73           C  
ATOM   1909  O   VAL A 247      11.869 -16.735 -10.292  1.00  0.73           O  
ATOM   1910  CB  VAL A 247      11.153 -13.570 -10.899  1.00  0.73           C  
ATOM   1911  CG1 VAL A 247      10.124 -14.453 -11.622  1.00  0.73           C  
ATOM   1912  CG2 VAL A 247      10.402 -12.438 -10.173  1.00  0.73           C  
ATOM   1913  N   GLU A 248      13.575 -15.647 -11.268  1.00  0.72           N  
ATOM   1914  CA  GLU A 248      14.218 -16.837 -11.808  1.00  0.72           C  
ATOM   1915  C   GLU A 248      14.661 -17.811 -10.733  1.00  0.72           C  
ATOM   1916  O   GLU A 248      14.433 -19.015 -10.824  1.00  0.72           O  
ATOM   1917  CB  GLU A 248      15.463 -16.455 -12.636  1.00  0.72           C  
ATOM   1918  CG  GLU A 248      15.119 -15.779 -13.981  1.00  0.72           C  
ATOM   1919  CD  GLU A 248      16.365 -15.333 -14.745  1.00  0.72           C  
ATOM   1920  OE1 GLU A 248      16.182 -14.907 -15.914  1.00  0.72           O  
ATOM   1921  OE2 GLU A 248      17.486 -15.407 -14.180  1.00  0.72           O  
ATOM   1922  N   ARG A 249      15.260 -17.306  -9.640  1.00  0.69           N  
ATOM   1923  CA  ARG A 249      15.623 -18.119  -8.498  1.00  0.69           C  
ATOM   1924  C   ARG A 249      14.431 -18.776  -7.822  1.00  0.69           C  
ATOM   1925  O   ARG A 249      14.449 -19.966  -7.522  1.00  0.69           O  
ATOM   1926  CB  ARG A 249      16.379 -17.251  -7.475  1.00  0.69           C  
ATOM   1927  CG  ARG A 249      17.002 -18.053  -6.322  1.00  0.69           C  
ATOM   1928  CD  ARG A 249      17.926 -17.190  -5.469  1.00  0.69           C  
ATOM   1929  NE  ARG A 249      18.467 -18.069  -4.393  1.00  0.69           N  
ATOM   1930  CZ  ARG A 249      19.523 -17.723  -3.644  1.00  0.69           C  
ATOM   1931  NH1 ARG A 249      20.153 -16.560  -3.806  1.00  0.69           N  
ATOM   1932  NH2 ARG A 249      19.984 -18.571  -2.732  1.00  0.69           N  
ATOM   1933  N   CYS A 250      13.334 -18.024  -7.626  1.00  0.72           N  
ATOM   1934  CA  CYS A 250      12.088 -18.556  -7.111  1.00  0.72           C  
ATOM   1935  C   CYS A 250      11.461 -19.626  -7.986  1.00  0.72           C  
ATOM   1936  O   CYS A 250      10.973 -20.632  -7.488  1.00  0.72           O  
ATOM   1937  CB  CYS A 250      11.048 -17.441  -6.929  1.00  0.72           C  
ATOM   1938  SG  CYS A 250      11.549 -16.221  -5.679  1.00  0.72           S  
ATOM   1939  N   LEU A 251      11.489 -19.459  -9.323  1.00  0.72           N  
ATOM   1940  CA  LEU A 251      11.071 -20.484 -10.265  1.00  0.72           C  
ATOM   1941  C   LEU A 251      11.907 -21.754 -10.174  1.00  0.72           C  
ATOM   1942  O   LEU A 251      11.378 -22.857 -10.241  1.00  0.72           O  
ATOM   1943  CB  LEU A 251      11.147 -19.950 -11.716  1.00  0.72           C  
ATOM   1944  CG  LEU A 251       9.989 -19.021 -12.125  1.00  0.72           C  
ATOM   1945  CD1 LEU A 251      10.349 -18.272 -13.415  1.00  0.72           C  
ATOM   1946  CD2 LEU A 251       8.685 -19.806 -12.324  1.00  0.72           C  
ATOM   1947  N   THR A 252      13.237 -21.638 -10.007  1.00  0.71           N  
ATOM   1948  CA  THR A 252      14.114 -22.784  -9.769  1.00  0.71           C  
ATOM   1949  C   THR A 252      13.814 -23.500  -8.465  1.00  0.71           C  
ATOM   1950  O   THR A 252      13.728 -24.725  -8.420  1.00  0.71           O  
ATOM   1951  CB  THR A 252      15.583 -22.374  -9.761  1.00  0.71           C  
ATOM   1952  OG1 THR A 252      15.914 -21.823 -11.026  1.00  0.71           O  
ATOM   1953  CG2 THR A 252      16.527 -23.568  -9.556  1.00  0.71           C  
ATOM   1954  N   GLU A 253      13.637 -22.750  -7.360  1.00  0.68           N  
ATOM   1955  CA  GLU A 253      13.337 -23.304  -6.052  1.00  0.68           C  
ATOM   1956  C   GLU A 253      11.924 -23.882  -5.931  1.00  0.68           C  
ATOM   1957  O   GLU A 253      11.730 -24.963  -5.379  1.00  0.68           O  
ATOM   1958  CB  GLU A 253      13.633 -22.246  -4.952  1.00  0.68           C  
ATOM   1959  CG  GLU A 253      15.154 -21.904  -4.853  1.00  0.68           C  
ATOM   1960  CD  GLU A 253      15.534 -20.795  -3.877  1.00  0.68           C  
ATOM   1961  OE1 GLU A 253      16.719 -20.346  -3.892  1.00  0.68           O  
ATOM   1962  OE2 GLU A 253      14.687 -20.332  -3.074  1.00  0.68           O  
ATOM   1963  N   GLU A 254      10.899 -23.196  -6.477  1.00  0.61           N  
ATOM   1964  CA  GLU A 254       9.509 -23.623  -6.407  1.00  0.61           C  
ATOM   1965  C   GLU A 254       8.852 -23.713  -7.801  1.00  0.61           C  
ATOM   1966  O   GLU A 254       7.956 -22.918  -8.101  1.00  0.61           O  
ATOM   1967  CB  GLU A 254       8.670 -22.658  -5.518  1.00  0.61           C  
ATOM   1968  CG  GLU A 254       9.045 -22.603  -4.004  1.00  0.61           C  
ATOM   1969  CD  GLU A 254       8.042 -21.801  -3.166  1.00  0.61           C  
ATOM   1970  OE1 GLU A 254       7.850 -22.099  -1.951  1.00  0.61           O  
ATOM   1971  OE2 GLU A 254       7.427 -20.864  -3.744  1.00  0.61           O  
ATOM   1972  N   PRO A 255       9.191 -24.652  -8.698  1.00  0.70           N  
ATOM   1973  CA  PRO A 255       8.775 -24.615 -10.108  1.00  0.70           C  
ATOM   1974  C   PRO A 255       7.303 -24.884 -10.317  1.00  0.70           C  
ATOM   1975  O   PRO A 255       6.754 -24.512 -11.355  1.00  0.70           O  
ATOM   1976  CB  PRO A 255       9.625 -25.716 -10.772  1.00  0.70           C  
ATOM   1977  CG  PRO A 255       9.988 -26.667  -9.627  1.00  0.70           C  
ATOM   1978  CD  PRO A 255      10.171 -25.710  -8.451  1.00  0.70           C  
ATOM   1979  N   SER A 256       6.648 -25.548  -9.356  1.00  0.61           N  
ATOM   1980  CA  SER A 256       5.241 -25.891  -9.406  1.00  0.61           C  
ATOM   1981  C   SER A 256       4.390 -24.853  -8.711  1.00  0.61           C  
ATOM   1982  O   SER A 256       3.175 -24.992  -8.641  1.00  0.61           O  
ATOM   1983  CB  SER A 256       4.986 -27.242  -8.691  1.00  0.61           C  
ATOM   1984  OG  SER A 256       5.646 -27.265  -7.420  1.00  0.61           O  
ATOM   1985  N   ASN A 257       4.988 -23.755  -8.206  1.00  0.56           N  
ATOM   1986  CA  ASN A 257       4.229 -22.679  -7.607  1.00  0.56           C  
ATOM   1987  C   ASN A 257       3.778 -21.689  -8.696  1.00  0.56           C  
ATOM   1988  O   ASN A 257       4.621 -21.017  -9.301  1.00  0.56           O  
ATOM   1989  CB  ASN A 257       5.085 -21.989  -6.515  1.00  0.56           C  
ATOM   1990  CG  ASN A 257       4.294 -20.978  -5.695  1.00  0.56           C  
ATOM   1991  OD1 ASN A 257       3.191 -20.561  -6.052  1.00  0.56           O  
ATOM   1992  ND2 ASN A 257       4.867 -20.548  -4.553  1.00  0.56           N  
ATOM   1993  N   PRO A 258       2.485 -21.519  -8.991  1.00  0.60           N  
ATOM   1994  CA  PRO A 258       2.040 -20.718 -10.128  1.00  0.60           C  
ATOM   1995  C   PRO A 258       2.227 -19.231  -9.901  1.00  0.60           C  
ATOM   1996  O   PRO A 258       2.207 -18.466 -10.867  1.00  0.60           O  
ATOM   1997  CB  PRO A 258       0.562 -21.088 -10.279  1.00  0.60           C  
ATOM   1998  CG  PRO A 258       0.131 -21.563  -8.889  1.00  0.60           C  
ATOM   1999  CD  PRO A 258       1.379 -22.247  -8.358  1.00  0.60           C  
ATOM   2000  N   LYS A 259       2.447 -18.803  -8.641  1.00  0.55           N  
ATOM   2001  CA  LYS A 259       2.715 -17.433  -8.248  1.00  0.55           C  
ATOM   2002  C   LYS A 259       3.940 -16.856  -8.958  1.00  0.55           C  
ATOM   2003  O   LYS A 259       3.935 -15.728  -9.449  1.00  0.55           O  
ATOM   2004  CB  LYS A 259       2.909 -17.409  -6.700  1.00  0.55           C  
ATOM   2005  CG  LYS A 259       3.281 -16.047  -6.086  1.00  0.55           C  
ATOM   2006  CD  LYS A 259       3.472 -16.054  -4.547  1.00  0.55           C  
ATOM   2007  CE  LYS A 259       3.949 -14.686  -4.024  1.00  0.55           C  
ATOM   2008  NZ  LYS A 259       3.943 -14.527  -2.566  1.00  0.55           N  
ATOM   2009  N   TRP A 260       5.028 -17.640  -9.071  1.00  0.64           N  
ATOM   2010  CA  TRP A 260       6.259 -17.198  -9.700  1.00  0.64           C  
ATOM   2011  C   TRP A 260       6.195 -17.098 -11.211  1.00  0.64           C  
ATOM   2012  O   TRP A 260       6.801 -16.213 -11.811  1.00  0.64           O  
ATOM   2013  CB  TRP A 260       7.444 -18.076  -9.254  1.00  0.64           C  
ATOM   2014  CG  TRP A 260       7.594 -18.130  -7.747  1.00  0.64           C  
ATOM   2015  CD1 TRP A 260       7.603 -19.228  -6.937  1.00  0.64           C  
ATOM   2016  CD2 TRP A 260       7.801 -16.991  -6.888  1.00  0.64           C  
ATOM   2017  NE1 TRP A 260       7.768 -18.856  -5.621  1.00  0.64           N  
ATOM   2018  CE2 TRP A 260       7.919 -17.493  -5.573  1.00  0.64           C  
ATOM   2019  CE3 TRP A 260       7.944 -15.628  -7.157  1.00  0.64           C  
ATOM   2020  CZ2 TRP A 260       8.208 -16.648  -4.517  1.00  0.64           C  
ATOM   2021  CZ3 TRP A 260       8.217 -14.773  -6.079  1.00  0.64           C  
ATOM   2022  CH2 TRP A 260       8.358 -15.283  -4.780  1.00  0.64           C  
ATOM   2023  N   HIS A 261       5.412 -17.971 -11.873  1.00  0.63           N  
ATOM   2024  CA  HIS A 261       5.139 -17.866 -13.298  1.00  0.63           C  
ATOM   2025  C   HIS A 261       4.382 -16.600 -13.657  1.00  0.63           C  
ATOM   2026  O   HIS A 261       4.687 -15.946 -14.652  1.00  0.63           O  
ATOM   2027  CB  HIS A 261       4.347 -19.079 -13.802  1.00  0.63           C  
ATOM   2028  CG  HIS A 261       5.118 -20.357 -13.683  1.00  0.63           C  
ATOM   2029  ND1 HIS A 261       6.029 -20.702 -14.667  1.00  0.63           N  
ATOM   2030  CD2 HIS A 261       5.066 -21.320 -12.726  1.00  0.63           C  
ATOM   2031  CE1 HIS A 261       6.500 -21.880 -14.286  1.00  0.63           C  
ATOM   2032  NE2 HIS A 261       5.953 -22.294 -13.118  1.00  0.63           N  
ATOM   2033  N   PHE A 262       3.407 -16.192 -12.813  1.00  0.59           N  
ATOM   2034  CA  PHE A 262       2.758 -14.896 -12.923  1.00  0.59           C  
ATOM   2035  C   PHE A 262       3.743 -13.732 -12.819  1.00  0.59           C  
ATOM   2036  O   PHE A 262       3.749 -12.837 -13.663  1.00  0.59           O  
ATOM   2037  CB  PHE A 262       1.650 -14.792 -11.827  1.00  0.59           C  
ATOM   2038  CG  PHE A 262       1.087 -13.401 -11.684  1.00  0.59           C  
ATOM   2039  CD1 PHE A 262       1.576 -12.541 -10.686  1.00  0.59           C  
ATOM   2040  CD2 PHE A 262       0.148 -12.915 -12.600  1.00  0.59           C  
ATOM   2041  CE1 PHE A 262       1.116 -11.223 -10.593  1.00  0.59           C  
ATOM   2042  CE2 PHE A 262      -0.331 -11.602 -12.498  1.00  0.59           C  
ATOM   2043  CZ  PHE A 262       0.151 -10.757 -11.492  1.00  0.59           C  
ATOM   2044  N   TYR A 263       4.627 -13.729 -11.804  1.00  0.61           N  
ATOM   2045  CA  TYR A 263       5.598 -12.665 -11.639  1.00  0.61           C  
ATOM   2046  C   TYR A 263       6.622 -12.602 -12.753  1.00  0.61           C  
ATOM   2047  O   TYR A 263       6.992 -11.524 -13.199  1.00  0.61           O  
ATOM   2048  CB  TYR A 263       6.293 -12.746 -10.257  1.00  0.61           C  
ATOM   2049  CG  TYR A 263       5.337 -12.363  -9.154  1.00  0.61           C  
ATOM   2050  CD1 TYR A 263       4.623 -11.154  -9.222  1.00  0.61           C  
ATOM   2051  CD2 TYR A 263       5.166 -13.175  -8.022  1.00  0.61           C  
ATOM   2052  CE1 TYR A 263       3.743 -10.784  -8.195  1.00  0.61           C  
ATOM   2053  CE2 TYR A 263       4.292 -12.780  -6.999  1.00  0.61           C  
ATOM   2054  CZ  TYR A 263       3.569 -11.594  -7.082  1.00  0.61           C  
ATOM   2055  OH  TYR A 263       2.672 -11.166  -6.075  1.00  0.61           O  
ATOM   2056  N   ALA A 264       7.058 -13.756 -13.287  1.00  0.67           N  
ATOM   2057  CA  ALA A 264       7.951 -13.813 -14.426  1.00  0.67           C  
ATOM   2058  C   ALA A 264       7.409 -13.141 -15.676  1.00  0.67           C  
ATOM   2059  O   ALA A 264       8.129 -12.444 -16.387  1.00  0.67           O  
ATOM   2060  CB  ALA A 264       8.266 -15.288 -14.728  1.00  0.67           C  
ATOM   2061  N   VAL A 265       6.108 -13.324 -15.966  1.00  0.66           N  
ATOM   2062  CA  VAL A 265       5.454 -12.584 -17.028  1.00  0.66           C  
ATOM   2063  C   VAL A 265       5.230 -11.120 -16.664  1.00  0.66           C  
ATOM   2064  O   VAL A 265       5.602 -10.233 -17.425  1.00  0.66           O  
ATOM   2065  CB  VAL A 265       4.140 -13.246 -17.427  1.00  0.66           C  
ATOM   2066  CG1 VAL A 265       3.464 -12.472 -18.575  1.00  0.66           C  
ATOM   2067  CG2 VAL A 265       4.419 -14.694 -17.885  1.00  0.66           C  
ATOM   2068  N   ARG A 266       4.669 -10.809 -15.472  1.00  0.59           N  
ATOM   2069  CA  ARG A 266       4.332  -9.443 -15.088  1.00  0.59           C  
ATOM   2070  C   ARG A 266       5.540  -8.524 -14.983  1.00  0.59           C  
ATOM   2071  O   ARG A 266       5.541  -7.409 -15.503  1.00  0.59           O  
ATOM   2072  CB  ARG A 266       3.585  -9.423 -13.725  1.00  0.59           C  
ATOM   2073  CG  ARG A 266       3.010  -8.039 -13.332  1.00  0.59           C  
ATOM   2074  CD  ARG A 266       2.718  -7.848 -11.842  1.00  0.59           C  
ATOM   2075  NE  ARG A 266       4.026  -7.768 -11.149  1.00  0.59           N  
ATOM   2076  CZ  ARG A 266       4.190  -7.671  -9.831  1.00  0.59           C  
ATOM   2077  NH1 ARG A 266       3.202  -7.513  -8.966  1.00  0.59           N  
ATOM   2078  NH2 ARG A 266       5.412  -7.825  -9.357  1.00  0.59           N  
ATOM   2079  N   ASP A 267       6.626  -8.985 -14.339  1.00  0.64           N  
ATOM   2080  CA  ASP A 267       7.773  -8.148 -14.047  1.00  0.64           C  
ATOM   2081  C   ASP A 267       8.639  -7.968 -15.288  1.00  0.64           C  
ATOM   2082  O   ASP A 267       9.362  -6.983 -15.430  1.00  0.64           O  
ATOM   2083  CB  ASP A 267       8.571  -8.719 -12.836  1.00  0.64           C  
ATOM   2084  CG  ASP A 267       7.758  -8.595 -11.558  1.00  0.64           C  
ATOM   2085  OD1 ASP A 267       6.629  -8.045 -11.634  1.00  0.64           O  
ATOM   2086  OD2 ASP A 267       8.197  -9.015 -10.456  1.00  0.64           O  
ATOM   2087  N   GLY A 268       8.497  -8.872 -16.286  1.00  0.65           N  
ATOM   2088  CA  GLY A 268       9.113  -8.716 -17.597  1.00  0.65           C  
ATOM   2089  C   GLY A 268       8.396  -7.752 -18.503  1.00  0.65           C  
ATOM   2090  O   GLY A 268       8.899  -7.428 -19.579  1.00  0.65           O  
ATOM   2091  N   LEU A 269       7.214  -7.254 -18.095  1.00  0.55           N  
ATOM   2092  CA  LEU A 269       6.448  -6.284 -18.851  1.00  0.55           C  
ATOM   2093  C   LEU A 269       6.479  -4.902 -18.214  1.00  0.55           C  
ATOM   2094  O   LEU A 269       5.963  -3.940 -18.777  1.00  0.55           O  
ATOM   2095  CB  LEU A 269       4.972  -6.741 -18.955  1.00  0.55           C  
ATOM   2096  CG  LEU A 269       4.765  -8.034 -19.770  1.00  0.55           C  
ATOM   2097  CD1 LEU A 269       3.296  -8.476 -19.701  1.00  0.55           C  
ATOM   2098  CD2 LEU A 269       5.233  -7.886 -21.225  1.00  0.55           C  
ATOM   2099  N   VAL A 270       7.118  -4.724 -17.037  1.00  0.47           N  
ATOM   2100  CA  VAL A 270       7.143  -3.432 -16.356  1.00  0.47           C  
ATOM   2101  C   VAL A 270       7.851  -2.338 -17.156  1.00  0.47           C  
ATOM   2102  O   VAL A 270       9.062  -2.346 -17.377  1.00  0.47           O  
ATOM   2103  CB  VAL A 270       7.699  -3.516 -14.934  1.00  0.47           C  
ATOM   2104  CG1 VAL A 270       7.840  -2.120 -14.283  1.00  0.47           C  
ATOM   2105  CG2 VAL A 270       6.739  -4.366 -14.080  1.00  0.47           C  
ATOM   2106  N   GLY A 271       7.079  -1.323 -17.605  1.00  0.34           N  
ATOM   2107  CA  GLY A 271       7.603  -0.218 -18.395  1.00  0.34           C  
ATOM   2108  C   GLY A 271       7.672  -0.470 -19.872  1.00  0.34           C  
ATOM   2109  O   GLY A 271       8.348   0.273 -20.577  1.00  0.34           O  
ATOM   2110  N   ARG A 272       6.988  -1.505 -20.387  1.00  0.31           N  
ATOM   2111  CA  ARG A 272       6.955  -1.746 -21.813  1.00  0.31           C  
ATOM   2112  C   ARG A 272       5.678  -2.461 -22.205  1.00  0.31           C  
ATOM   2113  O   ARG A 272       4.912  -2.926 -21.368  1.00  0.31           O  
ATOM   2114  CB  ARG A 272       8.195  -2.543 -22.305  1.00  0.31           C  
ATOM   2115  CG  ARG A 272       8.278  -3.999 -21.803  1.00  0.31           C  
ATOM   2116  CD  ARG A 272       9.535  -4.722 -22.293  1.00  0.31           C  
ATOM   2117  NE  ARG A 272       9.354  -6.173 -21.992  1.00  0.31           N  
ATOM   2118  CZ  ARG A 272       9.068  -7.125 -22.890  1.00  0.31           C  
ATOM   2119  NH1 ARG A 272       8.839  -6.872 -24.173  1.00  0.31           N  
ATOM   2120  NH2 ARG A 272       8.999  -8.379 -22.468  1.00  0.31           N  
ATOM   2121  N   LYS A 273       5.397  -2.546 -23.517  1.00  0.39           N  
ATOM   2122  CA  LYS A 273       4.284  -3.323 -24.027  1.00  0.39           C  
ATOM   2123  C   LYS A 273       4.844  -4.366 -24.983  1.00  0.39           C  
ATOM   2124  O   LYS A 273       5.724  -4.025 -25.776  1.00  0.39           O  
ATOM   2125  CB  LYS A 273       3.224  -2.446 -24.743  1.00  0.39           C  
ATOM   2126  CG  LYS A 273       2.403  -1.602 -23.752  1.00  0.39           C  
ATOM   2127  CD  LYS A 273       1.292  -0.782 -24.431  1.00  0.39           C  
ATOM   2128  CE  LYS A 273       0.458   0.029 -23.431  1.00  0.39           C  
ATOM   2129  NZ  LYS A 273      -0.600   0.793 -24.134  1.00  0.39           N  
ATOM   2130  N   PRO A 274       4.434  -5.630 -24.932  1.00  0.51           N  
ATOM   2131  CA  PRO A 274       4.932  -6.643 -25.846  1.00  0.51           C  
ATOM   2132  C   PRO A 274       4.266  -6.531 -27.206  1.00  0.51           C  
ATOM   2133  O   PRO A 274       3.114  -6.105 -27.301  1.00  0.51           O  
ATOM   2134  CB  PRO A 274       4.556  -7.951 -25.134  1.00  0.51           C  
ATOM   2135  CG  PRO A 274       3.250  -7.639 -24.396  1.00  0.51           C  
ATOM   2136  CD  PRO A 274       3.363  -6.145 -24.070  1.00  0.51           C  
ATOM   2137  N   GLY A 275       4.977  -6.882 -28.299  1.00  0.55           N  
ATOM   2138  CA  GLY A 275       4.338  -7.036 -29.608  1.00  0.55           C  
ATOM   2139  C   GLY A 275       3.400  -8.230 -29.684  1.00  0.55           C  
ATOM   2140  O   GLY A 275       3.456  -9.087 -28.801  1.00  0.55           O  
ATOM   2141  N   PRO A 276       2.561  -8.375 -30.716  1.00  0.57           N  
ATOM   2142  CA  PRO A 276       1.554  -9.437 -30.803  1.00  0.57           C  
ATOM   2143  C   PRO A 276       2.058 -10.856 -30.589  1.00  0.57           C  
ATOM   2144  O   PRO A 276       1.498 -11.582 -29.768  1.00  0.57           O  
ATOM   2145  CB  PRO A 276       0.910  -9.232 -32.183  1.00  0.57           C  
ATOM   2146  CG  PRO A 276       1.037  -7.724 -32.422  1.00  0.57           C  
ATOM   2147  CD  PRO A 276       2.378  -7.371 -31.771  1.00  0.57           C  
ATOM   2148  N   ASP A 277       3.138 -11.258 -31.281  1.00  0.57           N  
ATOM   2149  CA  ASP A 277       3.752 -12.567 -31.165  1.00  0.57           C  
ATOM   2150  C   ASP A 277       4.289 -12.853 -29.767  1.00  0.57           C  
ATOM   2151  O   ASP A 277       4.090 -13.929 -29.198  1.00  0.57           O  
ATOM   2152  CB  ASP A 277       4.917 -12.660 -32.177  1.00  0.57           C  
ATOM   2153  CG  ASP A 277       4.408 -12.477 -33.595  1.00  0.57           C  
ATOM   2154  OD1 ASP A 277       3.246 -12.863 -33.868  1.00  0.57           O  
ATOM   2155  OD2 ASP A 277       5.180 -11.907 -34.403  1.00  0.57           O  
ATOM   2156  N   GLU A 278       4.956 -11.853 -29.150  1.00  0.52           N  
ATOM   2157  CA  GLU A 278       5.429 -11.937 -27.781  1.00  0.52           C  
ATOM   2158  C   GLU A 278       4.285 -12.067 -26.785  1.00  0.52           C  
ATOM   2159  O   GLU A 278       4.310 -12.910 -25.889  1.00  0.52           O  
ATOM   2160  CB  GLU A 278       6.310 -10.720 -27.408  1.00  0.52           C  
ATOM   2161  CG  GLU A 278       6.969 -10.878 -26.016  1.00  0.52           C  
ATOM   2162  CD  GLU A 278       7.774  -9.677 -25.547  1.00  0.52           C  
ATOM   2163  OE1 GLU A 278       8.505  -9.851 -24.538  1.00  0.52           O  
ATOM   2164  OE2 GLU A 278       7.668  -8.554 -26.103  1.00  0.52           O  
ATOM   2165  N   ALA A 279       3.205 -11.279 -26.966  1.00  0.57           N  
ATOM   2166  CA  ALA A 279       2.010 -11.352 -26.154  1.00  0.57           C  
ATOM   2167  C   ALA A 279       1.334 -12.720 -26.202  1.00  0.57           C  
ATOM   2168  O   ALA A 279       0.950 -13.273 -25.172  1.00  0.57           O  
ATOM   2169  CB  ALA A 279       1.030 -10.249 -26.603  1.00  0.57           C  
ATOM   2170  N   LEU A 280       1.233 -13.333 -27.399  1.00  0.53           N  
ATOM   2171  CA  LEU A 280       0.738 -14.687 -27.575  1.00  0.53           C  
ATOM   2172  C   LEU A 280       1.600 -15.746 -26.901  1.00  0.53           C  
ATOM   2173  O   LEU A 280       1.101 -16.658 -26.238  1.00  0.53           O  
ATOM   2174  CB  LEU A 280       0.605 -14.996 -29.085  1.00  0.53           C  
ATOM   2175  CG  LEU A 280       0.051 -16.394 -29.441  1.00  0.53           C  
ATOM   2176  CD1 LEU A 280      -1.352 -16.626 -28.862  1.00  0.53           C  
ATOM   2177  CD2 LEU A 280       0.021 -16.561 -30.966  1.00  0.53           C  
ATOM   2178  N   ALA A 281       2.936 -15.643 -27.018  1.00  0.60           N  
ATOM   2179  CA  ALA A 281       3.858 -16.539 -26.351  1.00  0.60           C  
ATOM   2180  C   ALA A 281       3.782 -16.473 -24.828  1.00  0.60           C  
ATOM   2181  O   ALA A 281       3.716 -17.496 -24.143  1.00  0.60           O  
ATOM   2182  CB  ALA A 281       5.285 -16.224 -26.830  1.00  0.60           C  
ATOM   2183  N   LEU A 282       3.721 -15.251 -24.264  1.00  0.62           N  
ATOM   2184  CA  LEU A 282       3.510 -15.026 -22.847  1.00  0.62           C  
ATOM   2185  C   LEU A 282       2.164 -15.529 -22.356  1.00  0.62           C  
ATOM   2186  O   LEU A 282       2.074 -16.144 -21.294  1.00  0.62           O  
ATOM   2187  CB  LEU A 282       3.649 -13.525 -22.513  1.00  0.62           C  
ATOM   2188  CG  LEU A 282       5.081 -12.974 -22.673  1.00  0.62           C  
ATOM   2189  CD1 LEU A 282       5.076 -11.447 -22.531  1.00  0.62           C  
ATOM   2190  CD2 LEU A 282       6.067 -13.592 -21.669  1.00  0.62           C  
ATOM   2191  N   PHE A 283       1.086 -15.324 -23.142  1.00  0.51           N  
ATOM   2192  CA  PHE A 283      -0.242 -15.834 -22.851  1.00  0.51           C  
ATOM   2193  C   PHE A 283      -0.279 -17.350 -22.738  1.00  0.51           C  
ATOM   2194  O   PHE A 283      -0.829 -17.891 -21.783  1.00  0.51           O  
ATOM   2195  CB  PHE A 283      -1.210 -15.364 -23.973  1.00  0.51           C  
ATOM   2196  CG  PHE A 283      -2.597 -15.937 -23.854  1.00  0.51           C  
ATOM   2197  CD1 PHE A 283      -2.936 -17.130 -24.519  1.00  0.51           C  
ATOM   2198  CD2 PHE A 283      -3.549 -15.315 -23.042  1.00  0.51           C  
ATOM   2199  CE1 PHE A 283      -4.189 -17.721 -24.325  1.00  0.51           C  
ATOM   2200  CE2 PHE A 283      -4.811 -15.889 -22.867  1.00  0.51           C  
ATOM   2201  CZ  PHE A 283      -5.125 -17.106 -23.485  1.00  0.51           C  
ATOM   2202  N   ARG A 284       0.334 -18.077 -23.692  1.00  0.56           N  
ATOM   2203  CA  ARG A 284       0.375 -19.527 -23.667  1.00  0.56           C  
ATOM   2204  C   ARG A 284       1.113 -20.068 -22.458  1.00  0.56           C  
ATOM   2205  O   ARG A 284       0.624 -20.964 -21.775  1.00  0.56           O  
ATOM   2206  CB  ARG A 284       1.051 -20.061 -24.947  1.00  0.56           C  
ATOM   2207  CG  ARG A 284       0.176 -19.909 -26.206  1.00  0.56           C  
ATOM   2208  CD  ARG A 284       0.920 -20.365 -27.462  1.00  0.56           C  
ATOM   2209  NE  ARG A 284      -0.018 -20.245 -28.625  1.00  0.56           N  
ATOM   2210  CZ  ARG A 284       0.373 -20.270 -29.906  1.00  0.56           C  
ATOM   2211  NH1 ARG A 284       1.658 -20.338 -30.241  1.00  0.56           N  
ATOM   2212  NH2 ARG A 284      -0.541 -20.228 -30.873  1.00  0.56           N  
ATOM   2213  N   ARG A 285       2.275 -19.470 -22.130  1.00  0.61           N  
ATOM   2214  CA  ARG A 285       3.044 -19.809 -20.947  1.00  0.61           C  
ATOM   2215  C   ARG A 285       2.277 -19.567 -19.654  1.00  0.61           C  
ATOM   2216  O   ARG A 285       2.251 -20.396 -18.746  1.00  0.61           O  
ATOM   2217  CB  ARG A 285       4.330 -18.944 -20.933  1.00  0.61           C  
ATOM   2218  CG  ARG A 285       5.265 -19.208 -19.735  1.00  0.61           C  
ATOM   2219  CD  ARG A 285       6.504 -18.311 -19.753  1.00  0.61           C  
ATOM   2220  NE  ARG A 285       7.264 -18.590 -18.493  1.00  0.61           N  
ATOM   2221  CZ  ARG A 285       8.404 -17.977 -18.149  1.00  0.61           C  
ATOM   2222  NH1 ARG A 285       8.964 -17.053 -18.925  1.00  0.61           N  
ATOM   2223  NH2 ARG A 285       8.998 -18.304 -17.003  1.00  0.61           N  
ATOM   2224  N   LEU A 286       1.597 -18.409 -19.543  1.00  0.59           N  
ATOM   2225  CA  LEU A 286       0.771 -18.097 -18.399  1.00  0.59           C  
ATOM   2226  C   LEU A 286      -0.452 -18.993 -18.292  1.00  0.59           C  
ATOM   2227  O   LEU A 286      -0.824 -19.426 -17.206  1.00  0.59           O  
ATOM   2228  CB  LEU A 286       0.385 -16.601 -18.400  1.00  0.59           C  
ATOM   2229  CG  LEU A 286      -0.131 -16.065 -17.049  1.00  0.59           C  
ATOM   2230  CD1 LEU A 286       0.896 -16.233 -15.916  1.00  0.59           C  
ATOM   2231  CD2 LEU A 286      -0.501 -14.583 -17.173  1.00  0.59           C  
ATOM   2232  N   ARG A 287      -1.093 -19.342 -19.426  1.00  0.48           N  
ATOM   2233  CA  ARG A 287      -2.189 -20.289 -19.476  1.00  0.48           C  
ATOM   2234  C   ARG A 287      -1.805 -21.688 -19.016  1.00  0.48           C  
ATOM   2235  O   ARG A 287      -2.534 -22.306 -18.241  1.00  0.48           O  
ATOM   2236  CB  ARG A 287      -2.789 -20.365 -20.909  1.00  0.48           C  
ATOM   2237  CG  ARG A 287      -4.107 -21.165 -21.020  1.00  0.48           C  
ATOM   2238  CD  ARG A 287      -5.250 -20.490 -20.257  1.00  0.48           C  
ATOM   2239  NE  ARG A 287      -6.433 -21.408 -20.242  1.00  0.48           N  
ATOM   2240  CZ  ARG A 287      -7.424 -21.280 -19.349  1.00  0.48           C  
ATOM   2241  NH1 ARG A 287      -7.440 -20.275 -18.477  1.00  0.48           N  
ATOM   2242  NH2 ARG A 287      -8.409 -22.175 -19.326  1.00  0.48           N  
ATOM   2243  N   GLU A 288      -0.634 -22.200 -19.449  1.00  0.59           N  
ATOM   2244  CA  GLU A 288      -0.085 -23.466 -18.997  1.00  0.59           C  
ATOM   2245  C   GLU A 288       0.226 -23.471 -17.509  1.00  0.59           C  
ATOM   2246  O   GLU A 288      -0.196 -24.350 -16.763  1.00  0.59           O  
ATOM   2247  CB  GLU A 288       1.200 -23.770 -19.797  1.00  0.59           C  
ATOM   2248  CG  GLU A 288       1.825 -25.159 -19.521  1.00  0.59           C  
ATOM   2249  CD  GLU A 288       3.070 -25.406 -20.372  1.00  0.59           C  
ATOM   2250  OE1 GLU A 288       3.578 -26.555 -20.315  1.00  0.59           O  
ATOM   2251  OE2 GLU A 288       3.522 -24.464 -21.074  1.00  0.59           O  
ATOM   2252  N   ALA A 289       0.889 -22.410 -17.011  1.00  0.64           N  
ATOM   2253  CA  ALA A 289       1.158 -22.235 -15.601  1.00  0.64           C  
ATOM   2254  C   ALA A 289      -0.093 -22.066 -14.749  1.00  0.64           C  
ATOM   2255  O   ALA A 289      -0.145 -22.469 -13.592  1.00  0.64           O  
ATOM   2256  CB  ALA A 289       2.077 -21.025 -15.411  1.00  0.64           C  
ATOM   2257  N   HIS A 290      -1.162 -21.479 -15.313  1.00  0.48           N  
ATOM   2258  CA  HIS A 290      -2.441 -21.328 -14.651  1.00  0.48           C  
ATOM   2259  C   HIS A 290      -3.117 -22.654 -14.336  1.00  0.48           C  
ATOM   2260  O   HIS A 290      -3.868 -22.754 -13.374  1.00  0.48           O  
ATOM   2261  CB  HIS A 290      -3.399 -20.445 -15.477  1.00  0.48           C  
ATOM   2262  CG  HIS A 290      -4.550 -19.935 -14.673  1.00  0.48           C  
ATOM   2263  ND1 HIS A 290      -4.426 -18.732 -14.001  1.00  0.48           N  
ATOM   2264  CD2 HIS A 290      -5.732 -20.529 -14.372  1.00  0.48           C  
ATOM   2265  CE1 HIS A 290      -5.539 -18.622 -13.298  1.00  0.48           C  
ATOM   2266  NE2 HIS A 290      -6.361 -19.683 -13.486  1.00  0.48           N  
ATOM   2267  N   ALA A 291      -2.819 -23.728 -15.096  1.00  0.49           N  
ATOM   2268  CA  ALA A 291      -3.350 -25.057 -14.843  1.00  0.49           C  
ATOM   2269  C   ALA A 291      -2.836 -25.664 -13.538  1.00  0.49           C  
ATOM   2270  O   ALA A 291      -3.458 -26.539 -12.944  1.00  0.49           O  
ATOM   2271  CB  ALA A 291      -2.990 -25.977 -16.025  1.00  0.49           C  
ATOM   2272  N   LEU A 292      -1.719 -25.130 -12.997  1.00  0.35           N  
ATOM   2273  CA  LEU A 292      -1.212 -25.493 -11.687  1.00  0.35           C  
ATOM   2274  C   LEU A 292      -2.124 -25.004 -10.559  1.00  0.35           C  
ATOM   2275  O   LEU A 292      -2.028 -25.464  -9.426  1.00  0.35           O  
ATOM   2276  CB  LEU A 292       0.193 -24.886 -11.451  1.00  0.35           C  
ATOM   2277  CG  LEU A 292       1.293 -25.319 -12.442  1.00  0.35           C  
ATOM   2278  CD1 LEU A 292       2.517 -24.401 -12.292  1.00  0.35           C  
ATOM   2279  CD2 LEU A 292       1.702 -26.782 -12.233  1.00  0.35           C  
ATOM   2280  N   TYR A 293      -3.076 -24.077 -10.831  1.00  0.33           N  
ATOM   2281  CA  TYR A 293      -4.069 -23.672  -9.850  1.00  0.33           C  
ATOM   2282  C   TYR A 293      -5.153 -24.719  -9.643  1.00  0.33           C  
ATOM   2283  O   TYR A 293      -5.867 -24.678  -8.641  1.00  0.33           O  
ATOM   2284  CB  TYR A 293      -4.741 -22.317 -10.197  1.00  0.33           C  
ATOM   2285  CG  TYR A 293      -3.798 -21.161  -9.983  1.00  0.33           C  
ATOM   2286  CD1 TYR A 293      -3.381 -20.803  -8.688  1.00  0.33           C  
ATOM   2287  CD2 TYR A 293      -3.375 -20.375 -11.064  1.00  0.33           C  
ATOM   2288  CE1 TYR A 293      -2.543 -19.695  -8.491  1.00  0.33           C  
ATOM   2289  CE2 TYR A 293      -2.523 -19.278 -10.873  1.00  0.33           C  
ATOM   2290  CZ  TYR A 293      -2.097 -18.949  -9.583  1.00  0.33           C  
ATOM   2291  OH  TYR A 293      -1.215 -17.871  -9.381  1.00  0.33           O  
ATOM   2292  N   ASP A 294      -5.261 -25.696 -10.562  1.00  0.35           N  
ATOM   2293  CA  ASP A 294      -6.246 -26.748 -10.490  1.00  0.35           C  
ATOM   2294  C   ASP A 294      -5.626 -28.018  -9.867  1.00  0.35           C  
ATOM   2295  O   ASP A 294      -6.299 -29.028  -9.657  1.00  0.35           O  
ATOM   2296  CB  ASP A 294      -6.814 -27.000 -11.919  1.00  0.35           C  
ATOM   2297  CG  ASP A 294      -7.429 -25.729 -12.501  1.00  0.35           C  
ATOM   2298  OD1 ASP A 294      -8.244 -25.081 -11.794  1.00  0.35           O  
ATOM   2299  OD2 ASP A 294      -7.104 -25.396 -13.672  1.00  0.35           O  
ATOM   2300  N   GLU A 295      -4.321 -27.996  -9.499  1.00  0.32           N  
ATOM   2301  CA  GLU A 295      -3.638 -29.149  -8.922  1.00  0.32           C  
ATOM   2302  C   GLU A 295      -3.663 -29.160  -7.384  1.00  0.32           C  
ATOM   2303  O   GLU A 295      -3.095 -28.277  -6.752  1.00  0.32           O  
ATOM   2304  CB  GLU A 295      -2.160 -29.246  -9.403  1.00  0.32           C  
ATOM   2305  CG  GLU A 295      -1.969 -29.458 -10.930  1.00  0.32           C  
ATOM   2306  CD  GLU A 295      -0.495 -29.660 -11.287  1.00  0.32           C  
ATOM   2307  OE1 GLU A 295      -0.213 -29.846 -12.498  1.00  0.32           O  
ATOM   2308  OE2 GLU A 295       0.360 -29.646 -10.363  1.00  0.32           O  
ATOM   2309  N   ALA A 296      -4.290 -30.202  -6.748  1.00  0.30           N  
ATOM   2310  CA  ALA A 296      -4.346 -30.413  -5.293  1.00  0.30           C  
ATOM   2311  C   ALA A 296      -4.899 -29.216  -4.466  1.00  0.30           C  
ATOM   2312  O   ALA A 296      -5.222 -28.168  -5.021  1.00  0.30           O  
ATOM   2313  CB  ALA A 296      -2.944 -30.892  -4.808  1.00  0.30           C  
ATOM   2314  N   PRO A 297      -5.043 -29.250  -3.141  1.00  0.26           N  
ATOM   2315  CA  PRO A 297      -5.432 -28.048  -2.415  1.00  0.26           C  
ATOM   2316  C   PRO A 297      -4.185 -27.219  -2.179  1.00  0.26           C  
ATOM   2317  O   PRO A 297      -3.295 -27.616  -1.431  1.00  0.26           O  
ATOM   2318  CB  PRO A 297      -6.040 -28.542  -1.086  1.00  0.26           C  
ATOM   2319  CG  PRO A 297      -5.614 -30.011  -0.940  1.00  0.26           C  
ATOM   2320  CD  PRO A 297      -5.210 -30.464  -2.346  1.00  0.26           C  
ATOM   2321  N   LEU A 298      -4.106 -26.064  -2.861  1.00  0.30           N  
ATOM   2322  CA  LEU A 298      -3.052 -25.091  -2.697  1.00  0.30           C  
ATOM   2323  C   LEU A 298      -3.137 -24.338  -1.381  1.00  0.30           C  
ATOM   2324  O   LEU A 298      -4.214 -24.122  -0.827  1.00  0.30           O  
ATOM   2325  CB  LEU A 298      -3.094 -24.067  -3.854  1.00  0.30           C  
ATOM   2326  CG  LEU A 298      -2.816 -24.674  -5.238  1.00  0.30           C  
ATOM   2327  CD1 LEU A 298      -3.012 -23.601  -6.306  1.00  0.30           C  
ATOM   2328  CD2 LEU A 298      -1.399 -25.257  -5.347  1.00  0.30           C  
ATOM   2329  N   SER A 299      -1.986 -23.886  -0.850  1.00  0.30           N  
ATOM   2330  CA  SER A 299      -1.958 -22.920   0.236  1.00  0.30           C  
ATOM   2331  C   SER A 299      -2.263 -21.517  -0.273  1.00  0.30           C  
ATOM   2332  O   SER A 299      -2.138 -21.225  -1.463  1.00  0.30           O  
ATOM   2333  CB  SER A 299      -0.639 -22.969   1.072  1.00  0.30           C  
ATOM   2334  OG  SER A 299       0.520 -22.463   0.391  1.00  0.30           O  
ATOM   2335  N   ASP A 300      -2.665 -20.583   0.613  1.00  0.33           N  
ATOM   2336  CA  ASP A 300      -2.947 -19.196   0.269  1.00  0.33           C  
ATOM   2337  C   ASP A 300      -1.745 -18.505  -0.362  1.00  0.33           C  
ATOM   2338  O   ASP A 300      -1.869 -17.647  -1.232  1.00  0.33           O  
ATOM   2339  CB  ASP A 300      -3.370 -18.390   1.517  1.00  0.33           C  
ATOM   2340  CG  ASP A 300      -4.648 -18.924   2.130  1.00  0.33           C  
ATOM   2341  OD1 ASP A 300      -5.400 -19.655   1.447  1.00  0.33           O  
ATOM   2342  OD2 ASP A 300      -4.862 -18.591   3.323  1.00  0.33           O  
ATOM   2343  N   TYR A 301      -0.526 -18.909   0.047  1.00  0.28           N  
ATOM   2344  CA  TYR A 301       0.719 -18.498  -0.569  1.00  0.28           C  
ATOM   2345  C   TYR A 301       0.820 -18.877  -2.045  1.00  0.28           C  
ATOM   2346  O   TYR A 301       1.169 -18.053  -2.889  1.00  0.28           O  
ATOM   2347  CB  TYR A 301       1.871 -19.148   0.249  1.00  0.28           C  
ATOM   2348  CG  TYR A 301       3.231 -18.914  -0.338  1.00  0.28           C  
ATOM   2349  CD1 TYR A 301       3.988 -19.988  -0.833  1.00  0.28           C  
ATOM   2350  CD2 TYR A 301       3.750 -17.615  -0.408  1.00  0.28           C  
ATOM   2351  CE1 TYR A 301       5.276 -19.764  -1.342  1.00  0.28           C  
ATOM   2352  CE2 TYR A 301       5.031 -17.391  -0.923  1.00  0.28           C  
ATOM   2353  CZ  TYR A 301       5.793 -18.467  -1.372  1.00  0.28           C  
ATOM   2354  OH  TYR A 301       7.099 -18.212  -1.796  1.00  0.28           O  
ATOM   2355  N   GLU A 302       0.489 -20.132  -2.385  1.00  0.77           N  
ATOM   2356  CA  GLU A 302       0.506 -20.637  -3.743  1.00  0.77           C  
ATOM   2357  C   GLU A 302      -0.630 -20.056  -4.570  1.00  0.77           C  
ATOM   2358  O   GLU A 302      -0.484 -19.743  -5.750  1.00  0.77           O  
ATOM   2359  CB  GLU A 302       0.464 -22.180  -3.713  1.00  0.77           C  
ATOM   2360  CG  GLU A 302       1.711 -22.779  -3.015  1.00  0.77           C  
ATOM   2361  CD  GLU A 302       1.499 -24.206  -2.534  1.00  0.77           C  
ATOM   2362  OE1 GLU A 302       2.347 -25.075  -2.841  1.00  0.77           O  
ATOM   2363  OE2 GLU A 302       0.525 -24.397  -1.757  1.00  0.77           O  
ATOM   2364  N   ALA A 303      -1.800 -19.838  -3.940  1.00  0.83           N  
ATOM   2365  CA  ALA A 303      -3.005 -19.409  -4.610  1.00  0.83           C  
ATOM   2366  C   ALA A 303      -3.140 -17.894  -4.733  1.00  0.83           C  
ATOM   2367  O   ALA A 303      -4.073 -17.401  -5.370  1.00  0.83           O  
ATOM   2368  CB  ALA A 303      -4.209 -19.963  -3.830  1.00  0.83           C  
ATOM   2369  N   GLU A 304      -2.167 -17.130  -4.186  1.00  0.38           N  
ATOM   2370  CA  GLU A 304      -2.174 -15.683  -4.027  1.00  0.38           C  
ATOM   2371  C   GLU A 304      -2.468 -14.907  -5.307  1.00  0.38           C  
ATOM   2372  O   GLU A 304      -3.185 -13.910  -5.299  1.00  0.38           O  
ATOM   2373  CB  GLU A 304      -0.788 -15.246  -3.467  1.00  0.38           C  
ATOM   2374  CG  GLU A 304      -0.687 -13.769  -3.008  1.00  0.38           C  
ATOM   2375  CD  GLU A 304       0.753 -13.306  -2.909  1.00  0.38           C  
ATOM   2376  OE1 GLU A 304       1.122 -12.394  -3.700  1.00  0.38           O  
ATOM   2377  OE2 GLU A 304       1.521 -13.836  -2.063  1.00  0.38           O  
ATOM   2378  N   ARG A 305      -1.935 -15.367  -6.456  1.00  0.38           N  
ATOM   2379  CA  ARG A 305      -2.027 -14.641  -7.710  1.00  0.38           C  
ATOM   2380  C   ARG A 305      -2.972 -15.263  -8.722  1.00  0.38           C  
ATOM   2381  O   ARG A 305      -2.919 -14.941  -9.908  1.00  0.38           O  
ATOM   2382  CB  ARG A 305      -0.621 -14.516  -8.345  1.00  0.38           C  
ATOM   2383  CG  ARG A 305       0.316 -13.592  -7.546  1.00  0.38           C  
ATOM   2384  CD  ARG A 305      -0.147 -12.126  -7.521  1.00  0.38           C  
ATOM   2385  NE  ARG A 305      -0.386 -11.761  -6.096  1.00  0.38           N  
ATOM   2386  CZ  ARG A 305      -0.720 -10.532  -5.706  1.00  0.38           C  
ATOM   2387  NH1 ARG A 305      -1.250  -9.638  -6.509  1.00  0.38           N  
ATOM   2388  NH2 ARG A 305      -0.528 -10.211  -4.437  1.00  0.38           N  
ATOM   2389  N   CYS A 306      -3.891 -16.162  -8.307  1.00  0.44           N  
ATOM   2390  CA  CYS A 306      -4.773 -16.853  -9.245  1.00  0.44           C  
ATOM   2391  C   CYS A 306      -5.688 -15.937 -10.043  1.00  0.44           C  
ATOM   2392  O   CYS A 306      -5.815 -16.041 -11.263  1.00  0.44           O  
ATOM   2393  CB  CYS A 306      -5.641 -17.901  -8.496  1.00  0.44           C  
ATOM   2394  SG  CYS A 306      -6.594 -18.989  -9.626  1.00  0.44           S  
ATOM   2395  N   THR A 307      -6.339 -14.986  -9.359  1.00  0.50           N  
ATOM   2396  CA  THR A 307      -7.216 -14.012  -9.992  1.00  0.50           C  
ATOM   2397  C   THR A 307      -6.454 -13.018 -10.849  1.00  0.50           C  
ATOM   2398  O   THR A 307      -6.847 -12.730 -11.978  1.00  0.50           O  
ATOM   2399  CB  THR A 307      -8.091 -13.299  -8.977  1.00  0.50           C  
ATOM   2400  OG1 THR A 307      -8.841 -14.263  -8.241  1.00  0.50           O  
ATOM   2401  CG2 THR A 307      -9.111 -12.386  -9.669  1.00  0.50           C  
ATOM   2402  N   ASP A 308      -5.301 -12.514 -10.364  1.00  0.52           N  
ATOM   2403  CA  ASP A 308      -4.437 -11.600 -11.097  1.00  0.52           C  
ATOM   2404  C   ASP A 308      -3.868 -12.208 -12.372  1.00  0.52           C  
ATOM   2405  O   ASP A 308      -3.755 -11.555 -13.407  1.00  0.52           O  
ATOM   2406  CB  ASP A 308      -3.268 -11.133 -10.221  1.00  0.52           C  
ATOM   2407  CG  ASP A 308      -3.791 -10.435  -8.998  1.00  0.52           C  
ATOM   2408  OD1 ASP A 308      -4.891  -9.844  -8.963  1.00  0.52           O  
ATOM   2409  OD2 ASP A 308      -3.064 -10.544  -7.993  1.00  0.52           O  
ATOM   2410  N   SER A 309      -3.531 -13.514 -12.339  1.00  0.58           N  
ATOM   2411  CA  SER A 309      -3.097 -14.278 -13.503  1.00  0.58           C  
ATOM   2412  C   SER A 309      -4.115 -14.286 -14.627  1.00  0.58           C  
ATOM   2413  O   SER A 309      -3.777 -14.085 -15.790  1.00  0.58           O  
ATOM   2414  CB  SER A 309      -2.787 -15.746 -13.111  1.00  0.58           C  
ATOM   2415  OG  SER A 309      -2.251 -16.500 -14.201  1.00  0.58           O  
ATOM   2416  N   LEU A 310      -5.411 -14.456 -14.306  1.00  0.60           N  
ATOM   2417  CA  LEU A 310      -6.482 -14.340 -15.278  1.00  0.60           C  
ATOM   2418  C   LEU A 310      -6.608 -12.945 -15.883  1.00  0.60           C  
ATOM   2419  O   LEU A 310      -6.814 -12.802 -17.086  1.00  0.60           O  
ATOM   2420  CB  LEU A 310      -7.838 -14.717 -14.647  1.00  0.60           C  
ATOM   2421  CG  LEU A 310      -7.973 -16.181 -14.195  1.00  0.60           C  
ATOM   2422  CD1 LEU A 310      -9.297 -16.353 -13.443  1.00  0.60           C  
ATOM   2423  CD2 LEU A 310      -7.915 -17.161 -15.374  1.00  0.60           C  
ATOM   2424  N   VAL A 311      -6.455 -11.874 -15.069  1.00  0.61           N  
ATOM   2425  CA  VAL A 311      -6.461 -10.494 -15.551  1.00  0.61           C  
ATOM   2426  C   VAL A 311      -5.332 -10.245 -16.540  1.00  0.61           C  
ATOM   2427  O   VAL A 311      -5.555  -9.737 -17.638  1.00  0.61           O  
ATOM   2428  CB  VAL A 311      -6.364  -9.493 -14.397  1.00  0.61           C  
ATOM   2429  CG1 VAL A 311      -6.245  -8.038 -14.899  1.00  0.61           C  
ATOM   2430  CG2 VAL A 311      -7.614  -9.618 -13.504  1.00  0.61           C  
ATOM   2431  N   LEU A 312      -4.106 -10.695 -16.207  1.00  0.62           N  
ATOM   2432  CA  LEU A 312      -2.943 -10.609 -17.070  1.00  0.62           C  
ATOM   2433  C   LEU A 312      -3.084 -11.409 -18.362  1.00  0.62           C  
ATOM   2434  O   LEU A 312      -2.709 -10.956 -19.442  1.00  0.62           O  
ATOM   2435  CB  LEU A 312      -1.688 -11.041 -16.275  1.00  0.62           C  
ATOM   2436  CG  LEU A 312      -0.336 -10.864 -17.000  1.00  0.62           C  
ATOM   2437  CD1 LEU A 312      -0.109  -9.419 -17.467  1.00  0.62           C  
ATOM   2438  CD2 LEU A 312       0.816 -11.290 -16.077  1.00  0.62           C  
ATOM   2439  N   GLN A 313      -3.693 -12.616 -18.316  1.00  0.62           N  
ATOM   2440  CA  GLN A 313      -4.037 -13.370 -19.514  1.00  0.62           C  
ATOM   2441  C   GLN A 313      -4.981 -12.608 -20.442  1.00  0.62           C  
ATOM   2442  O   GLN A 313      -4.777 -12.583 -21.653  1.00  0.62           O  
ATOM   2443  CB  GLN A 313      -4.670 -14.746 -19.175  1.00  0.62           C  
ATOM   2444  CG  GLN A 313      -3.680 -15.777 -18.590  1.00  0.62           C  
ATOM   2445  CD  GLN A 313      -4.390 -17.031 -18.071  1.00  0.62           C  
ATOM   2446  OE1 GLN A 313      -5.100 -17.763 -18.767  1.00  0.62           O  
ATOM   2447  NE2 GLN A 313      -4.185 -17.310 -16.764  1.00  0.62           N  
ATOM   2448  N   CYS A 314      -6.011 -11.920 -19.911  1.00  0.65           N  
ATOM   2449  CA  CYS A 314      -6.854 -11.041 -20.710  1.00  0.65           C  
ATOM   2450  C   CYS A 314      -6.125  -9.857 -21.328  1.00  0.65           C  
ATOM   2451  O   CYS A 314      -6.328  -9.548 -22.501  1.00  0.65           O  
ATOM   2452  CB  CYS A 314      -8.043 -10.494 -19.898  1.00  0.65           C  
ATOM   2453  SG  CYS A 314      -9.227 -11.811 -19.493  1.00  0.65           S  
ATOM   2454  N   GLU A 315      -5.228  -9.187 -20.577  1.00  0.55           N  
ATOM   2455  CA  GLU A 315      -4.399  -8.105 -21.093  1.00  0.55           C  
ATOM   2456  C   GLU A 315      -3.488  -8.549 -22.229  1.00  0.55           C  
ATOM   2457  O   GLU A 315      -3.387  -7.903 -23.272  1.00  0.55           O  
ATOM   2458  CB  GLU A 315      -3.506  -7.518 -19.977  1.00  0.55           C  
ATOM   2459  CG  GLU A 315      -4.293  -6.781 -18.872  1.00  0.55           C  
ATOM   2460  CD  GLU A 315      -3.410  -6.339 -17.707  1.00  0.55           C  
ATOM   2461  OE1 GLU A 315      -3.986  -5.776 -16.741  1.00  0.55           O  
ATOM   2462  OE2 GLU A 315      -2.177  -6.581 -17.755  1.00  0.55           O  
ATOM   2463  N   LEU A 316      -2.837  -9.719 -22.078  1.00  0.56           N  
ATOM   2464  CA  LEU A 316      -2.049 -10.336 -23.127  1.00  0.56           C  
ATOM   2465  C   LEU A 316      -2.875 -10.723 -24.340  1.00  0.56           C  
ATOM   2466  O   LEU A 316      -2.458 -10.491 -25.471  1.00  0.56           O  
ATOM   2467  CB  LEU A 316      -1.309 -11.580 -22.593  1.00  0.56           C  
ATOM   2468  CG  LEU A 316      -0.215 -11.251 -21.560  1.00  0.56           C  
ATOM   2469  CD1 LEU A 316       0.241 -12.523 -20.838  1.00  0.56           C  
ATOM   2470  CD2 LEU A 316       0.988 -10.555 -22.214  1.00  0.56           C  
ATOM   2471  N   ALA A 317      -4.091 -11.270 -24.130  1.00  0.58           N  
ATOM   2472  CA  ALA A 317      -5.035 -11.600 -25.177  1.00  0.58           C  
ATOM   2473  C   ALA A 317      -5.453 -10.409 -26.018  1.00  0.58           C  
ATOM   2474  O   ALA A 317      -5.488 -10.486 -27.243  1.00  0.58           O  
ATOM   2475  CB  ALA A 317      -6.239 -12.340 -24.581  1.00  0.58           C  
ATOM   2476  N   LEU A 318      -5.680  -9.235 -25.399  1.00  0.44           N  
ATOM   2477  CA  LEU A 318      -5.892  -7.994 -26.129  1.00  0.44           C  
ATOM   2478  C   LEU A 318      -4.724  -7.633 -27.040  1.00  0.44           C  
ATOM   2479  O   LEU A 318      -4.926  -7.205 -28.174  1.00  0.44           O  
ATOM   2480  CB  LEU A 318      -6.118  -6.798 -25.174  1.00  0.44           C  
ATOM   2481  CG  LEU A 318      -7.464  -6.793 -24.427  1.00  0.44           C  
ATOM   2482  CD1 LEU A 318      -7.479  -5.648 -23.405  1.00  0.44           C  
ATOM   2483  CD2 LEU A 318      -8.659  -6.650 -25.382  1.00  0.44           C  
ATOM   2484  N   GLY A 319      -3.472  -7.852 -26.581  1.00  0.48           N  
ATOM   2485  CA  GLY A 319      -2.262  -7.551 -27.341  1.00  0.48           C  
ATOM   2486  C   GLY A 319      -2.084  -8.305 -28.636  1.00  0.48           C  
ATOM   2487  O   GLY A 319      -1.388  -7.831 -29.528  1.00  0.48           O  
ATOM   2488  N   PHE A 320      -2.704  -9.492 -28.789  1.00  0.39           N  
ATOM   2489  CA  PHE A 320      -2.659 -10.228 -30.045  1.00  0.39           C  
ATOM   2490  C   PHE A 320      -4.017 -10.370 -30.711  1.00  0.39           C  
ATOM   2491  O   PHE A 320      -4.151 -11.053 -31.723  1.00  0.39           O  
ATOM   2492  CB  PHE A 320      -1.967 -11.608 -29.894  1.00  0.39           C  
ATOM   2493  CG  PHE A 320      -2.647 -12.553 -28.943  1.00  0.39           C  
ATOM   2494  CD1 PHE A 320      -2.178 -12.663 -27.631  1.00  0.39           C  
ATOM   2495  CD2 PHE A 320      -3.698 -13.387 -29.364  1.00  0.39           C  
ATOM   2496  CE1 PHE A 320      -2.721 -13.610 -26.759  1.00  0.39           C  
ATOM   2497  CE2 PHE A 320      -4.257 -14.327 -28.488  1.00  0.39           C  
ATOM   2498  CZ  PHE A 320      -3.767 -14.439 -27.182  1.00  0.39           C  
ATOM   2499  N   GLY A 321      -5.067  -9.703 -30.192  1.00  0.47           N  
ATOM   2500  CA  GLY A 321      -6.393  -9.781 -30.801  1.00  0.47           C  
ATOM   2501  C   GLY A 321      -7.196 -11.005 -30.429  1.00  0.47           C  
ATOM   2502  O   GLY A 321      -8.139 -11.377 -31.126  1.00  0.47           O  
ATOM   2503  N   GLY A 322      -6.852 -11.669 -29.310  1.00  0.47           N  
ATOM   2504  CA  GLY A 322      -7.459 -12.918 -28.860  1.00  0.47           C  
ATOM   2505  C   GLY A 322      -8.817 -12.764 -28.233  1.00  0.47           C  
ATOM   2506  O   GLY A 322      -9.004 -12.911 -27.027  1.00  0.47           O  
ATOM   2507  N   GLY A 323      -9.836 -12.476 -29.066  1.00  0.45           N  
ATOM   2508  CA  GLY A 323     -11.219 -12.306 -28.632  1.00  0.45           C  
ATOM   2509  C   GLY A 323     -11.879 -13.566 -28.149  1.00  0.45           C  
ATOM   2510  O   GLY A 323     -12.763 -13.527 -27.299  1.00  0.45           O  
ATOM   2511  N   ARG A 324     -11.461 -14.733 -28.676  1.00  0.40           N  
ATOM   2512  CA  ARG A 324     -11.954 -16.015 -28.207  1.00  0.40           C  
ATOM   2513  C   ARG A 324     -11.439 -16.340 -26.817  1.00  0.40           C  
ATOM   2514  O   ARG A 324     -12.198 -16.700 -25.924  1.00  0.40           O  
ATOM   2515  CB  ARG A 324     -11.541 -17.149 -29.174  1.00  0.40           C  
ATOM   2516  CG  ARG A 324     -12.275 -17.100 -30.530  1.00  0.40           C  
ATOM   2517  CD  ARG A 324     -11.899 -18.288 -31.421  1.00  0.40           C  
ATOM   2518  NE  ARG A 324     -12.694 -18.187 -32.694  1.00  0.40           N  
ATOM   2519  CZ  ARG A 324     -12.772 -19.169 -33.604  1.00  0.40           C  
ATOM   2520  NH1 ARG A 324     -12.162 -20.336 -33.423  1.00  0.40           N  
ATOM   2521  NH2 ARG A 324     -13.476 -18.982 -34.719  1.00  0.40           N  
ATOM   2522  N   GLU A 325     -10.133 -16.131 -26.590  1.00  0.50           N  
ATOM   2523  CA  GLU A 325      -9.447 -16.342 -25.338  1.00  0.50           C  
ATOM   2524  C   GLU A 325     -10.018 -15.481 -24.225  1.00  0.50           C  
ATOM   2525  O   GLU A 325     -10.237 -15.930 -23.102  1.00  0.50           O  
ATOM   2526  CB  GLU A 325      -7.941 -16.014 -25.519  1.00  0.50           C  
ATOM   2527  CG  GLU A 325      -7.163 -16.978 -26.463  1.00  0.50           C  
ATOM   2528  CD  GLU A 325      -7.350 -16.781 -27.973  1.00  0.50           C  
ATOM   2529  OE1 GLU A 325      -6.635 -17.495 -28.720  1.00  0.50           O  
ATOM   2530  OE2 GLU A 325      -8.179 -15.935 -28.405  1.00  0.50           O  
ATOM   2531  N   ILE A 326     -10.331 -14.208 -24.526  1.00  0.49           N  
ATOM   2532  CA  ILE A 326     -11.042 -13.319 -23.620  1.00  0.49           C  
ATOM   2533  C   ILE A 326     -12.443 -13.807 -23.275  1.00  0.49           C  
ATOM   2534  O   ILE A 326     -12.860 -13.744 -22.118  1.00  0.49           O  
ATOM   2535  CB  ILE A 326     -11.097 -11.907 -24.184  1.00  0.49           C  
ATOM   2536  CG1 ILE A 326      -9.673 -11.312 -24.218  1.00  0.49           C  
ATOM   2537  CG2 ILE A 326     -12.030 -11.020 -23.336  1.00  0.49           C  
ATOM   2538  CD1 ILE A 326      -9.571 -10.013 -25.020  1.00  0.49           C  
ATOM   2539  N   ALA A 327     -13.200 -14.336 -24.258  1.00  0.50           N  
ATOM   2540  CA  ALA A 327     -14.524 -14.884 -24.043  1.00  0.50           C  
ATOM   2541  C   ALA A 327     -14.536 -16.056 -23.068  1.00  0.50           C  
ATOM   2542  O   ALA A 327     -15.388 -16.119 -22.186  1.00  0.50           O  
ATOM   2543  CB  ALA A 327     -15.136 -15.296 -25.397  1.00  0.50           C  
ATOM   2544  N   ASP A 328     -13.552 -16.968 -23.168  1.00  0.53           N  
ATOM   2545  CA  ASP A 328     -13.324 -18.028 -22.205  1.00  0.53           C  
ATOM   2546  C   ASP A 328     -12.925 -17.522 -20.806  1.00  0.53           C  
ATOM   2547  O   ASP A 328     -13.403 -18.000 -19.775  1.00  0.53           O  
ATOM   2548  CB  ASP A 328     -12.204 -18.959 -22.740  1.00  0.53           C  
ATOM   2549  CG  ASP A 328     -12.621 -19.734 -23.983  1.00  0.53           C  
ATOM   2550  OD1 ASP A 328     -13.828 -19.749 -24.328  1.00  0.53           O  
ATOM   2551  OD2 ASP A 328     -11.705 -20.366 -24.571  1.00  0.53           O  
ATOM   2552  N   LEU A 329     -12.013 -16.531 -20.721  1.00  0.57           N  
ATOM   2553  CA  LEU A 329     -11.509 -15.999 -19.463  1.00  0.57           C  
ATOM   2554  C   LEU A 329     -12.465 -15.113 -18.673  1.00  0.57           C  
ATOM   2555  O   LEU A 329     -12.479 -15.143 -17.441  1.00  0.57           O  
ATOM   2556  CB  LEU A 329     -10.194 -15.224 -19.688  1.00  0.57           C  
ATOM   2557  CG  LEU A 329      -9.015 -16.096 -20.154  1.00  0.57           C  
ATOM   2558  CD1 LEU A 329      -7.887 -15.191 -20.651  1.00  0.57           C  
ATOM   2559  CD2 LEU A 329      -8.486 -17.027 -19.055  1.00  0.57           C  
ATOM   2560  N   ALA A 330     -13.291 -14.284 -19.339  1.00  0.52           N  
ATOM   2561  CA  ALA A 330     -14.176 -13.332 -18.691  1.00  0.52           C  
ATOM   2562  C   ALA A 330     -15.198 -13.935 -17.712  1.00  0.52           C  
ATOM   2563  O   ALA A 330     -15.345 -13.373 -16.621  1.00  0.52           O  
ATOM   2564  CB  ALA A 330     -14.846 -12.437 -19.757  1.00  0.52           C  
ATOM   2565  N   PRO A 331     -15.881 -15.064 -17.945  1.00  0.42           N  
ATOM   2566  CA  PRO A 331     -16.707 -15.711 -16.931  1.00  0.42           C  
ATOM   2567  C   PRO A 331     -15.932 -16.144 -15.703  1.00  0.42           C  
ATOM   2568  O   PRO A 331     -16.455 -16.050 -14.593  1.00  0.42           O  
ATOM   2569  CB  PRO A 331     -17.325 -16.923 -17.654  1.00  0.42           C  
ATOM   2570  CG  PRO A 331     -17.317 -16.525 -19.130  1.00  0.42           C  
ATOM   2571  CD  PRO A 331     -16.036 -15.709 -19.249  1.00  0.42           C  
ATOM   2572  N   LEU A 332     -14.679 -16.614 -15.869  1.00  0.53           N  
ATOM   2573  CA  LEU A 332     -13.815 -16.992 -14.766  1.00  0.53           C  
ATOM   2574  C   LEU A 332     -13.449 -15.816 -13.873  1.00  0.53           C  
ATOM   2575  O   LEU A 332     -13.448 -15.931 -12.650  1.00  0.53           O  
ATOM   2576  CB  LEU A 332     -12.510 -17.661 -15.261  1.00  0.53           C  
ATOM   2577  CG  LEU A 332     -12.701 -18.934 -16.109  1.00  0.53           C  
ATOM   2578  CD1 LEU A 332     -11.336 -19.427 -16.612  1.00  0.53           C  
ATOM   2579  CD2 LEU A 332     -13.408 -20.057 -15.336  1.00  0.53           C  
ATOM   2580  N   LEU A 333     -13.155 -14.637 -14.460  1.00  0.50           N  
ATOM   2581  CA  LEU A 333     -12.947 -13.405 -13.713  1.00  0.50           C  
ATOM   2582  C   LEU A 333     -14.176 -12.957 -12.945  1.00  0.50           C  
ATOM   2583  O   LEU A 333     -14.096 -12.616 -11.765  1.00  0.50           O  
ATOM   2584  CB  LEU A 333     -12.529 -12.259 -14.664  1.00  0.50           C  
ATOM   2585  CG  LEU A 333     -11.065 -12.336 -15.127  1.00  0.50           C  
ATOM   2586  CD1 LEU A 333     -10.795 -11.285 -16.212  1.00  0.50           C  
ATOM   2587  CD2 LEU A 333     -10.101 -12.124 -13.951  1.00  0.50           C  
ATOM   2588  N   HIS A 334     -15.361 -13.011 -13.584  1.00  0.29           N  
ATOM   2589  CA  HIS A 334     -16.627 -12.661 -12.960  1.00  0.29           C  
ATOM   2590  C   HIS A 334     -16.951 -13.526 -11.749  1.00  0.29           C  
ATOM   2591  O   HIS A 334     -17.320 -13.031 -10.686  1.00  0.29           O  
ATOM   2592  CB  HIS A 334     -17.768 -12.786 -13.993  1.00  0.29           C  
ATOM   2593  CG  HIS A 334     -19.097 -12.359 -13.461  1.00  0.29           C  
ATOM   2594  ND1 HIS A 334     -19.394 -11.016 -13.392  1.00  0.29           N  
ATOM   2595  CD2 HIS A 334     -20.107 -13.096 -12.931  1.00  0.29           C  
ATOM   2596  CE1 HIS A 334     -20.582 -10.956 -12.827  1.00  0.29           C  
ATOM   2597  NE2 HIS A 334     -21.059 -12.187 -12.524  1.00  0.29           N  
ATOM   2598  N   ALA A 335     -16.728 -14.852 -11.858  1.00  0.47           N  
ATOM   2599  CA  ALA A 335     -16.951 -15.801 -10.787  1.00  0.47           C  
ATOM   2600  C   ALA A 335     -15.995 -15.636  -9.607  1.00  0.47           C  
ATOM   2601  O   ALA A 335     -16.272 -16.073  -8.493  1.00  0.47           O  
ATOM   2602  CB  ALA A 335     -16.810 -17.219 -11.374  1.00  0.47           C  
ATOM   2603  N   ARG A 336     -14.851 -14.959  -9.817  1.00  0.37           N  
ATOM   2604  CA  ARG A 336     -13.872 -14.693  -8.782  1.00  0.37           C  
ATOM   2605  C   ARG A 336     -13.979 -13.279  -8.241  1.00  0.37           C  
ATOM   2606  O   ARG A 336     -13.068 -12.790  -7.573  1.00  0.37           O  
ATOM   2607  CB  ARG A 336     -12.444 -14.923  -9.320  1.00  0.37           C  
ATOM   2608  CG  ARG A 336     -12.181 -16.403  -9.639  1.00  0.37           C  
ATOM   2609  CD  ARG A 336     -10.760 -16.662 -10.146  1.00  0.37           C  
ATOM   2610  NE  ARG A 336      -9.942 -17.196  -9.009  1.00  0.37           N  
ATOM   2611  CZ  ARG A 336      -9.953 -18.483  -8.629  1.00  0.37           C  
ATOM   2612  NH1 ARG A 336     -10.656 -19.399  -9.291  1.00  0.37           N  
ATOM   2613  NH2 ARG A 336      -9.247 -18.867  -7.568  1.00  0.37           N  
ATOM   2614  N   GLY A 337     -15.103 -12.580  -8.500  1.00  0.39           N  
ATOM   2615  CA  GLY A 337     -15.361 -11.284  -7.888  1.00  0.39           C  
ATOM   2616  C   GLY A 337     -14.745 -10.130  -8.615  1.00  0.39           C  
ATOM   2617  O   GLY A 337     -14.567  -9.054  -8.048  1.00  0.39           O  
ATOM   2618  N   ARG A 338     -14.411 -10.307  -9.904  1.00  0.29           N  
ATOM   2619  CA  ARG A 338     -13.955  -9.223 -10.757  1.00  0.29           C  
ATOM   2620  C   ARG A 338     -14.926  -8.942 -11.908  1.00  0.29           C  
ATOM   2621  O   ARG A 338     -14.588  -9.197 -13.068  1.00  0.29           O  
ATOM   2622  CB  ARG A 338     -12.550  -9.557 -11.313  1.00  0.29           C  
ATOM   2623  CG  ARG A 338     -11.463  -9.751 -10.233  1.00  0.29           C  
ATOM   2624  CD  ARG A 338     -11.211  -8.498  -9.386  1.00  0.29           C  
ATOM   2625  NE  ARG A 338     -10.036  -8.774  -8.487  1.00  0.29           N  
ATOM   2626  CZ  ARG A 338      -9.864  -8.193  -7.294  1.00  0.29           C  
ATOM   2627  NH1 ARG A 338     -10.804  -7.428  -6.750  1.00  0.29           N  
ATOM   2628  NH2 ARG A 338      -8.725  -8.386  -6.629  1.00  0.29           N  
ATOM   2629  N   PRO A 339     -16.144  -8.428 -11.675  1.00  0.33           N  
ATOM   2630  CA  PRO A 339     -17.127  -8.233 -12.733  1.00  0.33           C  
ATOM   2631  C   PRO A 339     -16.778  -7.068 -13.630  1.00  0.33           C  
ATOM   2632  O   PRO A 339     -17.121  -7.089 -14.809  1.00  0.33           O  
ATOM   2633  CB  PRO A 339     -18.436  -7.959 -11.968  1.00  0.33           C  
ATOM   2634  CG  PRO A 339     -17.992  -7.350 -10.635  1.00  0.33           C  
ATOM   2635  CD  PRO A 339     -16.693  -8.099 -10.354  1.00  0.33           C  
ATOM   2636  N   LEU A 340     -16.128  -6.014 -13.106  1.00  0.30           N  
ATOM   2637  CA  LEU A 340     -15.772  -4.853 -13.893  1.00  0.30           C  
ATOM   2638  C   LEU A 340     -14.730  -5.165 -14.943  1.00  0.30           C  
ATOM   2639  O   LEU A 340     -14.884  -4.820 -16.115  1.00  0.30           O  
ATOM   2640  CB  LEU A 340     -15.236  -3.744 -12.963  1.00  0.30           C  
ATOM   2641  CG  LEU A 340     -14.790  -2.455 -13.682  1.00  0.30           C  
ATOM   2642  CD1 LEU A 340     -15.970  -1.772 -14.394  1.00  0.30           C  
ATOM   2643  CD2 LEU A 340     -14.130  -1.523 -12.661  1.00  0.30           C  
ATOM   2644  N   GLU A 341     -13.664  -5.879 -14.548  1.00  0.34           N  
ATOM   2645  CA  GLU A 341     -12.621  -6.352 -15.419  1.00  0.34           C  
ATOM   2646  C   GLU A 341     -13.157  -7.316 -16.458  1.00  0.34           C  
ATOM   2647  O   GLU A 341     -12.858  -7.197 -17.643  1.00  0.34           O  
ATOM   2648  CB  GLU A 341     -11.501  -7.031 -14.595  1.00  0.34           C  
ATOM   2649  CG  GLU A 341     -10.810  -6.093 -13.567  1.00  0.34           C  
ATOM   2650  CD  GLU A 341     -11.474  -6.003 -12.189  1.00  0.34           C  
ATOM   2651  OE1 GLU A 341     -10.736  -5.691 -11.222  1.00  0.34           O  
ATOM   2652  OE2 GLU A 341     -12.702  -6.263 -12.066  1.00  0.34           O  
ATOM   2653  N   ALA A 342     -14.032  -8.261 -16.054  1.00  0.43           N  
ATOM   2654  CA  ALA A 342     -14.675  -9.182 -16.968  1.00  0.43           C  
ATOM   2655  C   ALA A 342     -15.508  -8.498 -18.049  1.00  0.43           C  
ATOM   2656  O   ALA A 342     -15.338  -8.765 -19.238  1.00  0.43           O  
ATOM   2657  CB  ALA A 342     -15.569 -10.133 -16.152  1.00  0.43           C  
ATOM   2658  N   SER A 343     -16.363  -7.531 -17.657  1.00  0.36           N  
ATOM   2659  CA  SER A 343     -17.137  -6.709 -18.575  1.00  0.36           C  
ATOM   2660  C   SER A 343     -16.285  -5.846 -19.475  1.00  0.36           C  
ATOM   2661  O   SER A 343     -16.560  -5.728 -20.666  1.00  0.36           O  
ATOM   2662  CB  SER A 343     -18.109  -5.771 -17.825  1.00  0.36           C  
ATOM   2663  OG  SER A 343     -19.125  -6.547 -17.197  1.00  0.36           O  
ATOM   2664  N   TYR A 344     -15.209  -5.227 -18.939  1.00  0.30           N  
ATOM   2665  CA  TYR A 344     -14.275  -4.429 -19.716  1.00  0.30           C  
ATOM   2666  C   TYR A 344     -13.588  -5.227 -20.812  1.00  0.30           C  
ATOM   2667  O   TYR A 344     -13.553  -4.794 -21.958  1.00  0.30           O  
ATOM   2668  CB  TYR A 344     -13.208  -3.804 -18.758  1.00  0.30           C  
ATOM   2669  CG  TYR A 344     -12.063  -3.122 -19.475  1.00  0.30           C  
ATOM   2670  CD1 TYR A 344     -10.852  -3.814 -19.656  1.00  0.30           C  
ATOM   2671  CD2 TYR A 344     -12.208  -1.845 -20.038  1.00  0.30           C  
ATOM   2672  CE1 TYR A 344      -9.811  -3.248 -20.403  1.00  0.30           C  
ATOM   2673  CE2 TYR A 344     -11.163  -1.273 -20.781  1.00  0.30           C  
ATOM   2674  CZ  TYR A 344      -9.969  -1.981 -20.970  1.00  0.30           C  
ATOM   2675  OH  TYR A 344      -8.926  -1.426 -21.736  1.00  0.30           O  
ATOM   2676  N   TYR A 345     -13.044  -6.416 -20.489  1.00  0.31           N  
ATOM   2677  CA  TYR A 345     -12.362  -7.234 -21.470  1.00  0.31           C  
ATOM   2678  C   TYR A 345     -13.292  -7.783 -22.538  1.00  0.31           C  
ATOM   2679  O   TYR A 345     -12.943  -7.820 -23.714  1.00  0.31           O  
ATOM   2680  CB  TYR A 345     -11.591  -8.396 -20.784  1.00  0.31           C  
ATOM   2681  CG  TYR A 345     -10.418  -7.878 -19.996  1.00  0.31           C  
ATOM   2682  CD1 TYR A 345      -9.433  -7.112 -20.639  1.00  0.31           C  
ATOM   2683  CD2 TYR A 345     -10.263  -8.163 -18.627  1.00  0.31           C  
ATOM   2684  CE1 TYR A 345      -8.370  -6.561 -19.912  1.00  0.31           C  
ATOM   2685  CE2 TYR A 345      -9.197  -7.614 -17.896  1.00  0.31           C  
ATOM   2686  CZ  TYR A 345      -8.276  -6.780 -18.537  1.00  0.31           C  
ATOM   2687  OH  TYR A 345      -7.302  -6.069 -17.816  1.00  0.31           O  
ATOM   2688  N   GLN A 346     -14.503  -8.230 -22.150  1.00  0.32           N  
ATOM   2689  CA  GLN A 346     -15.501  -8.729 -23.077  1.00  0.32           C  
ATOM   2690  C   GLN A 346     -16.036  -7.678 -24.042  1.00  0.32           C  
ATOM   2691  O   GLN A 346     -16.288  -7.949 -25.216  1.00  0.32           O  
ATOM   2692  CB  GLN A 346     -16.672  -9.355 -22.283  1.00  0.32           C  
ATOM   2693  CG  GLN A 346     -17.682 -10.118 -23.169  1.00  0.32           C  
ATOM   2694  CD  GLN A 346     -18.802 -10.745 -22.340  1.00  0.32           C  
ATOM   2695  OE1 GLN A 346     -18.752 -10.872 -21.119  1.00  0.32           O  
ATOM   2696  NE2 GLN A 346     -19.874 -11.173 -23.046  1.00  0.32           N  
ATOM   2697  N   ALA A 347     -16.248  -6.445 -23.551  1.00  0.33           N  
ATOM   2698  CA  ALA A 347     -16.631  -5.314 -24.358  1.00  0.33           C  
ATOM   2699  C   ALA A 347     -15.569  -4.858 -25.358  1.00  0.33           C  
ATOM   2700  O   ALA A 347     -14.373  -5.088 -25.213  1.00  0.33           O  
ATOM   2701  CB  ALA A 347     -17.028  -4.139 -23.449  1.00  0.33           C  
ATOM   2702  N   PHE A 348     -16.002  -4.185 -26.438  1.00  0.19           N  
ATOM   2703  CA  PHE A 348     -15.088  -3.726 -27.458  1.00  0.19           C  
ATOM   2704  C   PHE A 348     -15.529  -2.355 -27.942  1.00  0.19           C  
ATOM   2705  O   PHE A 348     -16.706  -2.123 -28.214  1.00  0.19           O  
ATOM   2706  CB  PHE A 348     -15.065  -4.750 -28.622  1.00  0.19           C  
ATOM   2707  CG  PHE A 348     -13.904  -4.517 -29.544  1.00  0.19           C  
ATOM   2708  CD1 PHE A 348     -14.089  -3.875 -30.778  1.00  0.19           C  
ATOM   2709  CD2 PHE A 348     -12.615  -4.940 -29.177  1.00  0.19           C  
ATOM   2710  CE1 PHE A 348     -13.003  -3.655 -31.629  1.00  0.19           C  
ATOM   2711  CE2 PHE A 348     -11.523  -4.713 -30.026  1.00  0.19           C  
ATOM   2712  CZ  PHE A 348     -11.718  -4.063 -31.251  1.00  0.19           C  
ATOM   2713  N   ALA A 349     -14.584  -1.403 -28.040  1.00  0.19           N  
ATOM   2714  CA  ALA A 349     -14.847  -0.074 -28.535  1.00  0.19           C  
ATOM   2715  C   ALA A 349     -13.561   0.467 -29.135  1.00  0.19           C  
ATOM   2716  O   ALA A 349     -12.470   0.139 -28.674  1.00  0.19           O  
ATOM   2717  CB  ALA A 349     -15.347   0.849 -27.402  1.00  0.19           C  
ATOM   2718  N   GLU A 350     -13.667   1.310 -30.178  1.00  0.10           N  
ATOM   2719  CA  GLU A 350     -12.533   1.840 -30.912  1.00  0.10           C  
ATOM   2720  C   GLU A 350     -12.715   3.333 -31.074  1.00  0.10           C  
ATOM   2721  O   GLU A 350     -13.773   3.886 -30.774  1.00  0.10           O  
ATOM   2722  CB  GLU A 350     -12.391   1.213 -32.319  1.00  0.10           C  
ATOM   2723  CG  GLU A 350     -12.037  -0.292 -32.309  1.00  0.10           C  
ATOM   2724  CD  GLU A 350     -11.813  -0.845 -33.717  1.00  0.10           C  
ATOM   2725  OE1 GLU A 350     -12.222  -0.174 -34.698  1.00  0.10           O  
ATOM   2726  OE2 GLU A 350     -11.233  -1.957 -33.811  1.00  0.10           O  
ATOM   2727  N   PHE A 351     -11.658   4.038 -31.515  1.00  0.09           N  
ATOM   2728  CA  PHE A 351     -11.659   5.482 -31.543  1.00  0.09           C  
ATOM   2729  C   PHE A 351     -10.623   6.013 -32.521  1.00  0.09           C  
ATOM   2730  O   PHE A 351      -9.765   5.296 -33.030  1.00  0.09           O  
ATOM   2731  CB  PHE A 351     -11.431   6.092 -30.121  1.00  0.09           C  
ATOM   2732  CG  PHE A 351     -10.126   5.649 -29.502  1.00  0.09           C  
ATOM   2733  CD1 PHE A 351     -10.045   4.449 -28.774  1.00  0.09           C  
ATOM   2734  CD2 PHE A 351      -8.967   6.425 -29.663  1.00  0.09           C  
ATOM   2735  CE1 PHE A 351      -8.824   4.019 -28.241  1.00  0.09           C  
ATOM   2736  CE2 PHE A 351      -7.743   6.001 -29.130  1.00  0.09           C  
ATOM   2737  CZ  PHE A 351      -7.671   4.794 -28.423  1.00  0.09           C  
ATOM   2738  N   SER A 352     -10.681   7.327 -32.786  1.00  0.16           N  
ATOM   2739  CA  SER A 352      -9.638   8.071 -33.464  1.00  0.16           C  
ATOM   2740  C   SER A 352      -9.421   9.332 -32.650  1.00  0.16           C  
ATOM   2741  O   SER A 352     -10.053   9.516 -31.612  1.00  0.16           O  
ATOM   2742  CB  SER A 352      -9.935   8.377 -34.960  1.00  0.16           C  
ATOM   2743  OG  SER A 352     -11.038   9.267 -35.133  1.00  0.16           O  
ATOM   2744  N   ALA A 353      -8.481  10.215 -33.037  1.00  0.20           N  
ATOM   2745  CA  ALA A 353      -8.147  11.337 -32.191  1.00  0.20           C  
ATOM   2746  C   ALA A 353      -7.550  12.478 -32.984  1.00  0.20           C  
ATOM   2747  O   ALA A 353      -7.095  12.319 -34.116  1.00  0.20           O  
ATOM   2748  CB  ALA A 353      -7.100  10.920 -31.136  1.00  0.20           C  
ATOM   2749  N   LEU A 354      -7.528  13.678 -32.371  1.00  0.21           N  
ATOM   2750  CA  LEU A 354      -6.878  14.840 -32.941  1.00  0.21           C  
ATOM   2751  C   LEU A 354      -5.406  14.932 -32.600  1.00  0.21           C  
ATOM   2752  O   LEU A 354      -4.582  15.187 -33.474  1.00  0.21           O  
ATOM   2753  CB  LEU A 354      -7.592  16.122 -32.474  1.00  0.21           C  
ATOM   2754  CG  LEU A 354      -6.969  17.446 -32.970  1.00  0.21           C  
ATOM   2755  CD1 LEU A 354      -6.919  17.528 -34.509  1.00  0.21           C  
ATOM   2756  CD2 LEU A 354      -7.737  18.633 -32.360  1.00  0.21           C  
ATOM   2757  N   LEU A 355      -5.014  14.686 -31.329  1.00  0.26           N  
ATOM   2758  CA  LEU A 355      -3.633  14.816 -30.873  1.00  0.26           C  
ATOM   2759  C   LEU A 355      -2.668  13.944 -31.666  1.00  0.26           C  
ATOM   2760  O   LEU A 355      -1.619  14.395 -32.121  1.00  0.26           O  
ATOM   2761  CB  LEU A 355      -3.517  14.437 -29.372  1.00  0.26           C  
ATOM   2762  CG  LEU A 355      -4.084  15.472 -28.374  1.00  0.26           C  
ATOM   2763  CD1 LEU A 355      -4.043  14.907 -26.945  1.00  0.26           C  
ATOM   2764  CD2 LEU A 355      -3.304  16.793 -28.403  1.00  0.26           C  
ATOM   2765  N   SER A 356      -3.058  12.682 -31.928  1.00  0.29           N  
ATOM   2766  CA  SER A 356      -2.349  11.761 -32.800  1.00  0.29           C  
ATOM   2767  C   SER A 356      -2.230  12.234 -34.238  1.00  0.29           C  
ATOM   2768  O   SER A 356      -1.211  12.044 -34.894  1.00  0.29           O  
ATOM   2769  CB  SER A 356      -3.037  10.375 -32.827  1.00  0.29           C  
ATOM   2770  OG  SER A 356      -3.258   9.935 -31.489  1.00  0.29           O  
ATOM   2771  N   ARG A 357      -3.284  12.866 -34.794  1.00  0.26           N  
ATOM   2772  CA  ARG A 357      -3.243  13.455 -36.122  1.00  0.26           C  
ATOM   2773  C   ARG A 357      -2.318  14.660 -36.211  1.00  0.26           C  
ATOM   2774  O   ARG A 357      -1.500  14.746 -37.122  1.00  0.26           O  
ATOM   2775  CB  ARG A 357      -4.675  13.820 -36.584  1.00  0.26           C  
ATOM   2776  CG  ARG A 357      -4.789  14.254 -38.063  1.00  0.26           C  
ATOM   2777  CD  ARG A 357      -6.245  14.502 -38.487  1.00  0.26           C  
ATOM   2778  NE  ARG A 357      -6.250  14.881 -39.940  1.00  0.26           N  
ATOM   2779  CZ  ARG A 357      -7.363  15.187 -40.627  1.00  0.26           C  
ATOM   2780  NH1 ARG A 357      -8.569  15.149 -40.069  1.00  0.26           N  
ATOM   2781  NH2 ARG A 357      -7.267  15.536 -41.909  1.00  0.26           N  
ATOM   2782  N   SER A 358      -2.382  15.577 -35.226  1.00  0.41           N  
ATOM   2783  CA  SER A 358      -1.506  16.738 -35.111  1.00  0.41           C  
ATOM   2784  C   SER A 358      -0.053  16.362 -34.948  1.00  0.41           C  
ATOM   2785  O   SER A 358       0.835  16.953 -35.558  1.00  0.41           O  
ATOM   2786  CB  SER A 358      -1.891  17.626 -33.904  1.00  0.41           C  
ATOM   2787  OG  SER A 358      -3.213  18.130 -34.087  1.00  0.41           O  
ATOM   2788  N   SER A 359       0.227  15.326 -34.131  1.00  0.48           N  
ATOM   2789  CA  SER A 359       1.564  14.769 -33.985  1.00  0.48           C  
ATOM   2790  C   SER A 359       2.122  14.181 -35.276  1.00  0.48           C  
ATOM   2791  O   SER A 359       3.245  14.480 -35.667  1.00  0.48           O  
ATOM   2792  CB  SER A 359       1.612  13.706 -32.860  1.00  0.48           C  
ATOM   2793  OG  SER A 359       2.941  13.568 -32.351  1.00  0.48           O  
ATOM   2794  N   ARG A 360       1.309  13.403 -36.029  1.00  0.41           N  
ATOM   2795  CA  ARG A 360       1.691  12.891 -37.340  1.00  0.41           C  
ATOM   2796  C   ARG A 360       1.953  13.976 -38.376  1.00  0.41           C  
ATOM   2797  O   ARG A 360       2.911  13.891 -39.140  1.00  0.41           O  
ATOM   2798  CB  ARG A 360       0.611  11.941 -37.924  1.00  0.41           C  
ATOM   2799  CG  ARG A 360       0.596  10.545 -37.272  1.00  0.41           C  
ATOM   2800  CD  ARG A 360      -0.282   9.519 -38.000  1.00  0.41           C  
ATOM   2801  NE  ARG A 360      -1.708   9.945 -37.836  1.00  0.41           N  
ATOM   2802  CZ  ARG A 360      -2.750   9.310 -38.392  1.00  0.41           C  
ATOM   2803  NH1 ARG A 360      -2.587   8.235 -39.157  1.00  0.41           N  
ATOM   2804  NH2 ARG A 360      -3.985   9.756 -38.172  1.00  0.41           N  
ATOM   2805  N   LEU A 361       1.121  15.040 -38.421  1.00  0.44           N  
ATOM   2806  CA  LEU A 361       1.342  16.181 -39.299  1.00  0.44           C  
ATOM   2807  C   LEU A 361       2.667  16.880 -39.027  1.00  0.44           C  
ATOM   2808  O   LEU A 361       3.398  17.247 -39.946  1.00  0.44           O  
ATOM   2809  CB  LEU A 361       0.202  17.223 -39.161  1.00  0.44           C  
ATOM   2810  CG  LEU A 361      -1.138  16.798 -39.794  1.00  0.44           C  
ATOM   2811  CD1 LEU A 361      -2.243  17.790 -39.400  1.00  0.44           C  
ATOM   2812  CD2 LEU A 361      -1.040  16.700 -41.325  1.00  0.44           C  
ATOM   2813  N   LEU A 362       3.033  17.036 -37.740  1.00  0.48           N  
ATOM   2814  CA  LEU A 362       4.329  17.543 -37.340  1.00  0.48           C  
ATOM   2815  C   LEU A 362       5.488  16.673 -37.797  1.00  0.48           C  
ATOM   2816  O   LEU A 362       6.451  17.179 -38.367  1.00  0.48           O  
ATOM   2817  CB  LEU A 362       4.359  17.680 -35.806  1.00  0.48           C  
ATOM   2818  CG  LEU A 362       5.704  18.105 -35.189  1.00  0.48           C  
ATOM   2819  CD1 LEU A 362       6.218  19.424 -35.760  1.00  0.48           C  
ATOM   2820  CD2 LEU A 362       5.519  18.242 -33.681  1.00  0.48           C  
ATOM   2821  N   ASP A 363       5.407  15.337 -37.631  1.00  0.44           N  
ATOM   2822  CA  ASP A 363       6.431  14.421 -38.105  1.00  0.44           C  
ATOM   2823  C   ASP A 363       6.621  14.481 -39.619  1.00  0.44           C  
ATOM   2824  O   ASP A 363       7.745  14.538 -40.115  1.00  0.44           O  
ATOM   2825  CB  ASP A 363       6.110  12.972 -37.673  1.00  0.44           C  
ATOM   2826  CG  ASP A 363       6.294  12.813 -36.176  1.00  0.44           C  
ATOM   2827  OD1 ASP A 363       7.207  13.459 -35.588  1.00  0.44           O  
ATOM   2828  OD2 ASP A 363       5.494  12.053 -35.581  1.00  0.44           O  
ATOM   2829  N   GLN A 364       5.519  14.546 -40.394  1.00  0.39           N  
ATOM   2830  CA  GLN A 364       5.566  14.725 -41.836  1.00  0.39           C  
ATOM   2831  C   GLN A 364       6.223  16.033 -42.277  1.00  0.39           C  
ATOM   2832  O   GLN A 364       7.074  16.047 -43.166  1.00  0.39           O  
ATOM   2833  CB  GLN A 364       4.129  14.659 -42.411  1.00  0.39           C  
ATOM   2834  CG  GLN A 364       3.508  13.244 -42.330  1.00  0.39           C  
ATOM   2835  CD  GLN A 364       2.039  13.256 -42.751  1.00  0.39           C  
ATOM   2836  OE1 GLN A 364       1.372  14.283 -42.856  1.00  0.39           O  
ATOM   2837  NE2 GLN A 364       1.490  12.045 -43.007  1.00  0.39           N  
ATOM   2838  N   LEU A 365       5.878  17.169 -41.634  1.00  0.39           N  
ATOM   2839  CA  LEU A 365       6.523  18.449 -41.881  1.00  0.39           C  
ATOM   2840  C   LEU A 365       7.992  18.476 -41.486  1.00  0.39           C  
ATOM   2841  O   LEU A 365       8.841  18.973 -42.225  1.00  0.39           O  
ATOM   2842  CB  LEU A 365       5.797  19.581 -41.120  1.00  0.39           C  
ATOM   2843  CG  LEU A 365       4.438  19.995 -41.714  1.00  0.39           C  
ATOM   2844  CD1 LEU A 365       3.730  20.949 -40.744  1.00  0.39           C  
ATOM   2845  CD2 LEU A 365       4.587  20.663 -43.089  1.00  0.39           C  
ATOM   2846  N   SER A 366       8.333  17.909 -40.312  1.00  0.48           N  
ATOM   2847  CA  SER A 366       9.699  17.805 -39.823  1.00  0.48           C  
ATOM   2848  C   SER A 366      10.578  16.985 -40.730  1.00  0.48           C  
ATOM   2849  O   SER A 366      11.703  17.382 -41.020  1.00  0.48           O  
ATOM   2850  CB  SER A 366       9.779  17.168 -38.414  1.00  0.48           C  
ATOM   2851  OG  SER A 366       9.275  18.083 -37.445  1.00  0.48           O  
ATOM   2852  N   GLU A 367      10.082  15.836 -41.233  1.00  0.33           N  
ATOM   2853  CA  GLU A 367      10.816  15.011 -42.175  1.00  0.33           C  
ATOM   2854  C   GLU A 367      11.090  15.710 -43.499  1.00  0.33           C  
ATOM   2855  O   GLU A 367      12.219  15.764 -43.977  1.00  0.33           O  
ATOM   2856  CB  GLU A 367      10.053  13.689 -42.429  1.00  0.33           C  
ATOM   2857  CG  GLU A 367      10.888  12.580 -43.119  1.00  0.33           C  
ATOM   2858  CD  GLU A 367      12.007  11.993 -42.251  1.00  0.33           C  
ATOM   2859  OE1 GLU A 367      12.574  10.960 -42.695  1.00  0.33           O  
ATOM   2860  OE2 GLU A 367      12.337  12.547 -41.168  1.00  0.33           O  
ATOM   2861  N   GLY A 368      10.070  16.376 -44.090  1.00  0.32           N  
ATOM   2862  CA  GLY A 368      10.239  17.108 -45.347  1.00  0.32           C  
ATOM   2863  C   GLY A 368      11.250  18.231 -45.306  1.00  0.32           C  
ATOM   2864  O   GLY A 368      11.972  18.481 -46.269  1.00  0.32           O  
ATOM   2865  N   SER A 369      11.363  18.913 -44.154  1.00  0.33           N  
ATOM   2866  CA  SER A 369      12.380  19.929 -43.932  1.00  0.33           C  
ATOM   2867  C   SER A 369      13.780  19.361 -43.729  1.00  0.33           C  
ATOM   2868  O   SER A 369      14.761  20.051 -43.997  1.00  0.33           O  
ATOM   2869  CB  SER A 369      12.052  20.817 -42.699  1.00  0.33           C  
ATOM   2870  OG  SER A 369      10.913  21.647 -42.949  1.00  0.33           O  
ATOM   2871  N   ARG A 370      13.932  18.101 -43.255  1.00  0.25           N  
ATOM   2872  CA  ARG A 370      15.243  17.492 -43.051  1.00  0.25           C  
ATOM   2873  C   ARG A 370      15.913  17.081 -44.319  1.00  0.25           C  
ATOM   2874  O   ARG A 370      17.069  17.416 -44.559  1.00  0.25           O  
ATOM   2875  CB  ARG A 370      15.161  16.190 -42.227  1.00  0.25           C  
ATOM   2876  CG  ARG A 370      14.921  16.459 -40.747  1.00  0.25           C  
ATOM   2877  CD  ARG A 370      14.867  15.145 -39.985  1.00  0.25           C  
ATOM   2878  NE  ARG A 370      14.537  15.509 -38.578  1.00  0.25           N  
ATOM   2879  CZ  ARG A 370      14.708  14.677 -37.546  1.00  0.25           C  
ATOM   2880  NH1 ARG A 370      15.261  13.479 -37.710  1.00  0.25           N  
ATOM   2881  NH2 ARG A 370      14.324  15.066 -36.333  1.00  0.25           N  
ATOM   2882  N   HIS A 371      15.169  16.344 -45.163  1.00  0.18           N  
ATOM   2883  CA  HIS A 371      15.618  15.931 -46.465  1.00  0.18           C  
ATOM   2884  C   HIS A 371      15.844  17.102 -47.345  1.00  0.18           C  
ATOM   2885  O   HIS A 371      16.828  17.057 -48.060  1.00  0.18           O  
ATOM   2886  CB  HIS A 371      14.630  15.039 -47.230  1.00  0.18           C  
ATOM   2887  CG  HIS A 371      14.525  13.722 -46.574  1.00  0.18           C  
ATOM   2888  ND1 HIS A 371      13.902  13.686 -45.355  1.00  0.18           N  
ATOM   2889  CD2 HIS A 371      15.100  12.527 -46.855  1.00  0.18           C  
ATOM   2890  CE1 HIS A 371      14.100  12.474 -44.898  1.00  0.18           C  
ATOM   2891  NE2 HIS A 371      14.822  11.727 -45.768  1.00  0.18           N  
ATOM   2892  N   GLN A 372      14.957  18.155 -47.294  1.00  0.22           N  
ATOM   2893  CA  GLN A 372      15.195  19.340 -48.075  1.00  0.22           C  
ATOM   2894  C   GLN A 372      14.384  20.654 -47.761  1.00  0.22           C  
ATOM   2895  O   GLN A 372      13.301  20.932 -48.264  1.00  0.22           O  
ATOM   2896  CB  GLN A 372      15.042  18.909 -49.538  1.00  0.22           C  
ATOM   2897  CG  GLN A 372      16.361  18.944 -50.347  1.00  0.22           C  
ATOM   2898  CD  GLN A 372      16.436  17.853 -51.420  1.00  0.22           C  
ATOM   2899  OE1 GLN A 372      16.153  16.683 -51.247  1.00  0.22           O  
ATOM   2900  NE2 GLN A 372      16.918  18.280 -52.600  1.00  0.22           N  
ATOM   2901  N   LEU A 373      15.067  21.552 -46.998  1.00  0.25           N  
ATOM   2902  CA  LEU A 373      14.806  22.954 -46.633  1.00  0.25           C  
ATOM   2903  C   LEU A 373      14.549  23.887 -47.796  1.00  0.25           C  
ATOM   2904  O   LEU A 373      15.479  24.053 -48.543  1.00  0.25           O  
ATOM   2905  CB  LEU A 373      16.088  23.621 -46.033  1.00  0.25           C  
ATOM   2906  CG  LEU A 373      16.472  23.253 -44.595  1.00  0.25           C  
ATOM   2907  CD1 LEU A 373      17.905  23.737 -44.333  1.00  0.25           C  
ATOM   2908  CD2 LEU A 373      15.548  23.948 -43.595  1.00  0.25           C  
ATOM   2909  N   PRO A 374      13.457  24.587 -47.986  1.00  0.26           N  
ATOM   2910  CA  PRO A 374      13.185  25.477 -49.110  1.00  0.26           C  
ATOM   2911  C   PRO A 374      14.233  26.466 -49.553  1.00  0.26           C  
ATOM   2912  O   PRO A 374      14.805  27.160 -48.720  1.00  0.26           O  
ATOM   2913  CB  PRO A 374      11.978  26.279 -48.635  1.00  0.26           C  
ATOM   2914  CG  PRO A 374      11.273  25.445 -47.577  1.00  0.26           C  
ATOM   2915  CD  PRO A 374      12.311  24.430 -47.123  1.00  0.26           C  
ATOM   2916  N   GLY A 375      14.365  26.637 -50.890  1.00  0.27           N  
ATOM   2917  CA  GLY A 375      15.196  27.664 -51.503  1.00  0.27           C  
ATOM   2918  C   GLY A 375      14.644  29.053 -51.285  1.00  0.27           C  
ATOM   2919  O   GLY A 375      15.331  30.059 -51.395  1.00  0.27           O  
ATOM   2920  N   ASN A 376      13.353  29.127 -50.913  1.00  0.27           N  
ATOM   2921  CA  ASN A 376      12.734  30.339 -50.439  1.00  0.27           C  
ATOM   2922  C   ASN A 376      12.811  30.345 -48.914  1.00  0.27           C  
ATOM   2923  O   ASN A 376      12.106  29.608 -48.224  1.00  0.27           O  
ATOM   2924  CB  ASN A 376      11.256  30.406 -50.900  1.00  0.27           C  
ATOM   2925  CG  ASN A 376      10.642  31.765 -50.602  1.00  0.27           C  
ATOM   2926  OD1 ASN A 376      10.789  32.314 -49.514  1.00  0.27           O  
ATOM   2927  ND2 ASN A 376       9.874  32.300 -51.568  1.00  0.27           N  
ATOM   2928  N   ARG A 377      13.649  31.242 -48.367  1.00  0.36           N  
ATOM   2929  CA  ARG A 377      13.909  31.406 -46.948  1.00  0.36           C  
ATOM   2930  C   ARG A 377      12.686  31.721 -46.094  1.00  0.36           C  
ATOM   2931  O   ARG A 377      12.538  31.200 -44.985  1.00  0.36           O  
ATOM   2932  CB  ARG A 377      14.931  32.549 -46.772  1.00  0.36           C  
ATOM   2933  CG  ARG A 377      15.419  32.769 -45.329  1.00  0.36           C  
ATOM   2934  CD  ARG A 377      16.476  33.867 -45.299  1.00  0.36           C  
ATOM   2935  NE  ARG A 377      16.883  34.068 -43.876  1.00  0.36           N  
ATOM   2936  CZ  ARG A 377      17.979  34.743 -43.513  1.00  0.36           C  
ATOM   2937  NH1 ARG A 377      18.831  35.216 -44.420  1.00  0.36           N  
ATOM   2938  NH2 ARG A 377      18.225  34.941 -42.220  1.00  0.36           N  
ATOM   2939  N   GLN A 378      11.773  32.575 -46.609  1.00  0.41           N  
ATOM   2940  CA  GLN A 378      10.553  32.987 -45.936  1.00  0.41           C  
ATOM   2941  C   GLN A 378       9.630  31.820 -45.640  1.00  0.41           C  
ATOM   2942  O   GLN A 378       9.023  31.718 -44.574  1.00  0.41           O  
ATOM   2943  CB  GLN A 378       9.779  34.031 -46.787  1.00  0.41           C  
ATOM   2944  CG  GLN A 378       8.531  34.597 -46.065  1.00  0.41           C  
ATOM   2945  CD  GLN A 378       7.851  35.711 -46.855  1.00  0.41           C  
ATOM   2946  OE1 GLN A 378       7.933  35.818 -48.073  1.00  0.41           O  
ATOM   2947  NE2 GLN A 378       7.103  36.575 -46.124  1.00  0.41           N  
ATOM   2948  N   LEU A 379       9.513  30.875 -46.588  1.00  0.37           N  
ATOM   2949  CA  LEU A 379       8.763  29.663 -46.371  1.00  0.37           C  
ATOM   2950  C   LEU A 379       9.365  28.743 -45.338  1.00  0.37           C  
ATOM   2951  O   LEU A 379       8.672  28.229 -44.467  1.00  0.37           O  
ATOM   2952  CB  LEU A 379       8.684  28.866 -47.672  1.00  0.37           C  
ATOM   2953  CG  LEU A 379       7.804  27.597 -47.598  1.00  0.37           C  
ATOM   2954  CD1 LEU A 379       6.638  27.620 -46.606  1.00  0.37           C  
ATOM   2955  CD2 LEU A 379       7.396  27.250 -49.014  1.00  0.37           C  
ATOM   2956  N   ALA A 380      10.695  28.534 -45.363  1.00  0.42           N  
ATOM   2957  CA  ALA A 380      11.346  27.678 -44.389  1.00  0.42           C  
ATOM   2958  C   ALA A 380      11.050  28.147 -42.964  1.00  0.42           C  
ATOM   2959  O   ALA A 380      10.681  27.352 -42.106  1.00  0.42           O  
ATOM   2960  CB  ALA A 380      12.858  27.584 -44.684  1.00  0.42           C  
ATOM   2961  N   GLY A 381      11.069  29.482 -42.743  1.00  0.50           N  
ATOM   2962  CA  GLY A 381      10.484  30.146 -41.577  1.00  0.50           C  
ATOM   2963  C   GLY A 381       9.054  29.794 -41.210  1.00  0.50           C  
ATOM   2964  O   GLY A 381       8.774  29.402 -40.082  1.00  0.50           O  
ATOM   2965  N   ARG A 382       8.096  29.926 -42.151  1.00  0.40           N  
ATOM   2966  CA  ARG A 382       6.689  29.596 -41.942  1.00  0.40           C  
ATOM   2967  C   ARG A 382       6.441  28.128 -41.644  1.00  0.40           C  
ATOM   2968  O   ARG A 382       5.600  27.781 -40.819  1.00  0.40           O  
ATOM   2969  CB  ARG A 382       5.824  29.985 -43.164  1.00  0.40           C  
ATOM   2970  CG  ARG A 382       5.720  31.506 -43.376  1.00  0.40           C  
ATOM   2971  CD  ARG A 382       4.820  31.842 -44.563  1.00  0.40           C  
ATOM   2972  NE  ARG A 382       4.770  33.332 -44.703  1.00  0.40           N  
ATOM   2973  CZ  ARG A 382       4.022  33.940 -45.631  1.00  0.40           C  
ATOM   2974  NH1 ARG A 382       3.274  33.235 -46.468  1.00  0.40           N  
ATOM   2975  NH2 ARG A 382       4.015  35.266 -45.730  1.00  0.40           N  
ATOM   2976  N   SER A 383       7.185  27.219 -42.305  1.00  0.44           N  
ATOM   2977  CA  SER A 383       7.133  25.790 -42.016  1.00  0.44           C  
ATOM   2978  C   SER A 383       7.560  25.494 -40.588  1.00  0.44           C  
ATOM   2979  O   SER A 383       6.871  24.788 -39.857  1.00  0.44           O  
ATOM   2980  CB  SER A 383       8.008  24.967 -43.004  1.00  0.44           C  
ATOM   2981  OG  SER A 383       7.925  23.557 -42.760  1.00  0.44           O  
ATOM   2982  N   TYR A 384       8.665  26.108 -40.118  1.00  0.50           N  
ATOM   2983  CA  TYR A 384       9.090  26.018 -38.732  1.00  0.50           C  
ATOM   2984  C   TYR A 384       8.093  26.604 -37.730  1.00  0.50           C  
ATOM   2985  O   TYR A 384       7.871  26.023 -36.669  1.00  0.50           O  
ATOM   2986  CB  TYR A 384      10.480  26.677 -38.536  1.00  0.50           C  
ATOM   2987  CG  TYR A 384      11.576  25.812 -39.092  1.00  0.50           C  
ATOM   2988  CD1 TYR A 384      11.735  24.500 -38.618  1.00  0.50           C  
ATOM   2989  CD2 TYR A 384      12.491  26.305 -40.040  1.00  0.50           C  
ATOM   2990  CE1 TYR A 384      12.767  23.688 -39.098  1.00  0.50           C  
ATOM   2991  CE2 TYR A 384      13.515  25.486 -40.541  1.00  0.50           C  
ATOM   2992  CZ  TYR A 384      13.654  24.180 -40.052  1.00  0.50           C  
ATOM   2993  OH  TYR A 384      14.694  23.339 -40.476  1.00  0.50           O  
ATOM   2994  N   ASP A 385       7.435  27.745 -38.045  1.00  0.54           N  
ATOM   2995  CA  ASP A 385       6.370  28.319 -37.225  1.00  0.54           C  
ATOM   2996  C   ASP A 385       5.167  27.375 -37.093  1.00  0.54           C  
ATOM   2997  O   ASP A 385       4.667  27.097 -36.007  1.00  0.54           O  
ATOM   2998  CB  ASP A 385       5.935  29.681 -37.844  1.00  0.54           C  
ATOM   2999  CG  ASP A 385       5.110  30.575 -36.928  1.00  0.54           C  
ATOM   3000  OD1 ASP A 385       4.767  30.195 -35.780  1.00  0.54           O  
ATOM   3001  OD2 ASP A 385       4.851  31.729 -37.364  1.00  0.54           O  
ATOM   3002  N   LEU A 386       4.710  26.773 -38.208  1.00  0.53           N  
ATOM   3003  CA  LEU A 386       3.636  25.796 -38.174  1.00  0.53           C  
ATOM   3004  C   LEU A 386       3.989  24.537 -37.390  1.00  0.53           C  
ATOM   3005  O   LEU A 386       3.190  24.023 -36.606  1.00  0.53           O  
ATOM   3006  CB  LEU A 386       3.210  25.429 -39.612  1.00  0.53           C  
ATOM   3007  CG  LEU A 386       2.022  24.446 -39.716  1.00  0.53           C  
ATOM   3008  CD1 LEU A 386       0.764  24.971 -39.004  1.00  0.53           C  
ATOM   3009  CD2 LEU A 386       1.707  24.148 -41.188  1.00  0.53           C  
ATOM   3010  N   GLN A 387       5.230  24.034 -37.542  1.00  0.62           N  
ATOM   3011  CA  GLN A 387       5.751  22.941 -36.742  1.00  0.62           C  
ATOM   3012  C   GLN A 387       5.787  23.262 -35.253  1.00  0.62           C  
ATOM   3013  O   GLN A 387       5.380  22.448 -34.427  1.00  0.62           O  
ATOM   3014  CB  GLN A 387       7.178  22.558 -37.202  1.00  0.62           C  
ATOM   3015  CG  GLN A 387       7.217  21.880 -38.587  1.00  0.62           C  
ATOM   3016  CD  GLN A 387       8.655  21.670 -39.056  1.00  0.62           C  
ATOM   3017  OE1 GLN A 387       9.572  21.371 -38.292  1.00  0.62           O  
ATOM   3018  NE2 GLN A 387       8.888  21.814 -40.378  1.00  0.62           N  
ATOM   3019  N   ALA A 388       6.224  24.478 -34.870  1.00  0.65           N  
ATOM   3020  CA  ALA A 388       6.202  24.939 -33.497  1.00  0.65           C  
ATOM   3021  C   ALA A 388       4.799  24.995 -32.897  1.00  0.65           C  
ATOM   3022  O   ALA A 388       4.575  24.544 -31.773  1.00  0.65           O  
ATOM   3023  CB  ALA A 388       6.870  26.324 -33.407  1.00  0.65           C  
ATOM   3024  N   LEU A 389       3.803  25.493 -33.657  1.00  0.61           N  
ATOM   3025  CA  LEU A 389       2.408  25.461 -33.257  1.00  0.61           C  
ATOM   3026  C   LEU A 389       1.847  24.053 -33.091  1.00  0.61           C  
ATOM   3027  O   LEU A 389       1.186  23.745 -32.102  1.00  0.61           O  
ATOM   3028  CB  LEU A 389       1.532  26.235 -34.272  1.00  0.61           C  
ATOM   3029  CG  LEU A 389       0.040  26.348 -33.874  1.00  0.61           C  
ATOM   3030  CD1 LEU A 389      -0.144  27.125 -32.560  1.00  0.61           C  
ATOM   3031  CD2 LEU A 389      -0.788  26.995 -34.990  1.00  0.61           C  
ATOM   3032  N   LEU A 390       2.128  23.127 -34.032  1.00  0.57           N  
ATOM   3033  CA  LEU A 390       1.717  21.735 -33.920  1.00  0.57           C  
ATOM   3034  C   LEU A 390       2.343  21.037 -32.735  1.00  0.57           C  
ATOM   3035  O   LEU A 390       1.663  20.306 -32.020  1.00  0.57           O  
ATOM   3036  CB  LEU A 390       2.049  20.932 -35.196  1.00  0.57           C  
ATOM   3037  CG  LEU A 390       1.140  21.255 -36.395  1.00  0.57           C  
ATOM   3038  CD1 LEU A 390       1.736  20.649 -37.669  1.00  0.57           C  
ATOM   3039  CD2 LEU A 390      -0.288  20.726 -36.187  1.00  0.57           C  
ATOM   3040  N   ALA A 391       3.640  21.295 -32.474  1.00  0.62           N  
ATOM   3041  CA  ALA A 391       4.349  20.816 -31.310  1.00  0.62           C  
ATOM   3042  C   ALA A 391       3.739  21.311 -30.007  1.00  0.62           C  
ATOM   3043  O   ALA A 391       3.517  20.530 -29.085  1.00  0.62           O  
ATOM   3044  CB  ALA A 391       5.829  21.229 -31.420  1.00  0.62           C  
ATOM   3045  N   LEU A 392       3.369  22.606 -29.929  1.00  0.55           N  
ATOM   3046  CA  LEU A 392       2.633  23.167 -28.808  1.00  0.55           C  
ATOM   3047  C   LEU A 392       1.274  22.498 -28.597  1.00  0.55           C  
ATOM   3048  O   LEU A 392       0.948  22.043 -27.506  1.00  0.55           O  
ATOM   3049  CB  LEU A 392       2.468  24.695 -29.048  1.00  0.55           C  
ATOM   3050  CG  LEU A 392       1.786  25.512 -27.928  1.00  0.55           C  
ATOM   3051  CD1 LEU A 392       2.651  25.598 -26.666  1.00  0.55           C  
ATOM   3052  CD2 LEU A 392       1.486  26.939 -28.406  1.00  0.55           C  
ATOM   3053  N   THR A 393       0.471  22.341 -29.665  1.00  0.52           N  
ATOM   3054  CA  THR A 393      -0.847  21.708 -29.620  1.00  0.52           C  
ATOM   3055  C   THR A 393      -0.820  20.240 -29.230  1.00  0.52           C  
ATOM   3056  O   THR A 393      -1.691  19.761 -28.509  1.00  0.52           O  
ATOM   3057  CB  THR A 393      -1.602  21.863 -30.936  1.00  0.52           C  
ATOM   3058  OG1 THR A 393      -1.697  23.241 -31.261  1.00  0.52           O  
ATOM   3059  CG2 THR A 393      -3.051  21.365 -30.826  1.00  0.52           C  
ATOM   3060  N   CYS A 394       0.182  19.454 -29.681  1.00  0.48           N  
ATOM   3061  CA  CYS A 394       0.232  18.030 -29.374  1.00  0.48           C  
ATOM   3062  C   CYS A 394       1.101  17.709 -28.167  1.00  0.48           C  
ATOM   3063  O   CYS A 394       1.361  16.549 -27.835  1.00  0.48           O  
ATOM   3064  CB  CYS A 394       0.679  17.194 -30.601  1.00  0.48           C  
ATOM   3065  SG  CYS A 394       2.427  17.440 -31.082  1.00  0.48           S  
ATOM   3066  N   GLY A 395       1.563  18.747 -27.453  1.00  0.58           N  
ATOM   3067  CA  GLY A 395       2.288  18.591 -26.213  1.00  0.58           C  
ATOM   3068  C   GLY A 395       3.758  18.297 -26.329  1.00  0.58           C  
ATOM   3069  O   GLY A 395       4.397  18.029 -25.323  1.00  0.58           O  
ATOM   3070  N   ARG A 396       4.370  18.343 -27.520  1.00  0.56           N  
ATOM   3071  CA  ARG A 396       5.819  18.241 -27.689  1.00  0.56           C  
ATOM   3072  C   ARG A 396       6.500  19.586 -27.437  1.00  0.56           C  
ATOM   3073  O   ARG A 396       7.057  20.230 -28.324  1.00  0.56           O  
ATOM   3074  CB  ARG A 396       6.169  17.717 -29.097  1.00  0.56           C  
ATOM   3075  CG  ARG A 396       5.619  16.300 -29.357  1.00  0.56           C  
ATOM   3076  CD  ARG A 396       5.652  15.882 -30.829  1.00  0.56           C  
ATOM   3077  NE  ARG A 396       7.051  15.580 -31.228  1.00  0.56           N  
ATOM   3078  CZ  ARG A 396       7.407  15.106 -32.428  1.00  0.56           C  
ATOM   3079  NH1 ARG A 396       6.531  14.829 -33.376  1.00  0.56           N  
ATOM   3080  NH2 ARG A 396       8.693  14.991 -32.708  1.00  0.56           N  
ATOM   3081  N   TYR A 397       6.428  20.069 -26.186  1.00  0.51           N  
ATOM   3082  CA  TYR A 397       6.793  21.419 -25.809  1.00  0.51           C  
ATOM   3083  C   TYR A 397       8.295  21.645 -25.718  1.00  0.51           C  
ATOM   3084  O   TYR A 397       8.768  22.779 -25.744  1.00  0.51           O  
ATOM   3085  CB  TYR A 397       6.201  21.774 -24.429  1.00  0.51           C  
ATOM   3086  CG  TYR A 397       4.702  21.581 -24.345  1.00  0.51           C  
ATOM   3087  CD1 TYR A 397       3.848  22.436 -25.049  1.00  0.51           C  
ATOM   3088  CD2 TYR A 397       4.118  20.626 -23.493  1.00  0.51           C  
ATOM   3089  CE1 TYR A 397       2.458  22.381 -24.854  1.00  0.51           C  
ATOM   3090  CE2 TYR A 397       2.732  20.552 -23.304  1.00  0.51           C  
ATOM   3091  CZ  TYR A 397       1.908  21.463 -23.961  1.00  0.51           C  
ATOM   3092  OH  TYR A 397       0.535  21.506 -23.673  1.00  0.51           O  
ATOM   3093  N   ASP A 398       9.087  20.567 -25.641  1.00  0.58           N  
ATOM   3094  CA  ASP A 398      10.527  20.554 -25.705  1.00  0.58           C  
ATOM   3095  C   ASP A 398      11.039  21.026 -27.066  1.00  0.58           C  
ATOM   3096  O   ASP A 398      12.017  21.767 -27.173  1.00  0.58           O  
ATOM   3097  CB  ASP A 398      11.028  19.132 -25.329  1.00  0.58           C  
ATOM   3098  CG  ASP A 398      10.343  18.012 -26.109  1.00  0.58           C  
ATOM   3099  OD1 ASP A 398       9.083  17.944 -26.089  1.00  0.58           O  
ATOM   3100  OD2 ASP A 398      11.086  17.213 -26.721  1.00  0.58           O  
ATOM   3101  N   GLU A 399      10.327  20.640 -28.140  1.00  0.63           N  
ATOM   3102  CA  GLU A 399      10.610  21.031 -29.504  1.00  0.63           C  
ATOM   3103  C   GLU A 399      10.184  22.465 -29.841  1.00  0.63           C  
ATOM   3104  O   GLU A 399      10.728  23.089 -30.753  1.00  0.63           O  
ATOM   3105  CB  GLU A 399       9.932  20.020 -30.458  1.00  0.63           C  
ATOM   3106  CG  GLU A 399      10.483  18.587 -30.259  1.00  0.63           C  
ATOM   3107  CD  GLU A 399       9.857  17.575 -31.189  1.00  0.63           C  
ATOM   3108  OE1 GLU A 399       9.453  16.501 -30.677  1.00  0.63           O  
ATOM   3109  OE2 GLU A 399       9.773  17.795 -32.423  1.00  0.63           O  
ATOM   3110  N   VAL A 400       9.237  23.065 -29.078  1.00  0.64           N  
ATOM   3111  CA  VAL A 400       8.716  24.417 -29.315  1.00  0.64           C  
ATOM   3112  C   VAL A 400       9.769  25.532 -29.281  1.00  0.64           C  
ATOM   3113  O   VAL A 400       9.761  26.327 -30.226  1.00  0.64           O  
ATOM   3114  CB  VAL A 400       7.531  24.764 -28.397  1.00  0.64           C  
ATOM   3115  CG1 VAL A 400       6.995  26.196 -28.629  1.00  0.64           C  
ATOM   3116  CG2 VAL A 400       6.382  23.780 -28.665  1.00  0.64           C  
ATOM   3117  N   PRO A 401      10.722  25.677 -28.341  1.00  0.61           N  
ATOM   3118  CA  PRO A 401      11.743  26.720 -28.410  1.00  0.61           C  
ATOM   3119  C   PRO A 401      12.650  26.593 -29.615  1.00  0.61           C  
ATOM   3120  O   PRO A 401      12.990  27.609 -30.219  1.00  0.61           O  
ATOM   3121  CB  PRO A 401      12.538  26.576 -27.095  1.00  0.61           C  
ATOM   3122  CG  PRO A 401      11.555  25.914 -26.128  1.00  0.61           C  
ATOM   3123  CD  PRO A 401      10.737  25.003 -27.041  1.00  0.61           C  
ATOM   3124  N   LEU A 402      13.056  25.360 -29.979  1.00  0.59           N  
ATOM   3125  CA  LEU A 402      13.940  25.115 -31.103  1.00  0.59           C  
ATOM   3126  C   LEU A 402      13.308  25.469 -32.440  1.00  0.59           C  
ATOM   3127  O   LEU A 402      13.869  26.217 -33.239  1.00  0.59           O  
ATOM   3128  CB  LEU A 402      14.341  23.619 -31.131  1.00  0.59           C  
ATOM   3129  CG  LEU A 402      15.199  23.160 -29.934  1.00  0.59           C  
ATOM   3130  CD1 LEU A 402      15.324  21.630 -29.931  1.00  0.59           C  
ATOM   3131  CD2 LEU A 402      16.598  23.795 -29.954  1.00  0.59           C  
ATOM   3132  N   LEU A 403      12.072  24.988 -32.681  1.00  0.63           N  
ATOM   3133  CA  LEU A 403      11.323  25.266 -33.892  1.00  0.63           C  
ATOM   3134  C   LEU A 403      10.966  26.739 -34.034  1.00  0.63           C  
ATOM   3135  O   LEU A 403      11.095  27.335 -35.102  1.00  0.63           O  
ATOM   3136  CB  LEU A 403      10.039  24.404 -33.915  1.00  0.63           C  
ATOM   3137  CG  LEU A 403      10.293  22.886 -34.028  1.00  0.63           C  
ATOM   3138  CD1 LEU A 403       9.016  22.100 -33.699  1.00  0.63           C  
ATOM   3139  CD2 LEU A 403      10.800  22.501 -35.423  1.00  0.63           C  
ATOM   3140  N   LEU A 404      10.546  27.390 -32.930  1.00  0.63           N  
ATOM   3141  CA  LEU A 404      10.274  28.814 -32.913  1.00  0.63           C  
ATOM   3142  C   LEU A 404      11.510  29.676 -33.161  1.00  0.63           C  
ATOM   3143  O   LEU A 404      11.454  30.664 -33.892  1.00  0.63           O  
ATOM   3144  CB  LEU A 404       9.585  29.202 -31.585  1.00  0.63           C  
ATOM   3145  CG  LEU A 404       9.051  30.647 -31.505  1.00  0.63           C  
ATOM   3146  CD1 LEU A 404       8.043  30.939 -32.625  1.00  0.63           C  
ATOM   3147  CD2 LEU A 404       8.394  30.888 -30.138  1.00  0.63           C  
ATOM   3148  N   GLY A 405      12.679  29.307 -32.585  1.00  0.64           N  
ATOM   3149  CA  GLY A 405      13.990  29.875 -32.919  1.00  0.64           C  
ATOM   3150  C   GLY A 405      14.320  29.894 -34.388  1.00  0.64           C  
ATOM   3151  O   GLY A 405      14.636  30.940 -34.954  1.00  0.64           O  
ATOM   3152  N   GLU A 406      14.204  28.729 -35.048  1.00  0.59           N  
ATOM   3153  CA  GLU A 406      14.405  28.575 -36.476  1.00  0.59           C  
ATOM   3154  C   GLU A 406      13.425  29.388 -37.315  1.00  0.59           C  
ATOM   3155  O   GLU A 406      13.772  29.931 -38.366  1.00  0.59           O  
ATOM   3156  CB  GLU A 406      14.306  27.088 -36.884  1.00  0.59           C  
ATOM   3157  CG  GLU A 406      15.495  26.214 -36.408  1.00  0.59           C  
ATOM   3158  CD  GLU A 406      16.843  26.634 -36.992  1.00  0.59           C  
ATOM   3159  OE1 GLU A 406      17.821  26.714 -36.215  1.00  0.59           O  
ATOM   3160  OE2 GLU A 406      16.918  26.904 -38.225  1.00  0.59           O  
ATOM   3161  N   ALA A 407      12.156  29.507 -36.878  1.00  0.61           N  
ATOM   3162  CA  ALA A 407      11.205  30.393 -37.513  1.00  0.61           C  
ATOM   3163  C   ALA A 407      11.591  31.869 -37.428  1.00  0.61           C  
ATOM   3164  O   ALA A 407      11.600  32.590 -38.425  1.00  0.61           O  
ATOM   3165  CB  ALA A 407       9.819  30.174 -36.884  1.00  0.61           C  
ATOM   3166  N   ARG A 408      11.997  32.333 -36.231  1.00  0.56           N  
ATOM   3167  CA  ARG A 408      12.420  33.696 -35.971  1.00  0.56           C  
ATOM   3168  C   ARG A 408      13.672  34.114 -36.721  1.00  0.56           C  
ATOM   3169  O   ARG A 408      13.771  35.241 -37.202  1.00  0.56           O  
ATOM   3170  CB  ARG A 408      12.624  33.918 -34.459  1.00  0.56           C  
ATOM   3171  CG  ARG A 408      11.291  33.973 -33.686  1.00  0.56           C  
ATOM   3172  CD  ARG A 408      11.513  34.140 -32.185  1.00  0.56           C  
ATOM   3173  NE  ARG A 408      10.177  34.271 -31.512  1.00  0.56           N  
ATOM   3174  CZ  ARG A 408      10.044  34.461 -30.193  1.00  0.56           C  
ATOM   3175  NH1 ARG A 408      11.117  34.473 -29.405  1.00  0.56           N  
ATOM   3176  NH2 ARG A 408       8.837  34.657 -29.664  1.00  0.56           N  
ATOM   3177  N   SER A 409      14.654  33.206 -36.901  1.00  0.61           N  
ATOM   3178  CA  SER A 409      15.891  33.488 -37.632  1.00  0.61           C  
ATOM   3179  C   SER A 409      15.664  33.728 -39.128  1.00  0.61           C  
ATOM   3180  O   SER A 409      16.521  34.216 -39.877  1.00  0.61           O  
ATOM   3181  CB  SER A 409      16.932  32.350 -37.425  1.00  0.61           C  
ATOM   3182  OG  SER A 409      16.574  31.146 -38.105  1.00  0.61           O  
ATOM   3183  N   ARG A 410      14.449  33.394 -39.592  1.00  0.54           N  
ATOM   3184  CA  ARG A 410      13.990  33.569 -40.945  1.00  0.54           C  
ATOM   3185  C   ARG A 410      12.837  34.554 -41.039  1.00  0.54           C  
ATOM   3186  O   ARG A 410      12.182  34.623 -42.076  1.00  0.54           O  
ATOM   3187  CB  ARG A 410      13.557  32.194 -41.488  1.00  0.54           C  
ATOM   3188  CG  ARG A 410      14.738  31.215 -41.607  1.00  0.54           C  
ATOM   3189  CD  ARG A 410      14.280  29.793 -41.923  1.00  0.54           C  
ATOM   3190  NE  ARG A 410      15.495  28.931 -42.095  1.00  0.54           N  
ATOM   3191  CZ  ARG A 410      16.139  28.377 -41.061  1.00  0.54           C  
ATOM   3192  NH1 ARG A 410      15.828  28.632 -39.802  1.00  0.54           N  
ATOM   3193  NH2 ARG A 410      17.123  27.503 -41.264  1.00  0.54           N  
ATOM   3194  N   GLN A 411      12.590  35.345 -39.969  1.00  0.48           N  
ATOM   3195  CA  GLN A 411      11.591  36.408 -39.915  1.00  0.48           C  
ATOM   3196  C   GLN A 411      10.148  35.906 -39.964  1.00  0.48           C  
ATOM   3197  O   GLN A 411       9.247  36.540 -40.512  1.00  0.48           O  
ATOM   3198  CB  GLN A 411      11.840  37.535 -40.955  1.00  0.48           C  
ATOM   3199  CG  GLN A 411      13.228  38.204 -40.827  1.00  0.48           C  
ATOM   3200  CD  GLN A 411      13.454  39.228 -41.938  1.00  0.48           C  
ATOM   3201  OE1 GLN A 411      12.661  39.420 -42.857  1.00  0.48           O  
ATOM   3202  NE2 GLN A 411      14.614  39.922 -41.864  1.00  0.48           N  
ATOM   3203  N   ALA A 412       9.900  34.751 -39.326  1.00  0.47           N  
ATOM   3204  CA  ALA A 412       8.591  34.180 -39.101  1.00  0.47           C  
ATOM   3205  C   ALA A 412       8.406  33.949 -37.601  1.00  0.47           C  
ATOM   3206  O   ALA A 412       9.184  34.441 -36.785  1.00  0.47           O  
ATOM   3207  CB  ALA A 412       8.459  32.872 -39.904  1.00  0.47           C  
ATOM   3208  N   GLY A 413       7.355  33.225 -37.155  1.00  0.46           N  
ATOM   3209  CA  GLY A 413       7.179  32.959 -35.731  1.00  0.46           C  
ATOM   3210  C   GLY A 413       6.120  33.805 -35.109  1.00  0.46           C  
ATOM   3211  O   GLY A 413       5.992  33.832 -33.889  1.00  0.46           O  
ATOM   3212  N   SER A 414       5.323  34.526 -35.916  1.00  0.52           N  
ATOM   3213  CA  SER A 414       4.190  35.300 -35.440  1.00  0.52           C  
ATOM   3214  C   SER A 414       3.029  34.439 -34.991  1.00  0.52           C  
ATOM   3215  O   SER A 414       2.417  34.728 -33.965  1.00  0.52           O  
ATOM   3216  CB  SER A 414       3.683  36.362 -36.456  1.00  0.52           C  
ATOM   3217  OG  SER A 414       3.325  35.784 -37.713  1.00  0.52           O  
ATOM   3218  N   LEU A 415       2.707  33.349 -35.721  1.00  0.45           N  
ATOM   3219  CA  LEU A 415       1.565  32.499 -35.429  1.00  0.45           C  
ATOM   3220  C   LEU A 415       1.693  31.790 -34.093  1.00  0.45           C  
ATOM   3221  O   LEU A 415       0.813  31.856 -33.234  1.00  0.45           O  
ATOM   3222  CB  LEU A 415       1.437  31.446 -36.556  1.00  0.45           C  
ATOM   3223  CG  LEU A 415       0.272  30.445 -36.434  1.00  0.45           C  
ATOM   3224  CD1 LEU A 415      -1.096  31.105 -36.656  1.00  0.45           C  
ATOM   3225  CD2 LEU A 415       0.485  29.302 -37.437  1.00  0.45           C  
ATOM   3226  N   THR A 416       2.845  31.140 -33.849  1.00  0.55           N  
ATOM   3227  CA  THR A 416       3.122  30.495 -32.569  1.00  0.55           C  
ATOM   3228  C   THR A 416       3.254  31.472 -31.430  1.00  0.55           C  
ATOM   3229  O   THR A 416       2.721  31.246 -30.345  1.00  0.55           O  
ATOM   3230  CB  THR A 416       4.352  29.628 -32.605  1.00  0.55           C  
ATOM   3231  OG1 THR A 416       4.180  28.668 -33.625  1.00  0.55           O  
ATOM   3232  CG2 THR A 416       4.521  28.825 -31.305  1.00  0.55           C  
ATOM   3233  N   THR A 417       3.938  32.620 -31.655  1.00  0.57           N  
ATOM   3234  CA  THR A 417       4.090  33.665 -30.635  1.00  0.57           C  
ATOM   3235  C   THR A 417       2.753  34.191 -30.168  1.00  0.57           C  
ATOM   3236  O   THR A 417       2.486  34.204 -28.970  1.00  0.57           O  
ATOM   3237  CB  THR A 417       4.949  34.844 -31.085  1.00  0.57           C  
ATOM   3238  OG1 THR A 417       6.274  34.380 -31.355  1.00  0.57           O  
ATOM   3239  CG2 THR A 417       5.050  35.928 -29.996  1.00  0.57           C  
ATOM   3240  N   ALA A 418       1.841  34.519 -31.104  1.00  0.58           N  
ATOM   3241  CA  ALA A 418       0.519  35.017 -30.790  1.00  0.58           C  
ATOM   3242  C   ALA A 418      -0.344  34.045 -29.991  1.00  0.58           C  
ATOM   3243  O   ALA A 418      -1.028  34.414 -29.037  1.00  0.58           O  
ATOM   3244  CB  ALA A 418      -0.198  35.368 -32.105  1.00  0.58           C  
ATOM   3245  N   THR A 419      -0.310  32.741 -30.338  1.00  0.57           N  
ATOM   3246  CA  THR A 419      -0.982  31.695 -29.569  1.00  0.57           C  
ATOM   3247  C   THR A 419      -0.451  31.585 -28.154  1.00  0.57           C  
ATOM   3248  O   THR A 419      -1.220  31.510 -27.199  1.00  0.57           O  
ATOM   3249  CB  THR A 419      -0.877  30.332 -30.235  1.00  0.57           C  
ATOM   3250  OG1 THR A 419      -1.492  30.399 -31.511  1.00  0.57           O  
ATOM   3251  CG2 THR A 419      -1.636  29.247 -29.454  1.00  0.57           C  
ATOM   3252  N   VAL A 420       0.885  31.630 -27.967  1.00  0.62           N  
ATOM   3253  CA  VAL A 420       1.514  31.632 -26.650  1.00  0.62           C  
ATOM   3254  C   VAL A 420       1.128  32.850 -25.816  1.00  0.62           C  
ATOM   3255  O   VAL A 420       0.791  32.709 -24.641  1.00  0.62           O  
ATOM   3256  CB  VAL A 420       3.036  31.519 -26.758  1.00  0.62           C  
ATOM   3257  CG1 VAL A 420       3.728  31.729 -25.396  1.00  0.62           C  
ATOM   3258  CG2 VAL A 420       3.401  30.120 -27.299  1.00  0.62           C  
ATOM   3259  N   GLU A 421       1.114  34.065 -26.405  1.00  0.48           N  
ATOM   3260  CA  GLU A 421       0.674  35.286 -25.738  1.00  0.48           C  
ATOM   3261  C   GLU A 421      -0.769  35.233 -25.294  1.00  0.48           C  
ATOM   3262  O   GLU A 421      -1.097  35.489 -24.141  1.00  0.48           O  
ATOM   3263  CB  GLU A 421       0.826  36.494 -26.681  1.00  0.48           C  
ATOM   3264  CG  GLU A 421       2.305  36.803 -26.953  1.00  0.48           C  
ATOM   3265  CD  GLU A 421       2.457  37.917 -27.972  1.00  0.48           C  
ATOM   3266  OE1 GLU A 421       3.213  38.872 -27.670  1.00  0.48           O  
ATOM   3267  OE2 GLU A 421       1.868  37.812 -29.076  1.00  0.48           O  
ATOM   3268  N   SER A 422      -1.660  34.780 -26.193  1.00  0.46           N  
ATOM   3269  CA  SER A 422      -3.074  34.581 -25.912  1.00  0.46           C  
ATOM   3270  C   SER A 422      -3.322  33.572 -24.804  1.00  0.46           C  
ATOM   3271  O   SER A 422      -4.173  33.758 -23.937  1.00  0.46           O  
ATOM   3272  CB  SER A 422      -3.791  34.116 -27.204  1.00  0.46           C  
ATOM   3273  OG  SER A 422      -5.208  33.964 -27.051  1.00  0.46           O  
ATOM   3274  N   LEU A 423      -2.554  32.467 -24.770  1.00  0.45           N  
ATOM   3275  CA  LEU A 423      -2.562  31.563 -23.639  1.00  0.45           C  
ATOM   3276  C   LEU A 423      -2.052  32.195 -22.353  1.00  0.45           C  
ATOM   3277  O   LEU A 423      -2.688  32.048 -21.320  1.00  0.45           O  
ATOM   3278  CB  LEU A 423      -1.745  30.288 -23.942  1.00  0.45           C  
ATOM   3279  CG  LEU A 423      -2.391  29.367 -24.995  1.00  0.45           C  
ATOM   3280  CD1 LEU A 423      -1.390  28.286 -25.428  1.00  0.45           C  
ATOM   3281  CD2 LEU A 423      -3.687  28.719 -24.482  1.00  0.45           C  
ATOM   3282  N   ALA A 424      -0.937  32.952 -22.370  1.00  0.46           N  
ATOM   3283  CA  ALA A 424      -0.389  33.615 -21.198  1.00  0.46           C  
ATOM   3284  C   ALA A 424      -1.340  34.629 -20.565  1.00  0.46           C  
ATOM   3285  O   ALA A 424      -1.555  34.615 -19.353  1.00  0.46           O  
ATOM   3286  CB  ALA A 424       0.944  34.285 -21.582  1.00  0.46           C  
ATOM   3287  N   ASP A 425      -2.003  35.451 -21.401  1.00  0.39           N  
ATOM   3288  CA  ASP A 425      -3.054  36.377 -21.028  1.00  0.39           C  
ATOM   3289  C   ASP A 425      -4.281  35.690 -20.429  1.00  0.39           C  
ATOM   3290  O   ASP A 425      -4.982  36.253 -19.589  1.00  0.39           O  
ATOM   3291  CB  ASP A 425      -3.486  37.196 -22.270  1.00  0.39           C  
ATOM   3292  CG  ASP A 425      -2.445  38.235 -22.661  1.00  0.39           C  
ATOM   3293  OD1 ASP A 425      -1.471  38.445 -21.896  1.00  0.39           O  
ATOM   3294  OD2 ASP A 425      -2.666  38.865 -23.727  1.00  0.39           O  
ATOM   3295  N   ARG A 426      -4.582  34.435 -20.827  1.00  0.29           N  
ATOM   3296  CA  ARG A 426      -5.722  33.703 -20.298  1.00  0.29           C  
ATOM   3297  C   ARG A 426      -5.355  32.745 -19.172  1.00  0.29           C  
ATOM   3298  O   ARG A 426      -6.231  32.177 -18.525  1.00  0.29           O  
ATOM   3299  CB  ARG A 426      -6.391  32.868 -21.408  1.00  0.29           C  
ATOM   3300  CG  ARG A 426      -7.056  33.720 -22.505  1.00  0.29           C  
ATOM   3301  CD  ARG A 426      -7.656  32.820 -23.583  1.00  0.29           C  
ATOM   3302  NE  ARG A 426      -8.259  33.680 -24.646  1.00  0.29           N  
ATOM   3303  CZ  ARG A 426      -9.055  33.201 -25.611  1.00  0.29           C  
ATOM   3304  NH1 ARG A 426      -9.404  31.918 -25.647  1.00  0.29           N  
ATOM   3305  NH2 ARG A 426      -9.515  34.020 -26.552  1.00  0.29           N  
ATOM   3306  N   LEU A 427      -4.056  32.594 -18.857  1.00  0.28           N  
ATOM   3307  CA  LEU A 427      -3.567  31.796 -17.745  1.00  0.28           C  
ATOM   3308  C   LEU A 427      -3.142  32.572 -16.475  1.00  0.28           C  
ATOM   3309  O   LEU A 427      -2.394  31.954 -15.709  1.00  0.28           O  
ATOM   3310  CB  LEU A 427      -2.361  30.933 -18.226  1.00  0.28           C  
ATOM   3311  CG  LEU A 427      -2.736  29.770 -19.172  1.00  0.28           C  
ATOM   3312  CD1 LEU A 427      -1.499  29.271 -19.936  1.00  0.28           C  
ATOM   3313  CD2 LEU A 427      -3.391  28.600 -18.422  1.00  0.28           C  
ATOM   3314  N   PRO A 428      -3.503  33.824 -16.081  1.00  0.28           N  
ATOM   3315  CA  PRO A 428      -2.890  34.500 -14.938  1.00  0.28           C  
ATOM   3316  C   PRO A 428      -3.161  33.828 -13.599  1.00  0.28           C  
ATOM   3317  O   PRO A 428      -2.501  34.172 -12.627  1.00  0.28           O  
ATOM   3318  CB  PRO A 428      -3.435  35.957 -14.967  1.00  0.28           C  
ATOM   3319  CG  PRO A 428      -4.402  36.086 -16.149  1.00  0.28           C  
ATOM   3320  CD  PRO A 428      -4.418  34.710 -16.799  1.00  0.28           C  
ATOM   3321  N   SER A 429      -4.105  32.872 -13.518  1.00  0.27           N  
ATOM   3322  CA  SER A 429      -4.521  32.250 -12.274  1.00  0.27           C  
ATOM   3323  C   SER A 429      -4.019  30.829 -12.120  1.00  0.27           C  
ATOM   3324  O   SER A 429      -4.397  30.135 -11.181  1.00  0.27           O  
ATOM   3325  CB  SER A 429      -6.067  32.214 -12.170  1.00  0.27           C  
ATOM   3326  OG  SER A 429      -6.651  31.563 -13.306  1.00  0.27           O  
ATOM   3327  N   TRP A 430      -3.127  30.323 -13.005  1.00  0.22           N  
ATOM   3328  CA  TRP A 430      -2.652  28.944 -12.892  1.00  0.22           C  
ATOM   3329  C   TRP A 430      -1.843  28.665 -11.612  1.00  0.22           C  
ATOM   3330  O   TRP A 430      -1.836  27.556 -11.085  1.00  0.22           O  
ATOM   3331  CB  TRP A 430      -1.908  28.443 -14.174  1.00  0.22           C  
ATOM   3332  CG  TRP A 430      -0.398  28.613 -14.173  1.00  0.22           C  
ATOM   3333  CD1 TRP A 430       0.303  29.759 -13.944  1.00  0.22           C  
ATOM   3334  CD2 TRP A 430       0.564  27.540 -14.192  1.00  0.22           C  
ATOM   3335  NE1 TRP A 430       1.631  29.471 -13.733  1.00  0.22           N  
ATOM   3336  CE2 TRP A 430       1.817  28.116 -13.906  1.00  0.22           C  
ATOM   3337  CE3 TRP A 430       0.439  26.169 -14.422  1.00  0.22           C  
ATOM   3338  CZ2 TRP A 430       2.967  27.340 -13.872  1.00  0.22           C  
ATOM   3339  CZ3 TRP A 430       1.605  25.386 -14.384  1.00  0.22           C  
ATOM   3340  CH2 TRP A 430       2.854  25.962 -14.111  1.00  0.22           C  
ATOM   3341  N   ARG A 431      -1.147  29.696 -11.075  1.00  0.24           N  
ATOM   3342  CA  ARG A 431      -0.395  29.602  -9.834  1.00  0.24           C  
ATOM   3343  C   ARG A 431      -1.309  29.548  -8.612  1.00  0.24           C  
ATOM   3344  O   ARG A 431      -0.897  29.059  -7.562  1.00  0.24           O  
ATOM   3345  CB  ARG A 431       0.590  30.799  -9.676  1.00  0.24           C  
ATOM   3346  CG  ARG A 431       1.777  30.776 -10.660  1.00  0.24           C  
ATOM   3347  CD  ARG A 431       2.772  31.925 -10.454  1.00  0.24           C  
ATOM   3348  NE  ARG A 431       3.915  31.704 -11.412  1.00  0.24           N  
ATOM   3349  CZ  ARG A 431       4.846  32.623 -11.710  1.00  0.24           C  
ATOM   3350  NH1 ARG A 431       4.817  33.848 -11.198  1.00  0.24           N  
ATOM   3351  NH2 ARG A 431       5.836  32.303 -12.544  1.00  0.24           N  
ATOM   3352  N   ASP A 432      -2.570  30.005  -8.769  1.00  0.32           N  
ATOM   3353  CA  ASP A 432      -3.577  30.096  -7.732  1.00  0.32           C  
ATOM   3354  C   ASP A 432      -4.564  28.931  -7.809  1.00  0.32           C  
ATOM   3355  O   ASP A 432      -5.525  28.843  -7.041  1.00  0.32           O  
ATOM   3356  CB  ASP A 432      -4.389  31.407  -7.892  1.00  0.32           C  
ATOM   3357  CG  ASP A 432      -3.521  32.645  -7.749  1.00  0.32           C  
ATOM   3358  OD1 ASP A 432      -2.556  32.625  -6.946  1.00  0.32           O  
ATOM   3359  OD2 ASP A 432      -3.837  33.634  -8.459  1.00  0.32           O  
ATOM   3360  N   LEU A 433      -4.346  27.956  -8.725  1.00  0.32           N  
ATOM   3361  CA  LEU A 433      -5.025  26.674  -8.670  1.00  0.32           C  
ATOM   3362  C   LEU A 433      -4.640  25.974  -7.380  1.00  0.32           C  
ATOM   3363  O   LEU A 433      -3.464  26.057  -7.015  1.00  0.32           O  
ATOM   3364  CB  LEU A 433      -4.649  25.758  -9.865  1.00  0.32           C  
ATOM   3365  CG  LEU A 433      -5.333  26.153 -11.185  1.00  0.32           C  
ATOM   3366  CD1 LEU A 433      -4.649  25.453 -12.369  1.00  0.32           C  
ATOM   3367  CD2 LEU A 433      -6.828  25.796 -11.158  1.00  0.32           C  
ATOM   3368  N   PRO A 434      -5.539  25.315  -6.632  1.00  0.41           N  
ATOM   3369  CA  PRO A 434      -5.164  24.536  -5.465  1.00  0.41           C  
ATOM   3370  C   PRO A 434      -4.019  23.599  -5.778  1.00  0.41           C  
ATOM   3371  O   PRO A 434      -4.223  22.623  -6.499  1.00  0.41           O  
ATOM   3372  CB  PRO A 434      -6.455  23.829  -4.983  1.00  0.41           C  
ATOM   3373  CG  PRO A 434      -7.563  24.165  -5.998  1.00  0.41           C  
ATOM   3374  CD  PRO A 434      -6.932  25.116  -7.019  1.00  0.41           C  
ATOM   3375  N   GLN A 435      -2.807  23.859  -5.232  1.00  0.36           N  
ATOM   3376  CA  GLN A 435      -1.747  22.886  -5.260  1.00  0.36           C  
ATOM   3377  C   GLN A 435      -2.172  21.705  -4.434  1.00  0.36           C  
ATOM   3378  O   GLN A 435      -2.219  21.719  -3.208  1.00  0.36           O  
ATOM   3379  CB  GLN A 435      -0.359  23.433  -4.848  1.00  0.36           C  
ATOM   3380  CG  GLN A 435       0.157  24.512  -5.840  1.00  0.36           C  
ATOM   3381  CD  GLN A 435       1.647  24.373  -6.170  1.00  0.36           C  
ATOM   3382  OE1 GLN A 435       2.376  23.514  -5.679  1.00  0.36           O  
ATOM   3383  NE2 GLN A 435       2.142  25.253  -7.072  1.00  0.36           N  
ATOM   3384  N   THR A 436      -2.596  20.657  -5.151  1.00  0.43           N  
ATOM   3385  CA  THR A 436      -3.080  19.454  -4.563  1.00  0.43           C  
ATOM   3386  C   THR A 436      -2.009  18.751  -3.739  1.00  0.43           C  
ATOM   3387  O   THR A 436      -1.094  18.165  -4.315  1.00  0.43           O  
ATOM   3388  CB  THR A 436      -3.663  18.528  -5.586  1.00  0.43           C  
ATOM   3389  OG1 THR A 436      -2.840  18.384  -6.747  1.00  0.43           O  
ATOM   3390  CG2 THR A 436      -5.101  18.922  -5.979  1.00  0.43           C  
ATOM   3391  N   SER A 437      -2.138  18.796  -2.394  1.00  0.35           N  
ATOM   3392  CA  SER A 437      -1.531  17.869  -1.454  1.00  0.35           C  
ATOM   3393  C   SER A 437      -2.085  16.420  -1.568  1.00  0.35           C  
ATOM   3394  O   SER A 437      -2.931  16.132  -2.465  1.00  0.35           O  
ATOM   3395  CB  SER A 437      -1.683  18.399   0.007  1.00  0.35           C  
ATOM   3396  OG  SER A 437      -2.989  18.941   0.254  1.00  0.35           O  
ATOM   3397  OXT SER A 437      -1.601  15.568  -0.774  1.00  0.35           O  
TER    3398      SER A 437                                                      
ATOM   3399  N   MET B   1      40.856   0.368 -64.609  1.00  0.68           N  
ATOM   3400  CA  MET B   1      40.781   1.699 -63.912  1.00  0.68           C  
ATOM   3401  C   MET B   1      39.493   2.428 -64.251  1.00  0.68           C  
ATOM   3402  O   MET B   1      38.947   2.200 -65.326  1.00  0.68           O  
ATOM   3403  CB  MET B   1      42.033   2.510 -64.342  1.00  0.68           C  
ATOM   3404  CG  MET B   1      42.171   3.878 -63.650  1.00  0.68           C  
ATOM   3405  SD  MET B   1      43.567   4.900 -64.173  1.00  0.68           S  
ATOM   3406  CE  MET B   1      44.833   3.665 -63.842  1.00  0.68           C  
ATOM   3407  N   LYS B   2      38.966   3.290 -63.358  1.00  0.68           N  
ATOM   3408  CA  LYS B   2      37.794   4.102 -63.625  1.00  0.68           C  
ATOM   3409  C   LYS B   2      38.158   5.434 -64.264  1.00  0.68           C  
ATOM   3410  O   LYS B   2      39.281   5.924 -64.165  1.00  0.68           O  
ATOM   3411  CB  LYS B   2      36.983   4.361 -62.326  1.00  0.68           C  
ATOM   3412  CG  LYS B   2      36.501   3.081 -61.615  1.00  0.68           C  
ATOM   3413  CD  LYS B   2      35.548   2.291 -62.519  1.00  0.68           C  
ATOM   3414  CE  LYS B   2      34.956   1.008 -61.941  1.00  0.68           C  
ATOM   3415  NZ  LYS B   2      34.177   0.361 -63.001  1.00  0.68           N  
ATOM   3416  N   PHE B   3      37.200   6.072 -64.966  1.00  0.78           N  
ATOM   3417  CA  PHE B   3      37.392   7.380 -65.578  1.00  0.78           C  
ATOM   3418  C   PHE B   3      37.695   8.472 -64.555  1.00  0.78           C  
ATOM   3419  O   PHE B   3      38.533   9.342 -64.792  1.00  0.78           O  
ATOM   3420  CB  PHE B   3      36.176   7.752 -66.474  1.00  0.78           C  
ATOM   3421  CG  PHE B   3      36.321   9.081 -67.190  1.00  0.78           C  
ATOM   3422  CD1 PHE B   3      35.258  10.001 -67.180  1.00  0.78           C  
ATOM   3423  CD2 PHE B   3      37.510   9.434 -67.856  1.00  0.78           C  
ATOM   3424  CE1 PHE B   3      35.382  11.251 -67.800  1.00  0.78           C  
ATOM   3425  CE2 PHE B   3      37.645  10.693 -68.456  1.00  0.78           C  
ATOM   3426  CZ  PHE B   3      36.580  11.600 -68.432  1.00  0.78           C  
ATOM   3427  N   SER B   4      37.065   8.423 -63.365  1.00  0.79           N  
ATOM   3428  CA  SER B   4      37.397   9.309 -62.255  1.00  0.79           C  
ATOM   3429  C   SER B   4      38.851   9.220 -61.821  1.00  0.79           C  
ATOM   3430  O   SER B   4      39.519  10.245 -61.715  1.00  0.79           O  
ATOM   3431  CB  SER B   4      36.516   9.024 -61.013  1.00  0.79           C  
ATOM   3432  OG  SER B   4      36.429   7.619 -60.757  1.00  0.79           O  
ATOM   3433  N   ASP B   5      39.405   7.997 -61.672  1.00  0.80           N  
ATOM   3434  CA  ASP B   5      40.805   7.779 -61.349  1.00  0.80           C  
ATOM   3435  C   ASP B   5      41.752   8.403 -62.385  1.00  0.80           C  
ATOM   3436  O   ASP B   5      42.783   8.991 -62.057  1.00  0.80           O  
ATOM   3437  CB  ASP B   5      41.176   6.271 -61.332  1.00  0.80           C  
ATOM   3438  CG  ASP B   5      40.283   5.361 -60.512  1.00  0.80           C  
ATOM   3439  OD1 ASP B   5      39.830   5.761 -59.420  1.00  0.80           O  
ATOM   3440  OD2 ASP B   5      40.066   4.212 -60.997  1.00  0.80           O  
ATOM   3441  N   VAL B   6      41.413   8.282 -63.691  1.00  0.83           N  
ATOM   3442  CA  VAL B   6      42.164   8.883 -64.788  1.00  0.83           C  
ATOM   3443  C   VAL B   6      42.196  10.402 -64.700  1.00  0.83           C  
ATOM   3444  O   VAL B   6      43.248  11.023 -64.860  1.00  0.83           O  
ATOM   3445  CB  VAL B   6      41.601   8.479 -66.154  1.00  0.83           C  
ATOM   3446  CG1 VAL B   6      42.338   9.180 -67.312  1.00  0.83           C  
ATOM   3447  CG2 VAL B   6      41.746   6.965 -66.352  1.00  0.83           C  
ATOM   3448  N   LEU B   7      41.047  11.047 -64.412  1.00  0.80           N  
ATOM   3449  CA  LEU B   7      40.978  12.486 -64.222  1.00  0.80           C  
ATOM   3450  C   LEU B   7      41.778  12.957 -63.019  1.00  0.80           C  
ATOM   3451  O   LEU B   7      42.569  13.891 -63.128  1.00  0.80           O  
ATOM   3452  CB  LEU B   7      39.513  12.968 -64.097  1.00  0.80           C  
ATOM   3453  CG  LEU B   7      38.667  12.811 -65.380  1.00  0.80           C  
ATOM   3454  CD1 LEU B   7      37.220  13.237 -65.094  1.00  0.80           C  
ATOM   3455  CD2 LEU B   7      39.227  13.623 -66.560  1.00  0.80           C  
ATOM   3456  N   ASP B   8      41.668  12.267 -61.868  1.00  0.77           N  
ATOM   3457  CA  ASP B   8      42.420  12.581 -60.666  1.00  0.77           C  
ATOM   3458  C   ASP B   8      43.926  12.503 -60.894  1.00  0.77           C  
ATOM   3459  O   ASP B   8      44.679  13.391 -60.501  1.00  0.77           O  
ATOM   3460  CB  ASP B   8      42.010  11.619 -59.524  1.00  0.77           C  
ATOM   3461  CG  ASP B   8      40.621  11.938 -58.987  1.00  0.77           C  
ATOM   3462  OD1 ASP B   8      40.032  12.972 -59.392  1.00  0.77           O  
ATOM   3463  OD2 ASP B   8      40.157  11.154 -58.122  1.00  0.77           O  
ATOM   3464  N   GLN B   9      44.413  11.466 -61.605  1.00  0.74           N  
ATOM   3465  CA  GLN B   9      45.808  11.380 -62.003  1.00  0.74           C  
ATOM   3466  C   GLN B   9      46.258  12.462 -62.979  1.00  0.74           C  
ATOM   3467  O   GLN B   9      47.331  13.033 -62.811  1.00  0.74           O  
ATOM   3468  CB  GLN B   9      46.159   9.971 -62.528  1.00  0.74           C  
ATOM   3469  CG  GLN B   9      46.066   8.919 -61.396  1.00  0.74           C  
ATOM   3470  CD  GLN B   9      46.599   7.550 -61.808  1.00  0.74           C  
ATOM   3471  OE1 GLN B   9      47.768   7.370 -62.147  1.00  0.74           O  
ATOM   3472  NE2 GLN B   9      45.729   6.517 -61.736  1.00  0.74           N  
ATOM   3473  N   ALA B  10      45.433  12.829 -63.983  1.00  0.82           N  
ATOM   3474  CA  ALA B  10      45.713  13.941 -64.878  1.00  0.82           C  
ATOM   3475  C   ALA B  10      45.832  15.285 -64.156  1.00  0.82           C  
ATOM   3476  O   ALA B  10      46.714  16.104 -64.419  1.00  0.82           O  
ATOM   3477  CB  ALA B  10      44.609  14.025 -65.954  1.00  0.82           C  
ATOM   3478  N   TRP B  11      44.961  15.549 -63.169  1.00  0.67           N  
ATOM   3479  CA  TRP B  11      45.034  16.748 -62.356  1.00  0.67           C  
ATOM   3480  C   TRP B  11      46.172  16.709 -61.343  1.00  0.67           C  
ATOM   3481  O   TRP B  11      46.618  17.760 -60.905  1.00  0.67           O  
ATOM   3482  CB  TRP B  11      43.675  17.019 -61.661  1.00  0.67           C  
ATOM   3483  CG  TRP B  11      42.628  17.623 -62.595  1.00  0.67           C  
ATOM   3484  CD1 TRP B  11      41.709  17.011 -63.407  1.00  0.67           C  
ATOM   3485  CD2 TRP B  11      42.432  19.039 -62.771  1.00  0.67           C  
ATOM   3486  NE1 TRP B  11      40.970  17.950 -64.093  1.00  0.67           N  
ATOM   3487  CE2 TRP B  11      41.387  19.197 -63.707  1.00  0.67           C  
ATOM   3488  CE3 TRP B  11      43.057  20.144 -62.197  1.00  0.67           C  
ATOM   3489  CZ2 TRP B  11      40.946  20.456 -64.082  1.00  0.67           C  
ATOM   3490  CZ3 TRP B  11      42.602  21.419 -62.569  1.00  0.67           C  
ATOM   3491  CH2 TRP B  11      41.563  21.574 -63.500  1.00  0.67           C  
ATOM   3492  N   ALA B  12      46.717  15.521 -61.012  1.00  0.72           N  
ATOM   3493  CA  ALA B  12      47.792  15.373 -60.050  1.00  0.72           C  
ATOM   3494  C   ALA B  12      49.192  15.309 -60.666  1.00  0.72           C  
ATOM   3495  O   ALA B  12      50.178  15.105 -59.958  1.00  0.72           O  
ATOM   3496  CB  ALA B  12      47.546  14.091 -59.229  1.00  0.72           C  
ATOM   3497  N   GLU B  13      49.351  15.504 -62.000  1.00  0.62           N  
ATOM   3498  CA  GLU B  13      50.659  15.696 -62.622  1.00  0.62           C  
ATOM   3499  C   GLU B  13      51.265  17.053 -62.231  1.00  0.62           C  
ATOM   3500  O   GLU B  13      51.208  18.025 -62.988  1.00  0.62           O  
ATOM   3501  CB  GLU B  13      50.636  15.596 -64.179  1.00  0.62           C  
ATOM   3502  CG  GLU B  13      50.136  14.255 -64.776  1.00  0.62           C  
ATOM   3503  CD  GLU B  13      50.131  14.289 -66.303  1.00  0.62           C  
ATOM   3504  OE1 GLU B  13      50.303  13.216 -66.933  1.00  0.62           O  
ATOM   3505  OE2 GLU B  13      49.982  15.394 -66.883  1.00  0.62           O  
ATOM   3506  N   ASP B  14      51.828  17.145 -61.012  1.00  0.52           N  
ATOM   3507  CA  ASP B  14      52.400  18.368 -60.482  1.00  0.52           C  
ATOM   3508  C   ASP B  14      53.922  18.416 -60.638  1.00  0.52           C  
ATOM   3509  O   ASP B  14      54.564  19.454 -60.473  1.00  0.52           O  
ATOM   3510  CB  ASP B  14      52.028  18.452 -58.977  1.00  0.52           C  
ATOM   3511  CG  ASP B  14      50.560  18.804 -58.786  1.00  0.52           C  
ATOM   3512  OD1 ASP B  14      49.944  19.363 -59.728  1.00  0.52           O  
ATOM   3513  OD2 ASP B  14      50.057  18.534 -57.665  1.00  0.52           O  
ATOM   3514  N   SER B  15      54.569  17.300 -61.016  1.00  0.54           N  
ATOM   3515  CA  SER B  15      56.014  17.216 -61.149  1.00  0.54           C  
ATOM   3516  C   SER B  15      56.434  17.468 -62.589  1.00  0.54           C  
ATOM   3517  O   SER B  15      56.772  16.551 -63.332  1.00  0.54           O  
ATOM   3518  CB  SER B  15      56.591  15.861 -60.618  1.00  0.54           C  
ATOM   3519  OG  SER B  15      55.578  14.854 -60.518  1.00  0.54           O  
ATOM   3520  N   GLY B  16      56.464  18.755 -63.012  1.00  0.60           N  
ATOM   3521  CA  GLY B  16      56.955  19.161 -64.329  1.00  0.60           C  
ATOM   3522  C   GLY B  16      55.847  19.622 -65.243  1.00  0.60           C  
ATOM   3523  O   GLY B  16      54.721  19.824 -64.792  1.00  0.60           O  
ATOM   3524  N   PRO B  17      56.113  19.863 -66.528  1.00  0.60           N  
ATOM   3525  CA  PRO B  17      55.065  20.054 -67.521  1.00  0.60           C  
ATOM   3526  C   PRO B  17      54.152  18.836 -67.623  1.00  0.60           C  
ATOM   3527  O   PRO B  17      54.698  17.731 -67.653  1.00  0.60           O  
ATOM   3528  CB  PRO B  17      55.815  20.367 -68.827  1.00  0.60           C  
ATOM   3529  CG  PRO B  17      57.202  19.734 -68.658  1.00  0.60           C  
ATOM   3530  CD  PRO B  17      57.431  19.692 -67.141  1.00  0.60           C  
ATOM   3531  N   PRO B  18      52.819  18.959 -67.632  1.00  0.73           N  
ATOM   3532  CA  PRO B  18      51.931  17.815 -67.755  1.00  0.73           C  
ATOM   3533  C   PRO B  18      52.161  17.050 -69.037  1.00  0.73           C  
ATOM   3534  O   PRO B  18      52.661  17.599 -70.022  1.00  0.73           O  
ATOM   3535  CB  PRO B  18      50.518  18.425 -67.698  1.00  0.73           C  
ATOM   3536  CG  PRO B  18      50.689  19.838 -68.257  1.00  0.73           C  
ATOM   3537  CD  PRO B  18      52.099  20.223 -67.797  1.00  0.73           C  
ATOM   3538  N   THR B  19      51.776  15.770 -69.056  1.00  0.78           N  
ATOM   3539  CA  THR B  19      51.775  14.977 -70.267  1.00  0.78           C  
ATOM   3540  C   THR B  19      50.746  15.516 -71.243  1.00  0.78           C  
ATOM   3541  O   THR B  19      49.805  16.209 -70.860  1.00  0.78           O  
ATOM   3542  CB  THR B  19      51.506  13.493 -70.028  1.00  0.78           C  
ATOM   3543  OG1 THR B  19      50.188  13.209 -69.559  1.00  0.78           O  
ATOM   3544  CG2 THR B  19      52.568  12.920 -69.064  1.00  0.78           C  
ATOM   3545  N   THR B  20      50.875  15.229 -72.557  1.00  0.81           N  
ATOM   3546  CA  THR B  20      49.907  15.701 -73.553  1.00  0.81           C  
ATOM   3547  C   THR B  20      48.494  15.252 -73.237  1.00  0.81           C  
ATOM   3548  O   THR B  20      47.560  16.041 -73.237  1.00  0.81           O  
ATOM   3549  CB  THR B  20      50.240  15.247 -74.970  1.00  0.81           C  
ATOM   3550  OG1 THR B  20      51.598  15.539 -75.261  1.00  0.81           O  
ATOM   3551  CG2 THR B  20      49.396  16.003 -76.004  1.00  0.81           C  
ATOM   3552  N   LEU B  21      48.315  13.975 -72.846  1.00  0.84           N  
ATOM   3553  CA  LEU B  21      47.038  13.485 -72.365  1.00  0.84           C  
ATOM   3554  C   LEU B  21      46.554  14.165 -71.089  1.00  0.84           C  
ATOM   3555  O   LEU B  21      45.392  14.558 -70.990  1.00  0.84           O  
ATOM   3556  CB  LEU B  21      47.138  11.965 -72.108  1.00  0.84           C  
ATOM   3557  CG  LEU B  21      45.828  11.298 -71.640  1.00  0.84           C  
ATOM   3558  CD1 LEU B  21      44.686  11.474 -72.654  1.00  0.84           C  
ATOM   3559  CD2 LEU B  21      46.067   9.813 -71.370  1.00  0.84           C  
ATOM   3560  N   GLY B  22      47.440  14.344 -70.084  1.00  0.85           N  
ATOM   3561  CA  GLY B  22      47.191  15.108 -68.866  1.00  0.85           C  
ATOM   3562  C   GLY B  22      46.672  16.494 -69.082  1.00  0.85           C  
ATOM   3563  O   GLY B  22      45.661  16.891 -68.511  1.00  0.85           O  
ATOM   3564  N   ARG B  23      47.336  17.266 -69.957  1.00  0.72           N  
ATOM   3565  CA  ARG B  23      46.925  18.604 -70.326  1.00  0.72           C  
ATOM   3566  C   ARG B  23      45.543  18.653 -70.951  1.00  0.72           C  
ATOM   3567  O   ARG B  23      44.684  19.442 -70.557  1.00  0.72           O  
ATOM   3568  CB  ARG B  23      47.930  19.152 -71.365  1.00  0.72           C  
ATOM   3569  CG  ARG B  23      47.624  20.584 -71.851  1.00  0.72           C  
ATOM   3570  CD  ARG B  23      48.543  21.050 -72.979  1.00  0.72           C  
ATOM   3571  NE  ARG B  23      48.208  20.235 -74.182  1.00  0.72           N  
ATOM   3572  CZ  ARG B  23      48.855  20.302 -75.347  1.00  0.72           C  
ATOM   3573  NH1 ARG B  23      49.821  21.194 -75.556  1.00  0.72           N  
ATOM   3574  NH2 ARG B  23      48.504  19.452 -76.306  1.00  0.72           N  
ATOM   3575  N   ASP B  24      45.306  17.768 -71.927  1.00  0.85           N  
ATOM   3576  CA  ASP B  24      44.107  17.720 -72.718  1.00  0.85           C  
ATOM   3577  C   ASP B  24      42.903  17.212 -71.884  1.00  0.85           C  
ATOM   3578  O   ASP B  24      41.775  17.682 -72.026  1.00  0.85           O  
ATOM   3579  CB  ASP B  24      44.430  16.929 -74.023  1.00  0.85           C  
ATOM   3580  CG  ASP B  24      45.578  17.524 -74.863  1.00  0.85           C  
ATOM   3581  OD1 ASP B  24      46.163  18.591 -74.528  1.00  0.85           O  
ATOM   3582  OD2 ASP B  24      45.912  16.908 -75.906  1.00  0.85           O  
ATOM   3583  N   LEU B  25      43.117  16.283 -70.918  1.00  0.85           N  
ATOM   3584  CA  LEU B  25      42.102  15.860 -69.952  1.00  0.85           C  
ATOM   3585  C   LEU B  25      41.788  16.880 -68.863  1.00  0.85           C  
ATOM   3586  O   LEU B  25      40.694  16.867 -68.306  1.00  0.85           O  
ATOM   3587  CB  LEU B  25      42.501  14.548 -69.229  1.00  0.85           C  
ATOM   3588  CG  LEU B  25      42.402  13.277 -70.092  1.00  0.85           C  
ATOM   3589  CD1 LEU B  25      43.026  12.105 -69.326  1.00  0.85           C  
ATOM   3590  CD2 LEU B  25      40.951  12.941 -70.480  1.00  0.85           C  
ATOM   3591  N   ARG B  26      42.690  17.837 -68.558  1.00  0.72           N  
ATOM   3592  CA  ARG B  26      42.423  18.911 -67.600  1.00  0.72           C  
ATOM   3593  C   ARG B  26      41.424  19.924 -68.134  1.00  0.72           C  
ATOM   3594  O   ARG B  26      40.895  20.757 -67.401  1.00  0.72           O  
ATOM   3595  CB  ARG B  26      43.708  19.680 -67.214  1.00  0.72           C  
ATOM   3596  CG  ARG B  26      44.617  18.921 -66.230  1.00  0.72           C  
ATOM   3597  CD  ARG B  26      45.971  19.617 -66.066  1.00  0.72           C  
ATOM   3598  NE  ARG B  26      46.830  18.762 -65.200  1.00  0.72           N  
ATOM   3599  CZ  ARG B  26      48.016  19.125 -64.699  1.00  0.72           C  
ATOM   3600  NH1 ARG B  26      48.642  20.233 -65.070  1.00  0.72           N  
ATOM   3601  NH2 ARG B  26      48.590  18.336 -63.805  1.00  0.72           N  
ATOM   3602  N   LEU B  27      41.108  19.854 -69.440  1.00  0.84           N  
ATOM   3603  CA  LEU B  27      40.022  20.608 -70.019  1.00  0.84           C  
ATOM   3604  C   LEU B  27      38.663  20.087 -69.587  1.00  0.84           C  
ATOM   3605  O   LEU B  27      37.672  20.806 -69.668  1.00  0.84           O  
ATOM   3606  CB  LEU B  27      40.096  20.564 -71.560  1.00  0.84           C  
ATOM   3607  CG  LEU B  27      41.371  21.211 -72.127  1.00  0.84           C  
ATOM   3608  CD1 LEU B  27      41.488  20.928 -73.630  1.00  0.84           C  
ATOM   3609  CD2 LEU B  27      41.369  22.720 -71.860  1.00  0.84           C  
ATOM   3610  N   VAL B  28      38.570  18.840 -69.082  1.00  0.83           N  
ATOM   3611  CA  VAL B  28      37.360  18.324 -68.464  1.00  0.83           C  
ATOM   3612  C   VAL B  28      37.126  18.968 -67.102  1.00  0.83           C  
ATOM   3613  O   VAL B  28      37.922  18.844 -66.173  1.00  0.83           O  
ATOM   3614  CB  VAL B  28      37.392  16.806 -68.330  1.00  0.83           C  
ATOM   3615  CG1 VAL B  28      36.105  16.294 -67.652  1.00  0.83           C  
ATOM   3616  CG2 VAL B  28      37.548  16.181 -69.732  1.00  0.83           C  
ATOM   3617  N   ARG B  29      36.001  19.694 -66.956  1.00  0.62           N  
ATOM   3618  CA  ARG B  29      35.691  20.444 -65.753  1.00  0.62           C  
ATOM   3619  C   ARG B  29      34.733  19.686 -64.868  1.00  0.62           C  
ATOM   3620  O   ARG B  29      34.787  19.779 -63.645  1.00  0.62           O  
ATOM   3621  CB  ARG B  29      34.992  21.772 -66.142  1.00  0.62           C  
ATOM   3622  CG  ARG B  29      35.924  22.777 -66.849  1.00  0.62           C  
ATOM   3623  CD  ARG B  29      36.969  23.435 -65.939  1.00  0.62           C  
ATOM   3624  NE  ARG B  29      36.203  24.247 -64.939  1.00  0.62           N  
ATOM   3625  CZ  ARG B  29      36.759  24.975 -63.964  1.00  0.62           C  
ATOM   3626  NH1 ARG B  29      38.077  25.053 -63.815  1.00  0.62           N  
ATOM   3627  NH2 ARG B  29      35.970  25.639 -63.121  1.00  0.62           N  
ATOM   3628  N   ALA B  30      33.845  18.900 -65.491  1.00  0.75           N  
ATOM   3629  CA  ALA B  30      32.886  18.091 -64.797  1.00  0.75           C  
ATOM   3630  C   ALA B  30      32.465  16.984 -65.735  1.00  0.75           C  
ATOM   3631  O   ALA B  30      32.573  17.092 -66.955  1.00  0.75           O  
ATOM   3632  CB  ALA B  30      31.659  18.915 -64.352  1.00  0.75           C  
ATOM   3633  N   ALA B  31      31.982  15.870 -65.178  1.00  0.82           N  
ATOM   3634  CA  ALA B  31      31.478  14.775 -65.959  1.00  0.82           C  
ATOM   3635  C   ALA B  31      30.399  14.119 -65.143  1.00  0.82           C  
ATOM   3636  O   ALA B  31      30.450  14.116 -63.914  1.00  0.82           O  
ATOM   3637  CB  ALA B  31      32.585  13.756 -66.296  1.00  0.82           C  
ATOM   3638  N   ALA B  32      29.373  13.578 -65.816  1.00  0.83           N  
ATOM   3639  CA  ALA B  32      28.285  12.884 -65.173  1.00  0.83           C  
ATOM   3640  C   ALA B  32      28.732  11.654 -64.359  1.00  0.83           C  
ATOM   3641  O   ALA B  32      29.680  10.980 -64.782  1.00  0.83           O  
ATOM   3642  CB  ALA B  32      27.256  12.505 -66.249  1.00  0.83           C  
ATOM   3643  N   PRO B  33      28.131  11.317 -63.206  1.00  0.79           N  
ATOM   3644  CA  PRO B  33      28.553  10.204 -62.354  1.00  0.79           C  
ATOM   3645  C   PRO B  33      28.663   8.871 -63.061  1.00  0.79           C  
ATOM   3646  O   PRO B  33      29.554   8.083 -62.743  1.00  0.79           O  
ATOM   3647  CB  PRO B  33      27.502  10.164 -61.232  1.00  0.79           C  
ATOM   3648  CG  PRO B  33      27.020  11.612 -61.127  1.00  0.79           C  
ATOM   3649  CD  PRO B  33      27.051  12.088 -62.581  1.00  0.79           C  
ATOM   3650  N   GLU B  34      27.775   8.606 -64.030  1.00  0.75           N  
ATOM   3651  CA  GLU B  34      27.735   7.414 -64.837  1.00  0.75           C  
ATOM   3652  C   GLU B  34      28.993   7.251 -65.671  1.00  0.75           C  
ATOM   3653  O   GLU B  34      29.571   6.170 -65.744  1.00  0.75           O  
ATOM   3654  CB  GLU B  34      26.495   7.445 -65.771  1.00  0.75           C  
ATOM   3655  CG  GLU B  34      25.136   7.656 -65.044  1.00  0.75           C  
ATOM   3656  CD  GLU B  34      24.825   9.101 -64.638  1.00  0.75           C  
ATOM   3657  OE1 GLU B  34      23.765   9.309 -64.003  1.00  0.75           O  
ATOM   3658  OE2 GLU B  34      25.655  10.001 -64.932  1.00  0.75           O  
ATOM   3659  N   LEU B  35      29.482   8.351 -66.284  1.00  0.79           N  
ATOM   3660  CA  LEU B  35      30.736   8.374 -67.020  1.00  0.79           C  
ATOM   3661  C   LEU B  35      31.944   8.180 -66.137  1.00  0.79           C  
ATOM   3662  O   LEU B  35      32.864   7.447 -66.486  1.00  0.79           O  
ATOM   3663  CB  LEU B  35      30.936   9.689 -67.806  1.00  0.79           C  
ATOM   3664  CG  LEU B  35      29.891   9.903 -68.909  1.00  0.79           C  
ATOM   3665  CD1 LEU B  35      30.044  11.291 -69.538  1.00  0.79           C  
ATOM   3666  CD2 LEU B  35      29.955   8.826 -70.002  1.00  0.79           C  
ATOM   3667  N   LEU B  36      31.958   8.809 -64.944  1.00  0.76           N  
ATOM   3668  CA  LEU B  36      33.027   8.687 -63.967  1.00  0.76           C  
ATOM   3669  C   LEU B  36      33.249   7.247 -63.518  1.00  0.76           C  
ATOM   3670  O   LEU B  36      34.376   6.820 -63.280  1.00  0.76           O  
ATOM   3671  CB  LEU B  36      32.750   9.606 -62.749  1.00  0.76           C  
ATOM   3672  CG  LEU B  36      32.828  11.118 -63.059  1.00  0.76           C  
ATOM   3673  CD1 LEU B  36      32.420  11.946 -61.831  1.00  0.76           C  
ATOM   3674  CD2 LEU B  36      34.229  11.549 -63.522  1.00  0.76           C  
ATOM   3675  N   ALA B  37      32.166   6.451 -63.456  1.00  0.76           N  
ATOM   3676  CA  ALA B  37      32.205   5.076 -63.021  1.00  0.76           C  
ATOM   3677  C   ALA B  37      32.507   4.073 -64.138  1.00  0.76           C  
ATOM   3678  O   ALA B  37      32.652   2.872 -63.884  1.00  0.76           O  
ATOM   3679  CB  ALA B  37      30.827   4.750 -62.417  1.00  0.76           C  
ATOM   3680  N   LEU B  38      32.635   4.528 -65.403  1.00  0.75           N  
ATOM   3681  CA  LEU B  38      33.065   3.685 -66.504  1.00  0.75           C  
ATOM   3682  C   LEU B  38      34.514   3.240 -66.410  1.00  0.75           C  
ATOM   3683  O   LEU B  38      35.402   3.989 -66.004  1.00  0.75           O  
ATOM   3684  CB  LEU B  38      32.858   4.356 -67.886  1.00  0.75           C  
ATOM   3685  CG  LEU B  38      31.385   4.602 -68.265  1.00  0.75           C  
ATOM   3686  CD1 LEU B  38      31.288   5.360 -69.597  1.00  0.75           C  
ATOM   3687  CD2 LEU B  38      30.579   3.297 -68.349  1.00  0.75           C  
ATOM   3688  N   ASP B  39      34.781   1.985 -66.813  1.00  0.76           N  
ATOM   3689  CA  ASP B  39      36.118   1.457 -66.951  1.00  0.76           C  
ATOM   3690  C   ASP B  39      36.796   1.968 -68.219  1.00  0.76           C  
ATOM   3691  O   ASP B  39      36.225   1.973 -69.308  1.00  0.76           O  
ATOM   3692  CB  ASP B  39      36.097  -0.087 -66.913  1.00  0.76           C  
ATOM   3693  CG  ASP B  39      35.617  -0.470 -65.546  1.00  0.76           C  
ATOM   3694  OD1 ASP B  39      36.387  -0.359 -64.560  1.00  0.76           O  
ATOM   3695  OD2 ASP B  39      34.409  -0.756 -65.378  1.00  0.76           O  
ATOM   3696  N   VAL B  40      38.053   2.428 -68.095  1.00  0.83           N  
ATOM   3697  CA  VAL B  40      38.843   2.890 -69.226  1.00  0.83           C  
ATOM   3698  C   VAL B  40      39.669   1.737 -69.781  1.00  0.83           C  
ATOM   3699  O   VAL B  40      39.901   0.774 -69.045  1.00  0.83           O  
ATOM   3700  CB  VAL B  40      39.749   4.066 -68.867  1.00  0.83           C  
ATOM   3701  CG1 VAL B  40      38.867   5.222 -68.359  1.00  0.83           C  
ATOM   3702  CG2 VAL B  40      40.804   3.668 -67.817  1.00  0.83           C  
ATOM   3703  N   PRO B  41      40.170   1.735 -71.020  1.00  0.83           N  
ATOM   3704  CA  PRO B  41      40.767   0.527 -71.593  1.00  0.83           C  
ATOM   3705  C   PRO B  41      42.255   0.468 -71.269  1.00  0.83           C  
ATOM   3706  O   PRO B  41      43.080   0.307 -72.164  1.00  0.83           O  
ATOM   3707  CB  PRO B  41      40.535   0.718 -73.105  1.00  0.83           C  
ATOM   3708  CG  PRO B  41      40.588   2.234 -73.296  1.00  0.83           C  
ATOM   3709  CD  PRO B  41      39.870   2.741 -72.048  1.00  0.83           C  
ATOM   3710  N   ALA B  42      42.604   0.576 -69.978  1.00  0.81           N  
ATOM   3711  CA  ALA B  42      43.952   0.426 -69.494  1.00  0.81           C  
ATOM   3712  C   ALA B  42      43.927   0.172 -68.001  1.00  0.81           C  
ATOM   3713  O   ALA B  42      43.002   0.590 -67.290  1.00  0.81           O  
ATOM   3714  CB  ALA B  42      44.773   1.699 -69.755  1.00  0.81           C  
ATOM   3715  N   ASP B  43      44.977  -0.488 -67.483  1.00  0.70           N  
ATOM   3716  CA  ASP B  43      45.066  -0.791 -66.074  1.00  0.70           C  
ATOM   3717  C   ASP B  43      45.887   0.269 -65.368  1.00  0.70           C  
ATOM   3718  O   ASP B  43      45.742   0.486 -64.163  1.00  0.70           O  
ATOM   3719  CB  ASP B  43      45.674  -2.197 -65.873  1.00  0.70           C  
ATOM   3720  CG  ASP B  43      44.628  -3.238 -66.234  1.00  0.70           C  
ATOM   3721  OD1 ASP B  43      43.443  -3.023 -65.854  1.00  0.70           O  
ATOM   3722  OD2 ASP B  43      44.995  -4.265 -66.855  1.00  0.70           O  
ATOM   3723  N   ALA B  44      46.695   1.041 -66.119  1.00  0.79           N  
ATOM   3724  CA  ALA B  44      47.475   2.109 -65.545  1.00  0.79           C  
ATOM   3725  C   ALA B  44      47.420   3.385 -66.372  1.00  0.79           C  
ATOM   3726  O   ALA B  44      47.301   3.398 -67.594  1.00  0.79           O  
ATOM   3727  CB  ALA B  44      48.923   1.646 -65.345  1.00  0.79           C  
ATOM   3728  N   TYR B  45      47.512   4.553 -65.699  1.00  0.78           N  
ATOM   3729  CA  TYR B  45      47.473   5.854 -66.345  1.00  0.78           C  
ATOM   3730  C   TYR B  45      48.643   6.066 -67.304  1.00  0.78           C  
ATOM   3731  O   TYR B  45      48.479   6.595 -68.400  1.00  0.78           O  
ATOM   3732  CB  TYR B  45      47.405   6.958 -65.260  1.00  0.78           C  
ATOM   3733  CG  TYR B  45      47.339   8.348 -65.829  1.00  0.78           C  
ATOM   3734  CD1 TYR B  45      48.424   9.225 -65.671  1.00  0.78           C  
ATOM   3735  CD2 TYR B  45      46.206   8.781 -66.536  1.00  0.78           C  
ATOM   3736  CE1 TYR B  45      48.382  10.512 -66.223  1.00  0.78           C  
ATOM   3737  CE2 TYR B  45      46.165  10.067 -67.093  1.00  0.78           C  
ATOM   3738  CZ  TYR B  45      47.254  10.926 -66.940  1.00  0.78           C  
ATOM   3739  OH  TYR B  45      47.205  12.198 -67.528  1.00  0.78           O  
ATOM   3740  N   GLY B  46      49.855   5.597 -66.932  1.00  0.81           N  
ATOM   3741  CA  GLY B  46      51.033   5.659 -67.795  1.00  0.81           C  
ATOM   3742  C   GLY B  46      50.900   4.921 -69.106  1.00  0.81           C  
ATOM   3743  O   GLY B  46      51.472   5.329 -70.112  1.00  0.81           O  
ATOM   3744  N   GLU B  47      50.102   3.835 -69.147  1.00  0.76           N  
ATOM   3745  CA  GLU B  47      49.754   3.148 -70.377  1.00  0.76           C  
ATOM   3746  C   GLU B  47      48.896   4.003 -71.289  1.00  0.76           C  
ATOM   3747  O   GLU B  47      49.165   4.112 -72.482  1.00  0.76           O  
ATOM   3748  CB  GLU B  47      48.979   1.849 -70.078  1.00  0.76           C  
ATOM   3749  CG  GLU B  47      49.785   0.819 -69.261  1.00  0.76           C  
ATOM   3750  CD  GLU B  47      48.915  -0.310 -68.716  1.00  0.76           C  
ATOM   3751  OE1 GLU B  47      49.532  -1.273 -68.203  1.00  0.76           O  
ATOM   3752  OE2 GLU B  47      47.660  -0.201 -68.738  1.00  0.76           O  
ATOM   3753  N   LEU B  48      47.873   4.694 -70.730  1.00  0.82           N  
ATOM   3754  CA  LEU B  48      47.059   5.646 -71.470  1.00  0.82           C  
ATOM   3755  C   LEU B  48      47.880   6.801 -72.012  1.00  0.82           C  
ATOM   3756  O   LEU B  48      47.727   7.191 -73.164  1.00  0.82           O  
ATOM   3757  CB  LEU B  48      45.918   6.253 -70.612  1.00  0.82           C  
ATOM   3758  CG  LEU B  48      44.807   5.269 -70.217  1.00  0.82           C  
ATOM   3759  CD1 LEU B  48      43.890   5.902 -69.161  1.00  0.82           C  
ATOM   3760  CD2 LEU B  48      43.971   4.827 -71.429  1.00  0.82           C  
ATOM   3761  N   VAL B  49      48.804   7.358 -71.207  1.00  0.83           N  
ATOM   3762  CA  VAL B  49      49.734   8.389 -71.648  1.00  0.83           C  
ATOM   3763  C   VAL B  49      50.634   7.905 -72.778  1.00  0.83           C  
ATOM   3764  O   VAL B  49      50.789   8.571 -73.800  1.00  0.83           O  
ATOM   3765  CB  VAL B  49      50.600   8.854 -70.480  1.00  0.83           C  
ATOM   3766  CG1 VAL B  49      51.721   9.806 -70.941  1.00  0.83           C  
ATOM   3767  CG2 VAL B  49      49.716   9.574 -69.444  1.00  0.83           C  
ATOM   3768  N   GLY B  50      51.213   6.692 -72.643  1.00  0.84           N  
ATOM   3769  CA  GLY B  50      52.102   6.109 -73.641  1.00  0.84           C  
ATOM   3770  C   GLY B  50      51.445   5.757 -74.949  1.00  0.84           C  
ATOM   3771  O   GLY B  50      52.084   5.783 -76.003  1.00  0.84           O  
ATOM   3772  N   SER B  51      50.139   5.435 -74.936  1.00  0.84           N  
ATOM   3773  CA  SER B  51      49.404   5.076 -76.138  1.00  0.84           C  
ATOM   3774  C   SER B  51      48.655   6.241 -76.746  1.00  0.84           C  
ATOM   3775  O   SER B  51      48.178   6.143 -77.874  1.00  0.84           O  
ATOM   3776  CB  SER B  51      48.387   3.932 -75.875  1.00  0.84           C  
ATOM   3777  OG  SER B  51      47.364   4.312 -74.949  1.00  0.84           O  
ATOM   3778  N   TYR B  52      48.573   7.395 -76.048  1.00  0.32           N  
ATOM   3779  CA  TYR B  52      47.911   8.582 -76.551  1.00  0.32           C  
ATOM   3780  C   TYR B  52      48.593   9.158 -77.784  1.00  0.32           C  
ATOM   3781  O   TYR B  52      49.803   9.386 -77.822  1.00  0.32           O  
ATOM   3782  CB  TYR B  52      47.766   9.665 -75.442  1.00  0.32           C  
ATOM   3783  CG  TYR B  52      46.878  10.815 -75.856  1.00  0.32           C  
ATOM   3784  CD1 TYR B  52      47.335  12.143 -75.800  1.00  0.32           C  
ATOM   3785  CD2 TYR B  52      45.568  10.569 -76.302  1.00  0.32           C  
ATOM   3786  CE1 TYR B  52      46.502  13.200 -76.198  1.00  0.32           C  
ATOM   3787  CE2 TYR B  52      44.733  11.624 -76.688  1.00  0.32           C  
ATOM   3788  CZ  TYR B  52      45.208  12.936 -76.650  1.00  0.32           C  
ATOM   3789  OH  TYR B  52      44.399  14.000 -77.084  1.00  0.32           O  
ATOM   3790  N   ARG B  53      47.810   9.392 -78.847  1.00  0.29           N  
ATOM   3791  CA  ARG B  53      48.308   9.965 -80.075  1.00  0.29           C  
ATOM   3792  C   ARG B  53      47.399  11.116 -80.479  1.00  0.29           C  
ATOM   3793  O   ARG B  53      46.304  10.864 -80.987  1.00  0.29           O  
ATOM   3794  CB  ARG B  53      48.362   8.902 -81.200  1.00  0.29           C  
ATOM   3795  CG  ARG B  53      49.385   7.773 -80.941  1.00  0.29           C  
ATOM   3796  CD  ARG B  53      50.842   8.257 -80.872  1.00  0.29           C  
ATOM   3797  NE  ARG B  53      51.701   7.069 -80.536  1.00  0.29           N  
ATOM   3798  CZ  ARG B  53      52.020   6.700 -79.287  1.00  0.29           C  
ATOM   3799  NH1 ARG B  53      51.615   7.358 -78.210  1.00  0.29           N  
ATOM   3800  NH2 ARG B  53      52.785   5.626 -79.094  1.00  0.29           N  
ATOM   3801  N   PRO B  54      47.775  12.383 -80.289  1.00  0.41           N  
ATOM   3802  CA  PRO B  54      46.882  13.514 -80.534  1.00  0.41           C  
ATOM   3803  C   PRO B  54      46.757  13.806 -82.013  1.00  0.41           C  
ATOM   3804  O   PRO B  54      45.837  14.514 -82.420  1.00  0.41           O  
ATOM   3805  CB  PRO B  54      47.558  14.681 -79.789  1.00  0.41           C  
ATOM   3806  CG  PRO B  54      49.036  14.289 -79.714  1.00  0.41           C  
ATOM   3807  CD  PRO B  54      48.963  12.780 -79.530  1.00  0.41           C  
ATOM   3808  N   ASP B  55      47.683  13.279 -82.823  1.00  0.40           N  
ATOM   3809  CA  ASP B  55      47.721  13.347 -84.260  1.00  0.40           C  
ATOM   3810  C   ASP B  55      46.670  12.449 -84.915  1.00  0.40           C  
ATOM   3811  O   ASP B  55      46.171  12.728 -86.001  1.00  0.40           O  
ATOM   3812  CB  ASP B  55      49.162  12.963 -84.703  1.00  0.40           C  
ATOM   3813  CG  ASP B  55      49.586  11.598 -84.166  1.00  0.40           C  
ATOM   3814  OD1 ASP B  55      49.689  11.460 -82.916  1.00  0.40           O  
ATOM   3815  OD2 ASP B  55      49.768  10.658 -84.978  1.00  0.40           O  
ATOM   3816  N   ARG B  56      46.267  11.364 -84.224  1.00  0.35           N  
ATOM   3817  CA  ARG B  56      45.271  10.418 -84.692  1.00  0.35           C  
ATOM   3818  C   ARG B  56      43.879  10.733 -84.170  1.00  0.35           C  
ATOM   3819  O   ARG B  56      43.090   9.842 -83.862  1.00  0.35           O  
ATOM   3820  CB  ARG B  56      45.639   8.976 -84.285  1.00  0.35           C  
ATOM   3821  CG  ARG B  56      46.925   8.462 -84.952  1.00  0.35           C  
ATOM   3822  CD  ARG B  56      47.079   6.958 -84.747  1.00  0.35           C  
ATOM   3823  NE  ARG B  56      48.317   6.530 -85.464  1.00  0.35           N  
ATOM   3824  CZ  ARG B  56      48.682   5.250 -85.606  1.00  0.35           C  
ATOM   3825  NH1 ARG B  56      47.970   4.263 -85.067  1.00  0.35           N  
ATOM   3826  NH2 ARG B  56      49.779   4.951 -86.295  1.00  0.35           N  
ATOM   3827  N   ALA B  57      43.545  12.027 -84.057  1.00  0.51           N  
ATOM   3828  CA  ALA B  57      42.230  12.493 -83.685  1.00  0.51           C  
ATOM   3829  C   ALA B  57      41.102  12.057 -84.620  1.00  0.51           C  
ATOM   3830  O   ALA B  57      41.245  12.045 -85.842  1.00  0.51           O  
ATOM   3831  CB  ALA B  57      42.267  14.031 -83.625  1.00  0.51           C  
ATOM   3832  N   GLY B  58      39.923  11.703 -84.056  1.00  0.52           N  
ATOM   3833  CA  GLY B  58      38.700  11.559 -84.838  1.00  0.52           C  
ATOM   3834  C   GLY B  58      38.278  12.841 -85.518  1.00  0.52           C  
ATOM   3835  O   GLY B  58      38.536  13.941 -85.033  1.00  0.52           O  
ATOM   3836  N   ALA B  59      37.600  12.735 -86.676  1.00  0.65           N  
ATOM   3837  CA  ALA B  59      37.143  13.895 -87.415  1.00  0.65           C  
ATOM   3838  C   ALA B  59      36.121  14.746 -86.669  1.00  0.65           C  
ATOM   3839  O   ALA B  59      35.133  14.246 -86.137  1.00  0.65           O  
ATOM   3840  CB  ALA B  59      36.559  13.467 -88.778  1.00  0.65           C  
ATOM   3841  N   VAL B  60      36.314  16.072 -86.643  1.00  0.65           N  
ATOM   3842  CA  VAL B  60      35.399  16.988 -85.992  1.00  0.65           C  
ATOM   3843  C   VAL B  60      34.705  17.815 -87.052  1.00  0.65           C  
ATOM   3844  O   VAL B  60      35.310  18.594 -87.788  1.00  0.65           O  
ATOM   3845  CB  VAL B  60      36.081  17.900 -84.976  1.00  0.65           C  
ATOM   3846  CG1 VAL B  60      35.038  18.795 -84.272  1.00  0.65           C  
ATOM   3847  CG2 VAL B  60      36.826  17.048 -83.929  1.00  0.65           C  
ATOM   3848  N   THR B  61      33.375  17.666 -87.151  1.00  0.67           N  
ATOM   3849  CA  THR B  61      32.559  18.448 -88.064  1.00  0.67           C  
ATOM   3850  C   THR B  61      31.839  19.491 -87.259  1.00  0.67           C  
ATOM   3851  O   THR B  61      31.044  19.179 -86.373  1.00  0.67           O  
ATOM   3852  CB  THR B  61      31.502  17.635 -88.798  1.00  0.67           C  
ATOM   3853  OG1 THR B  61      32.121  16.697 -89.667  1.00  0.67           O  
ATOM   3854  CG2 THR B  61      30.602  18.510 -89.689  1.00  0.67           C  
ATOM   3855  N   ALA B  62      32.064  20.779 -87.564  1.00  0.69           N  
ATOM   3856  CA  ALA B  62      31.223  21.828 -87.041  1.00  0.69           C  
ATOM   3857  C   ALA B  62      29.937  21.927 -87.836  1.00  0.69           C  
ATOM   3858  O   ALA B  62      29.941  21.982 -89.065  1.00  0.69           O  
ATOM   3859  CB  ALA B  62      31.924  23.190 -87.052  1.00  0.69           C  
ATOM   3860  N   VAL B  63      28.801  21.938 -87.130  1.00  0.71           N  
ATOM   3861  CA  VAL B  63      27.490  22.057 -87.726  1.00  0.71           C  
ATOM   3862  C   VAL B  63      26.946  23.405 -87.338  1.00  0.71           C  
ATOM   3863  O   VAL B  63      26.712  23.686 -86.163  1.00  0.71           O  
ATOM   3864  CB  VAL B  63      26.534  20.975 -87.253  1.00  0.71           C  
ATOM   3865  CG1 VAL B  63      25.160  21.155 -87.931  1.00  0.71           C  
ATOM   3866  CG2 VAL B  63      27.141  19.597 -87.588  1.00  0.71           C  
ATOM   3867  N   VAL B  64      26.741  24.280 -88.334  1.00  0.72           N  
ATOM   3868  CA  VAL B  64      26.271  25.628 -88.100  1.00  0.72           C  
ATOM   3869  C   VAL B  64      24.910  25.769 -88.734  1.00  0.72           C  
ATOM   3870  O   VAL B  64      24.750  25.701 -89.952  1.00  0.72           O  
ATOM   3871  CB  VAL B  64      27.220  26.694 -88.641  1.00  0.72           C  
ATOM   3872  CG1 VAL B  64      26.718  28.097 -88.236  1.00  0.72           C  
ATOM   3873  CG2 VAL B  64      28.627  26.459 -88.054  1.00  0.72           C  
ATOM   3874  N   LEU B  65      23.863  25.969 -87.915  1.00  0.67           N  
ATOM   3875  CA  LEU B  65      22.542  26.299 -88.422  1.00  0.67           C  
ATOM   3876  C   LEU B  65      22.507  27.778 -88.749  1.00  0.67           C  
ATOM   3877  O   LEU B  65      23.045  28.596 -88.008  1.00  0.67           O  
ATOM   3878  CB  LEU B  65      21.414  25.979 -87.409  1.00  0.67           C  
ATOM   3879  CG  LEU B  65      20.857  24.543 -87.486  1.00  0.67           C  
ATOM   3880  CD1 LEU B  65      21.917  23.459 -87.242  1.00  0.67           C  
ATOM   3881  CD2 LEU B  65      19.706  24.390 -86.482  1.00  0.67           C  
ATOM   3882  N   THR B  66      21.895  28.164 -89.883  1.00  0.65           N  
ATOM   3883  CA  THR B  66      21.982  29.550 -90.324  1.00  0.65           C  
ATOM   3884  C   THR B  66      20.727  29.983 -91.063  1.00  0.65           C  
ATOM   3885  O   THR B  66      20.033  29.173 -91.679  1.00  0.65           O  
ATOM   3886  CB  THR B  66      23.254  29.816 -91.135  1.00  0.65           C  
ATOM   3887  OG1 THR B  66      23.520  31.201 -91.248  1.00  0.65           O  
ATOM   3888  CG2 THR B  66      23.192  29.235 -92.551  1.00  0.65           C  
ATOM   3889  N   HIS B  67      20.398  31.286 -90.966  1.00  0.52           N  
ATOM   3890  CA  HIS B  67      19.259  31.915 -91.616  1.00  0.52           C  
ATOM   3891  C   HIS B  67      19.432  33.417 -91.526  1.00  0.52           C  
ATOM   3892  O   HIS B  67      19.161  34.002 -90.481  1.00  0.52           O  
ATOM   3893  CB  HIS B  67      17.896  31.574 -90.949  1.00  0.52           C  
ATOM   3894  CG  HIS B  67      16.739  32.213 -91.659  1.00  0.52           C  
ATOM   3895  ND1 HIS B  67      16.370  31.694 -92.876  1.00  0.52           N  
ATOM   3896  CD2 HIS B  67      16.152  33.421 -91.464  1.00  0.52           C  
ATOM   3897  CE1 HIS B  67      15.575  32.600 -93.415  1.00  0.52           C  
ATOM   3898  NE2 HIS B  67      15.411  33.671 -92.600  1.00  0.52           N  
ATOM   3899  N   ASP B  68      19.892  34.058 -92.618  1.00  0.54           N  
ATOM   3900  CA  ASP B  68      20.116  35.498 -92.690  1.00  0.54           C  
ATOM   3901  C   ASP B  68      21.135  36.040 -91.667  1.00  0.54           C  
ATOM   3902  O   ASP B  68      20.858  36.932 -90.864  1.00  0.54           O  
ATOM   3903  CB  ASP B  68      18.794  36.314 -92.676  1.00  0.54           C  
ATOM   3904  CG  ASP B  68      17.845  35.888 -93.781  1.00  0.54           C  
ATOM   3905  OD1 ASP B  68      18.317  35.499 -94.883  1.00  0.54           O  
ATOM   3906  OD2 ASP B  68      16.610  35.974 -93.541  1.00  0.54           O  
ATOM   3907  N   GLU B  69      22.362  35.482 -91.673  1.00  0.59           N  
ATOM   3908  CA  GLU B  69      23.408  35.717 -90.702  1.00  0.59           C  
ATOM   3909  C   GLU B  69      24.663  36.314 -91.335  1.00  0.59           C  
ATOM   3910  O   GLU B  69      25.779  36.108 -90.845  1.00  0.59           O  
ATOM   3911  CB  GLU B  69      23.792  34.394 -89.997  1.00  0.59           C  
ATOM   3912  CG  GLU B  69      22.641  33.782 -89.159  1.00  0.59           C  
ATOM   3913  CD  GLU B  69      22.358  34.522 -87.851  1.00  0.59           C  
ATOM   3914  OE1 GLU B  69      21.459  34.031 -87.120  1.00  0.59           O  
ATOM   3915  OE2 GLU B  69      23.047  35.532 -87.556  1.00  0.59           O  
ATOM   3916  N   GLU B  70      24.547  37.082 -92.447  1.00  0.56           N  
ATOM   3917  CA  GLU B  70      25.669  37.590 -93.233  1.00  0.56           C  
ATOM   3918  C   GLU B  70      26.718  38.354 -92.432  1.00  0.56           C  
ATOM   3919  O   GLU B  70      27.918  38.262 -92.681  1.00  0.56           O  
ATOM   3920  CB  GLU B  70      25.157  38.447 -94.423  1.00  0.56           C  
ATOM   3921  CG  GLU B  70      24.434  39.763 -94.038  1.00  0.56           C  
ATOM   3922  CD  GLU B  70      23.945  40.566 -95.244  1.00  0.56           C  
ATOM   3923  OE1 GLU B  70      23.533  41.730 -94.992  1.00  0.56           O  
ATOM   3924  OE2 GLU B  70      24.011  40.064 -96.404  1.00  0.56           O  
ATOM   3925  N   GLN B  71      26.282  39.092 -91.401  1.00  0.55           N  
ATOM   3926  CA  GLN B  71      27.133  39.849 -90.515  1.00  0.55           C  
ATOM   3927  C   GLN B  71      28.020  39.031 -89.586  1.00  0.55           C  
ATOM   3928  O   GLN B  71      29.154  39.414 -89.304  1.00  0.55           O  
ATOM   3929  CB  GLN B  71      26.273  40.878 -89.761  1.00  0.55           C  
ATOM   3930  CG  GLN B  71      25.546  41.773 -90.805  1.00  0.55           C  
ATOM   3931  CD  GLN B  71      25.087  43.119 -90.250  1.00  0.55           C  
ATOM   3932  OE1 GLN B  71      25.652  43.656 -89.301  1.00  0.55           O  
ATOM   3933  NE2 GLN B  71      24.035  43.707 -90.865  1.00  0.55           N  
ATOM   3934  N   VAL B  72      27.541  37.880 -89.075  1.00  0.64           N  
ATOM   3935  CA  VAL B  72      28.255  37.164 -88.024  1.00  0.64           C  
ATOM   3936  C   VAL B  72      28.879  35.865 -88.502  1.00  0.64           C  
ATOM   3937  O   VAL B  72      29.870  35.399 -87.934  1.00  0.64           O  
ATOM   3938  CB  VAL B  72      27.362  36.895 -86.819  1.00  0.64           C  
ATOM   3939  CG1 VAL B  72      26.967  38.240 -86.176  1.00  0.64           C  
ATOM   3940  CG2 VAL B  72      26.109  36.100 -87.223  1.00  0.64           C  
ATOM   3941  N   ILE B  73      28.383  35.280 -89.618  1.00  0.65           N  
ATOM   3942  CA  ILE B  73      28.773  33.952 -90.082  1.00  0.65           C  
ATOM   3943  C   ILE B  73      30.256  33.818 -90.395  1.00  0.65           C  
ATOM   3944  O   ILE B  73      30.892  32.809 -90.099  1.00  0.65           O  
ATOM   3945  CB  ILE B  73      27.909  33.488 -91.263  1.00  0.65           C  
ATOM   3946  CG1 ILE B  73      28.076  31.986 -91.596  1.00  0.65           C  
ATOM   3947  CG2 ILE B  73      28.172  34.341 -92.525  1.00  0.65           C  
ATOM   3948  CD1 ILE B  73      27.622  31.050 -90.471  1.00  0.65           C  
ATOM   3949  N   GLY B  74      30.885  34.866 -90.970  1.00  0.65           N  
ATOM   3950  CA  GLY B  74      32.303  34.813 -91.290  1.00  0.65           C  
ATOM   3951  C   GLY B  74      33.213  34.761 -90.093  1.00  0.65           C  
ATOM   3952  O   GLY B  74      34.260  34.125 -90.133  1.00  0.65           O  
ATOM   3953  N   ALA B  75      32.845  35.420 -88.978  1.00  0.67           N  
ATOM   3954  CA  ALA B  75      33.602  35.338 -87.746  1.00  0.67           C  
ATOM   3955  C   ALA B  75      33.487  33.982 -87.071  1.00  0.67           C  
ATOM   3956  O   ALA B  75      34.488  33.425 -86.623  1.00  0.67           O  
ATOM   3957  CB  ALA B  75      33.179  36.472 -86.797  1.00  0.67           C  
ATOM   3958  N   CYS B  76      32.268  33.406 -87.049  1.00  0.67           N  
ATOM   3959  CA  CYS B  76      32.006  32.073 -86.530  1.00  0.67           C  
ATOM   3960  C   CYS B  76      32.826  30.996 -87.232  1.00  0.67           C  
ATOM   3961  O   CYS B  76      33.543  30.227 -86.596  1.00  0.67           O  
ATOM   3962  CB  CYS B  76      30.482  31.782 -86.681  1.00  0.67           C  
ATOM   3963  SG  CYS B  76      29.951  30.071 -86.272  1.00  0.67           S  
ATOM   3964  N   LEU B  77      32.802  30.959 -88.579  1.00  0.67           N  
ATOM   3965  CA  LEU B  77      33.528  29.967 -89.350  1.00  0.67           C  
ATOM   3966  C   LEU B  77      35.036  30.066 -89.220  1.00  0.67           C  
ATOM   3967  O   LEU B  77      35.714  29.055 -89.057  1.00  0.67           O  
ATOM   3968  CB  LEU B  77      33.126  30.037 -90.839  1.00  0.67           C  
ATOM   3969  CG  LEU B  77      31.638  29.733 -91.110  1.00  0.67           C  
ATOM   3970  CD1 LEU B  77      31.356  29.886 -92.608  1.00  0.67           C  
ATOM   3971  CD2 LEU B  77      31.211  28.341 -90.623  1.00  0.67           C  
ATOM   3972  N   ARG B  78      35.603  31.293 -89.227  1.00  0.62           N  
ATOM   3973  CA  ARG B  78      37.027  31.512 -89.029  1.00  0.62           C  
ATOM   3974  C   ARG B  78      37.541  31.051 -87.677  1.00  0.62           C  
ATOM   3975  O   ARG B  78      38.694  30.662 -87.545  1.00  0.62           O  
ATOM   3976  CB  ARG B  78      37.404  33.004 -89.192  1.00  0.62           C  
ATOM   3977  CG  ARG B  78      37.431  33.469 -90.658  1.00  0.62           C  
ATOM   3978  CD  ARG B  78      38.021  34.871 -90.840  1.00  0.62           C  
ATOM   3979  NE  ARG B  78      37.058  35.867 -90.253  1.00  0.62           N  
ATOM   3980  CZ  ARG B  78      36.184  36.587 -90.969  1.00  0.62           C  
ATOM   3981  NH1 ARG B  78      36.054  36.414 -92.280  1.00  0.62           N  
ATOM   3982  NH2 ARG B  78      35.428  37.498 -90.358  1.00  0.62           N  
ATOM   3983  N   ALA B  79      36.705  31.087 -86.629  1.00  0.67           N  
ATOM   3984  CA  ALA B  79      37.109  30.656 -85.311  1.00  0.67           C  
ATOM   3985  C   ALA B  79      37.118  29.140 -85.145  1.00  0.67           C  
ATOM   3986  O   ALA B  79      37.694  28.613 -84.199  1.00  0.67           O  
ATOM   3987  CB  ALA B  79      36.164  31.312 -84.295  1.00  0.67           C  
ATOM   3988  N   LEU B  80      36.491  28.396 -86.074  1.00  0.64           N  
ATOM   3989  CA  LEU B  80      36.370  26.956 -85.973  1.00  0.64           C  
ATOM   3990  C   LEU B  80      37.380  26.213 -86.833  1.00  0.64           C  
ATOM   3991  O   LEU B  80      37.469  24.989 -86.765  1.00  0.64           O  
ATOM   3992  CB  LEU B  80      34.954  26.538 -86.442  1.00  0.64           C  
ATOM   3993  CG  LEU B  80      33.812  27.040 -85.537  1.00  0.64           C  
ATOM   3994  CD1 LEU B  80      32.458  26.857 -86.237  1.00  0.64           C  
ATOM   3995  CD2 LEU B  80      33.822  26.332 -84.175  1.00  0.64           C  
ATOM   3996  N   THR B  81      38.190  26.914 -87.652  1.00  0.61           N  
ATOM   3997  CA  THR B  81      39.113  26.309 -88.615  1.00  0.61           C  
ATOM   3998  C   THR B  81      40.213  25.482 -87.982  1.00  0.61           C  
ATOM   3999  O   THR B  81      40.531  24.397 -88.460  1.00  0.61           O  
ATOM   4000  CB  THR B  81      39.748  27.329 -89.558  1.00  0.61           C  
ATOM   4001  OG1 THR B  81      40.267  28.427 -88.825  1.00  0.61           O  
ATOM   4002  CG2 THR B  81      38.660  27.891 -90.487  1.00  0.61           C  
ATOM   4003  N   ASP B  82      40.803  25.954 -86.868  1.00  0.50           N  
ATOM   4004  CA  ASP B  82      41.858  25.251 -86.161  1.00  0.50           C  
ATOM   4005  C   ASP B  82      41.377  23.972 -85.463  1.00  0.50           C  
ATOM   4006  O   ASP B  82      42.118  23.002 -85.290  1.00  0.50           O  
ATOM   4007  CB  ASP B  82      42.523  26.196 -85.125  1.00  0.50           C  
ATOM   4008  CG  ASP B  82      43.198  27.378 -85.800  1.00  0.50           C  
ATOM   4009  OD1 ASP B  82      43.916  27.164 -86.807  1.00  0.50           O  
ATOM   4010  OD2 ASP B  82      43.043  28.516 -85.280  1.00  0.50           O  
ATOM   4011  N   ASP B  83      40.098  23.926 -85.043  1.00  0.56           N  
ATOM   4012  CA  ASP B  83      39.590  22.824 -84.257  1.00  0.56           C  
ATOM   4013  C   ASP B  83      38.783  21.828 -85.069  1.00  0.56           C  
ATOM   4014  O   ASP B  83      38.664  20.671 -84.673  1.00  0.56           O  
ATOM   4015  CB  ASP B  83      38.710  23.387 -83.120  1.00  0.56           C  
ATOM   4016  CG  ASP B  83      39.614  23.851 -82.006  1.00  0.56           C  
ATOM   4017  OD1 ASP B  83      39.987  22.975 -81.180  1.00  0.56           O  
ATOM   4018  OD2 ASP B  83      39.952  25.056 -81.934  1.00  0.56           O  
ATOM   4019  N   CYS B  84      38.257  22.193 -86.249  1.00  0.61           N  
ATOM   4020  CA  CYS B  84      37.312  21.353 -86.968  1.00  0.61           C  
ATOM   4021  C   CYS B  84      37.771  21.050 -88.377  1.00  0.61           C  
ATOM   4022  O   CYS B  84      38.100  21.938 -89.154  1.00  0.61           O  
ATOM   4023  CB  CYS B  84      35.919  22.020 -87.034  1.00  0.61           C  
ATOM   4024  SG  CYS B  84      35.239  22.309 -85.362  1.00  0.61           S  
ATOM   4025  N   ASP B  85      37.778  19.751 -88.744  1.00  0.62           N  
ATOM   4026  CA  ASP B  85      38.178  19.246 -90.045  1.00  0.62           C  
ATOM   4027  C   ASP B  85      37.194  19.652 -91.131  1.00  0.62           C  
ATOM   4028  O   ASP B  85      37.540  19.844 -92.295  1.00  0.62           O  
ATOM   4029  CB  ASP B  85      38.267  17.695 -90.024  1.00  0.62           C  
ATOM   4030  CG  ASP B  85      39.145  17.259 -88.881  1.00  0.62           C  
ATOM   4031  OD1 ASP B  85      40.387  17.224 -88.999  1.00  0.62           O  
ATOM   4032  OD2 ASP B  85      38.582  17.051 -87.773  1.00  0.62           O  
ATOM   4033  N   ARG B  86      35.908  19.771 -90.756  1.00  0.62           N  
ATOM   4034  CA  ARG B  86      34.859  20.065 -91.696  1.00  0.62           C  
ATOM   4035  C   ARG B  86      33.910  21.092 -91.132  1.00  0.62           C  
ATOM   4036  O   ARG B  86      33.560  21.078 -89.952  1.00  0.62           O  
ATOM   4037  CB  ARG B  86      34.087  18.774 -92.048  1.00  0.62           C  
ATOM   4038  CG  ARG B  86      33.378  18.822 -93.413  1.00  0.62           C  
ATOM   4039  CD  ARG B  86      32.734  17.490 -93.800  1.00  0.62           C  
ATOM   4040  NE  ARG B  86      31.480  17.362 -92.998  1.00  0.62           N  
ATOM   4041  CZ  ARG B  86      30.669  16.304 -93.044  1.00  0.62           C  
ATOM   4042  NH1 ARG B  86      30.884  15.287 -93.872  1.00  0.62           N  
ATOM   4043  NH2 ARG B  86      29.575  16.275 -92.294  1.00  0.62           N  
ATOM   4044  N   LEU B  87      33.459  22.021 -91.987  1.00  0.72           N  
ATOM   4045  CA  LEU B  87      32.490  23.030 -91.628  1.00  0.72           C  
ATOM   4046  C   LEU B  87      31.249  22.799 -92.467  1.00  0.72           C  
ATOM   4047  O   LEU B  87      31.290  22.889 -93.692  1.00  0.72           O  
ATOM   4048  CB  LEU B  87      33.037  24.454 -91.896  1.00  0.72           C  
ATOM   4049  CG  LEU B  87      34.360  24.796 -91.174  1.00  0.72           C  
ATOM   4050  CD1 LEU B  87      34.842  26.195 -91.583  1.00  0.72           C  
ATOM   4051  CD2 LEU B  87      34.245  24.712 -89.646  1.00  0.72           C  
ATOM   4052  N   LEU B  88      30.118  22.468 -91.818  1.00  0.70           N  
ATOM   4053  CA  LEU B  88      28.870  22.158 -92.481  1.00  0.70           C  
ATOM   4054  C   LEU B  88      27.829  23.182 -92.094  1.00  0.70           C  
ATOM   4055  O   LEU B  88      27.447  23.317 -90.932  1.00  0.70           O  
ATOM   4056  CB  LEU B  88      28.360  20.751 -92.066  1.00  0.70           C  
ATOM   4057  CG  LEU B  88      26.973  20.344 -92.621  1.00  0.70           C  
ATOM   4058  CD1 LEU B  88      26.969  20.259 -94.154  1.00  0.70           C  
ATOM   4059  CD2 LEU B  88      26.510  19.010 -92.016  1.00  0.70           C  
ATOM   4060  N   LEU B  89      27.321  23.934 -93.081  1.00  0.71           N  
ATOM   4061  CA  LEU B  89      26.230  24.856 -92.856  1.00  0.71           C  
ATOM   4062  C   LEU B  89      24.926  24.172 -93.190  1.00  0.71           C  
ATOM   4063  O   LEU B  89      24.739  23.621 -94.274  1.00  0.71           O  
ATOM   4064  CB  LEU B  89      26.341  26.170 -93.670  1.00  0.71           C  
ATOM   4065  CG  LEU B  89      27.225  27.247 -93.007  1.00  0.71           C  
ATOM   4066  CD1 LEU B  89      28.648  26.739 -92.759  1.00  0.71           C  
ATOM   4067  CD2 LEU B  89      27.243  28.523 -93.861  1.00  0.71           C  
ATOM   4068  N   VAL B  90      23.973  24.217 -92.250  1.00  0.68           N  
ATOM   4069  CA  VAL B  90      22.597  23.849 -92.511  1.00  0.68           C  
ATOM   4070  C   VAL B  90      21.838  25.147 -92.693  1.00  0.68           C  
ATOM   4071  O   VAL B  90      21.525  25.861 -91.738  1.00  0.68           O  
ATOM   4072  CB  VAL B  90      21.994  23.001 -91.400  1.00  0.68           C  
ATOM   4073  CG1 VAL B  90      20.561  22.573 -91.779  1.00  0.68           C  
ATOM   4074  CG2 VAL B  90      22.879  21.754 -91.188  1.00  0.68           C  
ATOM   4075  N   ASP B  91      21.564  25.498 -93.961  1.00  0.60           N  
ATOM   4076  CA  ASP B  91      20.976  26.757 -94.338  1.00  0.60           C  
ATOM   4077  C   ASP B  91      19.476  26.584 -94.414  1.00  0.60           C  
ATOM   4078  O   ASP B  91      18.965  25.723 -95.129  1.00  0.60           O  
ATOM   4079  CB  ASP B  91      21.561  27.227 -95.694  1.00  0.60           C  
ATOM   4080  CG  ASP B  91      21.002  28.584 -96.053  1.00  0.60           C  
ATOM   4081  OD1 ASP B  91      21.389  29.554 -95.362  1.00  0.60           O  
ATOM   4082  OD2 ASP B  91      20.162  28.677 -96.980  1.00  0.60           O  
ATOM   4083  N   ALA B  92      18.738  27.426 -93.675  1.00  0.59           N  
ATOM   4084  CA  ALA B  92      17.298  27.372 -93.626  1.00  0.59           C  
ATOM   4085  C   ALA B  92      16.642  28.274 -94.660  1.00  0.59           C  
ATOM   4086  O   ALA B  92      15.561  28.801 -94.411  1.00  0.59           O  
ATOM   4087  CB  ALA B  92      16.817  27.723 -92.209  1.00  0.59           C  
ATOM   4088  N   GLU B  93      17.303  28.437 -95.829  1.00  0.48           N  
ATOM   4089  CA  GLU B  93      16.864  29.230 -96.962  1.00  0.48           C  
ATOM   4090  C   GLU B  93      17.159  30.707 -96.781  1.00  0.48           C  
ATOM   4091  O   GLU B  93      16.273  31.556 -96.863  1.00  0.48           O  
ATOM   4092  CB  GLU B  93      15.415  28.959 -97.455  1.00  0.48           C  
ATOM   4093  CG  GLU B  93      15.170  27.485 -97.857  1.00  0.48           C  
ATOM   4094  CD  GLU B  93      13.713  27.200 -98.206  1.00  0.48           C  
ATOM   4095  OE1 GLU B  93      13.473  26.714 -99.342  1.00  0.48           O  
ATOM   4096  OE2 GLU B  93      12.835  27.393 -97.324  1.00  0.48           O  
ATOM   4097  N   SER B  94      18.445  31.048 -96.542  1.00  0.55           N  
ATOM   4098  CA  SER B  94      18.889  32.435 -96.397  1.00  0.55           C  
ATOM   4099  C   SER B  94      18.626  33.291 -97.629  1.00  0.55           C  
ATOM   4100  O   SER B  94      18.905  32.892 -98.763  1.00  0.55           O  
ATOM   4101  CB  SER B  94      20.395  32.580 -96.075  1.00  0.55           C  
ATOM   4102  OG  SER B  94      20.733  31.969 -94.831  1.00  0.55           O  
ATOM   4103  N   GLU B  95      18.108  34.516 -97.436  1.00  0.50           N  
ATOM   4104  CA  GLU B  95      17.745  35.386 -98.541  1.00  0.50           C  
ATOM   4105  C   GLU B  95      18.782  36.483 -98.743  1.00  0.50           C  
ATOM   4106  O   GLU B  95      18.783  37.173 -99.764  1.00  0.50           O  
ATOM   4107  CB  GLU B  95      16.364  36.049 -98.296  1.00  0.50           C  
ATOM   4108  CG  GLU B  95      15.169  35.056 -98.265  1.00  0.50           C  
ATOM   4109  CD  GLU B  95      13.806  35.750 -98.168  1.00  0.50           C  
ATOM   4110  OE1 GLU B  95      12.790  35.017 -98.038  1.00  0.50           O  
ATOM   4111  OE2 GLU B  95      13.750  37.005 -98.259  1.00  0.50           O  
ATOM   4112  N   ASP B  96      19.716  36.652 -97.786  1.00  0.51           N  
ATOM   4113  CA  ASP B  96      20.767  37.649 -97.829  1.00  0.51           C  
ATOM   4114  C   ASP B  96      22.047  37.183 -98.553  1.00  0.51           C  
ATOM   4115  O   ASP B  96      22.015  36.364 -99.472  1.00  0.51           O  
ATOM   4116  CB  ASP B  96      21.033  38.149 -96.377  1.00  0.51           C  
ATOM   4117  CG  ASP B  96      21.721  37.151 -95.455  1.00  0.51           C  
ATOM   4118  OD1 ASP B  96      22.014  36.004 -95.886  1.00  0.51           O  
ATOM   4119  OD2 ASP B  96      22.015  37.511 -94.290  1.00  0.51           O  
ATOM   4120  N   THR B  97      23.244  37.684 -98.145  1.00  0.63           N  
ATOM   4121  CA  THR B  97      24.516  37.205 -98.692  1.00  0.63           C  
ATOM   4122  C   THR B  97      25.222  36.174 -97.817  1.00  0.63           C  
ATOM   4123  O   THR B  97      26.379  35.852 -98.073  1.00  0.63           O  
ATOM   4124  CB  THR B  97      25.507  38.278 -99.166  1.00  0.63           C  
ATOM   4125  OG1 THR B  97      26.051  39.089 -98.129  1.00  0.63           O  
ATOM   4126  CG2 THR B  97      24.815  39.254-100.101  1.00  0.63           C  
ATOM   4127  N   THR B  98      24.550  35.549 -96.812  1.00  0.62           N  
ATOM   4128  CA  THR B  98      25.115  34.600 -95.834  1.00  0.62           C  
ATOM   4129  C   THR B  98      25.965  33.499 -96.426  1.00  0.62           C  
ATOM   4130  O   THR B  98      27.108  33.286 -96.022  1.00  0.62           O  
ATOM   4131  CB  THR B  98      24.036  33.895 -95.002  1.00  0.62           C  
ATOM   4132  OG1 THR B  98      23.431  34.778 -94.093  1.00  0.62           O  
ATOM   4133  CG2 THR B  98      24.578  32.856 -94.023  1.00  0.62           C  
ATOM   4134  N   LEU B  99      25.453  32.783 -97.445  1.00  0.59           N  
ATOM   4135  CA  LEU B  99      26.195  31.748 -98.142  1.00  0.59           C  
ATOM   4136  C   LEU B  99      27.417  32.275 -98.877  1.00  0.59           C  
ATOM   4137  O   LEU B  99      28.460  31.627 -98.917  1.00  0.59           O  
ATOM   4138  CB  LEU B  99      25.286  30.985 -99.133  1.00  0.59           C  
ATOM   4139  CG  LEU B  99      24.125  30.212 -98.472  1.00  0.59           C  
ATOM   4140  CD1 LEU B  99      23.310  29.471 -99.541  1.00  0.59           C  
ATOM   4141  CD2 LEU B  99      24.611  29.214 -97.407  1.00  0.59           C  
ATOM   4142  N   GLY B 100      27.334  33.490 -99.455  1.00  0.62           N  
ATOM   4143  CA  GLY B 100      28.469  34.133-100.110  1.00  0.62           C  
ATOM   4144  C   GLY B 100      29.532  34.557 -99.134  1.00  0.62           C  
ATOM   4145  O   GLY B 100      30.716  34.309 -99.344  1.00  0.62           O  
ATOM   4146  N   THR B 101      29.124  35.152 -98.000  1.00  0.64           N  
ATOM   4147  CA  THR B 101      30.007  35.512 -96.896  1.00  0.64           C  
ATOM   4148  C   THR B 101      30.686  34.313 -96.288  1.00  0.64           C  
ATOM   4149  O   THR B 101      31.881  34.341 -96.006  1.00  0.64           O  
ATOM   4150  CB  THR B 101      29.278  36.261 -95.791  1.00  0.64           C  
ATOM   4151  OG1 THR B 101      28.779  37.469 -96.333  1.00  0.64           O  
ATOM   4152  CG2 THR B 101      30.232  36.661 -94.656  1.00  0.64           C  
ATOM   4153  N   ALA B 102      29.955  33.199 -96.095  1.00  0.65           N  
ATOM   4154  CA  ALA B 102      30.513  31.966 -95.587  1.00  0.65           C  
ATOM   4155  C   ALA B 102      31.606  31.368 -96.465  1.00  0.65           C  
ATOM   4156  O   ALA B 102      32.673  31.007 -95.976  1.00  0.65           O  
ATOM   4157  CB  ALA B 102      29.374  30.943 -95.413  1.00  0.65           C  
ATOM   4158  N   ARG B 103      31.382  31.310 -97.795  1.00  0.56           N  
ATOM   4159  CA  ARG B 103      32.356  30.831 -98.764  1.00  0.56           C  
ATOM   4160  C   ARG B 103      33.608  31.683 -98.832  1.00  0.56           C  
ATOM   4161  O   ARG B 103      34.717  31.175 -98.928  1.00  0.56           O  
ATOM   4162  CB  ARG B 103      31.730  30.770-100.176  1.00  0.56           C  
ATOM   4163  CG  ARG B 103      30.648  29.683-100.319  1.00  0.56           C  
ATOM   4164  CD  ARG B 103      29.957  29.761-101.678  1.00  0.56           C  
ATOM   4165  NE  ARG B 103      28.843  28.765-101.679  1.00  0.56           N  
ATOM   4166  CZ  ARG B 103      27.858  28.766-102.583  1.00  0.56           C  
ATOM   4167  NH1 ARG B 103      27.857  29.597-103.622  1.00  0.56           N  
ATOM   4168  NH2 ARG B 103      26.854  27.908-102.441  1.00  0.56           N  
ATOM   4169  N   SER B 104      33.462  33.016 -98.767  1.00  0.63           N  
ATOM   4170  CA  SER B 104      34.599  33.923 -98.832  1.00  0.63           C  
ATOM   4171  C   SER B 104      35.367  34.016 -97.524  1.00  0.63           C  
ATOM   4172  O   SER B 104      36.480  34.532 -97.477  1.00  0.63           O  
ATOM   4173  CB  SER B 104      34.158  35.360 -99.204  1.00  0.63           C  
ATOM   4174  OG  SER B 104      33.565  35.374-100.503  1.00  0.63           O  
ATOM   4175  N   ALA B 105      34.788  33.543 -96.402  1.00  0.60           N  
ATOM   4176  CA  ALA B 105      35.396  33.662 -95.096  1.00  0.60           C  
ATOM   4177  C   ALA B 105      36.445  32.612 -94.772  1.00  0.60           C  
ATOM   4178  O   ALA B 105      37.325  32.866 -93.947  1.00  0.60           O  
ATOM   4179  CB  ALA B 105      34.292  33.577 -94.025  1.00  0.60           C  
ATOM   4180  N   VAL B 106      36.369  31.421 -95.396  1.00  0.54           N  
ATOM   4181  CA  VAL B 106      37.227  30.291 -95.084  1.00  0.54           C  
ATOM   4182  C   VAL B 106      37.548  29.545 -96.364  1.00  0.54           C  
ATOM   4183  O   VAL B 106      36.867  29.678 -97.371  1.00  0.54           O  
ATOM   4184  CB  VAL B 106      36.620  29.297 -94.083  1.00  0.54           C  
ATOM   4185  CG1 VAL B 106      36.488  29.947 -92.693  1.00  0.54           C  
ATOM   4186  CG2 VAL B 106      35.247  28.797 -94.574  1.00  0.54           C  
ATOM   4187  N   ALA B 107      38.624  28.730 -96.365  1.00  0.35           N  
ATOM   4188  CA  ALA B 107      39.070  27.999 -97.540  1.00  0.35           C  
ATOM   4189  C   ALA B 107      38.098  26.950 -98.079  1.00  0.35           C  
ATOM   4190  O   ALA B 107      37.984  26.753 -99.285  1.00  0.35           O  
ATOM   4191  CB  ALA B 107      40.413  27.308 -97.236  1.00  0.35           C  
ATOM   4192  N   HIS B 108      37.398  26.228 -97.185  1.00  0.48           N  
ATOM   4193  CA  HIS B 108      36.437  25.221 -97.583  1.00  0.48           C  
ATOM   4194  C   HIS B 108      35.284  25.248 -96.606  1.00  0.48           C  
ATOM   4195  O   HIS B 108      35.475  25.321 -95.392  1.00  0.48           O  
ATOM   4196  CB  HIS B 108      37.055  23.797 -97.641  1.00  0.48           C  
ATOM   4197  CG  HIS B 108      36.104  22.720 -98.085  1.00  0.48           C  
ATOM   4198  ND1 HIS B 108      35.244  22.970 -99.135  1.00  0.48           N  
ATOM   4199  CD2 HIS B 108      35.879  21.477 -97.580  1.00  0.48           C  
ATOM   4200  CE1 HIS B 108      34.509  21.880 -99.247  1.00  0.48           C  
ATOM   4201  NE2 HIS B 108      34.851  20.943 -98.329  1.00  0.48           N  
ATOM   4202  N   VAL B 109      34.051  25.215 -97.131  1.00  0.67           N  
ATOM   4203  CA  VAL B 109      32.849  25.139 -96.335  1.00  0.67           C  
ATOM   4204  C   VAL B 109      31.805  24.399 -97.148  1.00  0.67           C  
ATOM   4205  O   VAL B 109      31.616  24.648 -98.339  1.00  0.67           O  
ATOM   4206  CB  VAL B 109      32.375  26.512 -95.854  1.00  0.67           C  
ATOM   4207  CG1 VAL B 109      32.053  27.464 -97.021  1.00  0.67           C  
ATOM   4208  CG2 VAL B 109      31.178  26.381 -94.907  1.00  0.67           C  
ATOM   4209  N   GLU B 110      31.103  23.440 -96.522  1.00  0.69           N  
ATOM   4210  CA  GLU B 110      30.051  22.676 -97.156  1.00  0.69           C  
ATOM   4211  C   GLU B 110      28.720  23.254 -96.709  1.00  0.69           C  
ATOM   4212  O   GLU B 110      28.572  23.733 -95.584  1.00  0.69           O  
ATOM   4213  CB  GLU B 110      30.158  21.169 -96.793  1.00  0.69           C  
ATOM   4214  CG  GLU B 110      31.502  20.528 -97.239  1.00  0.69           C  
ATOM   4215  CD  GLU B 110      31.727  19.106 -96.736  1.00  0.69           C  
ATOM   4216  OE1 GLU B 110      32.830  18.561 -97.022  1.00  0.69           O  
ATOM   4217  OE2 GLU B 110      30.850  18.545 -96.029  1.00  0.69           O  
ATOM   4218  N   HIS B 111      27.695  23.259 -97.581  1.00  0.69           N  
ATOM   4219  CA  HIS B 111      26.392  23.769 -97.205  1.00  0.69           C  
ATOM   4220  C   HIS B 111      25.307  22.841 -97.699  1.00  0.69           C  
ATOM   4221  O   HIS B 111      25.357  22.320 -98.810  1.00  0.69           O  
ATOM   4222  CB  HIS B 111      26.118  25.234 -97.677  1.00  0.69           C  
ATOM   4223  CG  HIS B 111      25.727  25.400 -99.120  1.00  0.69           C  
ATOM   4224  ND1 HIS B 111      26.680  25.519-100.122  1.00  0.69           N  
ATOM   4225  CD2 HIS B 111      24.500  25.187 -99.664  1.00  0.69           C  
ATOM   4226  CE1 HIS B 111      26.011  25.338-101.243  1.00  0.69           C  
ATOM   4227  NE2 HIS B 111      24.691  25.147-101.025  1.00  0.69           N  
ATOM   4228  N   VAL B 112      24.280  22.618 -96.866  1.00  0.69           N  
ATOM   4229  CA  VAL B 112      23.071  21.932 -97.273  1.00  0.69           C  
ATOM   4230  C   VAL B 112      21.922  22.891 -97.048  1.00  0.69           C  
ATOM   4231  O   VAL B 112      21.727  23.417 -95.953  1.00  0.69           O  
ATOM   4232  CB  VAL B 112      22.831  20.634 -96.504  1.00  0.69           C  
ATOM   4233  CG1 VAL B 112      21.485  19.990 -96.895  1.00  0.69           C  
ATOM   4234  CG2 VAL B 112      23.966  19.642 -96.817  1.00  0.69           C  
ATOM   4235  N   THR B 113      21.129  23.150 -98.103  1.00  0.61           N  
ATOM   4236  CA  THR B 113      19.949  24.006 -98.029  1.00  0.61           C  
ATOM   4237  C   THR B 113      18.746  23.166 -97.692  1.00  0.61           C  
ATOM   4238  O   THR B 113      18.481  22.152 -98.336  1.00  0.61           O  
ATOM   4239  CB  THR B 113      19.643  24.751 -99.322  1.00  0.61           C  
ATOM   4240  OG1 THR B 113      20.794  25.460 -99.753  1.00  0.61           O  
ATOM   4241  CG2 THR B 113      18.528  25.791 -99.123  1.00  0.61           C  
ATOM   4242  N   ARG B 114      17.982  23.551 -96.658  1.00  0.50           N  
ATOM   4243  CA  ARG B 114      16.780  22.840 -96.280  1.00  0.50           C  
ATOM   4244  C   ARG B 114      15.715  23.805 -95.844  1.00  0.50           C  
ATOM   4245  O   ARG B 114      15.961  24.708 -95.056  1.00  0.50           O  
ATOM   4246  CB  ARG B 114      16.998  21.895 -95.075  1.00  0.50           C  
ATOM   4247  CG  ARG B 114      17.840  20.659 -95.415  1.00  0.50           C  
ATOM   4248  CD  ARG B 114      17.987  19.684 -94.250  1.00  0.50           C  
ATOM   4249  NE  ARG B 114      16.652  19.029 -94.021  1.00  0.50           N  
ATOM   4250  CZ  ARG B 114      15.973  19.072 -92.868  1.00  0.50           C  
ATOM   4251  NH1 ARG B 114      16.263  19.922 -91.894  1.00  0.50           N  
ATOM   4252  NH2 ARG B 114      14.967  18.221 -92.676  1.00  0.50           N  
ATOM   4253  N   ALA B 115      14.472  23.600 -96.309  1.00  0.52           N  
ATOM   4254  CA  ALA B 115      13.360  24.432 -95.911  1.00  0.52           C  
ATOM   4255  C   ALA B 115      13.064  24.458 -94.417  1.00  0.52           C  
ATOM   4256  O   ALA B 115      13.149  23.449 -93.712  1.00  0.52           O  
ATOM   4257  CB  ALA B 115      12.088  24.030 -96.680  1.00  0.52           C  
ATOM   4258  N   TRP B 116      12.707  25.643 -93.889  1.00  0.35           N  
ATOM   4259  CA  TRP B 116      12.260  25.784 -92.517  1.00  0.35           C  
ATOM   4260  C   TRP B 116      10.877  25.174 -92.295  1.00  0.35           C  
ATOM   4261  O   TRP B 116       9.871  25.604 -92.849  1.00  0.35           O  
ATOM   4262  CB  TRP B 116      12.310  27.262 -92.042  1.00  0.35           C  
ATOM   4263  CG  TRP B 116      11.738  27.527 -90.655  1.00  0.35           C  
ATOM   4264  CD1 TRP B 116      10.545  28.118 -90.345  1.00  0.35           C  
ATOM   4265  CD2 TRP B 116      12.299  27.071 -89.409  1.00  0.35           C  
ATOM   4266  NE1 TRP B 116      10.333  28.089 -88.984  1.00  0.35           N  
ATOM   4267  CE2 TRP B 116      11.394  27.448 -88.396  1.00  0.35           C  
ATOM   4268  CE3 TRP B 116      13.474  26.380 -89.108  1.00  0.35           C  
ATOM   4269  CZ2 TRP B 116      11.634  27.129 -87.070  1.00  0.35           C  
ATOM   4270  CZ3 TRP B 116      13.708  26.047 -87.764  1.00  0.35           C  
ATOM   4271  CH2 TRP B 116      12.799  26.416 -86.763  1.00  0.35           C  
ATOM   4272  N   THR B 117      10.799  24.138 -91.439  1.00  0.41           N  
ATOM   4273  CA  THR B 117       9.588  23.343 -91.265  1.00  0.41           C  
ATOM   4274  C   THR B 117       8.946  23.543 -89.911  1.00  0.41           C  
ATOM   4275  O   THR B 117       8.134  22.718 -89.483  1.00  0.41           O  
ATOM   4276  CB  THR B 117       9.851  21.849 -91.421  1.00  0.41           C  
ATOM   4277  OG1 THR B 117      10.950  21.425 -90.619  1.00  0.41           O  
ATOM   4278  CG2 THR B 117      10.209  21.555 -92.883  1.00  0.41           C  
ATOM   4279  N   ASP B 118       9.289  24.643 -89.204  1.00  0.37           N  
ATOM   4280  CA  ASP B 118       8.869  24.908 -87.838  1.00  0.37           C  
ATOM   4281  C   ASP B 118       9.396  23.880 -86.844  1.00  0.37           C  
ATOM   4282  O   ASP B 118       8.673  23.308 -86.022  1.00  0.37           O  
ATOM   4283  CB  ASP B 118       7.347  25.168 -87.726  1.00  0.37           C  
ATOM   4284  CG  ASP B 118       6.978  26.592 -88.084  1.00  0.37           C  
ATOM   4285  OD1 ASP B 118       7.836  27.513 -88.066  1.00  0.37           O  
ATOM   4286  OD2 ASP B 118       5.759  26.837 -88.245  1.00  0.37           O  
ATOM   4287  N   ASP B 119      10.717  23.637 -86.916  1.00  0.37           N  
ATOM   4288  CA  ASP B 119      11.345  22.616 -86.123  1.00  0.37           C  
ATOM   4289  C   ASP B 119      12.858  22.824 -86.091  1.00  0.37           C  
ATOM   4290  O   ASP B 119      13.581  22.585 -87.062  1.00  0.37           O  
ATOM   4291  CB  ASP B 119      10.965  21.246 -86.736  1.00  0.37           C  
ATOM   4292  CG  ASP B 119      11.227  20.092 -85.799  1.00  0.37           C  
ATOM   4293  OD1 ASP B 119      12.223  20.151 -85.039  1.00  0.37           O  
ATOM   4294  OD2 ASP B 119      10.427  19.128 -85.852  1.00  0.37           O  
ATOM   4295  N   PHE B 120      13.380  23.304 -84.942  1.00  0.35           N  
ATOM   4296  CA  PHE B 120      14.804  23.452 -84.706  1.00  0.35           C  
ATOM   4297  C   PHE B 120      15.520  22.109 -84.623  1.00  0.35           C  
ATOM   4298  O   PHE B 120      16.614  21.937 -85.166  1.00  0.35           O  
ATOM   4299  CB  PHE B 120      15.088  24.284 -83.427  1.00  0.35           C  
ATOM   4300  CG  PHE B 120      14.843  25.754 -83.659  1.00  0.35           C  
ATOM   4301  CD1 PHE B 120      15.773  26.511 -84.393  1.00  0.35           C  
ATOM   4302  CD2 PHE B 120      13.716  26.404 -83.129  1.00  0.35           C  
ATOM   4303  CE1 PHE B 120      15.572  27.882 -84.608  1.00  0.35           C  
ATOM   4304  CE2 PHE B 120      13.507  27.773 -83.343  1.00  0.35           C  
ATOM   4305  CZ  PHE B 120      14.434  28.512 -84.087  1.00  0.35           C  
ATOM   4306  N   ALA B 121      14.894  21.097 -83.986  1.00  0.54           N  
ATOM   4307  CA  ALA B 121      15.420  19.754 -83.887  1.00  0.54           C  
ATOM   4308  C   ALA B 121      15.582  19.078 -85.237  1.00  0.54           C  
ATOM   4309  O   ALA B 121      16.615  18.476 -85.525  1.00  0.54           O  
ATOM   4310  CB  ALA B 121      14.502  18.906 -82.990  1.00  0.54           C  
ATOM   4311  N   ALA B 122      14.594  19.212 -86.138  1.00  0.57           N  
ATOM   4312  CA  ALA B 122      14.671  18.726 -87.500  1.00  0.57           C  
ATOM   4313  C   ALA B 122      15.785  19.359 -88.322  1.00  0.57           C  
ATOM   4314  O   ALA B 122      16.385  18.719 -89.186  1.00  0.57           O  
ATOM   4315  CB  ALA B 122      13.334  18.943 -88.221  1.00  0.57           C  
ATOM   4316  N   GLN B 123      16.094  20.651 -88.103  1.00  0.57           N  
ATOM   4317  CA  GLN B 123      17.268  21.264 -88.699  1.00  0.57           C  
ATOM   4318  C   GLN B 123      18.583  20.724 -88.167  1.00  0.57           C  
ATOM   4319  O   GLN B 123      19.479  20.382 -88.934  1.00  0.57           O  
ATOM   4320  CB  GLN B 123      17.228  22.803 -88.578  1.00  0.57           C  
ATOM   4321  CG  GLN B 123      16.086  23.472 -89.381  1.00  0.57           C  
ATOM   4322  CD  GLN B 123      16.183  23.268 -90.899  1.00  0.57           C  
ATOM   4323  OE1 GLN B 123      17.032  22.569 -91.459  1.00  0.57           O  
ATOM   4324  NE2 GLN B 123      15.225  23.896 -91.613  1.00  0.57           N  
ATOM   4325  N   ARG B 124      18.718  20.567 -86.838  1.00  0.55           N  
ATOM   4326  CA  ARG B 124      19.901  19.984 -86.230  1.00  0.55           C  
ATOM   4327  C   ARG B 124      20.123  18.522 -86.595  1.00  0.55           C  
ATOM   4328  O   ARG B 124      21.249  18.092 -86.848  1.00  0.55           O  
ATOM   4329  CB  ARG B 124      19.863  20.135 -84.695  1.00  0.55           C  
ATOM   4330  CG  ARG B 124      19.971  21.595 -84.218  1.00  0.55           C  
ATOM   4331  CD  ARG B 124      20.162  21.700 -82.704  1.00  0.55           C  
ATOM   4332  NE  ARG B 124      20.204  23.140 -82.314  1.00  0.55           N  
ATOM   4333  CZ  ARG B 124      21.272  23.947 -82.394  1.00  0.55           C  
ATOM   4334  NH1 ARG B 124      22.408  23.579 -82.972  1.00  0.55           N  
ATOM   4335  NH2 ARG B 124      21.193  25.165 -81.868  1.00  0.55           N  
ATOM   4336  N   ASN B 125      19.040  17.723 -86.660  1.00  0.62           N  
ATOM   4337  CA  ASN B 125      19.089  16.310 -86.986  1.00  0.62           C  
ATOM   4338  C   ASN B 125      19.535  16.019 -88.418  1.00  0.62           C  
ATOM   4339  O   ASN B 125      20.126  14.975 -88.680  1.00  0.62           O  
ATOM   4340  CB  ASN B 125      17.740  15.609 -86.687  1.00  0.62           C  
ATOM   4341  CG  ASN B 125      17.559  15.456 -85.177  1.00  0.62           C  
ATOM   4342  OD1 ASN B 125      18.516  15.272 -84.421  1.00  0.62           O  
ATOM   4343  ND2 ASN B 125      16.289  15.479 -84.715  1.00  0.62           N  
ATOM   4344  N   ALA B 126      19.336  16.958 -89.366  1.00  0.68           N  
ATOM   4345  CA  ALA B 126      19.777  16.834 -90.746  1.00  0.68           C  
ATOM   4346  C   ALA B 126      21.287  16.697 -90.912  1.00  0.68           C  
ATOM   4347  O   ALA B 126      21.802  16.099 -91.853  1.00  0.68           O  
ATOM   4348  CB  ALA B 126      19.313  18.081 -91.512  1.00  0.68           C  
ATOM   4349  N   ALA B 127      22.057  17.245 -89.958  1.00  0.66           N  
ATOM   4350  CA  ALA B 127      23.494  17.144 -89.949  1.00  0.66           C  
ATOM   4351  C   ALA B 127      24.026  15.731 -89.748  1.00  0.66           C  
ATOM   4352  O   ALA B 127      25.109  15.398 -90.223  1.00  0.66           O  
ATOM   4353  CB  ALA B 127      24.026  18.063 -88.850  1.00  0.66           C  
ATOM   4354  N   PHE B 128      23.258  14.854 -89.066  1.00  0.48           N  
ATOM   4355  CA  PHE B 128      23.600  13.455 -88.870  1.00  0.48           C  
ATOM   4356  C   PHE B 128      23.661  12.676 -90.178  1.00  0.48           C  
ATOM   4357  O   PHE B 128      24.522  11.820 -90.354  1.00  0.48           O  
ATOM   4358  CB  PHE B 128      22.615  12.753 -87.902  1.00  0.48           C  
ATOM   4359  CG  PHE B 128      22.841  13.183 -86.475  1.00  0.48           C  
ATOM   4360  CD1 PHE B 128      23.643  12.415 -85.613  1.00  0.48           C  
ATOM   4361  CD2 PHE B 128      22.215  14.330 -85.966  1.00  0.48           C  
ATOM   4362  CE1 PHE B 128      23.786  12.770 -84.264  1.00  0.48           C  
ATOM   4363  CE2 PHE B 128      22.345  14.690 -84.619  1.00  0.48           C  
ATOM   4364  CZ  PHE B 128      23.126  13.902 -83.767  1.00  0.48           C  
ATOM   4365  N   GLU B 129      22.785  12.993 -91.154  1.00  0.61           N  
ATOM   4366  CA  GLU B 129      22.758  12.368 -92.469  1.00  0.61           C  
ATOM   4367  C   GLU B 129      23.990  12.703 -93.299  1.00  0.61           C  
ATOM   4368  O   GLU B 129      24.379  11.977 -94.208  1.00  0.61           O  
ATOM   4369  CB  GLU B 129      21.511  12.853 -93.243  1.00  0.61           C  
ATOM   4370  CG  GLU B 129      20.171  12.463 -92.572  1.00  0.61           C  
ATOM   4371  CD  GLU B 129      18.970  13.166 -93.206  1.00  0.61           C  
ATOM   4372  OE1 GLU B 129      17.840  12.903 -92.718  1.00  0.61           O  
ATOM   4373  OE2 GLU B 129      19.161  13.989 -94.139  1.00  0.61           O  
ATOM   4374  N   GLN B 130      24.656  13.827 -92.976  1.00  0.68           N  
ATOM   4375  CA  GLN B 130      25.830  14.285 -93.687  1.00  0.68           C  
ATOM   4376  C   GLN B 130      27.111  13.941 -92.947  1.00  0.68           C  
ATOM   4377  O   GLN B 130      28.225  14.219 -93.399  1.00  0.68           O  
ATOM   4378  CB  GLN B 130      25.772  15.828 -93.798  1.00  0.68           C  
ATOM   4379  CG  GLN B 130      24.471  16.366 -94.437  1.00  0.68           C  
ATOM   4380  CD  GLN B 130      24.288  15.843 -95.862  1.00  0.68           C  
ATOM   4381  OE1 GLN B 130      25.212  15.849 -96.674  1.00  0.68           O  
ATOM   4382  NE2 GLN B 130      23.054  15.397 -96.189  1.00  0.68           N  
ATOM   4383  N   ALA B 131      27.000  13.370 -91.741  1.00  0.63           N  
ATOM   4384  CA  ALA B 131      28.107  13.071 -90.871  1.00  0.63           C  
ATOM   4385  C   ALA B 131      29.020  11.951 -91.370  1.00  0.63           C  
ATOM   4386  O   ALA B 131      28.585  10.979 -91.977  1.00  0.63           O  
ATOM   4387  CB  ALA B 131      27.552  12.771 -89.474  1.00  0.63           C  
ATOM   4388  N   ARG B 132      30.344  12.052 -91.118  1.00  0.55           N  
ATOM   4389  CA  ARG B 132      31.249  10.949 -91.404  1.00  0.55           C  
ATOM   4390  C   ARG B 132      31.287   9.999 -90.214  1.00  0.55           C  
ATOM   4391  O   ARG B 132      31.298  10.505 -89.091  1.00  0.55           O  
ATOM   4392  CB  ARG B 132      32.703  11.424 -91.670  1.00  0.55           C  
ATOM   4393  CG  ARG B 132      32.853  12.257 -92.955  1.00  0.55           C  
ATOM   4394  CD  ARG B 132      34.312  12.578 -93.297  1.00  0.55           C  
ATOM   4395  NE  ARG B 132      34.279  13.409 -94.548  1.00  0.55           N  
ATOM   4396  CZ  ARG B 132      35.180  13.370 -95.539  1.00  0.55           C  
ATOM   4397  NH1 ARG B 132      36.180  12.495 -95.555  1.00  0.55           N  
ATOM   4398  NH2 ARG B 132      35.064  14.232 -96.549  1.00  0.55           N  
ATOM   4399  N   PRO B 133      31.311   8.673 -90.356  1.00  0.42           N  
ATOM   4400  CA  PRO B 133      31.350   7.747 -89.226  1.00  0.42           C  
ATOM   4401  C   PRO B 133      32.634   7.873 -88.425  1.00  0.42           C  
ATOM   4402  O   PRO B 133      33.681   8.185 -88.992  1.00  0.42           O  
ATOM   4403  CB  PRO B 133      31.206   6.359 -89.883  1.00  0.42           C  
ATOM   4404  CG  PRO B 133      31.764   6.534 -91.299  1.00  0.42           C  
ATOM   4405  CD  PRO B 133      31.396   7.978 -91.644  1.00  0.42           C  
ATOM   4406  N   GLY B 134      32.570   7.668 -87.092  1.00  0.34           N  
ATOM   4407  CA  GLY B 134      33.761   7.671 -86.250  1.00  0.34           C  
ATOM   4408  C   GLY B 134      34.283   9.036 -85.883  1.00  0.34           C  
ATOM   4409  O   GLY B 134      35.455   9.185 -85.549  1.00  0.34           O  
ATOM   4410  N   GLY B 135      33.442  10.083 -85.965  1.00  0.68           N  
ATOM   4411  CA  GLY B 135      33.844  11.441 -85.631  1.00  0.68           C  
ATOM   4412  C   GLY B 135      32.892  12.117 -84.690  1.00  0.68           C  
ATOM   4413  O   GLY B 135      32.036  11.504 -84.058  1.00  0.68           O  
ATOM   4414  N   TRP B 136      33.015  13.446 -84.591  1.00  0.60           N  
ATOM   4415  CA  TRP B 136      32.212  14.268 -83.719  1.00  0.60           C  
ATOM   4416  C   TRP B 136      31.446  15.294 -84.518  1.00  0.60           C  
ATOM   4417  O   TRP B 136      31.935  15.874 -85.489  1.00  0.60           O  
ATOM   4418  CB  TRP B 136      33.075  15.007 -82.671  1.00  0.60           C  
ATOM   4419  CG  TRP B 136      33.751  14.078 -81.684  1.00  0.60           C  
ATOM   4420  CD1 TRP B 136      34.971  13.467 -81.769  1.00  0.60           C  
ATOM   4421  CD2 TRP B 136      33.186  13.686 -80.420  1.00  0.60           C  
ATOM   4422  NE1 TRP B 136      35.218  12.747 -80.623  1.00  0.60           N  
ATOM   4423  CE2 TRP B 136      34.142  12.876 -79.779  1.00  0.60           C  
ATOM   4424  CE3 TRP B 136      31.966  13.976 -79.816  1.00  0.60           C  
ATOM   4425  CZ2 TRP B 136      33.901  12.360 -78.514  1.00  0.60           C  
ATOM   4426  CZ3 TRP B 136      31.710  13.435 -78.545  1.00  0.60           C  
ATOM   4427  CH2 TRP B 136      32.670  12.640 -77.902  1.00  0.60           C  
ATOM   4428  N   LEU B 137      30.201  15.557 -84.099  1.00  0.63           N  
ATOM   4429  CA  LEU B 137      29.406  16.650 -84.600  1.00  0.63           C  
ATOM   4430  C   LEU B 137      29.332  17.710 -83.532  1.00  0.63           C  
ATOM   4431  O   LEU B 137      28.759  17.495 -82.467  1.00  0.63           O  
ATOM   4432  CB  LEU B 137      27.963  16.208 -84.929  1.00  0.63           C  
ATOM   4433  CG  LEU B 137      27.870  15.155 -86.045  1.00  0.63           C  
ATOM   4434  CD1 LEU B 137      26.409  14.746 -86.257  1.00  0.63           C  
ATOM   4435  CD2 LEU B 137      28.485  15.667 -87.353  1.00  0.63           C  
ATOM   4436  N   ALA B 138      29.915  18.891 -83.796  1.00  0.68           N  
ATOM   4437  CA  ALA B 138      29.874  20.006 -82.883  1.00  0.68           C  
ATOM   4438  C   ALA B 138      28.881  21.042 -83.371  1.00  0.68           C  
ATOM   4439  O   ALA B 138      29.104  21.742 -84.356  1.00  0.68           O  
ATOM   4440  CB  ALA B 138      31.277  20.626 -82.733  1.00  0.68           C  
ATOM   4441  N   HIS B 139      27.732  21.158 -82.683  1.00  0.67           N  
ATOM   4442  CA  HIS B 139      26.692  22.099 -83.047  1.00  0.67           C  
ATOM   4443  C   HIS B 139      26.989  23.485 -82.504  1.00  0.67           C  
ATOM   4444  O   HIS B 139      27.108  23.688 -81.298  1.00  0.67           O  
ATOM   4445  CB  HIS B 139      25.310  21.633 -82.539  1.00  0.67           C  
ATOM   4446  CG  HIS B 139      24.762  20.475 -83.317  1.00  0.67           C  
ATOM   4447  ND1 HIS B 139      23.706  20.677 -84.192  1.00  0.67           N  
ATOM   4448  CD2 HIS B 139      25.189  19.186 -83.378  1.00  0.67           C  
ATOM   4449  CE1 HIS B 139      23.524  19.504 -84.776  1.00  0.67           C  
ATOM   4450  NE2 HIS B 139      24.394  18.569 -84.320  1.00  0.67           N  
ATOM   4451  N   VAL B 140      27.122  24.469 -83.406  1.00  0.68           N  
ATOM   4452  CA  VAL B 140      27.504  25.831 -83.073  1.00  0.68           C  
ATOM   4453  C   VAL B 140      26.456  26.746 -83.668  1.00  0.68           C  
ATOM   4454  O   VAL B 140      26.038  26.565 -84.813  1.00  0.68           O  
ATOM   4455  CB  VAL B 140      28.896  26.176 -83.612  1.00  0.68           C  
ATOM   4456  CG1 VAL B 140      29.319  27.595 -83.185  1.00  0.68           C  
ATOM   4457  CG2 VAL B 140      29.922  25.153 -83.081  1.00  0.68           C  
ATOM   4458  N   ASP B 141      25.962  27.737 -82.904  1.00  0.69           N  
ATOM   4459  CA  ASP B 141      24.991  28.682 -83.422  1.00  0.69           C  
ATOM   4460  C   ASP B 141      25.736  29.778 -84.217  1.00  0.69           C  
ATOM   4461  O   ASP B 141      26.930  30.012 -84.043  1.00  0.69           O  
ATOM   4462  CB  ASP B 141      24.067  29.206 -82.283  1.00  0.69           C  
ATOM   4463  CG  ASP B 141      23.225  28.101 -81.642  1.00  0.69           C  
ATOM   4464  OD1 ASP B 141      23.012  27.027 -82.276  1.00  0.69           O  
ATOM   4465  OD2 ASP B 141      22.738  28.299 -80.493  1.00  0.69           O  
ATOM   4466  N   ALA B 142      25.090  30.449 -85.197  1.00  0.73           N  
ATOM   4467  CA  ALA B 142      25.808  31.261 -86.176  1.00  0.73           C  
ATOM   4468  C   ALA B 142      26.389  32.555 -85.627  1.00  0.73           C  
ATOM   4469  O   ALA B 142      27.337  33.109 -86.185  1.00  0.73           O  
ATOM   4470  CB  ALA B 142      24.903  31.593 -87.376  1.00  0.73           C  
ATOM   4471  N   ASP B 143      25.863  33.023 -84.488  1.00  0.62           N  
ATOM   4472  CA  ASP B 143      26.293  34.196 -83.781  1.00  0.62           C  
ATOM   4473  C   ASP B 143      27.264  33.866 -82.648  1.00  0.62           C  
ATOM   4474  O   ASP B 143      27.689  34.738 -81.884  1.00  0.62           O  
ATOM   4475  CB  ASP B 143      25.039  34.981 -83.308  1.00  0.62           C  
ATOM   4476  CG  ASP B 143      24.015  34.199 -82.493  1.00  0.62           C  
ATOM   4477  OD1 ASP B 143      23.963  32.944 -82.567  1.00  0.62           O  
ATOM   4478  OD2 ASP B 143      23.244  34.890 -81.771  1.00  0.62           O  
ATOM   4479  N   GLU B 144      27.705  32.595 -82.568  1.00  0.63           N  
ATOM   4480  CA  GLU B 144      28.719  32.153 -81.639  1.00  0.63           C  
ATOM   4481  C   GLU B 144      30.103  32.068 -82.254  1.00  0.63           C  
ATOM   4482  O   GLU B 144      30.324  31.516 -83.328  1.00  0.63           O  
ATOM   4483  CB  GLU B 144      28.383  30.768 -81.070  1.00  0.63           C  
ATOM   4484  CG  GLU B 144      27.132  30.805 -80.177  1.00  0.63           C  
ATOM   4485  CD  GLU B 144      26.708  29.425 -79.730  1.00  0.63           C  
ATOM   4486  OE1 GLU B 144      25.830  29.368 -78.831  1.00  0.63           O  
ATOM   4487  OE2 GLU B 144      27.196  28.388 -80.261  1.00  0.63           O  
ATOM   4488  N   THR B 145      31.110  32.599 -81.542  1.00  0.63           N  
ATOM   4489  CA  THR B 145      32.499  32.577 -81.995  1.00  0.63           C  
ATOM   4490  C   THR B 145      33.342  31.872 -80.953  1.00  0.63           C  
ATOM   4491  O   THR B 145      33.312  32.240 -79.780  1.00  0.63           O  
ATOM   4492  CB  THR B 145      33.070  33.980 -82.199  1.00  0.63           C  
ATOM   4493  OG1 THR B 145      32.293  34.694 -83.149  1.00  0.63           O  
ATOM   4494  CG2 THR B 145      34.486  33.946 -82.782  1.00  0.63           C  
ATOM   4495  N   LEU B 146      34.134  30.834 -81.326  1.00  0.61           N  
ATOM   4496  CA  LEU B 146      35.086  30.189 -80.421  1.00  0.61           C  
ATOM   4497  C   LEU B 146      36.127  31.173 -79.894  1.00  0.61           C  
ATOM   4498  O   LEU B 146      36.695  31.963 -80.648  1.00  0.61           O  
ATOM   4499  CB  LEU B 146      35.802  28.997 -81.118  1.00  0.61           C  
ATOM   4500  CG  LEU B 146      36.727  28.141 -80.221  1.00  0.61           C  
ATOM   4501  CD1 LEU B 146      35.939  27.363 -79.164  1.00  0.61           C  
ATOM   4502  CD2 LEU B 146      37.553  27.153 -81.058  1.00  0.61           C  
ATOM   4503  N   SER B 147      36.380  31.193 -78.568  1.00  0.61           N  
ATOM   4504  CA  SER B 147      37.342  32.120 -77.992  1.00  0.61           C  
ATOM   4505  C   SER B 147      38.775  31.871 -78.421  1.00  0.61           C  
ATOM   4506  O   SER B 147      39.176  30.748 -78.722  1.00  0.61           O  
ATOM   4507  CB  SER B 147      37.257  32.279 -76.448  1.00  0.61           C  
ATOM   4508  OG  SER B 147      37.877  31.219 -75.712  1.00  0.61           O  
ATOM   4509  N   ALA B 148      39.607  32.931 -78.461  1.00  0.52           N  
ATOM   4510  CA  ALA B 148      40.998  32.833 -78.854  1.00  0.52           C  
ATOM   4511  C   ALA B 148      41.808  31.937 -77.924  1.00  0.52           C  
ATOM   4512  O   ALA B 148      42.647  31.149 -78.358  1.00  0.52           O  
ATOM   4513  CB  ALA B 148      41.611  34.243 -78.931  1.00  0.52           C  
ATOM   4514  N   GLU B 149      41.495  31.993 -76.617  1.00  0.32           N  
ATOM   4515  CA  GLU B 149      42.024  31.164 -75.561  1.00  0.32           C  
ATOM   4516  C   GLU B 149      41.624  29.705 -75.723  1.00  0.32           C  
ATOM   4517  O   GLU B 149      42.299  28.798 -75.237  1.00  0.32           O  
ATOM   4518  CB  GLU B 149      41.509  31.671 -74.182  1.00  0.32           C  
ATOM   4519  CG  GLU B 149      41.757  33.182 -73.906  1.00  0.32           C  
ATOM   4520  CD  GLU B 149      40.750  34.138 -74.555  1.00  0.32           C  
ATOM   4521  OE1 GLU B 149      40.905  35.365 -74.359  1.00  0.32           O  
ATOM   4522  OE2 GLU B 149      39.824  33.655 -75.262  1.00  0.32           O  
ATOM   4523  N   SER B 150      40.509  29.443 -76.436  1.00  0.57           N  
ATOM   4524  CA  SER B 150      39.985  28.100 -76.620  1.00  0.57           C  
ATOM   4525  C   SER B 150      40.409  27.453 -77.905  1.00  0.57           C  
ATOM   4526  O   SER B 150      40.033  26.315 -78.177  1.00  0.57           O  
ATOM   4527  CB  SER B 150      38.454  28.029 -76.570  1.00  0.57           C  
ATOM   4528  OG  SER B 150      38.004  28.459 -75.291  1.00  0.57           O  
ATOM   4529  N   ARG B 151      41.243  28.138 -78.701  1.00  0.31           N  
ATOM   4530  CA  ARG B 151      41.799  27.616 -79.931  1.00  0.31           C  
ATOM   4531  C   ARG B 151      42.614  26.336 -79.735  1.00  0.31           C  
ATOM   4532  O   ARG B 151      43.595  26.298 -78.993  1.00  0.31           O  
ATOM   4533  CB  ARG B 151      42.689  28.700 -80.579  1.00  0.31           C  
ATOM   4534  CG  ARG B 151      43.246  28.312 -81.960  1.00  0.31           C  
ATOM   4535  CD  ARG B 151      44.233  29.329 -82.537  1.00  0.31           C  
ATOM   4536  NE  ARG B 151      43.451  30.569 -82.827  1.00  0.31           N  
ATOM   4537  CZ  ARG B 151      43.982  31.674 -83.360  1.00  0.31           C  
ATOM   4538  NH1 ARG B 151      45.283  31.766 -83.611  1.00  0.31           N  
ATOM   4539  NH2 ARG B 151      43.192  32.709 -83.632  1.00  0.31           N  
ATOM   4540  N   GLY B 152      42.190  25.235 -80.380  1.00  0.58           N  
ATOM   4541  CA  GLY B 152      42.824  23.923 -80.335  1.00  0.58           C  
ATOM   4542  C   GLY B 152      42.414  23.104 -79.144  1.00  0.58           C  
ATOM   4543  O   GLY B 152      42.709  21.912 -79.057  1.00  0.58           O  
ATOM   4544  N   ARG B 153      41.681  23.712 -78.191  1.00  0.48           N  
ATOM   4545  CA  ARG B 153      41.200  23.039 -77.004  1.00  0.48           C  
ATOM   4546  C   ARG B 153      40.050  22.107 -77.301  1.00  0.48           C  
ATOM   4547  O   ARG B 153      39.931  21.046 -76.690  1.00  0.48           O  
ATOM   4548  CB  ARG B 153      40.727  24.017 -75.904  1.00  0.48           C  
ATOM   4549  CG  ARG B 153      41.850  24.842 -75.251  1.00  0.48           C  
ATOM   4550  CD  ARG B 153      41.331  25.602 -74.025  1.00  0.48           C  
ATOM   4551  NE  ARG B 153      42.477  26.326 -73.406  1.00  0.48           N  
ATOM   4552  CZ  ARG B 153      42.344  27.067 -72.296  1.00  0.48           C  
ATOM   4553  NH1 ARG B 153      41.186  27.157 -71.649  1.00  0.48           N  
ATOM   4554  NH2 ARG B 153      43.406  27.723 -71.834  1.00  0.48           N  
ATOM   4555  N   LEU B 154      39.159  22.483 -78.244  1.00  0.57           N  
ATOM   4556  CA  LEU B 154      38.019  21.665 -78.601  1.00  0.57           C  
ATOM   4557  C   LEU B 154      38.459  20.360 -79.229  1.00  0.57           C  
ATOM   4558  O   LEU B 154      38.031  19.283 -78.823  1.00  0.57           O  
ATOM   4559  CB  LEU B 154      37.064  22.425 -79.557  1.00  0.57           C  
ATOM   4560  CG  LEU B 154      35.871  21.599 -80.075  1.00  0.57           C  
ATOM   4561  CD1 LEU B 154      34.975  21.135 -78.926  1.00  0.57           C  
ATOM   4562  CD2 LEU B 154      35.056  22.388 -81.111  1.00  0.57           C  
ATOM   4563  N   ARG B 155      39.405  20.418 -80.181  1.00  0.53           N  
ATOM   4564  CA  ARG B 155      39.995  19.228 -80.754  1.00  0.53           C  
ATOM   4565  C   ARG B 155      40.731  18.376 -79.737  1.00  0.53           C  
ATOM   4566  O   ARG B 155      40.548  17.163 -79.681  1.00  0.53           O  
ATOM   4567  CB  ARG B 155      40.959  19.627 -81.892  1.00  0.53           C  
ATOM   4568  CG  ARG B 155      41.707  18.433 -82.525  1.00  0.53           C  
ATOM   4569  CD  ARG B 155      42.484  18.783 -83.795  1.00  0.53           C  
ATOM   4570  NE  ARG B 155      41.480  19.202 -84.811  1.00  0.53           N  
ATOM   4571  CZ  ARG B 155      40.923  18.419 -85.739  1.00  0.53           C  
ATOM   4572  NH1 ARG B 155      41.200  17.133 -85.898  1.00  0.53           N  
ATOM   4573  NH2 ARG B 155      40.021  18.954 -86.544  1.00  0.53           N  
ATOM   4574  N   ALA B 156      41.549  18.998 -78.868  1.00  0.56           N  
ATOM   4575  CA  ALA B 156      42.314  18.291 -77.864  1.00  0.56           C  
ATOM   4576  C   ALA B 156      41.468  17.509 -76.864  1.00  0.56           C  
ATOM   4577  O   ALA B 156      41.708  16.328 -76.604  1.00  0.56           O  
ATOM   4578  CB  ALA B 156      43.175  19.324 -77.120  1.00  0.56           C  
ATOM   4579  N   VAL B 157      40.403  18.132 -76.317  1.00  0.54           N  
ATOM   4580  CA  VAL B 157      39.525  17.459 -75.375  1.00  0.54           C  
ATOM   4581  C   VAL B 157      38.734  16.315 -75.996  1.00  0.54           C  
ATOM   4582  O   VAL B 157      38.617  15.246 -75.401  1.00  0.54           O  
ATOM   4583  CB  VAL B 157      38.646  18.429 -74.592  1.00  0.54           C  
ATOM   4584  CG1 VAL B 157      37.503  19.016 -75.440  1.00  0.54           C  
ATOM   4585  CG2 VAL B 157      38.108  17.734 -73.328  1.00  0.54           C  
ATOM   4586  N   LEU B 158      38.209  16.469 -77.233  1.00  0.52           N  
ATOM   4587  CA  LEU B 158      37.498  15.401 -77.918  1.00  0.52           C  
ATOM   4588  C   LEU B 158      38.384  14.195 -78.216  1.00  0.52           C  
ATOM   4589  O   LEU B 158      38.015  13.058 -77.932  1.00  0.52           O  
ATOM   4590  CB  LEU B 158      36.833  15.917 -79.216  1.00  0.52           C  
ATOM   4591  CG  LEU B 158      35.756  17.006 -79.002  1.00  0.52           C  
ATOM   4592  CD1 LEU B 158      35.233  17.502 -80.358  1.00  0.52           C  
ATOM   4593  CD2 LEU B 158      34.589  16.534 -78.125  1.00  0.52           C  
ATOM   4594  N   THR B 159      39.626  14.426 -78.695  1.00  0.53           N  
ATOM   4595  CA  THR B 159      40.634  13.385 -78.911  1.00  0.53           C  
ATOM   4596  C   THR B 159      40.993  12.655 -77.636  1.00  0.53           C  
ATOM   4597  O   THR B 159      41.112  11.430 -77.596  1.00  0.53           O  
ATOM   4598  CB  THR B 159      41.931  13.952 -79.470  1.00  0.53           C  
ATOM   4599  OG1 THR B 159      41.662  14.671 -80.656  1.00  0.53           O  
ATOM   4600  CG2 THR B 159      42.918  12.850 -79.874  1.00  0.53           C  
ATOM   4601  N   ALA B 160      41.155  13.392 -76.517  1.00  0.55           N  
ATOM   4602  CA  ALA B 160      41.373  12.796 -75.217  1.00  0.55           C  
ATOM   4603  C   ALA B 160      40.207  11.940 -74.738  1.00  0.55           C  
ATOM   4604  O   ALA B 160      40.420  10.823 -74.273  1.00  0.55           O  
ATOM   4605  CB  ALA B 160      41.706  13.890 -74.189  1.00  0.55           C  
ATOM   4606  N   LEU B 161      38.951  12.409 -74.900  1.00  0.87           N  
ATOM   4607  CA  LEU B 161      37.747  11.653 -74.593  1.00  0.87           C  
ATOM   4608  C   LEU B 161      37.589  10.385 -75.422  1.00  0.87           C  
ATOM   4609  O   LEU B 161      37.220   9.345 -74.883  1.00  0.87           O  
ATOM   4610  CB  LEU B 161      36.471  12.523 -74.724  1.00  0.87           C  
ATOM   4611  CG  LEU B 161      36.341  13.645 -73.667  1.00  0.87           C  
ATOM   4612  CD1 LEU B 161      35.153  14.557 -74.005  1.00  0.87           C  
ATOM   4613  CD2 LEU B 161      36.191  13.104 -72.236  1.00  0.87           C  
ATOM   4614  N   ASP B 162      37.906  10.408 -76.733  1.00  0.87           N  
ATOM   4615  CA  ASP B 162      37.932   9.228 -77.586  1.00  0.87           C  
ATOM   4616  C   ASP B 162      38.910   8.176 -77.119  1.00  0.87           C  
ATOM   4617  O   ASP B 162      38.607   6.986 -77.092  1.00  0.87           O  
ATOM   4618  CB  ASP B 162      38.318   9.640 -79.033  1.00  0.87           C  
ATOM   4619  CG  ASP B 162      37.133  10.264 -79.717  1.00  0.87           C  
ATOM   4620  OD1 ASP B 162      36.009  10.114 -79.175  1.00  0.87           O  
ATOM   4621  OD2 ASP B 162      37.293  10.869 -80.801  1.00  0.87           O  
ATOM   4622  N   HIS B 163      40.108   8.611 -76.708  1.00  0.85           N  
ATOM   4623  CA  HIS B 163      41.117   7.732 -76.162  1.00  0.85           C  
ATOM   4624  C   HIS B 163      40.736   7.072 -74.838  1.00  0.85           C  
ATOM   4625  O   HIS B 163      40.911   5.871 -74.646  1.00  0.85           O  
ATOM   4626  CB  HIS B 163      42.408   8.550 -75.981  1.00  0.85           C  
ATOM   4627  CG  HIS B 163      43.590   7.743 -75.572  1.00  0.85           C  
ATOM   4628  ND1 HIS B 163      44.099   6.812 -76.450  1.00  0.85           N  
ATOM   4629  CD2 HIS B 163      44.332   7.782 -74.436  1.00  0.85           C  
ATOM   4630  CE1 HIS B 163      45.139   6.292 -75.833  1.00  0.85           C  
ATOM   4631  NE2 HIS B 163      45.326   6.848 -74.613  1.00  0.85           N  
ATOM   4632  N   VAL B 164      40.183   7.835 -73.871  1.00  0.88           N  
ATOM   4633  CA  VAL B 164      39.913   7.281 -72.549  1.00  0.88           C  
ATOM   4634  C   VAL B 164      38.536   6.653 -72.426  1.00  0.88           C  
ATOM   4635  O   VAL B 164      38.332   5.766 -71.601  1.00  0.88           O  
ATOM   4636  CB  VAL B 164      40.119   8.296 -71.427  1.00  0.88           C  
ATOM   4637  CG1 VAL B 164      41.580   8.788 -71.461  1.00  0.88           C  
ATOM   4638  CG2 VAL B 164      39.143   9.481 -71.543  1.00  0.88           C  
ATOM   4639  N   LEU B 165      37.565   7.038 -73.277  1.00  0.85           N  
ATOM   4640  CA  LEU B 165      36.216   6.496 -73.243  1.00  0.85           C  
ATOM   4641  C   LEU B 165      35.768   6.082 -74.645  1.00  0.85           C  
ATOM   4642  O   LEU B 165      34.763   6.603 -75.150  1.00  0.85           O  
ATOM   4643  CB  LEU B 165      35.214   7.542 -72.682  1.00  0.85           C  
ATOM   4644  CG  LEU B 165      35.381   7.875 -71.186  1.00  0.85           C  
ATOM   4645  CD1 LEU B 165      34.533   9.101 -70.824  1.00  0.85           C  
ATOM   4646  CD2 LEU B 165      35.012   6.694 -70.276  1.00  0.85           C  
ATOM   4647  N   PRO B 166      36.473   5.177 -75.337  1.00  0.87           N  
ATOM   4648  CA  PRO B 166      36.107   4.756 -76.685  1.00  0.87           C  
ATOM   4649  C   PRO B 166      34.710   4.157 -76.769  1.00  0.87           C  
ATOM   4650  O   PRO B 166      34.399   3.204 -76.061  1.00  0.87           O  
ATOM   4651  CB  PRO B 166      37.207   3.754 -77.066  1.00  0.87           C  
ATOM   4652  CG  PRO B 166      37.591   3.106 -75.735  1.00  0.87           C  
ATOM   4653  CD  PRO B 166      37.473   4.271 -74.750  1.00  0.87           C  
ATOM   4654  N   GLY B 167      33.829   4.703 -77.630  1.00  0.85           N  
ATOM   4655  CA  GLY B 167      32.496   4.141 -77.831  1.00  0.85           C  
ATOM   4656  C   GLY B 167      31.484   4.476 -76.770  1.00  0.85           C  
ATOM   4657  O   GLY B 167      30.334   4.060 -76.862  1.00  0.85           O  
ATOM   4658  N   ALA B 168      31.845   5.259 -75.735  1.00  0.86           N  
ATOM   4659  CA  ALA B 168      30.857   5.773 -74.809  1.00  0.86           C  
ATOM   4660  C   ALA B 168      29.915   6.769 -75.487  1.00  0.86           C  
ATOM   4661  O   ALA B 168      30.370   7.694 -76.169  1.00  0.86           O  
ATOM   4662  CB  ALA B 168      31.538   6.415 -73.583  1.00  0.86           C  
ATOM   4663  N   ASP B 169      28.583   6.598 -75.311  1.00  0.80           N  
ATOM   4664  CA  ASP B 169      27.600   7.534 -75.815  1.00  0.80           C  
ATOM   4665  C   ASP B 169      27.479   8.656 -74.791  1.00  0.80           C  
ATOM   4666  O   ASP B 169      26.965   8.497 -73.684  1.00  0.80           O  
ATOM   4667  CB  ASP B 169      26.242   6.830 -76.114  1.00  0.80           C  
ATOM   4668  CG  ASP B 169      25.431   7.528 -77.198  1.00  0.80           C  
ATOM   4669  OD1 ASP B 169      25.946   8.491 -77.825  1.00  0.80           O  
ATOM   4670  OD2 ASP B 169      24.288   7.075 -77.450  1.00  0.80           O  
ATOM   4671  N   LEU B 170      28.050   9.818 -75.131  1.00  0.85           N  
ATOM   4672  CA  LEU B 170      28.155  10.937 -74.235  1.00  0.85           C  
ATOM   4673  C   LEU B 170      27.976  12.185 -75.046  1.00  0.85           C  
ATOM   4674  O   LEU B 170      28.192  12.206 -76.260  1.00  0.85           O  
ATOM   4675  CB  LEU B 170      29.506  10.969 -73.453  1.00  0.85           C  
ATOM   4676  CG  LEU B 170      30.801  11.217 -74.270  1.00  0.85           C  
ATOM   4677  CD1 LEU B 170      31.106  12.713 -74.446  1.00  0.85           C  
ATOM   4678  CD2 LEU B 170      32.014  10.563 -73.589  1.00  0.85           C  
ATOM   4679  N   VAL B 171      27.596  13.278 -74.374  1.00  0.86           N  
ATOM   4680  CA  VAL B 171      27.532  14.581 -74.997  1.00  0.86           C  
ATOM   4681  C   VAL B 171      28.522  15.498 -74.326  1.00  0.86           C  
ATOM   4682  O   VAL B 171      28.752  15.451 -73.119  1.00  0.86           O  
ATOM   4683  CB  VAL B 171      26.144  15.201 -74.999  1.00  0.86           C  
ATOM   4684  CG1 VAL B 171      25.248  14.350 -75.914  1.00  0.86           C  
ATOM   4685  CG2 VAL B 171      25.566  15.277 -73.574  1.00  0.86           C  
ATOM   4686  N   VAL B 172      29.175  16.360 -75.115  1.00  0.87           N  
ATOM   4687  CA  VAL B 172      30.149  17.295 -74.592  1.00  0.87           C  
ATOM   4688  C   VAL B 172      29.523  18.669 -74.578  1.00  0.87           C  
ATOM   4689  O   VAL B 172      28.888  19.113 -75.539  1.00  0.87           O  
ATOM   4690  CB  VAL B 172      31.472  17.292 -75.347  1.00  0.87           C  
ATOM   4691  CG1 VAL B 172      32.470  18.278 -74.716  1.00  0.87           C  
ATOM   4692  CG2 VAL B 172      32.059  15.874 -75.330  1.00  0.87           C  
ATOM   4693  N   SER B 173      29.674  19.368 -73.444  1.00  0.86           N  
ATOM   4694  CA  SER B 173      29.114  20.684 -73.230  1.00  0.86           C  
ATOM   4695  C   SER B 173      30.220  21.715 -73.131  1.00  0.86           C  
ATOM   4696  O   SER B 173      30.873  21.821 -72.090  1.00  0.86           O  
ATOM   4697  CB  SER B 173      28.317  20.764 -71.906  1.00  0.86           C  
ATOM   4698  OG  SER B 173      27.157  19.931 -71.946  1.00  0.86           O  
ATOM   4699  N   PRO B 174      30.481  22.517 -74.159  1.00  0.86           N  
ATOM   4700  CA  PRO B 174      31.250  23.742 -74.024  1.00  0.86           C  
ATOM   4701  C   PRO B 174      30.518  24.814 -73.261  1.00  0.86           C  
ATOM   4702  O   PRO B 174      29.298  24.751 -73.106  1.00  0.86           O  
ATOM   4703  CB  PRO B 174      31.496  24.220 -75.464  1.00  0.86           C  
ATOM   4704  CG  PRO B 174      31.249  22.991 -76.332  1.00  0.86           C  
ATOM   4705  CD  PRO B 174      30.189  22.213 -75.558  1.00  0.86           C  
ATOM   4706  N   ARG B 175      31.270  25.829 -72.827  1.00  0.77           N  
ATOM   4707  CA  ARG B 175      30.762  26.993 -72.154  1.00  0.77           C  
ATOM   4708  C   ARG B 175      30.399  28.069 -73.158  1.00  0.77           C  
ATOM   4709  O   ARG B 175      31.150  28.360 -74.086  1.00  0.77           O  
ATOM   4710  CB  ARG B 175      31.841  27.564 -71.205  1.00  0.77           C  
ATOM   4711  CG  ARG B 175      32.263  26.565 -70.107  1.00  0.77           C  
ATOM   4712  CD  ARG B 175      33.478  26.991 -69.274  1.00  0.77           C  
ATOM   4713  NE  ARG B 175      33.123  28.265 -68.580  1.00  0.77           N  
ATOM   4714  CZ  ARG B 175      34.034  29.109 -68.075  1.00  0.77           C  
ATOM   4715  NH1 ARG B 175      35.343  28.867 -68.131  1.00  0.77           N  
ATOM   4716  NH2 ARG B 175      33.606  30.229 -67.486  1.00  0.77           N  
ATOM   4717  N   ILE B 176      29.234  28.706 -72.983  1.00  0.79           N  
ATOM   4718  CA  ILE B 176      28.817  29.810 -73.832  1.00  0.79           C  
ATOM   4719  C   ILE B 176      28.716  31.034 -72.960  1.00  0.79           C  
ATOM   4720  O   ILE B 176      27.924  31.083 -72.020  1.00  0.79           O  
ATOM   4721  CB  ILE B 176      27.493  29.556 -74.540  1.00  0.79           C  
ATOM   4722  CG1 ILE B 176      27.604  28.307 -75.439  1.00  0.79           C  
ATOM   4723  CG2 ILE B 176      27.084  30.786 -75.382  1.00  0.79           C  
ATOM   4724  CD1 ILE B 176      26.242  27.808 -75.928  1.00  0.79           C  
ATOM   4725  N   LEU B 177      29.539  32.053 -73.257  1.00  0.72           N  
ATOM   4726  CA  LEU B 177      29.509  33.337 -72.592  1.00  0.72           C  
ATOM   4727  C   LEU B 177      28.703  34.287 -73.437  1.00  0.72           C  
ATOM   4728  O   LEU B 177      28.978  34.455 -74.622  1.00  0.72           O  
ATOM   4729  CB  LEU B 177      30.927  33.941 -72.437  1.00  0.72           C  
ATOM   4730  CG  LEU B 177      31.767  33.305 -71.315  1.00  0.72           C  
ATOM   4731  CD1 LEU B 177      33.232  33.745 -71.436  1.00  0.72           C  
ATOM   4732  CD2 LEU B 177      31.229  33.689 -69.931  1.00  0.72           C  
ATOM   4733  N   ASP B 178      27.675  34.931 -72.866  1.00  0.63           N  
ATOM   4734  CA  ASP B 178      26.903  35.910 -73.592  1.00  0.63           C  
ATOM   4735  C   ASP B 178      27.412  37.329 -73.382  1.00  0.63           C  
ATOM   4736  O   ASP B 178      28.445  37.593 -72.765  1.00  0.63           O  
ATOM   4737  CB  ASP B 178      25.381  35.730 -73.338  1.00  0.63           C  
ATOM   4738  CG  ASP B 178      24.885  36.210 -71.983  1.00  0.63           C  
ATOM   4739  OD1 ASP B 178      25.650  36.844 -71.215  1.00  0.63           O  
ATOM   4740  OD2 ASP B 178      23.673  36.023 -71.745  1.00  0.63           O  
ATOM   4741  N   THR B 179      26.659  38.305 -73.909  1.00  0.58           N  
ATOM   4742  CA  THR B 179      26.982  39.713 -73.792  1.00  0.58           C  
ATOM   4743  C   THR B 179      26.691  40.291 -72.424  1.00  0.58           C  
ATOM   4744  O   THR B 179      27.169  41.378 -72.107  1.00  0.58           O  
ATOM   4745  CB  THR B 179      26.257  40.571 -74.817  1.00  0.58           C  
ATOM   4746  OG1 THR B 179      24.855  40.333 -74.806  1.00  0.58           O  
ATOM   4747  CG2 THR B 179      26.755  40.191 -76.214  1.00  0.58           C  
ATOM   4748  N   SER B 180      25.931  39.588 -71.552  1.00  0.52           N  
ATOM   4749  CA  SER B 180      25.640  40.078 -70.210  1.00  0.52           C  
ATOM   4750  C   SER B 180      26.681  39.594 -69.221  1.00  0.52           C  
ATOM   4751  O   SER B 180      26.788  40.109 -68.110  1.00  0.52           O  
ATOM   4752  CB  SER B 180      24.188  39.742 -69.735  1.00  0.52           C  
ATOM   4753  OG  SER B 180      23.972  38.399 -69.291  1.00  0.52           O  
ATOM   4754  N   ARG B 181      27.508  38.628 -69.681  1.00  0.45           N  
ATOM   4755  CA  ARG B 181      28.581  37.931 -68.998  1.00  0.45           C  
ATOM   4756  C   ARG B 181      28.031  36.727 -68.261  1.00  0.45           C  
ATOM   4757  O   ARG B 181      28.691  36.165 -67.384  1.00  0.45           O  
ATOM   4758  CB  ARG B 181      29.478  38.779 -68.050  1.00  0.45           C  
ATOM   4759  CG  ARG B 181      30.230  39.940 -68.732  1.00  0.45           C  
ATOM   4760  CD  ARG B 181      31.104  40.701 -67.731  1.00  0.45           C  
ATOM   4761  NE  ARG B 181      31.903  41.726 -68.482  1.00  0.45           N  
ATOM   4762  CZ  ARG B 181      32.907  42.427 -67.938  1.00  0.45           C  
ATOM   4763  NH1 ARG B 181      33.257  42.262 -66.665  1.00  0.45           N  
ATOM   4764  NH2 ARG B 181      33.578  43.308 -68.676  1.00  0.45           N  
ATOM   4765  N   GLU B 182      26.822  36.264 -68.633  1.00  0.56           N  
ATOM   4766  CA  GLU B 182      26.276  35.027 -68.132  1.00  0.56           C  
ATOM   4767  C   GLU B 182      26.939  33.851 -68.835  1.00  0.56           C  
ATOM   4768  O   GLU B 182      27.309  33.914 -70.009  1.00  0.56           O  
ATOM   4769  CB  GLU B 182      24.735  34.985 -68.251  1.00  0.56           C  
ATOM   4770  CG  GLU B 182      24.079  33.809 -67.483  1.00  0.56           C  
ATOM   4771  CD  GLU B 182      22.549  33.838 -67.474  1.00  0.56           C  
ATOM   4772  OE1 GLU B 182      21.979  32.887 -66.876  1.00  0.56           O  
ATOM   4773  OE2 GLU B 182      21.939  34.775 -68.040  1.00  0.56           O  
ATOM   4774  N   CYS B 183      27.167  32.743 -68.104  1.00  0.69           N  
ATOM   4775  CA  CYS B 183      27.893  31.608 -68.636  1.00  0.69           C  
ATOM   4776  C   CYS B 183      27.043  30.358 -68.603  1.00  0.69           C  
ATOM   4777  O   CYS B 183      26.752  29.797 -67.549  1.00  0.69           O  
ATOM   4778  CB  CYS B 183      29.214  31.360 -67.861  1.00  0.69           C  
ATOM   4779  SG  CYS B 183      30.305  30.122 -68.652  1.00  0.69           S  
ATOM   4780  N   HIS B 184      26.674  29.862 -69.792  1.00  0.71           N  
ATOM   4781  CA  HIS B 184      25.875  28.662 -69.940  1.00  0.71           C  
ATOM   4782  C   HIS B 184      26.774  27.445 -70.060  1.00  0.71           C  
ATOM   4783  O   HIS B 184      27.573  27.353 -70.991  1.00  0.71           O  
ATOM   4784  CB  HIS B 184      24.989  28.753 -71.199  1.00  0.71           C  
ATOM   4785  CG  HIS B 184      24.126  29.972 -71.157  1.00  0.71           C  
ATOM   4786  ND1 HIS B 184      22.966  29.929 -70.416  1.00  0.71           N  
ATOM   4787  CD2 HIS B 184      24.367  31.237 -71.597  1.00  0.71           C  
ATOM   4788  CE1 HIS B 184      22.521  31.177 -70.408  1.00  0.71           C  
ATOM   4789  NE2 HIS B 184      23.332  32.007 -71.112  1.00  0.71           N  
ATOM   4790  N   THR B 185      26.691  26.491 -69.108  1.00  0.80           N  
ATOM   4791  CA  THR B 185      27.636  25.375 -69.025  1.00  0.80           C  
ATOM   4792  C   THR B 185      27.063  24.033 -69.446  1.00  0.80           C  
ATOM   4793  O   THR B 185      27.806  23.200 -69.950  1.00  0.80           O  
ATOM   4794  CB  THR B 185      28.223  25.211 -67.626  1.00  0.80           C  
ATOM   4795  OG1 THR B 185      27.202  25.130 -66.641  1.00  0.80           O  
ATOM   4796  CG2 THR B 185      29.071  26.454 -67.297  1.00  0.80           C  
ATOM   4797  N   ASP B 186      25.734  23.792 -69.344  1.00  0.79           N  
ATOM   4798  CA  ASP B 186      25.113  22.530 -69.749  1.00  0.79           C  
ATOM   4799  C   ASP B 186      24.501  22.672 -71.144  1.00  0.79           C  
ATOM   4800  O   ASP B 186      23.290  22.626 -71.365  1.00  0.79           O  
ATOM   4801  CB  ASP B 186      24.070  22.040 -68.700  1.00  0.79           C  
ATOM   4802  CG  ASP B 186      23.576  20.627 -68.991  1.00  0.79           C  
ATOM   4803  OD1 ASP B 186      24.373  19.792 -69.495  1.00  0.79           O  
ATOM   4804  OD2 ASP B 186      22.378  20.319 -68.749  1.00  0.79           O  
ATOM   4805  N   THR B 187      25.362  22.913 -72.143  1.00  0.80           N  
ATOM   4806  CA  THR B 187      24.948  23.155 -73.517  1.00  0.80           C  
ATOM   4807  C   THR B 187      24.596  21.901 -74.297  1.00  0.80           C  
ATOM   4808  O   THR B 187      23.652  21.919 -75.085  1.00  0.80           O  
ATOM   4809  CB  THR B 187      25.968  23.972 -74.295  1.00  0.80           C  
ATOM   4810  OG1 THR B 187      27.217  23.304 -74.395  1.00  0.80           O  
ATOM   4811  CG2 THR B 187      26.221  25.299 -73.574  1.00  0.80           C  
ATOM   4812  N   ARG B 188      25.350  20.791 -74.106  1.00  0.76           N  
ATOM   4813  CA  ARG B 188      25.141  19.485 -74.719  1.00  0.76           C  
ATOM   4814  C   ARG B 188      25.079  19.486 -76.234  1.00  0.76           C  
ATOM   4815  O   ARG B 188      24.200  18.887 -76.850  1.00  0.76           O  
ATOM   4816  CB  ARG B 188      23.891  18.772 -74.163  1.00  0.76           C  
ATOM   4817  CG  ARG B 188      23.911  18.645 -72.636  1.00  0.76           C  
ATOM   4818  CD  ARG B 188      22.673  17.939 -72.103  1.00  0.76           C  
ATOM   4819  NE  ARG B 188      22.857  17.871 -70.632  1.00  0.76           N  
ATOM   4820  CZ  ARG B 188      22.454  16.875 -69.840  1.00  0.76           C  
ATOM   4821  NH1 ARG B 188      22.065  15.702 -70.324  1.00  0.76           N  
ATOM   4822  NH2 ARG B 188      22.453  17.088 -68.531  1.00  0.76           N  
ATOM   4823  N   ARG B 189      26.028  20.177 -76.878  1.00  0.77           N  
ATOM   4824  CA  ARG B 189      25.924  20.462 -78.293  1.00  0.77           C  
ATOM   4825  C   ARG B 189      26.875  19.642 -79.125  1.00  0.77           C  
ATOM   4826  O   ARG B 189      26.881  19.740 -80.351  1.00  0.77           O  
ATOM   4827  CB  ARG B 189      26.238  21.948 -78.530  1.00  0.77           C  
ATOM   4828  CG  ARG B 189      25.127  22.874 -78.017  1.00  0.77           C  
ATOM   4829  CD  ARG B 189      25.387  24.316 -78.419  1.00  0.77           C  
ATOM   4830  NE  ARG B 189      24.258  25.146 -77.904  1.00  0.77           N  
ATOM   4831  CZ  ARG B 189      24.114  26.398 -78.355  1.00  0.77           C  
ATOM   4832  NH1 ARG B 189      25.021  26.930 -79.157  1.00  0.77           N  
ATOM   4833  NH2 ARG B 189      23.057  27.139 -78.057  1.00  0.77           N  
ATOM   4834  N   ILE B 190      27.705  18.803 -78.493  1.00  0.84           N  
ATOM   4835  CA  ILE B 190      28.690  18.029 -79.216  1.00  0.84           C  
ATOM   4836  C   ILE B 190      28.436  16.569 -78.947  1.00  0.84           C  
ATOM   4837  O   ILE B 190      28.315  16.141 -77.801  1.00  0.84           O  
ATOM   4838  CB  ILE B 190      30.111  18.385 -78.828  1.00  0.84           C  
ATOM   4839  CG1 ILE B 190      30.381  19.899 -78.942  1.00  0.84           C  
ATOM   4840  CG2 ILE B 190      31.114  17.562 -79.673  1.00  0.84           C  
ATOM   4841  CD1 ILE B 190      31.713  20.290 -78.309  1.00  0.84           C  
ATOM   4842  N   VAL B 191      28.342  15.765 -80.013  1.00  0.87           N  
ATOM   4843  CA  VAL B 191      27.930  14.380 -79.923  1.00  0.87           C  
ATOM   4844  C   VAL B 191      28.691  13.601 -80.969  1.00  0.87           C  
ATOM   4845  O   VAL B 191      29.133  14.154 -81.975  1.00  0.87           O  
ATOM   4846  CB  VAL B 191      26.420  14.257 -80.121  1.00  0.87           C  
ATOM   4847  CG1 VAL B 191      25.994  14.789 -81.505  1.00  0.87           C  
ATOM   4848  CG2 VAL B 191      25.920  12.817 -79.900  1.00  0.87           C  
ATOM   4849  N   ARG B 192      28.917  12.290 -80.753  1.00  0.80           N  
ATOM   4850  CA  ARG B 192      29.478  11.424 -81.769  1.00  0.80           C  
ATOM   4851  C   ARG B 192      28.589  11.322 -83.004  1.00  0.80           C  
ATOM   4852  O   ARG B 192      27.363  11.364 -82.925  1.00  0.80           O  
ATOM   4853  CB  ARG B 192      29.736   9.998 -81.241  1.00  0.80           C  
ATOM   4854  CG  ARG B 192      30.729   9.914 -80.074  1.00  0.80           C  
ATOM   4855  CD  ARG B 192      31.010   8.455 -79.673  1.00  0.80           C  
ATOM   4856  NE  ARG B 192      32.000   8.455 -78.550  1.00  0.80           N  
ATOM   4857  CZ  ARG B 192      33.289   8.757 -78.731  1.00  0.80           C  
ATOM   4858  NH1 ARG B 192      33.804   8.975 -79.937  1.00  0.80           N  
ATOM   4859  NH2 ARG B 192      34.114   8.873 -77.697  1.00  0.80           N  
ATOM   4860  N   SER B 193      29.193  11.192 -84.193  1.00  0.82           N  
ATOM   4861  CA  SER B 193      28.466  11.135 -85.451  1.00  0.82           C  
ATOM   4862  C   SER B 193      27.646   9.883 -85.664  1.00  0.82           C  
ATOM   4863  O   SER B 193      26.633   9.902 -86.359  1.00  0.82           O  
ATOM   4864  CB  SER B 193      29.422  11.260 -86.654  1.00  0.82           C  
ATOM   4865  OG  SER B 193      30.487  10.311 -86.610  1.00  0.82           O  
ATOM   4866  N   ASP B 194      28.061   8.768 -85.050  1.00  0.75           N  
ATOM   4867  CA  ASP B 194      27.459   7.465 -85.173  1.00  0.75           C  
ATOM   4868  C   ASP B 194      26.475   7.199 -84.048  1.00  0.75           C  
ATOM   4869  O   ASP B 194      25.818   6.160 -83.994  1.00  0.75           O  
ATOM   4870  CB  ASP B 194      28.588   6.393 -85.188  1.00  0.75           C  
ATOM   4871  CG  ASP B 194      29.650   6.524 -84.095  1.00  0.75           C  
ATOM   4872  OD1 ASP B 194      29.578   7.450 -83.247  1.00  0.75           O  
ATOM   4873  OD2 ASP B 194      30.599   5.704 -84.141  1.00  0.75           O  
ATOM   4874  N   SER B 195      26.314   8.176 -83.140  1.00  0.75           N  
ATOM   4875  CA  SER B 195      25.376   8.100 -82.038  1.00  0.75           C  
ATOM   4876  C   SER B 195      23.915   7.977 -82.461  1.00  0.75           C  
ATOM   4877  O   SER B 195      23.455   8.526 -83.468  1.00  0.75           O  
ATOM   4878  CB  SER B 195      25.502   9.302 -81.074  1.00  0.75           C  
ATOM   4879  OG  SER B 195      24.628   9.183 -79.951  1.00  0.75           O  
ATOM   4880  N   ALA B 196      23.121   7.263 -81.644  1.00  0.70           N  
ATOM   4881  CA  ALA B 196      21.705   7.094 -81.865  1.00  0.70           C  
ATOM   4882  C   ALA B 196      20.899   8.245 -81.287  1.00  0.70           C  
ATOM   4883  O   ALA B 196      19.710   8.388 -81.569  1.00  0.70           O  
ATOM   4884  CB  ALA B 196      21.252   5.767 -81.235  1.00  0.70           C  
ATOM   4885  N   LEU B 197      21.548   9.124 -80.499  1.00  0.73           N  
ATOM   4886  CA  LEU B 197      20.948  10.325 -79.964  1.00  0.73           C  
ATOM   4887  C   LEU B 197      20.457  11.296 -81.024  1.00  0.73           C  
ATOM   4888  O   LEU B 197      21.076  11.501 -82.068  1.00  0.73           O  
ATOM   4889  CB  LEU B 197      21.947  11.107 -79.087  1.00  0.73           C  
ATOM   4890  CG  LEU B 197      22.491  10.341 -77.870  1.00  0.73           C  
ATOM   4891  CD1 LEU B 197      23.685  11.107 -77.291  1.00  0.73           C  
ATOM   4892  CD2 LEU B 197      21.422  10.100 -76.800  1.00  0.73           C  
ATOM   4893  N   ARG B 198      19.316  11.949 -80.779  1.00  0.69           N  
ATOM   4894  CA  ARG B 198      18.748  12.876 -81.728  1.00  0.69           C  
ATOM   4895  C   ARG B 198      18.178  14.035 -80.962  1.00  0.69           C  
ATOM   4896  O   ARG B 198      17.770  13.913 -79.809  1.00  0.69           O  
ATOM   4897  CB  ARG B 198      17.628  12.228 -82.591  1.00  0.69           C  
ATOM   4898  CG  ARG B 198      18.138  11.198 -83.624  1.00  0.69           C  
ATOM   4899  CD  ARG B 198      19.068  11.797 -84.691  1.00  0.69           C  
ATOM   4900  NE  ARG B 198      19.503  10.689 -85.610  1.00  0.69           N  
ATOM   4901  CZ  ARG B 198      20.608   9.951 -85.417  1.00  0.69           C  
ATOM   4902  NH1 ARG B 198      21.384  10.091 -84.353  1.00  0.69           N  
ATOM   4903  NH2 ARG B 198      20.957   9.042 -86.326  1.00  0.69           N  
ATOM   4904  N   PHE B 199      18.174  15.227 -81.587  1.00  0.76           N  
ATOM   4905  CA  PHE B 199      17.532  16.392 -81.023  1.00  0.76           C  
ATOM   4906  C   PHE B 199      16.024  16.198 -80.950  1.00  0.76           C  
ATOM   4907  O   PHE B 199      15.403  15.720 -81.899  1.00  0.76           O  
ATOM   4908  CB  PHE B 199      17.877  17.688 -81.800  1.00  0.76           C  
ATOM   4909  CG  PHE B 199      19.298  18.094 -81.525  1.00  0.76           C  
ATOM   4910  CD1 PHE B 199      19.593  18.942 -80.443  1.00  0.76           C  
ATOM   4911  CD2 PHE B 199      20.350  17.643 -82.337  1.00  0.76           C  
ATOM   4912  CE1 PHE B 199      20.912  19.336 -80.179  1.00  0.76           C  
ATOM   4913  CE2 PHE B 199      21.669  18.037 -82.079  1.00  0.76           C  
ATOM   4914  CZ  PHE B 199      21.952  18.884 -81.000  1.00  0.76           C  
ATOM   4915  N   ARG B 200      15.402  16.549 -79.811  1.00  0.74           N  
ATOM   4916  CA  ARG B 200      13.975  16.375 -79.628  1.00  0.74           C  
ATOM   4917  C   ARG B 200      13.343  17.611 -79.017  1.00  0.74           C  
ATOM   4918  O   ARG B 200      13.828  18.178 -78.035  1.00  0.74           O  
ATOM   4919  CB  ARG B 200      13.667  15.128 -78.767  1.00  0.74           C  
ATOM   4920  CG  ARG B 200      12.179  14.731 -78.731  1.00  0.74           C  
ATOM   4921  CD  ARG B 200      11.922  13.471 -77.901  1.00  0.74           C  
ATOM   4922  NE  ARG B 200      10.439  13.252 -77.888  1.00  0.74           N  
ATOM   4923  CZ  ARG B 200       9.838  12.235 -77.259  1.00  0.74           C  
ATOM   4924  NH1 ARG B 200      10.540  11.240 -76.718  1.00  0.74           N  
ATOM   4925  NH2 ARG B 200       8.509  12.236 -77.159  1.00  0.74           N  
ATOM   4926  N   GLY B 201      12.214  18.045 -79.615  1.00  0.85           N  
ATOM   4927  CA  GLY B 201      11.520  19.283 -79.307  1.00  0.85           C  
ATOM   4928  C   GLY B 201      11.687  20.259 -80.423  1.00  0.85           C  
ATOM   4929  O   GLY B 201      12.796  20.597 -80.800  1.00  0.85           O  
ATOM   4930  N   ARG B 202      10.578  20.781 -80.979  1.00  0.80           N  
ATOM   4931  CA  ARG B 202      10.637  21.733 -82.081  1.00  0.80           C  
ATOM   4932  C   ARG B 202      11.296  23.051 -81.705  1.00  0.80           C  
ATOM   4933  O   ARG B 202      11.826  23.759 -82.556  1.00  0.80           O  
ATOM   4934  CB  ARG B 202       9.224  22.098 -82.578  1.00  0.80           C  
ATOM   4935  CG  ARG B 202       8.427  20.939 -83.193  1.00  0.80           C  
ATOM   4936  CD  ARG B 202       7.036  21.431 -83.610  1.00  0.80           C  
ATOM   4937  NE  ARG B 202       6.330  20.350 -84.345  1.00  0.80           N  
ATOM   4938  CZ  ARG B 202       6.577  19.978 -85.604  1.00  0.80           C  
ATOM   4939  NH1 ARG B 202       7.413  20.629 -86.400  1.00  0.80           N  
ATOM   4940  NH2 ARG B 202       5.915  18.920 -86.062  1.00  0.80           N  
ATOM   4941  N   LEU B 203      11.236  23.389 -80.406  1.00  0.84           N  
ATOM   4942  CA  LEU B 203      11.811  24.560 -79.799  1.00  0.84           C  
ATOM   4943  C   LEU B 203      12.364  24.118 -78.456  1.00  0.84           C  
ATOM   4944  O   LEU B 203      11.763  23.278 -77.789  1.00  0.84           O  
ATOM   4945  CB  LEU B 203      10.704  25.620 -79.566  1.00  0.84           C  
ATOM   4946  CG  LEU B 203      11.191  26.952 -78.965  1.00  0.84           C  
ATOM   4947  CD1 LEU B 203      12.066  27.745 -79.939  1.00  0.84           C  
ATOM   4948  CD2 LEU B 203      10.009  27.809 -78.497  1.00  0.84           C  
ATOM   4949  N   HIS B 204      13.535  24.634 -78.031  1.00  0.78           N  
ATOM   4950  CA  HIS B 204      14.223  24.205 -76.815  1.00  0.78           C  
ATOM   4951  C   HIS B 204      14.623  22.742 -76.895  1.00  0.78           C  
ATOM   4952  O   HIS B 204      14.343  21.918 -76.011  1.00  0.78           O  
ATOM   4953  CB  HIS B 204      13.449  24.500 -75.507  1.00  0.78           C  
ATOM   4954  CG  HIS B 204      12.963  25.907 -75.449  1.00  0.78           C  
ATOM   4955  ND1 HIS B 204      13.867  26.945 -75.339  1.00  0.78           N  
ATOM   4956  CD2 HIS B 204      11.708  26.391 -75.628  1.00  0.78           C  
ATOM   4957  CE1 HIS B 204      13.148  28.037 -75.473  1.00  0.78           C  
ATOM   4958  NE2 HIS B 204      11.831  27.762 -75.641  1.00  0.78           N  
ATOM   4959  N   GLU B 205      15.241  22.406 -78.037  1.00  0.77           N  
ATOM   4960  CA  GLU B 205      15.706  21.108 -78.418  1.00  0.77           C  
ATOM   4961  C   GLU B 205      16.970  20.701 -77.684  1.00  0.77           C  
ATOM   4962  O   GLU B 205      17.868  21.491 -77.397  1.00  0.77           O  
ATOM   4963  CB  GLU B 205      15.877  21.025 -79.961  1.00  0.77           C  
ATOM   4964  CG  GLU B 205      17.061  21.805 -80.601  1.00  0.77           C  
ATOM   4965  CD  GLU B 205      16.995  23.337 -80.589  1.00  0.77           C  
ATOM   4966  OE1 GLU B 205      17.999  23.929 -81.079  1.00  0.77           O  
ATOM   4967  OE2 GLU B 205      15.983  23.926 -80.130  1.00  0.77           O  
ATOM   4968  N   ARG B 206      17.070  19.411 -77.339  1.00  0.71           N  
ATOM   4969  CA  ARG B 206      18.254  18.857 -76.720  1.00  0.71           C  
ATOM   4970  C   ARG B 206      18.388  17.452 -77.242  1.00  0.71           C  
ATOM   4971  O   ARG B 206      17.424  16.894 -77.759  1.00  0.71           O  
ATOM   4972  CB  ARG B 206      18.170  18.795 -75.171  1.00  0.71           C  
ATOM   4973  CG  ARG B 206      18.124  20.170 -74.480  1.00  0.71           C  
ATOM   4974  CD  ARG B 206      18.153  20.051 -72.954  1.00  0.71           C  
ATOM   4975  NE  ARG B 206      18.270  21.433 -72.392  1.00  0.71           N  
ATOM   4976  CZ  ARG B 206      18.657  21.682 -71.134  1.00  0.71           C  
ATOM   4977  NH1 ARG B 206      18.762  20.714 -70.229  1.00  0.71           N  
ATOM   4978  NH2 ARG B 206      18.948  22.929 -70.768  1.00  0.71           N  
ATOM   4979  N   LEU B 207      19.592  16.861 -77.144  1.00  0.80           N  
ATOM   4980  CA  LEU B 207      19.840  15.471 -77.466  1.00  0.80           C  
ATOM   4981  C   LEU B 207      19.207  14.494 -76.488  1.00  0.80           C  
ATOM   4982  O   LEU B 207      19.366  14.609 -75.273  1.00  0.80           O  
ATOM   4983  CB  LEU B 207      21.359  15.205 -77.537  1.00  0.80           C  
ATOM   4984  CG  LEU B 207      22.027  15.864 -78.757  1.00  0.80           C  
ATOM   4985  CD1 LEU B 207      23.535  15.971 -78.541  1.00  0.80           C  
ATOM   4986  CD2 LEU B 207      21.741  15.079 -80.046  1.00  0.80           C  
ATOM   4987  N   TYR B 208      18.494  13.491 -77.024  1.00  0.76           N  
ATOM   4988  CA  TYR B 208      17.877  12.434 -76.253  1.00  0.76           C  
ATOM   4989  C   TYR B 208      18.065  11.139 -77.005  1.00  0.76           C  
ATOM   4990  O   TYR B 208      18.270  11.143 -78.219  1.00  0.76           O  
ATOM   4991  CB  TYR B 208      16.344  12.625 -76.095  1.00  0.76           C  
ATOM   4992  CG  TYR B 208      16.044  13.823 -75.255  1.00  0.76           C  
ATOM   4993  CD1 TYR B 208      15.969  13.708 -73.863  1.00  0.76           C  
ATOM   4994  CD2 TYR B 208      15.852  15.082 -75.844  1.00  0.76           C  
ATOM   4995  CE1 TYR B 208      15.753  14.842 -73.076  1.00  0.76           C  
ATOM   4996  CE2 TYR B 208      15.648  16.220 -75.054  1.00  0.76           C  
ATOM   4997  CZ  TYR B 208      15.645  16.098 -73.664  1.00  0.76           C  
ATOM   4998  OH  TYR B 208      15.571  17.207 -72.810  1.00  0.76           O  
ATOM   4999  N   ASP B 209      17.987   9.990 -76.307  1.00  0.70           N  
ATOM   5000  CA  ASP B 209      17.838   8.701 -76.946  1.00  0.70           C  
ATOM   5001  C   ASP B 209      16.439   8.504 -77.538  1.00  0.70           C  
ATOM   5002  O   ASP B 209      15.559   9.367 -77.476  1.00  0.70           O  
ATOM   5003  CB  ASP B 209      18.325   7.525 -76.044  1.00  0.70           C  
ATOM   5004  CG  ASP B 209      17.363   7.081 -74.952  1.00  0.70           C  
ATOM   5005  OD1 ASP B 209      16.274   7.688 -74.807  1.00  0.70           O  
ATOM   5006  OD2 ASP B 209      17.675   6.063 -74.294  1.00  0.70           O  
ATOM   5007  N   ALA B 210      16.197   7.320 -78.129  1.00  0.65           N  
ATOM   5008  CA  ALA B 210      14.911   6.943 -78.676  1.00  0.65           C  
ATOM   5009  C   ALA B 210      13.778   6.901 -77.649  1.00  0.65           C  
ATOM   5010  O   ALA B 210      12.613   7.105 -77.986  1.00  0.65           O  
ATOM   5011  CB  ALA B 210      15.041   5.566 -79.355  1.00  0.65           C  
ATOM   5012  N   HIS B 211      14.102   6.676 -76.362  1.00  0.66           N  
ATOM   5013  CA  HIS B 211      13.119   6.556 -75.306  1.00  0.66           C  
ATOM   5014  C   HIS B 211      12.917   7.875 -74.586  1.00  0.66           C  
ATOM   5015  O   HIS B 211      12.056   8.007 -73.720  1.00  0.66           O  
ATOM   5016  CB  HIS B 211      13.589   5.506 -74.281  1.00  0.66           C  
ATOM   5017  CG  HIS B 211      13.740   4.162 -74.917  1.00  0.66           C  
ATOM   5018  ND1 HIS B 211      12.632   3.550 -75.470  1.00  0.66           N  
ATOM   5019  CD2 HIS B 211      14.849   3.405 -75.125  1.00  0.66           C  
ATOM   5020  CE1 HIS B 211      13.084   2.437 -76.004  1.00  0.66           C  
ATOM   5021  NE2 HIS B 211      14.420   2.297 -75.825  1.00  0.66           N  
ATOM   5022  N   GLY B 212      13.684   8.919 -74.963  1.00  0.83           N  
ATOM   5023  CA  GLY B 212      13.601  10.238 -74.362  1.00  0.83           C  
ATOM   5024  C   GLY B 212      14.461  10.409 -73.150  1.00  0.83           C  
ATOM   5025  O   GLY B 212      14.268  11.364 -72.401  1.00  0.83           O  
ATOM   5026  N   ALA B 213      15.436   9.516 -72.922  1.00  0.85           N  
ATOM   5027  CA  ALA B 213      16.397   9.679 -71.857  1.00  0.85           C  
ATOM   5028  C   ALA B 213      17.521  10.617 -72.263  1.00  0.85           C  
ATOM   5029  O   ALA B 213      17.904  10.719 -73.432  1.00  0.85           O  
ATOM   5030  CB  ALA B 213      16.977   8.326 -71.417  1.00  0.85           C  
ATOM   5031  N   GLN B 214      18.071  11.366 -71.293  1.00  0.79           N  
ATOM   5032  CA  GLN B 214      19.159  12.283 -71.544  1.00  0.79           C  
ATOM   5033  C   GLN B 214      20.495  11.560 -71.503  1.00  0.79           C  
ATOM   5034  O   GLN B 214      20.746  10.767 -70.596  1.00  0.79           O  
ATOM   5035  CB  GLN B 214      19.202  13.474 -70.548  1.00  0.79           C  
ATOM   5036  CG  GLN B 214      18.244  14.605 -70.969  1.00  0.79           C  
ATOM   5037  CD  GLN B 214      18.308  15.852 -70.091  1.00  0.79           C  
ATOM   5038  OE1 GLN B 214      19.187  16.046 -69.253  1.00  0.79           O  
ATOM   5039  NE2 GLN B 214      17.336  16.772 -70.313  1.00  0.79           N  
ATOM   5040  N   PRO B 215      21.413  11.787 -72.432  1.00  0.86           N  
ATOM   5041  CA  PRO B 215      22.718  11.159 -72.364  1.00  0.86           C  
ATOM   5042  C   PRO B 215      23.573  11.775 -71.270  1.00  0.86           C  
ATOM   5043  O   PRO B 215      23.360  12.951 -70.943  1.00  0.86           O  
ATOM   5044  CB  PRO B 215      23.312  11.445 -73.744  1.00  0.86           C  
ATOM   5045  CG  PRO B 215      22.699  12.790 -74.138  1.00  0.86           C  
ATOM   5046  CD  PRO B 215      21.288  12.698 -73.573  1.00  0.86           C  
ATOM   5047  N   PRO B 216      24.519  11.055 -70.682  1.00  0.86           N  
ATOM   5048  CA  PRO B 216      25.443  11.630 -69.723  1.00  0.86           C  
ATOM   5049  C   PRO B 216      26.360  12.659 -70.375  1.00  0.86           C  
ATOM   5050  O   PRO B 216      26.728  12.525 -71.544  1.00  0.86           O  
ATOM   5051  CB  PRO B 216      26.206  10.411 -69.199  1.00  0.86           C  
ATOM   5052  CG  PRO B 216      26.202   9.414 -70.360  1.00  0.86           C  
ATOM   5053  CD  PRO B 216      24.833   9.652 -70.993  1.00  0.86           C  
ATOM   5054  N   SER B 217      26.710  13.733 -69.646  1.00  0.85           N  
ATOM   5055  CA  SER B 217      27.406  14.876 -70.205  1.00  0.85           C  
ATOM   5056  C   SER B 217      28.791  15.067 -69.622  1.00  0.85           C  
ATOM   5057  O   SER B 217      29.094  14.680 -68.492  1.00  0.85           O  
ATOM   5058  CB  SER B 217      26.603  16.202 -70.055  1.00  0.85           C  
ATOM   5059  OG  SER B 217      26.303  16.498 -68.689  1.00  0.85           O  
ATOM   5060  N   VAL B 218      29.690  15.665 -70.426  1.00  0.85           N  
ATOM   5061  CA  VAL B 218      31.007  16.105 -69.996  1.00  0.85           C  
ATOM   5062  C   VAL B 218      31.098  17.601 -70.231  1.00  0.85           C  
ATOM   5063  O   VAL B 218      30.955  18.074 -71.357  1.00  0.85           O  
ATOM   5064  CB  VAL B 218      32.142  15.412 -70.754  1.00  0.85           C  
ATOM   5065  CG1 VAL B 218      33.515  15.929 -70.285  1.00  0.85           C  
ATOM   5066  CG2 VAL B 218      32.066  13.897 -70.507  1.00  0.85           C  
ATOM   5067  N   GLU B 219      31.350  18.396 -69.175  1.00  0.79           N  
ATOM   5068  CA  GLU B 219      31.543  19.831 -69.292  1.00  0.79           C  
ATOM   5069  C   GLU B 219      33.011  20.139 -69.509  1.00  0.79           C  
ATOM   5070  O   GLU B 219      33.885  19.640 -68.797  1.00  0.79           O  
ATOM   5071  CB  GLU B 219      31.081  20.615 -68.046  1.00  0.79           C  
ATOM   5072  CG  GLU B 219      29.566  20.520 -67.750  1.00  0.79           C  
ATOM   5073  CD  GLU B 219      29.162  21.403 -66.569  1.00  0.79           C  
ATOM   5074  OE1 GLU B 219      28.050  21.178 -66.031  1.00  0.79           O  
ATOM   5075  OE2 GLU B 219      29.944  22.322 -66.205  1.00  0.79           O  
ATOM   5076  N   VAL B 220      33.327  20.966 -70.521  1.00  0.86           N  
ATOM   5077  CA  VAL B 220      34.704  21.215 -70.922  1.00  0.86           C  
ATOM   5078  C   VAL B 220      35.049  22.694 -70.881  1.00  0.86           C  
ATOM   5079  O   VAL B 220      34.214  23.567 -71.122  1.00  0.86           O  
ATOM   5080  CB  VAL B 220      35.050  20.634 -72.293  1.00  0.86           C  
ATOM   5081  CG1 VAL B 220      34.889  19.102 -72.239  1.00  0.86           C  
ATOM   5082  CG2 VAL B 220      34.160  21.230 -73.399  1.00  0.86           C  
ATOM   5083  N   ASP B 221      36.325  23.030 -70.578  1.00  0.86           N  
ATOM   5084  CA  ASP B 221      36.852  24.387 -70.645  1.00  0.86           C  
ATOM   5085  C   ASP B 221      37.169  24.791 -72.088  1.00  0.86           C  
ATOM   5086  O   ASP B 221      38.305  25.041 -72.498  1.00  0.86           O  
ATOM   5087  CB  ASP B 221      38.057  24.604 -69.693  1.00  0.86           C  
ATOM   5088  CG  ASP B 221      38.208  26.084 -69.387  1.00  0.86           C  
ATOM   5089  OD1 ASP B 221      37.214  26.691 -68.894  1.00  0.86           O  
ATOM   5090  OD2 ASP B 221      39.301  26.644 -69.645  1.00  0.86           O  
ATOM   5091  N   VAL B 222      36.101  24.844 -72.892  1.00  0.88           N  
ATOM   5092  CA  VAL B 222      36.080  25.349 -74.241  1.00  0.88           C  
ATOM   5093  C   VAL B 222      35.004  26.403 -74.236  1.00  0.88           C  
ATOM   5094  O   VAL B 222      33.871  26.142 -73.839  1.00  0.88           O  
ATOM   5095  CB  VAL B 222      35.722  24.269 -75.251  1.00  0.88           C  
ATOM   5096  CG1 VAL B 222      35.607  24.859 -76.667  1.00  0.88           C  
ATOM   5097  CG2 VAL B 222      36.807  23.177 -75.225  1.00  0.88           C  
ATOM   5098  N   VAL B 223      35.344  27.635 -74.635  1.00  0.85           N  
ATOM   5099  CA  VAL B 223      34.497  28.791 -74.444  1.00  0.85           C  
ATOM   5100  C   VAL B 223      34.113  29.355 -75.790  1.00  0.85           C  
ATOM   5101  O   VAL B 223      34.946  29.618 -76.656  1.00  0.85           O  
ATOM   5102  CB  VAL B 223      35.194  29.867 -73.616  1.00  0.85           C  
ATOM   5103  CG1 VAL B 223      34.305  31.116 -73.456  1.00  0.85           C  
ATOM   5104  CG2 VAL B 223      35.566  29.292 -72.233  1.00  0.85           C  
ATOM   5105  N   PHE B 224      32.807  29.577 -75.981  1.00  0.80           N  
ATOM   5106  CA  PHE B 224      32.258  30.270 -77.119  1.00  0.80           C  
ATOM   5107  C   PHE B 224      31.705  31.590 -76.636  1.00  0.80           C  
ATOM   5108  O   PHE B 224      31.066  31.679 -75.590  1.00  0.80           O  
ATOM   5109  CB  PHE B 224      31.105  29.476 -77.782  1.00  0.80           C  
ATOM   5110  CG  PHE B 224      31.648  28.322 -78.575  1.00  0.80           C  
ATOM   5111  CD1 PHE B 224      31.811  28.440 -79.963  1.00  0.80           C  
ATOM   5112  CD2 PHE B 224      31.984  27.108 -77.951  1.00  0.80           C  
ATOM   5113  CE1 PHE B 224      32.309  27.371 -80.715  1.00  0.80           C  
ATOM   5114  CE2 PHE B 224      32.486  26.035 -78.701  1.00  0.80           C  
ATOM   5115  CZ  PHE B 224      32.647  26.166 -80.086  1.00  0.80           C  
ATOM   5116  N   HIS B 225      31.946  32.665 -77.399  1.00  0.76           N  
ATOM   5117  CA  HIS B 225      31.334  33.949 -77.134  1.00  0.76           C  
ATOM   5118  C   HIS B 225      30.098  34.093 -77.986  1.00  0.76           C  
ATOM   5119  O   HIS B 225      30.163  34.027 -79.211  1.00  0.76           O  
ATOM   5120  CB  HIS B 225      32.272  35.132 -77.443  1.00  0.76           C  
ATOM   5121  CG  HIS B 225      33.463  35.162 -76.541  1.00  0.76           C  
ATOM   5122  ND1 HIS B 225      33.290  35.471 -75.208  1.00  0.76           N  
ATOM   5123  CD2 HIS B 225      34.779  34.960 -76.811  1.00  0.76           C  
ATOM   5124  CE1 HIS B 225      34.501  35.458 -74.690  1.00  0.76           C  
ATOM   5125  NE2 HIS B 225      35.442  35.154 -75.616  1.00  0.76           N  
ATOM   5126  N   HIS B 226      28.945  34.304 -77.338  1.00  0.72           N  
ATOM   5127  CA  HIS B 226      27.678  34.545 -77.984  1.00  0.72           C  
ATOM   5128  C   HIS B 226      27.492  36.029 -78.168  1.00  0.72           C  
ATOM   5129  O   HIS B 226      27.387  36.782 -77.201  1.00  0.72           O  
ATOM   5130  CB  HIS B 226      26.517  33.996 -77.128  1.00  0.72           C  
ATOM   5131  CG  HIS B 226      25.195  34.115 -77.787  1.00  0.72           C  
ATOM   5132  ND1 HIS B 226      25.070  33.507 -79.005  1.00  0.72           N  
ATOM   5133  CD2 HIS B 226      24.035  34.722 -77.431  1.00  0.72           C  
ATOM   5134  CE1 HIS B 226      23.832  33.735 -79.385  1.00  0.72           C  
ATOM   5135  NE2 HIS B 226      23.159  34.474 -78.467  1.00  0.72           N  
ATOM   5136  N   THR B 227      27.455  36.511 -79.425  1.00  0.71           N  
ATOM   5137  CA  THR B 227      27.360  37.947 -79.669  1.00  0.71           C  
ATOM   5138  C   THR B 227      25.965  38.469 -79.440  1.00  0.71           C  
ATOM   5139  O   THR B 227      25.786  39.660 -79.199  1.00  0.71           O  
ATOM   5140  CB  THR B 227      27.815  38.397 -81.058  1.00  0.71           C  
ATOM   5141  OG1 THR B 227      27.033  37.822 -82.093  1.00  0.71           O  
ATOM   5142  CG2 THR B 227      29.277  37.985 -81.288  1.00  0.71           C  
ATOM   5143  N   GLY B 228      24.933  37.590 -79.490  1.00  0.70           N  
ATOM   5144  CA  GLY B 228      23.544  37.987 -79.278  1.00  0.70           C  
ATOM   5145  C   GLY B 228      23.051  38.978 -80.283  1.00  0.70           C  
ATOM   5146  O   GLY B 228      22.261  39.862 -79.959  1.00  0.70           O  
ATOM   5147  N   TYR B 229      23.565  38.880 -81.522  1.00  0.55           N  
ATOM   5148  CA  TYR B 229      23.273  39.779 -82.608  1.00  0.55           C  
ATOM   5149  C   TYR B 229      21.808  39.692 -83.027  1.00  0.55           C  
ATOM   5150  O   TYR B 229      21.408  38.933 -83.899  1.00  0.55           O  
ATOM   5151  CB  TYR B 229      24.269  39.500 -83.769  1.00  0.55           C  
ATOM   5152  CG  TYR B 229      24.082  40.421 -84.935  1.00  0.55           C  
ATOM   5153  CD1 TYR B 229      23.461  39.936 -86.096  1.00  0.55           C  
ATOM   5154  CD2 TYR B 229      24.512  41.758 -84.883  1.00  0.55           C  
ATOM   5155  CE1 TYR B 229      23.205  40.794 -87.170  1.00  0.55           C  
ATOM   5156  CE2 TYR B 229      24.269  42.615 -85.964  1.00  0.55           C  
ATOM   5157  CZ  TYR B 229      23.589  42.136 -87.085  1.00  0.55           C  
ATOM   5158  OH  TYR B 229      23.164  43.049 -88.060  1.00  0.55           O  
ATOM   5159  N   GLU B 230      20.966  40.521 -82.396  1.00  0.54           N  
ATOM   5160  CA  GLU B 230      19.614  40.732 -82.840  1.00  0.54           C  
ATOM   5161  C   GLU B 230      19.453  42.201 -83.146  1.00  0.54           C  
ATOM   5162  O   GLU B 230      19.338  43.012 -82.221  1.00  0.54           O  
ATOM   5163  CB  GLU B 230      18.620  40.316 -81.743  1.00  0.54           C  
ATOM   5164  CG  GLU B 230      18.053  38.907 -82.013  1.00  0.54           C  
ATOM   5165  CD  GLU B 230      17.247  38.383 -80.837  1.00  0.54           C  
ATOM   5166  OE1 GLU B 230      17.327  37.151 -80.569  1.00  0.54           O  
ATOM   5167  OE2 GLU B 230      16.521  39.178 -80.183  1.00  0.54           O  
ATOM   5168  N   PRO B 231      19.417  42.621 -84.400  1.00  0.45           N  
ATOM   5169  CA  PRO B 231      19.296  44.025 -84.710  1.00  0.45           C  
ATOM   5170  C   PRO B 231      17.831  44.279 -84.878  1.00  0.45           C  
ATOM   5171  O   PRO B 231      17.194  43.629 -85.697  1.00  0.45           O  
ATOM   5172  CB  PRO B 231      20.042  44.234 -86.030  1.00  0.45           C  
ATOM   5173  CG  PRO B 231      20.296  42.824 -86.570  1.00  0.45           C  
ATOM   5174  CD  PRO B 231      19.695  41.821 -85.593  1.00  0.45           C  
ATOM   5175  N   GLU B 232      17.304  45.217 -84.076  1.00  0.47           N  
ATOM   5176  CA  GLU B 232      16.029  45.863 -84.292  1.00  0.47           C  
ATOM   5177  C   GLU B 232      14.926  45.234 -83.483  1.00  0.47           C  
ATOM   5178  O   GLU B 232      14.840  44.031 -83.244  1.00  0.47           O  
ATOM   5179  CB  GLU B 232      15.593  46.084 -85.761  1.00  0.47           C  
ATOM   5180  CG  GLU B 232      16.650  46.845 -86.596  1.00  0.47           C  
ATOM   5181  CD  GLU B 232      16.243  46.946 -88.060  1.00  0.47           C  
ATOM   5182  OE1 GLU B 232      17.094  47.426 -88.850  1.00  0.47           O  
ATOM   5183  OE2 GLU B 232      15.095  46.552 -88.390  1.00  0.47           O  
ATOM   5184  N   VAL B 233      14.015  46.103 -83.021  1.00  0.36           N  
ATOM   5185  CA  VAL B 233      12.828  45.773 -82.263  1.00  0.36           C  
ATOM   5186  C   VAL B 233      11.919  44.835 -83.049  1.00  0.36           C  
ATOM   5187  O   VAL B 233      11.327  43.906 -82.504  1.00  0.36           O  
ATOM   5188  CB  VAL B 233      12.134  47.078 -81.887  1.00  0.36           C  
ATOM   5189  CG1 VAL B 233      10.770  46.815 -81.224  1.00  0.36           C  
ATOM   5190  CG2 VAL B 233      13.054  47.864 -80.925  1.00  0.36           C  
ATOM   5191  N   ILE B 234      11.838  45.044 -84.378  1.00  0.39           N  
ATOM   5192  CA  ILE B 234      11.095  44.226 -85.320  1.00  0.39           C  
ATOM   5193  C   ILE B 234      11.604  42.791 -85.405  1.00  0.39           C  
ATOM   5194  O   ILE B 234      10.819  41.846 -85.340  1.00  0.39           O  
ATOM   5195  CB  ILE B 234      11.110  44.893 -86.694  1.00  0.39           C  
ATOM   5196  CG1 ILE B 234      10.433  46.287 -86.612  1.00  0.39           C  
ATOM   5197  CG2 ILE B 234      10.404  43.990 -87.732  1.00  0.39           C  
ATOM   5198  CD1 ILE B 234      10.586  47.117 -87.892  1.00  0.39           C  
ATOM   5199  N   ALA B 235      12.935  42.573 -85.494  1.00  0.42           N  
ATOM   5200  CA  ALA B 235      13.517  41.242 -85.508  1.00  0.42           C  
ATOM   5201  C   ALA B 235      13.271  40.469 -84.220  1.00  0.42           C  
ATOM   5202  O   ALA B 235      12.908  39.293 -84.228  1.00  0.42           O  
ATOM   5203  CB  ALA B 235      15.029  41.348 -85.762  1.00  0.42           C  
ATOM   5204  N   ARG B 236      13.409  41.155 -83.069  1.00  0.40           N  
ATOM   5205  CA  ARG B 236      13.081  40.608 -81.770  1.00  0.40           C  
ATOM   5206  C   ARG B 236      11.607  40.245 -81.627  1.00  0.40           C  
ATOM   5207  O   ARG B 236      11.249  39.196 -81.092  1.00  0.40           O  
ATOM   5208  CB  ARG B 236      13.462  41.632 -80.681  1.00  0.40           C  
ATOM   5209  CG  ARG B 236      13.425  41.052 -79.253  1.00  0.40           C  
ATOM   5210  CD  ARG B 236      13.770  42.076 -78.172  1.00  0.40           C  
ATOM   5211  NE  ARG B 236      15.204  42.444 -78.368  1.00  0.40           N  
ATOM   5212  CZ  ARG B 236      15.784  43.551 -77.888  1.00  0.40           C  
ATOM   5213  NH1 ARG B 236      15.105  44.456 -77.186  1.00  0.40           N  
ATOM   5214  NH2 ARG B 236      17.078  43.756 -78.119  1.00  0.40           N  
ATOM   5215  N   LYS B 237      10.697  41.108 -82.125  1.00  0.51           N  
ATOM   5216  CA  LYS B 237       9.270  40.848 -82.136  1.00  0.51           C  
ATOM   5217  C   LYS B 237       8.889  39.645 -82.989  1.00  0.51           C  
ATOM   5218  O   LYS B 237       8.175  38.758 -82.526  1.00  0.51           O  
ATOM   5219  CB  LYS B 237       8.505  42.105 -82.617  1.00  0.51           C  
ATOM   5220  CG  LYS B 237       6.979  42.007 -82.462  1.00  0.51           C  
ATOM   5221  CD  LYS B 237       6.258  43.298 -82.889  1.00  0.51           C  
ATOM   5222  CE  LYS B 237       4.735  43.142 -82.821  1.00  0.51           C  
ATOM   5223  NZ  LYS B 237       4.037  44.358 -83.291  1.00  0.51           N  
ATOM   5224  N   GLY B 238       9.436  39.542 -84.222  1.00  0.56           N  
ATOM   5225  CA  GLY B 238       9.186  38.407 -85.109  1.00  0.56           C  
ATOM   5226  C   GLY B 238       9.727  37.093 -84.600  1.00  0.56           C  
ATOM   5227  O   GLY B 238       9.173  36.023 -84.848  1.00  0.56           O  
ATOM   5228  N   LYS B 239      10.833  37.127 -83.830  1.00  0.57           N  
ATOM   5229  CA  LYS B 239      11.326  35.971 -83.108  1.00  0.57           C  
ATOM   5230  C   LYS B 239      10.376  35.505 -82.016  1.00  0.57           C  
ATOM   5231  O   LYS B 239      10.106  34.311 -81.890  1.00  0.57           O  
ATOM   5232  CB  LYS B 239      12.714  36.266 -82.493  1.00  0.57           C  
ATOM   5233  CG  LYS B 239      13.370  35.065 -81.787  1.00  0.57           C  
ATOM   5234  CD  LYS B 239      14.799  35.390 -81.327  1.00  0.57           C  
ATOM   5235  CE  LYS B 239      15.526  34.213 -80.671  1.00  0.57           C  
ATOM   5236  NZ  LYS B 239      16.904  34.606 -80.328  1.00  0.57           N  
ATOM   5237  N   ARG B 240       9.816  36.442 -81.223  1.00  0.51           N  
ATOM   5238  CA  ARG B 240       8.846  36.134 -80.187  1.00  0.51           C  
ATOM   5239  C   ARG B 240       7.554  35.550 -80.737  1.00  0.51           C  
ATOM   5240  O   ARG B 240       7.059  34.544 -80.233  1.00  0.51           O  
ATOM   5241  CB  ARG B 240       8.494  37.394 -79.359  1.00  0.51           C  
ATOM   5242  CG  ARG B 240       9.632  37.892 -78.447  1.00  0.51           C  
ATOM   5243  CD  ARG B 240       9.238  39.185 -77.726  1.00  0.51           C  
ATOM   5244  NE  ARG B 240      10.387  39.626 -76.872  1.00  0.51           N  
ATOM   5245  CZ  ARG B 240      10.357  40.728 -76.109  1.00  0.51           C  
ATOM   5246  NH1 ARG B 240       9.307  41.544 -76.102  1.00  0.51           N  
ATOM   5247  NH2 ARG B 240      11.407  41.034 -75.351  1.00  0.51           N  
ATOM   5248  N   GLU B 241       7.009  36.135 -81.823  1.00  0.56           N  
ATOM   5249  CA  GLU B 241       5.833  35.634 -82.514  1.00  0.56           C  
ATOM   5250  C   GLU B 241       6.042  34.242 -83.089  1.00  0.56           C  
ATOM   5251  O   GLU B 241       5.189  33.361 -82.979  1.00  0.56           O  
ATOM   5252  CB  GLU B 241       5.429  36.611 -83.638  1.00  0.56           C  
ATOM   5253  CG  GLU B 241       4.894  37.956 -83.088  1.00  0.56           C  
ATOM   5254  CD  GLU B 241       4.663  39.003 -84.174  1.00  0.56           C  
ATOM   5255  OE1 GLU B 241       4.228  40.122 -83.791  1.00  0.56           O  
ATOM   5256  OE2 GLU B 241       4.926  38.721 -85.369  1.00  0.56           O  
ATOM   5257  N   ARG B 242       7.230  33.978 -83.676  1.00  0.48           N  
ATOM   5258  CA  ARG B 242       7.611  32.644 -84.097  1.00  0.48           C  
ATOM   5259  C   ARG B 242       7.690  31.645 -82.954  1.00  0.48           C  
ATOM   5260  O   ARG B 242       7.164  30.541 -83.055  1.00  0.48           O  
ATOM   5261  CB  ARG B 242       8.989  32.684 -84.807  1.00  0.48           C  
ATOM   5262  CG  ARG B 242       9.489  31.319 -85.333  1.00  0.48           C  
ATOM   5263  CD  ARG B 242      10.770  31.401 -86.175  1.00  0.48           C  
ATOM   5264  NE  ARG B 242      11.881  31.836 -85.263  1.00  0.48           N  
ATOM   5265  CZ  ARG B 242      12.978  32.499 -85.657  1.00  0.48           C  
ATOM   5266  NH1 ARG B 242      13.166  32.873 -86.918  1.00  0.48           N  
ATOM   5267  NH2 ARG B 242      13.917  32.791 -84.759  1.00  0.48           N  
ATOM   5268  N   TYR B 243       8.326  32.010 -81.822  1.00  0.53           N  
ATOM   5269  CA  TYR B 243       8.449  31.129 -80.671  1.00  0.53           C  
ATOM   5270  C   TYR B 243       7.106  30.794 -80.051  1.00  0.53           C  
ATOM   5271  O   TYR B 243       6.841  29.635 -79.747  1.00  0.53           O  
ATOM   5272  CB  TYR B 243       9.401  31.712 -79.589  1.00  0.53           C  
ATOM   5273  CG  TYR B 243      10.874  31.545 -79.899  1.00  0.53           C  
ATOM   5274  CD1 TYR B 243      11.393  31.249 -81.179  1.00  0.53           C  
ATOM   5275  CD2 TYR B 243      11.776  31.676 -78.828  1.00  0.53           C  
ATOM   5276  CE1 TYR B 243      12.770  31.083 -81.371  1.00  0.53           C  
ATOM   5277  CE2 TYR B 243      13.153  31.495 -79.016  1.00  0.53           C  
ATOM   5278  CZ  TYR B 243      13.643  31.194 -80.290  1.00  0.53           C  
ATOM   5279  OH  TYR B 243      15.016  30.973 -80.497  1.00  0.53           O  
ATOM   5280  N   ALA B 244       6.199  31.783 -79.924  1.00  0.69           N  
ATOM   5281  CA  ALA B 244       4.846  31.567 -79.453  1.00  0.69           C  
ATOM   5282  C   ALA B 244       4.059  30.581 -80.315  1.00  0.69           C  
ATOM   5283  O   ALA B 244       3.489  29.619 -79.807  1.00  0.69           O  
ATOM   5284  CB  ALA B 244       4.124  32.928 -79.409  1.00  0.69           C  
ATOM   5285  N   ARG B 245       4.116  30.736 -81.657  1.00  0.64           N  
ATOM   5286  CA  ARG B 245       3.518  29.806 -82.601  1.00  0.64           C  
ATOM   5287  C   ARG B 245       4.086  28.391 -82.499  1.00  0.64           C  
ATOM   5288  O   ARG B 245       3.367  27.392 -82.546  1.00  0.64           O  
ATOM   5289  CB  ARG B 245       3.741  30.325 -84.047  1.00  0.64           C  
ATOM   5290  CG  ARG B 245       3.042  29.480 -85.135  1.00  0.64           C  
ATOM   5291  CD  ARG B 245       3.355  29.891 -86.582  1.00  0.64           C  
ATOM   5292  NE  ARG B 245       4.805  29.587 -86.885  1.00  0.64           N  
ATOM   5293  CZ  ARG B 245       5.655  30.433 -87.477  1.00  0.64           C  
ATOM   5294  NH1 ARG B 245       5.319  31.694 -87.751  1.00  0.64           N  
ATOM   5295  NH2 ARG B 245       6.875  30.013 -87.808  1.00  0.64           N  
ATOM   5296  N   LEU B 246       5.419  28.256 -82.336  1.00  0.69           N  
ATOM   5297  CA  LEU B 246       6.054  26.968 -82.131  1.00  0.69           C  
ATOM   5298  C   LEU B 246       5.611  26.285 -80.850  1.00  0.69           C  
ATOM   5299  O   LEU B 246       5.302  25.096 -80.853  1.00  0.69           O  
ATOM   5300  CB  LEU B 246       7.597  27.093 -82.122  1.00  0.69           C  
ATOM   5301  CG  LEU B 246       8.214  27.437 -83.490  1.00  0.69           C  
ATOM   5302  CD1 LEU B 246       9.725  27.671 -83.363  1.00  0.69           C  
ATOM   5303  CD2 LEU B 246       7.941  26.351 -84.533  1.00  0.69           C  
ATOM   5304  N   VAL B 247       5.518  27.028 -79.730  1.00  0.73           N  
ATOM   5305  CA  VAL B 247       5.012  26.517 -78.464  1.00  0.73           C  
ATOM   5306  C   VAL B 247       3.563  26.051 -78.555  1.00  0.73           C  
ATOM   5307  O   VAL B 247       3.222  24.974 -78.062  1.00  0.73           O  
ATOM   5308  CB  VAL B 247       5.171  27.543 -77.350  1.00  0.73           C  
ATOM   5309  CG1 VAL B 247       4.485  27.074 -76.057  1.00  0.73           C  
ATOM   5310  CG2 VAL B 247       6.668  27.760 -77.059  1.00  0.73           C  
ATOM   5311  N   GLU B 248       2.679  26.810 -79.240  1.00  0.72           N  
ATOM   5312  CA  GLU B 248       1.306  26.409 -79.511  1.00  0.72           C  
ATOM   5313  C   GLU B 248       1.209  25.127 -80.315  1.00  0.72           C  
ATOM   5314  O   GLU B 248       0.438  24.225 -79.997  1.00  0.72           O  
ATOM   5315  CB  GLU B 248       0.562  27.510 -80.295  1.00  0.72           C  
ATOM   5316  CG  GLU B 248       0.247  28.760 -79.444  1.00  0.72           C  
ATOM   5317  CD  GLU B 248      -0.413  29.870 -80.260  1.00  0.72           C  
ATOM   5318  OE1 GLU B 248      -0.835  30.864 -79.615  1.00  0.72           O  
ATOM   5319  OE2 GLU B 248      -0.496  29.742 -81.509  1.00  0.72           O  
ATOM   5320  N   ARG B 249       2.046  24.979 -81.359  1.00  0.69           N  
ATOM   5321  CA  ARG B 249       2.129  23.756 -82.130  1.00  0.69           C  
ATOM   5322  C   ARG B 249       2.572  22.556 -81.311  1.00  0.69           C  
ATOM   5323  O   ARG B 249       1.978  21.484 -81.384  1.00  0.69           O  
ATOM   5324  CB  ARG B 249       3.101  23.963 -83.306  1.00  0.69           C  
ATOM   5325  CG  ARG B 249       3.105  22.805 -84.318  1.00  0.69           C  
ATOM   5326  CD  ARG B 249       3.901  23.153 -85.571  1.00  0.69           C  
ATOM   5327  NE  ARG B 249       3.833  21.965 -86.470  1.00  0.69           N  
ATOM   5328  CZ  ARG B 249       4.172  22.023 -87.765  1.00  0.69           C  
ATOM   5329  NH1 ARG B 249       4.605  23.149 -88.332  1.00  0.69           N  
ATOM   5330  NH2 ARG B 249       4.046  20.939 -88.522  1.00  0.69           N  
ATOM   5331  N   CYS B 250       3.595  22.728 -80.456  1.00  0.72           N  
ATOM   5332  CA  CYS B 250       4.034  21.707 -79.526  1.00  0.72           C  
ATOM   5333  C   CYS B 250       2.979  21.290 -78.518  1.00  0.72           C  
ATOM   5334  O   CYS B 250       2.820  20.110 -78.233  1.00  0.72           O  
ATOM   5335  CB  CYS B 250       5.267  22.174 -78.739  1.00  0.72           C  
ATOM   5336  SG  CYS B 250       6.714  22.442 -79.806  1.00  0.72           S  
ATOM   5337  N   LEU B 251       2.200  22.245 -77.973  1.00  0.72           N  
ATOM   5338  CA  LEU B 251       1.055  21.955 -77.126  1.00  0.72           C  
ATOM   5339  C   LEU B 251      -0.026  21.154 -77.839  1.00  0.72           C  
ATOM   5340  O   LEU B 251      -0.607  20.239 -77.267  1.00  0.72           O  
ATOM   5341  CB  LEU B 251       0.424  23.267 -76.598  1.00  0.72           C  
ATOM   5342  CG  LEU B 251       1.188  23.930 -75.438  1.00  0.72           C  
ATOM   5343  CD1 LEU B 251       0.703  25.373 -75.248  1.00  0.72           C  
ATOM   5344  CD2 LEU B 251       1.012  23.145 -74.130  1.00  0.72           C  
ATOM   5345  N   THR B 252      -0.322  21.464 -79.115  1.00  0.72           N  
ATOM   5346  CA  THR B 252      -1.239  20.675 -79.936  1.00  0.72           C  
ATOM   5347  C   THR B 252      -0.745  19.262 -80.188  1.00  0.72           C  
ATOM   5348  O   THR B 252      -1.492  18.296 -80.054  1.00  0.72           O  
ATOM   5349  CB  THR B 252      -1.495  21.338 -81.285  1.00  0.72           C  
ATOM   5350  OG1 THR B 252      -2.085  22.611 -81.069  1.00  0.72           O  
ATOM   5351  CG2 THR B 252      -2.491  20.550 -82.150  1.00  0.72           C  
ATOM   5352  N   GLU B 253       0.542  19.100 -80.553  1.00  0.69           N  
ATOM   5353  CA  GLU B 253       1.145  17.806 -80.816  1.00  0.69           C  
ATOM   5354  C   GLU B 253       1.356  16.953 -79.563  1.00  0.69           C  
ATOM   5355  O   GLU B 253       1.076  15.755 -79.562  1.00  0.69           O  
ATOM   5356  CB  GLU B 253       2.461  17.994 -81.625  1.00  0.69           C  
ATOM   5357  CG  GLU B 253       2.200  18.563 -83.055  1.00  0.69           C  
ATOM   5358  CD  GLU B 253       3.437  18.886 -83.889  1.00  0.69           C  
ATOM   5359  OE1 GLU B 253       3.294  19.523 -84.975  1.00  0.69           O  
ATOM   5360  OE2 GLU B 253       4.578  18.531 -83.503  1.00  0.69           O  
ATOM   5361  N   GLU B 254       1.820  17.550 -78.447  1.00  0.61           N  
ATOM   5362  CA  GLU B 254       2.088  16.846 -77.202  1.00  0.61           C  
ATOM   5363  C   GLU B 254       1.350  17.475 -76.001  1.00  0.61           C  
ATOM   5364  O   GLU B 254       2.001  18.035 -75.114  1.00  0.61           O  
ATOM   5365  CB  GLU B 254       3.615  16.816 -76.892  1.00  0.61           C  
ATOM   5366  CG  GLU B 254       4.511  16.018 -77.889  1.00  0.61           C  
ATOM   5367  CD  GLU B 254       5.956  15.856 -77.399  1.00  0.61           C  
ATOM   5368  OE1 GLU B 254       6.628  14.837 -77.735  1.00  0.61           O  
ATOM   5369  OE2 GLU B 254       6.417  16.762 -76.653  1.00  0.61           O  
ATOM   5370  N   PRO B 255       0.017  17.408 -75.859  1.00  0.70           N  
ATOM   5371  CA  PRO B 255      -0.736  18.201 -74.877  1.00  0.70           C  
ATOM   5372  C   PRO B 255      -0.517  17.767 -73.446  1.00  0.70           C  
ATOM   5373  O   PRO B 255      -0.757  18.549 -72.525  1.00  0.70           O  
ATOM   5374  CB  PRO B 255      -2.208  17.994 -75.285  1.00  0.70           C  
ATOM   5375  CG  PRO B 255      -2.213  16.666 -76.050  1.00  0.70           C  
ATOM   5376  CD  PRO B 255      -0.874  16.704 -76.783  1.00  0.70           C  
ATOM   5377  N   SER B 256      -0.086  16.517 -73.233  1.00  0.61           N  
ATOM   5378  CA  SER B 256       0.164  15.945 -71.926  1.00  0.61           C  
ATOM   5379  C   SER B 256       1.616  16.087 -71.525  1.00  0.61           C  
ATOM   5380  O   SER B 256       2.010  15.642 -70.453  1.00  0.61           O  
ATOM   5381  CB  SER B 256      -0.164  14.431 -71.923  1.00  0.61           C  
ATOM   5382  OG  SER B 256       0.419  13.793 -73.066  1.00  0.61           O  
ATOM   5383  N   ASN B 257       2.456  16.744 -72.349  1.00  0.56           N  
ATOM   5384  CA  ASN B 257       3.836  16.994 -71.992  1.00  0.56           C  
ATOM   5385  C   ASN B 257       3.935  18.295 -71.175  1.00  0.56           C  
ATOM   5386  O   ASN B 257       3.674  19.378 -71.712  1.00  0.56           O  
ATOM   5387  CB  ASN B 257       4.699  17.050 -73.277  1.00  0.56           C  
ATOM   5388  CG  ASN B 257       6.193  17.108 -72.984  1.00  0.56           C  
ATOM   5389  OD1 ASN B 257       6.633  17.368 -71.863  1.00  0.56           O  
ATOM   5390  ND2 ASN B 257       7.020  16.867 -74.021  1.00  0.56           N  
ATOM   5391  N   PRO B 258       4.321  18.287 -69.895  1.00  0.59           N  
ATOM   5392  CA  PRO B 258       4.263  19.477 -69.051  1.00  0.59           C  
ATOM   5393  C   PRO B 258       5.324  20.498 -69.412  1.00  0.59           C  
ATOM   5394  O   PRO B 258       5.196  21.663 -69.027  1.00  0.59           O  
ATOM   5395  CB  PRO B 258       4.457  18.931 -67.634  1.00  0.59           C  
ATOM   5396  CG  PRO B 258       5.215  17.614 -67.820  1.00  0.59           C  
ATOM   5397  CD  PRO B 258       4.660  17.081 -69.130  1.00  0.59           C  
ATOM   5398  N   LYS B 259       6.358  20.097 -70.180  1.00  0.54           N  
ATOM   5399  CA  LYS B 259       7.423  20.946 -70.675  1.00  0.54           C  
ATOM   5400  C   LYS B 259       6.893  22.116 -71.505  1.00  0.54           C  
ATOM   5401  O   LYS B 259       7.317  23.262 -71.357  1.00  0.54           O  
ATOM   5402  CB  LYS B 259       8.389  20.059 -71.521  1.00  0.54           C  
ATOM   5403  CG  LYS B 259       9.556  20.792 -72.206  1.00  0.54           C  
ATOM   5404  CD  LYS B 259      10.495  19.886 -73.045  1.00  0.54           C  
ATOM   5405  CE  LYS B 259      11.570  20.706 -73.783  1.00  0.54           C  
ATOM   5406  NZ  LYS B 259      12.635  19.927 -74.422  1.00  0.54           N  
ATOM   5407  N   TRP B 260       5.907  21.866 -72.386  1.00  0.63           N  
ATOM   5408  CA  TRP B 260       5.338  22.886 -73.247  1.00  0.63           C  
ATOM   5409  C   TRP B 260       4.433  23.875 -72.541  1.00  0.63           C  
ATOM   5410  O   TRP B 260       4.402  25.056 -72.880  1.00  0.63           O  
ATOM   5411  CB  TRP B 260       4.624  22.245 -74.451  1.00  0.63           C  
ATOM   5412  CG  TRP B 260       5.526  21.314 -75.236  1.00  0.63           C  
ATOM   5413  CD1 TRP B 260       5.331  19.995 -75.529  1.00  0.63           C  
ATOM   5414  CD2 TRP B 260       6.767  21.689 -75.864  1.00  0.63           C  
ATOM   5415  NE1 TRP B 260       6.382  19.504 -76.269  1.00  0.63           N  
ATOM   5416  CE2 TRP B 260       7.259  20.533 -76.510  1.00  0.63           C  
ATOM   5417  CE3 TRP B 260       7.438  22.910 -75.960  1.00  0.63           C  
ATOM   5418  CZ2 TRP B 260       8.407  20.586 -77.279  1.00  0.63           C  
ATOM   5419  CZ3 TRP B 260       8.613  22.954 -76.725  1.00  0.63           C  
ATOM   5420  CH2 TRP B 260       9.080  21.807 -77.384  1.00  0.63           C  
ATOM   5421  N   HIS B 261       3.706  23.437 -71.496  1.00  0.63           N  
ATOM   5422  CA  HIS B 261       2.935  24.326 -70.639  1.00  0.63           C  
ATOM   5423  C   HIS B 261       3.809  25.309 -69.881  1.00  0.63           C  
ATOM   5424  O   HIS B 261       3.476  26.486 -69.766  1.00  0.63           O  
ATOM   5425  CB  HIS B 261       2.091  23.533 -69.634  1.00  0.63           C  
ATOM   5426  CG  HIS B 261       1.046  22.692 -70.300  1.00  0.63           C  
ATOM   5427  ND1 HIS B 261      -0.159  23.263 -70.671  1.00  0.63           N  
ATOM   5428  CD2 HIS B 261       1.060  21.369 -70.609  1.00  0.63           C  
ATOM   5429  CE1 HIS B 261      -0.857  22.262 -71.187  1.00  0.63           C  
ATOM   5430  NE2 HIS B 261      -0.163  21.099 -71.177  1.00  0.63           N  
ATOM   5431  N   PHE B 262       4.987  24.856 -69.394  1.00  0.59           N  
ATOM   5432  CA  PHE B 262       6.006  25.734 -68.842  1.00  0.59           C  
ATOM   5433  C   PHE B 262       6.485  26.783 -69.844  1.00  0.59           C  
ATOM   5434  O   PHE B 262       6.518  27.975 -69.540  1.00  0.59           O  
ATOM   5435  CB  PHE B 262       7.197  24.865 -68.328  1.00  0.59           C  
ATOM   5436  CG  PHE B 262       8.413  25.681 -67.970  1.00  0.59           C  
ATOM   5437  CD1 PHE B 262       9.460  25.830 -68.896  1.00  0.59           C  
ATOM   5438  CD2 PHE B 262       8.470  26.379 -66.760  1.00  0.59           C  
ATOM   5439  CE1 PHE B 262      10.556  26.649 -68.604  1.00  0.59           C  
ATOM   5440  CE2 PHE B 262       9.574  27.185 -66.456  1.00  0.59           C  
ATOM   5441  CZ  PHE B 262      10.619  27.318 -67.378  1.00  0.59           C  
ATOM   5442  N   TYR B 263       6.835  26.378 -71.080  1.00  0.61           N  
ATOM   5443  CA  TYR B 263       7.293  27.311 -72.089  1.00  0.61           C  
ATOM   5444  C   TYR B 263       6.231  28.296 -72.531  1.00  0.61           C  
ATOM   5445  O   TYR B 263       6.515  29.469 -72.737  1.00  0.61           O  
ATOM   5446  CB  TYR B 263       7.897  26.571 -73.308  1.00  0.61           C  
ATOM   5447  CG  TYR B 263       9.222  25.944 -72.950  1.00  0.61           C  
ATOM   5448  CD1 TYR B 263      10.235  26.716 -72.353  1.00  0.61           C  
ATOM   5449  CD2 TYR B 263       9.495  24.597 -73.237  1.00  0.61           C  
ATOM   5450  CE1 TYR B 263      11.474  26.145 -72.031  1.00  0.61           C  
ATOM   5451  CE2 TYR B 263      10.746  24.049 -72.920  1.00  0.61           C  
ATOM   5452  CZ  TYR B 263      11.736  24.811 -72.308  1.00  0.61           C  
ATOM   5453  OH  TYR B 263      13.007  24.293 -71.967  1.00  0.61           O  
ATOM   5454  N   ALA B 264       4.960  27.868 -72.622  1.00  0.67           N  
ATOM   5455  CA  ALA B 264       3.849  28.745 -72.928  1.00  0.67           C  
ATOM   5456  C   ALA B 264       3.666  29.885 -71.940  1.00  0.67           C  
ATOM   5457  O   ALA B 264       3.397  31.022 -72.322  1.00  0.67           O  
ATOM   5458  CB  ALA B 264       2.563  27.904 -72.990  1.00  0.67           C  
ATOM   5459  N   VAL B 265       3.826  29.607 -70.633  1.00  0.65           N  
ATOM   5460  CA  VAL B 265       3.853  30.654 -69.630  1.00  0.65           C  
ATOM   5461  C   VAL B 265       5.140  31.471 -69.676  1.00  0.65           C  
ATOM   5462  O   VAL B 265       5.090  32.695 -69.735  1.00  0.65           O  
ATOM   5463  CB  VAL B 265       3.629  30.081 -68.235  1.00  0.65           C  
ATOM   5464  CG1 VAL B 265       3.628  31.202 -67.177  1.00  0.65           C  
ATOM   5465  CG2 VAL B 265       2.271  29.348 -68.198  1.00  0.65           C  
ATOM   5466  N   ARG B 266       6.333  30.833 -69.707  1.00  0.59           N  
ATOM   5467  CA  ARG B 266       7.609  31.536 -69.655  1.00  0.59           C  
ATOM   5468  C   ARG B 266       7.847  32.457 -70.842  1.00  0.59           C  
ATOM   5469  O   ARG B 266       8.241  33.612 -70.686  1.00  0.59           O  
ATOM   5470  CB  ARG B 266       8.790  30.528 -69.575  1.00  0.59           C  
ATOM   5471  CG  ARG B 266      10.171  31.182 -69.313  1.00  0.59           C  
ATOM   5472  CD  ARG B 266      11.383  30.336 -69.707  1.00  0.59           C  
ATOM   5473  NE  ARG B 266      11.418  30.290 -71.189  1.00  0.59           N  
ATOM   5474  CZ  ARG B 266      12.290  29.592 -71.913  1.00  0.59           C  
ATOM   5475  NH1 ARG B 266      13.322  28.935 -71.408  1.00  0.59           N  
ATOM   5476  NH2 ARG B 266      12.059  29.485 -73.208  1.00  0.59           N  
ATOM   5477  N   ASP B 267       7.573  31.982 -72.070  1.00  0.64           N  
ATOM   5478  CA  ASP B 267       7.902  32.710 -73.278  1.00  0.64           C  
ATOM   5479  C   ASP B 267       6.890  33.822 -73.530  1.00  0.64           C  
ATOM   5480  O   ASP B 267       7.185  34.825 -74.179  1.00  0.64           O  
ATOM   5481  CB  ASP B 267       8.033  31.733 -74.486  1.00  0.64           C  
ATOM   5482  CG  ASP B 267       9.251  30.839 -74.317  1.00  0.64           C  
ATOM   5483  OD1 ASP B 267       9.973  31.020 -73.302  1.00  0.64           O  
ATOM   5484  OD2 ASP B 267       9.539  29.955 -75.164  1.00  0.64           O  
ATOM   5485  N   GLY B 268       5.688  33.725 -72.915  1.00  0.65           N  
ATOM   5486  CA  GLY B 268       4.705  34.800 -72.910  1.00  0.65           C  
ATOM   5487  C   GLY B 268       5.004  35.903 -71.932  1.00  0.65           C  
ATOM   5488  O   GLY B 268       4.327  36.931 -71.938  1.00  0.65           O  
ATOM   5489  N   LEU B 269       6.030  35.735 -71.077  1.00  0.55           N  
ATOM   5490  CA  LEU B 269       6.450  36.739 -70.120  1.00  0.55           C  
ATOM   5491  C   LEU B 269       7.770  37.389 -70.509  1.00  0.55           C  
ATOM   5492  O   LEU B 269       8.222  38.328 -69.859  1.00  0.55           O  
ATOM   5493  CB  LEU B 269       6.615  36.098 -68.720  1.00  0.55           C  
ATOM   5494  CG  LEU B 269       5.300  35.580 -68.101  1.00  0.55           C  
ATOM   5495  CD1 LEU B 269       5.586  34.846 -66.783  1.00  0.55           C  
ATOM   5496  CD2 LEU B 269       4.271  36.701 -67.901  1.00  0.55           C  
ATOM   5497  N   VAL B 270       8.430  36.955 -71.604  1.00  0.47           N  
ATOM   5498  CA  VAL B 270       9.722  37.509 -72.001  1.00  0.47           C  
ATOM   5499  C   VAL B 270       9.661  38.994 -72.358  1.00  0.47           C  
ATOM   5500  O   VAL B 270       9.071  39.422 -73.351  1.00  0.47           O  
ATOM   5501  CB  VAL B 270      10.401  36.707 -73.113  1.00  0.47           C  
ATOM   5502  CG1 VAL B 270      11.699  37.387 -73.607  1.00  0.47           C  
ATOM   5503  CG2 VAL B 270      10.750  35.309 -72.567  1.00  0.47           C  
ATOM   5504  N   GLY B 271      10.315  39.841 -71.532  1.00  0.34           N  
ATOM   5505  CA  GLY B 271      10.334  41.283 -71.728  1.00  0.34           C  
ATOM   5506  C   GLY B 271       9.171  42.022 -71.136  1.00  0.34           C  
ATOM   5507  O   GLY B 271       8.953  43.178 -71.483  1.00  0.34           O  
ATOM   5508  N   ARG B 272       8.396  41.396 -70.234  1.00  0.31           N  
ATOM   5509  CA  ARG B 272       7.311  42.085 -69.570  1.00  0.31           C  
ATOM   5510  C   ARG B 272       7.044  41.477 -68.208  1.00  0.31           C  
ATOM   5511  O   ARG B 272       7.565  40.425 -67.854  1.00  0.31           O  
ATOM   5512  CB  ARG B 272       6.012  42.095 -70.423  1.00  0.31           C  
ATOM   5513  CG  ARG B 272       5.351  40.716 -70.626  1.00  0.31           C  
ATOM   5514  CD  ARG B 272       4.097  40.785 -71.500  1.00  0.31           C  
ATOM   5515  NE  ARG B 272       3.403  39.468 -71.378  1.00  0.31           N  
ATOM   5516  CZ  ARG B 272       2.287  39.238 -70.674  1.00  0.31           C  
ATOM   5517  NH1 ARG B 272       1.692  40.161 -69.927  1.00  0.31           N  
ATOM   5518  NH2 ARG B 272       1.762  38.023 -70.717  1.00  0.31           N  
ATOM   5519  N   LYS B 273       6.227  42.152 -67.382  1.00  0.38           N  
ATOM   5520  CA  LYS B 273       5.782  41.612 -66.112  1.00  0.38           C  
ATOM   5521  C   LYS B 273       4.261  41.556 -66.138  1.00  0.38           C  
ATOM   5522  O   LYS B 273       3.646  42.515 -66.606  1.00  0.38           O  
ATOM   5523  CB  LYS B 273       6.274  42.448 -64.903  1.00  0.38           C  
ATOM   5524  CG  LYS B 273       7.780  42.269 -64.646  1.00  0.38           C  
ATOM   5525  CD  LYS B 273       8.276  43.028 -63.402  1.00  0.38           C  
ATOM   5526  CE  LYS B 273       9.772  42.815 -63.134  1.00  0.38           C  
ATOM   5527  NZ  LYS B 273      10.196  43.561 -61.926  1.00  0.38           N  
ATOM   5528  N   PRO B 274       3.608  40.477 -65.714  1.00  0.51           N  
ATOM   5529  CA  PRO B 274       2.158  40.403 -65.703  1.00  0.51           C  
ATOM   5530  C   PRO B 274       1.578  41.161 -64.522  1.00  0.51           C  
ATOM   5531  O   PRO B 274       2.214  41.255 -63.472  1.00  0.51           O  
ATOM   5532  CB  PRO B 274       1.900  38.893 -65.593  1.00  0.51           C  
ATOM   5533  CG  PRO B 274       3.065  38.352 -64.758  1.00  0.51           C  
ATOM   5534  CD  PRO B 274       4.224  39.297 -65.094  1.00  0.51           C  
ATOM   5535  N   GLY B 275       0.369  41.746 -64.666  1.00  0.55           N  
ATOM   5536  CA  GLY B 275      -0.362  42.278 -63.515  1.00  0.55           C  
ATOM   5537  C   GLY B 275      -0.861  41.201 -62.565  1.00  0.55           C  
ATOM   5538  O   GLY B 275      -0.864  40.030 -62.946  1.00  0.55           O  
ATOM   5539  N   PRO B 276      -1.331  41.522 -61.355  1.00  0.57           N  
ATOM   5540  CA  PRO B 276      -1.724  40.533 -60.346  1.00  0.57           C  
ATOM   5541  C   PRO B 276      -2.702  39.462 -60.805  1.00  0.57           C  
ATOM   5542  O   PRO B 276      -2.439  38.276 -60.613  1.00  0.57           O  
ATOM   5543  CB  PRO B 276      -2.264  41.378 -59.182  1.00  0.57           C  
ATOM   5544  CG  PRO B 276      -1.472  42.685 -59.285  1.00  0.57           C  
ATOM   5545  CD  PRO B 276      -1.297  42.879 -60.795  1.00  0.57           C  
ATOM   5546  N   ASP B 277      -3.815  39.853 -61.451  1.00  0.57           N  
ATOM   5547  CA  ASP B 277      -4.824  38.952 -61.973  1.00  0.57           C  
ATOM   5548  C   ASP B 277      -4.288  38.009 -63.045  1.00  0.57           C  
ATOM   5549  O   ASP B 277      -4.551  36.805 -63.046  1.00  0.57           O  
ATOM   5550  CB  ASP B 277      -5.974  39.791 -62.577  1.00  0.57           C  
ATOM   5551  CG  ASP B 277      -6.602  40.676 -61.515  1.00  0.57           C  
ATOM   5552  OD1 ASP B 277      -6.616  40.270 -60.328  1.00  0.57           O  
ATOM   5553  OD2 ASP B 277      -7.037  41.790 -61.894  1.00  0.57           O  
ATOM   5554  N   GLU B 278      -3.463  38.542 -63.973  1.00  0.52           N  
ATOM   5555  CA  GLU B 278      -2.789  37.753 -64.986  1.00  0.52           C  
ATOM   5556  C   GLU B 278      -1.805  36.761 -64.382  1.00  0.52           C  
ATOM   5557  O   GLU B 278      -1.780  35.584 -64.741  1.00  0.52           O  
ATOM   5558  CB  GLU B 278      -2.060  38.650 -66.015  1.00  0.52           C  
ATOM   5559  CG  GLU B 278      -1.487  37.837 -67.202  1.00  0.52           C  
ATOM   5560  CD  GLU B 278      -0.677  38.645 -68.203  1.00  0.52           C  
ATOM   5561  OE1 GLU B 278      -0.393  38.074 -69.286  1.00  0.52           O  
ATOM   5562  OE2 GLU B 278      -0.263  39.802 -67.935  1.00  0.52           O  
ATOM   5563  N   ALA B 279      -1.013  37.197 -63.381  1.00  0.57           N  
ATOM   5564  CA  ALA B 279      -0.093  36.350 -62.654  1.00  0.57           C  
ATOM   5565  C   ALA B 279      -0.783  35.188 -61.942  1.00  0.57           C  
ATOM   5566  O   ALA B 279      -0.330  34.046 -62.009  1.00  0.57           O  
ATOM   5567  CB  ALA B 279       0.694  37.211 -61.646  1.00  0.57           C  
ATOM   5568  N   LEU B 280      -1.939  35.442 -61.294  1.00  0.53           N  
ATOM   5569  CA  LEU B 280      -2.768  34.414 -60.690  1.00  0.53           C  
ATOM   5570  C   LEU B 280      -3.336  33.418 -61.692  1.00  0.53           C  
ATOM   5571  O   LEU B 280      -3.323  32.205 -61.475  1.00  0.53           O  
ATOM   5572  CB  LEU B 280      -3.918  35.079 -59.896  1.00  0.53           C  
ATOM   5573  CG  LEU B 280      -4.875  34.116 -59.159  1.00  0.53           C  
ATOM   5574  CD1 LEU B 280      -4.138  33.241 -58.134  1.00  0.53           C  
ATOM   5575  CD2 LEU B 280      -5.977  34.922 -58.459  1.00  0.53           C  
ATOM   5576  N   ALA B 281      -3.830  33.896 -62.849  1.00  0.60           N  
ATOM   5577  CA  ALA B 281      -4.316  33.040 -63.911  1.00  0.60           C  
ATOM   5578  C   ALA B 281      -3.242  32.133 -64.508  1.00  0.60           C  
ATOM   5579  O   ALA B 281      -3.443  30.929 -64.682  1.00  0.60           O  
ATOM   5580  CB  ALA B 281      -4.940  33.922 -65.007  1.00  0.60           C  
ATOM   5581  N   LEU B 282      -2.043  32.686 -64.772  1.00  0.62           N  
ATOM   5582  CA  LEU B 282      -0.886  31.931 -65.213  1.00  0.62           C  
ATOM   5583  C   LEU B 282      -0.407  30.921 -64.185  1.00  0.62           C  
ATOM   5584  O   LEU B 282      -0.081  29.785 -64.527  1.00  0.62           O  
ATOM   5585  CB  LEU B 282       0.275  32.884 -65.573  1.00  0.62           C  
ATOM   5586  CG  LEU B 282       0.015  33.747 -66.824  1.00  0.62           C  
ATOM   5587  CD1 LEU B 282       1.118  34.801 -66.974  1.00  0.62           C  
ATOM   5588  CD2 LEU B 282      -0.089  32.908 -68.108  1.00  0.62           C  
ATOM   5589  N   PHE B 283      -0.399  31.294 -62.889  1.00  0.50           N  
ATOM   5590  CA  PHE B 283      -0.065  30.408 -61.790  1.00  0.50           C  
ATOM   5591  C   PHE B 283      -0.976  29.193 -61.712  1.00  0.50           C  
ATOM   5592  O   PHE B 283      -0.504  28.065 -61.598  1.00  0.50           O  
ATOM   5593  CB  PHE B 283      -0.151  31.219 -60.466  1.00  0.50           C  
ATOM   5594  CG  PHE B 283       0.047  30.381 -59.237  1.00  0.50           C  
ATOM   5595  CD1 PHE B 283      -1.052  29.803 -58.575  1.00  0.50           C  
ATOM   5596  CD2 PHE B 283       1.337  30.124 -58.771  1.00  0.50           C  
ATOM   5597  CE1 PHE B 283      -0.855  28.922 -57.505  1.00  0.50           C  
ATOM   5598  CE2 PHE B 283       1.535  29.276 -57.681  1.00  0.50           C  
ATOM   5599  CZ  PHE B 283       0.446  28.640 -57.071  1.00  0.50           C  
ATOM   5600  N   ARG B 284      -2.306  29.386 -61.804  1.00  0.56           N  
ATOM   5601  CA  ARG B 284      -3.260  28.294 -61.761  1.00  0.56           C  
ATOM   5602  C   ARG B 284      -3.089  27.325 -62.915  1.00  0.56           C  
ATOM   5603  O   ARG B 284      -3.053  26.114 -62.716  1.00  0.56           O  
ATOM   5604  CB  ARG B 284      -4.700  28.848 -61.780  1.00  0.56           C  
ATOM   5605  CG  ARG B 284      -5.110  29.523 -60.457  1.00  0.56           C  
ATOM   5606  CD  ARG B 284      -6.508  30.137 -60.553  1.00  0.56           C  
ATOM   5607  NE  ARG B 284      -6.854  30.712 -59.213  1.00  0.56           N  
ATOM   5608  CZ  ARG B 284      -7.855  31.579 -59.008  1.00  0.56           C  
ATOM   5609  NH1 ARG B 284      -8.586  32.050 -60.014  1.00  0.56           N  
ATOM   5610  NH2 ARG B 284      -8.133  31.980 -57.770  1.00  0.56           N  
ATOM   5611  N   ARG B 285      -2.901  27.858 -64.139  1.00  0.62           N  
ATOM   5612  CA  ARG B 285      -2.625  27.066 -65.322  1.00  0.62           C  
ATOM   5613  C   ARG B 285      -1.336  26.264 -65.209  1.00  0.62           C  
ATOM   5614  O   ARG B 285      -1.275  25.078 -65.530  1.00  0.62           O  
ATOM   5615  CB  ARG B 285      -2.509  28.021 -66.537  1.00  0.62           C  
ATOM   5616  CG  ARG B 285      -2.233  27.316 -67.881  1.00  0.62           C  
ATOM   5617  CD  ARG B 285      -2.101  28.302 -69.042  1.00  0.62           C  
ATOM   5618  NE  ARG B 285      -1.731  27.504 -70.254  1.00  0.62           N  
ATOM   5619  CZ  ARG B 285      -1.514  28.031 -71.466  1.00  0.62           C  
ATOM   5620  NH1 ARG B 285      -1.618  29.338 -71.689  1.00  0.62           N  
ATOM   5621  NH2 ARG B 285      -1.190  27.227 -72.476  1.00  0.62           N  
ATOM   5622  N   LEU B 286      -0.253  26.897 -64.716  1.00  0.59           N  
ATOM   5623  CA  LEU B 286       1.004  26.222 -64.488  1.00  0.59           C  
ATOM   5624  C   LEU B 286       0.923  25.181 -63.382  1.00  0.59           C  
ATOM   5625  O   LEU B 286       1.473  24.092 -63.505  1.00  0.59           O  
ATOM   5626  CB  LEU B 286       2.132  27.247 -64.230  1.00  0.59           C  
ATOM   5627  CG  LEU B 286       3.562  26.689 -64.386  1.00  0.59           C  
ATOM   5628  CD1 LEU B 286       3.826  26.119 -65.789  1.00  0.59           C  
ATOM   5629  CD2 LEU B 286       4.594  27.785 -64.091  1.00  0.59           C  
ATOM   5630  N   ARG B 287       0.189  25.459 -62.284  1.00  0.49           N  
ATOM   5631  CA  ARG B 287      -0.067  24.508 -61.217  1.00  0.49           C  
ATOM   5632  C   ARG B 287      -0.829  23.274 -61.679  1.00  0.49           C  
ATOM   5633  O   ARG B 287      -0.463  22.154 -61.324  1.00  0.49           O  
ATOM   5634  CB  ARG B 287      -0.838  25.179 -60.043  1.00  0.49           C  
ATOM   5635  CG  ARG B 287      -0.966  24.323 -58.757  1.00  0.49           C  
ATOM   5636  CD  ARG B 287       0.388  24.060 -58.083  1.00  0.49           C  
ATOM   5637  NE  ARG B 287       0.197  23.135 -56.912  1.00  0.49           N  
ATOM   5638  CZ  ARG B 287       1.208  22.469 -56.331  1.00  0.49           C  
ATOM   5639  NH1 ARG B 287       2.453  22.587 -56.786  1.00  0.49           N  
ATOM   5640  NH2 ARG B 287       0.973  21.673 -55.288  1.00  0.49           N  
ATOM   5641  N   GLU B 288      -1.878  23.447 -62.512  1.00  0.60           N  
ATOM   5642  CA  GLU B 288      -2.617  22.356 -63.125  1.00  0.60           C  
ATOM   5643  C   GLU B 288      -1.758  21.511 -64.052  1.00  0.60           C  
ATOM   5644  O   GLU B 288      -1.689  20.290 -63.937  1.00  0.60           O  
ATOM   5645  CB  GLU B 288      -3.809  22.937 -63.915  1.00  0.60           C  
ATOM   5646  CG  GLU B 288      -4.770  21.880 -64.513  1.00  0.60           C  
ATOM   5647  CD  GLU B 288      -5.944  22.526 -65.249  1.00  0.60           C  
ATOM   5648  OE1 GLU B 288      -6.848  21.756 -65.661  1.00  0.60           O  
ATOM   5649  OE2 GLU B 288      -5.947  23.774 -65.408  1.00  0.60           O  
ATOM   5650  N   ALA B 289      -0.976  22.160 -64.937  1.00  0.64           N  
ATOM   5651  CA  ALA B 289      -0.034  21.488 -65.805  1.00  0.64           C  
ATOM   5652  C   ALA B 289       1.089  20.784 -65.058  1.00  0.64           C  
ATOM   5653  O   ALA B 289       1.613  19.760 -65.487  1.00  0.64           O  
ATOM   5654  CB  ALA B 289       0.564  22.507 -66.781  1.00  0.64           C  
ATOM   5655  N   HIS B 290       1.478  21.303 -63.882  1.00  0.47           N  
ATOM   5656  CA  HIS B 290       2.494  20.709 -63.043  1.00  0.47           C  
ATOM   5657  C   HIS B 290       2.066  19.383 -62.434  1.00  0.47           C  
ATOM   5658  O   HIS B 290       2.903  18.566 -62.067  1.00  0.47           O  
ATOM   5659  CB  HIS B 290       2.905  21.674 -61.913  1.00  0.47           C  
ATOM   5660  CG  HIS B 290       4.211  21.306 -61.292  1.00  0.47           C  
ATOM   5661  ND1 HIS B 290       5.370  21.855 -61.806  1.00  0.47           N  
ATOM   5662  CD2 HIS B 290       4.504  20.382 -60.344  1.00  0.47           C  
ATOM   5663  CE1 HIS B 290       6.348  21.251 -61.161  1.00  0.47           C  
ATOM   5664  NE2 HIS B 290       5.879  20.348 -60.270  1.00  0.47           N  
ATOM   5665  N   ALA B 291       0.749  19.097 -62.368  1.00  0.48           N  
ATOM   5666  CA  ALA B 291       0.242  17.820 -61.902  1.00  0.48           C  
ATOM   5667  C   ALA B 291       0.528  16.689 -62.886  1.00  0.48           C  
ATOM   5668  O   ALA B 291       0.577  15.519 -62.520  1.00  0.48           O  
ATOM   5669  CB  ALA B 291      -1.274  17.934 -61.658  1.00  0.48           C  
ATOM   5670  N   LEU B 292       0.835  17.026 -64.157  1.00  0.36           N  
ATOM   5671  CA  LEU B 292       1.267  16.068 -65.158  1.00  0.36           C  
ATOM   5672  C   LEU B 292       2.662  15.516 -64.859  1.00  0.36           C  
ATOM   5673  O   LEU B 292       3.064  14.489 -65.393  1.00  0.36           O  
ATOM   5674  CB  LEU B 292       1.311  16.717 -66.563  1.00  0.36           C  
ATOM   5675  CG  LEU B 292      -0.026  17.272 -67.095  1.00  0.36           C  
ATOM   5676  CD1 LEU B 292       0.235  18.168 -68.317  1.00  0.36           C  
ATOM   5677  CD2 LEU B 292      -1.002  16.148 -67.463  1.00  0.36           C  
ATOM   5678  N   TYR B 293       3.444  16.154 -63.951  1.00  0.33           N  
ATOM   5679  CA  TYR B 293       4.712  15.606 -63.496  1.00  0.33           C  
ATOM   5680  C   TYR B 293       4.528  14.443 -62.536  1.00  0.33           C  
ATOM   5681  O   TYR B 293       5.461  13.678 -62.300  1.00  0.33           O  
ATOM   5682  CB  TYR B 293       5.619  16.666 -62.816  1.00  0.33           C  
ATOM   5683  CG  TYR B 293       6.189  17.630 -63.823  1.00  0.33           C  
ATOM   5684  CD1 TYR B 293       7.130  17.201 -64.777  1.00  0.33           C  
ATOM   5685  CD2 TYR B 293       5.836  18.986 -63.790  1.00  0.33           C  
ATOM   5686  CE1 TYR B 293       7.684  18.113 -65.688  1.00  0.33           C  
ATOM   5687  CE2 TYR B 293       6.377  19.897 -64.709  1.00  0.33           C  
ATOM   5688  CZ  TYR B 293       7.291  19.452 -65.669  1.00  0.33           C  
ATOM   5689  OH  TYR B 293       7.808  20.347 -66.624  1.00  0.33           O  
ATOM   5690  N   ASP B 294       3.307  14.273 -61.996  1.00  0.36           N  
ATOM   5691  CA  ASP B 294       2.991  13.233 -61.053  1.00  0.36           C  
ATOM   5692  C   ASP B 294       2.348  12.030 -61.791  1.00  0.36           C  
ATOM   5693  O   ASP B 294       2.037  11.000 -61.192  1.00  0.36           O  
ATOM   5694  CB  ASP B 294       2.087  13.845 -59.929  1.00  0.36           C  
ATOM   5695  CG  ASP B 294       2.791  15.002 -59.220  1.00  0.36           C  
ATOM   5696  OD1 ASP B 294       3.926  14.751 -58.750  1.00  0.36           O  
ATOM   5697  OD2 ASP B 294       2.240  16.137 -59.094  1.00  0.36           O  
ATOM   5698  N   GLU B 295       2.175  12.099 -63.138  1.00  0.33           N  
ATOM   5699  CA  GLU B 295       1.554  11.037 -63.928  1.00  0.33           C  
ATOM   5700  C   GLU B 295       2.568  10.077 -64.576  1.00  0.33           C  
ATOM   5701  O   GLU B 295       3.363  10.493 -65.410  1.00  0.33           O  
ATOM   5702  CB  GLU B 295       0.638  11.615 -65.048  1.00  0.33           C  
ATOM   5703  CG  GLU B 295      -0.579  12.444 -64.553  1.00  0.33           C  
ATOM   5704  CD  GLU B 295      -1.478  12.872 -65.716  1.00  0.33           C  
ATOM   5705  OE1 GLU B 295      -2.500  13.550 -65.438  1.00  0.33           O  
ATOM   5706  OE2 GLU B 295      -1.167  12.522 -66.884  1.00  0.33           O  
ATOM   5707  N   ALA B 296       2.523   8.747 -64.236  1.00  0.30           N  
ATOM   5708  CA  ALA B 296       3.360   7.679 -64.808  1.00  0.30           C  
ATOM   5709  C   ALA B 296       4.896   7.925 -64.743  1.00  0.30           C  
ATOM   5710  O   ALA B 296       5.341   8.973 -64.278  1.00  0.30           O  
ATOM   5711  CB  ALA B 296       2.854   7.365 -66.249  1.00  0.30           C  
ATOM   5712  N   PRO B 297       5.798   7.048 -65.182  1.00  0.27           N  
ATOM   5713  CA  PRO B 297       7.209   7.406 -65.226  1.00  0.27           C  
ATOM   5714  C   PRO B 297       7.459   8.189 -66.500  1.00  0.27           C  
ATOM   5715  O   PRO B 297       7.362   7.652 -67.600  1.00  0.27           O  
ATOM   5716  CB  PRO B 297       7.978   6.069 -65.225  1.00  0.27           C  
ATOM   5717  CG  PRO B 297       6.951   4.983 -65.581  1.00  0.27           C  
ATOM   5718  CD  PRO B 297       5.579   5.609 -65.308  1.00  0.27           C  
ATOM   5719  N   LEU B 298       7.747   9.492 -66.346  1.00  0.32           N  
ATOM   5720  CA  LEU B 298       8.114  10.378 -67.425  1.00  0.32           C  
ATOM   5721  C   LEU B 298       9.507  10.109 -67.968  1.00  0.32           C  
ATOM   5722  O   LEU B 298      10.404   9.661 -67.255  1.00  0.32           O  
ATOM   5723  CB  LEU B 298       8.044  11.847 -66.949  1.00  0.32           C  
ATOM   5724  CG  LEU B 298       6.632  12.314 -66.562  1.00  0.32           C  
ATOM   5725  CD1 LEU B 298       6.707  13.727 -65.989  1.00  0.32           C  
ATOM   5726  CD2 LEU B 298       5.661  12.291 -67.753  1.00  0.32           C  
ATOM   5727  N   SER B 299       9.737  10.405 -69.259  1.00  0.31           N  
ATOM   5728  CA  SER B 299      11.080  10.467 -69.815  1.00  0.31           C  
ATOM   5729  C   SER B 299      11.781  11.755 -69.408  1.00  0.31           C  
ATOM   5730  O   SER B 299      11.145  12.738 -69.025  1.00  0.31           O  
ATOM   5731  CB  SER B 299      11.120  10.238 -71.360  1.00  0.31           C  
ATOM   5732  OG  SER B 299      10.586  11.321 -72.139  1.00  0.31           O  
ATOM   5733  N   ASP B 300      13.127  11.810 -69.485  1.00  0.34           N  
ATOM   5734  CA  ASP B 300      13.919  12.991 -69.168  1.00  0.34           C  
ATOM   5735  C   ASP B 300      13.524  14.192 -70.019  1.00  0.34           C  
ATOM   5736  O   ASP B 300      13.566  15.340 -69.586  1.00  0.34           O  
ATOM   5737  CB  ASP B 300      15.425  12.721 -69.378  1.00  0.34           C  
ATOM   5738  CG  ASP B 300      15.939  11.627 -68.465  1.00  0.34           C  
ATOM   5739  OD1 ASP B 300      15.272  11.301 -67.458  1.00  0.34           O  
ATOM   5740  OD2 ASP B 300      17.028  11.099 -68.805  1.00  0.34           O  
ATOM   5741  N   TYR B 301      13.083  13.937 -71.267  1.00  0.28           N  
ATOM   5742  CA  TYR B 301      12.498  14.930 -72.143  1.00  0.28           C  
ATOM   5743  C   TYR B 301      11.240  15.580 -71.572  1.00  0.28           C  
ATOM   5744  O   TYR B 301      11.102  16.802 -71.570  1.00  0.28           O  
ATOM   5745  CB  TYR B 301      12.189  14.223 -73.495  1.00  0.28           C  
ATOM   5746  CG  TYR B 301      11.465  15.094 -74.477  1.00  0.28           C  
ATOM   5747  CD1 TYR B 301      10.156  14.781 -74.877  1.00  0.28           C  
ATOM   5748  CD2 TYR B 301      12.088  16.238 -74.993  1.00  0.28           C  
ATOM   5749  CE1 TYR B 301       9.503  15.578 -75.828  1.00  0.28           C  
ATOM   5750  CE2 TYR B 301      11.433  17.037 -75.934  1.00  0.28           C  
ATOM   5751  CZ  TYR B 301      10.151  16.695 -76.359  1.00  0.28           C  
ATOM   5752  OH  TYR B 301       9.567  17.468 -77.365  1.00  0.28           O  
ATOM   5753  N   GLU B 302      10.307  14.768 -71.050  1.00  0.77           N  
ATOM   5754  CA  GLU B 302       9.074  15.230 -70.446  1.00  0.77           C  
ATOM   5755  C   GLU B 302       9.324  15.895 -69.102  1.00  0.77           C  
ATOM   5756  O   GLU B 302       8.700  16.891 -68.742  1.00  0.77           O  
ATOM   5757  CB  GLU B 302       8.090  14.046 -70.327  1.00  0.77           C  
ATOM   5758  CG  GLU B 302       7.702  13.473 -71.714  1.00  0.77           C  
ATOM   5759  CD  GLU B 302       7.153  12.057 -71.643  1.00  0.77           C  
ATOM   5760  OE1 GLU B 302       6.071  11.803 -72.218  1.00  0.77           O  
ATOM   5761  OE2 GLU B 302       7.892  11.197 -71.092  1.00  0.77           O  
ATOM   5762  N   ALA B 303      10.307  15.383 -68.337  1.00  0.80           N  
ATOM   5763  CA  ALA B 303      10.590  15.825 -66.992  1.00  0.80           C  
ATOM   5764  C   ALA B 303      11.559  17.001 -66.919  1.00  0.80           C  
ATOM   5765  O   ALA B 303      11.807  17.539 -65.839  1.00  0.80           O  
ATOM   5766  CB  ALA B 303      11.173  14.637 -66.209  1.00  0.80           C  
ATOM   5767  N   GLU B 304      12.067  17.473 -68.080  1.00  0.38           N  
ATOM   5768  CA  GLU B 304      13.128  18.459 -68.231  1.00  0.38           C  
ATOM   5769  C   GLU B 304      12.904  19.757 -67.461  1.00  0.38           C  
ATOM   5770  O   GLU B 304      13.834  20.336 -66.909  1.00  0.38           O  
ATOM   5771  CB  GLU B 304      13.285  18.781 -69.746  1.00  0.38           C  
ATOM   5772  CG  GLU B 304      14.527  19.629 -70.124  1.00  0.38           C  
ATOM   5773  CD  GLU B 304      14.379  20.269 -71.489  1.00  0.38           C  
ATOM   5774  OE1 GLU B 304      14.332  21.529 -71.535  1.00  0.38           O  
ATOM   5775  OE2 GLU B 304      14.306  19.539 -72.513  1.00  0.38           O  
ATOM   5776  N   ARG B 305      11.646  20.237 -67.391  1.00  0.38           N  
ATOM   5777  CA  ARG B 305      11.326  21.524 -66.803  1.00  0.38           C  
ATOM   5778  C   ARG B 305      10.585  21.436 -65.479  1.00  0.38           C  
ATOM   5779  O   ARG B 305       9.960  22.406 -65.049  1.00  0.38           O  
ATOM   5780  CB  ARG B 305      10.487  22.361 -67.800  1.00  0.38           C  
ATOM   5781  CG  ARG B 305      11.283  22.785 -69.049  1.00  0.38           C  
ATOM   5782  CD  ARG B 305      12.434  23.758 -68.743  1.00  0.38           C  
ATOM   5783  NE  ARG B 305      13.704  23.107 -69.178  1.00  0.38           N  
ATOM   5784  CZ  ARG B 305      14.896  23.700 -69.105  1.00  0.38           C  
ATOM   5785  NH1 ARG B 305      15.146  24.726 -68.315  1.00  0.38           N  
ATOM   5786  NH2 ARG B 305      15.873  23.212 -69.856  1.00  0.38           N  
ATOM   5787  N   CYS B 306      10.628  20.288 -64.767  1.00  0.42           N  
ATOM   5788  CA  CYS B 306       9.892  20.121 -63.515  1.00  0.42           C  
ATOM   5789  C   CYS B 306      10.287  21.106 -62.421  1.00  0.42           C  
ATOM   5790  O   CYS B 306       9.447  21.781 -61.824  1.00  0.42           O  
ATOM   5791  CB  CYS B 306      10.058  18.666 -62.993  1.00  0.42           C  
ATOM   5792  SG  CYS B 306       8.999  18.267 -61.546  1.00  0.42           S  
ATOM   5793  N   THR B 307      11.597  21.249 -62.171  1.00  0.42           N  
ATOM   5794  CA  THR B 307      12.135  22.188 -61.195  1.00  0.42           C  
ATOM   5795  C   THR B 307      11.933  23.636 -61.593  1.00  0.42           C  
ATOM   5796  O   THR B 307      11.493  24.454 -60.787  1.00  0.42           O  
ATOM   5797  CB  THR B 307      13.606  21.933 -60.920  1.00  0.42           C  
ATOM   5798  OG1 THR B 307      13.781  20.573 -60.554  1.00  0.42           O  
ATOM   5799  CG2 THR B 307      14.107  22.775 -59.739  1.00  0.42           C  
ATOM   5800  N   ASP B 308      12.177  23.988 -62.875  1.00  0.45           N  
ATOM   5801  CA  ASP B 308      11.969  25.331 -63.397  1.00  0.45           C  
ATOM   5802  C   ASP B 308      10.523  25.792 -63.299  1.00  0.45           C  
ATOM   5803  O   ASP B 308      10.224  26.946 -62.996  1.00  0.45           O  
ATOM   5804  CB  ASP B 308      12.368  25.423 -64.879  1.00  0.45           C  
ATOM   5805  CG  ASP B 308      13.836  25.145 -65.040  1.00  0.45           C  
ATOM   5806  OD1 ASP B 308      14.671  25.630 -64.249  1.00  0.45           O  
ATOM   5807  OD2 ASP B 308      14.139  24.414 -66.009  1.00  0.45           O  
ATOM   5808  N   SER B 309       9.570  24.868 -63.530  1.00  0.54           N  
ATOM   5809  CA  SER B 309       8.145  25.116 -63.372  1.00  0.54           C  
ATOM   5810  C   SER B 309       7.765  25.545 -61.969  1.00  0.54           C  
ATOM   5811  O   SER B 309       7.002  26.489 -61.779  1.00  0.54           O  
ATOM   5812  CB  SER B 309       7.330  23.855 -63.745  1.00  0.54           C  
ATOM   5813  OG  SER B 309       5.919  24.087 -63.712  1.00  0.54           O  
ATOM   5814  N   LEU B 310       8.336  24.903 -60.935  1.00  0.51           N  
ATOM   5815  CA  LEU B 310       8.157  25.322 -59.558  1.00  0.51           C  
ATOM   5816  C   LEU B 310       8.722  26.713 -59.271  1.00  0.51           C  
ATOM   5817  O   LEU B 310       8.106  27.504 -58.557  1.00  0.51           O  
ATOM   5818  CB  LEU B 310       8.813  24.310 -58.595  1.00  0.51           C  
ATOM   5819  CG  LEU B 310       8.200  22.899 -58.585  1.00  0.51           C  
ATOM   5820  CD1 LEU B 310       9.076  21.981 -57.724  1.00  0.51           C  
ATOM   5821  CD2 LEU B 310       6.759  22.902 -58.054  1.00  0.51           C  
ATOM   5822  N   VAL B 311       9.901  27.062 -59.844  1.00  0.54           N  
ATOM   5823  CA  VAL B 311      10.507  28.387 -59.705  1.00  0.54           C  
ATOM   5824  C   VAL B 311       9.609  29.461 -60.291  1.00  0.54           C  
ATOM   5825  O   VAL B 311       9.286  30.450 -59.636  1.00  0.54           O  
ATOM   5826  CB  VAL B 311      11.888  28.459 -60.365  1.00  0.54           C  
ATOM   5827  CG1 VAL B 311      12.467  29.890 -60.338  1.00  0.54           C  
ATOM   5828  CG2 VAL B 311      12.864  27.514 -59.639  1.00  0.54           C  
ATOM   5829  N   LEU B 312       9.093  29.222 -61.511  1.00  0.57           N  
ATOM   5830  CA  LEU B 312       8.163  30.102 -62.188  1.00  0.57           C  
ATOM   5831  C   LEU B 312       6.838  30.262 -61.448  1.00  0.57           C  
ATOM   5832  O   LEU B 312       6.289  31.357 -61.342  1.00  0.57           O  
ATOM   5833  CB  LEU B 312       7.949  29.594 -63.632  1.00  0.57           C  
ATOM   5834  CG  LEU B 312       7.100  30.504 -64.545  1.00  0.57           C  
ATOM   5835  CD1 LEU B 312       7.668  31.929 -64.634  1.00  0.57           C  
ATOM   5836  CD2 LEU B 312       7.011  29.900 -65.954  1.00  0.57           C  
ATOM   5837  N   GLN B 313       6.298  29.179 -60.844  1.00  0.57           N  
ATOM   5838  CA  GLN B 313       5.143  29.269 -59.962  1.00  0.57           C  
ATOM   5839  C   GLN B 313       5.381  30.172 -58.750  1.00  0.57           C  
ATOM   5840  O   GLN B 313       4.524  30.982 -58.405  1.00  0.57           O  
ATOM   5841  CB  GLN B 313       4.678  27.873 -59.470  1.00  0.57           C  
ATOM   5842  CG  GLN B 313       4.021  26.996 -60.556  1.00  0.57           C  
ATOM   5843  CD  GLN B 313       3.782  25.562 -60.075  1.00  0.57           C  
ATOM   5844  OE1 GLN B 313       3.071  25.265 -59.112  1.00  0.57           O  
ATOM   5845  NE2 GLN B 313       4.404  24.602 -60.792  1.00  0.57           N  
ATOM   5846  N   CYS B 314       6.560  30.107 -58.095  1.00  0.58           N  
ATOM   5847  CA  CYS B 314       6.920  31.051 -57.042  1.00  0.58           C  
ATOM   5848  C   CYS B 314       7.023  32.493 -57.507  1.00  0.58           C  
ATOM   5849  O   CYS B 314       6.530  33.397 -56.835  1.00  0.58           O  
ATOM   5850  CB  CYS B 314       8.250  30.674 -56.352  1.00  0.58           C  
ATOM   5851  SG  CYS B 314       8.009  29.239 -55.261  1.00  0.58           S  
ATOM   5852  N   GLU B 315       7.635  32.748 -58.680  1.00  0.48           N  
ATOM   5853  CA  GLU B 315       7.714  34.076 -59.268  1.00  0.48           C  
ATOM   5854  C   GLU B 315       6.347  34.670 -59.582  1.00  0.48           C  
ATOM   5855  O   GLU B 315       6.052  35.822 -59.261  1.00  0.48           O  
ATOM   5856  CB  GLU B 315       8.541  34.041 -60.571  1.00  0.48           C  
ATOM   5857  CG  GLU B 315      10.045  33.753 -60.349  1.00  0.48           C  
ATOM   5858  CD  GLU B 315      10.818  33.651 -61.664  1.00  0.48           C  
ATOM   5859  OE1 GLU B 315      12.066  33.529 -61.579  1.00  0.48           O  
ATOM   5860  OE2 GLU B 315      10.179  33.686 -62.747  1.00  0.48           O  
ATOM   5861  N   LEU B 316       5.438  33.865 -60.165  1.00  0.52           N  
ATOM   5862  CA  LEU B 316       4.057  34.252 -60.389  1.00  0.52           C  
ATOM   5863  C   LEU B 316       3.298  34.512 -59.103  1.00  0.52           C  
ATOM   5864  O   LEU B 316       2.558  35.487 -59.005  1.00  0.52           O  
ATOM   5865  CB  LEU B 316       3.312  33.174 -61.204  1.00  0.52           C  
ATOM   5866  CG  LEU B 316       3.807  33.051 -62.656  1.00  0.52           C  
ATOM   5867  CD1 LEU B 316       3.273  31.765 -63.296  1.00  0.52           C  
ATOM   5868  CD2 LEU B 316       3.398  34.269 -63.495  1.00  0.52           C  
ATOM   5869  N   ALA B 317       3.507  33.674 -58.068  1.00  0.55           N  
ATOM   5870  CA  ALA B 317       2.937  33.843 -56.750  1.00  0.55           C  
ATOM   5871  C   ALA B 317       3.329  35.144 -56.077  1.00  0.55           C  
ATOM   5872  O   ALA B 317       2.488  35.835 -55.509  1.00  0.55           O  
ATOM   5873  CB  ALA B 317       3.255  32.612 -55.893  1.00  0.55           C  
ATOM   5874  N   LEU B 318       4.596  35.581 -56.210  1.00  0.40           N  
ATOM   5875  CA  LEU B 318       5.018  36.905 -55.779  1.00  0.40           C  
ATOM   5876  C   LEU B 318       4.241  38.029 -56.454  1.00  0.40           C  
ATOM   5877  O   LEU B 318       3.860  39.002 -55.808  1.00  0.40           O  
ATOM   5878  CB  LEU B 318       6.526  37.136 -56.047  1.00  0.40           C  
ATOM   5879  CG  LEU B 318       7.471  36.316 -55.148  1.00  0.40           C  
ATOM   5880  CD1 LEU B 318       8.919  36.425 -55.646  1.00  0.40           C  
ATOM   5881  CD2 LEU B 318       7.392  36.763 -53.680  1.00  0.40           C  
ATOM   5882  N   GLY B 319       3.934  37.890 -57.763  1.00  0.45           N  
ATOM   5883  CA  GLY B 319       3.188  38.881 -58.535  1.00  0.45           C  
ATOM   5884  C   GLY B 319       1.774  39.153 -58.085  1.00  0.45           C  
ATOM   5885  O   GLY B 319       1.246  40.229 -58.352  1.00  0.45           O  
ATOM   5886  N   PHE B 320       1.114  38.206 -57.390  1.00  0.37           N  
ATOM   5887  CA  PHE B 320      -0.218  38.442 -56.848  1.00  0.37           C  
ATOM   5888  C   PHE B 320      -0.260  38.425 -55.332  1.00  0.37           C  
ATOM   5889  O   PHE B 320      -1.330  38.491 -54.732  1.00  0.37           O  
ATOM   5890  CB  PHE B 320      -1.281  37.484 -57.447  1.00  0.37           C  
ATOM   5891  CG  PHE B 320      -1.034  36.025 -57.192  1.00  0.37           C  
ATOM   5892  CD1 PHE B 320      -0.408  35.250 -58.173  1.00  0.37           C  
ATOM   5893  CD2 PHE B 320      -1.494  35.398 -56.020  1.00  0.37           C  
ATOM   5894  CE1 PHE B 320      -0.266  33.870 -58.007  1.00  0.37           C  
ATOM   5895  CE2 PHE B 320      -1.343  34.017 -55.845  1.00  0.37           C  
ATOM   5896  CZ  PHE B 320      -0.723  33.250 -56.838  1.00  0.37           C  
ATOM   5897  N   GLY B 321       0.904  38.368 -54.654  1.00  0.48           N  
ATOM   5898  CA  GLY B 321       0.926  38.362 -53.194  1.00  0.48           C  
ATOM   5899  C   GLY B 321       0.639  37.016 -52.579  1.00  0.48           C  
ATOM   5900  O   GLY B 321       0.295  36.918 -51.401  1.00  0.48           O  
ATOM   5901  N   GLY B 322       0.780  35.933 -53.365  1.00  0.50           N  
ATOM   5902  CA  GLY B 322       0.441  34.565 -52.999  1.00  0.50           C  
ATOM   5903  C   GLY B 322       1.413  33.923 -52.063  1.00  0.50           C  
ATOM   5904  O   GLY B 322       2.147  32.994 -52.391  1.00  0.50           O  
ATOM   5905  N   GLY B 323       1.427  34.407 -50.812  1.00  0.44           N  
ATOM   5906  CA  GLY B 323       2.303  33.912 -49.772  1.00  0.44           C  
ATOM   5907  C   GLY B 323       1.994  32.514 -49.333  1.00  0.44           C  
ATOM   5908  O   GLY B 323       2.882  31.811 -48.864  1.00  0.44           O  
ATOM   5909  N   ARG B 324       0.726  32.084 -49.425  1.00  0.36           N  
ATOM   5910  CA  ARG B 324       0.346  30.725 -49.094  1.00  0.36           C  
ATOM   5911  C   ARG B 324       0.768  29.754 -50.174  1.00  0.36           C  
ATOM   5912  O   ARG B 324       1.323  28.706 -49.890  1.00  0.36           O  
ATOM   5913  CB  ARG B 324      -1.166  30.585 -48.857  1.00  0.36           C  
ATOM   5914  CG  ARG B 324      -1.665  31.264 -47.569  1.00  0.36           C  
ATOM   5915  CD  ARG B 324      -3.162  31.004 -47.404  1.00  0.36           C  
ATOM   5916  NE  ARG B 324      -3.634  31.657 -46.141  1.00  0.36           N  
ATOM   5917  CZ  ARG B 324      -4.842  31.426 -45.609  1.00  0.36           C  
ATOM   5918  NH1 ARG B 324      -5.691  30.564 -46.162  1.00  0.36           N  
ATOM   5919  NH2 ARG B 324      -5.208  32.069 -44.504  1.00  0.36           N  
ATOM   5920  N   GLU B 325       0.586  30.120 -51.447  1.00  0.44           N  
ATOM   5921  CA  GLU B 325       1.007  29.368 -52.602  1.00  0.44           C  
ATOM   5922  C   GLU B 325       2.508  29.196 -52.622  1.00  0.44           C  
ATOM   5923  O   GLU B 325       3.034  28.102 -52.818  1.00  0.44           O  
ATOM   5924  CB  GLU B 325       0.557  30.122 -53.875  1.00  0.44           C  
ATOM   5925  CG  GLU B 325      -0.986  30.195 -54.064  1.00  0.44           C  
ATOM   5926  CD  GLU B 325      -1.733  31.230 -53.214  1.00  0.44           C  
ATOM   5927  OE1 GLU B 325      -2.977  31.296 -53.375  1.00  0.44           O  
ATOM   5928  OE2 GLU B 325      -1.095  31.961 -52.407  1.00  0.44           O  
ATOM   5929  N   ILE B 326       3.252  30.278 -52.297  1.00  0.44           N  
ATOM   5930  CA  ILE B 326       4.674  30.192 -52.023  1.00  0.44           C  
ATOM   5931  C   ILE B 326       4.931  29.221 -50.912  1.00  0.44           C  
ATOM   5932  O   ILE B 326       5.772  28.355 -51.115  1.00  0.44           O  
ATOM   5933  CB  ILE B 326       5.300  31.547 -51.711  1.00  0.44           C  
ATOM   5934  CG1 ILE B 326       5.320  32.379 -53.007  1.00  0.44           C  
ATOM   5935  CG2 ILE B 326       6.732  31.392 -51.151  1.00  0.44           C  
ATOM   5936  CD1 ILE B 326       5.696  33.845 -52.798  1.00  0.44           C  
ATOM   5937  N   ALA B 327       4.148  29.274 -49.804  1.00  0.39           N  
ATOM   5938  CA  ALA B 327       4.234  28.424 -48.640  1.00  0.39           C  
ATOM   5939  C   ALA B 327       3.971  26.922 -48.855  1.00  0.39           C  
ATOM   5940  O   ALA B 327       4.258  26.092 -48.000  1.00  0.39           O  
ATOM   5941  CB  ALA B 327       3.332  28.933 -47.492  1.00  0.39           C  
ATOM   5942  N   ASP B 328       3.473  26.531 -50.030  1.00  0.36           N  
ATOM   5943  CA  ASP B 328       3.363  25.127 -50.382  1.00  0.36           C  
ATOM   5944  C   ASP B 328       4.464  24.736 -51.365  1.00  0.36           C  
ATOM   5945  O   ASP B 328       4.893  23.586 -51.448  1.00  0.36           O  
ATOM   5946  CB  ASP B 328       2.001  24.826 -51.041  1.00  0.36           C  
ATOM   5947  CG  ASP B 328       0.841  25.061 -50.083  1.00  0.36           C  
ATOM   5948  OD1 ASP B 328       0.997  24.843 -48.855  1.00  0.36           O  
ATOM   5949  OD2 ASP B 328      -0.244  25.429 -50.604  1.00  0.36           O  
ATOM   5950  N   LEU B 329       4.992  25.695 -52.149  1.00  0.45           N  
ATOM   5951  CA  LEU B 329       5.898  25.381 -53.235  1.00  0.45           C  
ATOM   5952  C   LEU B 329       7.350  25.198 -52.865  1.00  0.45           C  
ATOM   5953  O   LEU B 329       8.079  24.441 -53.492  1.00  0.45           O  
ATOM   5954  CB  LEU B 329       5.857  26.467 -54.324  1.00  0.45           C  
ATOM   5955  CG  LEU B 329       4.575  26.430 -55.161  1.00  0.45           C  
ATOM   5956  CD1 LEU B 329       4.487  27.699 -55.999  1.00  0.45           C  
ATOM   5957  CD2 LEU B 329       4.498  25.202 -56.079  1.00  0.45           C  
ATOM   5958  N   ALA B 330       7.881  25.915 -51.876  1.00  0.36           N  
ATOM   5959  CA  ALA B 330       9.323  25.948 -51.739  1.00  0.36           C  
ATOM   5960  C   ALA B 330       9.926  24.747 -50.982  1.00  0.36           C  
ATOM   5961  O   ALA B 330      11.111  24.546 -51.260  1.00  0.36           O  
ATOM   5962  CB  ALA B 330       9.840  27.346 -51.326  1.00  0.36           C  
ATOM   5963  N   PRO B 331       9.317  23.843 -50.135  1.00  0.27           N  
ATOM   5964  CA  PRO B 331       9.945  22.566 -49.803  1.00  0.27           C  
ATOM   5965  C   PRO B 331      10.174  21.777 -51.053  1.00  0.27           C  
ATOM   5966  O   PRO B 331      11.220  21.141 -51.175  1.00  0.27           O  
ATOM   5967  CB  PRO B 331       8.972  21.846 -48.838  1.00  0.27           C  
ATOM   5968  CG  PRO B 331       8.137  22.955 -48.207  1.00  0.27           C  
ATOM   5969  CD  PRO B 331       8.116  24.028 -49.304  1.00  0.27           C  
ATOM   5970  N   LEU B 332       9.258  21.871 -52.027  1.00  0.34           N  
ATOM   5971  CA  LEU B 332       9.384  21.275 -53.335  1.00  0.34           C  
ATOM   5972  C   LEU B 332      10.603  21.780 -54.113  1.00  0.34           C  
ATOM   5973  O   LEU B 332      11.306  21.019 -54.764  1.00  0.34           O  
ATOM   5974  CB  LEU B 332       8.091  21.510 -54.172  1.00  0.34           C  
ATOM   5975  CG  LEU B 332       6.755  21.426 -53.397  1.00  0.34           C  
ATOM   5976  CD1 LEU B 332       5.593  21.591 -54.385  1.00  0.34           C  
ATOM   5977  CD2 LEU B 332       6.642  20.103 -52.674  1.00  0.34           C  
ATOM   5978  N   LEU B 333      10.884  23.102 -54.054  1.00  0.34           N  
ATOM   5979  CA  LEU B 333      11.978  23.729 -54.783  1.00  0.34           C  
ATOM   5980  C   LEU B 333      13.332  23.252 -54.328  1.00  0.34           C  
ATOM   5981  O   LEU B 333      14.180  22.838 -55.121  1.00  0.34           O  
ATOM   5982  CB  LEU B 333      11.883  25.278 -54.667  1.00  0.34           C  
ATOM   5983  CG  LEU B 333      11.041  25.887 -55.794  1.00  0.34           C  
ATOM   5984  CD1 LEU B 333      10.966  27.410 -55.655  1.00  0.34           C  
ATOM   5985  CD2 LEU B 333      11.667  25.527 -57.144  1.00  0.34           C  
ATOM   5986  N   HIS B 334      13.522  23.217 -53.009  1.00  0.22           N  
ATOM   5987  CA  HIS B 334      14.769  22.706 -52.451  1.00  0.22           C  
ATOM   5988  C   HIS B 334      14.916  21.174 -52.529  1.00  0.22           C  
ATOM   5989  O   HIS B 334      15.913  20.707 -52.960  1.00  0.22           O  
ATOM   5990  CB  HIS B 334      15.072  23.172 -51.097  1.00  0.22           C  
ATOM   5991  CG  HIS B 334      16.537  22.920 -50.623  1.00  0.22           C  
ATOM   5992  ND1 HIS B 334      17.624  23.756 -50.808  1.00  0.22           N  
ATOM   5993  CD2 HIS B 334      16.832  22.047 -49.624  1.00  0.22           C  
ATOM   5994  CE1 HIS B 334      18.524  23.371 -49.888  1.00  0.22           C  
ATOM   5995  NE2 HIS B 334      18.079  22.341 -49.168  1.00  0.22           N  
ATOM   5996  N   ALA B 335      13.715  20.495 -52.317  1.00  0.30           N  
ATOM   5997  CA  ALA B 335      13.176  19.233 -52.891  1.00  0.30           C  
ATOM   5998  C   ALA B 335      13.848  18.585 -54.065  1.00  0.30           C  
ATOM   5999  O   ALA B 335      14.170  17.409 -54.082  1.00  0.30           O  
ATOM   6000  CB  ALA B 335      12.381  18.368 -51.887  1.00  0.30           C  
ATOM   6001  N   ARG B 336      13.976  19.371 -55.163  1.00  0.28           N  
ATOM   6002  CA  ARG B 336      14.625  18.921 -56.380  1.00  0.28           C  
ATOM   6003  C   ARG B 336      13.794  17.778 -57.012  1.00  0.28           C  
ATOM   6004  O   ARG B 336      14.213  17.030 -57.891  1.00  0.28           O  
ATOM   6005  CB  ARG B 336      16.132  18.565 -56.139  1.00  0.28           C  
ATOM   6006  CG  ARG B 336      16.939  18.375 -57.427  1.00  0.28           C  
ATOM   6007  CD  ARG B 336      18.405  18.056 -57.168  1.00  0.28           C  
ATOM   6008  NE  ARG B 336      18.929  17.750 -58.522  1.00  0.28           N  
ATOM   6009  CZ  ARG B 336      20.181  17.359 -58.768  1.00  0.28           C  
ATOM   6010  NH1 ARG B 336      20.539  17.078 -60.016  1.00  0.28           N  
ATOM   6011  NH2 ARG B 336      21.080  17.247 -57.796  1.00  0.28           N  
ATOM   6012  N   GLY B 337      12.538  17.641 -56.551  1.00  0.29           N  
ATOM   6013  CA  GLY B 337      11.715  16.479 -56.755  1.00  0.29           C  
ATOM   6014  C   GLY B 337      10.400  16.773 -56.137  1.00  0.29           C  
ATOM   6015  O   GLY B 337      10.274  17.347 -55.058  1.00  0.29           O  
ATOM   6016  N   ARG B 338       9.352  16.394 -56.855  1.00  0.26           N  
ATOM   6017  CA  ARG B 338       8.004  16.543 -56.401  1.00  0.26           C  
ATOM   6018  C   ARG B 338       7.652  15.423 -55.407  1.00  0.26           C  
ATOM   6019  O   ARG B 338       7.920  14.261 -55.709  1.00  0.26           O  
ATOM   6020  CB  ARG B 338       7.123  16.472 -57.654  1.00  0.26           C  
ATOM   6021  CG  ARG B 338       5.673  16.907 -57.452  1.00  0.26           C  
ATOM   6022  CD  ARG B 338       5.435  18.392 -57.246  1.00  0.26           C  
ATOM   6023  NE  ARG B 338       3.948  18.514 -57.365  1.00  0.26           N  
ATOM   6024  CZ  ARG B 338       3.146  18.671 -56.313  1.00  0.26           C  
ATOM   6025  NH1 ARG B 338       1.830  18.584 -56.448  1.00  0.26           N  
ATOM   6026  NH2 ARG B 338       3.622  18.852 -55.090  1.00  0.26           N  
ATOM   6027  N   PRO B 339       7.110  15.672 -54.217  1.00  0.26           N  
ATOM   6028  CA  PRO B 339       6.790  14.644 -53.259  1.00  0.26           C  
ATOM   6029  C   PRO B 339       5.428  14.110 -53.591  1.00  0.26           C  
ATOM   6030  O   PRO B 339       4.605  14.791 -54.203  1.00  0.26           O  
ATOM   6031  CB  PRO B 339       6.701  15.393 -51.916  1.00  0.26           C  
ATOM   6032  CG  PRO B 339       6.173  16.763 -52.317  1.00  0.26           C  
ATOM   6033  CD  PRO B 339       6.887  16.980 -53.656  1.00  0.26           C  
ATOM   6034  N   LEU B 340       5.170  12.886 -53.138  1.00  0.22           N  
ATOM   6035  CA  LEU B 340       3.839  12.343 -53.048  1.00  0.22           C  
ATOM   6036  C   LEU B 340       2.993  13.063 -52.000  1.00  0.22           C  
ATOM   6037  O   LEU B 340       3.096  12.808 -50.801  1.00  0.22           O  
ATOM   6038  CB  LEU B 340       3.976  10.850 -52.680  1.00  0.22           C  
ATOM   6039  CG  LEU B 340       2.674  10.032 -52.608  1.00  0.22           C  
ATOM   6040  CD1 LEU B 340       1.943  10.015 -53.957  1.00  0.22           C  
ATOM   6041  CD2 LEU B 340       3.007   8.601 -52.160  1.00  0.22           C  
ATOM   6042  N   GLU B 341       2.109  13.983 -52.433  1.00  0.25           N  
ATOM   6043  CA  GLU B 341       1.195  14.651 -51.529  1.00  0.25           C  
ATOM   6044  C   GLU B 341      -0.081  13.838 -51.409  1.00  0.25           C  
ATOM   6045  O   GLU B 341      -0.891  13.769 -52.328  1.00  0.25           O  
ATOM   6046  CB  GLU B 341       0.791  16.070 -52.003  1.00  0.25           C  
ATOM   6047  CG  GLU B 341       1.941  17.102 -52.076  1.00  0.25           C  
ATOM   6048  CD  GLU B 341       1.395  18.480 -52.434  1.00  0.25           C  
ATOM   6049  OE1 GLU B 341       0.874  19.171 -51.536  1.00  0.25           O  
ATOM   6050  OE2 GLU B 341       1.508  18.874 -53.632  1.00  0.25           O  
ATOM   6051  N   ALA B 342      -0.289  13.180 -50.254  1.00  0.16           N  
ATOM   6052  CA  ALA B 342      -1.510  12.448 -49.985  1.00  0.16           C  
ATOM   6053  C   ALA B 342      -2.731  13.335 -49.776  1.00  0.16           C  
ATOM   6054  O   ALA B 342      -3.832  13.038 -50.235  1.00  0.16           O  
ATOM   6055  CB  ALA B 342      -1.306  11.565 -48.741  1.00  0.16           C  
ATOM   6056  N   SER B 343      -2.559  14.447 -49.041  1.00  0.14           N  
ATOM   6057  CA  SER B 343      -3.650  15.346 -48.751  1.00  0.14           C  
ATOM   6058  C   SER B 343      -3.134  16.700 -48.313  1.00  0.14           C  
ATOM   6059  O   SER B 343      -2.015  16.834 -47.825  1.00  0.14           O  
ATOM   6060  CB  SER B 343      -4.616  14.781 -47.666  1.00  0.14           C  
ATOM   6061  OG  SER B 343      -4.001  14.583 -46.389  1.00  0.14           O  
ATOM   6062  N   TYR B 344      -3.974  17.740 -48.464  1.00  0.17           N  
ATOM   6063  CA  TYR B 344      -3.767  19.040 -47.873  1.00  0.17           C  
ATOM   6064  C   TYR B 344      -5.157  19.501 -47.468  1.00  0.17           C  
ATOM   6065  O   TYR B 344      -6.128  19.267 -48.185  1.00  0.17           O  
ATOM   6066  CB  TYR B 344      -3.101  20.048 -48.856  1.00  0.17           C  
ATOM   6067  CG  TYR B 344      -2.922  21.397 -48.206  1.00  0.17           C  
ATOM   6068  CD1 TYR B 344      -3.859  22.424 -48.423  1.00  0.17           C  
ATOM   6069  CD2 TYR B 344      -1.859  21.621 -47.316  1.00  0.17           C  
ATOM   6070  CE1 TYR B 344      -3.745  23.646 -47.747  1.00  0.17           C  
ATOM   6071  CE2 TYR B 344      -1.733  22.852 -46.654  1.00  0.17           C  
ATOM   6072  CZ  TYR B 344      -2.679  23.862 -46.871  1.00  0.17           C  
ATOM   6073  OH  TYR B 344      -2.528  25.119 -46.254  1.00  0.17           O  
ATOM   6074  N   TYR B 345      -5.281  20.141 -46.292  1.00  0.14           N  
ATOM   6075  CA  TYR B 345      -6.541  20.626 -45.772  1.00  0.14           C  
ATOM   6076  C   TYR B 345      -6.245  21.860 -44.945  1.00  0.14           C  
ATOM   6077  O   TYR B 345      -5.119  22.080 -44.506  1.00  0.14           O  
ATOM   6078  CB  TYR B 345      -7.244  19.602 -44.835  1.00  0.14           C  
ATOM   6079  CG  TYR B 345      -7.865  18.474 -45.614  1.00  0.14           C  
ATOM   6080  CD1 TYR B 345      -9.123  18.648 -46.216  1.00  0.14           C  
ATOM   6081  CD2 TYR B 345      -7.218  17.230 -45.740  1.00  0.14           C  
ATOM   6082  CE1 TYR B 345      -9.717  17.608 -46.945  1.00  0.14           C  
ATOM   6083  CE2 TYR B 345      -7.815  16.190 -46.471  1.00  0.14           C  
ATOM   6084  CZ  TYR B 345      -9.055  16.388 -47.088  1.00  0.14           C  
ATOM   6085  OH  TYR B 345      -9.645  15.363 -47.854  1.00  0.14           O  
ATOM   6086  N   GLN B 346      -7.260  22.716 -44.711  1.00  0.17           N  
ATOM   6087  CA  GLN B 346      -7.146  23.823 -43.779  1.00  0.17           C  
ATOM   6088  C   GLN B 346      -6.992  23.376 -42.326  1.00  0.17           C  
ATOM   6089  O   GLN B 346      -7.550  22.372 -41.900  1.00  0.17           O  
ATOM   6090  CB  GLN B 346      -8.373  24.760 -43.877  1.00  0.17           C  
ATOM   6091  CG  GLN B 346      -8.579  25.416 -45.265  1.00  0.17           C  
ATOM   6092  CD  GLN B 346      -7.450  26.384 -45.638  1.00  0.17           C  
ATOM   6093  OE1 GLN B 346      -7.172  27.368 -44.948  1.00  0.17           O  
ATOM   6094  NE2 GLN B 346      -6.780  26.119 -46.783  1.00  0.17           N  
ATOM   6095  N   ALA B 347      -6.219  24.129 -41.519  1.00  0.21           N  
ATOM   6096  CA  ALA B 347      -5.967  23.763 -40.137  1.00  0.21           C  
ATOM   6097  C   ALA B 347      -6.874  24.464 -39.138  1.00  0.21           C  
ATOM   6098  O   ALA B 347      -7.513  23.835 -38.298  1.00  0.21           O  
ATOM   6099  CB  ALA B 347      -4.494  24.076 -39.815  1.00  0.21           C  
ATOM   6100  N   PHE B 348      -6.959  25.810 -39.207  1.00  0.20           N  
ATOM   6101  CA  PHE B 348      -7.670  26.630 -38.239  1.00  0.20           C  
ATOM   6102  C   PHE B 348      -9.167  26.335 -38.174  1.00  0.20           C  
ATOM   6103  O   PHE B 348      -9.754  26.229 -37.099  1.00  0.20           O  
ATOM   6104  CB  PHE B 348      -7.404  28.127 -38.572  1.00  0.20           C  
ATOM   6105  CG  PHE B 348      -7.867  29.046 -37.471  1.00  0.20           C  
ATOM   6106  CD1 PHE B 348      -9.185  29.535 -37.458  1.00  0.20           C  
ATOM   6107  CD2 PHE B 348      -6.991  29.425 -36.441  1.00  0.20           C  
ATOM   6108  CE1 PHE B 348      -9.631  30.358 -36.417  1.00  0.20           C  
ATOM   6109  CE2 PHE B 348      -7.431  30.255 -35.401  1.00  0.20           C  
ATOM   6110  CZ  PHE B 348      -8.754  30.712 -35.384  1.00  0.20           C  
ATOM   6111  N   ALA B 349      -9.816  26.159 -39.341  1.00  0.36           N  
ATOM   6112  CA  ALA B 349     -11.221  25.824 -39.420  1.00  0.36           C  
ATOM   6113  C   ALA B 349     -11.574  24.479 -38.784  1.00  0.36           C  
ATOM   6114  O   ALA B 349     -12.515  24.389 -37.998  1.00  0.36           O  
ATOM   6115  CB  ALA B 349     -11.641  25.849 -40.901  1.00  0.36           C  
ATOM   6116  N   GLU B 350     -10.771  23.429 -39.055  1.00  0.34           N  
ATOM   6117  CA  GLU B 350     -10.892  22.116 -38.444  1.00  0.34           C  
ATOM   6118  C   GLU B 350     -10.663  22.142 -36.943  1.00  0.34           C  
ATOM   6119  O   GLU B 350     -11.426  21.579 -36.162  1.00  0.34           O  
ATOM   6120  CB  GLU B 350      -9.855  21.160 -39.078  1.00  0.34           C  
ATOM   6121  CG  GLU B 350     -10.168  20.805 -40.552  1.00  0.34           C  
ATOM   6122  CD  GLU B 350     -11.358  19.861 -40.725  1.00  0.34           C  
ATOM   6123  OE1 GLU B 350     -11.758  19.678 -41.903  1.00  0.34           O  
ATOM   6124  OE2 GLU B 350     -11.841  19.290 -39.715  1.00  0.34           O  
ATOM   6125  N   PHE B 351      -9.624  22.870 -36.480  1.00  0.26           N  
ATOM   6126  CA  PHE B 351      -9.344  23.055 -35.066  1.00  0.26           C  
ATOM   6127  C   PHE B 351     -10.506  23.727 -34.327  1.00  0.26           C  
ATOM   6128  O   PHE B 351     -10.954  23.263 -33.279  1.00  0.26           O  
ATOM   6129  CB  PHE B 351      -8.028  23.879 -34.938  1.00  0.26           C  
ATOM   6130  CG  PHE B 351      -7.643  24.166 -33.512  1.00  0.26           C  
ATOM   6131  CD1 PHE B 351      -7.736  25.475 -33.011  1.00  0.26           C  
ATOM   6132  CD2 PHE B 351      -7.224  23.133 -32.658  1.00  0.26           C  
ATOM   6133  CE1 PHE B 351      -7.434  25.746 -31.671  1.00  0.26           C  
ATOM   6134  CE2 PHE B 351      -6.925  23.400 -31.315  1.00  0.26           C  
ATOM   6135  CZ  PHE B 351      -7.038  24.706 -30.821  1.00  0.26           C  
ATOM   6136  N   SER B 352     -11.072  24.800 -34.910  1.00  0.40           N  
ATOM   6137  CA  SER B 352     -12.255  25.477 -34.392  1.00  0.40           C  
ATOM   6138  C   SER B 352     -13.491  24.584 -34.339  1.00  0.40           C  
ATOM   6139  O   SER B 352     -14.220  24.538 -33.348  1.00  0.40           O  
ATOM   6140  CB  SER B 352     -12.556  26.726 -35.257  1.00  0.40           C  
ATOM   6141  OG  SER B 352     -13.589  27.535 -34.692  1.00  0.40           O  
ATOM   6142  N   ALA B 353     -13.729  23.784 -35.398  1.00  0.46           N  
ATOM   6143  CA  ALA B 353     -14.806  22.819 -35.453  1.00  0.46           C  
ATOM   6144  C   ALA B 353     -14.712  21.737 -34.384  1.00  0.46           C  
ATOM   6145  O   ALA B 353     -15.699  21.391 -33.730  1.00  0.46           O  
ATOM   6146  CB  ALA B 353     -14.821  22.173 -36.850  1.00  0.46           C  
ATOM   6147  N   LEU B 354     -13.500  21.203 -34.149  1.00  0.40           N  
ATOM   6148  CA  LEU B 354     -13.221  20.258 -33.090  1.00  0.40           C  
ATOM   6149  C   LEU B 354     -13.413  20.824 -31.695  1.00  0.40           C  
ATOM   6150  O   LEU B 354     -14.030  20.180 -30.847  1.00  0.40           O  
ATOM   6151  CB  LEU B 354     -11.804  19.689 -33.270  1.00  0.40           C  
ATOM   6152  CG  LEU B 354     -11.708  18.787 -34.519  1.00  0.40           C  
ATOM   6153  CD1 LEU B 354     -10.249  18.535 -34.881  1.00  0.40           C  
ATOM   6154  CD2 LEU B 354     -12.403  17.435 -34.308  1.00  0.40           C  
ATOM   6155  N   LEU B 355     -12.960  22.068 -31.425  1.00  0.45           N  
ATOM   6156  CA  LEU B 355     -13.229  22.743 -30.162  1.00  0.45           C  
ATOM   6157  C   LEU B 355     -14.716  22.955 -29.904  1.00  0.45           C  
ATOM   6158  O   LEU B 355     -15.225  22.641 -28.826  1.00  0.45           O  
ATOM   6159  CB  LEU B 355     -12.537  24.127 -30.107  1.00  0.45           C  
ATOM   6160  CG  LEU B 355     -11.005  24.100 -29.933  1.00  0.45           C  
ATOM   6161  CD1 LEU B 355     -10.470  25.537 -30.002  1.00  0.45           C  
ATOM   6162  CD2 LEU B 355     -10.563  23.454 -28.613  1.00  0.45           C  
ATOM   6163  N   SER B 356     -15.470  23.427 -30.918  1.00  0.44           N  
ATOM   6164  CA  SER B 356     -16.918  23.583 -30.856  1.00  0.44           C  
ATOM   6165  C   SER B 356     -17.652  22.274 -30.645  1.00  0.44           C  
ATOM   6166  O   SER B 356     -18.616  22.186 -29.887  1.00  0.44           O  
ATOM   6167  CB  SER B 356     -17.479  24.240 -32.139  1.00  0.44           C  
ATOM   6168  OG  SER B 356     -17.108  25.614 -32.166  1.00  0.44           O  
ATOM   6169  N   ARG B 357     -17.220  21.186 -31.308  1.00  0.44           N  
ATOM   6170  CA  ARG B 357     -17.757  19.859 -31.073  1.00  0.44           C  
ATOM   6171  C   ARG B 357     -17.486  19.314 -29.678  1.00  0.44           C  
ATOM   6172  O   ARG B 357     -18.402  18.821 -29.025  1.00  0.44           O  
ATOM   6173  CB  ARG B 357     -17.232  18.884 -32.148  1.00  0.44           C  
ATOM   6174  CG  ARG B 357     -17.927  17.507 -32.152  1.00  0.44           C  
ATOM   6175  CD  ARG B 357     -17.445  16.627 -33.309  1.00  0.44           C  
ATOM   6176  NE  ARG B 357     -18.206  15.337 -33.252  1.00  0.44           N  
ATOM   6177  CZ  ARG B 357     -18.046  14.341 -34.134  1.00  0.44           C  
ATOM   6178  NH1 ARG B 357     -17.188  14.435 -35.146  1.00  0.44           N  
ATOM   6179  NH2 ARG B 357     -18.764  13.227 -34.005  1.00  0.44           N  
ATOM   6180  N   SER B 358     -16.248  19.449 -29.164  1.00  0.55           N  
ATOM   6181  CA  SER B 358     -15.879  19.065 -27.804  1.00  0.55           C  
ATOM   6182  C   SER B 358     -16.636  19.834 -26.749  1.00  0.55           C  
ATOM   6183  O   SER B 358     -17.091  19.275 -25.754  1.00  0.55           O  
ATOM   6184  CB  SER B 358     -14.373  19.280 -27.538  1.00  0.55           C  
ATOM   6185  OG  SER B 358     -13.625  18.345 -28.312  1.00  0.55           O  
ATOM   6186  N   SER B 359     -16.824  21.151 -26.962  1.00  0.55           N  
ATOM   6187  CA  SER B 359     -17.643  21.979 -26.089  1.00  0.55           C  
ATOM   6188  C   SER B 359     -19.107  21.552 -26.044  1.00  0.55           C  
ATOM   6189  O   SER B 359     -19.683  21.392 -24.972  1.00  0.55           O  
ATOM   6190  CB  SER B 359     -17.549  23.474 -26.472  1.00  0.55           C  
ATOM   6191  OG  SER B 359     -17.929  24.289 -25.361  1.00  0.55           O  
ATOM   6192  N   ARG B 360     -19.723  21.253 -27.211  1.00  0.46           N  
ATOM   6193  CA  ARG B 360     -21.078  20.720 -27.277  1.00  0.46           C  
ATOM   6194  C   ARG B 360     -21.245  19.367 -26.599  1.00  0.46           C  
ATOM   6195  O   ARG B 360     -22.231  19.135 -25.903  1.00  0.46           O  
ATOM   6196  CB  ARG B 360     -21.567  20.569 -28.743  1.00  0.46           C  
ATOM   6197  CG  ARG B 360     -21.947  21.907 -29.406  1.00  0.46           C  
ATOM   6198  CD  ARG B 360     -22.664  21.758 -30.754  1.00  0.46           C  
ATOM   6199  NE  ARG B 360     -21.672  21.215 -31.735  1.00  0.46           N  
ATOM   6200  CZ  ARG B 360     -21.967  20.894 -33.002  1.00  0.46           C  
ATOM   6201  NH1 ARG B 360     -23.200  21.013 -33.486  1.00  0.46           N  
ATOM   6202  NH2 ARG B 360     -21.004  20.450 -33.807  1.00  0.46           N  
ATOM   6203  N   LEU B 361     -20.278  18.439 -26.764  1.00  0.54           N  
ATOM   6204  CA  LEU B 361     -20.286  17.157 -26.073  1.00  0.54           C  
ATOM   6205  C   LEU B 361     -20.264  17.308 -24.558  1.00  0.54           C  
ATOM   6206  O   LEU B 361     -20.984  16.620 -23.835  1.00  0.54           O  
ATOM   6207  CB  LEU B 361     -19.076  16.287 -26.495  1.00  0.54           C  
ATOM   6208  CG  LEU B 361     -19.173  15.702 -27.919  1.00  0.54           C  
ATOM   6209  CD1 LEU B 361     -17.834  15.061 -28.313  1.00  0.54           C  
ATOM   6210  CD2 LEU B 361     -20.306  14.670 -28.034  1.00  0.54           C  
ATOM   6211  N   LEU B 362     -19.462  18.258 -24.040  1.00  0.54           N  
ATOM   6212  CA  LEU B 362     -19.454  18.612 -22.636  1.00  0.54           C  
ATOM   6213  C   LEU B 362     -20.786  19.147 -22.137  1.00  0.54           C  
ATOM   6214  O   LEU B 362     -21.287  18.692 -21.112  1.00  0.54           O  
ATOM   6215  CB  LEU B 362     -18.350  19.660 -22.391  1.00  0.54           C  
ATOM   6216  CG  LEU B 362     -18.267  20.237 -20.966  1.00  0.54           C  
ATOM   6217  CD1 LEU B 362     -18.090  19.152 -19.906  1.00  0.54           C  
ATOM   6218  CD2 LEU B 362     -17.089  21.204 -20.905  1.00  0.54           C  
ATOM   6219  N   ASP B 363     -21.436  20.070 -22.875  1.00  0.48           N  
ATOM   6220  CA  ASP B 363     -22.748  20.581 -22.516  1.00  0.48           C  
ATOM   6221  C   ASP B 363     -23.816  19.491 -22.473  1.00  0.48           C  
ATOM   6222  O   ASP B 363     -24.608  19.416 -21.536  1.00  0.48           O  
ATOM   6223  CB  ASP B 363     -23.181  21.701 -23.488  1.00  0.48           C  
ATOM   6224  CG  ASP B 363     -22.353  22.952 -23.262  1.00  0.48           C  
ATOM   6225  OD1 ASP B 363     -21.941  23.231 -22.100  1.00  0.48           O  
ATOM   6226  OD2 ASP B 363     -22.094  23.648 -24.273  1.00  0.48           O  
ATOM   6227  N   GLN B 364     -23.819  18.566 -23.456  1.00  0.49           N  
ATOM   6228  CA  GLN B 364     -24.706  17.414 -23.465  1.00  0.49           C  
ATOM   6229  C   GLN B 364     -24.509  16.473 -22.277  1.00  0.49           C  
ATOM   6230  O   GLN B 364     -25.472  16.058 -21.631  1.00  0.49           O  
ATOM   6231  CB  GLN B 364     -24.507  16.619 -24.779  1.00  0.49           C  
ATOM   6232  CG  GLN B 364     -25.028  17.370 -26.026  1.00  0.49           C  
ATOM   6233  CD  GLN B 364     -24.671  16.628 -27.313  1.00  0.49           C  
ATOM   6234  OE1 GLN B 364     -23.848  15.716 -27.363  1.00  0.49           O  
ATOM   6235  NE2 GLN B 364     -25.318  17.038 -28.429  1.00  0.49           N  
ATOM   6236  N   LEU B 365     -23.248  16.144 -21.926  1.00  0.43           N  
ATOM   6237  CA  LEU B 365     -22.933  15.359 -20.742  1.00  0.43           C  
ATOM   6238  C   LEU B 365     -23.290  16.058 -19.438  1.00  0.43           C  
ATOM   6239  O   LEU B 365     -23.866  15.457 -18.532  1.00  0.43           O  
ATOM   6240  CB  LEU B 365     -21.428  15.009 -20.706  1.00  0.43           C  
ATOM   6241  CG  LEU B 365     -20.989  13.927 -21.710  1.00  0.43           C  
ATOM   6242  CD1 LEU B 365     -19.458  13.844 -21.727  1.00  0.43           C  
ATOM   6243  CD2 LEU B 365     -21.583  12.551 -21.373  1.00  0.43           C  
ATOM   6244  N   SER B 366     -22.982  17.364 -19.323  1.00  0.53           N  
ATOM   6245  CA  SER B 366     -23.308  18.181 -18.165  1.00  0.53           C  
ATOM   6246  C   SER B 366     -24.791  18.282 -17.926  1.00  0.53           C  
ATOM   6247  O   SER B 366     -25.238  18.167 -16.788  1.00  0.53           O  
ATOM   6248  CB  SER B 366     -22.771  19.628 -18.285  1.00  0.53           C  
ATOM   6249  OG  SER B 366     -21.353  19.625 -18.151  1.00  0.53           O  
ATOM   6250  N   GLU B 367     -25.599  18.471 -18.990  1.00  0.42           N  
ATOM   6251  CA  GLU B 367     -27.045  18.489 -18.879  1.00  0.42           C  
ATOM   6252  C   GLU B 367     -27.624  17.160 -18.420  1.00  0.42           C  
ATOM   6253  O   GLU B 367     -28.393  17.092 -17.468  1.00  0.42           O  
ATOM   6254  CB  GLU B 367     -27.681  18.905 -20.227  1.00  0.42           C  
ATOM   6255  CG  GLU B 367     -29.178  19.305 -20.140  1.00  0.42           C  
ATOM   6256  CD  GLU B 367     -29.446  20.601 -19.363  1.00  0.42           C  
ATOM   6257  OE1 GLU B 367     -30.636  21.013 -19.356  1.00  0.42           O  
ATOM   6258  OE2 GLU B 367     -28.510  21.192 -18.761  1.00  0.42           O  
ATOM   6259  N   GLY B 368     -27.182  16.025 -19.012  1.00  0.37           N  
ATOM   6260  CA  GLY B 368     -27.671  14.703 -18.614  1.00  0.37           C  
ATOM   6261  C   GLY B 368     -27.405  14.328 -17.175  1.00  0.37           C  
ATOM   6262  O   GLY B 368     -28.210  13.658 -16.534  1.00  0.37           O  
ATOM   6263  N   SER B 369     -26.285  14.809 -16.606  1.00  0.36           N  
ATOM   6264  CA  SER B 369     -25.961  14.613 -15.199  1.00  0.36           C  
ATOM   6265  C   SER B 369     -26.774  15.491 -14.253  1.00  0.36           C  
ATOM   6266  O   SER B 369     -26.878  15.185 -13.067  1.00  0.36           O  
ATOM   6267  CB  SER B 369     -24.459  14.892 -14.904  1.00  0.36           C  
ATOM   6268  OG  SER B 369     -23.616  13.898 -15.494  1.00  0.36           O  
ATOM   6269  N   ARG B 370     -27.386  16.599 -14.730  1.00  0.27           N  
ATOM   6270  CA  ARG B 370     -28.239  17.452 -13.911  1.00  0.27           C  
ATOM   6271  C   ARG B 370     -29.620  16.863 -13.676  1.00  0.27           C  
ATOM   6272  O   ARG B 370     -30.213  17.046 -12.615  1.00  0.27           O  
ATOM   6273  CB  ARG B 370     -28.407  18.866 -14.526  1.00  0.27           C  
ATOM   6274  CG  ARG B 370     -27.131  19.726 -14.463  1.00  0.27           C  
ATOM   6275  CD  ARG B 370     -27.340  21.098 -15.108  1.00  0.27           C  
ATOM   6276  NE  ARG B 370     -26.018  21.806 -15.064  1.00  0.27           N  
ATOM   6277  CZ  ARG B 370     -25.876  23.124 -15.252  1.00  0.27           C  
ATOM   6278  NH1 ARG B 370     -26.930  23.918 -15.416  1.00  0.27           N  
ATOM   6279  NH2 ARG B 370     -24.655  23.656 -15.267  1.00  0.27           N  
ATOM   6280  N   HIS B 371     -30.177  16.157 -14.677  1.00  0.20           N  
ATOM   6281  CA  HIS B 371     -31.571  15.742 -14.649  1.00  0.20           C  
ATOM   6282  C   HIS B 371     -31.774  14.386 -14.011  1.00  0.20           C  
ATOM   6283  O   HIS B 371     -32.871  14.077 -13.551  1.00  0.20           O  
ATOM   6284  CB  HIS B 371     -32.169  15.696 -16.077  1.00  0.20           C  
ATOM   6285  CG  HIS B 371     -32.380  17.054 -16.661  1.00  0.20           C  
ATOM   6286  ND1 HIS B 371     -31.284  17.785 -17.041  1.00  0.20           N  
ATOM   6287  CD2 HIS B 371     -33.518  17.769 -16.864  1.00  0.20           C  
ATOM   6288  CE1 HIS B 371     -31.758  18.933 -17.472  1.00  0.20           C  
ATOM   6289  NE2 HIS B 371     -33.109  18.977 -17.389  1.00  0.20           N  
ATOM   6290  N   GLN B 372     -30.721  13.557 -13.922  1.00  0.25           N  
ATOM   6291  CA  GLN B 372     -30.838  12.246 -13.326  1.00  0.25           C  
ATOM   6292  C   GLN B 372     -29.453  11.677 -13.140  1.00  0.25           C  
ATOM   6293  O   GLN B 372     -28.801  11.220 -14.076  1.00  0.25           O  
ATOM   6294  CB  GLN B 372     -31.685  11.260 -14.185  1.00  0.25           C  
ATOM   6295  CG  GLN B 372     -32.234  10.052 -13.390  1.00  0.25           C  
ATOM   6296  CD  GLN B 372     -33.209   9.235 -14.240  1.00  0.25           C  
ATOM   6297  OE1 GLN B 372     -33.407   9.445 -15.435  1.00  0.25           O  
ATOM   6298  NE2 GLN B 372     -33.869   8.249 -13.590  1.00  0.25           N  
ATOM   6299  N   LEU B 373     -28.935  11.684 -11.896  1.00  0.29           N  
ATOM   6300  CA  LEU B 373     -27.718  10.961 -11.594  1.00  0.29           C  
ATOM   6301  C   LEU B 373     -27.944   9.454 -11.751  1.00  0.29           C  
ATOM   6302  O   LEU B 373     -28.960   8.955 -11.258  1.00  0.29           O  
ATOM   6303  CB  LEU B 373     -27.199  11.287 -10.173  1.00  0.29           C  
ATOM   6304  CG  LEU B 373     -26.582  12.697 -10.068  1.00  0.29           C  
ATOM   6305  CD1 LEU B 373     -26.606  13.206  -8.620  1.00  0.29           C  
ATOM   6306  CD2 LEU B 373     -25.145  12.715 -10.615  1.00  0.29           C  
ATOM   6307  N   PRO B 374     -27.086   8.684 -12.431  1.00  0.29           N  
ATOM   6308  CA  PRO B 374     -27.156   7.234 -12.426  1.00  0.29           C  
ATOM   6309  C   PRO B 374     -27.115   6.672 -11.018  1.00  0.29           C  
ATOM   6310  O   PRO B 374     -26.414   7.205 -10.161  1.00  0.29           O  
ATOM   6311  CB  PRO B 374     -25.994   6.745 -13.323  1.00  0.29           C  
ATOM   6312  CG  PRO B 374     -25.190   7.986 -13.748  1.00  0.29           C  
ATOM   6313  CD  PRO B 374     -25.904   9.188 -13.124  1.00  0.29           C  
ATOM   6314  N   GLY B 375     -27.832   5.558 -10.756  1.00  0.33           N  
ATOM   6315  CA  GLY B 375     -27.762   4.900  -9.450  1.00  0.33           C  
ATOM   6316  C   GLY B 375     -26.464   4.143  -9.271  1.00  0.33           C  
ATOM   6317  O   GLY B 375     -26.117   3.676  -8.192  1.00  0.33           O  
ATOM   6318  N   ASN B 376     -25.682   4.054 -10.360  1.00  0.29           N  
ATOM   6319  CA  ASN B 376     -24.316   3.597 -10.364  1.00  0.29           C  
ATOM   6320  C   ASN B 376     -23.375   4.781 -10.121  1.00  0.29           C  
ATOM   6321  O   ASN B 376     -23.114   5.611 -10.994  1.00  0.29           O  
ATOM   6322  CB  ASN B 376     -24.021   2.892 -11.716  1.00  0.29           C  
ATOM   6323  CG  ASN B 376     -22.671   2.182 -11.719  1.00  0.29           C  
ATOM   6324  OD1 ASN B 376     -21.721   2.575 -11.042  1.00  0.29           O  
ATOM   6325  ND2 ASN B 376     -22.562   1.107 -12.529  1.00  0.29           N  
ATOM   6326  N   ARG B 377     -22.802   4.827  -8.902  1.00  0.37           N  
ATOM   6327  CA  ARG B 377     -21.857   5.824  -8.433  1.00  0.37           C  
ATOM   6328  C   ARG B 377     -20.580   5.903  -9.264  1.00  0.37           C  
ATOM   6329  O   ARG B 377     -20.057   6.987  -9.533  1.00  0.37           O  
ATOM   6330  CB  ARG B 377     -21.505   5.490  -6.959  1.00  0.37           C  
ATOM   6331  CG  ARG B 377     -20.621   6.526  -6.230  1.00  0.37           C  
ATOM   6332  CD  ARG B 377     -20.413   6.171  -4.751  1.00  0.37           C  
ATOM   6333  NE  ARG B 377     -19.509   7.207  -4.145  1.00  0.37           N  
ATOM   6334  CZ  ARG B 377     -19.337   7.380  -2.828  1.00  0.37           C  
ATOM   6335  NH1 ARG B 377     -20.033   6.677  -1.937  1.00  0.37           N  
ATOM   6336  NH2 ARG B 377     -18.455   8.279  -2.391  1.00  0.37           N  
ATOM   6337  N   GLN B 378     -20.059   4.740  -9.703  1.00  0.42           N  
ATOM   6338  CA  GLN B 378     -18.865   4.635 -10.517  1.00  0.42           C  
ATOM   6339  C   GLN B 378     -19.032   5.232 -11.908  1.00  0.42           C  
ATOM   6340  O   GLN B 378     -18.161   5.939 -12.416  1.00  0.42           O  
ATOM   6341  CB  GLN B 378     -18.431   3.154 -10.628  1.00  0.42           C  
ATOM   6342  CG  GLN B 378     -17.026   2.990 -11.247  1.00  0.42           C  
ATOM   6343  CD  GLN B 378     -16.568   1.535 -11.271  1.00  0.42           C  
ATOM   6344  OE1 GLN B 378     -17.340   0.582 -11.252  1.00  0.42           O  
ATOM   6345  NE2 GLN B 378     -15.229   1.354 -11.359  1.00  0.42           N  
ATOM   6346  N   LEU B 379     -20.191   4.991 -12.555  1.00  0.38           N  
ATOM   6347  CA  LEU B 379     -20.532   5.585 -13.837  1.00  0.38           C  
ATOM   6348  C   LEU B 379     -20.631   7.102 -13.771  1.00  0.38           C  
ATOM   6349  O   LEU B 379     -20.122   7.818 -14.634  1.00  0.38           O  
ATOM   6350  CB  LEU B 379     -21.859   4.990 -14.363  1.00  0.38           C  
ATOM   6351  CG  LEU B 379     -22.294   5.481 -15.762  1.00  0.38           C  
ATOM   6352  CD1 LEU B 379     -21.269   5.130 -16.853  1.00  0.38           C  
ATOM   6353  CD2 LEU B 379     -23.663   4.894 -16.130  1.00  0.38           C  
ATOM   6354  N   ALA B 380     -21.241   7.634 -12.693  1.00  0.45           N  
ATOM   6355  CA  ALA B 380     -21.291   9.056 -12.431  1.00  0.45           C  
ATOM   6356  C   ALA B 380     -19.909   9.684 -12.260  1.00  0.45           C  
ATOM   6357  O   ALA B 380     -19.611  10.724 -12.843  1.00  0.45           O  
ATOM   6358  CB  ALA B 380     -22.140   9.298 -11.169  1.00  0.45           C  
ATOM   6359  N   GLY B 381     -19.006   9.029 -11.495  1.00  0.52           N  
ATOM   6360  CA  GLY B 381     -17.589   9.390 -11.408  1.00  0.52           C  
ATOM   6361  C   GLY B 381     -16.862   9.490 -12.728  1.00  0.52           C  
ATOM   6362  O   GLY B 381     -16.200  10.484 -13.014  1.00  0.52           O  
ATOM   6363  N   ARG B 382     -16.985   8.455 -13.582  1.00  0.44           N  
ATOM   6364  CA  ARG B 382     -16.414   8.434 -14.921  1.00  0.44           C  
ATOM   6365  C   ARG B 382     -16.970   9.514 -15.836  1.00  0.44           C  
ATOM   6366  O   ARG B 382     -16.239  10.119 -16.616  1.00  0.44           O  
ATOM   6367  CB  ARG B 382     -16.640   7.064 -15.601  1.00  0.44           C  
ATOM   6368  CG  ARG B 382     -15.845   5.911 -14.957  1.00  0.44           C  
ATOM   6369  CD  ARG B 382     -16.093   4.588 -15.684  1.00  0.44           C  
ATOM   6370  NE  ARG B 382     -15.266   3.536 -15.016  1.00  0.44           N  
ATOM   6371  CZ  ARG B 382     -15.253   2.251 -15.391  1.00  0.44           C  
ATOM   6372  NH1 ARG B 382     -16.031   1.799 -16.371  1.00  0.44           N  
ATOM   6373  NH2 ARG B 382     -14.438   1.402 -14.772  1.00  0.44           N  
ATOM   6374  N   SER B 383     -18.286   9.802 -15.749  1.00  0.50           N  
ATOM   6375  CA  SER B 383     -18.907  10.901 -16.485  1.00  0.50           C  
ATOM   6376  C   SER B 383     -18.306  12.250 -16.123  1.00  0.50           C  
ATOM   6377  O   SER B 383     -17.930  13.026 -16.997  1.00  0.50           O  
ATOM   6378  CB  SER B 383     -20.445  10.946 -16.252  1.00  0.50           C  
ATOM   6379  OG  SER B 383     -21.085  11.964 -17.032  1.00  0.50           O  
ATOM   6380  N   TYR B 384     -18.111  12.530 -14.819  1.00  0.53           N  
ATOM   6381  CA  TYR B 384     -17.421  13.725 -14.362  1.00  0.53           C  
ATOM   6382  C   TYR B 384     -15.959  13.811 -14.809  1.00  0.53           C  
ATOM   6383  O   TYR B 384     -15.492  14.883 -15.189  1.00  0.53           O  
ATOM   6384  CB  TYR B 384     -17.513  13.864 -12.819  1.00  0.53           C  
ATOM   6385  CG  TYR B 384     -18.892  14.282 -12.382  1.00  0.53           C  
ATOM   6386  CD1 TYR B 384     -19.441  15.494 -12.838  1.00  0.53           C  
ATOM   6387  CD2 TYR B 384     -19.633  13.505 -11.475  1.00  0.53           C  
ATOM   6388  CE1 TYR B 384     -20.714  15.904 -12.422  1.00  0.53           C  
ATOM   6389  CE2 TYR B 384     -20.907  13.915 -11.053  1.00  0.53           C  
ATOM   6390  CZ  TYR B 384     -21.446  15.114 -11.533  1.00  0.53           C  
ATOM   6391  OH  TYR B 384     -22.724  15.540 -11.126  1.00  0.53           O  
ATOM   6392  N   ASP B 385     -15.204  12.686 -14.817  1.00  0.56           N  
ATOM   6393  CA  ASP B 385     -13.844  12.627 -15.352  1.00  0.56           C  
ATOM   6394  C   ASP B 385     -13.792  12.961 -16.848  1.00  0.56           C  
ATOM   6395  O   ASP B 385     -13.008  13.786 -17.311  1.00  0.56           O  
ATOM   6396  CB  ASP B 385     -13.258  11.207 -15.085  1.00  0.56           C  
ATOM   6397  CG  ASP B 385     -11.748  11.089 -15.243  1.00  0.56           C  
ATOM   6398  OD1 ASP B 385     -11.052  12.066 -15.620  1.00  0.56           O  
ATOM   6399  OD2 ASP B 385     -11.239   9.984 -14.914  1.00  0.56           O  
ATOM   6400  N   LEU B 386     -14.702  12.385 -17.658  1.00  0.61           N  
ATOM   6401  CA  LEU B 386     -14.793  12.705 -19.071  1.00  0.61           C  
ATOM   6402  C   LEU B 386     -15.168  14.158 -19.340  1.00  0.61           C  
ATOM   6403  O   LEU B 386     -14.597  14.820 -20.208  1.00  0.61           O  
ATOM   6404  CB  LEU B 386     -15.796  11.757 -19.764  1.00  0.61           C  
ATOM   6405  CG  LEU B 386     -15.935  11.947 -21.291  1.00  0.61           C  
ATOM   6406  CD1 LEU B 386     -14.593  11.783 -22.024  1.00  0.61           C  
ATOM   6407  CD2 LEU B 386     -16.968  10.963 -21.857  1.00  0.61           C  
ATOM   6408  N   GLN B 387     -16.113  14.715 -18.556  1.00  0.63           N  
ATOM   6409  CA  GLN B 387     -16.452  16.126 -18.594  1.00  0.63           C  
ATOM   6410  C   GLN B 387     -15.273  17.029 -18.255  1.00  0.63           C  
ATOM   6411  O   GLN B 387     -15.025  18.021 -18.939  1.00  0.63           O  
ATOM   6412  CB  GLN B 387     -17.612  16.436 -17.618  1.00  0.63           C  
ATOM   6413  CG  GLN B 387     -18.968  15.850 -18.066  1.00  0.63           C  
ATOM   6414  CD  GLN B 387     -20.037  16.049 -16.993  1.00  0.63           C  
ATOM   6415  OE1 GLN B 387     -20.098  17.054 -16.288  1.00  0.63           O  
ATOM   6416  NE2 GLN B 387     -20.946  15.059 -16.856  1.00  0.63           N  
ATOM   6417  N   ALA B 388     -14.479  16.684 -17.222  1.00  0.66           N  
ATOM   6418  CA  ALA B 388     -13.270  17.401 -16.870  1.00  0.66           C  
ATOM   6419  C   ALA B 388     -12.221  17.403 -17.980  1.00  0.66           C  
ATOM   6420  O   ALA B 388     -11.637  18.441 -18.295  1.00  0.66           O  
ATOM   6421  CB  ALA B 388     -12.674  16.801 -15.583  1.00  0.66           C  
ATOM   6422  N   LEU B 389     -12.000  16.251 -18.647  1.00  0.64           N  
ATOM   6423  CA  LEU B 389     -11.142  16.160 -19.813  1.00  0.64           C  
ATOM   6424  C   LEU B 389     -11.624  16.992 -20.997  1.00  0.64           C  
ATOM   6425  O   LEU B 389     -10.851  17.716 -21.620  1.00  0.64           O  
ATOM   6426  CB  LEU B 389     -10.984  14.686 -20.262  1.00  0.64           C  
ATOM   6427  CG  LEU B 389      -9.998  14.478 -21.438  1.00  0.64           C  
ATOM   6428  CD1 LEU B 389      -8.569  14.907 -21.068  1.00  0.64           C  
ATOM   6429  CD2 LEU B 389     -10.004  13.023 -21.920  1.00  0.64           C  
ATOM   6430  N   LEU B 390     -12.933  16.957 -21.323  1.00  0.61           N  
ATOM   6431  CA  LEU B 390     -13.508  17.782 -22.375  1.00  0.61           C  
ATOM   6432  C   LEU B 390     -13.391  19.262 -22.082  1.00  0.61           C  
ATOM   6433  O   LEU B 390     -13.034  20.036 -22.965  1.00  0.61           O  
ATOM   6434  CB  LEU B 390     -14.993  17.438 -22.629  1.00  0.61           C  
ATOM   6435  CG  LEU B 390     -15.214  16.098 -23.355  1.00  0.61           C  
ATOM   6436  CD1 LEU B 390     -16.694  15.708 -23.282  1.00  0.61           C  
ATOM   6437  CD2 LEU B 390     -14.769  16.163 -24.825  1.00  0.61           C  
ATOM   6438  N   ALA B 391     -13.631  19.675 -20.820  1.00  0.65           N  
ATOM   6439  CA  ALA B 391     -13.444  21.033 -20.354  1.00  0.65           C  
ATOM   6440  C   ALA B 391     -12.007  21.513 -20.492  1.00  0.65           C  
ATOM   6441  O   ALA B 391     -11.755  22.613 -20.978  1.00  0.65           O  
ATOM   6442  CB  ALA B 391     -13.913  21.136 -18.890  1.00  0.65           C  
ATOM   6443  N   LEU B 392     -11.024  20.661 -20.135  1.00  0.58           N  
ATOM   6444  CA  LEU B 392      -9.614  20.931 -20.349  1.00  0.58           C  
ATOM   6445  C   LEU B 392      -9.252  21.105 -21.820  1.00  0.58           C  
ATOM   6446  O   LEU B 392      -8.618  22.082 -22.208  1.00  0.58           O  
ATOM   6447  CB  LEU B 392      -8.792  19.766 -19.738  1.00  0.58           C  
ATOM   6448  CG  LEU B 392      -7.258  19.911 -19.807  1.00  0.58           C  
ATOM   6449  CD1 LEU B 392      -6.755  21.088 -18.961  1.00  0.58           C  
ATOM   6450  CD2 LEU B 392      -6.590  18.605 -19.352  1.00  0.58           C  
ATOM   6451  N   THR B 393      -9.712  20.187 -22.691  1.00  0.53           N  
ATOM   6452  CA  THR B 393      -9.478  20.220 -24.133  1.00  0.53           C  
ATOM   6453  C   THR B 393     -10.092  21.425 -24.816  1.00  0.53           C  
ATOM   6454  O   THR B 393      -9.511  21.991 -25.739  1.00  0.53           O  
ATOM   6455  CB  THR B 393      -9.967  18.952 -24.827  1.00  0.53           C  
ATOM   6456  OG1 THR B 393      -9.333  17.823 -24.247  1.00  0.53           O  
ATOM   6457  CG2 THR B 393      -9.579  18.922 -26.314  1.00  0.53           C  
ATOM   6458  N   CYS B 394     -11.294  21.873 -24.396  1.00  0.53           N  
ATOM   6459  CA  CYS B 394     -11.963  22.980 -25.062  1.00  0.53           C  
ATOM   6460  C   CYS B 394     -11.734  24.334 -24.406  1.00  0.53           C  
ATOM   6461  O   CYS B 394     -12.321  25.334 -24.812  1.00  0.53           O  
ATOM   6462  CB  CYS B 394     -13.481  22.717 -25.248  1.00  0.53           C  
ATOM   6463  SG  CYS B 394     -14.444  22.698 -23.695  1.00  0.53           S  
ATOM   6464  N   GLY B 395     -10.846  24.419 -23.395  1.00  0.57           N  
ATOM   6465  CA  GLY B 395     -10.455  25.696 -22.807  1.00  0.57           C  
ATOM   6466  C   GLY B 395     -11.339  26.235 -21.710  1.00  0.57           C  
ATOM   6467  O   GLY B 395     -11.146  27.362 -21.264  1.00  0.57           O  
ATOM   6468  N   ARG B 396     -12.313  25.447 -21.219  1.00  0.55           N  
ATOM   6469  CA  ARG B 396     -13.144  25.773 -20.063  1.00  0.55           C  
ATOM   6470  C   ARG B 396     -12.445  25.361 -18.771  1.00  0.55           C  
ATOM   6471  O   ARG B 396     -12.862  24.462 -18.039  1.00  0.55           O  
ATOM   6472  CB  ARG B 396     -14.539  25.107 -20.167  1.00  0.55           C  
ATOM   6473  CG  ARG B 396     -15.347  25.610 -21.382  1.00  0.55           C  
ATOM   6474  CD  ARG B 396     -16.599  24.787 -21.707  1.00  0.55           C  
ATOM   6475  NE  ARG B 396     -17.667  25.070 -20.711  1.00  0.55           N  
ATOM   6476  CZ  ARG B 396     -18.916  24.591 -20.783  1.00  0.55           C  
ATOM   6477  NH1 ARG B 396     -19.335  23.823 -21.773  1.00  0.55           N  
ATOM   6478  NH2 ARG B 396     -19.744  24.827 -19.781  1.00  0.55           N  
ATOM   6479  N   TYR B 397     -11.298  26.009 -18.489  1.00  0.46           N  
ATOM   6480  CA  TYR B 397     -10.355  25.640 -17.448  1.00  0.46           C  
ATOM   6481  C   TYR B 397     -10.881  25.838 -16.038  1.00  0.46           C  
ATOM   6482  O   TYR B 397     -10.461  25.161 -15.102  1.00  0.46           O  
ATOM   6483  CB  TYR B 397      -9.039  26.455 -17.579  1.00  0.46           C  
ATOM   6484  CG  TYR B 397      -8.357  26.240 -18.906  1.00  0.46           C  
ATOM   6485  CD1 TYR B 397      -8.050  24.946 -19.363  1.00  0.46           C  
ATOM   6486  CD2 TYR B 397      -7.969  27.343 -19.688  1.00  0.46           C  
ATOM   6487  CE1 TYR B 397      -7.371  24.761 -20.577  1.00  0.46           C  
ATOM   6488  CE2 TYR B 397      -7.289  27.159 -20.901  1.00  0.46           C  
ATOM   6489  CZ  TYR B 397      -6.989  25.866 -21.341  1.00  0.46           C  
ATOM   6490  OH  TYR B 397      -6.311  25.673 -22.560  1.00  0.46           O  
ATOM   6491  N   ASP B 398     -11.832  26.763 -15.864  1.00  0.53           N  
ATOM   6492  CA  ASP B 398     -12.529  27.076 -14.643  1.00  0.53           C  
ATOM   6493  C   ASP B 398     -13.375  25.913 -14.127  1.00  0.53           C  
ATOM   6494  O   ASP B 398     -13.441  25.643 -12.927  1.00  0.53           O  
ATOM   6495  CB  ASP B 398     -13.360  28.368 -14.875  1.00  0.53           C  
ATOM   6496  CG  ASP B 398     -14.271  28.306 -16.098  1.00  0.53           C  
ATOM   6497  OD1 ASP B 398     -13.761  28.002 -17.211  1.00  0.53           O  
ATOM   6498  OD2 ASP B 398     -15.479  28.577 -15.918  1.00  0.53           O  
ATOM   6499  N   GLU B 399     -14.006  25.163 -15.048  1.00  0.63           N  
ATOM   6500  CA  GLU B 399     -14.820  24.005 -14.741  1.00  0.63           C  
ATOM   6501  C   GLU B 399     -14.010  22.750 -14.402  1.00  0.63           C  
ATOM   6502  O   GLU B 399     -14.492  21.852 -13.710  1.00  0.63           O  
ATOM   6503  CB  GLU B 399     -15.772  23.737 -15.929  1.00  0.63           C  
ATOM   6504  CG  GLU B 399     -16.734  24.925 -16.167  1.00  0.63           C  
ATOM   6505  CD  GLU B 399     -17.701  24.684 -17.302  1.00  0.63           C  
ATOM   6506  OE1 GLU B 399     -17.848  25.615 -18.133  1.00  0.63           O  
ATOM   6507  OE2 GLU B 399     -18.341  23.607 -17.390  1.00  0.63           O  
ATOM   6508  N   VAL B 400     -12.724  22.671 -14.823  1.00  0.63           N  
ATOM   6509  CA  VAL B 400     -11.848  21.516 -14.598  1.00  0.63           C  
ATOM   6510  C   VAL B 400     -11.626  21.152 -13.123  1.00  0.63           C  
ATOM   6511  O   VAL B 400     -11.783  19.966 -12.816  1.00  0.63           O  
ATOM   6512  CB  VAL B 400     -10.502  21.644 -15.331  1.00  0.63           C  
ATOM   6513  CG1 VAL B 400      -9.587  20.420 -15.098  1.00  0.63           C  
ATOM   6514  CG2 VAL B 400     -10.754  21.782 -16.841  1.00  0.63           C  
ATOM   6515  N   PRO B 401     -11.327  22.024 -12.141  1.00  0.58           N  
ATOM   6516  CA  PRO B 401     -11.195  21.620 -10.743  1.00  0.58           C  
ATOM   6517  C   PRO B 401     -12.476  21.075 -10.150  1.00  0.58           C  
ATOM   6518  O   PRO B 401     -12.421  20.105  -9.396  1.00  0.58           O  
ATOM   6519  CB  PRO B 401     -10.743  22.899 -10.008  1.00  0.58           C  
ATOM   6520  CG  PRO B 401     -10.059  23.733 -11.091  1.00  0.58           C  
ATOM   6521  CD  PRO B 401     -10.868  23.400 -12.342  1.00  0.58           C  
ATOM   6522  N   LEU B 402     -13.635  21.685 -10.470  1.00  0.58           N  
ATOM   6523  CA  LEU B 402     -14.923  21.267  -9.948  1.00  0.58           C  
ATOM   6524  C   LEU B 402     -15.336  19.888 -10.435  1.00  0.58           C  
ATOM   6525  O   LEU B 402     -15.669  19.002  -9.650  1.00  0.58           O  
ATOM   6526  CB  LEU B 402     -16.009  22.286 -10.376  1.00  0.58           C  
ATOM   6527  CG  LEU B 402     -15.848  23.692  -9.763  1.00  0.58           C  
ATOM   6528  CD1 LEU B 402     -16.813  24.675 -10.440  1.00  0.58           C  
ATOM   6529  CD2 LEU B 402     -16.091  23.689  -8.246  1.00  0.58           C  
ATOM   6530  N   LEU B 403     -15.249  19.652 -11.759  1.00  0.63           N  
ATOM   6531  CA  LEU B 403     -15.573  18.378 -12.373  1.00  0.63           C  
ATOM   6532  C   LEU B 403     -14.634  17.262 -11.935  1.00  0.63           C  
ATOM   6533  O   LEU B 403     -15.054  16.149 -11.623  1.00  0.63           O  
ATOM   6534  CB  LEU B 403     -15.541  18.524 -13.912  1.00  0.63           C  
ATOM   6535  CG  LEU B 403     -16.633  19.452 -14.485  1.00  0.63           C  
ATOM   6536  CD1 LEU B 403     -16.325  19.811 -15.945  1.00  0.63           C  
ATOM   6537  CD2 LEU B 403     -18.024  18.813 -14.386  1.00  0.63           C  
ATOM   6538  N   LEU B 404     -13.318  17.548 -11.852  1.00  0.62           N  
ATOM   6539  CA  LEU B 404     -12.338  16.605 -11.351  1.00  0.62           C  
ATOM   6540  C   LEU B 404     -12.526  16.251  -9.877  1.00  0.62           C  
ATOM   6541  O   LEU B 404     -12.394  15.092  -9.484  1.00  0.62           O  
ATOM   6542  CB  LEU B 404     -10.913  17.140 -11.615  1.00  0.62           C  
ATOM   6543  CG  LEU B 404      -9.765  16.152 -11.324  1.00  0.62           C  
ATOM   6544  CD1 LEU B 404      -9.908  14.859 -12.139  1.00  0.62           C  
ATOM   6545  CD2 LEU B 404      -8.418  16.817 -11.638  1.00  0.62           C  
ATOM   6546  N   GLY B 405     -12.873  17.237  -9.016  1.00  0.64           N  
ATOM   6547  CA  GLY B 405     -13.332  17.019  -7.640  1.00  0.64           C  
ATOM   6548  C   GLY B 405     -14.451  16.023  -7.493  1.00  0.64           C  
ATOM   6549  O   GLY B 405     -14.343  15.052  -6.744  1.00  0.64           O  
ATOM   6550  N   GLU B 406     -15.541  16.224  -8.253  1.00  0.60           N  
ATOM   6551  CA  GLU B 406     -16.682  15.330  -8.299  1.00  0.60           C  
ATOM   6552  C   GLU B 406     -16.337  13.933  -8.799  1.00  0.60           C  
ATOM   6553  O   GLU B 406     -16.872  12.928  -8.325  1.00  0.60           O  
ATOM   6554  CB  GLU B 406     -17.802  15.921  -9.186  1.00  0.60           C  
ATOM   6555  CG  GLU B 406     -18.520  17.152  -8.573  1.00  0.60           C  
ATOM   6556  CD  GLU B 406     -19.248  16.852  -7.264  1.00  0.60           C  
ATOM   6557  OE1 GLU B 406     -19.105  17.656  -6.316  1.00  0.60           O  
ATOM   6558  OE2 GLU B 406     -19.947  15.801  -7.180  1.00  0.60           O  
ATOM   6559  N   ALA B 407     -15.421  13.812  -9.779  1.00  0.61           N  
ATOM   6560  CA  ALA B 407     -14.908  12.525 -10.198  1.00  0.61           C  
ATOM   6561  C   ALA B 407     -14.135  11.789  -9.102  1.00  0.61           C  
ATOM   6562  O   ALA B 407     -14.382  10.617  -8.819  1.00  0.61           O  
ATOM   6563  CB  ALA B 407     -14.008  12.725 -11.429  1.00  0.61           C  
ATOM   6564  N   ARG B 408     -13.226  12.497  -8.403  1.00  0.54           N  
ATOM   6565  CA  ARG B 408     -12.419  11.970  -7.317  1.00  0.54           C  
ATOM   6566  C   ARG B 408     -13.223  11.522  -6.108  1.00  0.54           C  
ATOM   6567  O   ARG B 408     -12.916  10.504  -5.491  1.00  0.54           O  
ATOM   6568  CB  ARG B 408     -11.355  13.002  -6.877  1.00  0.54           C  
ATOM   6569  CG  ARG B 408     -10.209  13.157  -7.899  1.00  0.54           C  
ATOM   6570  CD  ARG B 408      -9.204  14.237  -7.490  1.00  0.54           C  
ATOM   6571  NE  ARG B 408      -8.083  14.244  -8.492  1.00  0.54           N  
ATOM   6572  CZ  ARG B 408      -7.146  15.200  -8.567  1.00  0.54           C  
ATOM   6573  NH1 ARG B 408      -7.198  16.277  -7.784  1.00  0.54           N  
ATOM   6574  NH2 ARG B 408      -6.130  15.073  -9.418  1.00  0.54           N  
ATOM   6575  N   SER B 409     -14.316  12.231  -5.755  1.00  0.60           N  
ATOM   6576  CA  SER B 409     -15.178  11.878  -4.624  1.00  0.60           C  
ATOM   6577  C   SER B 409     -15.945  10.569  -4.839  1.00  0.60           C  
ATOM   6578  O   SER B 409     -16.531   9.966  -3.931  1.00  0.60           O  
ATOM   6579  CB  SER B 409     -16.172  13.032  -4.299  1.00  0.60           C  
ATOM   6580  OG  SER B 409     -17.192  13.174  -5.289  1.00  0.60           O  
ATOM   6581  N   ARG B 410     -15.929  10.087  -6.092  1.00  0.53           N  
ATOM   6582  CA  ARG B 410     -16.537   8.856  -6.528  1.00  0.53           C  
ATOM   6583  C   ARG B 410     -15.508   7.849  -7.014  1.00  0.53           C  
ATOM   6584  O   ARG B 410     -15.878   6.860  -7.641  1.00  0.53           O  
ATOM   6585  CB  ARG B 410     -17.531   9.180  -7.660  1.00  0.53           C  
ATOM   6586  CG  ARG B 410     -18.715  10.036  -7.177  1.00  0.53           C  
ATOM   6587  CD  ARG B 410     -19.570  10.553  -8.333  1.00  0.53           C  
ATOM   6588  NE  ARG B 410     -20.729  11.310  -7.752  1.00  0.53           N  
ATOM   6589  CZ  ARG B 410     -20.641  12.593  -7.373  1.00  0.53           C  
ATOM   6590  NH1 ARG B 410     -19.504  13.267  -7.378  1.00  0.53           N  
ATOM   6591  NH2 ARG B 410     -21.726  13.266  -6.997  1.00  0.53           N  
ATOM   6592  N   GLN B 411     -14.207   8.072  -6.712  1.00  0.44           N  
ATOM   6593  CA  GLN B 411     -13.101   7.168  -7.016  1.00  0.44           C  
ATOM   6594  C   GLN B 411     -12.805   7.028  -8.509  1.00  0.44           C  
ATOM   6595  O   GLN B 411     -12.402   5.977  -9.005  1.00  0.44           O  
ATOM   6596  CB  GLN B 411     -13.240   5.781  -6.330  1.00  0.44           C  
ATOM   6597  CG  GLN B 411     -13.362   5.860  -4.791  1.00  0.44           C  
ATOM   6598  CD  GLN B 411     -13.590   4.478  -4.182  1.00  0.44           C  
ATOM   6599  OE1 GLN B 411     -13.725   3.454  -4.847  1.00  0.44           O  
ATOM   6600  NE2 GLN B 411     -13.650   4.440  -2.831  1.00  0.44           N  
ATOM   6601  N   ALA B 412     -12.958   8.137  -9.250  1.00  0.44           N  
ATOM   6602  CA  ALA B 412     -12.578   8.278 -10.638  1.00  0.44           C  
ATOM   6603  C   ALA B 412     -11.624   9.466 -10.767  1.00  0.44           C  
ATOM   6604  O   ALA B 412     -11.124   9.988  -9.771  1.00  0.44           O  
ATOM   6605  CB  ALA B 412     -13.842   8.458 -11.499  1.00  0.44           C  
ATOM   6606  N   GLY B 413     -11.294   9.932 -11.992  1.00  0.46           N  
ATOM   6607  CA  GLY B 413     -10.417  11.089 -12.142  1.00  0.46           C  
ATOM   6608  C   GLY B 413      -9.035  10.717 -12.556  1.00  0.46           C  
ATOM   6609  O   GLY B 413      -8.144  11.561 -12.546  1.00  0.46           O  
ATOM   6610  N   SER B 414      -8.797   9.450 -12.934  1.00  0.52           N  
ATOM   6611  CA  SER B 414      -7.519   8.997 -13.457  1.00  0.52           C  
ATOM   6612  C   SER B 414      -7.227   9.520 -14.847  1.00  0.52           C  
ATOM   6613  O   SER B 414      -6.096   9.911 -15.126  1.00  0.52           O  
ATOM   6614  CB  SER B 414      -7.343   7.453 -13.436  1.00  0.52           C  
ATOM   6615  OG  SER B 414      -8.375   6.779 -14.160  1.00  0.52           O  
ATOM   6616  N   LEU B 415      -8.231   9.568 -15.750  1.00  0.48           N  
ATOM   6617  CA  LEU B 415      -8.044   9.979 -17.132  1.00  0.48           C  
ATOM   6618  C   LEU B 415      -7.619  11.431 -17.255  1.00  0.48           C  
ATOM   6619  O   LEU B 415      -6.614  11.764 -17.882  1.00  0.48           O  
ATOM   6620  CB  LEU B 415      -9.376   9.769 -17.891  1.00  0.48           C  
ATOM   6621  CG  LEU B 415      -9.382  10.141 -19.386  1.00  0.48           C  
ATOM   6622  CD1 LEU B 415      -8.542   9.177 -20.235  1.00  0.48           C  
ATOM   6623  CD2 LEU B 415     -10.833  10.172 -19.891  1.00  0.48           C  
ATOM   6624  N   THR B 416      -8.346  12.344 -16.585  1.00  0.55           N  
ATOM   6625  CA  THR B 416      -7.987  13.759 -16.556  1.00  0.55           C  
ATOM   6626  C   THR B 416      -6.694  14.027 -15.830  1.00  0.55           C  
ATOM   6627  O   THR B 416      -5.860  14.803 -16.293  1.00  0.55           O  
ATOM   6628  CB  THR B 416      -9.065  14.622 -15.956  1.00  0.55           C  
ATOM   6629  OG1 THR B 416     -10.251  14.416 -16.694  1.00  0.55           O  
ATOM   6630  CG2 THR B 416      -8.742  16.117 -16.098  1.00  0.55           C  
ATOM   6631  N   THR B 417      -6.462  13.352 -14.680  1.00  0.57           N  
ATOM   6632  CA  THR B 417      -5.221  13.492 -13.910  1.00  0.57           C  
ATOM   6633  C   THR B 417      -4.003  13.113 -14.722  1.00  0.57           C  
ATOM   6634  O   THR B 417      -3.054  13.886 -14.814  1.00  0.57           O  
ATOM   6635  CB  THR B 417      -5.219  12.686 -12.616  1.00  0.57           C  
ATOM   6636  OG1 THR B 417      -6.257  13.171 -11.761  1.00  0.57           O  
ATOM   6637  CG2 THR B 417      -3.897  12.837 -11.856  1.00  0.57           C  
ATOM   6638  N   ALA B 418      -4.049  11.964 -15.425  1.00  0.58           N  
ATOM   6639  CA  ALA B 418      -2.966  11.505 -16.269  1.00  0.58           C  
ATOM   6640  C   ALA B 418      -2.635  12.444 -17.423  1.00  0.58           C  
ATOM   6641  O   ALA B 418      -1.471  12.713 -17.721  1.00  0.58           O  
ATOM   6642  CB  ALA B 418      -3.333  10.123 -16.836  1.00  0.58           C  
ATOM   6643  N   THR B 419      -3.660  13.009 -18.094  1.00  0.56           N  
ATOM   6644  CA  THR B 419      -3.465  14.028 -19.123  1.00  0.56           C  
ATOM   6645  C   THR B 419      -2.806  15.278 -18.578  1.00  0.56           C  
ATOM   6646  O   THR B 419      -1.856  15.787 -19.166  1.00  0.56           O  
ATOM   6647  CB  THR B 419      -4.767  14.419 -19.805  1.00  0.56           C  
ATOM   6648  OG1 THR B 419      -5.318  13.267 -20.423  1.00  0.56           O  
ATOM   6649  CG2 THR B 419      -4.547  15.440 -20.932  1.00  0.56           C  
ATOM   6650  N   VAL B 420      -3.241  15.784 -17.404  1.00  0.62           N  
ATOM   6651  CA  VAL B 420      -2.623  16.934 -16.750  1.00  0.62           C  
ATOM   6652  C   VAL B 420      -1.173  16.682 -16.354  1.00  0.62           C  
ATOM   6653  O   VAL B 420      -0.310  17.522 -16.603  1.00  0.62           O  
ATOM   6654  CB  VAL B 420      -3.430  17.400 -15.538  1.00  0.62           C  
ATOM   6655  CG1 VAL B 420      -2.706  18.525 -14.766  1.00  0.62           C  
ATOM   6656  CG2 VAL B 420      -4.795  17.931 -16.022  1.00  0.62           C  
ATOM   6657  N   GLU B 421      -0.854  15.507 -15.774  1.00  0.47           N  
ATOM   6658  CA  GLU B 421       0.507  15.115 -15.435  1.00  0.47           C  
ATOM   6659  C   GLU B 421       1.409  14.990 -16.651  1.00  0.47           C  
ATOM   6660  O   GLU B 421       2.499  15.550 -16.689  1.00  0.47           O  
ATOM   6661  CB  GLU B 421       0.491  13.795 -14.637  1.00  0.47           C  
ATOM   6662  CG  GLU B 421      -0.103  13.996 -13.221  1.00  0.47           C  
ATOM   6663  CD  GLU B 421      -0.380  12.700 -12.465  1.00  0.47           C  
ATOM   6664  OE1 GLU B 421      -0.750  12.829 -11.267  1.00  0.47           O  
ATOM   6665  OE2 GLU B 421      -0.284  11.600 -13.063  1.00  0.47           O  
ATOM   6666  N   SER B 422       0.922  14.351 -17.734  1.00  0.46           N  
ATOM   6667  CA  SER B 422       1.616  14.286 -19.020  1.00  0.46           C  
ATOM   6668  C   SER B 422       1.879  15.656 -19.628  1.00  0.46           C  
ATOM   6669  O   SER B 422       2.961  15.940 -20.136  1.00  0.46           O  
ATOM   6670  CB  SER B 422       0.795  13.446 -20.037  1.00  0.46           C  
ATOM   6671  OG  SER B 422       1.455  13.268 -21.297  1.00  0.46           O  
ATOM   6672  N   LEU B 423       0.900  16.581 -19.565  1.00  0.46           N  
ATOM   6673  CA  LEU B 423       1.124  17.960 -19.956  1.00  0.46           C  
ATOM   6674  C   LEU B 423       2.157  18.662 -19.083  1.00  0.46           C  
ATOM   6675  O   LEU B 423       3.048  19.317 -19.607  1.00  0.46           O  
ATOM   6676  CB  LEU B 423      -0.199  18.768 -19.954  1.00  0.46           C  
ATOM   6677  CG  LEU B 423      -1.220  18.335 -21.032  1.00  0.46           C  
ATOM   6678  CD1 LEU B 423      -2.589  18.971 -20.746  1.00  0.46           C  
ATOM   6679  CD2 LEU B 423      -0.776  18.669 -22.463  1.00  0.46           C  
ATOM   6680  N   ALA B 424       2.105  18.513 -17.745  1.00  0.46           N  
ATOM   6681  CA  ALA B 424       3.047  19.118 -16.820  1.00  0.46           C  
ATOM   6682  C   ALA B 424       4.488  18.653 -16.979  1.00  0.46           C  
ATOM   6683  O   ALA B 424       5.403  19.475 -17.031  1.00  0.46           O  
ATOM   6684  CB  ALA B 424       2.580  18.839 -15.381  1.00  0.46           C  
ATOM   6685  N   ASP B 425       4.700  17.332 -17.139  1.00  0.40           N  
ATOM   6686  CA  ASP B 425       5.979  16.714 -17.429  1.00  0.40           C  
ATOM   6687  C   ASP B 425       6.578  17.221 -18.733  1.00  0.40           C  
ATOM   6688  O   ASP B 425       7.782  17.438 -18.849  1.00  0.40           O  
ATOM   6689  CB  ASP B 425       5.796  15.179 -17.542  1.00  0.40           C  
ATOM   6690  CG  ASP B 425       5.690  14.493 -16.188  1.00  0.40           C  
ATOM   6691  OD1 ASP B 425       5.867  15.163 -15.141  1.00  0.40           O  
ATOM   6692  OD2 ASP B 425       5.478  13.253 -16.216  1.00  0.40           O  
ATOM   6693  N   ARG B 426       5.741  17.438 -19.768  1.00  0.31           N  
ATOM   6694  CA  ARG B 426       6.202  17.982 -21.024  1.00  0.31           C  
ATOM   6695  C   ARG B 426       6.356  19.508 -21.019  1.00  0.31           C  
ATOM   6696  O   ARG B 426       7.131  20.034 -21.807  1.00  0.31           O  
ATOM   6697  CB  ARG B 426       5.279  17.509 -22.173  1.00  0.31           C  
ATOM   6698  CG  ARG B 426       5.256  15.978 -22.389  1.00  0.31           C  
ATOM   6699  CD  ARG B 426       4.320  15.611 -23.544  1.00  0.31           C  
ATOM   6700  NE  ARG B 426       4.191  14.139 -23.719  1.00  0.31           N  
ATOM   6701  CZ  ARG B 426       3.605  13.611 -24.803  1.00  0.31           C  
ATOM   6702  NH1 ARG B 426       3.039  14.366 -25.745  1.00  0.31           N  
ATOM   6703  NH2 ARG B 426       3.596  12.290 -24.948  1.00  0.31           N  
ATOM   6704  N   LEU B 427       5.704  20.275 -20.109  1.00  0.30           N  
ATOM   6705  CA  LEU B 427       5.785  21.739 -20.034  1.00  0.30           C  
ATOM   6706  C   LEU B 427       6.927  22.359 -19.179  1.00  0.30           C  
ATOM   6707  O   LEU B 427       6.728  23.523 -18.812  1.00  0.30           O  
ATOM   6708  CB  LEU B 427       4.441  22.322 -19.467  1.00  0.30           C  
ATOM   6709  CG  LEU B 427       3.243  22.340 -20.435  1.00  0.30           C  
ATOM   6710  CD1 LEU B 427       1.913  22.470 -19.675  1.00  0.30           C  
ATOM   6711  CD2 LEU B 427       3.345  23.482 -21.459  1.00  0.30           C  
ATOM   6712  N   PRO B 428       8.120  21.840 -18.794  1.00  0.27           N  
ATOM   6713  CA  PRO B 428       8.989  22.512 -17.831  1.00  0.27           C  
ATOM   6714  C   PRO B 428       9.576  23.827 -18.326  1.00  0.27           C  
ATOM   6715  O   PRO B 428      10.133  24.557 -17.517  1.00  0.27           O  
ATOM   6716  CB  PRO B 428      10.106  21.487 -17.486  1.00  0.27           C  
ATOM   6717  CG  PRO B 428       9.854  20.210 -18.292  1.00  0.27           C  
ATOM   6718  CD  PRO B 428       8.624  20.515 -19.131  1.00  0.27           C  
ATOM   6719  N   SER B 429       9.460  24.162 -19.626  1.00  0.28           N  
ATOM   6720  CA  SER B 429      10.093  25.330 -20.212  1.00  0.28           C  
ATOM   6721  C   SER B 429       9.122  26.458 -20.487  1.00  0.28           C  
ATOM   6722  O   SER B 429       9.494  27.473 -21.069  1.00  0.28           O  
ATOM   6723  CB  SER B 429      10.772  24.964 -21.558  1.00  0.28           C  
ATOM   6724  OG  SER B 429       9.832  24.374 -22.466  1.00  0.28           O  
ATOM   6725  N   TRP B 430       7.838  26.360 -20.071  1.00  0.23           N  
ATOM   6726  CA  TRP B 430       6.870  27.408 -20.386  1.00  0.23           C  
ATOM   6727  C   TRP B 430       7.162  28.756 -19.699  1.00  0.23           C  
ATOM   6728  O   TRP B 430       6.817  29.822 -20.199  1.00  0.23           O  
ATOM   6729  CB  TRP B 430       5.392  26.944 -20.180  1.00  0.23           C  
ATOM   6730  CG  TRP B 430       4.790  27.223 -18.823  1.00  0.23           C  
ATOM   6731  CD1 TRP B 430       5.252  26.841 -17.596  1.00  0.23           C  
ATOM   6732  CD2 TRP B 430       3.754  28.195 -18.588  1.00  0.23           C  
ATOM   6733  NE1 TRP B 430       4.621  27.560 -16.607  1.00  0.23           N  
ATOM   6734  CE2 TRP B 430       3.752  28.440 -17.212  1.00  0.23           C  
ATOM   6735  CE3 TRP B 430       2.887  28.881 -19.449  1.00  0.23           C  
ATOM   6736  CZ2 TRP B 430       2.948  29.421 -16.673  1.00  0.23           C  
ATOM   6737  CZ3 TRP B 430       2.000  29.812 -18.875  1.00  0.23           C  
ATOM   6738  CH2 TRP B 430       2.046  30.096 -17.504  1.00  0.23           C  
ATOM   6739  N   ARG B 431       7.846  28.724 -18.531  1.00  0.25           N  
ATOM   6740  CA  ARG B 431       8.289  29.913 -17.821  1.00  0.25           C  
ATOM   6741  C   ARG B 431       9.487  30.580 -18.491  1.00  0.25           C  
ATOM   6742  O   ARG B 431       9.725  31.766 -18.272  1.00  0.25           O  
ATOM   6743  CB  ARG B 431       8.663  29.574 -16.349  1.00  0.25           C  
ATOM   6744  CG  ARG B 431       7.447  29.243 -15.459  1.00  0.25           C  
ATOM   6745  CD  ARG B 431       7.831  28.907 -14.014  1.00  0.25           C  
ATOM   6746  NE  ARG B 431       6.550  28.669 -13.258  1.00  0.25           N  
ATOM   6747  CZ  ARG B 431       6.508  28.211 -11.995  1.00  0.25           C  
ATOM   6748  NH1 ARG B 431       7.618  27.974 -11.303  1.00  0.25           N  
ATOM   6749  NH2 ARG B 431       5.331  28.000 -11.403  1.00  0.25           N  
ATOM   6750  N   ASP B 432      10.213  29.830 -19.347  1.00  0.32           N  
ATOM   6751  CA  ASP B 432      11.410  30.264 -20.040  1.00  0.32           C  
ATOM   6752  C   ASP B 432      11.090  30.678 -21.475  1.00  0.32           C  
ATOM   6753  O   ASP B 432      11.967  31.048 -22.259  1.00  0.32           O  
ATOM   6754  CB  ASP B 432      12.445  29.111 -20.097  1.00  0.32           C  
ATOM   6755  CG  ASP B 432      12.919  28.693 -18.716  1.00  0.32           C  
ATOM   6756  OD1 ASP B 432      13.011  29.560 -17.812  1.00  0.32           O  
ATOM   6757  OD2 ASP B 432      13.201  27.476 -18.567  1.00  0.32           O  
ATOM   6758  N   LEU B 433       9.796  30.666 -21.875  1.00  0.35           N  
ATOM   6759  CA  LEU B 433       9.358  31.307 -23.097  1.00  0.35           C  
ATOM   6760  C   LEU B 433       9.608  32.804 -22.996  1.00  0.35           C  
ATOM   6761  O   LEU B 433       9.323  33.373 -21.939  1.00  0.35           O  
ATOM   6762  CB  LEU B 433       7.856  31.054 -23.385  1.00  0.35           C  
ATOM   6763  CG  LEU B 433       7.569  29.629 -23.891  1.00  0.35           C  
ATOM   6764  CD1 LEU B 433       6.079  29.293 -23.741  1.00  0.35           C  
ATOM   6765  CD2 LEU B 433       8.002  29.464 -25.358  1.00  0.35           C  
ATOM   6766  N   PRO B 434      10.156  33.486 -24.012  1.00  0.51           N  
ATOM   6767  CA  PRO B 434      10.302  34.934 -24.015  1.00  0.51           C  
ATOM   6768  C   PRO B 434       9.004  35.617 -23.650  1.00  0.51           C  
ATOM   6769  O   PRO B 434       8.071  35.596 -24.450  1.00  0.51           O  
ATOM   6770  CB  PRO B 434      10.849  35.310 -25.413  1.00  0.51           C  
ATOM   6771  CG  PRO B 434      10.807  34.027 -26.259  1.00  0.51           C  
ATOM   6772  CD  PRO B 434      10.432  32.891 -25.311  1.00  0.51           C  
ATOM   6773  N   GLN B 435       8.936  36.243 -22.457  1.00  0.43           N  
ATOM   6774  CA  GLN B 435       7.837  37.103 -22.102  1.00  0.43           C  
ATOM   6775  C   GLN B 435       7.854  38.323 -22.998  1.00  0.43           C  
ATOM   6776  O   GLN B 435       8.799  39.108 -22.981  1.00  0.43           O  
ATOM   6777  CB  GLN B 435       7.853  37.490 -20.602  1.00  0.43           C  
ATOM   6778  CG  GLN B 435       7.708  36.248 -19.685  1.00  0.43           C  
ATOM   6779  CD  GLN B 435       6.819  36.510 -18.469  1.00  0.43           C  
ATOM   6780  OE1 GLN B 435       6.364  37.613 -18.177  1.00  0.43           O  
ATOM   6781  NE2 GLN B 435       6.528  35.427 -17.714  1.00  0.43           N  
ATOM   6782  N   THR B 436       6.841  38.467 -23.867  1.00  0.39           N  
ATOM   6783  CA  THR B 436       6.780  39.571 -24.806  1.00  0.39           C  
ATOM   6784  C   THR B 436       6.604  40.914 -24.099  1.00  0.39           C  
ATOM   6785  O   THR B 436       5.628  41.167 -23.400  1.00  0.39           O  
ATOM   6786  CB  THR B 436       5.768  39.332 -25.925  1.00  0.39           C  
ATOM   6787  OG1 THR B 436       4.584  38.722 -25.438  1.00  0.39           O  
ATOM   6788  CG2 THR B 436       6.396  38.328 -26.919  1.00  0.39           C  
ATOM   6789  N   SER B 437       7.628  41.784 -24.212  1.00  0.48           N  
ATOM   6790  CA  SER B 437       7.586  43.192 -23.874  1.00  0.48           C  
ATOM   6791  C   SER B 437       7.072  44.098 -25.023  1.00  0.48           C  
ATOM   6792  O   SER B 437       6.835  43.609 -26.158  1.00  0.48           O  
ATOM   6793  CB  SER B 437       9.010  43.680 -23.468  1.00  0.48           C  
ATOM   6794  OG  SER B 437      10.048  43.125 -24.290  1.00  0.48           O  
ATOM   6795  OXT SER B 437       6.928  45.324 -24.754  1.00  0.48           O  
TER    6796      SER B 437                                                      
END   


A second structure was input as follows:


TITLE     SWISS-MODEL SERVER (https://swissmodel.expasy.org)
TITLE    2 Untitled Project
EXPDTA    THEORETICAL MODEL (SWISS-MODEL SERVER)
AUTHOR    SWISS-MODEL SERVER (SEE REFERENCE IN JRNL Records)
REVDAT   1   18-OCT-21 1MOD    1       15:58
JRNL        AUTH   A.WATERHOUSE,M.BERTONI,S.BIENERT,G.STUDER,G.TAURIELLO,
JRNL        AUTH 2 R.GUMIENNY,F.T.HEER,T.A.P.DE BEER,C.REMPFER,L.BORDOLI,
JRNL        AUTH 3 R.LEPORE,T.SCHWEDE
JRNL        TITL   SWISS-MODEL: HOMOLOGY MODELLING OF PROTEIN STRUCTURES AND
JRNL        TITL 2 COMPLEXES
JRNL        REF    NUCLEIC.ACIDS.RES..           V.  46 W296  2018
JRNL        PMID   29788355
JRNL        DOI    10.1093/nar/gky427
REMARK   1
REMARK   1 REFERENCE 1
REMARK   1  AUTH   S.BIENERT,A.WATERHOUSE,T.A.P.DE BEER,G.TAURIELLO,G.STUDER,
REMARK   1  AUTH 2 L.BORDOLI,T.SCHWEDE
REMARK   1  TITL   THE SWISS-MODEL REPOSITORY - NEW FEATURES AND FUNCTIONALITY
REMARK   1  REF    NUCLEIC.ACIDS.RES..           V.  45       2017
REMARK   1  REFN                   ISSN 0305-1048
REMARK   1  PMID   27899672
REMARK   1  DOI    10.1093/nar/gkw1132
REMARK   1
REMARK   1 REFERENCE 2
REMARK   1  AUTH   N.GUEX,M.C.PEITSCH,T.SCHWEDE
REMARK   1  TITL   AUTOMATED COMPARATIVE PROTEIN STRUCTURE MODELING WITH
REMARK   1  TITL 2 SWISS-MODEL AND SWISS-PDBVIEWER: A HISTORICAL PERSPECTIVE
REMARK   1  REF    ELECTROPHORESIS               V.  30       2009
REMARK   1  REFN                   ISSN 0173-0835
REMARK   1  PMID   19517507
REMARK   1  DOI    10.1002/elps.200900140
REMARK   1
REMARK   1 REFERENCE 3
REMARK   1  AUTH   G.STUDER,G.TAURIELLO,S.BIENERT,M.BIASINI,N.JOHNER,T.SCHWEDE
REMARK   1  TITL   PROMOD3 - A VERSATILE HOMOLOGY MODELLING TOOLBOX
REMARK   1  REF    PLOS COMP. BIOL.              V.  17       2021
REMARK   1  REFN                   ISSN 
REMARK   1  PMID   33507980
REMARK   1  DOI    https://doi.org/10.1371/journal.pcbi.1008667
REMARK   1
REMARK   1 REFERENCE 4
REMARK   1  AUTH   G.STUDER,C.REMPFER,A.WATERHOUSE,R.GUMIENNY,J.HAAS,T.SCHWEDE
REMARK   1  TITL   QMEANDISCO - DISTANCE CONSTRAINTS APPLIED ON MODEL QUALITY 
REMARK   1  TITL 2 ESTIMATION
REMARK   1  REF    BIOINFORMATICS                V.  36       2020
REMARK   1  REFN                   ISSN 
REMARK   1  PMID   31697312
REMARK   1  DOI    https://doi.org/10.1093/bioinformatics/btz828
REMARK   1
REMARK   1 REFERENCE 5
REMARK   1  AUTH   P.BENKERT,M.BIASINI,T.SCHWEDE
REMARK   1  TITL   TOWARD THE ESTIMATION OF THE ABSOLUTE QUALITY OF INDIVIDUAL
REMARK   1  TITL 2 PROTEIN STRUCTURE MODELS
REMARK   1  REF    BIOINFORMATICS                V.  27       2011
REMARK   1  REFN                   ISSN 1367-4803
REMARK   1  PMID   21134891
REMARK   1  DOI    10.1093/bioinformatics/btq662
REMARK   1
REMARK   1 REFERENCE 6
REMARK   1  AUTH   M.BERTONI,F.KIEFER,M.BIASINI,L.BORDOLI,T.SCHWEDE
REMARK   1  TITL   MODELING PROTEIN QUATERNARY STRUCTURE OF HOMO- AND
REMARK   1  TITL 2 HETERO-OLIGOMERS BEYOND BINARY INTERACTIONS BY HOMOLOGY
REMARK   1  REF    SCI.REP.                      V.   7       2017
REMARK   1  REFN                   ISSN
REMARK   1  PMID   28874689
REMARK   1  DOI    10.1038/s41598-017-09654-8
REMARK   1
REMARK   1 DISCLAIMER
REMARK   1 The SWISS-MODEL SERVER produces theoretical models for proteins.
REMARK   1 The results of any theoretical modelling procedure is
REMARK   1 NON-EXPERIMENTAL and MUST be considered with care. These models may
REMARK   1 contain significant errors. This is especially true for automated
REMARK   1 modeling since there is no human intervention during model
REMARK   1 building. Please read the header section and the logfile carefully
REMARK   1 to know what templates and alignments were used during the model
REMARK   1 building process. All information by the SWISS-MODEL SERVER is
REMARK   1 provided "AS-IS", without any warranty, expressed or implied.
REMARK   2
REMARK   2 COPYRIGHT NOTICE
REMARK   2 This SWISS-MODEL protein model is copyright. It is produced by the
REMARK   2 SWISS-MODEL server, developed by the Computational Structural
REMARK   2 Biology Group at the SIB Swiss Institute of Bioinformatics at the
REMARK   2 Biozentrum, University of Basel (https://swissmodel.expasy.org). This
REMARK   2 model is licensed under the CC BY-SA 4.0 Creative Commons
REMARK   2 Attribution-ShareAlike 4.0 International License
REMARK   2 (https://creativecommons.org/licenses/by-sa/4.0/legalcode), i.e. you
REMARK   2 can copy and redistribute the model in any medium or format,
REMARK   2 transform and build upon the model for any purpose, even
REMARK   2 commercially, under the following terms:
REMARK   2 Attribution - You must give appropriate credit, provide a link to
REMARK   2 the license, and indicate if changes were made. You may do so in any
REMARK   2 reasonable manner, but not in any way that suggests the licensor
REMARK   2 endorses you or your use. When you publish, patent or distribute
REMARK   2 results that were fully or partially based on the model, please cite
REMARK   2 the corresponding papers mentioned under JRNL.
REMARK   2 ShareAlike - If you remix, transform, or build upon the material,
REMARK   2 you must distribute your contributions under the same license as the
REMARK   2 original.
REMARK   2 No additional restrictions - you may not apply legal terms or
REMARK   2 technological measures that legally restrict others from doing
REMARK   2 anything the license permits.
REMARK   2 Find a human-readable summary of (and not a substitute for) the
REMARK   2 CC BY-SA 4.0 license at this link:
REMARK   2 https://creativecommons.org/licenses/by-sa/4.0/
REMARK   3 
REMARK   3 MODEL INFORMATION
REMARK   3  ENGIN   PROMOD3
REMARK   3  VERSN   3.2.0
REMARK   3  OSTAT   homo-dimer
REMARK   3  OSRSN   PREDICTION
REMARK   3  QSPRD   0.958
REMARK   3  GMQE    0.56
REMARK   3  QMNV    4.2.0
REMARK   3  QMNDG   0.48
REMARK   3  MODT    FALSE
REMARK   3 
REMARK   3 TEMPLATE 1
REMARK   3  PDBID   template_upload
REMARK   3  CHAIN   A
REMARK   3  MMCIF   A
REMARK   3  PDBV    2021-10-08
REMARK   3  SMTLE   template_upload.1.A
REMARK   3  SMTLV   2021-10-13
REMARK   3  MTHD    Unknown
REMARK   3  FOUND   HHblits
REMARK   3  GMQE    0.49
REMARK   3  SIM     0.61
REMARK   3  SID     99.77
REMARK   3  OSTAT   homo-dimer
REMARK   3  ALN A TRG MKFSDVLDQAWAEDSGPPTTLGRDLRLVRAAAPELLALDVPADAYGELVGSYRPDRAG
REMARK   3  ALN A TRG AVTAVVLTHDEEQVIGACLRALTDDCDRLLLVDAESEDTTLGTARSAVAHVEHVTRAW
REMARK   3  ALN A TRG TDDFAAQRNAAFEQARP-GGWLAHVDADETLSAESRGRLRAVLTALDHVLPGADLVVS
REMARK   3  ALN A TRG PRILDTSRECHTDTRRIVRSDSALRFRGRLHERLYDAHGAQPPSVEVDVVFHHTGYEP
REMARK   3  ALN A TRG EVIARKGKRERYARLVERCLTEEPSNPKWHFYAVRDGLVGRKPGPDEALALFRRLREA
REMARK   3  ALN A TRG HALYDEAPLSDYEAERCTDSLVLQCELALGFGGGREIADLAPLLHARGRPLEASYYQA
REMARK   3  ALN A TRG FAEFSALLSRSSRLLDQLSEGSRHQLPGNRQLAGRSYDLQALLALTCGRYDEVPLLLG
REMARK   3  ALN A TRG EARSRQAGSLTTATVESLADRLPSWRDLPQTS
REMARK   3  ALN A TPL MKFSDVLDQAWAEDSGPPTTLGRDLRLVRAAAPELLALDVPADAYGELVGSYRPDRAG
REMARK   3  ALN A TPL AVTAVVLTHDEEQVIGACLRALTDDCDRLLLVDAESEDTTLGTARSAVAHVEHVTRAW
REMARK   3  ALN A TPL TDDFAAQRNAAFEQA-RPGGWLAHVDADETLSAESRGRLRAVLTALDHVLPGADLVVS
REMARK   3  ALN A TPL PRILDTSRECHTDTRRIVRSDSALRFRGRLHERLYDAHGAQPPSVEVDVVFHHTGYEP
REMARK   3  ALN A TPL EVIARKGKRERYARLVERCLTEEPSNPKWHFYAVRDGLVGRKPGPDEALALFRRLREA
REMARK   3  ALN A TPL HALYDEAPLSDYEAERCTDSLVLQCELALGFGGGREIADLAPLLHARGRPLEASYYQA
REMARK   3  ALN A TPL FAEFSALLSRSSRLLDQLSEGSRHQLPGNRQLAGRSYDLQALLALTCGRYDEVPLLLG
REMARK   3  ALN A TPL EARSRQAGSLTTATVESLADRLPSWRDLPQTS
REMARK   3  ALN A OFF 0
ATOM      1  N   MET A   1     -31.471   4.007   5.840  1.00  0.62           N  
ATOM      2  CA  MET A   1     -30.622   4.930   4.994  1.00  0.62           C  
ATOM      3  C   MET A   1     -29.253   4.297   4.718  1.00  0.62           C  
ATOM      4  O   MET A   1     -28.867   3.392   5.449  1.00  0.62           O  
ATOM      5  CB  MET A   1     -30.502   6.285   5.764  1.00  0.62           C  
ATOM      6  CG  MET A   1     -29.589   7.360   5.138  1.00  0.62           C  
ATOM      7  SD  MET A   1     -29.406   8.892   6.105  1.00  0.62           S  
ATOM      8  CE  MET A   1     -31.053   9.539   5.725  1.00  0.62           C  
ATOM      9  N   LYS A   2     -28.477   4.697   3.680  1.00  0.66           N  
ATOM     10  CA  LYS A   2     -27.149   4.142   3.434  1.00  0.66           C  
ATOM     11  C   LYS A   2     -26.045   4.958   4.090  1.00  0.66           C  
ATOM     12  O   LYS A   2     -26.216   6.113   4.474  1.00  0.66           O  
ATOM     13  CB  LYS A   2     -26.822   4.026   1.922  1.00  0.66           C  
ATOM     14  CG  LYS A   2     -27.773   3.118   1.130  1.00  0.66           C  
ATOM     15  CD  LYS A   2     -27.667   1.667   1.604  1.00  0.66           C  
ATOM     16  CE  LYS A   2     -28.394   0.655   0.725  1.00  0.66           C  
ATOM     17  NZ  LYS A   2     -28.169  -0.682   1.295  1.00  0.66           N  
ATOM     18  N   PHE A   3     -24.848   4.358   4.250  1.00  0.65           N  
ATOM     19  CA  PHE A   3     -23.673   5.036   4.775  1.00  0.65           C  
ATOM     20  C   PHE A   3     -23.192   6.193   3.895  1.00  0.65           C  
ATOM     21  O   PHE A   3     -22.778   7.233   4.408  1.00  0.65           O  
ATOM     22  CB  PHE A   3     -22.543   4.012   5.074  1.00  0.65           C  
ATOM     23  CG  PHE A   3     -21.323   4.614   5.744  1.00  0.65           C  
ATOM     24  CD1 PHE A   3     -20.039   4.272   5.285  1.00  0.65           C  
ATOM     25  CD2 PHE A   3     -21.432   5.519   6.817  1.00  0.65           C  
ATOM     26  CE1 PHE A   3     -18.892   4.819   5.872  1.00  0.65           C  
ATOM     27  CE2 PHE A   3     -20.288   6.088   7.391  1.00  0.65           C  
ATOM     28  CZ  PHE A   3     -19.017   5.732   6.925  1.00  0.65           C  
ATOM     29  N   SER A   4     -23.288   6.075   2.551  1.00  0.67           N  
ATOM     30  CA  SER A   4     -23.009   7.175   1.624  1.00  0.67           C  
ATOM     31  C   SER A   4     -23.836   8.414   1.901  1.00  0.67           C  
ATOM     32  O   SER A   4     -23.308   9.509   2.062  1.00  0.67           O  
ATOM     33  CB  SER A   4     -23.296   6.766   0.149  1.00  0.67           C  
ATOM     34  OG  SER A   4     -24.515   6.021   0.015  1.00  0.67           O  
ATOM     35  N   ASP A   5     -25.154   8.233   2.072  1.00  0.68           N  
ATOM     36  CA  ASP A   5     -26.141   9.257   2.316  1.00  0.68           C  
ATOM     37  C   ASP A   5     -25.846  10.027   3.600  1.00  0.68           C  
ATOM     38  O   ASP A   5     -25.994  11.246   3.685  1.00  0.68           O  
ATOM     39  CB  ASP A   5     -27.549   8.610   2.477  1.00  0.68           C  
ATOM     40  CG  ASP A   5     -27.877   7.449   1.546  1.00  0.68           C  
ATOM     41  OD1 ASP A   5     -27.139   7.185   0.564  1.00  0.68           O  
ATOM     42  OD2 ASP A   5     -28.865   6.746   1.896  1.00  0.68           O  
ATOM     43  N   VAL A   6     -25.417   9.291   4.647  1.00  0.71           N  
ATOM     44  CA  VAL A   6     -24.962   9.821   5.922  1.00  0.71           C  
ATOM     45  C   VAL A   6     -23.711  10.675   5.795  1.00  0.71           C  
ATOM     46  O   VAL A   6     -23.645  11.771   6.351  1.00  0.71           O  
ATOM     47  CB  VAL A   6     -24.722   8.678   6.906  1.00  0.71           C  
ATOM     48  CG1 VAL A   6     -24.091   9.150   8.228  1.00  0.71           C  
ATOM     49  CG2 VAL A   6     -26.070   8.020   7.224  1.00  0.71           C  
ATOM     50  N   LEU A   7     -22.689  10.225   5.034  1.00  0.68           N  
ATOM     51  CA  LEU A   7     -21.501  11.023   4.773  1.00  0.68           C  
ATOM     52  C   LEU A   7     -21.790  12.272   3.956  1.00  0.68           C  
ATOM     53  O   LEU A   7     -21.369  13.366   4.326  1.00  0.68           O  
ATOM     54  CB  LEU A   7     -20.395  10.202   4.064  1.00  0.68           C  
ATOM     55  CG  LEU A   7     -19.786   9.065   4.912  1.00  0.68           C  
ATOM     56  CD1 LEU A   7     -18.775   8.274   4.069  1.00  0.68           C  
ATOM     57  CD2 LEU A   7     -19.106   9.578   6.193  1.00  0.68           C  
ATOM     58  N   ASP A   8     -22.577  12.162   2.870  1.00  0.66           N  
ATOM     59  CA  ASP A   8     -22.957  13.283   2.030  1.00  0.66           C  
ATOM     60  C   ASP A   8     -23.743  14.348   2.796  1.00  0.66           C  
ATOM     61  O   ASP A   8     -23.471  15.541   2.694  1.00  0.66           O  
ATOM     62  CB  ASP A   8     -23.781  12.777   0.819  1.00  0.66           C  
ATOM     63  CG  ASP A   8     -22.926  11.985  -0.162  1.00  0.66           C  
ATOM     64  OD1 ASP A   8     -21.682  11.940   0.005  1.00  0.66           O  
ATOM     65  OD2 ASP A   8     -23.532  11.436  -1.117  1.00  0.66           O  
ATOM     66  N   GLN A   9     -24.708  13.944   3.649  1.00  0.63           N  
ATOM     67  CA  GLN A   9     -25.399  14.856   4.549  1.00  0.63           C  
ATOM     68  C   GLN A   9     -24.499  15.487   5.611  1.00  0.63           C  
ATOM     69  O   GLN A   9     -24.579  16.688   5.851  1.00  0.63           O  
ATOM     70  CB  GLN A   9     -26.642  14.179   5.170  1.00  0.63           C  
ATOM     71  CG  GLN A   9     -27.750  13.984   4.106  1.00  0.63           C  
ATOM     72  CD  GLN A   9     -28.911  13.130   4.612  1.00  0.63           C  
ATOM     73  OE1 GLN A   9     -29.838  13.585   5.283  1.00  0.63           O  
ATOM     74  NE2 GLN A   9     -28.869  11.823   4.266  1.00  0.63           N  
ATOM     75  N   ALA A  10     -23.567  14.723   6.223  1.00  0.69           N  
ATOM     76  CA  ALA A  10     -22.568  15.253   7.140  1.00  0.69           C  
ATOM     77  C   ALA A  10     -21.645  16.292   6.503  1.00  0.69           C  
ATOM     78  O   ALA A  10     -21.331  17.336   7.075  1.00  0.69           O  
ATOM     79  CB  ALA A  10     -21.710  14.093   7.688  1.00  0.69           C  
ATOM     80  N   TRP A  11     -21.209  16.058   5.254  1.00  0.56           N  
ATOM     81  CA  TRP A  11     -20.413  17.002   4.493  1.00  0.56           C  
ATOM     82  C   TRP A  11     -21.208  18.199   3.971  1.00  0.56           C  
ATOM     83  O   TRP A  11     -20.605  19.207   3.630  1.00  0.56           O  
ATOM     84  CB  TRP A  11     -19.666  16.285   3.338  1.00  0.56           C  
ATOM     85  CG  TRP A  11     -18.396  15.573   3.792  1.00  0.56           C  
ATOM     86  CD1 TRP A  11     -18.195  14.271   4.168  1.00  0.56           C  
ATOM     87  CD2 TRP A  11     -17.116  16.224   3.902  1.00  0.56           C  
ATOM     88  NE1 TRP A  11     -16.874  14.072   4.519  1.00  0.56           N  
ATOM     89  CE2 TRP A  11     -16.195  15.254   4.352  1.00  0.56           C  
ATOM     90  CE3 TRP A  11     -16.712  17.534   3.644  1.00  0.56           C  
ATOM     91  CZ2 TRP A  11     -14.860  15.572   4.546  1.00  0.56           C  
ATOM     92  CZ3 TRP A  11     -15.360  17.854   3.838  1.00  0.56           C  
ATOM     93  CH2 TRP A  11     -14.445  16.888   4.285  1.00  0.56           C  
ATOM     94  N   ALA A  12     -22.558  18.145   3.954  1.00  0.61           N  
ATOM     95  CA  ALA A  12     -23.418  19.221   3.481  1.00  0.61           C  
ATOM     96  C   ALA A  12     -24.067  20.065   4.587  1.00  0.61           C  
ATOM     97  O   ALA A  12     -24.907  20.929   4.329  1.00  0.61           O  
ATOM     98  CB  ALA A  12     -24.530  18.599   2.611  1.00  0.61           C  
ATOM     99  N   GLU A  13     -23.700  19.865   5.871  1.00  0.55           N  
ATOM    100  CA  GLU A  13     -24.064  20.780   6.950  1.00  0.55           C  
ATOM    101  C   GLU A  13     -23.332  22.129   6.873  1.00  0.55           C  
ATOM    102  O   GLU A  13     -22.373  22.377   7.605  1.00  0.55           O  
ATOM    103  CB  GLU A  13     -23.767  20.195   8.353  1.00  0.55           C  
ATOM    104  CG  GLU A  13     -24.491  18.879   8.712  1.00  0.55           C  
ATOM    105  CD  GLU A  13     -24.156  18.482  10.140  1.00  0.55           C  
ATOM    106  OE1 GLU A  13     -24.996  17.828  10.805  1.00  0.55           O  
ATOM    107  OE2 GLU A  13     -23.048  18.833  10.618  1.00  0.55           O  
ATOM    108  N   ASP A  14     -23.751  23.027   5.964  1.00  0.50           N  
ATOM    109  CA  ASP A  14     -23.067  24.293   5.743  1.00  0.50           C  
ATOM    110  C   ASP A  14     -23.819  25.486   6.326  1.00  0.50           C  
ATOM    111  O   ASP A  14     -23.353  26.623   6.318  1.00  0.50           O  
ATOM    112  CB  ASP A  14     -22.872  24.489   4.222  1.00  0.50           C  
ATOM    113  CG  ASP A  14     -22.013  23.349   3.698  1.00  0.50           C  
ATOM    114  OD1 ASP A  14     -20.989  23.032   4.366  1.00  0.50           O  
ATOM    115  OD2 ASP A  14     -22.390  22.774   2.648  1.00  0.50           O  
ATOM    116  N   SER A  15     -25.013  25.262   6.900  1.00  0.39           N  
ATOM    117  CA  SER A  15     -25.897  26.307   7.400  1.00  0.39           C  
ATOM    118  C   SER A  15     -25.663  26.680   8.859  1.00  0.39           C  
ATOM    119  O   SER A  15     -26.594  26.953   9.613  1.00  0.39           O  
ATOM    120  CB  SER A  15     -27.387  25.927   7.175  1.00  0.39           C  
ATOM    121  OG  SER A  15     -27.641  24.569   7.550  1.00  0.39           O  
ATOM    122  N   GLY A  16     -24.388  26.756   9.292  1.00  0.47           N  
ATOM    123  CA  GLY A  16     -24.034  27.119  10.657  1.00  0.47           C  
ATOM    124  C   GLY A  16     -22.757  26.434  11.059  1.00  0.47           C  
ATOM    125  O   GLY A  16     -21.977  26.056  10.186  1.00  0.47           O  
ATOM    126  N   PRO A  17     -22.473  26.234  12.341  1.00  0.55           N  
ATOM    127  CA  PRO A  17     -21.480  25.257  12.766  1.00  0.55           C  
ATOM    128  C   PRO A  17     -22.017  23.842  12.531  1.00  0.55           C  
ATOM    129  O   PRO A  17     -23.226  23.660  12.690  1.00  0.55           O  
ATOM    130  CB  PRO A  17     -21.297  25.564  14.264  1.00  0.55           C  
ATOM    131  CG  PRO A  17     -22.657  26.117  14.707  1.00  0.55           C  
ATOM    132  CD  PRO A  17     -23.161  26.868  13.470  1.00  0.55           C  
ATOM    133  N   PRO A  18     -21.229  22.850  12.119  1.00  0.60           N  
ATOM    134  CA  PRO A  18     -21.711  21.486  11.930  1.00  0.60           C  
ATOM    135  C   PRO A  18     -22.144  20.833  13.233  1.00  0.60           C  
ATOM    136  O   PRO A  18     -21.768  21.281  14.317  1.00  0.60           O  
ATOM    137  CB  PRO A  18     -20.496  20.773  11.312  1.00  0.60           C  
ATOM    138  CG  PRO A  18     -19.297  21.484  11.940  1.00  0.60           C  
ATOM    139  CD  PRO A  18     -19.770  22.938  12.013  1.00  0.60           C  
ATOM    140  N   THR A  19     -22.929  19.747  13.162  1.00  0.62           N  
ATOM    141  CA  THR A  19     -23.315  18.984  14.339  1.00  0.62           C  
ATOM    142  C   THR A  19     -22.146  18.167  14.847  1.00  0.62           C  
ATOM    143  O   THR A  19     -21.146  17.977  14.160  1.00  0.62           O  
ATOM    144  CB  THR A  19     -24.516  18.063  14.155  1.00  0.62           C  
ATOM    145  OG1 THR A  19     -24.263  16.999  13.241  1.00  0.62           O  
ATOM    146  CG2 THR A  19     -25.724  18.870  13.657  1.00  0.62           C  
ATOM    147  N   THR A  20     -22.211  17.640  16.089  1.00  0.65           N  
ATOM    148  CA  THR A  20     -21.127  16.821  16.634  1.00  0.65           C  
ATOM    149  C   THR A  20     -20.877  15.580  15.799  1.00  0.65           C  
ATOM    150  O   THR A  20     -19.749  15.259  15.446  1.00  0.65           O  
ATOM    151  CB  THR A  20     -21.371  16.371  18.070  1.00  0.65           C  
ATOM    152  OG1 THR A  20     -21.889  17.444  18.842  1.00  0.65           O  
ATOM    153  CG2 THR A  20     -20.045  15.959  18.718  1.00  0.65           C  
ATOM    154  N   LEU A  21     -21.959  14.888  15.383  1.00  0.69           N  
ATOM    155  CA  LEU A  21     -21.865  13.778  14.452  1.00  0.69           C  
ATOM    156  C   LEU A  21     -21.376  14.204  13.072  1.00  0.69           C  
ATOM    157  O   LEU A  21     -20.496  13.570  12.496  1.00  0.69           O  
ATOM    158  CB  LEU A  21     -23.231  13.061  14.321  1.00  0.69           C  
ATOM    159  CG  LEU A  21     -23.216  11.793  13.439  1.00  0.69           C  
ATOM    160  CD1 LEU A  21     -22.289  10.693  13.984  1.00  0.69           C  
ATOM    161  CD2 LEU A  21     -24.635  11.247  13.269  1.00  0.69           C  
ATOM    162  N   GLY A  22     -21.910  15.315  12.517  1.00  0.70           N  
ATOM    163  CA  GLY A  22     -21.431  15.950  11.290  1.00  0.70           C  
ATOM    164  C   GLY A  22     -19.959  16.232  11.236  1.00  0.70           C  
ATOM    165  O   GLY A  22     -19.266  15.834  10.305  1.00  0.70           O  
ATOM    166  N   ARG A  23     -19.427  16.900  12.272  1.00  0.60           N  
ATOM    167  CA  ARG A  23     -18.017  17.189  12.443  1.00  0.60           C  
ATOM    168  C   ARG A  23     -17.155  15.936  12.483  1.00  0.60           C  
ATOM    169  O   ARG A  23     -16.144  15.835  11.789  1.00  0.60           O  
ATOM    170  CB  ARG A  23     -17.838  17.950  13.782  1.00  0.60           C  
ATOM    171  CG  ARG A  23     -16.396  18.408  14.096  1.00  0.60           C  
ATOM    172  CD  ARG A  23     -16.200  18.893  15.540  1.00  0.60           C  
ATOM    173  NE  ARG A  23     -16.322  17.684  16.408  1.00  0.60           N  
ATOM    174  CZ  ARG A  23     -16.409  17.657  17.738  1.00  0.60           C  
ATOM    175  NH1 ARG A  23     -16.359  18.767  18.467  1.00  0.60           N  
ATOM    176  NH2 ARG A  23     -16.537  16.480  18.342  1.00  0.60           N  
ATOM    177  N   ASP A  24     -17.569  14.929  13.271  1.00  0.71           N  
ATOM    178  CA  ASP A  24     -16.753  13.764  13.538  1.00  0.71           C  
ATOM    179  C   ASP A  24     -16.843  12.725  12.414  1.00  0.71           C  
ATOM    180  O   ASP A  24     -15.948  11.902  12.226  1.00  0.71           O  
ATOM    181  CB  ASP A  24     -17.134  13.227  14.945  1.00  0.71           C  
ATOM    182  CG  ASP A  24     -16.781  14.263  16.002  1.00  0.71           C  
ATOM    183  OD1 ASP A  24     -15.954  15.170  15.723  1.00  0.71           O  
ATOM    184  OD2 ASP A  24     -17.299  14.201  17.146  1.00  0.71           O  
ATOM    185  N   LEU A  25     -17.885  12.796  11.558  1.00  0.71           N  
ATOM    186  CA  LEU A  25     -17.933  12.071  10.297  1.00  0.71           C  
ATOM    187  C   LEU A  25     -17.178  12.758   9.162  1.00  0.71           C  
ATOM    188  O   LEU A  25     -16.762  12.100   8.212  1.00  0.71           O  
ATOM    189  CB  LEU A  25     -19.389  11.862   9.826  1.00  0.71           C  
ATOM    190  CG  LEU A  25     -20.200  10.850  10.656  1.00  0.71           C  
ATOM    191  CD1 LEU A  25     -21.662  10.914  10.202  1.00  0.71           C  
ATOM    192  CD2 LEU A  25     -19.669   9.413  10.530  1.00  0.71           C  
ATOM    193  N   ARG A  26     -16.897  14.080   9.243  1.00  0.60           N  
ATOM    194  CA  ARG A  26     -16.084  14.789   8.250  1.00  0.60           C  
ATOM    195  C   ARG A  26     -14.612  14.406   8.347  1.00  0.60           C  
ATOM    196  O   ARG A  26     -13.800  14.703   7.473  1.00  0.60           O  
ATOM    197  CB  ARG A  26     -16.202  16.331   8.380  1.00  0.60           C  
ATOM    198  CG  ARG A  26     -17.517  16.913   7.821  1.00  0.60           C  
ATOM    199  CD  ARG A  26     -17.728  18.382   8.214  1.00  0.60           C  
ATOM    200  NE  ARG A  26     -19.065  18.793   7.689  1.00  0.60           N  
ATOM    201  CZ  ARG A  26     -19.445  20.033   7.353  1.00  0.60           C  
ATOM    202  NH1 ARG A  26     -18.727  21.114   7.620  1.00  0.60           N  
ATOM    203  NH2 ARG A  26     -20.609  20.190   6.741  1.00  0.60           N  
ATOM    204  N   LEU A  27     -14.234  13.691   9.421  1.00  0.68           N  
ATOM    205  CA  LEU A  27     -12.938  13.072   9.556  1.00  0.68           C  
ATOM    206  C   LEU A  27     -12.759  11.859   8.652  1.00  0.68           C  
ATOM    207  O   LEU A  27     -11.631  11.461   8.375  1.00  0.68           O  
ATOM    208  CB  LEU A  27     -12.722  12.640  11.024  1.00  0.68           C  
ATOM    209  CG  LEU A  27     -12.728  13.815  12.023  1.00  0.68           C  
ATOM    210  CD1 LEU A  27     -12.626  13.294  13.463  1.00  0.68           C  
ATOM    211  CD2 LEU A  27     -11.599  14.807  11.716  1.00  0.68           C  
ATOM    212  N   VAL A  28     -13.852  11.256   8.134  1.00  0.67           N  
ATOM    213  CA  VAL A  28     -13.783  10.220   7.113  1.00  0.67           C  
ATOM    214  C   VAL A  28     -13.389  10.821   5.767  1.00  0.67           C  
ATOM    215  O   VAL A  28     -14.057  11.698   5.222  1.00  0.67           O  
ATOM    216  CB  VAL A  28     -15.090   9.435   6.991  1.00  0.67           C  
ATOM    217  CG1 VAL A  28     -15.016   8.389   5.858  1.00  0.67           C  
ATOM    218  CG2 VAL A  28     -15.386   8.743   8.338  1.00  0.67           C  
ATOM    219  N   ARG A  29     -12.257  10.361   5.200  1.00  0.56           N  
ATOM    220  CA  ARG A  29     -11.717  10.874   3.956  1.00  0.56           C  
ATOM    221  C   ARG A  29     -12.063   9.975   2.790  1.00  0.56           C  
ATOM    222  O   ARG A  29     -12.222  10.437   1.663  1.00  0.56           O  
ATOM    223  CB  ARG A  29     -10.171  10.926   4.059  1.00  0.56           C  
ATOM    224  CG  ARG A  29      -9.646  11.995   5.040  1.00  0.56           C  
ATOM    225  CD  ARG A  29      -9.875  13.450   4.611  1.00  0.56           C  
ATOM    226  NE  ARG A  29      -9.158  13.617   3.308  1.00  0.56           N  
ATOM    227  CZ  ARG A  29      -9.097  14.761   2.618  1.00  0.56           C  
ATOM    228  NH1 ARG A  29      -9.622  15.885   3.092  1.00  0.56           N  
ATOM    229  NH2 ARG A  29      -8.500  14.772   1.427  1.00  0.56           N  
ATOM    230  N   ALA A  30     -12.215   8.668   3.050  1.00  0.60           N  
ATOM    231  CA  ALA A  30     -12.620   7.716   2.052  1.00  0.60           C  
ATOM    232  C   ALA A  30     -13.125   6.491   2.780  1.00  0.60           C  
ATOM    233  O   ALA A  30     -12.800   6.261   3.944  1.00  0.60           O  
ATOM    234  CB  ALA A  30     -11.449   7.331   1.121  1.00  0.60           C  
ATOM    235  N   ALA A  31     -13.939   5.664   2.113  1.00  0.65           N  
ATOM    236  CA  ALA A  31     -14.381   4.413   2.667  1.00  0.65           C  
ATOM    237  C   ALA A  31     -14.602   3.477   1.507  1.00  0.65           C  
ATOM    238  O   ALA A  31     -14.931   3.908   0.403  1.00  0.65           O  
ATOM    239  CB  ALA A  31     -15.675   4.572   3.492  1.00  0.65           C  
ATOM    240  N   ALA A  32     -14.375   2.172   1.722  1.00  0.68           N  
ATOM    241  CA  ALA A  32     -14.571   1.151   0.719  1.00  0.68           C  
ATOM    242  C   ALA A  32     -16.025   1.027   0.214  1.00  0.68           C  
ATOM    243  O   ALA A  32     -16.949   1.278   0.998  1.00  0.68           O  
ATOM    244  CB  ALA A  32     -14.044  -0.178   1.278  1.00  0.68           C  
ATOM    245  N   PRO A  33     -16.307   0.679  -1.053  1.00  0.65           N  
ATOM    246  CA  PRO A  33     -17.657   0.689  -1.625  1.00  0.65           C  
ATOM    247  C   PRO A  33     -18.665  -0.176  -0.899  1.00  0.65           C  
ATOM    248  O   PRO A  33     -19.845   0.173  -0.850  1.00  0.65           O  
ATOM    249  CB  PRO A  33     -17.454   0.198  -3.070  1.00  0.65           C  
ATOM    250  CG  PRO A  33     -16.017   0.602  -3.398  1.00  0.65           C  
ATOM    251  CD  PRO A  33     -15.302   0.353  -2.071  1.00  0.65           C  
ATOM    252  N   GLU A  34     -18.223  -1.308  -0.329  1.00  0.62           N  
ATOM    253  CA  GLU A  34     -19.016  -2.252   0.421  1.00  0.62           C  
ATOM    254  C   GLU A  34     -19.586  -1.615   1.674  1.00  0.62           C  
ATOM    255  O   GLU A  34     -20.768  -1.747   1.976  1.00  0.62           O  
ATOM    256  CB  GLU A  34     -18.160  -3.490   0.817  1.00  0.62           C  
ATOM    257  CG  GLU A  34     -17.405  -4.170  -0.363  1.00  0.62           C  
ATOM    258  CD  GLU A  34     -16.177  -3.400  -0.854  1.00  0.62           C  
ATOM    259  OE1 GLU A  34     -15.694  -3.705  -1.969  1.00  0.62           O  
ATOM    260  OE2 GLU A  34     -15.749  -2.455  -0.138  1.00  0.62           O  
ATOM    261  N   LEU A  35     -18.751  -0.840   2.400  1.00  0.64           N  
ATOM    262  CA  LEU A  35     -19.151  -0.057   3.557  1.00  0.64           C  
ATOM    263  C   LEU A  35     -20.115   1.056   3.208  1.00  0.64           C  
ATOM    264  O   LEU A  35     -21.094   1.281   3.913  1.00  0.64           O  
ATOM    265  CB  LEU A  35     -17.933   0.556   4.290  1.00  0.64           C  
ATOM    266  CG  LEU A  35     -16.983  -0.488   4.906  1.00  0.64           C  
ATOM    267  CD1 LEU A  35     -15.718   0.193   5.441  1.00  0.64           C  
ATOM    268  CD2 LEU A  35     -17.651  -1.304   6.023  1.00  0.64           C  
ATOM    269  N   LEU A  36     -19.886   1.765   2.082  1.00  0.62           N  
ATOM    270  CA  LEU A  36     -20.771   2.810   1.583  1.00  0.62           C  
ATOM    271  C   LEU A  36     -22.176   2.306   1.274  1.00  0.62           C  
ATOM    272  O   LEU A  36     -23.166   2.995   1.513  1.00  0.62           O  
ATOM    273  CB  LEU A  36     -20.170   3.498   0.333  1.00  0.62           C  
ATOM    274  CG  LEU A  36     -18.864   4.277   0.601  1.00  0.62           C  
ATOM    275  CD1 LEU A  36     -18.240   4.755  -0.719  1.00  0.62           C  
ATOM    276  CD2 LEU A  36     -19.090   5.480   1.528  1.00  0.62           C  
ATOM    277  N   ALA A  37     -22.286   1.061   0.774  1.00  0.64           N  
ATOM    278  CA  ALA A  37     -23.542   0.444   0.418  1.00  0.64           C  
ATOM    279  C   ALA A  37     -24.247  -0.257   1.583  1.00  0.64           C  
ATOM    280  O   ALA A  37     -25.380  -0.727   1.434  1.00  0.64           O  
ATOM    281  CB  ALA A  37     -23.263  -0.584  -0.695  1.00  0.64           C  
ATOM    282  N   LEU A  38     -23.627  -0.323   2.781  1.00  0.62           N  
ATOM    283  CA  LEU A  38     -24.295  -0.745   4.003  1.00  0.62           C  
ATOM    284  C   LEU A  38     -25.388   0.210   4.460  1.00  0.62           C  
ATOM    285  O   LEU A  38     -25.301   1.430   4.316  1.00  0.62           O  
ATOM    286  CB  LEU A  38     -23.330  -0.943   5.203  1.00  0.62           C  
ATOM    287  CG  LEU A  38     -22.300  -2.078   5.044  1.00  0.62           C  
ATOM    288  CD1 LEU A  38     -21.352  -2.102   6.251  1.00  0.62           C  
ATOM    289  CD2 LEU A  38     -22.954  -3.456   4.862  1.00  0.62           C  
ATOM    290  N   ASP A  39     -26.455  -0.354   5.049  1.00  0.63           N  
ATOM    291  CA  ASP A  39     -27.529   0.386   5.662  1.00  0.63           C  
ATOM    292  C   ASP A  39     -27.170   0.771   7.094  1.00  0.63           C  
ATOM    293  O   ASP A  39     -26.652  -0.027   7.874  1.00  0.63           O  
ATOM    294  CB  ASP A  39     -28.836  -0.442   5.638  1.00  0.63           C  
ATOM    295  CG  ASP A  39     -29.146  -0.797   4.206  1.00  0.63           C  
ATOM    296  OD1 ASP A  39     -29.780   0.021   3.496  1.00  0.63           O  
ATOM    297  OD2 ASP A  39     -28.653  -1.845   3.715  1.00  0.63           O  
ATOM    298  N   VAL A  40     -27.432   2.035   7.467  1.00  0.68           N  
ATOM    299  CA  VAL A  40     -27.187   2.562   8.799  1.00  0.68           C  
ATOM    300  C   VAL A  40     -28.443   2.377   9.642  1.00  0.68           C  
ATOM    301  O   VAL A  40     -29.515   2.176   9.065  1.00  0.68           O  
ATOM    302  CB  VAL A  40     -26.761   4.034   8.775  1.00  0.68           C  
ATOM    303  CG1 VAL A  40     -25.511   4.163   7.885  1.00  0.68           C  
ATOM    304  CG2 VAL A  40     -27.896   4.956   8.287  1.00  0.68           C  
ATOM    305  N   PRO A  41     -28.445   2.449  10.973  1.00  0.67           N  
ATOM    306  CA  PRO A  41     -29.610   2.006  11.744  1.00  0.67           C  
ATOM    307  C   PRO A  41     -30.520   3.196  12.021  1.00  0.67           C  
ATOM    308  O   PRO A  41     -30.914   3.434  13.160  1.00  0.67           O  
ATOM    309  CB  PRO A  41     -28.965   1.470  13.038  1.00  0.67           C  
ATOM    310  CG  PRO A  41     -27.725   2.344  13.222  1.00  0.67           C  
ATOM    311  CD  PRO A  41     -27.224   2.484  11.789  1.00  0.67           C  
ATOM    312  N   ALA A  42     -30.878   3.933  10.958  1.00  0.64           N  
ATOM    313  CA  ALA A  42     -31.789   5.048  10.980  1.00  0.64           C  
ATOM    314  C   ALA A  42     -32.216   5.323   9.544  1.00  0.64           C  
ATOM    315  O   ALA A  42     -31.542   4.891   8.599  1.00  0.64           O  
ATOM    316  CB  ALA A  42     -31.110   6.298  11.569  1.00  0.64           C  
ATOM    317  N   ASP A  43     -33.328   6.061   9.345  1.00  0.57           N  
ATOM    318  CA  ASP A  43     -33.796   6.448   8.024  1.00  0.57           C  
ATOM    319  C   ASP A  43     -33.883   7.956   7.846  1.00  0.57           C  
ATOM    320  O   ASP A  43     -34.096   8.442   6.736  1.00  0.57           O  
ATOM    321  CB  ASP A  43     -35.121   5.737   7.653  1.00  0.57           C  
ATOM    322  CG  ASP A  43     -34.743   4.388   7.057  1.00  0.57           C  
ATOM    323  OD1 ASP A  43     -34.034   4.400   6.011  1.00  0.57           O  
ATOM    324  OD2 ASP A  43     -35.076   3.335   7.641  1.00  0.57           O  
ATOM    325  N   ALA A  44     -33.601   8.753   8.888  1.00  0.61           N  
ATOM    326  CA  ALA A  44     -33.274  10.151   8.735  1.00  0.61           C  
ATOM    327  C   ALA A  44     -31.937  10.471   9.388  1.00  0.61           C  
ATOM    328  O   ALA A  44     -31.558   9.960  10.439  1.00  0.61           O  
ATOM    329  CB  ALA A  44     -34.388  11.062   9.283  1.00  0.61           C  
ATOM    330  N   TYR A  45     -31.147  11.378   8.776  1.00  0.61           N  
ATOM    331  CA  TYR A  45     -29.872  11.814   9.325  1.00  0.61           C  
ATOM    332  C   TYR A  45     -30.028  12.496  10.690  1.00  0.61           C  
ATOM    333  O   TYR A  45     -29.233  12.294  11.606  1.00  0.61           O  
ATOM    334  CB  TYR A  45     -29.148  12.710   8.285  1.00  0.61           C  
ATOM    335  CG  TYR A  45     -27.773  13.126   8.733  1.00  0.61           C  
ATOM    336  CD1 TYR A  45     -27.482  14.483   8.947  1.00  0.61           C  
ATOM    337  CD2 TYR A  45     -26.775  12.165   8.972  1.00  0.61           C  
ATOM    338  CE1 TYR A  45     -26.221  14.873   9.414  1.00  0.61           C  
ATOM    339  CE2 TYR A  45     -25.518  12.556   9.456  1.00  0.61           C  
ATOM    340  CZ  TYR A  45     -25.248  13.908   9.679  1.00  0.61           C  
ATOM    341  OH  TYR A  45     -24.000  14.296  10.187  1.00  0.61           O  
ATOM    342  N   GLY A  46     -31.118  13.272  10.879  1.00  0.62           N  
ATOM    343  CA  GLY A  46     -31.455  13.893  12.160  1.00  0.62           C  
ATOM    344  C   GLY A  46     -31.700  12.934  13.305  1.00  0.62           C  
ATOM    345  O   GLY A  46     -31.437  13.267  14.457  1.00  0.62           O  
ATOM    346  N   GLU A  47     -32.172  11.699  13.025  1.00  0.57           N  
ATOM    347  CA  GLU A  47     -32.290  10.634  14.011  1.00  0.57           C  
ATOM    348  C   GLU A  47     -30.932  10.207  14.539  1.00  0.57           C  
ATOM    349  O   GLU A  47     -30.726  10.092  15.745  1.00  0.57           O  
ATOM    350  CB  GLU A  47     -32.972   9.391  13.392  1.00  0.57           C  
ATOM    351  CG  GLU A  47     -34.432   9.640  12.946  1.00  0.57           C  
ATOM    352  CD  GLU A  47     -34.931   8.657  11.887  1.00  0.57           C  
ATOM    353  OE1 GLU A  47     -36.122   8.787  11.517  1.00  0.57           O  
ATOM    354  OE2 GLU A  47     -34.134   7.818  11.395  1.00  0.57           O  
ATOM    355  N   LEU A  48     -29.943  10.030  13.633  1.00  0.64           N  
ATOM    356  CA  LEU A  48     -28.563   9.750  13.989  1.00  0.64           C  
ATOM    357  C   LEU A  48     -27.917  10.883  14.767  1.00  0.64           C  
ATOM    358  O   LEU A  48     -27.248  10.651  15.768  1.00  0.64           O  
ATOM    359  CB  LEU A  48     -27.683   9.467  12.745  1.00  0.64           C  
ATOM    360  CG  LEU A  48     -28.064   8.209  11.950  1.00  0.64           C  
ATOM    361  CD1 LEU A  48     -27.317   8.182  10.611  1.00  0.64           C  
ATOM    362  CD2 LEU A  48     -27.778   6.920  12.738  1.00  0.64           C  
ATOM    363  N   VAL A  49     -28.123  12.150  14.357  1.00  0.65           N  
ATOM    364  CA  VAL A  49     -27.635  13.313  15.091  1.00  0.65           C  
ATOM    365  C   VAL A  49     -28.227  13.399  16.496  1.00  0.65           C  
ATOM    366  O   VAL A  49     -27.513  13.593  17.480  1.00  0.65           O  
ATOM    367  CB  VAL A  49     -27.920  14.600  14.319  1.00  0.65           C  
ATOM    368  CG1 VAL A  49     -27.560  15.854  15.143  1.00  0.65           C  
ATOM    369  CG2 VAL A  49     -27.097  14.600  13.015  1.00  0.65           C  
ATOM    370  N   GLY A  50     -29.555  13.191  16.636  1.00  0.63           N  
ATOM    371  CA  GLY A  50     -30.244  13.214  17.922  1.00  0.63           C  
ATOM    372  C   GLY A  50     -29.882  12.097  18.870  1.00  0.63           C  
ATOM    373  O   GLY A  50     -29.915  12.267  20.091  1.00  0.63           O  
ATOM    374  N   SER A  51     -29.504  10.917  18.346  1.00  0.63           N  
ATOM    375  CA  SER A  51     -29.127   9.770  19.159  1.00  0.63           C  
ATOM    376  C   SER A  51     -27.635   9.680  19.427  1.00  0.63           C  
ATOM    377  O   SER A  51     -27.214   8.928  20.302  1.00  0.63           O  
ATOM    378  CB  SER A  51     -29.593   8.433  18.516  1.00  0.63           C  
ATOM    379  OG  SER A  51     -28.962   8.184  17.258  1.00  0.63           O  
ATOM    380  N   TYR A  52     -26.794  10.471  18.724  1.00  0.30           N  
ATOM    381  CA  TYR A  52     -25.349  10.459  18.894  1.00  0.30           C  
ATOM    382  C   TYR A  52     -24.886  10.916  20.271  1.00  0.30           C  
ATOM    383  O   TYR A  52     -25.227  11.997  20.752  1.00  0.30           O  
ATOM    384  CB  TYR A  52     -24.647  11.308  17.795  1.00  0.30           C  
ATOM    385  CG  TYR A  52     -23.144  11.144  17.798  1.00  0.30           C  
ATOM    386  CD1 TYR A  52     -22.292  12.258  17.900  1.00  0.30           C  
ATOM    387  CD2 TYR A  52     -22.574   9.866  17.699  1.00  0.30           C  
ATOM    388  CE1 TYR A  52     -20.898  12.092  17.887  1.00  0.30           C  
ATOM    389  CE2 TYR A  52     -21.184   9.698  17.678  1.00  0.30           C  
ATOM    390  CZ  TYR A  52     -20.348  10.813  17.770  1.00  0.30           C  
ATOM    391  OH  TYR A  52     -18.951  10.658  17.741  1.00  0.30           O  
ATOM    392  N   ARG A  53     -24.077  10.088  20.947  1.00  0.27           N  
ATOM    393  CA  ARG A  53     -23.545  10.410  22.250  1.00  0.27           C  
ATOM    394  C   ARG A  53     -22.034  10.220  22.224  1.00  0.27           C  
ATOM    395  O   ARG A  53     -21.579   9.075  22.253  1.00  0.27           O  
ATOM    396  CB  ARG A  53     -24.216   9.515  23.325  1.00  0.27           C  
ATOM    397  CG  ARG A  53     -25.721   9.816  23.526  1.00  0.27           C  
ATOM    398  CD  ARG A  53     -26.025  11.245  24.008  1.00  0.27           C  
ATOM    399  NE  ARG A  53     -27.525  11.408  24.020  1.00  0.27           N  
ATOM    400  CZ  ARG A  53     -28.251  11.801  22.964  1.00  0.27           C  
ATOM    401  NH1 ARG A  53     -27.721  12.170  21.807  1.00  0.27           N  
ATOM    402  NH2 ARG A  53     -29.582  11.832  23.039  1.00  0.27           N  
ATOM    403  N   PRO A  54     -21.201  11.270  22.171  1.00  0.39           N  
ATOM    404  CA  PRO A  54     -19.750  11.124  22.101  1.00  0.39           C  
ATOM    405  C   PRO A  54     -19.192  10.827  23.481  1.00  0.39           C  
ATOM    406  O   PRO A  54     -18.027  10.450  23.598  1.00  0.39           O  
ATOM    407  CB  PRO A  54     -19.284  12.488  21.565  1.00  0.39           C  
ATOM    408  CG  PRO A  54     -20.321  13.472  22.111  1.00  0.39           C  
ATOM    409  CD  PRO A  54     -21.620  12.670  22.033  1.00  0.39           C  
ATOM    410  N   ASP A  55     -20.016  10.989  24.534  1.00  0.36           N  
ATOM    411  CA  ASP A  55     -19.797  10.550  25.891  1.00  0.36           C  
ATOM    412  C   ASP A  55     -19.690   9.028  25.990  1.00  0.36           C  
ATOM    413  O   ASP A  55     -18.841   8.482  26.691  1.00  0.36           O  
ATOM    414  CB  ASP A  55     -20.929  11.128  26.808  1.00  0.36           C  
ATOM    415  CG  ASP A  55     -22.338  10.970  26.242  1.00  0.36           C  
ATOM    416  OD1 ASP A  55     -22.613  11.598  25.184  1.00  0.36           O  
ATOM    417  OD2 ASP A  55     -23.160  10.221  26.835  1.00  0.36           O  
ATOM    418  N   ARG A  56     -20.535   8.300  25.236  1.00  0.30           N  
ATOM    419  CA  ARG A  56     -20.613   6.851  25.245  1.00  0.30           C  
ATOM    420  C   ARG A  56     -19.714   6.198  24.209  1.00  0.30           C  
ATOM    421  O   ARG A  56     -20.118   5.283  23.495  1.00  0.30           O  
ATOM    422  CB  ARG A  56     -22.072   6.389  25.028  1.00  0.30           C  
ATOM    423  CG  ARG A  56     -23.015   6.972  26.088  1.00  0.30           C  
ATOM    424  CD  ARG A  56     -24.454   6.493  25.960  1.00  0.30           C  
ATOM    425  NE  ARG A  56     -25.202   7.220  27.032  1.00  0.30           N  
ATOM    426  CZ  ARG A  56     -26.328   6.771  27.602  1.00  0.30           C  
ATOM    427  NH1 ARG A  56     -26.968   5.706  27.126  1.00  0.30           N  
ATOM    428  NH2 ARG A  56     -26.820   7.398  28.666  1.00  0.30           N  
ATOM    429  N   ALA A  57     -18.458   6.663  24.111  1.00  0.44           N  
ATOM    430  CA  ALA A  57     -17.445   6.093  23.250  1.00  0.44           C  
ATOM    431  C   ALA A  57     -17.091   4.635  23.551  1.00  0.44           C  
ATOM    432  O   ALA A  57     -16.985   4.220  24.705  1.00  0.44           O  
ATOM    433  CB  ALA A  57     -16.170   6.956  23.335  1.00  0.44           C  
ATOM    434  N   GLY A  58     -16.871   3.812  22.498  1.00  0.47           N  
ATOM    435  CA  GLY A  58     -16.241   2.501  22.642  1.00  0.47           C  
ATOM    436  C   GLY A  58     -14.807   2.615  23.103  1.00  0.47           C  
ATOM    437  O   GLY A  58     -14.084   3.517  22.694  1.00  0.47           O  
ATOM    438  N   ALA A  59     -14.345   1.695  23.973  1.00  0.65           N  
ATOM    439  CA  ALA A  59     -13.008   1.767  24.537  1.00  0.65           C  
ATOM    440  C   ALA A  59     -11.889   1.586  23.511  1.00  0.65           C  
ATOM    441  O   ALA A  59     -11.853   0.610  22.763  1.00  0.65           O  
ATOM    442  CB  ALA A  59     -12.852   0.733  25.674  1.00  0.65           C  
ATOM    443  N   VAL A  60     -10.927   2.522  23.465  1.00  0.63           N  
ATOM    444  CA  VAL A  60      -9.863   2.530  22.483  1.00  0.63           C  
ATOM    445  C   VAL A  60      -8.565   2.152  23.169  1.00  0.63           C  
ATOM    446  O   VAL A  60      -7.989   2.900  23.961  1.00  0.63           O  
ATOM    447  CB  VAL A  60      -9.710   3.888  21.799  1.00  0.63           C  
ATOM    448  CG1 VAL A  60      -8.622   3.828  20.705  1.00  0.63           C  
ATOM    449  CG2 VAL A  60     -11.056   4.313  21.178  1.00  0.63           C  
ATOM    450  N   THR A  61      -8.048   0.950  22.863  1.00  0.66           N  
ATOM    451  CA  THR A  61      -6.765   0.493  23.378  1.00  0.66           C  
ATOM    452  C   THR A  61      -5.709   0.786  22.348  1.00  0.66           C  
ATOM    453  O   THR A  61      -5.759   0.288  21.223  1.00  0.66           O  
ATOM    454  CB  THR A  61      -6.710  -1.005  23.666  1.00  0.66           C  
ATOM    455  OG1 THR A  61      -7.553  -1.334  24.760  1.00  0.66           O  
ATOM    456  CG2 THR A  61      -5.304  -1.477  24.076  1.00  0.66           C  
ATOM    457  N   ALA A  62      -4.684   1.577  22.710  1.00  0.69           N  
ATOM    458  CA  ALA A  62      -3.501   1.702  21.889  1.00  0.69           C  
ATOM    459  C   ALA A  62      -2.608   0.490  22.069  1.00  0.69           C  
ATOM    460  O   ALA A  62      -2.295   0.092  23.190  1.00  0.69           O  
ATOM    461  CB  ALA A  62      -2.689   2.960  22.232  1.00  0.69           C  
ATOM    462  N   VAL A  63      -2.190  -0.127  20.959  1.00  0.71           N  
ATOM    463  CA  VAL A  63      -1.318  -1.279  20.958  1.00  0.71           C  
ATOM    464  C   VAL A  63      -0.002  -0.823  20.379  1.00  0.71           C  
ATOM    465  O   VAL A  63       0.084  -0.462  19.207  1.00  0.71           O  
ATOM    466  CB  VAL A  63      -1.869  -2.419  20.111  1.00  0.71           C  
ATOM    467  CG1 VAL A  63      -0.885  -3.607  20.114  1.00  0.71           C  
ATOM    468  CG2 VAL A  63      -3.250  -2.835  20.660  1.00  0.71           C  
ATOM    469  N   VAL A  64       1.060  -0.820  21.201  1.00  0.72           N  
ATOM    470  CA  VAL A  64       2.372  -0.377  20.776  1.00  0.72           C  
ATOM    471  C   VAL A  64       3.317  -1.555  20.816  1.00  0.72           C  
ATOM    472  O   VAL A  64       3.593  -2.129  21.868  1.00  0.72           O  
ATOM    473  CB  VAL A  64       2.925   0.769  21.622  1.00  0.72           C  
ATOM    474  CG1 VAL A  64       4.256   1.269  21.024  1.00  0.72           C  
ATOM    475  CG2 VAL A  64       1.905   1.926  21.641  1.00  0.72           C  
ATOM    476  N   LEU A  65       3.856  -1.963  19.654  1.00  0.67           N  
ATOM    477  CA  LEU A  65       4.907  -2.964  19.601  1.00  0.67           C  
ATOM    478  C   LEU A  65       6.227  -2.262  19.848  1.00  0.67           C  
ATOM    479  O   LEU A  65       6.461  -1.171  19.337  1.00  0.67           O  
ATOM    480  CB  LEU A  65       4.958  -3.708  18.242  1.00  0.67           C  
ATOM    481  CG  LEU A  65       4.056  -4.958  18.155  1.00  0.67           C  
ATOM    482  CD1 LEU A  65       2.562  -4.656  18.355  1.00  0.67           C  
ATOM    483  CD2 LEU A  65       4.289  -5.665  16.813  1.00  0.67           C  
ATOM    484  N   THR A  66       7.112  -2.850  20.670  1.00  0.66           N  
ATOM    485  CA  THR A  66       8.309  -2.143  21.098  1.00  0.66           C  
ATOM    486  C   THR A  66       9.454  -3.112  21.307  1.00  0.66           C  
ATOM    487  O   THR A  66       9.245  -4.308  21.518  1.00  0.66           O  
ATOM    488  CB  THR A  66       8.059  -1.286  22.340  1.00  0.66           C  
ATOM    489  OG1 THR A  66       9.118  -0.370  22.561  1.00  0.66           O  
ATOM    490  CG2 THR A  66       7.876  -2.125  23.613  1.00  0.66           C  
ATOM    491  N   HIS A  67      10.695  -2.601  21.206  1.00  0.53           N  
ATOM    492  CA  HIS A  67      11.922  -3.372  21.272  1.00  0.53           C  
ATOM    493  C   HIS A  67      13.104  -2.425  21.149  1.00  0.53           C  
ATOM    494  O   HIS A  67      13.448  -2.020  20.042  1.00  0.53           O  
ATOM    495  CB  HIS A  67      12.082  -4.410  20.126  1.00  0.53           C  
ATOM    496  CG  HIS A  67      13.293  -5.254  20.361  1.00  0.53           C  
ATOM    497  ND1 HIS A  67      13.195  -6.257  21.299  1.00  0.53           N  
ATOM    498  CD2 HIS A  67      14.593  -4.933  20.148  1.00  0.53           C  
ATOM    499  CE1 HIS A  67      14.439  -6.521  21.655  1.00  0.53           C  
ATOM    500  NE2 HIS A  67      15.325  -5.739  20.992  1.00  0.53           N  
ATOM    501  N   ASP A  68      13.746  -2.062  22.275  1.00  0.54           N  
ATOM    502  CA  ASP A  68      14.892  -1.159  22.329  1.00  0.54           C  
ATOM    503  C   ASP A  68      14.616   0.254  21.775  1.00  0.54           C  
ATOM    504  O   ASP A  68      15.331   0.788  20.926  1.00  0.54           O  
ATOM    505  CB  ASP A  68      16.205  -1.781  21.769  1.00  0.54           C  
ATOM    506  CG  ASP A  68      16.590  -3.059  22.491  1.00  0.54           C  
ATOM    507  OD1 ASP A  68      16.288  -3.186  23.705  1.00  0.54           O  
ATOM    508  OD2 ASP A  68      17.209  -3.938  21.833  1.00  0.54           O  
ATOM    509  N   GLU A  69      13.531   0.883  22.273  1.00  0.59           N  
ATOM    510  CA  GLU A  69      12.934   2.099  21.747  1.00  0.59           C  
ATOM    511  C   GLU A  69      12.921   3.233  22.768  1.00  0.59           C  
ATOM    512  O   GLU A  69      12.099   4.153  22.682  1.00  0.59           O  
ATOM    513  CB  GLU A  69      11.466   1.821  21.338  1.00  0.59           C  
ATOM    514  CG  GLU A  69      11.319   0.830  20.156  1.00  0.59           C  
ATOM    515  CD  GLU A  69      11.581   1.430  18.774  1.00  0.59           C  
ATOM    516  OE1 GLU A  69      11.320   0.690  17.789  1.00  0.59           O  
ATOM    517  OE2 GLU A  69      11.985   2.617  18.686  1.00  0.59           O  
ATOM    518  N   GLU A  70      13.814   3.226  23.787  1.00  0.57           N  
ATOM    519  CA  GLU A  70      13.735   4.099  24.958  1.00  0.57           C  
ATOM    520  C   GLU A  70      13.603   5.589  24.676  1.00  0.57           C  
ATOM    521  O   GLU A  70      12.849   6.303  25.334  1.00  0.57           O  
ATOM    522  CB  GLU A  70      14.942   3.882  25.913  1.00  0.57           C  
ATOM    523  CG  GLU A  70      16.339   4.211  25.315  1.00  0.57           C  
ATOM    524  CD  GLU A  70      17.515   3.924  26.244  1.00  0.57           C  
ATOM    525  OE1 GLU A  70      18.624   4.416  25.911  1.00  0.57           O  
ATOM    526  OE2 GLU A  70      17.326   3.242  27.284  1.00  0.57           O  
ATOM    527  N   GLN A  71      14.316   6.090  23.657  1.00  0.57           N  
ATOM    528  CA  GLN A  71      14.308   7.478  23.256  1.00  0.57           C  
ATOM    529  C   GLN A  71      12.984   7.961  22.663  1.00  0.57           C  
ATOM    530  O   GLN A  71      12.560   9.088  22.916  1.00  0.57           O  
ATOM    531  CB  GLN A  71      15.515   7.752  22.324  1.00  0.57           C  
ATOM    532  CG  GLN A  71      16.845   7.304  22.984  1.00  0.57           C  
ATOM    533  CD  GLN A  71      18.093   7.758  22.232  1.00  0.57           C  
ATOM    534  OE1 GLN A  71      18.072   8.612  21.344  1.00  0.57           O  
ATOM    535  NE2 GLN A  71      19.240   7.141  22.599  1.00  0.57           N  
ATOM    536  N   VAL A  72      12.273   7.128  21.872  1.00  0.65           N  
ATOM    537  CA  VAL A  72      11.052   7.561  21.197  1.00  0.65           C  
ATOM    538  C   VAL A  72       9.779   7.144  21.916  1.00  0.65           C  
ATOM    539  O   VAL A  72       8.747   7.809  21.791  1.00  0.65           O  
ATOM    540  CB  VAL A  72      10.975   7.055  19.760  1.00  0.65           C  
ATOM    541  CG1 VAL A  72      12.091   7.716  18.931  1.00  0.65           C  
ATOM    542  CG2 VAL A  72      11.076   5.520  19.693  1.00  0.65           C  
ATOM    543  N   ILE A  73       9.807   6.078  22.750  1.00  0.67           N  
ATOM    544  CA  ILE A  73       8.607   5.483  23.341  1.00  0.67           C  
ATOM    545  C   ILE A  73       7.785   6.446  24.195  1.00  0.67           C  
ATOM    546  O   ILE A  73       6.556   6.481  24.139  1.00  0.67           O  
ATOM    547  CB  ILE A  73       8.927   4.189  24.102  1.00  0.67           C  
ATOM    548  CG1 ILE A  73       7.668   3.385  24.515  1.00  0.67           C  
ATOM    549  CG2 ILE A  73       9.822   4.454  25.335  1.00  0.67           C  
ATOM    550  CD1 ILE A  73       6.828   2.887  23.333  1.00  0.67           C  
ATOM    551  N   GLY A  74       8.450   7.321  24.980  1.00  0.65           N  
ATOM    552  CA  GLY A  74       7.766   8.318  25.794  1.00  0.65           C  
ATOM    553  C   GLY A  74       7.057   9.404  25.019  1.00  0.65           C  
ATOM    554  O   GLY A  74       6.085   9.979  25.499  1.00  0.65           O  
ATOM    555  N   ALA A  75       7.521   9.724  23.795  1.00  0.69           N  
ATOM    556  CA  ALA A  75       6.837  10.643  22.905  1.00  0.69           C  
ATOM    557  C   ALA A  75       5.567  10.041  22.319  1.00  0.69           C  
ATOM    558  O   ALA A  75       4.516  10.679  22.311  1.00  0.69           O  
ATOM    559  CB  ALA A  75       7.785  11.092  21.777  1.00  0.69           C  
ATOM    560  N   CYS A  76       5.639   8.766  21.876  1.00  0.69           N  
ATOM    561  CA  CYS A  76       4.518   8.008  21.339  1.00  0.69           C  
ATOM    562  C   CYS A  76       3.370   7.882  22.337  1.00  0.69           C  
ATOM    563  O   CYS A  76       2.226   8.225  22.047  1.00  0.69           O  
ATOM    564  CB  CYS A  76       5.042   6.595  20.935  1.00  0.69           C  
ATOM    565  SG  CYS A  76       3.813   5.423  20.247  1.00  0.69           S  
ATOM    566  N   LEU A  77       3.663   7.461  23.584  1.00  0.68           N  
ATOM    567  CA  LEU A  77       2.657   7.296  24.622  1.00  0.68           C  
ATOM    568  C   LEU A  77       1.978   8.581  25.066  1.00  0.68           C  
ATOM    569  O   LEU A  77       0.764   8.614  25.262  1.00  0.68           O  
ATOM    570  CB  LEU A  77       3.235   6.544  25.842  1.00  0.68           C  
ATOM    571  CG  LEU A  77       3.755   5.129  25.514  1.00  0.68           C  
ATOM    572  CD1 LEU A  77       4.358   4.499  26.774  1.00  0.68           C  
ATOM    573  CD2 LEU A  77       2.672   4.215  24.916  1.00  0.68           C  
ATOM    574  N   ARG A  78       2.722   9.701  25.189  1.00  0.61           N  
ATOM    575  CA  ARG A  78       2.154  10.983  25.583  1.00  0.61           C  
ATOM    576  C   ARG A  78       1.295  11.637  24.515  1.00  0.61           C  
ATOM    577  O   ARG A  78       0.564  12.582  24.794  1.00  0.61           O  
ATOM    578  CB  ARG A  78       3.252  11.999  25.975  1.00  0.61           C  
ATOM    579  CG  ARG A  78       3.868  11.713  27.353  1.00  0.61           C  
ATOM    580  CD  ARG A  78       4.738  12.851  27.892  1.00  0.61           C  
ATOM    581  NE  ARG A  78       5.937  12.963  26.992  1.00  0.61           N  
ATOM    582  CZ  ARG A  78       7.148  12.460  27.268  1.00  0.61           C  
ATOM    583  NH1 ARG A  78       7.386  11.805  28.398  1.00  0.61           N  
ATOM    584  NH2 ARG A  78       8.140  12.625  26.394  1.00  0.61           N  
ATOM    585  N   ALA A  79       1.348  11.154  23.264  1.00  0.68           N  
ATOM    586  CA  ALA A  79       0.495  11.662  22.217  1.00  0.68           C  
ATOM    587  C   ALA A  79      -0.764  10.820  22.065  1.00  0.68           C  
ATOM    588  O   ALA A  79      -1.656  11.151  21.293  1.00  0.68           O  
ATOM    589  CB  ALA A  79       1.302  11.649  20.909  1.00  0.68           C  
ATOM    590  N   LEU A  80      -0.891   9.716  22.826  1.00  0.64           N  
ATOM    591  CA  LEU A  80      -2.041   8.835  22.738  1.00  0.64           C  
ATOM    592  C   LEU A  80      -2.954   8.948  23.947  1.00  0.64           C  
ATOM    593  O   LEU A  80      -4.023   8.345  23.977  1.00  0.64           O  
ATOM    594  CB  LEU A  80      -1.555   7.368  22.622  1.00  0.64           C  
ATOM    595  CG  LEU A  80      -0.839   7.055  21.293  1.00  0.64           C  
ATOM    596  CD1 LEU A  80      -0.061   5.735  21.386  1.00  0.64           C  
ATOM    597  CD2 LEU A  80      -1.818   7.024  20.110  1.00  0.64           C  
ATOM    598  N   THR A  81      -2.591   9.739  24.975  1.00  0.60           N  
ATOM    599  CA  THR A  81      -3.364   9.870  26.212  1.00  0.60           C  
ATOM    600  C   THR A  81      -4.731  10.496  26.052  1.00  0.60           C  
ATOM    601  O   THR A  81      -5.685  10.079  26.699  1.00  0.60           O  
ATOM    602  CB  THR A  81      -2.636  10.624  27.317  1.00  0.60           C  
ATOM    603  OG1 THR A  81      -2.049  11.831  26.845  1.00  0.60           O  
ATOM    604  CG2 THR A  81      -1.479   9.750  27.822  1.00  0.60           C  
ATOM    605  N   ASP A  82      -4.869  11.523  25.193  1.00  0.48           N  
ATOM    606  CA  ASP A  82      -6.139  12.165  24.910  1.00  0.48           C  
ATOM    607  C   ASP A  82      -7.148  11.226  24.232  1.00  0.48           C  
ATOM    608  O   ASP A  82      -8.339  11.187  24.544  1.00  0.48           O  
ATOM    609  CB  ASP A  82      -5.878  13.374  23.985  1.00  0.48           C  
ATOM    610  CG  ASP A  82      -4.828  14.308  24.562  1.00  0.48           C  
ATOM    611  OD1 ASP A  82      -5.169  15.121  25.452  1.00  0.48           O  
ATOM    612  OD2 ASP A  82      -3.675  14.292  24.048  1.00  0.48           O  
ATOM    613  N   ASP A  83      -6.667  10.425  23.264  1.00  0.54           N  
ATOM    614  CA  ASP A  83      -7.516   9.624  22.417  1.00  0.54           C  
ATOM    615  C   ASP A  83      -7.715   8.191  22.883  1.00  0.54           C  
ATOM    616  O   ASP A  83      -8.704   7.569  22.493  1.00  0.54           O  
ATOM    617  CB  ASP A  83      -6.894   9.597  21.004  1.00  0.54           C  
ATOM    618  CG  ASP A  83      -7.314  10.851  20.277  1.00  0.54           C  
ATOM    619  OD1 ASP A  83      -8.481  10.870  19.801  1.00  0.54           O  
ATOM    620  OD2 ASP A  83      -6.505  11.801  20.169  1.00  0.54           O  
ATOM    621  N   CYS A  84      -6.853   7.621  23.747  1.00  0.59           N  
ATOM    622  CA  CYS A  84      -6.898   6.197  24.065  1.00  0.59           C  
ATOM    623  C   CYS A  84      -7.052   5.935  25.553  1.00  0.59           C  
ATOM    624  O   CYS A  84      -6.265   6.395  26.376  1.00  0.59           O  
ATOM    625  CB  CYS A  84      -5.627   5.468  23.558  1.00  0.59           C  
ATOM    626  SG  CYS A  84      -5.436   5.624  21.746  1.00  0.59           S  
ATOM    627  N   ASP A  85      -8.085   5.149  25.929  1.00  0.62           N  
ATOM    628  CA  ASP A  85      -8.455   4.803  27.292  1.00  0.62           C  
ATOM    629  C   ASP A  85      -7.410   3.923  27.967  1.00  0.62           C  
ATOM    630  O   ASP A  85      -7.228   3.939  29.184  1.00  0.62           O  
ATOM    631  CB  ASP A  85      -9.824   4.052  27.329  1.00  0.62           C  
ATOM    632  CG  ASP A  85     -10.851   4.715  26.442  1.00  0.62           C  
ATOM    633  OD1 ASP A  85     -11.772   5.414  26.923  1.00  0.62           O  
ATOM    634  OD2 ASP A  85     -10.709   4.576  25.198  1.00  0.62           O  
ATOM    635  N   ARG A  86      -6.706   3.102  27.166  1.00  0.60           N  
ATOM    636  CA  ARG A  86      -5.756   2.143  27.673  1.00  0.60           C  
ATOM    637  C   ARG A  86      -4.547   2.072  26.756  1.00  0.60           C  
ATOM    638  O   ARG A  86      -4.668   2.094  25.531  1.00  0.60           O  
ATOM    639  CB  ARG A  86      -6.436   0.758  27.776  1.00  0.60           C  
ATOM    640  CG  ARG A  86      -5.762  -0.204  28.767  1.00  0.60           C  
ATOM    641  CD  ARG A  86      -6.468  -1.558  28.891  1.00  0.60           C  
ATOM    642  NE  ARG A  86      -6.133  -2.314  27.646  1.00  0.60           N  
ATOM    643  CZ  ARG A  86      -6.285  -3.636  27.516  1.00  0.60           C  
ATOM    644  NH1 ARG A  86      -6.859  -4.379  28.452  1.00  0.60           N  
ATOM    645  NH2 ARG A  86      -5.827  -4.243  26.427  1.00  0.60           N  
ATOM    646  N   LEU A  87      -3.331   1.991  27.329  1.00  0.71           N  
ATOM    647  CA  LEU A  87      -2.098   1.946  26.567  1.00  0.71           C  
ATOM    648  C   LEU A  87      -1.408   0.619  26.831  1.00  0.71           C  
ATOM    649  O   LEU A  87      -0.967   0.345  27.945  1.00  0.71           O  
ATOM    650  CB  LEU A  87      -1.141   3.100  26.968  1.00  0.71           C  
ATOM    651  CG  LEU A  87      -1.712   4.525  26.795  1.00  0.71           C  
ATOM    652  CD1 LEU A  87      -0.705   5.564  27.311  1.00  0.71           C  
ATOM    653  CD2 LEU A  87      -2.096   4.848  25.345  1.00  0.71           C  
ATOM    654  N   LEU A  88      -1.306  -0.243  25.801  1.00  0.70           N  
ATOM    655  CA  LEU A  88      -0.772  -1.583  25.920  1.00  0.70           C  
ATOM    656  C   LEU A  88       0.502  -1.710  25.105  1.00  0.70           C  
ATOM    657  O   LEU A  88       0.517  -1.542  23.886  1.00  0.70           O  
ATOM    658  CB  LEU A  88      -1.810  -2.616  25.404  1.00  0.70           C  
ATOM    659  CG  LEU A  88      -1.357  -4.094  25.417  1.00  0.70           C  
ATOM    660  CD1 LEU A  88      -1.097  -4.608  26.841  1.00  0.70           C  
ATOM    661  CD2 LEU A  88      -2.383  -4.989  24.705  1.00  0.70           C  
ATOM    662  N   LEU A  89       1.623  -2.032  25.769  1.00  0.70           N  
ATOM    663  CA  LEU A  89       2.886  -2.305  25.118  1.00  0.70           C  
ATOM    664  C   LEU A  89       3.052  -3.799  24.946  1.00  0.70           C  
ATOM    665  O   LEU A  89       2.990  -4.569  25.904  1.00  0.70           O  
ATOM    666  CB  LEU A  89       4.108  -1.772  25.913  1.00  0.70           C  
ATOM    667  CG  LEU A  89       4.465  -0.299  25.630  1.00  0.70           C  
ATOM    668  CD1 LEU A  89       3.299   0.650  25.916  1.00  0.70           C  
ATOM    669  CD2 LEU A  89       5.694   0.117  26.451  1.00  0.70           C  
ATOM    670  N   VAL A  90       3.316  -4.239  23.706  1.00  0.69           N  
ATOM    671  CA  VAL A  90       3.768  -5.589  23.436  1.00  0.69           C  
ATOM    672  C   VAL A  90       5.273  -5.494  23.302  1.00  0.69           C  
ATOM    673  O   VAL A  90       5.807  -4.990  22.312  1.00  0.69           O  
ATOM    674  CB  VAL A  90       3.145  -6.204  22.187  1.00  0.69           C  
ATOM    675  CG1 VAL A  90       3.636  -7.658  22.022  1.00  0.69           C  
ATOM    676  CG2 VAL A  90       1.608  -6.175  22.326  1.00  0.69           C  
ATOM    677  N   ASP A  91       6.000  -5.943  24.338  1.00  0.63           N  
ATOM    678  CA  ASP A  91       7.437  -5.844  24.406  1.00  0.63           C  
ATOM    679  C   ASP A  91       8.024  -7.134  23.854  1.00  0.63           C  
ATOM    680  O   ASP A  91       7.577  -8.232  24.183  1.00  0.63           O  
ATOM    681  CB  ASP A  91       7.865  -5.559  25.870  1.00  0.63           C  
ATOM    682  CG  ASP A  91       9.356  -5.326  25.977  1.00  0.63           C  
ATOM    683  OD1 ASP A  91       9.794  -4.173  25.760  1.00  0.63           O  
ATOM    684  OD2 ASP A  91      10.086  -6.309  26.252  1.00  0.63           O  
ATOM    685  N   ALA A  92       9.034  -7.018  22.975  1.00  0.59           N  
ATOM    686  CA  ALA A  92       9.632  -8.148  22.300  1.00  0.59           C  
ATOM    687  C   ALA A  92      10.903  -8.637  22.987  1.00  0.59           C  
ATOM    688  O   ALA A  92      11.673  -9.378  22.376  1.00  0.59           O  
ATOM    689  CB  ALA A  92       9.921  -7.757  20.839  1.00  0.59           C  
ATOM    690  N   GLU A  93      11.092  -8.231  24.268  1.00  0.49           N  
ATOM    691  CA  GLU A  93      12.244  -8.463  25.125  1.00  0.49           C  
ATOM    692  C   GLU A  93      13.287  -7.360  24.973  1.00  0.49           C  
ATOM    693  O   GLU A  93      14.439  -7.599  24.617  1.00  0.49           O  
ATOM    694  CB  GLU A  93      12.824  -9.912  25.123  1.00  0.49           C  
ATOM    695  CG  GLU A  93      11.774 -10.984  25.527  1.00  0.49           C  
ATOM    696  CD  GLU A  93      12.283 -12.425  25.483  1.00  0.49           C  
ATOM    697  OE1 GLU A  93      12.122 -13.127  26.516  1.00  0.49           O  
ATOM    698  OE2 GLU A  93      12.761 -12.861  24.404  1.00  0.49           O  
ATOM    699  N   SER A  94      12.893  -6.092  25.255  1.00  0.56           N  
ATOM    700  CA  SER A  94      13.808  -4.944  25.274  1.00  0.56           C  
ATOM    701  C   SER A  94      14.923  -5.070  26.299  1.00  0.56           C  
ATOM    702  O   SER A  94      14.694  -5.498  27.431  1.00  0.56           O  
ATOM    703  CB  SER A  94      13.115  -3.602  25.610  1.00  0.56           C  
ATOM    704  OG  SER A  94      12.073  -3.326  24.672  1.00  0.56           O  
ATOM    705  N   GLU A  95      16.155  -4.658  25.946  1.00  0.50           N  
ATOM    706  CA  GLU A  95      17.293  -4.705  26.847  1.00  0.50           C  
ATOM    707  C   GLU A  95      17.690  -3.318  27.337  1.00  0.50           C  
ATOM    708  O   GLU A  95      18.529  -3.182  28.229  1.00  0.50           O  
ATOM    709  CB  GLU A  95      18.532  -5.340  26.161  1.00  0.50           C  
ATOM    710  CG  GLU A  95      18.361  -6.838  25.790  1.00  0.50           C  
ATOM    711  CD  GLU A  95      19.665  -7.542  25.401  1.00  0.50           C  
ATOM    712  OE1 GLU A  95      19.587  -8.762  25.093  1.00  0.50           O  
ATOM    713  OE2 GLU A  95      20.748  -6.902  25.434  1.00  0.50           O  
ATOM    714  N   ASP A  96      17.084  -2.243  26.793  1.00  0.51           N  
ATOM    715  CA  ASP A  96      17.353  -0.874  27.193  1.00  0.51           C  
ATOM    716  C   ASP A  96      16.522  -0.408  28.409  1.00  0.51           C  
ATOM    717  O   ASP A  96      16.130  -1.182  29.283  1.00  0.51           O  
ATOM    718  CB  ASP A  96      17.198   0.059  25.952  1.00  0.51           C  
ATOM    719  CG  ASP A  96      15.763   0.238  25.502  1.00  0.51           C  
ATOM    720  OD1 ASP A  96      14.847  -0.390  26.091  1.00  0.51           O  
ATOM    721  OD2 ASP A  96      15.507   1.064  24.594  1.00  0.51           O  
ATOM    722  N   THR A  97      16.195   0.905  28.486  1.00  0.63           N  
ATOM    723  CA  THR A  97      15.336   1.451  29.532  1.00  0.63           C  
ATOM    724  C   THR A  97      13.880   1.609  29.114  1.00  0.63           C  
ATOM    725  O   THR A  97      13.092   2.184  29.864  1.00  0.63           O  
ATOM    726  CB  THR A  97      15.816   2.770  30.151  1.00  0.63           C  
ATOM    727  OG1 THR A  97      15.795   3.880  29.264  1.00  0.63           O  
ATOM    728  CG2 THR A  97      17.249   2.608  30.675  1.00  0.63           C  
ATOM    729  N   THR A  98      13.446   1.060  27.949  1.00  0.63           N  
ATOM    730  CA  THR A  98      12.118   1.238  27.325  1.00  0.63           C  
ATOM    731  C   THR A  98      10.953   1.119  28.264  1.00  0.63           C  
ATOM    732  O   THR A  98      10.100   2.001  28.336  1.00  0.63           O  
ATOM    733  CB  THR A  98      11.851   0.256  26.183  1.00  0.63           C  
ATOM    734  OG1 THR A  98      12.660   0.632  25.085  1.00  0.63           O  
ATOM    735  CG2 THR A  98      10.418   0.288  25.628  1.00  0.63           C  
ATOM    736  N   LEU A  99      10.899   0.033  29.052  1.00  0.59           N  
ATOM    737  CA  LEU A  99       9.831  -0.197  30.004  1.00  0.59           C  
ATOM    738  C   LEU A  99       9.809   0.788  31.166  1.00  0.59           C  
ATOM    739  O   LEU A  99       8.747   1.103  31.697  1.00  0.59           O  
ATOM    740  CB  LEU A  99       9.864  -1.646  30.541  1.00  0.59           C  
ATOM    741  CG  LEU A  99       9.671  -2.728  29.456  1.00  0.59           C  
ATOM    742  CD1 LEU A  99       9.773  -4.137  30.061  1.00  0.59           C  
ATOM    743  CD2 LEU A  99       8.337  -2.582  28.706  1.00  0.59           C  
ATOM    744  N   GLY A 100      10.974   1.328  31.583  1.00  0.63           N  
ATOM    745  CA  GLY A 100      11.037   2.375  32.600  1.00  0.63           C  
ATOM    746  C   GLY A 100      10.618   3.715  32.061  1.00  0.63           C  
ATOM    747  O   GLY A 100       9.810   4.414  32.665  1.00  0.63           O  
ATOM    748  N   THR A 101      11.113   4.081  30.865  1.00  0.64           N  
ATOM    749  CA  THR A 101      10.744   5.309  30.159  1.00  0.64           C  
ATOM    750  C   THR A 101       9.275   5.355  29.807  1.00  0.64           C  
ATOM    751  O   THR A 101       8.625   6.387  29.944  1.00  0.64           O  
ATOM    752  CB  THR A 101      11.581   5.548  28.911  1.00  0.64           C  
ATOM    753  OG1 THR A 101      12.930   5.707  29.316  1.00  0.64           O  
ATOM    754  CG2 THR A 101      11.184   6.854  28.202  1.00  0.64           C  
ATOM    755  N   ALA A 102       8.685   4.221  29.380  1.00  0.64           N  
ATOM    756  CA  ALA A 102       7.261   4.099  29.146  1.00  0.64           C  
ATOM    757  C   ALA A 102       6.396   4.354  30.379  1.00  0.64           C  
ATOM    758  O   ALA A 102       5.418   5.093  30.315  1.00  0.64           O  
ATOM    759  CB  ALA A 102       6.967   2.685  28.609  1.00  0.64           C  
ATOM    760  N   ARG A 103       6.767   3.779  31.544  1.00  0.56           N  
ATOM    761  CA  ARG A 103       6.098   4.017  32.815  1.00  0.56           C  
ATOM    762  C   ARG A 103       6.227   5.445  33.318  1.00  0.56           C  
ATOM    763  O   ARG A 103       5.271   6.032  33.807  1.00  0.56           O  
ATOM    764  CB  ARG A 103       6.623   3.047  33.899  1.00  0.56           C  
ATOM    765  CG  ARG A 103       6.224   1.581  33.640  1.00  0.56           C  
ATOM    766  CD  ARG A 103       6.966   0.606  34.555  1.00  0.56           C  
ATOM    767  NE  ARG A 103       6.642  -0.780  34.084  1.00  0.56           N  
ATOM    768  CZ  ARG A 103       7.414  -1.843  34.337  1.00  0.56           C  
ATOM    769  NH1 ARG A 103       8.394  -1.787  35.235  1.00  0.56           N  
ATOM    770  NH2 ARG A 103       7.205  -2.985  33.691  1.00  0.56           N  
ATOM    771  N   SER A 104       7.414   6.062  33.189  1.00  0.62           N  
ATOM    772  CA  SER A 104       7.634   7.436  33.628  1.00  0.62           C  
ATOM    773  C   SER A 104       7.044   8.475  32.689  1.00  0.62           C  
ATOM    774  O   SER A 104       6.956   9.655  33.019  1.00  0.62           O  
ATOM    775  CB  SER A 104       9.141   7.763  33.761  1.00  0.62           C  
ATOM    776  OG  SER A 104       9.742   6.940  34.760  1.00  0.62           O  
ATOM    777  N   ALA A 105       6.649   8.083  31.463  1.00  0.59           N  
ATOM    778  CA  ALA A 105       6.093   8.998  30.493  1.00  0.59           C  
ATOM    779  C   ALA A 105       4.615   9.324  30.666  1.00  0.59           C  
ATOM    780  O   ALA A 105       4.182  10.388  30.221  1.00  0.59           O  
ATOM    781  CB  ALA A 105       6.294   8.415  29.081  1.00  0.59           C  
ATOM    782  N   VAL A 106       3.817   8.434  31.289  1.00  0.51           N  
ATOM    783  CA  VAL A 106       2.364   8.547  31.336  1.00  0.51           C  
ATOM    784  C   VAL A 106       1.842   8.014  32.661  1.00  0.51           C  
ATOM    785  O   VAL A 106       2.515   7.279  33.370  1.00  0.51           O  
ATOM    786  CB  VAL A 106       1.639   7.808  30.200  1.00  0.51           C  
ATOM    787  CG1 VAL A 106       1.877   8.526  28.858  1.00  0.51           C  
ATOM    788  CG2 VAL A 106       2.097   6.339  30.123  1.00  0.51           C  
ATOM    789  N   ALA A 107       0.604   8.393  33.048  1.00  0.34           N  
ATOM    790  CA  ALA A 107      -0.003   8.012  34.314  1.00  0.34           C  
ATOM    791  C   ALA A 107      -0.282   6.518  34.512  1.00  0.34           C  
ATOM    792  O   ALA A 107      -0.173   5.998  35.618  1.00  0.34           O  
ATOM    793  CB  ALA A 107      -1.307   8.814  34.507  1.00  0.34           C  
ATOM    794  N   HIS A 108      -0.673   5.797  33.445  1.00  0.45           N  
ATOM    795  CA  HIS A 108      -0.905   4.366  33.501  1.00  0.45           C  
ATOM    796  C   HIS A 108      -0.507   3.782  32.165  1.00  0.45           C  
ATOM    797  O   HIS A 108      -0.754   4.376  31.116  1.00  0.45           O  
ATOM    798  CB  HIS A 108      -2.388   4.012  33.804  1.00  0.45           C  
ATOM    799  CG  HIS A 108      -2.731   2.553  33.682  1.00  0.45           C  
ATOM    800  ND1 HIS A 108      -1.977   1.625  34.372  1.00  0.45           N  
ATOM    801  CD2 HIS A 108      -3.661   1.927  32.912  1.00  0.45           C  
ATOM    802  CE1 HIS A 108      -2.462   0.452  34.007  1.00  0.45           C  
ATOM    803  NE2 HIS A 108      -3.482   0.577  33.125  1.00  0.45           N  
ATOM    804  N   VAL A 109       0.144   2.608  32.183  1.00  0.66           N  
ATOM    805  CA  VAL A 109       0.541   1.898  30.988  1.00  0.66           C  
ATOM    806  C   VAL A 109       0.666   0.425  31.336  1.00  0.66           C  
ATOM    807  O   VAL A 109       1.073   0.061  32.439  1.00  0.66           O  
ATOM    808  CB  VAL A 109       1.822   2.470  30.371  1.00  0.66           C  
ATOM    809  CG1 VAL A 109       3.022   2.374  31.334  1.00  0.66           C  
ATOM    810  CG2 VAL A 109       2.138   1.811  29.019  1.00  0.66           C  
ATOM    811  N   GLU A 110       0.308  -0.471  30.401  1.00  0.67           N  
ATOM    812  CA  GLU A 110       0.309  -1.903  30.612  1.00  0.67           C  
ATOM    813  C   GLU A 110       1.330  -2.516  29.679  1.00  0.67           C  
ATOM    814  O   GLU A 110       1.421  -2.145  28.511  1.00  0.67           O  
ATOM    815  CB  GLU A 110      -1.098  -2.478  30.313  1.00  0.67           C  
ATOM    816  CG  GLU A 110      -2.163  -1.917  31.285  1.00  0.67           C  
ATOM    817  CD  GLU A 110      -3.605  -2.210  30.895  1.00  0.67           C  
ATOM    818  OE1 GLU A 110      -4.489  -1.585  31.547  1.00  0.67           O  
ATOM    819  OE2 GLU A 110      -3.864  -3.001  29.951  1.00  0.67           O  
ATOM    820  N   HIS A 111       2.167  -3.456  30.159  1.00  0.68           N  
ATOM    821  CA  HIS A 111       3.159  -4.102  29.319  1.00  0.68           C  
ATOM    822  C   HIS A 111       2.980  -5.608  29.347  1.00  0.68           C  
ATOM    823  O   HIS A 111       2.777  -6.210  30.399  1.00  0.68           O  
ATOM    824  CB  HIS A 111       4.624  -3.721  29.697  1.00  0.68           C  
ATOM    825  CG  HIS A 111       5.177  -4.440  30.897  1.00  0.68           C  
ATOM    826  ND1 HIS A 111       4.886  -4.016  32.184  1.00  0.68           N  
ATOM    827  CD2 HIS A 111       5.735  -5.678  30.924  1.00  0.68           C  
ATOM    828  CE1 HIS A 111       5.243  -5.027  32.959  1.00  0.68           C  
ATOM    829  NE2 HIS A 111       5.772  -6.050  32.248  1.00  0.68           N  
ATOM    830  N   VAL A 112       3.068  -6.263  28.178  1.00  0.70           N  
ATOM    831  CA  VAL A 112       3.135  -7.711  28.090  1.00  0.70           C  
ATOM    832  C   VAL A 112       4.411  -8.046  27.344  1.00  0.70           C  
ATOM    833  O   VAL A 112       4.623  -7.617  26.212  1.00  0.70           O  
ATOM    834  CB  VAL A 112       1.928  -8.331  27.391  1.00  0.70           C  
ATOM    835  CG1 VAL A 112       2.070  -9.865  27.307  1.00  0.70           C  
ATOM    836  CG2 VAL A 112       0.659  -7.981  28.192  1.00  0.70           C  
ATOM    837  N   THR A 113       5.318  -8.810  27.980  1.00  0.62           N  
ATOM    838  CA  THR A 113       6.598  -9.200  27.393  1.00  0.62           C  
ATOM    839  C   THR A 113       6.454 -10.547  26.724  1.00  0.62           C  
ATOM    840  O   THR A 113       6.009 -11.512  27.341  1.00  0.62           O  
ATOM    841  CB  THR A 113       7.720  -9.296  28.421  1.00  0.62           C  
ATOM    842  OG1 THR A 113       7.881  -8.054  29.088  1.00  0.62           O  
ATOM    843  CG2 THR A 113       9.078  -9.595  27.776  1.00  0.62           C  
ATOM    844  N   ARG A 114       6.801 -10.649  25.428  1.00  0.51           N  
ATOM    845  CA  ARG A 114       6.724 -11.890  24.682  1.00  0.51           C  
ATOM    846  C   ARG A 114       7.944 -12.022  23.800  1.00  0.51           C  
ATOM    847  O   ARG A 114       8.243 -11.127  23.017  1.00  0.51           O  
ATOM    848  CB  ARG A 114       5.501 -11.923  23.731  1.00  0.51           C  
ATOM    849  CG  ARG A 114       4.143 -11.908  24.451  1.00  0.51           C  
ATOM    850  CD  ARG A 114       2.941 -11.868  23.506  1.00  0.51           C  
ATOM    851  NE  ARG A 114       2.754 -13.229  22.889  1.00  0.51           N  
ATOM    852  CZ  ARG A 114       2.713 -13.436  21.567  1.00  0.51           C  
ATOM    853  NH1 ARG A 114       3.359 -12.664  20.700  1.00  0.51           N  
ATOM    854  NH2 ARG A 114       1.911 -14.387  21.085  1.00  0.51           N  
ATOM    855  N   ALA A 115       8.654 -13.162  23.870  1.00  0.51           N  
ATOM    856  CA  ALA A 115       9.850 -13.411  23.091  1.00  0.51           C  
ATOM    857  C   ALA A 115       9.703 -13.277  21.579  1.00  0.51           C  
ATOM    858  O   ALA A 115       8.679 -13.614  20.981  1.00  0.51           O  
ATOM    859  CB  ALA A 115      10.398 -14.809  23.438  1.00  0.51           C  
ATOM    860  N   TRP A 116      10.743 -12.747  20.910  1.00  0.36           N  
ATOM    861  CA  TRP A 116      10.769 -12.626  19.466  1.00  0.36           C  
ATOM    862  C   TRP A 116      10.907 -13.981  18.756  1.00  0.36           C  
ATOM    863  O   TRP A 116      11.909 -14.682  18.863  1.00  0.36           O  
ATOM    864  CB  TRP A 116      11.879 -11.628  19.034  1.00  0.36           C  
ATOM    865  CG  TRP A 116      12.031 -11.452  17.531  1.00  0.36           C  
ATOM    866  CD1 TRP A 116      12.978 -12.008  16.719  1.00  0.36           C  
ATOM    867  CD2 TRP A 116      11.067 -10.828  16.667  1.00  0.36           C  
ATOM    868  NE1 TRP A 116      12.672 -11.773  15.397  1.00  0.36           N  
ATOM    869  CE2 TRP A 116      11.506 -11.048  15.343  1.00  0.36           C  
ATOM    870  CE3 TRP A 116       9.880 -10.149  16.931  1.00  0.36           C  
ATOM    871  CZ2 TRP A 116      10.762 -10.600  14.262  1.00  0.36           C  
ATOM    872  CZ3 TRP A 116       9.116  -9.718  15.837  1.00  0.36           C  
ATOM    873  CH2 TRP A 116       9.552  -9.944  14.524  1.00  0.36           C  
ATOM    874  N   THR A 117       9.878 -14.376  17.980  1.00  0.38           N  
ATOM    875  CA  THR A 117       9.766 -15.701  17.376  1.00  0.38           C  
ATOM    876  C   THR A 117      10.054 -15.704  15.883  1.00  0.38           C  
ATOM    877  O   THR A 117       9.790 -16.696  15.196  1.00  0.38           O  
ATOM    878  CB  THR A 117       8.359 -16.271  17.567  1.00  0.38           C  
ATOM    879  OG1 THR A 117       7.366 -15.324  17.186  1.00  0.38           O  
ATOM    880  CG2 THR A 117       8.131 -16.580  19.054  1.00  0.38           C  
ATOM    881  N   ASP A 118      10.606 -14.591  15.345  1.00  0.33           N  
ATOM    882  CA  ASP A 118      10.671 -14.302  13.921  1.00  0.33           C  
ATOM    883  C   ASP A 118       9.277 -14.160  13.297  1.00  0.33           C  
ATOM    884  O   ASP A 118       8.891 -14.884  12.376  1.00  0.33           O  
ATOM    885  CB  ASP A 118      11.640 -15.245  13.141  1.00  0.33           C  
ATOM    886  CG  ASP A 118      13.036 -14.683  12.991  1.00  0.33           C  
ATOM    887  OD1 ASP A 118      13.367 -13.596  13.529  1.00  0.33           O  
ATOM    888  OD2 ASP A 118      13.831 -15.342  12.277  1.00  0.33           O  
ATOM    889  N   ASP A 119       8.481 -13.198  13.825  1.00  0.35           N  
ATOM    890  CA  ASP A 119       7.089 -13.027  13.457  1.00  0.35           C  
ATOM    891  C   ASP A 119       6.507 -11.706  13.999  1.00  0.35           C  
ATOM    892  O   ASP A 119       6.237 -11.550  15.193  1.00  0.35           O  
ATOM    893  CB  ASP A 119       6.271 -14.221  14.024  1.00  0.35           C  
ATOM    894  CG  ASP A 119       5.035 -14.501  13.200  1.00  0.35           C  
ATOM    895  OD1 ASP A 119       4.263 -13.547  12.942  1.00  0.35           O  
ATOM    896  OD2 ASP A 119       4.853 -15.688  12.821  1.00  0.35           O  
ATOM    897  N   PHE A 120       6.305 -10.693  13.126  1.00  0.37           N  
ATOM    898  CA  PHE A 120       5.623  -9.450  13.466  1.00  0.37           C  
ATOM    899  C   PHE A 120       4.128  -9.641  13.700  1.00  0.37           C  
ATOM    900  O   PHE A 120       3.550  -9.076  14.632  1.00  0.37           O  
ATOM    901  CB  PHE A 120       5.850  -8.360  12.384  1.00  0.37           C  
ATOM    902  CG  PHE A 120       7.236  -7.784  12.486  1.00  0.37           C  
ATOM    903  CD1 PHE A 120       7.531  -6.871  13.512  1.00  0.37           C  
ATOM    904  CD2 PHE A 120       8.250  -8.130  11.577  1.00  0.37           C  
ATOM    905  CE1 PHE A 120       8.816  -6.328  13.641  1.00  0.37           C  
ATOM    906  CE2 PHE A 120       9.539  -7.592  11.704  1.00  0.37           C  
ATOM    907  CZ  PHE A 120       9.822  -6.692  12.737  1.00  0.37           C  
ATOM    908  N   ALA A 121       3.463 -10.484  12.883  1.00  0.53           N  
ATOM    909  CA  ALA A 121       2.055 -10.796  13.013  1.00  0.53           C  
ATOM    910  C   ALA A 121       1.707 -11.469  14.333  1.00  0.53           C  
ATOM    911  O   ALA A 121       0.747 -11.090  15.001  1.00  0.53           O  
ATOM    912  CB  ALA A 121       1.609 -11.695  11.847  1.00  0.53           C  
ATOM    913  N   ALA A 122       2.511 -12.448  14.784  1.00  0.56           N  
ATOM    914  CA  ALA A 122       2.356 -13.090  16.076  1.00  0.56           C  
ATOM    915  C   ALA A 122       2.497 -12.148  17.269  1.00  0.56           C  
ATOM    916  O   ALA A 122       1.870 -12.351  18.310  1.00  0.56           O  
ATOM    917  CB  ALA A 122       3.348 -14.252  16.231  1.00  0.56           C  
ATOM    918  N   GLN A 123       3.340 -11.099  17.171  1.00  0.58           N  
ATOM    919  CA  GLN A 123       3.352 -10.019  18.146  1.00  0.58           C  
ATOM    920  C   GLN A 123       2.121  -9.115  18.089  1.00  0.58           C  
ATOM    921  O   GLN A 123       1.514  -8.830  19.118  1.00  0.58           O  
ATOM    922  CB  GLN A 123       4.656  -9.184  18.065  1.00  0.58           C  
ATOM    923  CG  GLN A 123       5.958  -9.964  18.405  1.00  0.58           C  
ATOM    924  CD  GLN A 123       6.076 -10.396  19.877  1.00  0.58           C  
ATOM    925  OE1 GLN A 123       5.109 -10.504  20.635  1.00  0.58           O  
ATOM    926  NE2 GLN A 123       7.329 -10.685  20.299  1.00  0.58           N  
ATOM    927  N   ARG A 124       1.664  -8.679  16.893  1.00  0.55           N  
ATOM    928  CA  ARG A 124       0.444  -7.884  16.772  1.00  0.55           C  
ATOM    929  C   ARG A 124      -0.835  -8.612  17.184  1.00  0.55           C  
ATOM    930  O   ARG A 124      -1.717  -8.035  17.821  1.00  0.55           O  
ATOM    931  CB  ARG A 124       0.248  -7.292  15.356  1.00  0.55           C  
ATOM    932  CG  ARG A 124       1.327  -6.272  14.947  1.00  0.55           C  
ATOM    933  CD  ARG A 124       0.879  -5.359  13.800  1.00  0.55           C  
ATOM    934  NE  ARG A 124       2.086  -4.668  13.259  1.00  0.55           N  
ATOM    935  CZ  ARG A 124       2.502  -3.427  13.529  1.00  0.55           C  
ATOM    936  NH1 ARG A 124       1.999  -2.684  14.500  1.00  0.55           N  
ATOM    937  NH2 ARG A 124       3.491  -2.937  12.784  1.00  0.55           N  
ATOM    938  N   ASN A 125      -0.958  -9.913  16.852  1.00  0.60           N  
ATOM    939  CA  ASN A 125      -2.093 -10.751  17.207  1.00  0.60           C  
ATOM    940  C   ASN A 125      -2.262 -10.975  18.706  1.00  0.60           C  
ATOM    941  O   ASN A 125      -3.375 -11.181  19.183  1.00  0.60           O  
ATOM    942  CB  ASN A 125      -2.027 -12.127  16.495  1.00  0.60           C  
ATOM    943  CG  ASN A 125      -2.365 -11.948  15.019  1.00  0.60           C  
ATOM    944  OD1 ASN A 125      -3.237 -11.153  14.659  1.00  0.60           O  
ATOM    945  ND2 ASN A 125      -1.699 -12.724  14.137  1.00  0.60           N  
ATOM    946  N   ALA A 126      -1.177 -10.882  19.498  1.00  0.69           N  
ATOM    947  CA  ALA A 126      -1.224 -11.045  20.938  1.00  0.69           C  
ATOM    948  C   ALA A 126      -2.001  -9.957  21.670  1.00  0.69           C  
ATOM    949  O   ALA A 126      -2.509 -10.127  22.774  1.00  0.69           O  
ATOM    950  CB  ALA A 126       0.213 -11.055  21.464  1.00  0.69           C  
ATOM    951  N   ALA A 127      -2.163  -8.782  21.042  1.00  0.65           N  
ATOM    952  CA  ALA A 127      -2.972  -7.714  21.579  1.00  0.65           C  
ATOM    953  C   ALA A 127      -4.461  -8.047  21.674  1.00  0.65           C  
ATOM    954  O   ALA A 127      -5.160  -7.544  22.551  1.00  0.65           O  
ATOM    955  CB  ALA A 127      -2.755  -6.469  20.717  1.00  0.65           C  
ATOM    956  N   PHE A 128      -4.968  -8.934  20.789  1.00  0.45           N  
ATOM    957  CA  PHE A 128      -6.326  -9.460  20.830  1.00  0.45           C  
ATOM    958  C   PHE A 128      -6.596 -10.303  22.073  1.00  0.45           C  
ATOM    959  O   PHE A 128      -7.677 -10.233  22.651  1.00  0.45           O  
ATOM    960  CB  PHE A 128      -6.674 -10.301  19.575  1.00  0.45           C  
ATOM    961  CG  PHE A 128      -6.776  -9.449  18.336  1.00  0.45           C  
ATOM    962  CD1 PHE A 128      -8.027  -8.999  17.877  1.00  0.45           C  
ATOM    963  CD2 PHE A 128      -5.633  -9.142  17.582  1.00  0.45           C  
ATOM    964  CE1 PHE A 128      -8.133  -8.300  16.667  1.00  0.45           C  
ATOM    965  CE2 PHE A 128      -5.731  -8.451  16.369  1.00  0.45           C  
ATOM    966  CZ  PHE A 128      -6.986  -8.043  15.906  1.00  0.45           C  
ATOM    967  N   GLU A 129      -5.598 -11.089  22.540  1.00  0.60           N  
ATOM    968  CA  GLU A 129      -5.651 -11.891  23.758  1.00  0.60           C  
ATOM    969  C   GLU A 129      -5.895 -11.031  24.996  1.00  0.60           C  
ATOM    970  O   GLU A 129      -6.590 -11.408  25.935  1.00  0.60           O  
ATOM    971  CB  GLU A 129      -4.301 -12.636  23.974  1.00  0.60           C  
ATOM    972  CG  GLU A 129      -3.810 -13.542  22.808  1.00  0.60           C  
ATOM    973  CD  GLU A 129      -2.307 -13.866  22.887  1.00  0.60           C  
ATOM    974  OE1 GLU A 129      -1.772 -14.441  21.901  1.00  0.60           O  
ATOM    975  OE2 GLU A 129      -1.654 -13.496  23.900  1.00  0.60           O  
ATOM    976  N   GLN A 130      -5.312  -9.818  24.998  1.00  0.68           N  
ATOM    977  CA  GLN A 130      -5.350  -8.883  26.102  1.00  0.68           C  
ATOM    978  C   GLN A 130      -6.442  -7.831  25.939  1.00  0.68           C  
ATOM    979  O   GLN A 130      -6.503  -6.852  26.689  1.00  0.68           O  
ATOM    980  CB  GLN A 130      -3.995  -8.129  26.160  1.00  0.68           C  
ATOM    981  CG  GLN A 130      -2.743  -9.041  26.135  1.00  0.68           C  
ATOM    982  CD  GLN A 130      -2.726 -10.012  27.315  1.00  0.68           C  
ATOM    983  OE1 GLN A 130      -2.796  -9.600  28.473  1.00  0.68           O  
ATOM    984  NE2 GLN A 130      -2.615 -11.330  27.035  1.00  0.68           N  
ATOM    985  N   ALA A 131      -7.306  -7.966  24.918  1.00  0.59           N  
ATOM    986  CA  ALA A 131      -8.272  -6.962  24.540  1.00  0.59           C  
ATOM    987  C   ALA A 131      -9.524  -6.921  25.409  1.00  0.59           C  
ATOM    988  O   ALA A 131      -9.863  -7.852  26.132  1.00  0.59           O  
ATOM    989  CB  ALA A 131      -8.656  -7.145  23.061  1.00  0.59           C  
ATOM    990  N   ARG A 132     -10.263  -5.797  25.351  1.00  0.52           N  
ATOM    991  CA  ARG A 132     -11.529  -5.659  26.041  1.00  0.52           C  
ATOM    992  C   ARG A 132     -12.628  -5.666  24.983  1.00  0.52           C  
ATOM    993  O   ARG A 132     -12.633  -4.734  24.179  1.00  0.52           O  
ATOM    994  CB  ARG A 132     -11.559  -4.334  26.846  1.00  0.52           C  
ATOM    995  CG  ARG A 132     -12.797  -4.168  27.752  1.00  0.52           C  
ATOM    996  CD  ARG A 132     -12.734  -2.906  28.620  1.00  0.52           C  
ATOM    997  NE  ARG A 132     -13.946  -2.922  29.502  1.00  0.52           N  
ATOM    998  CZ  ARG A 132     -14.157  -2.068  30.513  1.00  0.52           C  
ATOM    999  NH1 ARG A 132     -15.250  -2.193  31.263  1.00  0.52           N  
ATOM   1000  NH2 ARG A 132     -13.298  -1.092  30.791  1.00  0.52           N  
ATOM   1001  N   PRO A 133     -13.520  -6.661  24.889  1.00  0.42           N  
ATOM   1002  CA  PRO A 133     -14.704  -6.659  24.019  1.00  0.42           C  
ATOM   1003  C   PRO A 133     -15.532  -5.383  24.004  1.00  0.42           C  
ATOM   1004  O   PRO A 133     -15.656  -4.735  25.044  1.00  0.42           O  
ATOM   1005  CB  PRO A 133     -15.512  -7.873  24.502  1.00  0.42           C  
ATOM   1006  CG  PRO A 133     -14.439  -8.847  24.993  1.00  0.42           C  
ATOM   1007  CD  PRO A 133     -13.410  -7.919  25.634  1.00  0.42           C  
ATOM   1008  N   GLY A 134     -16.105  -5.004  22.841  1.00  0.31           N  
ATOM   1009  CA  GLY A 134     -16.905  -3.795  22.700  1.00  0.31           C  
ATOM   1010  C   GLY A 134     -16.075  -2.562  22.481  1.00  0.31           C  
ATOM   1011  O   GLY A 134     -16.460  -1.459  22.866  1.00  0.31           O  
ATOM   1012  N   GLY A 135     -14.882  -2.719  21.883  1.00  0.66           N  
ATOM   1013  CA  GLY A 135     -13.968  -1.606  21.691  1.00  0.66           C  
ATOM   1014  C   GLY A 135     -13.090  -1.746  20.484  1.00  0.66           C  
ATOM   1015  O   GLY A 135     -13.329  -2.533  19.571  1.00  0.66           O  
ATOM   1016  N   TRP A 136     -12.013  -0.950  20.465  1.00  0.56           N  
ATOM   1017  CA  TRP A 136     -11.092  -0.848  19.357  1.00  0.56           C  
ATOM   1018  C   TRP A 136      -9.671  -1.132  19.800  1.00  0.56           C  
ATOM   1019  O   TRP A 136      -9.229  -0.751  20.884  1.00  0.56           O  
ATOM   1020  CB  TRP A 136     -11.131   0.566  18.724  1.00  0.56           C  
ATOM   1021  CG  TRP A 136     -12.465   0.919  18.097  1.00  0.56           C  
ATOM   1022  CD1 TRP A 136     -13.545   1.540  18.662  1.00  0.56           C  
ATOM   1023  CD2 TRP A 136     -12.825   0.644  16.730  1.00  0.56           C  
ATOM   1024  NE1 TRP A 136     -14.549   1.677  17.733  1.00  0.56           N  
ATOM   1025  CE2 TRP A 136     -14.125   1.154  16.538  1.00  0.56           C  
ATOM   1026  CE3 TRP A 136     -12.138   0.021  15.694  1.00  0.56           C  
ATOM   1027  CZ2 TRP A 136     -14.749   1.066  15.301  1.00  0.56           C  
ATOM   1028  CZ3 TRP A 136     -12.773  -0.084  14.446  1.00  0.56           C  
ATOM   1029  CH2 TRP A 136     -14.062   0.436  14.251  1.00  0.56           C  
ATOM   1030  N   LEU A 137      -8.902  -1.800  18.928  1.00  0.61           N  
ATOM   1031  CA  LEU A 137      -7.473  -1.961  19.066  1.00  0.61           C  
ATOM   1032  C   LEU A 137      -6.820  -1.104  18.007  1.00  0.61           C  
ATOM   1033  O   LEU A 137      -7.021  -1.316  16.814  1.00  0.61           O  
ATOM   1034  CB  LEU A 137      -7.028  -3.424  18.825  1.00  0.61           C  
ATOM   1035  CG  LEU A 137      -7.592  -4.438  19.837  1.00  0.61           C  
ATOM   1036  CD1 LEU A 137      -7.152  -5.857  19.462  1.00  0.61           C  
ATOM   1037  CD2 LEU A 137      -7.175  -4.107  21.276  1.00  0.61           C  
ATOM   1038  N   ALA A 138      -6.024  -0.104  18.420  1.00  0.64           N  
ATOM   1039  CA  ALA A 138      -5.332   0.777  17.510  1.00  0.64           C  
ATOM   1040  C   ALA A 138      -3.846   0.476  17.548  1.00  0.64           C  
ATOM   1041  O   ALA A 138      -3.161   0.770  18.524  1.00  0.64           O  
ATOM   1042  CB  ALA A 138      -5.584   2.245  17.917  1.00  0.64           C  
ATOM   1043  N   HIS A 139      -3.302  -0.129  16.476  1.00  0.63           N  
ATOM   1044  CA  HIS A 139      -1.887  -0.447  16.396  1.00  0.63           C  
ATOM   1045  C   HIS A 139      -1.073   0.764  15.978  1.00  0.63           C  
ATOM   1046  O   HIS A 139      -1.303   1.360  14.927  1.00  0.63           O  
ATOM   1047  CB  HIS A 139      -1.612  -1.627  15.437  1.00  0.63           C  
ATOM   1048  CG  HIS A 139      -2.116  -2.927  15.990  1.00  0.63           C  
ATOM   1049  ND1 HIS A 139      -1.207  -3.898  16.371  1.00  0.63           N  
ATOM   1050  CD2 HIS A 139      -3.384  -3.332  16.272  1.00  0.63           C  
ATOM   1051  CE1 HIS A 139      -1.940  -4.869  16.883  1.00  0.63           C  
ATOM   1052  NE2 HIS A 139      -3.263  -4.578  16.848  1.00  0.63           N  
ATOM   1053  N   VAL A 140      -0.108   1.158  16.821  1.00  0.65           N  
ATOM   1054  CA  VAL A 140       0.758   2.303  16.611  1.00  0.65           C  
ATOM   1055  C   VAL A 140       2.171   1.785  16.767  1.00  0.65           C  
ATOM   1056  O   VAL A 140       2.462   1.056  17.714  1.00  0.65           O  
ATOM   1057  CB  VAL A 140       0.498   3.413  17.633  1.00  0.65           C  
ATOM   1058  CG1 VAL A 140       1.402   4.629  17.351  1.00  0.65           C  
ATOM   1059  CG2 VAL A 140      -0.985   3.834  17.577  1.00  0.65           C  
ATOM   1060  N   ASP A 141       3.093   2.107  15.843  1.00  0.68           N  
ATOM   1061  CA  ASP A 141       4.457   1.624  15.959  1.00  0.68           C  
ATOM   1062  C   ASP A 141       5.271   2.607  16.805  1.00  0.68           C  
ATOM   1063  O   ASP A 141       4.910   3.766  16.996  1.00  0.68           O  
ATOM   1064  CB  ASP A 141       5.056   1.272  14.567  1.00  0.68           C  
ATOM   1065  CG  ASP A 141       4.409   0.011  14.010  1.00  0.68           C  
ATOM   1066  OD1 ASP A 141       3.700  -0.715  14.755  1.00  0.68           O  
ATOM   1067  OD2 ASP A 141       4.603  -0.305  12.805  1.00  0.68           O  
ATOM   1068  N   ALA A 142       6.364   2.134  17.436  1.00  0.72           N  
ATOM   1069  CA  ALA A 142       7.014   2.831  18.533  1.00  0.72           C  
ATOM   1070  C   ALA A 142       7.569   4.222  18.233  1.00  0.72           C  
ATOM   1071  O   ALA A 142       7.505   5.107  19.088  1.00  0.72           O  
ATOM   1072  CB  ALA A 142       8.110   1.941  19.133  1.00  0.72           C  
ATOM   1073  N   ASP A 143       8.100   4.466  17.018  1.00  0.62           N  
ATOM   1074  CA  ASP A 143       8.671   5.741  16.650  1.00  0.62           C  
ATOM   1075  C   ASP A 143       7.657   6.670  15.953  1.00  0.62           C  
ATOM   1076  O   ASP A 143       8.012   7.742  15.450  1.00  0.62           O  
ATOM   1077  CB  ASP A 143      10.009   5.495  15.892  1.00  0.62           C  
ATOM   1078  CG  ASP A 143       9.866   4.899  14.507  1.00  0.62           C  
ATOM   1079  OD1 ASP A 143       9.184   3.855  14.363  1.00  0.62           O  
ATOM   1080  OD2 ASP A 143      10.470   5.481  13.564  1.00  0.62           O  
ATOM   1081  N   GLU A 144       6.352   6.306  15.977  1.00  0.60           N  
ATOM   1082  CA  GLU A 144       5.234   7.121  15.525  1.00  0.60           C  
ATOM   1083  C   GLU A 144       4.621   7.953  16.645  1.00  0.60           C  
ATOM   1084  O   GLU A 144       4.330   7.472  17.738  1.00  0.60           O  
ATOM   1085  CB  GLU A 144       4.083   6.257  14.947  1.00  0.60           C  
ATOM   1086  CG  GLU A 144       4.472   5.503  13.659  1.00  0.60           C  
ATOM   1087  CD  GLU A 144       3.460   4.465  13.209  1.00  0.60           C  
ATOM   1088  OE1 GLU A 144       3.693   3.867  12.125  1.00  0.60           O  
ATOM   1089  OE2 GLU A 144       2.453   4.184  13.915  1.00  0.60           O  
ATOM   1090  N   THR A 145       4.361   9.246  16.377  1.00  0.62           N  
ATOM   1091  CA  THR A 145       3.751  10.163  17.339  1.00  0.62           C  
ATOM   1092  C   THR A 145       2.482  10.727  16.732  1.00  0.62           C  
ATOM   1093  O   THR A 145       2.508  11.259  15.624  1.00  0.62           O  
ATOM   1094  CB  THR A 145       4.661  11.344  17.682  1.00  0.62           C  
ATOM   1095  OG1 THR A 145       5.896  10.881  18.204  1.00  0.62           O  
ATOM   1096  CG2 THR A 145       4.062  12.231  18.780  1.00  0.62           C  
ATOM   1097  N   LEU A 146       1.316  10.640  17.420  1.00  0.60           N  
ATOM   1098  CA  LEU A 146       0.077  11.280  16.972  1.00  0.60           C  
ATOM   1099  C   LEU A 146       0.217  12.801  16.865  1.00  0.60           C  
ATOM   1100  O   LEU A 146       0.818  13.452  17.718  1.00  0.60           O  
ATOM   1101  CB  LEU A 146      -1.113  10.928  17.908  1.00  0.60           C  
ATOM   1102  CG  LEU A 146      -2.506  11.450  17.477  1.00  0.60           C  
ATOM   1103  CD1 LEU A 146      -3.021  10.756  16.212  1.00  0.60           C  
ATOM   1104  CD2 LEU A 146      -3.540  11.274  18.599  1.00  0.60           C  
ATOM   1105  N   SER A 147      -0.292  13.408  15.775  1.00  0.57           N  
ATOM   1106  CA  SER A 147      -0.179  14.842  15.546  1.00  0.57           C  
ATOM   1107  C   SER A 147      -0.992  15.716  16.501  1.00  0.57           C  
ATOM   1108  O   SER A 147      -2.039  15.320  17.011  1.00  0.57           O  
ATOM   1109  CB  SER A 147      -0.362  15.232  14.049  1.00  0.57           C  
ATOM   1110  OG  SER A 147      -1.671  15.687  13.699  1.00  0.57           O  
ATOM   1111  N   ALA A 148      -0.533  16.958  16.767  1.00  0.48           N  
ATOM   1112  CA  ALA A 148      -1.186  17.900  17.665  1.00  0.48           C  
ATOM   1113  C   ALA A 148      -2.580  18.303  17.195  1.00  0.48           C  
ATOM   1114  O   ALA A 148      -3.528  18.419  17.971  1.00  0.48           O  
ATOM   1115  CB  ALA A 148      -0.296  19.151  17.815  1.00  0.48           C  
ATOM   1116  N   GLU A 149      -2.732  18.461  15.872  1.00  0.30           N  
ATOM   1117  CA  GLU A 149      -3.939  18.800  15.156  1.00  0.30           C  
ATOM   1118  C   GLU A 149      -4.914  17.631  15.123  1.00  0.30           C  
ATOM   1119  O   GLU A 149      -6.102  17.785  14.827  1.00  0.30           O  
ATOM   1120  CB  GLU A 149      -3.589  19.156  13.680  1.00  0.30           C  
ATOM   1121  CG  GLU A 149      -2.371  20.108  13.482  1.00  0.30           C  
ATOM   1122  CD  GLU A 149      -0.997  19.440  13.611  1.00  0.30           C  
ATOM   1123  OE1 GLU A 149       0.025  20.149  13.492  1.00  0.30           O  
ATOM   1124  OE2 GLU A 149      -0.957  18.204  13.859  1.00  0.30           O  
ATOM   1125  N   SER A 150      -4.405  16.419  15.431  1.00  0.54           N  
ATOM   1126  CA  SER A 150      -5.152  15.177  15.423  1.00  0.54           C  
ATOM   1127  C   SER A 150      -5.611  14.755  16.793  1.00  0.54           C  
ATOM   1128  O   SER A 150      -6.312  13.753  16.916  1.00  0.54           O  
ATOM   1129  CB  SER A 150      -4.352  13.991  14.840  1.00  0.54           C  
ATOM   1130  OG  SER A 150      -4.025  14.249  13.479  1.00  0.54           O  
ATOM   1131  N   ARG A 151      -5.282  15.527  17.848  1.00  0.31           N  
ATOM   1132  CA  ARG A 151      -5.737  15.270  19.203  1.00  0.31           C  
ATOM   1133  C   ARG A 151      -7.259  15.266  19.344  1.00  0.31           C  
ATOM   1134  O   ARG A 151      -7.946  16.244  19.052  1.00  0.31           O  
ATOM   1135  CB  ARG A 151      -5.143  16.312  20.188  1.00  0.31           C  
ATOM   1136  CG  ARG A 151      -5.596  16.102  21.648  1.00  0.31           C  
ATOM   1137  CD  ARG A 151      -5.083  17.134  22.657  1.00  0.31           C  
ATOM   1138  NE  ARG A 151      -3.674  16.761  22.977  1.00  0.31           N  
ATOM   1139  CZ  ARG A 151      -2.737  17.614  23.395  1.00  0.31           C  
ATOM   1140  NH1 ARG A 151      -3.034  18.876  23.691  1.00  0.31           N  
ATOM   1141  NH2 ARG A 151      -1.491  17.172  23.541  1.00  0.31           N  
ATOM   1142  N   GLY A 152      -7.823  14.131  19.795  1.00  0.57           N  
ATOM   1143  CA  GLY A 152      -9.246  13.918  20.012  1.00  0.57           C  
ATOM   1144  C   GLY A 152      -9.987  13.522  18.766  1.00  0.57           C  
ATOM   1145  O   GLY A 152     -11.162  13.166  18.819  1.00  0.57           O  
ATOM   1146  N   ARG A 153      -9.313  13.528  17.598  1.00  0.47           N  
ATOM   1147  CA  ARG A 153      -9.894  13.104  16.340  1.00  0.47           C  
ATOM   1148  C   ARG A 153     -10.067  11.601  16.263  1.00  0.47           C  
ATOM   1149  O   ARG A 153     -11.034  11.102  15.691  1.00  0.47           O  
ATOM   1150  CB  ARG A 153      -9.043  13.498  15.113  1.00  0.47           C  
ATOM   1151  CG  ARG A 153      -8.902  15.003  14.826  1.00  0.47           C  
ATOM   1152  CD  ARG A 153      -8.285  15.168  13.435  1.00  0.47           C  
ATOM   1153  NE  ARG A 153      -8.004  16.605  13.139  1.00  0.47           N  
ATOM   1154  CZ  ARG A 153      -7.843  17.030  11.876  1.00  0.47           C  
ATOM   1155  NH1 ARG A 153      -7.936  16.183  10.856  1.00  0.47           N  
ATOM   1156  NH2 ARG A 153      -7.572  18.308  11.640  1.00  0.47           N  
ATOM   1157  N   LEU A 154      -9.101  10.837  16.809  1.00  0.55           N  
ATOM   1158  CA  LEU A 154      -9.107   9.389  16.754  1.00  0.55           C  
ATOM   1159  C   LEU A 154     -10.261   8.800  17.554  1.00  0.55           C  
ATOM   1160  O   LEU A 154     -11.020   7.971  17.055  1.00  0.55           O  
ATOM   1161  CB  LEU A 154      -7.735   8.846  17.226  1.00  0.55           C  
ATOM   1162  CG  LEU A 154      -7.598   7.314  17.302  1.00  0.55           C  
ATOM   1163  CD1 LEU A 154      -7.850   6.644  15.950  1.00  0.55           C  
ATOM   1164  CD2 LEU A 154      -6.212   6.918  17.834  1.00  0.55           C  
ATOM   1165  N   ARG A 155     -10.488   9.288  18.789  1.00  0.50           N  
ATOM   1166  CA  ARG A 155     -11.657   8.937  19.576  1.00  0.50           C  
ATOM   1167  C   ARG A 155     -12.971   9.376  18.937  1.00  0.50           C  
ATOM   1168  O   ARG A 155     -13.964   8.642  18.939  1.00  0.50           O  
ATOM   1169  CB  ARG A 155     -11.559   9.536  21.002  1.00  0.50           C  
ATOM   1170  CG  ARG A 155     -12.745   9.152  21.920  1.00  0.50           C  
ATOM   1171  CD  ARG A 155     -12.664   9.678  23.359  1.00  0.50           C  
ATOM   1172  NE  ARG A 155     -11.470   9.036  23.981  1.00  0.50           N  
ATOM   1173  CZ  ARG A 155     -11.491   7.842  24.582  1.00  0.50           C  
ATOM   1174  NH1 ARG A 155     -12.543   7.348  25.221  1.00  0.50           N  
ATOM   1175  NH2 ARG A 155     -10.402   7.094  24.529  1.00  0.50           N  
ATOM   1176  N   ALA A 156     -13.012  10.597  18.368  1.00  0.54           N  
ATOM   1177  CA  ALA A 156     -14.187  11.125  17.709  1.00  0.54           C  
ATOM   1178  C   ALA A 156     -14.635  10.327  16.487  1.00  0.54           C  
ATOM   1179  O   ALA A 156     -15.793   9.918  16.384  1.00  0.54           O  
ATOM   1180  CB  ALA A 156     -13.882  12.574  17.297  1.00  0.54           C  
ATOM   1181  N   VAL A 157     -13.708  10.013  15.555  1.00  0.51           N  
ATOM   1182  CA  VAL A 157     -14.034   9.258  14.353  1.00  0.51           C  
ATOM   1183  C   VAL A 157     -14.452   7.821  14.629  1.00  0.51           C  
ATOM   1184  O   VAL A 157     -15.416   7.328  14.047  1.00  0.51           O  
ATOM   1185  CB  VAL A 157     -12.967   9.365  13.262  1.00  0.51           C  
ATOM   1186  CG1 VAL A 157     -11.706   8.527  13.554  1.00  0.51           C  
ATOM   1187  CG2 VAL A 157     -13.597   9.000  11.903  1.00  0.51           C  
ATOM   1188  N   LEU A 158     -13.787   7.110  15.569  1.00  0.49           N  
ATOM   1189  CA  LEU A 158     -14.173   5.758  15.948  1.00  0.49           C  
ATOM   1190  C   LEU A 158     -15.558   5.691  16.582  1.00  0.49           C  
ATOM   1191  O   LEU A 158     -16.395   4.886  16.181  1.00  0.49           O  
ATOM   1192  CB  LEU A 158     -13.117   5.123  16.886  1.00  0.49           C  
ATOM   1193  CG  LEU A 158     -11.730   4.910  16.236  1.00  0.49           C  
ATOM   1194  CD1 LEU A 158     -10.721   4.419  17.284  1.00  0.49           C  
ATOM   1195  CD2 LEU A 158     -11.781   3.935  15.050  1.00  0.49           C  
ATOM   1196  N   THR A 159     -15.873   6.616  17.517  1.00  0.54           N  
ATOM   1197  CA  THR A 159     -17.205   6.747  18.119  1.00  0.54           C  
ATOM   1198  C   THR A 159     -18.277   7.075  17.088  1.00  0.54           C  
ATOM   1199  O   THR A 159     -19.381   6.531  17.097  1.00  0.54           O  
ATOM   1200  CB  THR A 159     -17.267   7.809  19.215  1.00  0.54           C  
ATOM   1201  OG1 THR A 159     -16.257   7.591  20.205  1.00  0.54           O  
ATOM   1202  CG2 THR A 159     -18.616   7.784  19.946  1.00  0.54           C  
ATOM   1203  N   ALA A 160     -17.975   7.969  16.120  1.00  0.56           N  
ATOM   1204  CA  ALA A 160     -18.849   8.243  14.993  1.00  0.56           C  
ATOM   1205  C   ALA A 160     -19.105   7.025  14.099  1.00  0.56           C  
ATOM   1206  O   ALA A 160     -20.248   6.747  13.738  1.00  0.56           O  
ATOM   1207  CB  ALA A 160     -18.272   9.409  14.169  1.00  0.56           C  
ATOM   1208  N   LEU A 161     -18.058   6.237  13.770  1.00  0.74           N  
ATOM   1209  CA  LEU A 161     -18.172   4.979  13.046  1.00  0.74           C  
ATOM   1210  C   LEU A 161     -18.975   3.908  13.774  1.00  0.74           C  
ATOM   1211  O   LEU A 161     -19.806   3.246  13.159  1.00  0.74           O  
ATOM   1212  CB  LEU A 161     -16.783   4.410  12.660  1.00  0.74           C  
ATOM   1213  CG  LEU A 161     -16.043   5.221  11.573  1.00  0.74           C  
ATOM   1214  CD1 LEU A 161     -14.592   4.738  11.447  1.00  0.74           C  
ATOM   1215  CD2 LEU A 161     -16.741   5.146  10.205  1.00  0.74           C  
ATOM   1216  N   ASP A 162     -18.804   3.733  15.100  1.00  0.73           N  
ATOM   1217  CA  ASP A 162     -19.628   2.837  15.903  1.00  0.73           C  
ATOM   1218  C   ASP A 162     -21.103   3.189  15.890  1.00  0.73           C  
ATOM   1219  O   ASP A 162     -21.965   2.321  15.787  1.00  0.73           O  
ATOM   1220  CB  ASP A 162     -19.144   2.833  17.374  1.00  0.73           C  
ATOM   1221  CG  ASP A 162     -17.891   2.007  17.499  1.00  0.73           C  
ATOM   1222  OD1 ASP A 162     -17.725   1.068  16.676  1.00  0.73           O  
ATOM   1223  OD2 ASP A 162     -17.093   2.254  18.431  1.00  0.73           O  
ATOM   1224  N   HIS A 163     -21.424   4.489  15.965  1.00  0.71           N  
ATOM   1225  CA  HIS A 163     -22.785   4.976  15.873  1.00  0.71           C  
ATOM   1226  C   HIS A 163     -23.478   4.701  14.538  1.00  0.71           C  
ATOM   1227  O   HIS A 163     -24.639   4.301  14.488  1.00  0.71           O  
ATOM   1228  CB  HIS A 163     -22.774   6.492  16.136  1.00  0.71           C  
ATOM   1229  CG  HIS A 163     -24.130   7.076  16.321  1.00  0.71           C  
ATOM   1230  ND1 HIS A 163     -24.838   6.751  17.458  1.00  0.71           N  
ATOM   1231  CD2 HIS A 163     -24.831   7.949  15.555  1.00  0.71           C  
ATOM   1232  CE1 HIS A 163     -25.965   7.424  17.362  1.00  0.71           C  
ATOM   1233  NE2 HIS A 163     -26.007   8.170  16.233  1.00  0.71           N  
ATOM   1234  N   VAL A 164     -22.781   4.904  13.400  1.00  0.74           N  
ATOM   1235  CA  VAL A 164     -23.413   4.771  12.091  1.00  0.74           C  
ATOM   1236  C   VAL A 164     -23.226   3.398  11.457  1.00  0.74           C  
ATOM   1237  O   VAL A 164     -24.008   3.005  10.595  1.00  0.74           O  
ATOM   1238  CB  VAL A 164     -22.967   5.866  11.122  1.00  0.74           C  
ATOM   1239  CG1 VAL A 164     -23.281   7.240  11.747  1.00  0.74           C  
ATOM   1240  CG2 VAL A 164     -21.471   5.754  10.776  1.00  0.74           C  
ATOM   1241  N   LEU A 165     -22.241   2.596  11.909  1.00  0.71           N  
ATOM   1242  CA  LEU A 165     -22.004   1.241  11.427  1.00  0.71           C  
ATOM   1243  C   LEU A 165     -21.786   0.268  12.598  1.00  0.71           C  
ATOM   1244  O   LEU A 165     -20.735  -0.385  12.669  1.00  0.71           O  
ATOM   1245  CB  LEU A 165     -20.758   1.195  10.497  1.00  0.71           C  
ATOM   1246  CG  LEU A 165     -20.904   1.921   9.143  1.00  0.71           C  
ATOM   1247  CD1 LEU A 165     -19.547   1.987   8.425  1.00  0.71           C  
ATOM   1248  CD2 LEU A 165     -21.950   1.257   8.235  1.00  0.71           C  
ATOM   1249  N   PRO A 166     -22.715   0.128  13.556  1.00  0.73           N  
ATOM   1250  CA  PRO A 166     -22.573  -0.788  14.687  1.00  0.73           C  
ATOM   1251  C   PRO A 166     -22.377  -2.240  14.280  1.00  0.73           C  
ATOM   1252  O   PRO A 166     -23.184  -2.795  13.541  1.00  0.73           O  
ATOM   1253  CB  PRO A 166     -23.868  -0.589  15.489  1.00  0.73           C  
ATOM   1254  CG  PRO A 166     -24.902  -0.231  14.421  1.00  0.73           C  
ATOM   1255  CD  PRO A 166     -24.090   0.635  13.458  1.00  0.73           C  
ATOM   1256  N   GLY A 167     -21.294  -2.891  14.748  1.00  0.72           N  
ATOM   1257  CA  GLY A 167     -21.058  -4.310  14.488  1.00  0.72           C  
ATOM   1258  C   GLY A 167     -20.513  -4.624  13.122  1.00  0.72           C  
ATOM   1259  O   GLY A 167     -20.236  -5.777  12.810  1.00  0.72           O  
ATOM   1260  N   ALA A 168     -20.298  -3.608  12.265  1.00  0.72           N  
ATOM   1261  CA  ALA A 168     -19.608  -3.798  11.010  1.00  0.72           C  
ATOM   1262  C   ALA A 168     -18.127  -4.051  11.245  1.00  0.72           C  
ATOM   1263  O   ALA A 168     -17.449  -3.258  11.906  1.00  0.72           O  
ATOM   1264  CB  ALA A 168     -19.789  -2.573  10.095  1.00  0.72           C  
ATOM   1265  N   ASP A 169     -17.600  -5.176  10.721  1.00  0.67           N  
ATOM   1266  CA  ASP A 169     -16.194  -5.495  10.807  1.00  0.67           C  
ATOM   1267  C   ASP A 169     -15.465  -4.760   9.687  1.00  0.67           C  
ATOM   1268  O   ASP A 169     -15.781  -4.886   8.504  1.00  0.67           O  
ATOM   1269  CB  ASP A 169     -15.976  -7.035  10.769  1.00  0.67           C  
ATOM   1270  CG  ASP A 169     -14.744  -7.445  11.558  1.00  0.67           C  
ATOM   1271  OD1 ASP A 169     -14.024  -6.546  12.064  1.00  0.67           O  
ATOM   1272  OD2 ASP A 169     -14.501  -8.668  11.716  1.00  0.67           O  
ATOM   1273  N   LEU A 170     -14.510  -3.901  10.060  1.00  0.71           N  
ATOM   1274  CA  LEU A 170     -13.903  -2.964   9.151  1.00  0.71           C  
ATOM   1275  C   LEU A 170     -12.601  -2.545   9.762  1.00  0.71           C  
ATOM   1276  O   LEU A 170     -12.382  -2.710  10.967  1.00  0.71           O  
ATOM   1277  CB  LEU A 170     -14.809  -1.730   8.841  1.00  0.71           C  
ATOM   1278  CG  LEU A 170     -15.190  -0.796  10.019  1.00  0.71           C  
ATOM   1279  CD1 LEU A 170     -14.140   0.291  10.300  1.00  0.71           C  
ATOM   1280  CD2 LEU A 170     -16.534  -0.104   9.740  1.00  0.71           C  
ATOM   1281  N   VAL A 171     -11.694  -1.984   8.951  1.00  0.74           N  
ATOM   1282  CA  VAL A 171     -10.426  -1.492   9.452  1.00  0.74           C  
ATOM   1283  C   VAL A 171     -10.309  -0.009   9.198  1.00  0.74           C  
ATOM   1284  O   VAL A 171     -10.598   0.506   8.118  1.00  0.74           O  
ATOM   1285  CB  VAL A 171      -9.216  -2.241   8.913  1.00  0.74           C  
ATOM   1286  CG1 VAL A 171      -9.248  -3.665   9.492  1.00  0.74           C  
ATOM   1287  CG2 VAL A 171      -9.205  -2.269   7.375  1.00  0.74           C  
ATOM   1288  N   VAL A 172      -9.892   0.744  10.226  1.00  0.75           N  
ATOM   1289  CA  VAL A 172      -9.718   2.178  10.110  1.00  0.75           C  
ATOM   1290  C   VAL A 172      -8.250   2.454   9.866  1.00  0.75           C  
ATOM   1291  O   VAL A 172      -7.357   1.903  10.517  1.00  0.75           O  
ATOM   1292  CB  VAL A 172     -10.270   2.965  11.295  1.00  0.75           C  
ATOM   1293  CG1 VAL A 172     -10.144   4.480  11.047  1.00  0.75           C  
ATOM   1294  CG2 VAL A 172     -11.746   2.583  11.493  1.00  0.75           C  
ATOM   1295  N   SER A 173      -7.970   3.304   8.870  1.00  0.72           N  
ATOM   1296  CA  SER A 173      -6.630   3.654   8.457  1.00  0.72           C  
ATOM   1297  C   SER A 173      -6.355   5.113   8.772  1.00  0.72           C  
ATOM   1298  O   SER A 173      -6.874   5.994   8.081  1.00  0.72           O  
ATOM   1299  CB  SER A 173      -6.444   3.514   6.928  1.00  0.72           C  
ATOM   1300  OG  SER A 173      -6.538   2.158   6.488  1.00  0.72           O  
ATOM   1301  N   PRO A 174      -5.556   5.449   9.780  1.00  0.73           N  
ATOM   1302  CA  PRO A 174      -4.923   6.756   9.902  1.00  0.73           C  
ATOM   1303  C   PRO A 174      -3.926   7.046   8.802  1.00  0.73           C  
ATOM   1304  O   PRO A 174      -3.450   6.127   8.136  1.00  0.73           O  
ATOM   1305  CB  PRO A 174      -4.204   6.701  11.262  1.00  0.73           C  
ATOM   1306  CG  PRO A 174      -4.941   5.608  12.030  1.00  0.73           C  
ATOM   1307  CD  PRO A 174      -5.273   4.602  10.934  1.00  0.73           C  
ATOM   1308  N   ARG A 175      -3.564   8.325   8.640  1.00  0.62           N  
ATOM   1309  CA  ARG A 175      -2.546   8.773   7.722  1.00  0.62           C  
ATOM   1310  C   ARG A 175      -1.203   8.797   8.437  1.00  0.62           C  
ATOM   1311  O   ARG A 175      -1.076   9.369   9.517  1.00  0.62           O  
ATOM   1312  CB  ARG A 175      -2.859  10.220   7.259  1.00  0.62           C  
ATOM   1313  CG  ARG A 175      -4.207  10.378   6.518  1.00  0.62           C  
ATOM   1314  CD  ARG A 175      -4.671  11.834   6.350  1.00  0.62           C  
ATOM   1315  NE  ARG A 175      -3.608  12.529   5.560  1.00  0.62           N  
ATOM   1316  CZ  ARG A 175      -3.463  13.859   5.507  1.00  0.62           C  
ATOM   1317  NH1 ARG A 175      -4.357  14.705   6.003  1.00  0.62           N  
ATOM   1318  NH2 ARG A 175      -2.368  14.351   4.928  1.00  0.62           N  
ATOM   1319  N   ILE A 176      -0.152   8.194   7.857  1.00  0.64           N  
ATOM   1320  CA  ILE A 176       1.184   8.258   8.438  1.00  0.64           C  
ATOM   1321  C   ILE A 176       2.048   9.130   7.546  1.00  0.64           C  
ATOM   1322  O   ILE A 176       2.225   8.848   6.362  1.00  0.64           O  
ATOM   1323  CB  ILE A 176       1.824   6.882   8.630  1.00  0.64           C  
ATOM   1324  CG1 ILE A 176       0.972   6.002   9.577  1.00  0.64           C  
ATOM   1325  CG2 ILE A 176       3.253   7.040   9.195  1.00  0.64           C  
ATOM   1326  CD1 ILE A 176       1.395   4.527   9.573  1.00  0.64           C  
ATOM   1327  N   LEU A 177       2.598  10.227   8.103  1.00  0.58           N  
ATOM   1328  CA  LEU A 177       3.579  11.077   7.450  1.00  0.58           C  
ATOM   1329  C   LEU A 177       4.954  10.675   7.936  1.00  0.58           C  
ATOM   1330  O   LEU A 177       5.121  10.393   9.119  1.00  0.58           O  
ATOM   1331  CB  LEU A 177       3.388  12.573   7.814  1.00  0.58           C  
ATOM   1332  CG  LEU A 177       2.152  13.241   7.185  1.00  0.58           C  
ATOM   1333  CD1 LEU A 177       1.929  14.621   7.818  1.00  0.58           C  
ATOM   1334  CD2 LEU A 177       2.298  13.384   5.663  1.00  0.58           C  
ATOM   1335  N   ASP A 178       5.975  10.619   7.062  1.00  0.56           N  
ATOM   1336  CA  ASP A 178       7.330  10.306   7.474  1.00  0.56           C  
ATOM   1337  C   ASP A 178       8.209  11.559   7.576  1.00  0.56           C  
ATOM   1338  O   ASP A 178       7.742  12.693   7.683  1.00  0.56           O  
ATOM   1339  CB  ASP A 178       7.924   9.190   6.561  1.00  0.56           C  
ATOM   1340  CG  ASP A 178       8.406   9.745   5.232  1.00  0.56           C  
ATOM   1341  OD1 ASP A 178       7.736  10.658   4.691  1.00  0.56           O  
ATOM   1342  OD2 ASP A 178       9.541   9.398   4.823  1.00  0.56           O  
ATOM   1343  N   THR A 179       9.539  11.360   7.534  1.00  0.53           N  
ATOM   1344  CA  THR A 179      10.523  12.427   7.518  1.00  0.53           C  
ATOM   1345  C   THR A 179      10.876  12.901   6.117  1.00  0.53           C  
ATOM   1346  O   THR A 179      11.462  13.972   5.967  1.00  0.53           O  
ATOM   1347  CB  THR A 179      11.813  12.015   8.216  1.00  0.53           C  
ATOM   1348  OG1 THR A 179      12.288  10.761   7.745  1.00  0.53           O  
ATOM   1349  CG2 THR A 179      11.525  11.839   9.711  1.00  0.53           C  
ATOM   1350  N   SER A 180      10.503  12.165   5.045  1.00  0.43           N  
ATOM   1351  CA  SER A 180      10.653  12.635   3.668  1.00  0.43           C  
ATOM   1352  C   SER A 180       9.481  13.481   3.199  1.00  0.43           C  
ATOM   1353  O   SER A 180       9.637  14.316   2.307  1.00  0.43           O  
ATOM   1354  CB  SER A 180      10.869  11.461   2.670  1.00  0.43           C  
ATOM   1355  OG  SER A 180       9.705  10.660   2.449  1.00  0.43           O  
ATOM   1356  N   ARG A 181       8.316  13.295   3.858  1.00  0.39           N  
ATOM   1357  CA  ARG A 181       7.015  13.923   3.667  1.00  0.39           C  
ATOM   1358  C   ARG A 181       6.105  13.100   2.764  1.00  0.39           C  
ATOM   1359  O   ARG A 181       5.125  13.610   2.217  1.00  0.39           O  
ATOM   1360  CB  ARG A 181       7.016  15.399   3.174  1.00  0.39           C  
ATOM   1361  CG  ARG A 181       7.750  16.398   4.089  1.00  0.39           C  
ATOM   1362  CD  ARG A 181       7.753  17.798   3.477  1.00  0.39           C  
ATOM   1363  NE  ARG A 181       8.428  18.713   4.452  1.00  0.39           N  
ATOM   1364  CZ  ARG A 181       8.439  20.048   4.340  1.00  0.39           C  
ATOM   1365  NH1 ARG A 181       7.855  20.664   3.316  1.00  0.39           N  
ATOM   1366  NH2 ARG A 181       9.043  20.783   5.271  1.00  0.39           N  
ATOM   1367  N   GLU A 182       6.364  11.789   2.625  1.00  0.47           N  
ATOM   1368  CA  GLU A 182       5.439  10.847   2.033  1.00  0.47           C  
ATOM   1369  C   GLU A 182       4.247  10.610   2.957  1.00  0.47           C  
ATOM   1370  O   GLU A 182       4.352  10.671   4.180  1.00  0.47           O  
ATOM   1371  CB  GLU A 182       6.151   9.525   1.658  1.00  0.47           C  
ATOM   1372  CG  GLU A 182       5.297   8.576   0.778  1.00  0.47           C  
ATOM   1373  CD  GLU A 182       6.075   7.371   0.251  1.00  0.47           C  
ATOM   1374  OE1 GLU A 182       5.941   7.081  -0.965  1.00  0.47           O  
ATOM   1375  OE2 GLU A 182       6.759   6.707   1.075  1.00  0.47           O  
ATOM   1376  N   CYS A 183       3.046  10.375   2.394  1.00  0.58           N  
ATOM   1377  CA  CYS A 183       1.836  10.221   3.178  1.00  0.58           C  
ATOM   1378  C   CYS A 183       1.227   8.863   2.902  1.00  0.58           C  
ATOM   1379  O   CYS A 183       0.622   8.626   1.860  1.00  0.58           O  
ATOM   1380  CB  CYS A 183       0.827  11.353   2.831  1.00  0.58           C  
ATOM   1381  SG  CYS A 183      -0.734  11.318   3.796  1.00  0.58           S  
ATOM   1382  N   HIS A 184       1.332   7.946   3.876  1.00  0.56           N  
ATOM   1383  CA  HIS A 184       0.848   6.586   3.754  1.00  0.56           C  
ATOM   1384  C   HIS A 184      -0.568   6.498   4.270  1.00  0.56           C  
ATOM   1385  O   HIS A 184      -0.811   6.675   5.463  1.00  0.56           O  
ATOM   1386  CB  HIS A 184       1.733   5.629   4.576  1.00  0.56           C  
ATOM   1387  CG  HIS A 184       3.125   5.648   4.046  1.00  0.56           C  
ATOM   1388  ND1 HIS A 184       3.350   4.966   2.872  1.00  0.56           N  
ATOM   1389  CD2 HIS A 184       4.206   6.403   4.380  1.00  0.56           C  
ATOM   1390  CE1 HIS A 184       4.569   5.319   2.503  1.00  0.56           C  
ATOM   1391  NE2 HIS A 184       5.128   6.184   3.382  1.00  0.56           N  
ATOM   1392  N   THR A 185      -1.547   6.268   3.372  1.00  0.63           N  
ATOM   1393  CA  THR A 185      -2.963   6.256   3.719  1.00  0.63           C  
ATOM   1394  C   THR A 185      -3.535   4.868   3.985  1.00  0.63           C  
ATOM   1395  O   THR A 185      -4.163   4.677   5.017  1.00  0.63           O  
ATOM   1396  CB  THR A 185      -3.826   7.003   2.713  1.00  0.63           C  
ATOM   1397  OG1 THR A 185      -3.867   6.351   1.452  1.00  0.63           O  
ATOM   1398  CG2 THR A 185      -3.274   8.423   2.481  1.00  0.63           C  
ATOM   1399  N   ASP A 186      -3.309   3.839   3.127  1.00  0.64           N  
ATOM   1400  CA  ASP A 186      -3.782   2.469   3.330  1.00  0.64           C  
ATOM   1401  C   ASP A 186      -2.994   1.723   4.426  1.00  0.64           C  
ATOM   1402  O   ASP A 186      -2.291   0.734   4.215  1.00  0.64           O  
ATOM   1403  CB  ASP A 186      -3.780   1.713   1.982  1.00  0.64           C  
ATOM   1404  CG  ASP A 186      -4.419   0.357   2.083  1.00  0.64           C  
ATOM   1405  OD1 ASP A 186      -5.617   0.195   2.432  1.00  0.64           O  
ATOM   1406  OD2 ASP A 186      -3.680  -0.594   1.771  1.00  0.64           O  
ATOM   1407  N   THR A 187      -3.089   2.217   5.666  1.00  0.66           N  
ATOM   1408  CA  THR A 187      -2.369   1.694   6.815  1.00  0.66           C  
ATOM   1409  C   THR A 187      -3.017   0.480   7.452  1.00  0.66           C  
ATOM   1410  O   THR A 187      -2.323  -0.476   7.792  1.00  0.66           O  
ATOM   1411  CB  THR A 187      -2.108   2.760   7.870  1.00  0.66           C  
ATOM   1412  OG1 THR A 187      -3.305   3.339   8.364  1.00  0.66           O  
ATOM   1413  CG2 THR A 187      -1.301   3.899   7.241  1.00  0.66           C  
ATOM   1414  N   ARG A 188      -4.359   0.486   7.617  1.00  0.64           N  
ATOM   1415  CA  ARG A 188      -5.179  -0.597   8.150  1.00  0.64           C  
ATOM   1416  C   ARG A 188      -4.786  -1.114   9.527  1.00  0.64           C  
ATOM   1417  O   ARG A 188      -4.655  -2.315   9.757  1.00  0.64           O  
ATOM   1418  CB  ARG A 188      -5.346  -1.758   7.141  1.00  0.64           C  
ATOM   1419  CG  ARG A 188      -5.935  -1.274   5.805  1.00  0.64           C  
ATOM   1420  CD  ARG A 188      -6.373  -2.407   4.881  1.00  0.64           C  
ATOM   1421  NE  ARG A 188      -6.879  -1.749   3.650  1.00  0.64           N  
ATOM   1422  CZ  ARG A 188      -7.306  -2.455   2.604  1.00  0.64           C  
ATOM   1423  NH1 ARG A 188      -8.044  -3.545   2.737  1.00  0.64           N  
ATOM   1424  NH2 ARG A 188      -6.919  -2.049   1.398  1.00  0.64           N  
ATOM   1425  N   ARG A 189      -4.595  -0.196  10.490  1.00  0.66           N  
ATOM   1426  CA  ARG A 189      -4.024  -0.539  11.778  1.00  0.66           C  
ATOM   1427  C   ARG A 189      -5.003  -0.504  12.932  1.00  0.66           C  
ATOM   1428  O   ARG A 189      -4.643  -0.844  14.059  1.00  0.66           O  
ATOM   1429  CB  ARG A 189      -2.899   0.460  12.099  1.00  0.66           C  
ATOM   1430  CG  ARG A 189      -1.668   0.275  11.199  1.00  0.66           C  
ATOM   1431  CD  ARG A 189      -0.526   1.183  11.638  1.00  0.66           C  
ATOM   1432  NE  ARG A 189       0.688   0.766  10.876  1.00  0.66           N  
ATOM   1433  CZ  ARG A 189       1.913   1.037  11.345  1.00  0.66           C  
ATOM   1434  NH1 ARG A 189       2.091   1.841  12.379  1.00  0.66           N  
ATOM   1435  NH2 ARG A 189       2.985   0.453  10.827  1.00  0.66           N  
ATOM   1436  N   ILE A 190      -6.263  -0.106  12.700  1.00  0.74           N  
ATOM   1437  CA  ILE A 190      -7.244  -0.004  13.766  1.00  0.74           C  
ATOM   1438  C   ILE A 190      -8.390  -0.938  13.454  1.00  0.74           C  
ATOM   1439  O   ILE A 190      -8.942  -0.919  12.355  1.00  0.74           O  
ATOM   1440  CB  ILE A 190      -7.778   1.408  13.940  1.00  0.74           C  
ATOM   1441  CG1 ILE A 190      -6.649   2.442  14.134  1.00  0.74           C  
ATOM   1442  CG2 ILE A 190      -8.775   1.442  15.123  1.00  0.74           C  
ATOM   1443  CD1 ILE A 190      -7.167   3.875  14.010  1.00  0.74           C  
ATOM   1444  N   VAL A 191      -8.774  -1.787  14.421  1.00  0.76           N  
ATOM   1445  CA  VAL A 191      -9.725  -2.861  14.205  1.00  0.76           C  
ATOM   1446  C   VAL A 191     -10.505  -3.083  15.486  1.00  0.76           C  
ATOM   1447  O   VAL A 191     -10.053  -2.714  16.570  1.00  0.76           O  
ATOM   1448  CB  VAL A 191      -8.989  -4.123  13.761  1.00  0.76           C  
ATOM   1449  CG1 VAL A 191      -8.010  -4.622  14.845  1.00  0.76           C  
ATOM   1450  CG2 VAL A 191      -9.959  -5.234  13.319  1.00  0.76           C  
ATOM   1451  N   ARG A 192     -11.732  -3.639  15.413  1.00  0.67           N  
ATOM   1452  CA  ARG A 192     -12.505  -3.992  16.591  1.00  0.67           C  
ATOM   1453  C   ARG A 192     -11.836  -5.050  17.469  1.00  0.67           C  
ATOM   1454  O   ARG A 192     -11.166  -5.963  16.989  1.00  0.67           O  
ATOM   1455  CB  ARG A 192     -13.931  -4.467  16.235  1.00  0.67           C  
ATOM   1456  CG  ARG A 192     -14.740  -3.469  15.391  1.00  0.67           C  
ATOM   1457  CD  ARG A 192     -16.209  -3.898  15.263  1.00  0.67           C  
ATOM   1458  NE  ARG A 192     -16.968  -2.774  14.619  1.00  0.67           N  
ATOM   1459  CZ  ARG A 192     -17.319  -1.660  15.268  1.00  0.67           C  
ATOM   1460  NH1 ARG A 192     -17.038  -1.455  16.552  1.00  0.67           N  
ATOM   1461  NH2 ARG A 192     -17.963  -0.675  14.650  1.00  0.67           N  
ATOM   1462  N   SER A 193     -12.003  -4.960  18.800  1.00  0.71           N  
ATOM   1463  CA  SER A 193     -11.436  -5.911  19.751  1.00  0.71           C  
ATOM   1464  C   SER A 193     -12.030  -7.307  19.668  1.00  0.71           C  
ATOM   1465  O   SER A 193     -11.352  -8.302  19.915  1.00  0.71           O  
ATOM   1466  CB  SER A 193     -11.543  -5.404  21.208  1.00  0.71           C  
ATOM   1467  OG  SER A 193     -12.873  -5.016  21.541  1.00  0.71           O  
ATOM   1468  N   ASP A 194     -13.312  -7.396  19.285  1.00  0.66           N  
ATOM   1469  CA  ASP A 194     -14.103  -8.603  19.161  1.00  0.66           C  
ATOM   1470  C   ASP A 194     -14.101  -9.155  17.734  1.00  0.66           C  
ATOM   1471  O   ASP A 194     -14.687 -10.198  17.445  1.00  0.66           O  
ATOM   1472  CB  ASP A 194     -15.557  -8.298  19.635  1.00  0.66           C  
ATOM   1473  CG  ASP A 194     -15.954  -6.849  19.378  1.00  0.66           C  
ATOM   1474  OD1 ASP A 194     -15.863  -6.390  18.212  1.00  0.66           O  
ATOM   1475  OD2 ASP A 194     -16.266  -6.159  20.381  1.00  0.66           O  
ATOM   1476  N   SER A 195     -13.375  -8.489  16.818  1.00  0.66           N  
ATOM   1477  CA  SER A 195     -13.195  -8.897  15.432  1.00  0.66           C  
ATOM   1478  C   SER A 195     -12.570 -10.277  15.244  1.00  0.66           C  
ATOM   1479  O   SER A 195     -11.741 -10.746  16.031  1.00  0.66           O  
ATOM   1480  CB  SER A 195     -12.351  -7.858  14.656  1.00  0.66           C  
ATOM   1481  OG  SER A 195     -12.173  -8.204  13.282  1.00  0.66           O  
ATOM   1482  N   ALA A 196     -12.942 -10.969  14.147  1.00  0.63           N  
ATOM   1483  CA  ALA A 196     -12.336 -12.222  13.756  1.00  0.63           C  
ATOM   1484  C   ALA A 196     -11.052 -12.012  12.956  1.00  0.63           C  
ATOM   1485  O   ALA A 196     -10.250 -12.931  12.802  1.00  0.63           O  
ATOM   1486  CB  ALA A 196     -13.346 -13.036  12.923  1.00  0.63           C  
ATOM   1487  N   LEU A 197     -10.808 -10.780  12.460  1.00  0.64           N  
ATOM   1488  CA  LEU A 197      -9.633 -10.420  11.690  1.00  0.64           C  
ATOM   1489  C   LEU A 197      -8.323 -10.572  12.449  1.00  0.64           C  
ATOM   1490  O   LEU A 197      -8.204 -10.209  13.619  1.00  0.64           O  
ATOM   1491  CB  LEU A 197      -9.715  -8.956  11.199  1.00  0.64           C  
ATOM   1492  CG  LEU A 197     -10.931  -8.639  10.309  1.00  0.64           C  
ATOM   1493  CD1 LEU A 197     -11.134  -7.118  10.237  1.00  0.64           C  
ATOM   1494  CD2 LEU A 197     -10.798  -9.264   8.915  1.00  0.64           C  
ATOM   1495  N   ARG A 198      -7.277 -11.100  11.799  1.00  0.61           N  
ATOM   1496  CA  ARG A 198      -5.989 -11.291  12.431  1.00  0.61           C  
ATOM   1497  C   ARG A 198      -4.902 -10.940  11.446  1.00  0.61           C  
ATOM   1498  O   ARG A 198      -5.079 -10.999  10.232  1.00  0.61           O  
ATOM   1499  CB  ARG A 198      -5.777 -12.752  12.922  1.00  0.61           C  
ATOM   1500  CG  ARG A 198      -6.684 -13.173  14.101  1.00  0.61           C  
ATOM   1501  CD  ARG A 198      -6.446 -12.379  15.395  1.00  0.61           C  
ATOM   1502  NE  ARG A 198      -7.419 -12.875  16.431  1.00  0.61           N  
ATOM   1503  CZ  ARG A 198      -8.652 -12.375  16.594  1.00  0.61           C  
ATOM   1504  NH1 ARG A 198      -9.147 -11.416  15.832  1.00  0.61           N  
ATOM   1505  NH2 ARG A 198      -9.437 -12.842  17.565  1.00  0.61           N  
ATOM   1506  N   PHE A 199      -3.733 -10.523  11.959  1.00  0.67           N  
ATOM   1507  CA  PHE A 199      -2.571 -10.219  11.153  1.00  0.67           C  
ATOM   1508  C   PHE A 199      -1.979 -11.488  10.545  1.00  0.67           C  
ATOM   1509  O   PHE A 199      -1.744 -12.467  11.252  1.00  0.67           O  
ATOM   1510  CB  PHE A 199      -1.498  -9.462  11.979  1.00  0.67           C  
ATOM   1511  CG  PHE A 199      -1.943  -8.052  12.268  1.00  0.67           C  
ATOM   1512  CD1 PHE A 199      -1.647  -7.020  11.361  1.00  0.67           C  
ATOM   1513  CD2 PHE A 199      -2.641  -7.736  13.446  1.00  0.67           C  
ATOM   1514  CE1 PHE A 199      -2.034  -5.699  11.623  1.00  0.67           C  
ATOM   1515  CE2 PHE A 199      -3.029  -6.416  13.713  1.00  0.67           C  
ATOM   1516  CZ  PHE A 199      -2.724  -5.397  12.803  1.00  0.67           C  
ATOM   1517  N   ARG A 200      -1.733 -11.513   9.218  1.00  0.63           N  
ATOM   1518  CA  ARG A 200      -1.149 -12.670   8.555  1.00  0.63           C  
ATOM   1519  C   ARG A 200       0.118 -12.287   7.803  1.00  0.63           C  
ATOM   1520  O   ARG A 200       0.177 -11.278   7.097  1.00  0.63           O  
ATOM   1521  CB  ARG A 200      -2.161 -13.384   7.613  1.00  0.63           C  
ATOM   1522  CG  ARG A 200      -1.704 -14.768   7.086  1.00  0.63           C  
ATOM   1523  CD  ARG A 200      -2.753 -15.472   6.207  1.00  0.63           C  
ATOM   1524  NE  ARG A 200      -2.123 -16.700   5.600  1.00  0.63           N  
ATOM   1525  CZ  ARG A 200      -2.711 -17.437   4.646  1.00  0.63           C  
ATOM   1526  NH1 ARG A 200      -4.008 -17.320   4.369  1.00  0.63           N  
ATOM   1527  NH2 ARG A 200      -1.978 -18.283   3.925  1.00  0.63           N  
ATOM   1528  N   GLY A 201       1.174 -13.118   7.955  1.00  0.72           N  
ATOM   1529  CA  GLY A 201       2.489 -12.932   7.352  1.00  0.72           C  
ATOM   1530  C   GLY A 201       3.504 -12.473   8.362  1.00  0.72           C  
ATOM   1531  O   GLY A 201       3.282 -11.516   9.089  1.00  0.72           O  
ATOM   1532  N   ARG A 202       4.680 -13.134   8.421  1.00  0.67           N  
ATOM   1533  CA  ARG A 202       5.687 -12.874   9.447  1.00  0.67           C  
ATOM   1534  C   ARG A 202       6.322 -11.497   9.390  1.00  0.67           C  
ATOM   1535  O   ARG A 202       6.849 -10.999  10.381  1.00  0.67           O  
ATOM   1536  CB  ARG A 202       6.883 -13.847   9.334  1.00  0.67           C  
ATOM   1537  CG  ARG A 202       6.520 -15.329   9.476  1.00  0.67           C  
ATOM   1538  CD  ARG A 202       7.779 -16.208   9.518  1.00  0.67           C  
ATOM   1539  NE  ARG A 202       7.380 -17.571   9.962  1.00  0.67           N  
ATOM   1540  CZ  ARG A 202       6.841 -17.843  11.155  1.00  0.67           C  
ATOM   1541  NH1 ARG A 202       6.992 -17.064  12.211  1.00  0.67           N  
ATOM   1542  NH2 ARG A 202       6.090 -18.934  11.241  1.00  0.67           N  
ATOM   1543  N   LEU A 203       6.331 -10.894   8.195  1.00  0.69           N  
ATOM   1544  CA  LEU A 203       6.957  -9.628   7.927  1.00  0.69           C  
ATOM   1545  C   LEU A 203       6.069  -8.887   6.948  1.00  0.69           C  
ATOM   1546  O   LEU A 203       5.656  -9.451   5.933  1.00  0.69           O  
ATOM   1547  CB  LEU A 203       8.357  -9.874   7.310  1.00  0.69           C  
ATOM   1548  CG  LEU A 203       9.143  -8.608   6.926  1.00  0.69           C  
ATOM   1549  CD1 LEU A 203       9.555  -7.753   8.127  1.00  0.69           C  
ATOM   1550  CD2 LEU A 203      10.357  -8.959   6.053  1.00  0.69           C  
ATOM   1551  N   HIS A 204       5.736  -7.613   7.253  1.00  0.64           N  
ATOM   1552  CA  HIS A 204       4.857  -6.764   6.466  1.00  0.64           C  
ATOM   1553  C   HIS A 204       3.424  -7.278   6.466  1.00  0.64           C  
ATOM   1554  O   HIS A 204       2.757  -7.446   5.437  1.00  0.64           O  
ATOM   1555  CB  HIS A 204       5.329  -6.523   5.029  1.00  0.64           C  
ATOM   1556  CG  HIS A 204       6.794  -6.258   4.807  1.00  0.64           C  
ATOM   1557  ND1 HIS A 204       7.327  -5.009   5.059  1.00  0.64           N  
ATOM   1558  CD2 HIS A 204       7.756  -7.084   4.311  1.00  0.64           C  
ATOM   1559  CE1 HIS A 204       8.600  -5.105   4.727  1.00  0.64           C  
ATOM   1560  NE2 HIS A 204       8.914  -6.339   4.265  1.00  0.64           N  
ATOM   1561  N   GLU A 205       2.979  -7.581   7.684  1.00  0.65           N  
ATOM   1562  CA  GLU A 205       1.700  -8.046   8.122  1.00  0.65           C  
ATOM   1563  C   GLU A 205       0.543  -7.093   7.856  1.00  0.65           C  
ATOM   1564  O   GLU A 205       0.655  -5.869   7.902  1.00  0.65           O  
ATOM   1565  CB  GLU A 205       1.802  -8.378   9.636  1.00  0.65           C  
ATOM   1566  CG  GLU A 205       2.053  -7.177  10.602  1.00  0.65           C  
ATOM   1567  CD  GLU A 205       3.432  -6.503  10.557  1.00  0.65           C  
ATOM   1568  OE1 GLU A 205       3.562  -5.454  11.245  1.00  0.65           O  
ATOM   1569  OE2 GLU A 205       4.362  -7.007   9.879  1.00  0.65           O  
ATOM   1570  N   ARG A 206      -0.644  -7.654   7.577  1.00  0.61           N  
ATOM   1571  CA  ARG A 206      -1.865  -6.883   7.472  1.00  0.61           C  
ATOM   1572  C   ARG A 206      -2.973  -7.750   8.022  1.00  0.61           C  
ATOM   1573  O   ARG A 206      -2.823  -8.967   8.108  1.00  0.61           O  
ATOM   1574  CB  ARG A 206      -2.227  -6.485   6.015  1.00  0.61           C  
ATOM   1575  CG  ARG A 206      -1.352  -5.380   5.399  1.00  0.61           C  
ATOM   1576  CD  ARG A 206      -1.762  -5.053   3.964  1.00  0.61           C  
ATOM   1577  NE  ARG A 206      -1.239  -3.687   3.691  1.00  0.61           N  
ATOM   1578  CZ  ARG A 206      -1.819  -2.804   2.883  1.00  0.61           C  
ATOM   1579  NH1 ARG A 206      -2.888  -3.088   2.144  1.00  0.61           N  
ATOM   1580  NH2 ARG A 206      -1.354  -1.562   2.814  1.00  0.61           N  
ATOM   1581  N   LEU A 207      -4.094  -7.131   8.443  1.00  0.68           N  
ATOM   1582  CA  LEU A 207      -5.300  -7.816   8.873  1.00  0.68           C  
ATOM   1583  C   LEU A 207      -6.022  -8.557   7.754  1.00  0.68           C  
ATOM   1584  O   LEU A 207      -6.290  -8.000   6.690  1.00  0.68           O  
ATOM   1585  CB  LEU A 207      -6.281  -6.812   9.524  1.00  0.68           C  
ATOM   1586  CG  LEU A 207      -5.788  -6.270  10.879  1.00  0.68           C  
ATOM   1587  CD1 LEU A 207      -6.496  -4.961  11.234  1.00  0.68           C  
ATOM   1588  CD2 LEU A 207      -5.993  -7.295  12.003  1.00  0.68           C  
ATOM   1589  N   TYR A 208      -6.377  -9.830   8.003  1.00  0.66           N  
ATOM   1590  CA  TYR A 208      -7.119 -10.677   7.092  1.00  0.66           C  
ATOM   1591  C   TYR A 208      -8.133 -11.461   7.880  1.00  0.66           C  
ATOM   1592  O   TYR A 208      -7.999 -11.626   9.092  1.00  0.66           O  
ATOM   1593  CB  TYR A 208      -6.220 -11.745   6.417  1.00  0.66           C  
ATOM   1594  CG  TYR A 208      -5.329 -11.058   5.449  1.00  0.66           C  
ATOM   1595  CD1 TYR A 208      -5.824 -10.698   4.192  1.00  0.66           C  
ATOM   1596  CD2 TYR A 208      -4.042 -10.656   5.825  1.00  0.66           C  
ATOM   1597  CE1 TYR A 208      -5.079  -9.866   3.359  1.00  0.66           C  
ATOM   1598  CE2 TYR A 208      -3.299  -9.809   4.994  1.00  0.66           C  
ATOM   1599  CZ  TYR A 208      -3.860  -9.360   3.794  1.00  0.66           C  
ATOM   1600  OH  TYR A 208      -3.255  -8.354   3.034  1.00  0.66           O  
ATOM   1601  N   ASP A 209      -9.168 -11.994   7.207  1.00  0.63           N  
ATOM   1602  CA  ASP A 209     -10.016 -13.015   7.782  1.00  0.63           C  
ATOM   1603  C   ASP A 209      -9.322 -14.388   7.826  1.00  0.63           C  
ATOM   1604  O   ASP A 209      -8.158 -14.560   7.457  1.00  0.63           O  
ATOM   1605  CB  ASP A 209     -11.450 -13.018   7.166  1.00  0.63           C  
ATOM   1606  CG  ASP A 209     -11.605 -13.835   5.895  1.00  0.63           C  
ATOM   1607  OD1 ASP A 209     -10.580 -14.132   5.235  1.00  0.63           O  
ATOM   1608  OD2 ASP A 209     -12.750 -14.258   5.618  1.00  0.63           O  
ATOM   1609  N   ALA A 210     -10.054 -15.418   8.290  1.00  0.59           N  
ATOM   1610  CA  ALA A 210      -9.616 -16.799   8.293  1.00  0.59           C  
ATOM   1611  C   ALA A 210      -9.280 -17.365   6.909  1.00  0.59           C  
ATOM   1612  O   ALA A 210      -8.394 -18.207   6.767  1.00  0.59           O  
ATOM   1613  CB  ALA A 210     -10.716 -17.657   8.948  1.00  0.59           C  
ATOM   1614  N   HIS A 211      -9.968 -16.895   5.849  1.00  0.59           N  
ATOM   1615  CA  HIS A 211      -9.792 -17.386   4.494  1.00  0.59           C  
ATOM   1616  C   HIS A 211      -8.724 -16.603   3.751  1.00  0.59           C  
ATOM   1617  O   HIS A 211      -8.277 -16.986   2.673  1.00  0.59           O  
ATOM   1618  CB  HIS A 211     -11.117 -17.233   3.719  1.00  0.59           C  
ATOM   1619  CG  HIS A 211     -12.231 -17.973   4.383  1.00  0.59           C  
ATOM   1620  ND1 HIS A 211     -12.201 -19.354   4.417  1.00  0.59           N  
ATOM   1621  CD2 HIS A 211     -13.313 -17.509   5.059  1.00  0.59           C  
ATOM   1622  CE1 HIS A 211     -13.263 -19.703   5.112  1.00  0.59           C  
ATOM   1623  NE2 HIS A 211     -13.973 -18.625   5.526  1.00  0.59           N  
ATOM   1624  N   GLY A 212      -8.254 -15.486   4.338  1.00  0.69           N  
ATOM   1625  CA  GLY A 212      -7.272 -14.604   3.737  1.00  0.69           C  
ATOM   1626  C   GLY A 212      -7.877 -13.480   2.946  1.00  0.69           C  
ATOM   1627  O   GLY A 212      -7.189 -12.882   2.129  1.00  0.69           O  
ATOM   1628  N   ALA A 213      -9.160 -13.145   3.150  1.00  0.72           N  
ATOM   1629  CA  ALA A 213      -9.795 -12.010   2.514  1.00  0.72           C  
ATOM   1630  C   ALA A 213      -9.504 -10.705   3.253  1.00  0.72           C  
ATOM   1631  O   ALA A 213      -9.282 -10.682   4.467  1.00  0.72           O  
ATOM   1632  CB  ALA A 213     -11.312 -12.232   2.398  1.00  0.72           C  
ATOM   1633  N   GLN A 214      -9.464  -9.566   2.530  1.00  0.67           N  
ATOM   1634  CA  GLN A 214      -9.182  -8.279   3.139  1.00  0.67           C  
ATOM   1635  C   GLN A 214     -10.426  -7.666   3.768  1.00  0.67           C  
ATOM   1636  O   GLN A 214     -11.510  -7.713   3.188  1.00  0.67           O  
ATOM   1637  CB  GLN A 214      -8.574  -7.233   2.163  1.00  0.67           C  
ATOM   1638  CG  GLN A 214      -7.058  -7.435   1.970  1.00  0.67           C  
ATOM   1639  CD  GLN A 214      -6.380  -6.346   1.144  1.00  0.67           C  
ATOM   1640  OE1 GLN A 214      -6.915  -5.271   0.860  1.00  0.67           O  
ATOM   1641  NE2 GLN A 214      -5.108  -6.623   0.773  1.00  0.67           N  
ATOM   1642  N   PRO A 215     -10.342  -7.035   4.933  1.00  0.73           N  
ATOM   1643  CA  PRO A 215     -11.450  -6.259   5.455  1.00  0.73           C  
ATOM   1644  C   PRO A 215     -11.576  -4.931   4.717  1.00  0.73           C  
ATOM   1645  O   PRO A 215     -10.541  -4.369   4.326  1.00  0.73           O  
ATOM   1646  CB  PRO A 215     -11.079  -6.046   6.925  1.00  0.73           C  
ATOM   1647  CG  PRO A 215      -9.549  -6.069   6.938  1.00  0.73           C  
ATOM   1648  CD  PRO A 215      -9.213  -7.094   5.861  1.00  0.73           C  
ATOM   1649  N   PRO A 216     -12.779  -4.408   4.496  1.00  0.72           N  
ATOM   1650  CA  PRO A 216     -12.971  -3.119   3.854  1.00  0.72           C  
ATOM   1651  C   PRO A 216     -12.504  -1.991   4.764  1.00  0.72           C  
ATOM   1652  O   PRO A 216     -12.626  -2.073   5.989  1.00  0.72           O  
ATOM   1653  CB  PRO A 216     -14.483  -3.083   3.587  1.00  0.72           C  
ATOM   1654  CG  PRO A 216     -15.088  -3.908   4.725  1.00  0.72           C  
ATOM   1655  CD  PRO A 216     -14.048  -5.008   4.926  1.00  0.72           C  
ATOM   1656  N   SER A 217     -11.894  -0.945   4.184  1.00  0.70           N  
ATOM   1657  CA  SER A 217     -11.206   0.081   4.941  1.00  0.70           C  
ATOM   1658  C   SER A 217     -11.932   1.409   4.962  1.00  0.70           C  
ATOM   1659  O   SER A 217     -12.735   1.744   4.090  1.00  0.70           O  
ATOM   1660  CB  SER A 217      -9.755   0.311   4.434  1.00  0.70           C  
ATOM   1661  OG  SER A 217      -9.720   0.574   3.030  1.00  0.70           O  
ATOM   1662  N   VAL A 218     -11.648   2.206   6.008  1.00  0.70           N  
ATOM   1663  CA  VAL A 218     -12.060   3.593   6.125  1.00  0.70           C  
ATOM   1664  C   VAL A 218     -10.801   4.416   6.323  1.00  0.70           C  
ATOM   1665  O   VAL A 218     -10.057   4.200   7.277  1.00  0.70           O  
ATOM   1666  CB  VAL A 218     -12.997   3.838   7.310  1.00  0.70           C  
ATOM   1667  CG1 VAL A 218     -13.435   5.315   7.355  1.00  0.70           C  
ATOM   1668  CG2 VAL A 218     -14.239   2.939   7.180  1.00  0.70           C  
ATOM   1669  N   GLU A 219     -10.521   5.391   5.437  1.00  0.65           N  
ATOM   1670  CA  GLU A 219      -9.409   6.308   5.616  1.00  0.65           C  
ATOM   1671  C   GLU A 219      -9.876   7.509   6.410  1.00  0.65           C  
ATOM   1672  O   GLU A 219     -10.921   8.096   6.124  1.00  0.65           O  
ATOM   1673  CB  GLU A 219      -8.806   6.834   4.296  1.00  0.65           C  
ATOM   1674  CG  GLU A 219      -8.066   5.770   3.451  1.00  0.65           C  
ATOM   1675  CD  GLU A 219      -7.248   6.409   2.329  1.00  0.65           C  
ATOM   1676  OE1 GLU A 219      -6.490   5.662   1.655  1.00  0.65           O  
ATOM   1677  OE2 GLU A 219      -7.306   7.656   2.177  1.00  0.65           O  
ATOM   1678  N   VAL A 220      -9.120   7.901   7.449  1.00  0.71           N  
ATOM   1679  CA  VAL A 220      -9.520   8.981   8.334  1.00  0.71           C  
ATOM   1680  C   VAL A 220      -8.449  10.046   8.427  1.00  0.71           C  
ATOM   1681  O   VAL A 220      -7.250   9.777   8.364  1.00  0.71           O  
ATOM   1682  CB  VAL A 220      -9.913   8.511   9.734  1.00  0.71           C  
ATOM   1683  CG1 VAL A 220     -11.161   7.617   9.615  1.00  0.71           C  
ATOM   1684  CG2 VAL A 220      -8.761   7.752  10.420  1.00  0.71           C  
ATOM   1685  N   ASP A 221      -8.858  11.324   8.591  1.00  0.71           N  
ATOM   1686  CA  ASP A 221      -7.953  12.442   8.778  1.00  0.71           C  
ATOM   1687  C   ASP A 221      -7.438  12.505  10.217  1.00  0.71           C  
ATOM   1688  O   ASP A 221      -7.670  13.446  10.975  1.00  0.71           O  
ATOM   1689  CB  ASP A 221      -8.598  13.773   8.305  1.00  0.71           C  
ATOM   1690  CG  ASP A 221      -7.527  14.702   7.766  1.00  0.71           C  
ATOM   1691  OD1 ASP A 221      -6.784  14.246   6.855  1.00  0.71           O  
ATOM   1692  OD2 ASP A 221      -7.420  15.857   8.247  1.00  0.71           O  
ATOM   1693  N   VAL A 222      -6.714  11.450  10.611  1.00  0.74           N  
ATOM   1694  CA  VAL A 222      -6.010  11.308  11.863  1.00  0.74           C  
ATOM   1695  C   VAL A 222      -4.585  11.081  11.424  1.00  0.74           C  
ATOM   1696  O   VAL A 222      -4.313  10.164  10.650  1.00  0.74           O  
ATOM   1697  CB  VAL A 222      -6.501  10.105  12.668  1.00  0.74           C  
ATOM   1698  CG1 VAL A 222      -5.668   9.918  13.949  1.00  0.74           C  
ATOM   1699  CG2 VAL A 222      -7.986  10.306  13.029  1.00  0.74           C  
ATOM   1700  N   VAL A 223      -3.645  11.939  11.850  1.00  0.72           N  
ATOM   1701  CA  VAL A 223      -2.303  11.961  11.304  1.00  0.72           C  
ATOM   1702  C   VAL A 223      -1.303  11.533  12.357  1.00  0.72           C  
ATOM   1703  O   VAL A 223      -1.266  12.039  13.478  1.00  0.72           O  
ATOM   1704  CB  VAL A 223      -1.935  13.341  10.760  1.00  0.72           C  
ATOM   1705  CG1 VAL A 223      -0.504  13.353  10.184  1.00  0.72           C  
ATOM   1706  CG2 VAL A 223      -2.942  13.747   9.662  1.00  0.72           C  
ATOM   1707  N   PHE A 224      -0.438  10.573  11.998  1.00  0.68           N  
ATOM   1708  CA  PHE A 224       0.683  10.149  12.803  1.00  0.68           C  
ATOM   1709  C   PHE A 224       1.943  10.619  12.110  1.00  0.68           C  
ATOM   1710  O   PHE A 224       2.111  10.466  10.902  1.00  0.68           O  
ATOM   1711  CB  PHE A 224       0.749   8.608  12.952  1.00  0.68           C  
ATOM   1712  CG  PHE A 224      -0.271   8.131  13.948  1.00  0.68           C  
ATOM   1713  CD1 PHE A 224       0.123   7.830  15.261  1.00  0.68           C  
ATOM   1714  CD2 PHE A 224      -1.619   7.966  13.588  1.00  0.68           C  
ATOM   1715  CE1 PHE A 224      -0.809   7.367  16.197  1.00  0.68           C  
ATOM   1716  CE2 PHE A 224      -2.556   7.504  14.522  1.00  0.68           C  
ATOM   1717  CZ  PHE A 224      -2.149   7.198  15.827  1.00  0.68           C  
ATOM   1718  N   HIS A 225       2.867  11.214  12.878  1.00  0.65           N  
ATOM   1719  CA  HIS A 225       4.171  11.601  12.391  1.00  0.65           C  
ATOM   1720  C   HIS A 225       5.146  10.500  12.737  1.00  0.65           C  
ATOM   1721  O   HIS A 225       5.424  10.240  13.907  1.00  0.65           O  
ATOM   1722  CB  HIS A 225       4.672  12.911  13.038  1.00  0.65           C  
ATOM   1723  CG  HIS A 225       3.868  14.109  12.642  1.00  0.65           C  
ATOM   1724  ND1 HIS A 225       3.817  14.458  11.310  1.00  0.65           N  
ATOM   1725  CD2 HIS A 225       3.200  15.022  13.396  1.00  0.65           C  
ATOM   1726  CE1 HIS A 225       3.122  15.576  11.272  1.00  0.65           C  
ATOM   1727  NE2 HIS A 225       2.724  15.965  12.507  1.00  0.65           N  
ATOM   1728  N   HIS A 226       5.678   9.822  11.712  1.00  0.62           N  
ATOM   1729  CA  HIS A 226       6.644   8.756  11.837  1.00  0.62           C  
ATOM   1730  C   HIS A 226       8.034   9.341  11.891  1.00  0.62           C  
ATOM   1731  O   HIS A 226       8.483   9.999  10.953  1.00  0.62           O  
ATOM   1732  CB  HIS A 226       6.552   7.806  10.622  1.00  0.62           C  
ATOM   1733  CG  HIS A 226       7.457   6.635  10.731  1.00  0.62           C  
ATOM   1734  ND1 HIS A 226       7.274   5.852  11.837  1.00  0.62           N  
ATOM   1735  CD2 HIS A 226       8.511   6.192   9.997  1.00  0.62           C  
ATOM   1736  CE1 HIS A 226       8.212   4.934  11.775  1.00  0.62           C  
ATOM   1737  NE2 HIS A 226       8.993   5.094  10.678  1.00  0.62           N  
ATOM   1738  N   THR A 227       8.759   9.147  13.008  1.00  0.62           N  
ATOM   1739  CA  THR A 227      10.051   9.805  13.189  1.00  0.62           C  
ATOM   1740  C   THR A 227      11.187   9.136  12.444  1.00  0.62           C  
ATOM   1741  O   THR A 227      12.183   9.785  12.130  1.00  0.62           O  
ATOM   1742  CB  THR A 227      10.458  10.037  14.641  1.00  0.62           C  
ATOM   1743  OG1 THR A 227      10.569   8.842  15.393  1.00  0.62           O  
ATOM   1744  CG2 THR A 227       9.415  10.918  15.344  1.00  0.62           C  
ATOM   1745  N   GLY A 228      11.060   7.839  12.088  1.00  0.61           N  
ATOM   1746  CA  GLY A 228      12.023   7.141  11.244  1.00  0.61           C  
ATOM   1747  C   GLY A 228      13.297   6.827  11.971  1.00  0.61           C  
ATOM   1748  O   GLY A 228      14.392   6.947  11.424  1.00  0.61           O  
ATOM   1749  N   TYR A 229      13.173   6.446  13.254  1.00  0.54           N  
ATOM   1750  CA  TYR A 229      14.272   6.391  14.199  1.00  0.54           C  
ATOM   1751  C   TYR A 229      15.187   5.174  14.029  1.00  0.54           C  
ATOM   1752  O   TYR A 229      15.220   4.244  14.829  1.00  0.54           O  
ATOM   1753  CB  TYR A 229      13.748   6.570  15.653  1.00  0.54           C  
ATOM   1754  CG  TYR A 229      14.871   6.792  16.640  1.00  0.54           C  
ATOM   1755  CD1 TYR A 229      15.201   5.785  17.562  1.00  0.54           C  
ATOM   1756  CD2 TYR A 229      15.644   7.967  16.610  1.00  0.54           C  
ATOM   1757  CE1 TYR A 229      16.312   5.924  18.402  1.00  0.54           C  
ATOM   1758  CE2 TYR A 229      16.748   8.115  17.464  1.00  0.54           C  
ATOM   1759  CZ  TYR A 229      17.092   7.081  18.341  1.00  0.54           C  
ATOM   1760  OH  TYR A 229      18.263   7.165  19.116  1.00  0.54           O  
ATOM   1761  N   GLU A 230      16.013   5.186  12.970  1.00  0.49           N  
ATOM   1762  CA  GLU A 230      17.150   4.300  12.833  1.00  0.49           C  
ATOM   1763  C   GLU A 230      18.427   5.079  13.130  1.00  0.49           C  
ATOM   1764  O   GLU A 230      18.914   5.794  12.247  1.00  0.49           O  
ATOM   1765  CB  GLU A 230      17.262   3.761  11.388  1.00  0.49           C  
ATOM   1766  CG  GLU A 230      16.171   2.732  11.010  1.00  0.49           C  
ATOM   1767  CD  GLU A 230      16.256   2.340   9.545  1.00  0.49           C  
ATOM   1768  OE1 GLU A 230      15.415   1.500   9.124  1.00  0.49           O  
ATOM   1769  OE2 GLU A 230      17.144   2.860   8.824  1.00  0.49           O  
ATOM   1770  N   PRO A 231      19.036   4.994  14.308  1.00  0.47           N  
ATOM   1771  CA  PRO A 231      20.396   5.454  14.503  1.00  0.47           C  
ATOM   1772  C   PRO A 231      21.384   4.456  13.920  1.00  0.47           C  
ATOM   1773  O   PRO A 231      21.181   3.252  14.035  1.00  0.47           O  
ATOM   1774  CB  PRO A 231      20.515   5.586  16.031  1.00  0.47           C  
ATOM   1775  CG  PRO A 231      19.499   4.590  16.617  1.00  0.47           C  
ATOM   1776  CD  PRO A 231      18.515   4.290  15.480  1.00  0.47           C  
ATOM   1777  N   GLU A 232      22.458   4.960  13.283  1.00  0.41           N  
ATOM   1778  CA  GLU A 232      23.580   4.176  12.799  1.00  0.41           C  
ATOM   1779  C   GLU A 232      23.371   3.268  11.589  1.00  0.41           C  
ATOM   1780  O   GLU A 232      22.300   2.758  11.263  1.00  0.41           O  
ATOM   1781  CB  GLU A 232      24.315   3.381  13.901  1.00  0.41           C  
ATOM   1782  CG  GLU A 232      24.795   4.233  15.096  1.00  0.41           C  
ATOM   1783  CD  GLU A 232      25.655   3.401  16.045  1.00  0.41           C  
ATOM   1784  OE1 GLU A 232      26.004   3.943  17.123  1.00  0.41           O  
ATOM   1785  OE2 GLU A 232      25.977   2.237  15.689  1.00  0.41           O  
ATOM   1786  N   VAL A 233      24.481   3.037  10.861  1.00  0.34           N  
ATOM   1787  CA  VAL A 233      24.579   2.089   9.765  1.00  0.34           C  
ATOM   1788  C   VAL A 233      24.372   0.650  10.233  1.00  0.34           C  
ATOM   1789  O   VAL A 233      23.720  -0.150   9.565  1.00  0.34           O  
ATOM   1790  CB  VAL A 233      25.923   2.248   9.054  1.00  0.34           C  
ATOM   1791  CG1 VAL A 233      26.060   1.256   7.881  1.00  0.34           C  
ATOM   1792  CG2 VAL A 233      26.038   3.692   8.522  1.00  0.34           C  
ATOM   1793  N   ILE A 234      24.912   0.292  11.418  1.00  0.40           N  
ATOM   1794  CA  ILE A 234      24.857  -1.048  11.991  1.00  0.40           C  
ATOM   1795  C   ILE A 234      23.436  -1.521  12.286  1.00  0.40           C  
ATOM   1796  O   ILE A 234      23.051  -2.630  11.914  1.00  0.40           O  
ATOM   1797  CB  ILE A 234      25.726  -1.116  13.251  1.00  0.40           C  
ATOM   1798  CG1 ILE A 234      27.201  -0.781  12.908  1.00  0.40           C  
ATOM   1799  CG2 ILE A 234      25.620  -2.510  13.916  1.00  0.40           C  
ATOM   1800  CD1 ILE A 234      28.071  -0.550  14.150  1.00  0.40           C  
ATOM   1801  N   ALA A 235      22.589  -0.673  12.909  1.00  0.42           N  
ATOM   1802  CA  ALA A 235      21.202  -0.999  13.189  1.00  0.42           C  
ATOM   1803  C   ALA A 235      20.365  -1.197  11.930  1.00  0.42           C  
ATOM   1804  O   ALA A 235      19.583  -2.140  11.811  1.00  0.42           O  
ATOM   1805  CB  ALA A 235      20.574   0.116  14.041  1.00  0.42           C  
ATOM   1806  N   ARG A 236      20.560  -0.316  10.929  1.00  0.35           N  
ATOM   1807  CA  ARG A 236      19.951  -0.426   9.619  1.00  0.35           C  
ATOM   1808  C   ARG A 236      20.367  -1.684   8.867  1.00  0.35           C  
ATOM   1809  O   ARG A 236      19.546  -2.360   8.250  1.00  0.35           O  
ATOM   1810  CB  ARG A 236      20.307   0.824   8.782  1.00  0.35           C  
ATOM   1811  CG  ARG A 236      19.619   0.874   7.401  1.00  0.35           C  
ATOM   1812  CD  ARG A 236      19.920   2.150   6.608  1.00  0.35           C  
ATOM   1813  NE  ARG A 236      19.235   3.244   7.334  1.00  0.35           N  
ATOM   1814  CZ  ARG A 236      19.634   4.511   7.474  1.00  0.35           C  
ATOM   1815  NH1 ARG A 236      20.639   5.015   6.766  1.00  0.35           N  
ATOM   1816  NH2 ARG A 236      18.971   5.268   8.344  1.00  0.35           N  
ATOM   1817  N   LYS A 237      21.663  -2.054   8.920  1.00  0.44           N  
ATOM   1818  CA  LYS A 237      22.162  -3.291   8.351  1.00  0.44           C  
ATOM   1819  C   LYS A 237      21.550  -4.535   8.986  1.00  0.44           C  
ATOM   1820  O   LYS A 237      21.032  -5.401   8.283  1.00  0.44           O  
ATOM   1821  CB  LYS A 237      23.705  -3.336   8.476  1.00  0.44           C  
ATOM   1822  CG  LYS A 237      24.331  -4.593   7.860  1.00  0.44           C  
ATOM   1823  CD  LYS A 237      25.863  -4.635   7.955  1.00  0.44           C  
ATOM   1824  CE  LYS A 237      26.359  -6.042   7.616  1.00  0.44           C  
ATOM   1825  NZ  LYS A 237      27.830  -6.130   7.631  1.00  0.44           N  
ATOM   1826  N   GLY A 238      21.507  -4.605  10.336  1.00  0.50           N  
ATOM   1827  CA  GLY A 238      20.913  -5.732  11.054  1.00  0.50           C  
ATOM   1828  C   GLY A 238      19.421  -5.869  10.863  1.00  0.50           C  
ATOM   1829  O   GLY A 238      18.856  -6.960  10.908  1.00  0.50           O  
ATOM   1830  N   LYS A 239      18.724  -4.746  10.611  1.00  0.48           N  
ATOM   1831  CA  LYS A 239      17.335  -4.728  10.192  1.00  0.48           C  
ATOM   1832  C   LYS A 239      17.112  -5.380   8.831  1.00  0.48           C  
ATOM   1833  O   LYS A 239      16.196  -6.186   8.677  1.00  0.48           O  
ATOM   1834  CB  LYS A 239      16.818  -3.271  10.202  1.00  0.48           C  
ATOM   1835  CG  LYS A 239      15.327  -3.076   9.879  1.00  0.48           C  
ATOM   1836  CD  LYS A 239      14.935  -1.603  10.087  1.00  0.48           C  
ATOM   1837  CE  LYS A 239      13.509  -1.234   9.664  1.00  0.48           C  
ATOM   1838  NZ  LYS A 239      13.305   0.212   9.880  1.00  0.48           N  
ATOM   1839  N   ARG A 240      17.976  -5.095   7.831  1.00  0.43           N  
ATOM   1840  CA  ARG A 240      17.960  -5.752   6.528  1.00  0.43           C  
ATOM   1841  C   ARG A 240      18.265  -7.243   6.613  1.00  0.43           C  
ATOM   1842  O   ARG A 240      17.568  -8.069   6.028  1.00  0.43           O  
ATOM   1843  CB  ARG A 240      19.002  -5.125   5.565  1.00  0.43           C  
ATOM   1844  CG  ARG A 240      18.765  -3.640   5.234  1.00  0.43           C  
ATOM   1845  CD  ARG A 240      19.954  -3.030   4.488  1.00  0.43           C  
ATOM   1846  NE  ARG A 240      19.695  -1.562   4.371  1.00  0.43           N  
ATOM   1847  CZ  ARG A 240      20.484  -0.718   3.693  1.00  0.43           C  
ATOM   1848  NH1 ARG A 240      21.621  -1.116   3.132  1.00  0.43           N  
ATOM   1849  NH2 ARG A 240      20.095   0.540   3.506  1.00  0.43           N  
ATOM   1850  N   GLU A 241      19.297  -7.627   7.392  1.00  0.48           N  
ATOM   1851  CA  GLU A 241      19.685  -9.007   7.637  1.00  0.48           C  
ATOM   1852  C   GLU A 241      18.597  -9.808   8.352  1.00  0.48           C  
ATOM   1853  O   GLU A 241      18.304 -10.954   8.010  1.00  0.48           O  
ATOM   1854  CB  GLU A 241      21.046  -9.040   8.382  1.00  0.48           C  
ATOM   1855  CG  GLU A 241      22.201  -8.524   7.477  1.00  0.48           C  
ATOM   1856  CD  GLU A 241      23.557  -8.332   8.160  1.00  0.48           C  
ATOM   1857  OE1 GLU A 241      24.578  -8.397   7.419  1.00  0.48           O  
ATOM   1858  OE2 GLU A 241      23.603  -8.048   9.383  1.00  0.48           O  
ATOM   1859  N   ARG A 242      17.903  -9.201   9.339  1.00  0.43           N  
ATOM   1860  CA  ARG A 242      16.691  -9.763   9.913  1.00  0.43           C  
ATOM   1861  C   ARG A 242      15.546  -9.916   8.916  1.00  0.43           C  
ATOM   1862  O   ARG A 242      14.904 -10.961   8.862  1.00  0.43           O  
ATOM   1863  CB  ARG A 242      16.209  -8.890  11.102  1.00  0.43           C  
ATOM   1864  CG  ARG A 242      14.944  -9.415  11.821  1.00  0.43           C  
ATOM   1865  CD  ARG A 242      14.552  -8.634  13.082  1.00  0.43           C  
ATOM   1866  NE  ARG A 242      14.185  -7.248  12.637  1.00  0.43           N  
ATOM   1867  CZ  ARG A 242      14.106  -6.187  13.453  1.00  0.43           C  
ATOM   1868  NH1 ARG A 242      14.342  -6.282  14.757  1.00  0.43           N  
ATOM   1869  NH2 ARG A 242      13.778  -4.998  12.948  1.00  0.43           N  
ATOM   1870  N   TYR A 243      15.268  -8.891   8.082  1.00  0.48           N  
ATOM   1871  CA  TYR A 243      14.200  -8.934   7.090  1.00  0.48           C  
ATOM   1872  C   TYR A 243      14.427 -10.005   6.032  1.00  0.48           C  
ATOM   1873  O   TYR A 243      13.514 -10.763   5.713  1.00  0.48           O  
ATOM   1874  CB  TYR A 243      13.975  -7.549   6.415  1.00  0.48           C  
ATOM   1875  CG  TYR A 243      13.187  -6.555   7.249  1.00  0.48           C  
ATOM   1876  CD1 TYR A 243      12.992  -6.656   8.645  1.00  0.48           C  
ATOM   1877  CD2 TYR A 243      12.593  -5.472   6.574  1.00  0.48           C  
ATOM   1878  CE1 TYR A 243      12.236  -5.699   9.337  1.00  0.48           C  
ATOM   1879  CE2 TYR A 243      11.825  -4.522   7.262  1.00  0.48           C  
ATOM   1880  CZ  TYR A 243      11.655  -4.635   8.645  1.00  0.48           C  
ATOM   1881  OH  TYR A 243      10.869  -3.704   9.350  1.00  0.48           O  
ATOM   1882  N   ALA A 244      15.667 -10.147   5.523  1.00  0.63           N  
ATOM   1883  CA  ALA A 244      16.046 -11.202   4.601  1.00  0.63           C  
ATOM   1884  C   ALA A 244      15.850 -12.610   5.169  1.00  0.63           C  
ATOM   1885  O   ALA A 244      15.273 -13.481   4.524  1.00  0.63           O  
ATOM   1886  CB  ALA A 244      17.514 -10.997   4.180  1.00  0.63           C  
ATOM   1887  N   ARG A 245      16.241 -12.850   6.437  1.00  0.60           N  
ATOM   1888  CA  ARG A 245      15.983 -14.116   7.107  1.00  0.60           C  
ATOM   1889  C   ARG A 245      14.498 -14.442   7.270  1.00  0.60           C  
ATOM   1890  O   ARG A 245      14.058 -15.573   7.056  1.00  0.60           O  
ATOM   1891  CB  ARG A 245      16.640 -14.116   8.506  1.00  0.60           C  
ATOM   1892  CG  ARG A 245      16.502 -15.466   9.241  1.00  0.60           C  
ATOM   1893  CD  ARG A 245      17.090 -15.499  10.652  1.00  0.60           C  
ATOM   1894  NE  ARG A 245      16.261 -14.608  11.525  1.00  0.60           N  
ATOM   1895  CZ  ARG A 245      16.689 -13.566  12.233  1.00  0.60           C  
ATOM   1896  NH1 ARG A 245      17.909 -13.064  12.060  1.00  0.60           N  
ATOM   1897  NH2 ARG A 245      15.896 -13.012  13.142  1.00  0.60           N  
ATOM   1898  N   LEU A 246      13.665 -13.441   7.630  1.00  0.65           N  
ATOM   1899  CA  LEU A 246      12.221 -13.597   7.715  1.00  0.65           C  
ATOM   1900  C   LEU A 246      11.608 -13.995   6.381  1.00  0.65           C  
ATOM   1901  O   LEU A 246      10.761 -14.883   6.303  1.00  0.65           O  
ATOM   1902  CB  LEU A 246      11.550 -12.284   8.195  1.00  0.65           C  
ATOM   1903  CG  LEU A 246      11.841 -11.921   9.663  1.00  0.65           C  
ATOM   1904  CD1 LEU A 246      11.384 -10.493   9.986  1.00  0.65           C  
ATOM   1905  CD2 LEU A 246      11.170 -12.902  10.622  1.00  0.65           C  
ATOM   1906  N   VAL A 247      12.074 -13.370   5.292  1.00  0.68           N  
ATOM   1907  CA  VAL A 247      11.727 -13.679   3.919  1.00  0.68           C  
ATOM   1908  C   VAL A 247      12.089 -15.091   3.475  1.00  0.68           C  
ATOM   1909  O   VAL A 247      11.255 -15.812   2.925  1.00  0.68           O  
ATOM   1910  CB  VAL A 247      12.436 -12.650   3.061  1.00  0.68           C  
ATOM   1911  CG1 VAL A 247      12.642 -13.107   1.607  1.00  0.68           C  
ATOM   1912  CG2 VAL A 247      11.638 -11.335   3.162  1.00  0.68           C  
ATOM   1913  N   GLU A 248      13.328 -15.550   3.746  1.00  0.68           N  
ATOM   1914  CA  GLU A 248      13.790 -16.897   3.441  1.00  0.68           C  
ATOM   1915  C   GLU A 248      13.000 -17.958   4.191  1.00  0.68           C  
ATOM   1916  O   GLU A 248      12.608 -19.002   3.662  1.00  0.68           O  
ATOM   1917  CB  GLU A 248      15.289 -17.023   3.785  1.00  0.68           C  
ATOM   1918  CG  GLU A 248      16.195 -16.212   2.828  1.00  0.68           C  
ATOM   1919  CD  GLU A 248      17.657 -16.173   3.273  1.00  0.68           C  
ATOM   1920  OE1 GLU A 248      18.484 -15.710   2.445  1.00  0.68           O  
ATOM   1921  OE2 GLU A 248      17.956 -16.592   4.422  1.00  0.68           O  
ATOM   1922  N   ARG A 249      12.688 -17.675   5.466  1.00  0.61           N  
ATOM   1923  CA  ARG A 249      11.782 -18.474   6.254  1.00  0.61           C  
ATOM   1924  C   ARG A 249      10.360 -18.535   5.697  1.00  0.61           C  
ATOM   1925  O   ARG A 249       9.788 -19.612   5.560  1.00  0.61           O  
ATOM   1926  CB  ARG A 249      11.771 -17.916   7.691  1.00  0.61           C  
ATOM   1927  CG  ARG A 249      10.921 -18.758   8.647  1.00  0.61           C  
ATOM   1928  CD  ARG A 249      11.016 -18.325  10.105  1.00  0.61           C  
ATOM   1929  NE  ARG A 249      10.106 -19.274  10.794  1.00  0.61           N  
ATOM   1930  CZ  ARG A 249       9.900 -19.363  12.109  1.00  0.61           C  
ATOM   1931  NH1 ARG A 249      10.521 -18.575  12.977  1.00  0.61           N  
ATOM   1932  NH2 ARG A 249       9.025 -20.274  12.517  1.00  0.61           N  
ATOM   1933  N   CYS A 250       9.763 -17.394   5.296  1.00  0.66           N  
ATOM   1934  CA  CYS A 250       8.445 -17.362   4.674  1.00  0.66           C  
ATOM   1935  C   CYS A 250       8.365 -18.081   3.338  1.00  0.66           C  
ATOM   1936  O   CYS A 250       7.378 -18.751   3.052  1.00  0.66           O  
ATOM   1937  CB  CYS A 250       7.929 -15.933   4.442  1.00  0.66           C  
ATOM   1938  SG  CYS A 250       7.593 -15.010   5.963  1.00  0.66           S  
ATOM   1939  N   LEU A 251       9.418 -17.996   2.496  1.00  0.64           N  
ATOM   1940  CA  LEU A 251       9.546 -18.801   1.289  1.00  0.64           C  
ATOM   1941  C   LEU A 251       9.506 -20.291   1.569  1.00  0.64           C  
ATOM   1942  O   LEU A 251       8.905 -21.060   0.834  1.00  0.64           O  
ATOM   1943  CB  LEU A 251      10.907 -18.544   0.596  1.00  0.64           C  
ATOM   1944  CG  LEU A 251      10.916 -17.411  -0.433  1.00  0.64           C  
ATOM   1945  CD1 LEU A 251      12.366 -17.167  -0.864  1.00  0.64           C  
ATOM   1946  CD2 LEU A 251      10.049 -17.760  -1.651  1.00  0.64           C  
ATOM   1947  N   THR A 252      10.172 -20.727   2.650  1.00  0.63           N  
ATOM   1948  CA  THR A 252      10.155 -22.117   3.090  1.00  0.63           C  
ATOM   1949  C   THR A 252       8.782 -22.553   3.586  1.00  0.63           C  
ATOM   1950  O   THR A 252       8.293 -23.627   3.247  1.00  0.63           O  
ATOM   1951  CB  THR A 252      11.192 -22.371   4.180  1.00  0.63           C  
ATOM   1952  OG1 THR A 252      12.492 -21.986   3.738  1.00  0.63           O  
ATOM   1953  CG2 THR A 252      11.277 -23.866   4.525  1.00  0.63           C  
ATOM   1954  N   GLU A 253       8.118 -21.712   4.407  1.00  0.61           N  
ATOM   1955  CA  GLU A 253       6.806 -21.979   4.976  1.00  0.61           C  
ATOM   1956  C   GLU A 253       5.624 -21.888   3.995  1.00  0.61           C  
ATOM   1957  O   GLU A 253       4.753 -22.756   3.997  1.00  0.61           O  
ATOM   1958  CB  GLU A 253       6.601 -21.107   6.248  1.00  0.61           C  
ATOM   1959  CG  GLU A 253       7.610 -21.453   7.389  1.00  0.61           C  
ATOM   1960  CD  GLU A 253       7.444 -20.626   8.657  1.00  0.61           C  
ATOM   1961  OE1 GLU A 253       8.254 -20.789   9.614  1.00  0.61           O  
ATOM   1962  OE2 GLU A 253       6.519 -19.777   8.726  1.00  0.61           O  
ATOM   1963  N   GLU A 254       5.560 -20.873   3.102  1.00  0.51           N  
ATOM   1964  CA  GLU A 254       4.510 -20.757   2.089  1.00  0.51           C  
ATOM   1965  C   GLU A 254       5.090 -20.715   0.655  1.00  0.51           C  
ATOM   1966  O   GLU A 254       5.007 -19.668   0.008  1.00  0.51           O  
ATOM   1967  CB  GLU A 254       3.613 -19.497   2.321  1.00  0.51           C  
ATOM   1968  CG  GLU A 254       2.756 -19.478   3.621  1.00  0.51           C  
ATOM   1969  CD  GLU A 254       1.805 -18.279   3.696  1.00  0.51           C  
ATOM   1970  OE1 GLU A 254       0.644 -18.434   4.164  1.00  0.51           O  
ATOM   1971  OE2 GLU A 254       2.197 -17.153   3.286  1.00  0.51           O  
ATOM   1972  N   PRO A 255       5.662 -21.775   0.057  1.00  0.65           N  
ATOM   1973  CA  PRO A 255       6.501 -21.656  -1.143  1.00  0.65           C  
ATOM   1974  C   PRO A 255       5.717 -21.468  -2.423  1.00  0.65           C  
ATOM   1975  O   PRO A 255       6.305 -21.087  -3.434  1.00  0.65           O  
ATOM   1976  CB  PRO A 255       7.263 -22.995  -1.198  1.00  0.65           C  
ATOM   1977  CG  PRO A 255       6.359 -23.973  -0.446  1.00  0.65           C  
ATOM   1978  CD  PRO A 255       5.794 -23.096   0.671  1.00  0.65           C  
ATOM   1979  N   SER A 256       4.404 -21.754  -2.432  1.00  0.56           N  
ATOM   1980  CA  SER A 256       3.546 -21.535  -3.586  1.00  0.56           C  
ATOM   1981  C   SER A 256       2.788 -20.236  -3.450  1.00  0.56           C  
ATOM   1982  O   SER A 256       2.029 -19.863  -4.336  1.00  0.56           O  
ATOM   1983  CB  SER A 256       2.502 -22.666  -3.779  1.00  0.56           C  
ATOM   1984  OG  SER A 256       1.780 -22.919  -2.570  1.00  0.56           O  
ATOM   1985  N   ASN A 257       3.004 -19.477  -2.356  1.00  0.51           N  
ATOM   1986  CA  ASN A 257       2.443 -18.153  -2.220  1.00  0.51           C  
ATOM   1987  C   ASN A 257       3.378 -17.186  -2.948  1.00  0.51           C  
ATOM   1988  O   ASN A 257       4.525 -17.000  -2.521  1.00  0.51           O  
ATOM   1989  CB  ASN A 257       2.291 -17.774  -0.722  1.00  0.51           C  
ATOM   1990  CG  ASN A 257       1.663 -16.400  -0.512  1.00  0.51           C  
ATOM   1991  OD1 ASN A 257       1.345 -15.671  -1.453  1.00  0.51           O  
ATOM   1992  ND2 ASN A 257       1.504 -16.001   0.767  1.00  0.51           N  
ATOM   1993  N   PRO A 258       2.977 -16.522  -4.025  1.00  0.50           N  
ATOM   1994  CA  PRO A 258       3.880 -15.667  -4.766  1.00  0.50           C  
ATOM   1995  C   PRO A 258       4.167 -14.389  -4.019  1.00  0.50           C  
ATOM   1996  O   PRO A 258       5.120 -13.717  -4.394  1.00  0.50           O  
ATOM   1997  CB  PRO A 258       3.146 -15.406  -6.072  1.00  0.50           C  
ATOM   1998  CG  PRO A 258       1.666 -15.515  -5.699  1.00  0.50           C  
ATOM   1999  CD  PRO A 258       1.663 -16.632  -4.667  1.00  0.50           C  
ATOM   2000  N   LYS A 259       3.436 -14.069  -2.925  1.00  0.46           N  
ATOM   2001  CA  LYS A 259       3.739 -12.958  -2.042  1.00  0.46           C  
ATOM   2002  C   LYS A 259       5.135 -13.058  -1.435  1.00  0.46           C  
ATOM   2003  O   LYS A 259       5.745 -12.030  -1.161  1.00  0.46           O  
ATOM   2004  CB  LYS A 259       2.680 -12.787  -0.914  1.00  0.46           C  
ATOM   2005  CG  LYS A 259       2.892 -11.542  -0.031  1.00  0.46           C  
ATOM   2006  CD  LYS A 259       1.848 -11.387   1.088  1.00  0.46           C  
ATOM   2007  CE  LYS A 259       2.288 -10.347   2.128  1.00  0.46           C  
ATOM   2008  NZ  LYS A 259       1.253 -10.085   3.145  1.00  0.46           N  
ATOM   2009  N   TRP A 260       5.698 -14.277  -1.237  1.00  0.48           N  
ATOM   2010  CA  TRP A 260       7.051 -14.432  -0.707  1.00  0.48           C  
ATOM   2011  C   TRP A 260       8.103 -14.728  -1.747  1.00  0.48           C  
ATOM   2012  O   TRP A 260       9.280 -14.491  -1.508  1.00  0.48           O  
ATOM   2013  CB  TRP A 260       7.147 -15.526   0.364  1.00  0.48           C  
ATOM   2014  CG  TRP A 260       6.115 -15.314   1.430  1.00  0.48           C  
ATOM   2015  CD1 TRP A 260       4.989 -16.047   1.613  1.00  0.48           C  
ATOM   2016  CD2 TRP A 260       6.080 -14.249   2.399  1.00  0.48           C  
ATOM   2017  NE1 TRP A 260       4.245 -15.524   2.637  1.00  0.48           N  
ATOM   2018  CE2 TRP A 260       4.888 -14.416   3.131  1.00  0.48           C  
ATOM   2019  CE3 TRP A 260       6.978 -13.228   2.705  1.00  0.48           C  
ATOM   2020  CZ2 TRP A 260       4.560 -13.551   4.163  1.00  0.48           C  
ATOM   2021  CZ3 TRP A 260       6.655 -12.366   3.767  1.00  0.48           C  
ATOM   2022  CH2 TRP A 260       5.457 -12.521   4.480  1.00  0.48           C  
ATOM   2023  N   HIS A 261       7.737 -15.173  -2.967  1.00  0.49           N  
ATOM   2024  CA  HIS A 261       8.655 -15.069  -4.101  1.00  0.49           C  
ATOM   2025  C   HIS A 261       8.851 -13.631  -4.470  1.00  0.49           C  
ATOM   2026  O   HIS A 261       9.963 -13.177  -4.716  1.00  0.49           O  
ATOM   2027  CB  HIS A 261       8.195 -15.795  -5.366  1.00  0.49           C  
ATOM   2028  CG  HIS A 261       8.365 -17.249  -5.201  1.00  0.49           C  
ATOM   2029  ND1 HIS A 261       9.639 -17.792  -5.182  1.00  0.49           N  
ATOM   2030  CD2 HIS A 261       7.429 -18.195  -4.964  1.00  0.49           C  
ATOM   2031  CE1 HIS A 261       9.441 -19.075  -4.938  1.00  0.49           C  
ATOM   2032  NE2 HIS A 261       8.124 -19.367  -4.795  1.00  0.49           N  
ATOM   2033  N   PHE A 262       7.742 -12.870  -4.453  1.00  0.39           N  
ATOM   2034  CA  PHE A 262       7.785 -11.434  -4.457  1.00  0.39           C  
ATOM   2035  C   PHE A 262       8.508 -10.837  -3.260  1.00  0.39           C  
ATOM   2036  O   PHE A 262       9.523 -10.205  -3.455  1.00  0.39           O  
ATOM   2037  CB  PHE A 262       6.379 -10.833  -4.570  1.00  0.39           C  
ATOM   2038  CG  PHE A 262       6.515  -9.432  -5.048  1.00  0.39           C  
ATOM   2039  CD1 PHE A 262       6.531  -8.379  -4.139  1.00  0.39           C  
ATOM   2040  CD2 PHE A 262       6.689  -9.158  -6.401  1.00  0.39           C  
ATOM   2041  CE1 PHE A 262       6.484  -7.055  -4.582  1.00  0.39           C  
ATOM   2042  CE2 PHE A 262       6.788  -7.838  -6.843  1.00  0.39           C  
ATOM   2043  CZ  PHE A 262       6.616  -6.781  -5.943  1.00  0.39           C  
ATOM   2044  N   TYR A 263       8.136 -11.075  -1.982  1.00  0.38           N  
ATOM   2045  CA  TYR A 263       8.940 -10.680  -0.834  1.00  0.38           C  
ATOM   2046  C   TYR A 263      10.306 -11.340  -0.749  1.00  0.38           C  
ATOM   2047  O   TYR A 263      10.941 -11.221   0.271  1.00  0.38           O  
ATOM   2048  CB  TYR A 263       8.190 -10.788   0.542  1.00  0.38           C  
ATOM   2049  CG  TYR A 263       7.428  -9.560   0.991  1.00  0.38           C  
ATOM   2050  CD1 TYR A 263       7.921  -8.255   0.816  1.00  0.38           C  
ATOM   2051  CD2 TYR A 263       6.218  -9.715   1.696  1.00  0.38           C  
ATOM   2052  CE1 TYR A 263       7.176  -7.142   1.222  1.00  0.38           C  
ATOM   2053  CE2 TYR A 263       5.506  -8.602   2.159  1.00  0.38           C  
ATOM   2054  CZ  TYR A 263       5.949  -7.316   1.851  1.00  0.38           C  
ATOM   2055  OH  TYR A 263       5.136  -6.196   2.107  1.00  0.38           O  
ATOM   2056  N   ALA A 264      10.862 -11.940  -1.814  1.00  0.56           N  
ATOM   2057  CA  ALA A 264      12.241 -12.345  -1.853  1.00  0.56           C  
ATOM   2058  C   ALA A 264      13.013 -11.664  -2.953  1.00  0.56           C  
ATOM   2059  O   ALA A 264      13.905 -12.290  -3.504  1.00  0.56           O  
ATOM   2060  CB  ALA A 264      12.323 -13.867  -1.952  1.00  0.56           C  
ATOM   2061  N   VAL A 265      12.672 -10.393  -3.320  1.00  0.49           N  
ATOM   2062  CA  VAL A 265      13.335  -9.533  -4.326  1.00  0.49           C  
ATOM   2063  C   VAL A 265      13.815  -7.986  -4.073  1.00  0.49           C  
ATOM   2064  O   VAL A 265      14.558  -7.461  -4.886  1.00  0.49           O  
ATOM   2065  CB  VAL A 265      12.388  -9.751  -5.495  1.00  0.49           C  
ATOM   2066  CG1 VAL A 265      12.491  -8.655  -6.525  1.00  0.49           C  
ATOM   2067  CG2 VAL A 265      12.582 -11.165  -6.061  1.00  0.49           C  
ATOM   2068  N   ARG A 266      13.521  -7.217  -2.947  1.00  0.38           N  
ATOM   2069  CA  ARG A 266      13.747  -5.752  -2.678  1.00  0.38           C  
ATOM   2070  C   ARG A 266      14.539  -5.468  -1.424  1.00  0.38           C  
ATOM   2071  O   ARG A 266      15.376  -4.589  -1.427  1.00  0.38           O  
ATOM   2072  CB  ARG A 266      12.503  -4.753  -2.538  1.00  0.38           C  
ATOM   2073  CG  ARG A 266      12.626  -3.344  -1.845  1.00  0.38           C  
ATOM   2074  CD  ARG A 266      11.534  -2.810  -0.865  1.00  0.38           C  
ATOM   2075  NE  ARG A 266      11.281  -3.754   0.259  1.00  0.38           N  
ATOM   2076  CZ  ARG A 266      10.119  -3.905   0.906  1.00  0.38           C  
ATOM   2077  NH1 ARG A 266       9.073  -3.106   0.705  1.00  0.38           N  
ATOM   2078  NH2 ARG A 266      10.006  -4.880   1.802  1.00  0.38           N  
ATOM   2079  N   ASP A 267      14.348  -6.136  -0.281  1.00  0.44           N  
ATOM   2080  CA  ASP A 267      14.976  -5.737   0.980  1.00  0.44           C  
ATOM   2081  C   ASP A 267      16.502  -5.894   1.019  1.00  0.44           C  
ATOM   2082  O   ASP A 267      17.175  -5.358   1.893  1.00  0.44           O  
ATOM   2083  CB  ASP A 267      14.295  -6.457   2.184  1.00  0.44           C  
ATOM   2084  CG  ASP A 267      12.921  -5.870   2.406  1.00  0.44           C  
ATOM   2085  OD1 ASP A 267      12.808  -4.626   2.265  1.00  0.44           O  
ATOM   2086  OD2 ASP A 267      11.939  -6.603   2.677  1.00  0.44           O  
ATOM   2087  N   GLY A 268      17.106  -6.563   0.014  1.00  0.38           N  
ATOM   2088  CA  GLY A 268      18.526  -6.432  -0.302  1.00  0.38           C  
ATOM   2089  C   GLY A 268      18.906  -5.296  -1.241  1.00  0.38           C  
ATOM   2090  O   GLY A 268      20.071  -4.910  -1.302  1.00  0.38           O  
ATOM   2091  N   LEU A 269      17.957  -4.735  -2.024  1.00  0.30           N  
ATOM   2092  CA  LEU A 269      18.103  -3.518  -2.798  1.00  0.30           C  
ATOM   2093  C   LEU A 269      18.224  -2.273  -1.964  1.00  0.30           C  
ATOM   2094  O   LEU A 269      18.934  -1.353  -2.368  1.00  0.30           O  
ATOM   2095  CB  LEU A 269      16.932  -3.234  -3.797  1.00  0.30           C  
ATOM   2096  CG  LEU A 269      17.044  -3.791  -5.222  1.00  0.30           C  
ATOM   2097  CD1 LEU A 269      15.728  -4.436  -5.682  1.00  0.30           C  
ATOM   2098  CD2 LEU A 269      17.411  -2.672  -6.197  1.00  0.30           C  
ATOM   2099  N   VAL A 270      17.487  -2.191  -0.838  1.00  0.28           N  
ATOM   2100  CA  VAL A 270      17.375  -1.000  -0.005  1.00  0.28           C  
ATOM   2101  C   VAL A 270      18.736  -0.365   0.283  1.00  0.28           C  
ATOM   2102  O   VAL A 270      19.591  -0.943   0.942  1.00  0.28           O  
ATOM   2103  CB  VAL A 270      16.591  -1.265   1.285  1.00  0.28           C  
ATOM   2104  CG1 VAL A 270      16.446   0.025   2.121  1.00  0.28           C  
ATOM   2105  CG2 VAL A 270      15.183  -1.785   0.927  1.00  0.28           C  
ATOM   2106  N   GLY A 271      18.987   0.849  -0.256  1.00  0.24           N  
ATOM   2107  CA  GLY A 271      20.271   1.544  -0.165  1.00  0.24           C  
ATOM   2108  C   GLY A 271      21.540   0.830  -0.612  1.00  0.24           C  
ATOM   2109  O   GLY A 271      22.474   0.711   0.177  1.00  0.24           O  
ATOM   2110  N   ARG A 272      21.593   0.379  -1.887  1.00  0.23           N  
ATOM   2111  CA  ARG A 272      22.806   0.168  -2.683  1.00  0.23           C  
ATOM   2112  C   ARG A 272      22.402   0.130  -4.170  1.00  0.23           C  
ATOM   2113  O   ARG A 272      21.223   0.272  -4.462  1.00  0.23           O  
ATOM   2114  CB  ARG A 272      23.742  -1.001  -2.236  1.00  0.23           C  
ATOM   2115  CG  ARG A 272      23.158  -2.421  -2.018  1.00  0.23           C  
ATOM   2116  CD  ARG A 272      24.253  -3.486  -2.273  1.00  0.23           C  
ATOM   2117  NE  ARG A 272      23.686  -4.874  -2.403  1.00  0.23           N  
ATOM   2118  CZ  ARG A 272      24.172  -5.832  -3.217  1.00  0.23           C  
ATOM   2119  NH1 ARG A 272      24.988  -5.584  -4.240  1.00  0.23           N  
ATOM   2120  NH2 ARG A 272      23.807  -7.099  -3.032  1.00  0.23           N  
ATOM   2121  N   LYS A 273      23.297  -0.039  -5.186  1.00  0.28           N  
ATOM   2122  CA  LYS A 273      22.913  -0.010  -6.613  1.00  0.28           C  
ATOM   2123  C   LYS A 273      23.264  -1.327  -7.361  1.00  0.28           C  
ATOM   2124  O   LYS A 273      24.314  -1.860  -7.001  1.00  0.28           O  
ATOM   2125  CB  LYS A 273      23.655   1.141  -7.343  1.00  0.28           C  
ATOM   2126  CG  LYS A 273      23.431   2.558  -6.800  1.00  0.28           C  
ATOM   2127  CD  LYS A 273      23.551   3.600  -7.933  1.00  0.28           C  
ATOM   2128  CE  LYS A 273      23.136   5.022  -7.548  1.00  0.28           C  
ATOM   2129  NZ  LYS A 273      23.072   5.862  -8.766  1.00  0.28           N  
ATOM   2130  N   PRO A 274      22.513  -1.933  -8.320  1.00  0.33           N  
ATOM   2131  CA  PRO A 274      22.987  -3.143  -9.027  1.00  0.33           C  
ATOM   2132  C   PRO A 274      22.836  -3.096 -10.573  1.00  0.33           C  
ATOM   2133  O   PRO A 274      21.952  -2.432 -11.092  1.00  0.33           O  
ATOM   2134  CB  PRO A 274      22.040  -4.159  -8.408  1.00  0.33           C  
ATOM   2135  CG  PRO A 274      20.681  -3.463  -8.425  1.00  0.33           C  
ATOM   2136  CD  PRO A 274      21.045  -1.996  -8.204  1.00  0.33           C  
ATOM   2137  N   GLY A 275      23.727  -3.746 -11.362  1.00  0.32           N  
ATOM   2138  CA  GLY A 275      23.952  -3.440 -12.786  1.00  0.32           C  
ATOM   2139  C   GLY A 275      23.146  -4.161 -13.881  1.00  0.32           C  
ATOM   2140  O   GLY A 275      21.914  -4.204 -13.849  1.00  0.32           O  
ATOM   2141  N   PRO A 276      23.788  -4.709 -14.926  1.00  0.27           N  
ATOM   2142  CA  PRO A 276      23.075  -5.426 -15.994  1.00  0.27           C  
ATOM   2143  C   PRO A 276      22.834  -6.913 -15.775  1.00  0.27           C  
ATOM   2144  O   PRO A 276      21.742  -7.375 -16.079  1.00  0.27           O  
ATOM   2145  CB  PRO A 276      23.971  -5.248 -17.239  1.00  0.27           C  
ATOM   2146  CG  PRO A 276      24.767  -3.982 -16.941  1.00  0.27           C  
ATOM   2147  CD  PRO A 276      25.026  -4.121 -15.447  1.00  0.27           C  
ATOM   2148  N   ASP A 277      23.836  -7.699 -15.344  1.00  0.42           N  
ATOM   2149  CA  ASP A 277      23.831  -9.141 -15.557  1.00  0.42           C  
ATOM   2150  C   ASP A 277      23.070 -10.007 -14.538  1.00  0.42           C  
ATOM   2151  O   ASP A 277      22.313 -10.895 -14.932  1.00  0.42           O  
ATOM   2152  CB  ASP A 277      25.297  -9.605 -15.704  1.00  0.42           C  
ATOM   2153  CG  ASP A 277      25.985  -8.697 -16.711  1.00  0.42           C  
ATOM   2154  OD1 ASP A 277      25.946  -9.014 -17.921  1.00  0.42           O  
ATOM   2155  OD2 ASP A 277      26.476  -7.627 -16.256  1.00  0.42           O  
ATOM   2156  N   GLU A 278      23.198  -9.745 -13.205  1.00  0.42           N  
ATOM   2157  CA  GLU A 278      22.531 -10.454 -12.088  1.00  0.42           C  
ATOM   2158  C   GLU A 278      21.018 -10.411 -12.235  1.00  0.42           C  
ATOM   2159  O   GLU A 278      20.272 -11.330 -11.942  1.00  0.42           O  
ATOM   2160  CB  GLU A 278      22.968  -9.872 -10.718  1.00  0.42           C  
ATOM   2161  CG  GLU A 278      22.377 -10.539  -9.445  1.00  0.42           C  
ATOM   2162  CD  GLU A 278      22.607  -9.704  -8.176  1.00  0.42           C  
ATOM   2163  OE1 GLU A 278      21.650  -9.527  -7.368  1.00  0.42           O  
ATOM   2164  OE2 GLU A 278      23.746  -9.206  -8.003  1.00  0.42           O  
ATOM   2165  N   ALA A 279      20.564  -9.326 -12.856  1.00  0.42           N  
ATOM   2166  CA  ALA A 279      19.258  -9.156 -13.399  1.00  0.42           C  
ATOM   2167  C   ALA A 279      18.720 -10.127 -14.404  1.00  0.42           C  
ATOM   2168  O   ALA A 279      17.543 -10.407 -14.402  1.00  0.42           O  
ATOM   2169  CB  ALA A 279      19.190  -7.828 -14.152  1.00  0.42           C  
ATOM   2170  N   LEU A 280      19.499 -10.635 -15.362  1.00  0.42           N  
ATOM   2171  CA  LEU A 280      18.942 -11.544 -16.316  1.00  0.42           C  
ATOM   2172  C   LEU A 280      18.714 -12.929 -15.744  1.00  0.42           C  
ATOM   2173  O   LEU A 280      17.850 -13.671 -16.204  1.00  0.42           O  
ATOM   2174  CB  LEU A 280      19.931 -11.557 -17.479  1.00  0.42           C  
ATOM   2175  CG  LEU A 280      19.438 -12.325 -18.705  1.00  0.42           C  
ATOM   2176  CD1 LEU A 280      18.101 -11.802 -19.242  1.00  0.42           C  
ATOM   2177  CD2 LEU A 280      20.456 -12.269 -19.842  1.00  0.42           C  
ATOM   2178  N   ALA A 281      19.445 -13.292 -14.679  1.00  0.51           N  
ATOM   2179  CA  ALA A 281      19.078 -14.427 -13.869  1.00  0.51           C  
ATOM   2180  C   ALA A 281      17.856 -14.189 -12.987  1.00  0.51           C  
ATOM   2181  O   ALA A 281      16.915 -14.977 -12.975  1.00  0.51           O  
ATOM   2182  CB  ALA A 281      20.254 -14.794 -12.954  1.00  0.51           C  
ATOM   2183  N   LEU A 282      17.833 -13.074 -12.233  1.00  0.46           N  
ATOM   2184  CA  LEU A 282      16.766 -12.813 -11.287  1.00  0.46           C  
ATOM   2185  C   LEU A 282      15.448 -12.356 -11.885  1.00  0.46           C  
ATOM   2186  O   LEU A 282      14.401 -12.688 -11.344  1.00  0.46           O  
ATOM   2187  CB  LEU A 282      17.234 -11.856 -10.178  1.00  0.46           C  
ATOM   2188  CG  LEU A 282      18.427 -12.401  -9.362  1.00  0.46           C  
ATOM   2189  CD1 LEU A 282      18.852 -11.413  -8.278  1.00  0.46           C  
ATOM   2190  CD2 LEU A 282      18.180 -13.751  -8.676  1.00  0.46           C  
ATOM   2191  N   PHE A 283      15.404 -11.656 -13.037  1.00  0.38           N  
ATOM   2192  CA  PHE A 283      14.147 -11.305 -13.693  1.00  0.38           C  
ATOM   2193  C   PHE A 283      13.286 -12.507 -14.035  1.00  0.38           C  
ATOM   2194  O   PHE A 283      12.072 -12.511 -13.835  1.00  0.38           O  
ATOM   2195  CB  PHE A 283      14.432 -10.485 -14.986  1.00  0.38           C  
ATOM   2196  CG  PHE A 283      13.230 -10.274 -15.891  1.00  0.38           C  
ATOM   2197  CD1 PHE A 283      13.176 -10.923 -17.138  1.00  0.38           C  
ATOM   2198  CD2 PHE A 283      12.142  -9.471 -15.503  1.00  0.38           C  
ATOM   2199  CE1 PHE A 283      12.078 -10.762 -17.990  1.00  0.38           C  
ATOM   2200  CE2 PHE A 283      11.035  -9.310 -16.351  1.00  0.38           C  
ATOM   2201  CZ  PHE A 283      11.001  -9.963 -17.589  1.00  0.38           C  
ATOM   2202  N   ARG A 284      13.923 -13.578 -14.531  1.00  0.47           N  
ATOM   2203  CA  ARG A 284      13.259 -14.799 -14.916  1.00  0.47           C  
ATOM   2204  C   ARG A 284      12.519 -15.436 -13.751  1.00  0.47           C  
ATOM   2205  O   ARG A 284      11.391 -15.878 -13.915  1.00  0.47           O  
ATOM   2206  CB  ARG A 284      14.300 -15.745 -15.545  1.00  0.47           C  
ATOM   2207  CG  ARG A 284      14.810 -15.204 -16.898  1.00  0.47           C  
ATOM   2208  CD  ARG A 284      15.977 -16.012 -17.464  1.00  0.47           C  
ATOM   2209  NE  ARG A 284      16.265 -15.450 -18.827  1.00  0.47           N  
ATOM   2210  CZ  ARG A 284      17.441 -15.564 -19.459  1.00  0.47           C  
ATOM   2211  NH1 ARG A 284      18.513 -16.066 -18.856  1.00  0.47           N  
ATOM   2212  NH2 ARG A 284      17.534 -15.179 -20.730  1.00  0.47           N  
ATOM   2213  N   ARG A 285      13.100 -15.376 -12.537  1.00  0.55           N  
ATOM   2214  CA  ARG A 285      12.528 -15.892 -11.306  1.00  0.55           C  
ATOM   2215  C   ARG A 285      11.159 -15.312 -10.937  1.00  0.55           C  
ATOM   2216  O   ARG A 285      10.266 -16.030 -10.496  1.00  0.55           O  
ATOM   2217  CB  ARG A 285      13.534 -15.627 -10.154  1.00  0.55           C  
ATOM   2218  CG  ARG A 285      13.110 -16.176  -8.780  1.00  0.55           C  
ATOM   2219  CD  ARG A 285      14.114 -15.846  -7.675  1.00  0.55           C  
ATOM   2220  NE  ARG A 285      13.478 -16.301  -6.403  1.00  0.55           N  
ATOM   2221  CZ  ARG A 285      13.970 -16.078  -5.180  1.00  0.55           C  
ATOM   2222  NH1 ARG A 285      15.175 -15.548  -4.989  1.00  0.55           N  
ATOM   2223  NH2 ARG A 285      13.219 -16.391  -4.129  1.00  0.55           N  
ATOM   2224  N   LEU A 286      10.918 -13.995 -11.110  1.00  0.46           N  
ATOM   2225  CA  LEU A 286       9.595 -13.448 -10.849  1.00  0.46           C  
ATOM   2226  C   LEU A 286       8.749 -13.377 -12.100  1.00  0.46           C  
ATOM   2227  O   LEU A 286       7.530 -13.290 -12.026  1.00  0.46           O  
ATOM   2228  CB  LEU A 286       9.687 -12.053 -10.218  1.00  0.46           C  
ATOM   2229  CG  LEU A 286       8.405 -11.530  -9.535  1.00  0.46           C  
ATOM   2230  CD1 LEU A 286       8.142 -12.190  -8.172  1.00  0.46           C  
ATOM   2231  CD2 LEU A 286       8.461 -10.004  -9.388  1.00  0.46           C  
ATOM   2232  N   ARG A 287       9.327 -13.501 -13.311  1.00  0.42           N  
ATOM   2233  CA  ARG A 287       8.503 -13.774 -14.477  1.00  0.42           C  
ATOM   2234  C   ARG A 287       7.853 -15.157 -14.396  1.00  0.42           C  
ATOM   2235  O   ARG A 287       6.666 -15.321 -14.675  1.00  0.42           O  
ATOM   2236  CB  ARG A 287       9.254 -13.571 -15.824  1.00  0.42           C  
ATOM   2237  CG  ARG A 287       8.324 -13.559 -17.068  1.00  0.42           C  
ATOM   2238  CD  ARG A 287       7.232 -12.484 -16.972  1.00  0.42           C  
ATOM   2239  NE  ARG A 287       6.241 -12.608 -18.090  1.00  0.42           N  
ATOM   2240  CZ  ARG A 287       4.949 -12.279 -17.923  1.00  0.42           C  
ATOM   2241  NH1 ARG A 287       4.509 -11.741 -16.787  1.00  0.42           N  
ATOM   2242  NH2 ARG A 287       4.079 -12.489 -18.909  1.00  0.42           N  
ATOM   2243  N   GLU A 288       8.629 -16.155 -13.934  1.00  0.59           N  
ATOM   2244  CA  GLU A 288       8.196 -17.477 -13.524  1.00  0.59           C  
ATOM   2245  C   GLU A 288       7.230 -17.460 -12.342  1.00  0.59           C  
ATOM   2246  O   GLU A 288       6.127 -18.000 -12.409  1.00  0.59           O  
ATOM   2247  CB  GLU A 288       9.481 -18.242 -13.135  1.00  0.59           C  
ATOM   2248  CG  GLU A 288       9.329 -19.713 -12.691  1.00  0.59           C  
ATOM   2249  CD  GLU A 288      10.677 -20.306 -12.267  1.00  0.59           C  
ATOM   2250  OE1 GLU A 288      10.709 -21.540 -12.036  1.00  0.59           O  
ATOM   2251  OE2 GLU A 288      11.673 -19.540 -12.164  1.00  0.59           O  
ATOM   2252  N   ALA A 289       7.563 -16.750 -11.241  1.00  0.55           N  
ATOM   2253  CA  ALA A 289       6.711 -16.692 -10.066  1.00  0.55           C  
ATOM   2254  C   ALA A 289       5.473 -15.817 -10.235  1.00  0.55           C  
ATOM   2255  O   ALA A 289       4.516 -15.927  -9.474  1.00  0.55           O  
ATOM   2256  CB  ALA A 289       7.511 -16.234  -8.834  1.00  0.55           C  
ATOM   2257  N   HIS A 290       5.423 -14.958 -11.276  1.00  0.40           N  
ATOM   2258  CA  HIS A 290       4.216 -14.263 -11.686  1.00  0.40           C  
ATOM   2259  C   HIS A 290       3.112 -15.219 -12.103  1.00  0.40           C  
ATOM   2260  O   HIS A 290       1.941 -14.984 -11.833  1.00  0.40           O  
ATOM   2261  CB  HIS A 290       4.430 -13.264 -12.846  1.00  0.40           C  
ATOM   2262  CG  HIS A 290       3.194 -12.445 -13.074  1.00  0.40           C  
ATOM   2263  ND1 HIS A 290       2.953 -11.349 -12.267  1.00  0.40           N  
ATOM   2264  CD2 HIS A 290       2.081 -12.762 -13.782  1.00  0.40           C  
ATOM   2265  CE1 HIS A 290       1.693 -11.025 -12.498  1.00  0.40           C  
ATOM   2266  NE2 HIS A 290       1.121 -11.849 -13.408  1.00  0.40           N  
ATOM   2267  N   ALA A 291       3.467 -16.352 -12.741  1.00  0.46           N  
ATOM   2268  CA  ALA A 291       2.512 -17.325 -13.238  1.00  0.46           C  
ATOM   2269  C   ALA A 291       1.694 -17.994 -12.132  1.00  0.46           C  
ATOM   2270  O   ALA A 291       0.588 -18.472 -12.357  1.00  0.46           O  
ATOM   2271  CB  ALA A 291       3.263 -18.389 -14.062  1.00  0.46           C  
ATOM   2272  N   LEU A 292       2.190 -17.951 -10.877  1.00  0.36           N  
ATOM   2273  CA  LEU A 292       1.473 -18.383  -9.691  1.00  0.36           C  
ATOM   2274  C   LEU A 292       0.254 -17.509  -9.375  1.00  0.36           C  
ATOM   2275  O   LEU A 292      -0.654 -17.917  -8.659  1.00  0.36           O  
ATOM   2276  CB  LEU A 292       2.405 -18.312  -8.457  1.00  0.36           C  
ATOM   2277  CG  LEU A 292       3.682 -19.176  -8.514  1.00  0.36           C  
ATOM   2278  CD1 LEU A 292       4.600 -18.841  -7.326  1.00  0.36           C  
ATOM   2279  CD2 LEU A 292       3.356 -20.673  -8.520  1.00  0.36           C  
ATOM   2280  N   TYR A 293       0.175 -16.272  -9.915  1.00  0.34           N  
ATOM   2281  CA  TYR A 293      -1.007 -15.430  -9.784  1.00  0.34           C  
ATOM   2282  C   TYR A 293      -2.104 -15.800 -10.757  1.00  0.34           C  
ATOM   2283  O   TYR A 293      -3.250 -15.384 -10.587  1.00  0.34           O  
ATOM   2284  CB  TYR A 293      -0.689 -13.939 -10.012  1.00  0.34           C  
ATOM   2285  CG  TYR A 293       0.093 -13.415  -8.854  1.00  0.34           C  
ATOM   2286  CD1 TYR A 293      -0.540 -13.078  -7.646  1.00  0.34           C  
ATOM   2287  CD2 TYR A 293       1.477 -13.262  -8.963  1.00  0.34           C  
ATOM   2288  CE1 TYR A 293       0.203 -12.530  -6.589  1.00  0.34           C  
ATOM   2289  CE2 TYR A 293       2.219 -12.763  -7.894  1.00  0.34           C  
ATOM   2290  CZ  TYR A 293       1.580 -12.337  -6.729  1.00  0.34           C  
ATOM   2291  OH  TYR A 293       2.323 -11.691  -5.722  1.00  0.34           O  
ATOM   2292  N   ASP A 294      -1.766 -16.607 -11.775  1.00  0.37           N  
ATOM   2293  CA  ASP A 294      -2.690 -17.097 -12.767  1.00  0.37           C  
ATOM   2294  C   ASP A 294      -3.126 -18.528 -12.395  1.00  0.37           C  
ATOM   2295  O   ASP A 294      -3.936 -19.161 -13.074  1.00  0.37           O  
ATOM   2296  CB  ASP A 294      -2.001 -17.042 -14.159  1.00  0.37           C  
ATOM   2297  CG  ASP A 294      -1.499 -15.634 -14.469  1.00  0.37           C  
ATOM   2298  OD1 ASP A 294      -2.330 -14.690 -14.467  1.00  0.37           O  
ATOM   2299  OD2 ASP A 294      -0.275 -15.484 -14.726  1.00  0.37           O  
ATOM   2300  N   GLU A 295      -2.623 -19.058 -11.254  1.00  0.33           N  
ATOM   2301  CA  GLU A 295      -2.979 -20.356 -10.707  1.00  0.33           C  
ATOM   2302  C   GLU A 295      -4.071 -20.253  -9.651  1.00  0.33           C  
ATOM   2303  O   GLU A 295      -3.861 -19.729  -8.561  1.00  0.33           O  
ATOM   2304  CB  GLU A 295      -1.775 -21.069 -10.035  1.00  0.33           C  
ATOM   2305  CG  GLU A 295      -0.664 -21.512 -11.017  1.00  0.33           C  
ATOM   2306  CD  GLU A 295       0.455 -22.315 -10.351  1.00  0.33           C  
ATOM   2307  OE1 GLU A 295       1.407 -22.681 -11.088  1.00  0.33           O  
ATOM   2308  OE2 GLU A 295       0.377 -22.579  -9.123  1.00  0.33           O  
ATOM   2309  N   ALA A 296      -5.261 -20.830  -9.954  1.00  0.27           N  
ATOM   2310  CA  ALA A 296      -6.418 -20.907  -9.071  1.00  0.27           C  
ATOM   2311  C   ALA A 296      -7.063 -19.562  -8.676  1.00  0.27           C  
ATOM   2312  O   ALA A 296      -6.489 -18.498  -8.905  1.00  0.27           O  
ATOM   2313  CB  ALA A 296      -6.049 -21.766  -7.834  1.00  0.27           C  
ATOM   2314  N   PRO A 297      -8.278 -19.475  -8.119  1.00  0.27           N  
ATOM   2315  CA  PRO A 297      -8.618 -18.348  -7.259  1.00  0.27           C  
ATOM   2316  C   PRO A 297      -7.692 -18.260  -6.048  1.00  0.27           C  
ATOM   2317  O   PRO A 297      -7.633 -19.189  -5.247  1.00  0.27           O  
ATOM   2318  CB  PRO A 297     -10.089 -18.597  -6.887  1.00  0.27           C  
ATOM   2319  CG  PRO A 297     -10.221 -20.123  -6.903  1.00  0.27           C  
ATOM   2320  CD  PRO A 297      -9.285 -20.541  -8.044  1.00  0.27           C  
ATOM   2321  N   LEU A 298      -6.995 -17.127  -5.890  1.00  0.32           N  
ATOM   2322  CA  LEU A 298      -6.161 -16.842  -4.744  1.00  0.32           C  
ATOM   2323  C   LEU A 298      -6.942 -16.016  -3.736  1.00  0.32           C  
ATOM   2324  O   LEU A 298      -7.912 -15.341  -4.078  1.00  0.32           O  
ATOM   2325  CB  LEU A 298      -4.933 -16.010  -5.184  1.00  0.32           C  
ATOM   2326  CG  LEU A 298      -3.881 -16.744  -6.037  1.00  0.32           C  
ATOM   2327  CD1 LEU A 298      -2.789 -15.752  -6.462  1.00  0.32           C  
ATOM   2328  CD2 LEU A 298      -3.240 -17.929  -5.301  1.00  0.32           C  
ATOM   2329  N   SER A 299      -6.524 -16.034  -2.455  1.00  0.28           N  
ATOM   2330  CA  SER A 299      -7.063 -15.150  -1.428  1.00  0.28           C  
ATOM   2331  C   SER A 299      -6.505 -13.745  -1.549  1.00  0.28           C  
ATOM   2332  O   SER A 299      -5.487 -13.519  -2.196  1.00  0.28           O  
ATOM   2333  CB  SER A 299      -6.774 -15.665   0.012  1.00  0.28           C  
ATOM   2334  OG  SER A 299      -5.382 -15.645   0.345  1.00  0.28           O  
ATOM   2335  N   ASP A 300      -7.117 -12.748  -0.887  1.00  0.29           N  
ATOM   2336  CA  ASP A 300      -6.644 -11.375  -0.907  1.00  0.29           C  
ATOM   2337  C   ASP A 300      -5.355 -11.161  -0.116  1.00  0.29           C  
ATOM   2338  O   ASP A 300      -4.819 -10.060  -0.094  1.00  0.29           O  
ATOM   2339  CB  ASP A 300      -7.661 -10.396  -0.291  1.00  0.29           C  
ATOM   2340  CG  ASP A 300      -9.057 -10.488  -0.868  1.00  0.29           C  
ATOM   2341  OD1 ASP A 300      -9.245 -11.048  -1.971  1.00  0.29           O  
ATOM   2342  OD2 ASP A 300      -9.962  -9.985  -0.152  1.00  0.29           O  
ATOM   2343  N   TYR A 301      -4.854 -12.187   0.597  1.00  0.23           N  
ATOM   2344  CA  TYR A 301      -3.521 -12.261   1.164  1.00  0.23           C  
ATOM   2345  C   TYR A 301      -2.490 -12.707   0.124  1.00  0.23           C  
ATOM   2346  O   TYR A 301      -1.390 -12.169   0.029  1.00  0.23           O  
ATOM   2347  CB  TYR A 301      -3.575 -13.224   2.378  1.00  0.23           C  
ATOM   2348  CG  TYR A 301      -2.227 -13.612   2.912  1.00  0.23           C  
ATOM   2349  CD1 TYR A 301      -1.731 -14.890   2.630  1.00  0.23           C  
ATOM   2350  CD2 TYR A 301      -1.453 -12.732   3.683  1.00  0.23           C  
ATOM   2351  CE1 TYR A 301      -0.503 -15.305   3.142  1.00  0.23           C  
ATOM   2352  CE2 TYR A 301      -0.230 -13.158   4.223  1.00  0.23           C  
ATOM   2353  CZ  TYR A 301       0.243 -14.446   3.946  1.00  0.23           C  
ATOM   2354  OH  TYR A 301       1.455 -14.903   4.481  1.00  0.23           O  
ATOM   2355  N   GLU A 302      -2.815 -13.719  -0.693  1.00  0.65           N  
ATOM   2356  CA  GLU A 302      -1.932 -14.201  -1.740  1.00  0.65           C  
ATOM   2357  C   GLU A 302      -1.945 -13.284  -2.955  1.00  0.65           C  
ATOM   2358  O   GLU A 302      -0.913 -12.902  -3.496  1.00  0.65           O  
ATOM   2359  CB  GLU A 302      -2.372 -15.624  -2.131  1.00  0.65           C  
ATOM   2360  CG  GLU A 302      -2.217 -16.629  -0.964  1.00  0.65           C  
ATOM   2361  CD  GLU A 302      -3.224 -17.772  -0.994  1.00  0.65           C  
ATOM   2362  OE1 GLU A 302      -2.821 -18.919  -0.691  1.00  0.65           O  
ATOM   2363  OE2 GLU A 302      -4.428 -17.481  -1.234  1.00  0.65           O  
ATOM   2364  N   ALA A 303      -3.146 -12.831  -3.364  1.00  0.66           N  
ATOM   2365  CA  ALA A 303      -3.370 -11.926  -4.469  1.00  0.66           C  
ATOM   2366  C   ALA A 303      -3.408 -10.487  -4.000  1.00  0.66           C  
ATOM   2367  O   ALA A 303      -3.622  -9.582  -4.807  1.00  0.66           O  
ATOM   2368  CB  ALA A 303      -4.708 -12.234  -5.164  1.00  0.66           C  
ATOM   2369  N   GLU A 304      -3.074 -10.259  -2.702  1.00  0.32           N  
ATOM   2370  CA  GLU A 304      -2.853  -8.981  -2.020  1.00  0.32           C  
ATOM   2371  C   GLU A 304      -2.039  -8.054  -2.867  1.00  0.32           C  
ATOM   2372  O   GLU A 304      -2.276  -6.851  -2.968  1.00  0.32           O  
ATOM   2373  CB  GLU A 304      -1.995  -9.232  -0.733  1.00  0.32           C  
ATOM   2374  CG  GLU A 304      -1.718  -8.030   0.213  1.00  0.32           C  
ATOM   2375  CD  GLU A 304      -0.714  -8.370   1.313  1.00  0.32           C  
ATOM   2376  OE1 GLU A 304       0.394  -7.775   1.360  1.00  0.32           O  
ATOM   2377  OE2 GLU A 304      -1.024  -9.231   2.177  1.00  0.32           O  
ATOM   2378  N   ARG A 305      -1.034  -8.693  -3.483  1.00  0.31           N  
ATOM   2379  CA  ARG A 305       0.063  -8.111  -4.173  1.00  0.31           C  
ATOM   2380  C   ARG A 305       0.278  -8.797  -5.526  1.00  0.31           C  
ATOM   2381  O   ARG A 305       1.394  -9.038  -5.982  1.00  0.31           O  
ATOM   2382  CB  ARG A 305       1.296  -8.191  -3.263  1.00  0.31           C  
ATOM   2383  CG  ARG A 305       1.138  -7.585  -1.854  1.00  0.31           C  
ATOM   2384  CD  ARG A 305       0.705  -6.124  -1.768  1.00  0.31           C  
ATOM   2385  NE  ARG A 305       0.918  -5.754  -0.336  1.00  0.31           N  
ATOM   2386  CZ  ARG A 305       0.392  -4.668   0.222  1.00  0.31           C  
ATOM   2387  NH1 ARG A 305       1.038  -4.107   1.233  1.00  0.31           N  
ATOM   2388  NH2 ARG A 305      -0.717  -4.119  -0.260  1.00  0.31           N  
ATOM   2389  N   CYS A 306      -0.825  -9.149  -6.233  1.00  0.32           N  
ATOM   2390  CA  CYS A 306      -0.805  -9.591  -7.636  1.00  0.32           C  
ATOM   2391  C   CYS A 306      -0.313  -8.495  -8.549  1.00  0.32           C  
ATOM   2392  O   CYS A 306       0.504  -8.684  -9.448  1.00  0.32           O  
ATOM   2393  CB  CYS A 306      -2.229 -10.062  -8.086  1.00  0.32           C  
ATOM   2394  SG  CYS A 306      -2.397 -10.619  -9.828  1.00  0.32           S  
ATOM   2395  N   THR A 307      -0.806  -7.284  -8.292  1.00  0.33           N  
ATOM   2396  CA  THR A 307      -0.454  -6.083  -9.009  1.00  0.33           C  
ATOM   2397  C   THR A 307       0.987  -5.696  -8.830  1.00  0.33           C  
ATOM   2398  O   THR A 307       1.698  -5.369  -9.766  1.00  0.33           O  
ATOM   2399  CB  THR A 307      -1.321  -4.919  -8.583  1.00  0.33           C  
ATOM   2400  OG1 THR A 307      -2.612  -5.352  -8.167  1.00  0.33           O  
ATOM   2401  CG2 THR A 307      -1.541  -4.111  -9.843  1.00  0.33           C  
ATOM   2402  N   ASP A 308       1.461  -5.797  -7.592  1.00  0.30           N  
ATOM   2403  CA  ASP A 308       2.805  -5.628  -7.137  1.00  0.30           C  
ATOM   2404  C   ASP A 308       3.753  -6.605  -7.770  1.00  0.30           C  
ATOM   2405  O   ASP A 308       4.859  -6.230  -8.090  1.00  0.30           O  
ATOM   2406  CB  ASP A 308       2.839  -5.823  -5.622  1.00  0.30           C  
ATOM   2407  CG  ASP A 308       1.801  -4.981  -4.915  1.00  0.30           C  
ATOM   2408  OD1 ASP A 308       2.218  -4.200  -4.036  1.00  0.30           O  
ATOM   2409  OD2 ASP A 308       0.580  -5.091  -5.213  1.00  0.30           O  
ATOM   2410  N   SER A 309       3.356  -7.861  -8.057  1.00  0.31           N  
ATOM   2411  CA  SER A 309       4.184  -8.774  -8.854  1.00  0.31           C  
ATOM   2412  C   SER A 309       4.545  -8.209 -10.197  1.00  0.31           C  
ATOM   2413  O   SER A 309       5.703  -8.213 -10.617  1.00  0.31           O  
ATOM   2414  CB  SER A 309       3.541 -10.151  -9.064  1.00  0.31           C  
ATOM   2415  OG  SER A 309       4.379 -11.061  -9.787  1.00  0.31           O  
ATOM   2416  N   LEU A 310       3.565  -7.593 -10.873  1.00  0.30           N  
ATOM   2417  CA  LEU A 310       3.844  -6.744 -12.008  1.00  0.30           C  
ATOM   2418  C   LEU A 310       4.727  -5.577 -11.611  1.00  0.30           C  
ATOM   2419  O   LEU A 310       5.755  -5.350 -12.236  1.00  0.30           O  
ATOM   2420  CB  LEU A 310       2.554  -6.334 -12.738  1.00  0.30           C  
ATOM   2421  CG  LEU A 310       1.804  -7.569 -13.264  1.00  0.30           C  
ATOM   2422  CD1 LEU A 310       0.379  -7.188 -13.628  1.00  0.30           C  
ATOM   2423  CD2 LEU A 310       2.463  -8.207 -14.494  1.00  0.30           C  
ATOM   2424  N   VAL A 311       4.496  -4.888 -10.487  1.00  0.28           N  
ATOM   2425  CA  VAL A 311       5.521  -3.991  -9.959  1.00  0.28           C  
ATOM   2426  C   VAL A 311       6.803  -4.600  -9.340  1.00  0.28           C  
ATOM   2427  O   VAL A 311       7.482  -3.958  -8.551  1.00  0.28           O  
ATOM   2428  CB  VAL A 311       5.046  -2.810  -9.150  1.00  0.28           C  
ATOM   2429  CG1 VAL A 311       5.873  -1.570  -9.551  1.00  0.28           C  
ATOM   2430  CG2 VAL A 311       3.593  -2.525  -9.497  1.00  0.28           C  
ATOM   2431  N   LEU A 312       7.272  -5.810  -9.763  1.00  0.27           N  
ATOM   2432  CA  LEU A 312       8.711  -6.031  -9.893  1.00  0.27           C  
ATOM   2433  C   LEU A 312       9.189  -6.538 -11.274  1.00  0.27           C  
ATOM   2434  O   LEU A 312      10.269  -7.086 -11.391  1.00  0.27           O  
ATOM   2435  CB  LEU A 312       9.570  -6.244  -8.598  1.00  0.27           C  
ATOM   2436  CG  LEU A 312      10.907  -5.422  -8.514  1.00  0.27           C  
ATOM   2437  CD1 LEU A 312      10.896  -3.995  -9.066  1.00  0.27           C  
ATOM   2438  CD2 LEU A 312      11.412  -5.167  -7.092  1.00  0.27           C  
ATOM   2439  N   GLN A 313       8.433  -6.310 -12.395  1.00  0.29           N  
ATOM   2440  CA  GLN A 313       8.810  -6.736 -13.751  1.00  0.29           C  
ATOM   2441  C   GLN A 313       9.045  -5.666 -14.881  1.00  0.29           C  
ATOM   2442  O   GLN A 313       9.379  -6.064 -15.980  1.00  0.29           O  
ATOM   2443  CB  GLN A 313       7.757  -7.770 -14.231  1.00  0.29           C  
ATOM   2444  CG  GLN A 313       7.762  -9.106 -13.435  1.00  0.29           C  
ATOM   2445  CD  GLN A 313       6.530  -9.976 -13.715  1.00  0.29           C  
ATOM   2446  OE1 GLN A 313       6.431 -10.710 -14.700  1.00  0.29           O  
ATOM   2447  NE2 GLN A 313       5.530  -9.908 -12.811  1.00  0.29           N  
ATOM   2448  N   CYS A 314       8.983  -4.322 -14.628  1.00  0.24           N  
ATOM   2449  CA  CYS A 314       9.496  -3.075 -15.361  1.00  0.24           C  
ATOM   2450  C   CYS A 314      10.619  -1.859 -14.895  1.00  0.24           C  
ATOM   2451  O   CYS A 314      10.451  -0.889 -15.685  1.00  0.24           O  
ATOM   2452  CB  CYS A 314       8.137  -2.305 -15.548  1.00  0.24           C  
ATOM   2453  SG  CYS A 314       7.325  -2.367 -17.142  1.00  0.24           S  
ATOM   2454  N   GLU A 315      11.710  -1.477 -13.941  1.00  0.26           N  
ATOM   2455  CA  GLU A 315      12.556  -1.716 -12.529  1.00  0.26           C  
ATOM   2456  C   GLU A 315      13.738  -2.735 -12.207  1.00  0.26           C  
ATOM   2457  O   GLU A 315      14.428  -2.175 -11.370  1.00  0.26           O  
ATOM   2458  CB  GLU A 315      12.332  -1.165 -10.964  1.00  0.26           C  
ATOM   2459  CG  GLU A 315      11.119  -0.759 -10.056  1.00  0.26           C  
ATOM   2460  CD  GLU A 315      11.445  -0.489  -8.571  1.00  0.26           C  
ATOM   2461  OE1 GLU A 315      10.474  -0.149  -7.836  1.00  0.26           O  
ATOM   2462  OE2 GLU A 315      12.633  -0.546  -8.151  1.00  0.26           O  
ATOM   2463  N   LEU A 316      14.131  -4.009 -12.718  1.00  0.24           N  
ATOM   2464  CA  LEU A 316      15.309  -4.757 -13.454  1.00  0.24           C  
ATOM   2465  C   LEU A 316      16.489  -4.531 -14.579  1.00  0.24           C  
ATOM   2466  O   LEU A 316      17.622  -4.649 -14.162  1.00  0.24           O  
ATOM   2467  CB  LEU A 316      14.894  -6.135 -13.687  1.00  0.24           C  
ATOM   2468  CG  LEU A 316      15.121  -6.915 -12.490  1.00  0.24           C  
ATOM   2469  CD1 LEU A 316      14.077  -7.977 -12.457  1.00  0.24           C  
ATOM   2470  CD2 LEU A 316      16.548  -7.378 -12.418  1.00  0.24           C  
ATOM   2471  N   ALA A 317      16.675  -4.210 -15.915  1.00  0.25           N  
ATOM   2472  CA  ALA A 317      16.268  -3.929 -17.331  1.00  0.25           C  
ATOM   2473  C   ALA A 317      16.982  -2.735 -17.955  1.00  0.25           C  
ATOM   2474  O   ALA A 317      17.598  -2.911 -18.995  1.00  0.25           O  
ATOM   2475  CB  ALA A 317      14.884  -3.823 -17.953  1.00  0.25           C  
ATOM   2476  N   LEU A 318      17.008  -1.530 -17.323  1.00  0.22           N  
ATOM   2477  CA  LEU A 318      17.748  -0.327 -17.708  1.00  0.22           C  
ATOM   2478  C   LEU A 318      19.184  -0.767 -17.764  1.00  0.22           C  
ATOM   2479  O   LEU A 318      19.953  -0.299 -18.567  1.00  0.22           O  
ATOM   2480  CB  LEU A 318      17.539   0.978 -16.828  1.00  0.22           C  
ATOM   2481  CG  LEU A 318      16.677   2.094 -17.451  1.00  0.22           C  
ATOM   2482  CD1 LEU A 318      16.015   3.021 -16.457  1.00  0.22           C  
ATOM   2483  CD2 LEU A 318      17.246   2.946 -18.575  1.00  0.22           C  
ATOM   2484  N   GLY A 319      19.580  -1.756 -16.946  1.00  0.23           N  
ATOM   2485  CA  GLY A 319      20.783  -2.542 -17.139  1.00  0.23           C  
ATOM   2486  C   GLY A 319      21.096  -3.167 -18.494  1.00  0.23           C  
ATOM   2487  O   GLY A 319      22.196  -2.961 -18.990  1.00  0.23           O  
ATOM   2488  N   PHE A 320      20.206  -3.984 -19.114  1.00  0.20           N  
ATOM   2489  CA  PHE A 320      20.629  -4.955 -20.138  1.00  0.20           C  
ATOM   2490  C   PHE A 320      20.139  -4.764 -21.583  1.00  0.20           C  
ATOM   2491  O   PHE A 320      20.640  -5.432 -22.478  1.00  0.20           O  
ATOM   2492  CB  PHE A 320      20.361  -6.440 -19.688  1.00  0.20           C  
ATOM   2493  CG  PHE A 320      19.051  -7.049 -20.136  1.00  0.20           C  
ATOM   2494  CD1 PHE A 320      17.839  -6.423 -19.828  1.00  0.20           C  
ATOM   2495  CD2 PHE A 320      19.037  -8.193 -20.955  1.00  0.20           C  
ATOM   2496  CE1 PHE A 320      16.628  -6.942 -20.291  1.00  0.20           C  
ATOM   2497  CE2 PHE A 320      17.829  -8.717 -21.429  1.00  0.20           C  
ATOM   2498  CZ  PHE A 320      16.626  -8.095 -21.087  1.00  0.20           C  
ATOM   2499  N   GLY A 321      19.166  -3.874 -21.875  1.00  0.27           N  
ATOM   2500  CA  GLY A 321      18.693  -3.730 -23.259  1.00  0.27           C  
ATOM   2501  C   GLY A 321      17.507  -4.574 -23.661  1.00  0.27           C  
ATOM   2502  O   GLY A 321      17.358  -4.923 -24.827  1.00  0.27           O  
ATOM   2503  N   GLY A 322      16.592  -4.913 -22.734  1.00  0.31           N  
ATOM   2504  CA  GLY A 322      15.420  -5.729 -23.079  1.00  0.31           C  
ATOM   2505  C   GLY A 322      14.267  -5.010 -23.697  1.00  0.31           C  
ATOM   2506  O   GLY A 322      13.298  -4.682 -23.029  1.00  0.31           O  
ATOM   2507  N   GLY A 323      14.334  -4.770 -25.017  1.00  0.28           N  
ATOM   2508  CA  GLY A 323      13.382  -3.951 -25.762  1.00  0.28           C  
ATOM   2509  C   GLY A 323      12.071  -4.594 -26.130  1.00  0.28           C  
ATOM   2510  O   GLY A 323      11.290  -3.989 -26.858  1.00  0.28           O  
ATOM   2511  N   ARG A 324      11.794  -5.840 -25.701  1.00  0.23           N  
ATOM   2512  CA  ARG A 324      10.621  -6.562 -26.173  1.00  0.23           C  
ATOM   2513  C   ARG A 324       9.644  -6.913 -25.083  1.00  0.23           C  
ATOM   2514  O   ARG A 324       8.447  -6.718 -25.259  1.00  0.23           O  
ATOM   2515  CB  ARG A 324      11.084  -7.848 -26.869  1.00  0.23           C  
ATOM   2516  CG  ARG A 324      11.850  -7.489 -28.153  1.00  0.23           C  
ATOM   2517  CD  ARG A 324      12.452  -8.692 -28.863  1.00  0.23           C  
ATOM   2518  NE  ARG A 324      13.089  -8.138 -30.104  1.00  0.23           N  
ATOM   2519  CZ  ARG A 324      13.426  -8.863 -31.178  1.00  0.23           C  
ATOM   2520  NH1 ARG A 324      13.336 -10.188 -31.182  1.00  0.23           N  
ATOM   2521  NH2 ARG A 324      13.857  -8.243 -32.274  1.00  0.23           N  
ATOM   2522  N   GLU A 325      10.136  -7.300 -23.887  1.00  0.32           N  
ATOM   2523  CA  GLU A 325       9.396  -7.653 -22.687  1.00  0.32           C  
ATOM   2524  C   GLU A 325       8.448  -6.536 -22.278  1.00  0.32           C  
ATOM   2525  O   GLU A 325       7.387  -6.724 -21.696  1.00  0.32           O  
ATOM   2526  CB  GLU A 325      10.411  -7.842 -21.527  1.00  0.32           C  
ATOM   2527  CG  GLU A 325      11.392  -9.037 -21.655  1.00  0.32           C  
ATOM   2528  CD  GLU A 325      12.680  -8.765 -22.441  1.00  0.32           C  
ATOM   2529  OE1 GLU A 325      13.680  -9.456 -22.110  1.00  0.32           O  
ATOM   2530  OE2 GLU A 325      12.701  -7.875 -23.335  1.00  0.32           O  
ATOM   2531  N   ILE A 326       8.863  -5.325 -22.661  1.00  0.25           N  
ATOM   2532  CA  ILE A 326       8.255  -4.016 -22.588  1.00  0.25           C  
ATOM   2533  C   ILE A 326       6.879  -3.985 -23.231  1.00  0.25           C  
ATOM   2534  O   ILE A 326       5.934  -3.447 -22.685  1.00  0.25           O  
ATOM   2535  CB  ILE A 326       9.161  -3.010 -23.326  1.00  0.25           C  
ATOM   2536  CG1 ILE A 326      10.675  -3.232 -23.063  1.00  0.25           C  
ATOM   2537  CG2 ILE A 326       8.701  -1.562 -23.087  1.00  0.25           C  
ATOM   2538  CD1 ILE A 326      11.436  -2.145 -22.310  1.00  0.25           C  
ATOM   2539  N   ALA A 327       6.714  -4.610 -24.406  1.00  0.26           N  
ATOM   2540  CA  ALA A 327       5.465  -4.637 -25.122  1.00  0.26           C  
ATOM   2541  C   ALA A 327       4.627  -5.880 -24.824  1.00  0.26           C  
ATOM   2542  O   ALA A 327       3.476  -5.986 -25.245  1.00  0.26           O  
ATOM   2543  CB  ALA A 327       5.855  -4.571 -26.607  1.00  0.26           C  
ATOM   2544  N   ASP A 328       5.176  -6.809 -24.021  1.00  0.27           N  
ATOM   2545  CA  ASP A 328       4.556  -8.078 -23.723  1.00  0.27           C  
ATOM   2546  C   ASP A 328       4.007  -8.165 -22.308  1.00  0.27           C  
ATOM   2547  O   ASP A 328       3.114  -8.957 -22.018  1.00  0.27           O  
ATOM   2548  CB  ASP A 328       5.663  -9.153 -23.807  1.00  0.27           C  
ATOM   2549  CG  ASP A 328       6.140  -9.455 -25.222  1.00  0.27           C  
ATOM   2550  OD1 ASP A 328       5.413  -9.168 -26.203  1.00  0.27           O  
ATOM   2551  OD2 ASP A 328       7.251 -10.040 -25.306  1.00  0.27           O  
ATOM   2552  N   LEU A 329       4.496  -7.363 -21.344  1.00  0.23           N  
ATOM   2553  CA  LEU A 329       4.175  -7.617 -19.946  1.00  0.23           C  
ATOM   2554  C   LEU A 329       2.829  -7.039 -19.480  1.00  0.23           C  
ATOM   2555  O   LEU A 329       2.610  -6.767 -18.304  1.00  0.23           O  
ATOM   2556  CB  LEU A 329       5.368  -7.108 -19.084  1.00  0.23           C  
ATOM   2557  CG  LEU A 329       6.073  -8.207 -18.269  1.00  0.23           C  
ATOM   2558  CD1 LEU A 329       7.530  -7.828 -17.960  1.00  0.23           C  
ATOM   2559  CD2 LEU A 329       5.285  -8.485 -16.990  1.00  0.23           C  
ATOM   2560  N   ALA A 330       1.886  -6.796 -20.413  1.00  0.23           N  
ATOM   2561  CA  ALA A 330       1.083  -5.619 -20.313  1.00  0.23           C  
ATOM   2562  C   ALA A 330      -0.104  -5.704 -21.296  1.00  0.23           C  
ATOM   2563  O   ALA A 330      -0.140  -6.609 -22.131  1.00  0.23           O  
ATOM   2564  CB  ALA A 330       2.134  -4.511 -20.502  1.00  0.23           C  
ATOM   2565  N   PRO A 331      -1.127  -4.828 -21.193  1.00  0.18           N  
ATOM   2566  CA  PRO A 331      -2.524  -5.183 -20.904  1.00  0.18           C  
ATOM   2567  C   PRO A 331      -2.881  -6.230 -19.905  1.00  0.18           C  
ATOM   2568  O   PRO A 331      -4.041  -6.368 -19.582  1.00  0.18           O  
ATOM   2569  CB  PRO A 331      -3.146  -5.492 -22.267  1.00  0.18           C  
ATOM   2570  CG  PRO A 331      -2.323  -4.629 -23.214  1.00  0.18           C  
ATOM   2571  CD  PRO A 331      -1.286  -3.950 -22.331  1.00  0.18           C  
ATOM   2572  N   LEU A 332      -1.883  -6.801 -19.244  1.00  0.20           N  
ATOM   2573  CA  LEU A 332      -2.011  -7.193 -17.880  1.00  0.20           C  
ATOM   2574  C   LEU A 332      -2.052  -5.942 -16.969  1.00  0.20           C  
ATOM   2575  O   LEU A 332      -1.673  -6.055 -15.817  1.00  0.20           O  
ATOM   2576  CB  LEU A 332      -0.745  -8.046 -17.526  1.00  0.20           C  
ATOM   2577  CG  LEU A 332      -0.280  -9.109 -18.555  1.00  0.20           C  
ATOM   2578  CD1 LEU A 332       1.019  -9.789 -18.075  1.00  0.20           C  
ATOM   2579  CD2 LEU A 332      -1.364 -10.153 -18.835  1.00  0.20           C  
ATOM   2580  N   LEU A 333      -2.436  -4.713 -17.440  1.00  0.19           N  
ATOM   2581  CA  LEU A 333      -1.848  -3.475 -16.943  1.00  0.19           C  
ATOM   2582  C   LEU A 333      -2.801  -2.314 -16.637  1.00  0.19           C  
ATOM   2583  O   LEU A 333      -2.928  -1.944 -15.491  1.00  0.19           O  
ATOM   2584  CB  LEU A 333      -0.685  -3.065 -17.872  1.00  0.19           C  
ATOM   2585  CG  LEU A 333       0.737  -3.397 -17.399  1.00  0.19           C  
ATOM   2586  CD1 LEU A 333       1.304  -2.242 -16.628  1.00  0.19           C  
ATOM   2587  CD2 LEU A 333       0.908  -4.661 -16.568  1.00  0.19           C  
ATOM   2588  N   HIS A 334      -3.531  -1.658 -17.552  1.00  0.18           N  
ATOM   2589  CA  HIS A 334      -4.524  -0.634 -17.127  1.00  0.18           C  
ATOM   2590  C   HIS A 334      -5.883  -1.242 -16.822  1.00  0.18           C  
ATOM   2591  O   HIS A 334      -6.930  -0.660 -17.070  1.00  0.18           O  
ATOM   2592  CB  HIS A 334      -4.589   0.509 -18.178  1.00  0.18           C  
ATOM   2593  CG  HIS A 334      -5.617   1.631 -18.214  1.00  0.18           C  
ATOM   2594  ND1 HIS A 334      -5.129   2.922 -18.266  1.00  0.18           N  
ATOM   2595  CD2 HIS A 334      -6.928   1.633 -18.597  1.00  0.18           C  
ATOM   2596  CE1 HIS A 334      -6.132   3.678 -18.649  1.00  0.18           C  
ATOM   2597  NE2 HIS A 334      -7.251   2.948 -18.868  1.00  0.18           N  
ATOM   2598  N   ALA A 335      -5.917  -2.465 -16.263  1.00  0.20           N  
ATOM   2599  CA  ALA A 335      -7.158  -3.152 -15.981  1.00  0.20           C  
ATOM   2600  C   ALA A 335      -7.440  -3.231 -14.479  1.00  0.20           C  
ATOM   2601  O   ALA A 335      -8.496  -3.697 -14.059  1.00  0.20           O  
ATOM   2602  CB  ALA A 335      -7.081  -4.547 -16.629  1.00  0.20           C  
ATOM   2603  N   ARG A 336      -6.513  -2.729 -13.631  1.00  0.17           N  
ATOM   2604  CA  ARG A 336      -6.762  -2.475 -12.216  1.00  0.17           C  
ATOM   2605  C   ARG A 336      -6.691  -0.977 -11.877  1.00  0.17           C  
ATOM   2606  O   ARG A 336      -7.200  -0.570 -10.839  1.00  0.17           O  
ATOM   2607  CB  ARG A 336      -5.796  -3.273 -11.288  1.00  0.17           C  
ATOM   2608  CG  ARG A 336      -5.967  -4.815 -11.350  1.00  0.17           C  
ATOM   2609  CD  ARG A 336      -4.962  -5.598 -10.483  1.00  0.17           C  
ATOM   2610  NE  ARG A 336      -5.486  -6.981 -10.194  1.00  0.17           N  
ATOM   2611  CZ  ARG A 336      -5.165  -8.095 -10.869  1.00  0.17           C  
ATOM   2612  NH1 ARG A 336      -4.486  -8.049 -12.005  1.00  0.17           N  
ATOM   2613  NH2 ARG A 336      -5.533  -9.278 -10.373  1.00  0.17           N  
ATOM   2614  N   GLY A 337      -6.136  -0.119 -12.775  1.00  0.23           N  
ATOM   2615  CA  GLY A 337      -6.304   1.342 -12.740  1.00  0.23           C  
ATOM   2616  C   GLY A 337      -5.306   2.193 -11.973  1.00  0.23           C  
ATOM   2617  O   GLY A 337      -5.304   2.267 -10.749  1.00  0.23           O  
ATOM   2618  N   ARG A 338      -4.479   2.968 -12.694  1.00  0.18           N  
ATOM   2619  CA  ARG A 338      -3.500   3.855 -12.101  1.00  0.18           C  
ATOM   2620  C   ARG A 338      -3.170   5.155 -12.870  1.00  0.18           C  
ATOM   2621  O   ARG A 338      -2.156   5.733 -12.476  1.00  0.18           O  
ATOM   2622  CB  ARG A 338      -2.177   3.045 -11.932  1.00  0.18           C  
ATOM   2623  CG  ARG A 338      -1.772   2.771 -10.486  1.00  0.18           C  
ATOM   2624  CD  ARG A 338      -1.429   4.026  -9.681  1.00  0.18           C  
ATOM   2625  NE  ARG A 338      -1.098   3.574  -8.287  1.00  0.18           N  
ATOM   2626  CZ  ARG A 338      -2.016   3.065  -7.451  1.00  0.18           C  
ATOM   2627  NH1 ARG A 338      -3.317   3.132  -7.707  1.00  0.18           N  
ATOM   2628  NH2 ARG A 338      -1.639   2.317  -6.415  1.00  0.18           N  
ATOM   2629  N   PRO A 339      -3.885   5.740 -13.862  1.00  0.17           N  
ATOM   2630  CA  PRO A 339      -3.303   6.344 -15.079  1.00  0.17           C  
ATOM   2631  C   PRO A 339      -2.344   7.533 -14.999  1.00  0.17           C  
ATOM   2632  O   PRO A 339      -1.906   8.010 -16.048  1.00  0.17           O  
ATOM   2633  CB  PRO A 339      -4.517   6.662 -15.972  1.00  0.17           C  
ATOM   2634  CG  PRO A 339      -5.709   6.661 -15.018  1.00  0.17           C  
ATOM   2635  CD  PRO A 339      -5.326   5.549 -14.048  1.00  0.17           C  
ATOM   2636  N   LEU A 340      -1.964   8.043 -13.807  1.00  0.15           N  
ATOM   2637  CA  LEU A 340      -0.741   8.818 -13.654  1.00  0.15           C  
ATOM   2638  C   LEU A 340       0.449   7.982 -14.063  1.00  0.15           C  
ATOM   2639  O   LEU A 340       1.295   8.442 -14.803  1.00  0.15           O  
ATOM   2640  CB  LEU A 340      -0.474   9.255 -12.185  1.00  0.15           C  
ATOM   2641  CG  LEU A 340       0.914   9.915 -11.929  1.00  0.15           C  
ATOM   2642  CD1 LEU A 340       1.119  11.192 -12.760  1.00  0.15           C  
ATOM   2643  CD2 LEU A 340       1.197  10.172 -10.437  1.00  0.15           C  
ATOM   2644  N   GLU A 341       0.516   6.713 -13.665  1.00  0.22           N  
ATOM   2645  CA  GLU A 341       1.613   5.863 -14.067  1.00  0.22           C  
ATOM   2646  C   GLU A 341       1.238   5.018 -15.263  1.00  0.22           C  
ATOM   2647  O   GLU A 341       1.375   3.803 -15.249  1.00  0.22           O  
ATOM   2648  CB  GLU A 341       2.127   4.997 -12.901  1.00  0.22           C  
ATOM   2649  CG  GLU A 341       2.797   5.830 -11.775  1.00  0.22           C  
ATOM   2650  CD  GLU A 341       2.054   5.823 -10.455  1.00  0.22           C  
ATOM   2651  OE1 GLU A 341       2.593   5.338  -9.421  1.00  0.22           O  
ATOM   2652  OE2 GLU A 341       0.918   6.370 -10.374  1.00  0.22           O  
ATOM   2653  N   ALA A 342       0.764   5.661 -16.354  1.00  0.19           N  
ATOM   2654  CA  ALA A 342       0.481   4.991 -17.608  1.00  0.19           C  
ATOM   2655  C   ALA A 342       1.115   5.581 -18.870  1.00  0.19           C  
ATOM   2656  O   ALA A 342       0.926   5.019 -19.943  1.00  0.19           O  
ATOM   2657  CB  ALA A 342      -1.033   4.886 -17.857  1.00  0.19           C  
ATOM   2658  N   SER A 343       1.921   6.669 -18.844  1.00  0.18           N  
ATOM   2659  CA  SER A 343       2.540   7.168 -20.075  1.00  0.18           C  
ATOM   2660  C   SER A 343       3.830   7.944 -19.796  1.00  0.18           C  
ATOM   2661  O   SER A 343       3.988   8.516 -18.732  1.00  0.18           O  
ATOM   2662  CB  SER A 343       1.619   8.070 -20.902  1.00  0.18           C  
ATOM   2663  OG  SER A 343       0.640   7.324 -21.610  1.00  0.18           O  
ATOM   2664  N   TYR A 344       4.797   8.006 -20.742  1.00  0.14           N  
ATOM   2665  CA  TYR A 344       6.188   8.369 -20.452  1.00  0.14           C  
ATOM   2666  C   TYR A 344       6.758   8.997 -21.722  1.00  0.14           C  
ATOM   2667  O   TYR A 344       6.018   9.279 -22.653  1.00  0.14           O  
ATOM   2668  CB  TYR A 344       6.961   7.092 -19.977  1.00  0.14           C  
ATOM   2669  CG  TYR A 344       8.460   7.177 -19.679  1.00  0.14           C  
ATOM   2670  CD1 TYR A 344       9.031   7.420 -18.413  1.00  0.14           C  
ATOM   2671  CD2 TYR A 344       9.331   6.814 -20.715  1.00  0.14           C  
ATOM   2672  CE1 TYR A 344      10.423   7.307 -18.217  1.00  0.14           C  
ATOM   2673  CE2 TYR A 344      10.713   6.715 -20.529  1.00  0.14           C  
ATOM   2674  CZ  TYR A 344      11.276   7.003 -19.285  1.00  0.14           C  
ATOM   2675  OH  TYR A 344      12.668   6.919 -19.033  1.00  0.14           O  
ATOM   2676  N   TYR A 345       8.068   9.300 -21.825  1.00  0.11           N  
ATOM   2677  CA  TYR A 345       8.551   9.988 -23.011  1.00  0.11           C  
ATOM   2678  C   TYR A 345       9.845   9.541 -23.665  1.00  0.11           C  
ATOM   2679  O   TYR A 345      10.423  10.301 -24.433  1.00  0.11           O  
ATOM   2680  CB  TYR A 345       8.433  11.525 -22.893  1.00  0.11           C  
ATOM   2681  CG  TYR A 345       9.383  12.223 -21.967  1.00  0.11           C  
ATOM   2682  CD1 TYR A 345      10.653  12.636 -22.400  1.00  0.11           C  
ATOM   2683  CD2 TYR A 345       8.975  12.563 -20.671  1.00  0.11           C  
ATOM   2684  CE1 TYR A 345      11.508  13.312 -21.527  1.00  0.11           C  
ATOM   2685  CE2 TYR A 345       9.803  13.316 -19.823  1.00  0.11           C  
ATOM   2686  CZ  TYR A 345      11.076  13.681 -20.258  1.00  0.11           C  
ATOM   2687  OH  TYR A 345      11.957  14.426 -19.458  1.00  0.11           O  
ATOM   2688  N   GLN A 346      10.335   8.292 -23.474  1.00  0.15           N  
ATOM   2689  CA  GLN A 346      11.552   7.871 -24.183  1.00  0.15           C  
ATOM   2690  C   GLN A 346      11.585   6.449 -24.762  1.00  0.15           C  
ATOM   2691  O   GLN A 346      12.646   5.891 -24.997  1.00  0.15           O  
ATOM   2692  CB  GLN A 346      12.767   8.017 -23.252  1.00  0.15           C  
ATOM   2693  CG  GLN A 346      13.070   9.481 -22.908  1.00  0.15           C  
ATOM   2694  CD  GLN A 346      13.911   9.586 -21.654  1.00  0.15           C  
ATOM   2695  OE1 GLN A 346      14.549   8.663 -21.154  1.00  0.15           O  
ATOM   2696  NE2 GLN A 346      13.821  10.794 -21.061  1.00  0.15           N  
ATOM   2697  N   ALA A 347      10.440   5.818 -25.044  1.00  0.16           N  
ATOM   2698  CA  ALA A 347      10.345   4.479 -25.583  1.00  0.16           C  
ATOM   2699  C   ALA A 347      10.984   4.037 -26.868  1.00  0.16           C  
ATOM   2700  O   ALA A 347      11.697   3.042 -26.914  1.00  0.16           O  
ATOM   2701  CB  ALA A 347       8.886   4.062 -25.897  1.00  0.16           C  
ATOM   2702  N   PHE A 348      10.617   4.697 -27.965  1.00  0.14           N  
ATOM   2703  CA  PHE A 348      10.412   4.007 -29.216  1.00  0.14           C  
ATOM   2704  C   PHE A 348       9.622   5.020 -30.002  1.00  0.14           C  
ATOM   2705  O   PHE A 348       8.824   5.755 -29.429  1.00  0.14           O  
ATOM   2706  CB  PHE A 348       9.539   2.699 -29.135  1.00  0.14           C  
ATOM   2707  CG  PHE A 348       9.879   1.762 -30.266  1.00  0.14           C  
ATOM   2708  CD1 PHE A 348       9.004   1.565 -31.348  1.00  0.14           C  
ATOM   2709  CD2 PHE A 348      11.108   1.082 -30.255  1.00  0.14           C  
ATOM   2710  CE1 PHE A 348       9.357   0.714 -32.405  1.00  0.14           C  
ATOM   2711  CE2 PHE A 348      11.464   0.228 -31.309  1.00  0.14           C  
ATOM   2712  CZ  PHE A 348      10.586   0.043 -32.383  1.00  0.14           C  
ATOM   2713  N   ALA A 349       9.841   5.104 -31.317  1.00  0.16           N  
ATOM   2714  CA  ALA A 349       8.995   5.881 -32.187  1.00  0.16           C  
ATOM   2715  C   ALA A 349       8.574   4.940 -33.293  1.00  0.16           C  
ATOM   2716  O   ALA A 349       9.372   4.570 -34.152  1.00  0.16           O  
ATOM   2717  CB  ALA A 349       9.755   7.105 -32.737  1.00  0.16           C  
ATOM   2718  N   GLU A 350       7.302   4.505 -33.266  1.00  0.13           N  
ATOM   2719  CA  GLU A 350       6.758   3.592 -34.239  1.00  0.13           C  
ATOM   2720  C   GLU A 350       6.113   4.358 -35.369  1.00  0.13           C  
ATOM   2721  O   GLU A 350       5.467   5.391 -35.198  1.00  0.13           O  
ATOM   2722  CB  GLU A 350       5.767   2.583 -33.604  1.00  0.13           C  
ATOM   2723  CG  GLU A 350       4.519   3.209 -32.930  1.00  0.13           C  
ATOM   2724  CD  GLU A 350       3.672   2.184 -32.174  1.00  0.13           C  
ATOM   2725  OE1 GLU A 350       2.657   2.620 -31.571  1.00  0.13           O  
ATOM   2726  OE2 GLU A 350       4.033   0.981 -32.172  1.00  0.13           O  
ATOM   2727  N   PHE A 351       6.322   3.860 -36.590  1.00  0.13           N  
ATOM   2728  CA  PHE A 351       5.699   4.385 -37.768  1.00  0.13           C  
ATOM   2729  C   PHE A 351       5.702   3.246 -38.753  1.00  0.13           C  
ATOM   2730  O   PHE A 351       6.506   2.322 -38.653  1.00  0.13           O  
ATOM   2731  CB  PHE A 351       6.387   5.665 -38.345  1.00  0.13           C  
ATOM   2732  CG  PHE A 351       7.817   5.449 -38.777  1.00  0.13           C  
ATOM   2733  CD1 PHE A 351       8.872   5.552 -37.856  1.00  0.13           C  
ATOM   2734  CD2 PHE A 351       8.112   5.138 -40.115  1.00  0.13           C  
ATOM   2735  CE1 PHE A 351      10.197   5.344 -38.263  1.00  0.13           C  
ATOM   2736  CE2 PHE A 351       9.434   4.929 -40.528  1.00  0.13           C  
ATOM   2737  CZ  PHE A 351      10.478   5.036 -39.601  1.00  0.13           C  
ATOM   2738  N   SER A 352       4.795   3.299 -39.733  1.00  0.15           N  
ATOM   2739  CA  SER A 352       4.798   2.360 -40.830  1.00  0.15           C  
ATOM   2740  C   SER A 352       4.869   3.192 -42.074  1.00  0.15           C  
ATOM   2741  O   SER A 352       4.014   4.035 -42.328  1.00  0.15           O  
ATOM   2742  CB  SER A 352       3.541   1.470 -40.901  1.00  0.15           C  
ATOM   2743  OG  SER A 352       3.536   0.510 -39.848  1.00  0.15           O  
ATOM   2744  N   ALA A 353       5.933   2.970 -42.847  1.00  0.16           N  
ATOM   2745  CA  ALA A 353       6.361   3.722 -43.995  1.00  0.16           C  
ATOM   2746  C   ALA A 353       7.783   3.242 -44.156  1.00  0.16           C  
ATOM   2747  O   ALA A 353       8.376   2.715 -43.218  1.00  0.16           O  
ATOM   2748  CB  ALA A 353       6.333   5.263 -43.838  1.00  0.16           C  
ATOM   2749  N   LEU A 354       8.343   3.320 -45.366  1.00  0.15           N  
ATOM   2750  CA  LEU A 354       9.655   2.771 -45.641  1.00  0.15           C  
ATOM   2751  C   LEU A 354      10.610   3.944 -45.770  1.00  0.15           C  
ATOM   2752  O   LEU A 354      10.190   5.090 -45.689  1.00  0.15           O  
ATOM   2753  CB  LEU A 354       9.606   1.867 -46.896  1.00  0.15           C  
ATOM   2754  CG  LEU A 354       9.165   0.407 -46.615  1.00  0.15           C  
ATOM   2755  CD1 LEU A 354       7.753   0.264 -46.028  1.00  0.15           C  
ATOM   2756  CD2 LEU A 354       9.218  -0.432 -47.894  1.00  0.15           C  
ATOM   2757  N   LEU A 355      11.931   3.723 -45.920  1.00  0.19           N  
ATOM   2758  CA  LEU A 355      12.852   4.842 -46.111  1.00  0.19           C  
ATOM   2759  C   LEU A 355      13.612   4.703 -47.418  1.00  0.19           C  
ATOM   2760  O   LEU A 355      13.631   5.619 -48.233  1.00  0.19           O  
ATOM   2761  CB  LEU A 355      13.839   4.950 -44.928  1.00  0.19           C  
ATOM   2762  CG  LEU A 355      13.164   5.233 -43.565  1.00  0.19           C  
ATOM   2763  CD1 LEU A 355      14.190   5.128 -42.428  1.00  0.19           C  
ATOM   2764  CD2 LEU A 355      12.478   6.609 -43.530  1.00  0.19           C  
ATOM   2765  N   SER A 356      14.168   3.513 -47.733  1.00  0.19           N  
ATOM   2766  CA  SER A 356      14.691   3.219 -49.070  1.00  0.19           C  
ATOM   2767  C   SER A 356      13.601   3.142 -50.120  1.00  0.19           C  
ATOM   2768  O   SER A 356      13.822   3.399 -51.296  1.00  0.19           O  
ATOM   2769  CB  SER A 356      15.512   1.907 -49.167  1.00  0.19           C  
ATOM   2770  OG  SER A 356      16.475   1.858 -48.119  1.00  0.19           O  
ATOM   2771  N   ARG A 357      12.366   2.760 -49.733  1.00  0.19           N  
ATOM   2772  CA  ARG A 357      11.204   2.946 -50.580  1.00  0.19           C  
ATOM   2773  C   ARG A 357      10.681   4.389 -50.523  1.00  0.19           C  
ATOM   2774  O   ARG A 357      10.382   4.927 -51.568  1.00  0.19           O  
ATOM   2775  CB  ARG A 357      10.159   1.817 -50.349  1.00  0.19           C  
ATOM   2776  CG  ARG A 357       9.475   1.250 -51.615  1.00  0.19           C  
ATOM   2777  CD  ARG A 357       8.933  -0.187 -51.506  1.00  0.19           C  
ATOM   2778  NE  ARG A 357       8.308  -0.487 -52.824  1.00  0.19           N  
ATOM   2779  CZ  ARG A 357       7.091  -0.986 -53.058  1.00  0.19           C  
ATOM   2780  NH1 ARG A 357       6.173  -1.205 -52.134  1.00  0.19           N  
ATOM   2781  NH2 ARG A 357       6.797  -1.277 -54.323  1.00  0.19           N  
ATOM   2782  N   SER A 358      10.637   5.107 -49.367  1.00  0.22           N  
ATOM   2783  CA  SER A 358      10.024   6.452 -49.322  1.00  0.22           C  
ATOM   2784  C   SER A 358      10.951   7.627 -49.646  1.00  0.22           C  
ATOM   2785  O   SER A 358      10.502   8.762 -49.761  1.00  0.22           O  
ATOM   2786  CB  SER A 358       9.327   6.836 -47.993  1.00  0.22           C  
ATOM   2787  OG  SER A 358       8.357   5.865 -47.597  1.00  0.22           O  
ATOM   2788  N   SER A 359      12.271   7.406 -49.844  1.00  0.27           N  
ATOM   2789  CA  SER A 359      13.127   8.345 -50.575  1.00  0.27           C  
ATOM   2790  C   SER A 359      13.168   7.930 -52.019  1.00  0.27           C  
ATOM   2791  O   SER A 359      13.707   8.634 -52.861  1.00  0.27           O  
ATOM   2792  CB  SER A 359      14.606   8.411 -50.078  1.00  0.27           C  
ATOM   2793  OG  SER A 359      15.387   9.392 -50.780  1.00  0.27           O  
ATOM   2794  N   ARG A 360      12.536   6.808 -52.400  1.00  0.22           N  
ATOM   2795  CA  ARG A 360      12.574   6.400 -53.775  1.00  0.22           C  
ATOM   2796  C   ARG A 360      11.447   6.964 -54.589  1.00  0.22           C  
ATOM   2797  O   ARG A 360      11.554   6.809 -55.776  1.00  0.22           O  
ATOM   2798  CB  ARG A 360      12.737   4.881 -54.017  1.00  0.22           C  
ATOM   2799  CG  ARG A 360      14.220   4.478 -54.194  1.00  0.22           C  
ATOM   2800  CD  ARG A 360      14.452   3.125 -54.861  1.00  0.22           C  
ATOM   2801  NE  ARG A 360      13.773   2.133 -53.996  1.00  0.22           N  
ATOM   2802  CZ  ARG A 360      13.207   1.030 -54.491  1.00  0.22           C  
ATOM   2803  NH1 ARG A 360      13.371   0.651 -55.753  1.00  0.22           N  
ATOM   2804  NH2 ARG A 360      12.379   0.292 -53.760  1.00  0.22           N  
ATOM   2805  N   LEU A 361      10.424   7.696 -54.080  1.00  0.24           N  
ATOM   2806  CA  LEU A 361       9.812   8.842 -54.742  1.00  0.24           C  
ATOM   2807  C   LEU A 361      10.466  10.031 -53.941  1.00  0.24           C  
ATOM   2808  O   LEU A 361       9.769  10.802 -53.299  1.00  0.24           O  
ATOM   2809  CB  LEU A 361       8.243   9.085 -55.217  1.00  0.24           C  
ATOM   2810  CG  LEU A 361       7.279   8.335 -56.264  1.00  0.24           C  
ATOM   2811  CD1 LEU A 361       6.153   7.295 -55.924  1.00  0.24           C  
ATOM   2812  CD2 LEU A 361       6.493   9.388 -57.056  1.00  0.24           C  
ATOM   2813  N   LEU A 362      11.837  10.236 -53.981  1.00  0.24           N  
ATOM   2814  CA  LEU A 362      12.506  11.550 -53.844  1.00  0.24           C  
ATOM   2815  C   LEU A 362      13.471  12.146 -54.958  1.00  0.24           C  
ATOM   2816  O   LEU A 362      13.721  13.347 -54.908  1.00  0.24           O  
ATOM   2817  CB  LEU A 362      12.758  11.960 -52.364  1.00  0.24           C  
ATOM   2818  CG  LEU A 362      12.667  13.489 -52.066  1.00  0.24           C  
ATOM   2819  CD1 LEU A 362      11.508  14.264 -52.710  1.00  0.24           C  
ATOM   2820  CD2 LEU A 362      12.544  13.782 -50.573  1.00  0.24           C  
ATOM   2821  N   ASP A 363      13.895  11.458 -56.093  1.00  0.27           N  
ATOM   2822  CA  ASP A 363      14.564  12.135 -57.268  1.00  0.27           C  
ATOM   2823  C   ASP A 363      14.010  12.218 -58.783  1.00  0.27           C  
ATOM   2824  O   ASP A 363      14.067  13.321 -59.303  1.00  0.27           O  
ATOM   2825  CB  ASP A 363      16.065  11.778 -57.254  1.00  0.27           C  
ATOM   2826  CG  ASP A 363      16.652  12.263 -55.937  1.00  0.27           C  
ATOM   2827  OD1 ASP A 363      16.762  13.500 -55.736  1.00  0.27           O  
ATOM   2828  OD2 ASP A 363      16.936  11.407 -55.062  1.00  0.27           O  
ATOM   2829  N   GLN A 364      13.397  11.231 -59.553  1.00  0.19           N  
ATOM   2830  CA  GLN A 364      12.616  11.430 -60.829  1.00  0.19           C  
ATOM   2831  C   GLN A 364      11.614  12.580 -60.902  1.00  0.19           C  
ATOM   2832  O   GLN A 364      11.952  13.504 -61.616  1.00  0.19           O  
ATOM   2833  CB  GLN A 364      11.732  10.288 -61.465  1.00  0.19           C  
ATOM   2834  CG  GLN A 364      12.373   8.989 -61.995  1.00  0.19           C  
ATOM   2835  CD  GLN A 364      11.241   8.044 -62.425  1.00  0.19           C  
ATOM   2836  OE1 GLN A 364      10.451   8.362 -63.314  1.00  0.19           O  
ATOM   2837  NE2 GLN A 364      11.137   6.871 -61.766  1.00  0.19           N  
ATOM   2838  N   LEU A 365      10.399  12.582 -60.210  1.00  0.21           N  
ATOM   2839  CA  LEU A 365       9.506  13.768 -60.037  1.00  0.21           C  
ATOM   2840  C   LEU A 365      10.367  15.042 -60.017  1.00  0.21           C  
ATOM   2841  O   LEU A 365      10.449  15.683 -61.045  1.00  0.21           O  
ATOM   2842  CB  LEU A 365       8.353  13.843 -58.880  1.00  0.21           C  
ATOM   2843  CG  LEU A 365       7.231  12.754 -58.556  1.00  0.21           C  
ATOM   2844  CD1 LEU A 365       6.978  12.599 -57.059  1.00  0.21           C  
ATOM   2845  CD2 LEU A 365       5.768  13.014 -58.936  1.00  0.21           C  
ATOM   2846  N   SER A 366      11.127  15.331 -58.929  1.00  0.27           N  
ATOM   2847  CA  SER A 366      12.125  16.371 -58.657  1.00  0.27           C  
ATOM   2848  C   SER A 366      13.051  16.783 -59.803  1.00  0.27           C  
ATOM   2849  O   SER A 366      13.259  17.973 -60.050  1.00  0.27           O  
ATOM   2850  CB  SER A 366      13.004  16.005 -57.425  1.00  0.27           C  
ATOM   2851  OG  SER A 366      12.197  15.555 -56.335  1.00  0.27           O  
ATOM   2852  N   GLU A 367      13.612  15.807 -60.552  1.00  0.24           N  
ATOM   2853  CA  GLU A 367      14.351  15.916 -61.807  1.00  0.24           C  
ATOM   2854  C   GLU A 367      13.396  16.217 -62.939  1.00  0.24           C  
ATOM   2855  O   GLU A 367      13.195  15.474 -63.897  1.00  0.24           O  
ATOM   2856  CB  GLU A 367      15.185  14.632 -62.082  1.00  0.24           C  
ATOM   2857  CG  GLU A 367      16.044  14.628 -63.378  1.00  0.24           C  
ATOM   2858  CD  GLU A 367      17.083  15.740 -63.407  1.00  0.24           C  
ATOM   2859  OE1 GLU A 367      17.612  16.016 -64.510  1.00  0.24           O  
ATOM   2860  OE2 GLU A 367      17.370  16.347 -62.343  1.00  0.24           O  
ATOM   2861  N   GLY A 368      12.715  17.363 -62.797  1.00  0.21           N  
ATOM   2862  CA  GLY A 368      11.492  17.473 -63.550  1.00  0.21           C  
ATOM   2863  C   GLY A 368      10.719  18.753 -63.567  1.00  0.21           C  
ATOM   2864  O   GLY A 368       9.782  18.866 -64.331  1.00  0.21           O  
ATOM   2865  N   SER A 369      11.060  19.771 -62.747  1.00  0.25           N  
ATOM   2866  CA  SER A 369      10.634  21.153 -63.010  1.00  0.25           C  
ATOM   2867  C   SER A 369      11.782  21.887 -63.647  1.00  0.25           C  
ATOM   2868  O   SER A 369      11.821  23.105 -63.769  1.00  0.25           O  
ATOM   2869  CB  SER A 369      10.215  21.954 -61.745  1.00  0.25           C  
ATOM   2870  OG  SER A 369       8.829  21.761 -61.522  1.00  0.25           O  
ATOM   2871  N   ARG A 370      12.780  21.091 -64.041  1.00  0.18           N  
ATOM   2872  CA  ARG A 370      14.052  21.495 -64.565  1.00  0.18           C  
ATOM   2873  C   ARG A 370      13.987  21.562 -66.071  1.00  0.18           C  
ATOM   2874  O   ARG A 370      14.273  22.593 -66.671  1.00  0.18           O  
ATOM   2875  CB  ARG A 370      15.133  20.469 -64.122  1.00  0.18           C  
ATOM   2876  CG  ARG A 370      15.173  20.219 -62.597  1.00  0.18           C  
ATOM   2877  CD  ARG A 370      16.246  19.212 -62.176  1.00  0.18           C  
ATOM   2878  NE  ARG A 370      16.061  18.983 -60.692  1.00  0.18           N  
ATOM   2879  CZ  ARG A 370      17.014  18.468 -59.902  1.00  0.18           C  
ATOM   2880  NH1 ARG A 370      18.122  17.951 -60.414  1.00  0.18           N  
ATOM   2881  NH2 ARG A 370      16.836  18.424 -58.583  1.00  0.18           N  
ATOM   2882  N   HIS A 371      13.570  20.475 -66.752  1.00  0.16           N  
ATOM   2883  CA  HIS A 371      13.673  20.475 -68.191  1.00  0.16           C  
ATOM   2884  C   HIS A 371      12.373  20.970 -68.806  1.00  0.16           C  
ATOM   2885  O   HIS A 371      12.344  21.562 -69.888  1.00  0.16           O  
ATOM   2886  CB  HIS A 371      14.003  19.062 -68.716  1.00  0.16           C  
ATOM   2887  CG  HIS A 371      14.873  18.205 -67.856  1.00  0.16           C  
ATOM   2888  ND1 HIS A 371      16.056  18.690 -67.328  1.00  0.16           N  
ATOM   2889  CD2 HIS A 371      14.717  16.890 -67.551  1.00  0.16           C  
ATOM   2890  CE1 HIS A 371      16.585  17.658 -66.696  1.00  0.16           C  
ATOM   2891  NE2 HIS A 371      15.815  16.545 -66.801  1.00  0.16           N  
ATOM   2892  N   GLN A 372      11.260  20.762 -68.089  1.00  0.17           N  
ATOM   2893  CA  GLN A 372       9.964  21.285 -68.440  1.00  0.17           C  
ATOM   2894  C   GLN A 372       9.189  21.595 -67.187  1.00  0.17           C  
ATOM   2895  O   GLN A 372       9.260  20.905 -66.187  1.00  0.17           O  
ATOM   2896  CB  GLN A 372       9.171  20.233 -69.257  1.00  0.17           C  
ATOM   2897  CG  GLN A 372       7.682  20.526 -69.588  1.00  0.17           C  
ATOM   2898  CD  GLN A 372       7.131  19.484 -70.557  1.00  0.17           C  
ATOM   2899  OE1 GLN A 372       7.487  18.324 -70.469  1.00  0.17           O  
ATOM   2900  NE2 GLN A 372       6.243  19.808 -71.499  1.00  0.17           N  
ATOM   2901  N   LEU A 373       8.353  22.637 -67.252  1.00  0.17           N  
ATOM   2902  CA  LEU A 373       7.073  22.558 -66.598  1.00  0.17           C  
ATOM   2903  C   LEU A 373       6.077  23.129 -67.642  1.00  0.17           C  
ATOM   2904  O   LEU A 373       6.555  23.597 -68.666  1.00  0.17           O  
ATOM   2905  CB  LEU A 373       6.932  22.969 -65.077  1.00  0.17           C  
ATOM   2906  CG  LEU A 373       8.033  23.551 -64.154  1.00  0.17           C  
ATOM   2907  CD1 LEU A 373       9.026  24.618 -64.615  1.00  0.17           C  
ATOM   2908  CD2 LEU A 373       7.339  24.128 -62.909  1.00  0.17           C  
ATOM   2909  N   PRO A 374       4.749  23.083 -67.542  1.00  0.17           N  
ATOM   2910  CA  PRO A 374       3.850  23.252 -68.714  1.00  0.17           C  
ATOM   2911  C   PRO A 374       3.285  24.674 -69.222  1.00  0.17           C  
ATOM   2912  O   PRO A 374       4.095  25.509 -69.582  1.00  0.17           O  
ATOM   2913  CB  PRO A 374       2.716  22.340 -68.222  1.00  0.17           C  
ATOM   2914  CG  PRO A 374       3.225  21.344 -67.222  1.00  0.17           C  
ATOM   2915  CD  PRO A 374       4.164  22.237 -66.506  1.00  0.17           C  
ATOM   2916  N   GLY A 375       1.919  24.975 -69.266  1.00  0.19           N  
ATOM   2917  CA  GLY A 375       1.111  26.157 -69.753  1.00  0.19           C  
ATOM   2918  C   GLY A 375      -0.345  26.610 -69.251  1.00  0.19           C  
ATOM   2919  O   GLY A 375      -1.171  26.851 -70.116  1.00  0.19           O  
ATOM   2920  N   ASN A 376      -0.737  26.781 -67.929  1.00  0.17           N  
ATOM   2921  CA  ASN A 376      -2.087  27.065 -67.311  1.00  0.17           C  
ATOM   2922  C   ASN A 376      -2.120  26.845 -65.746  1.00  0.17           C  
ATOM   2923  O   ASN A 376      -2.056  25.725 -65.261  1.00  0.17           O  
ATOM   2924  CB  ASN A 376      -3.268  26.164 -67.808  1.00  0.17           C  
ATOM   2925  CG  ASN A 376      -4.624  26.504 -67.167  1.00  0.17           C  
ATOM   2926  OD1 ASN A 376      -4.856  27.616 -66.692  1.00  0.17           O  
ATOM   2927  ND2 ASN A 376      -5.493  25.473 -67.046  1.00  0.17           N  
ATOM   2928  N   ARG A 377      -2.342  27.887 -64.911  1.00  0.20           N  
ATOM   2929  CA  ARG A 377      -1.930  27.975 -63.501  1.00  0.20           C  
ATOM   2930  C   ARG A 377      -2.355  26.939 -62.481  1.00  0.20           C  
ATOM   2931  O   ARG A 377      -1.615  26.603 -61.561  1.00  0.20           O  
ATOM   2932  CB  ARG A 377      -2.486  29.292 -62.894  1.00  0.20           C  
ATOM   2933  CG  ARG A 377      -1.928  29.826 -61.543  1.00  0.20           C  
ATOM   2934  CD  ARG A 377      -2.902  30.822 -60.888  1.00  0.20           C  
ATOM   2935  NE  ARG A 377      -2.195  31.702 -59.903  1.00  0.20           N  
ATOM   2936  CZ  ARG A 377      -2.731  32.859 -59.472  1.00  0.20           C  
ATOM   2937  NH1 ARG A 377      -3.818  33.356 -60.054  1.00  0.20           N  
ATOM   2938  NH2 ARG A 377      -2.223  33.484 -58.412  1.00  0.20           N  
ATOM   2939  N   GLN A 378      -3.599  26.457 -62.565  1.00  0.22           N  
ATOM   2940  CA  GLN A 378      -4.225  25.637 -61.552  1.00  0.22           C  
ATOM   2941  C   GLN A 378      -3.489  24.340 -61.273  1.00  0.22           C  
ATOM   2942  O   GLN A 378      -3.397  23.895 -60.133  1.00  0.22           O  
ATOM   2943  CB  GLN A 378      -5.699  25.452 -61.951  1.00  0.22           C  
ATOM   2944  CG  GLN A 378      -6.545  24.586 -61.007  1.00  0.22           C  
ATOM   2945  CD  GLN A 378      -8.021  24.664 -61.412  1.00  0.22           C  
ATOM   2946  OE1 GLN A 378      -8.377  24.521 -62.580  1.00  0.22           O  
ATOM   2947  NE2 GLN A 378      -8.913  24.880 -60.423  1.00  0.22           N  
ATOM   2948  N   LEU A 379      -2.830  23.737 -62.290  1.00  0.20           N  
ATOM   2949  CA  LEU A 379      -1.945  22.620 -62.011  1.00  0.20           C  
ATOM   2950  C   LEU A 379      -0.541  23.092 -61.513  1.00  0.20           C  
ATOM   2951  O   LEU A 379       0.477  22.445 -61.719  1.00  0.20           O  
ATOM   2952  CB  LEU A 379      -2.151  21.364 -62.954  1.00  0.20           C  
ATOM   2953  CG  LEU A 379      -1.201  20.124 -63.008  1.00  0.20           C  
ATOM   2954  CD1 LEU A 379      -1.669  18.955 -62.131  1.00  0.20           C  
ATOM   2955  CD2 LEU A 379      -1.071  19.548 -64.435  1.00  0.20           C  
ATOM   2956  N   ALA A 380      -0.463  24.181 -60.707  1.00  0.25           N  
ATOM   2957  CA  ALA A 380       0.440  24.267 -59.566  1.00  0.25           C  
ATOM   2958  C   ALA A 380      -0.186  24.415 -58.138  1.00  0.25           C  
ATOM   2959  O   ALA A 380       0.414  24.970 -57.237  1.00  0.25           O  
ATOM   2960  CB  ALA A 380       1.899  24.741 -59.769  1.00  0.25           C  
ATOM   2961  N   GLY A 381      -1.373  23.783 -57.893  1.00  0.24           N  
ATOM   2962  CA  GLY A 381      -1.910  23.121 -56.654  1.00  0.24           C  
ATOM   2963  C   GLY A 381      -2.017  21.597 -56.150  1.00  0.24           C  
ATOM   2964  O   GLY A 381      -2.774  21.372 -55.213  1.00  0.24           O  
ATOM   2965  N   ARG A 382      -1.228  20.588 -56.673  1.00  0.21           N  
ATOM   2966  CA  ARG A 382      -0.628  19.241 -56.345  1.00  0.21           C  
ATOM   2967  C   ARG A 382       0.843  18.446 -56.826  1.00  0.21           C  
ATOM   2968  O   ARG A 382       0.763  17.285 -56.497  1.00  0.21           O  
ATOM   2969  CB  ARG A 382      -1.827  18.298 -56.669  1.00  0.21           C  
ATOM   2970  CG  ARG A 382      -3.280  18.680 -56.184  1.00  0.21           C  
ATOM   2971  CD  ARG A 382      -4.313  17.554 -56.390  1.00  0.21           C  
ATOM   2972  NE  ARG A 382      -5.672  17.635 -55.746  1.00  0.21           N  
ATOM   2973  CZ  ARG A 382      -6.801  17.254 -56.386  1.00  0.21           C  
ATOM   2974  NH1 ARG A 382      -6.833  17.064 -57.707  1.00  0.21           N  
ATOM   2975  NH2 ARG A 382      -7.948  17.220 -55.725  1.00  0.21           N  
ATOM   2976  N   SER A 383       2.199  18.584 -57.476  1.00  0.28           N  
ATOM   2977  CA  SER A 383       3.609  19.257 -58.046  1.00  0.28           C  
ATOM   2978  C   SER A 383       5.308  19.063 -57.553  1.00  0.28           C  
ATOM   2979  O   SER A 383       5.879  18.168 -58.171  1.00  0.28           O  
ATOM   2980  CB  SER A 383       3.587  20.028 -59.367  1.00  0.28           C  
ATOM   2981  OG  SER A 383       4.867  20.025 -59.979  1.00  0.28           O  
ATOM   2982  N   TYR A 384       6.334  19.567 -56.641  1.00  0.30           N  
ATOM   2983  CA  TYR A 384       6.849  20.068 -55.255  1.00  0.30           C  
ATOM   2984  C   TYR A 384       6.439  19.600 -53.863  1.00  0.30           C  
ATOM   2985  O   TYR A 384       7.036  18.766 -53.251  1.00  0.30           O  
ATOM   2986  CB  TYR A 384       7.494  21.470 -54.840  1.00  0.30           C  
ATOM   2987  CG  TYR A 384       8.284  22.299 -55.783  1.00  0.30           C  
ATOM   2988  CD1 TYR A 384       9.312  21.815 -56.605  1.00  0.30           C  
ATOM   2989  CD2 TYR A 384       7.917  23.656 -55.856  1.00  0.30           C  
ATOM   2990  CE1 TYR A 384       9.847  22.646 -57.604  1.00  0.30           C  
ATOM   2991  CE2 TYR A 384       8.379  24.442 -56.909  1.00  0.30           C  
ATOM   2992  CZ  TYR A 384       9.312  23.922 -57.803  1.00  0.30           C  
ATOM   2993  OH  TYR A 384       9.478  24.565 -59.036  1.00  0.30           O  
ATOM   2994  N   ASP A 385       5.475  20.252 -53.257  1.00  0.31           N  
ATOM   2995  CA  ASP A 385       5.011  20.435 -51.917  1.00  0.31           C  
ATOM   2996  C   ASP A 385       4.837  19.019 -51.264  1.00  0.31           C  
ATOM   2997  O   ASP A 385       5.449  18.708 -50.245  1.00  0.31           O  
ATOM   2998  CB  ASP A 385       3.887  21.379 -52.549  1.00  0.31           C  
ATOM   2999  CG  ASP A 385       2.816  22.427 -52.172  1.00  0.31           C  
ATOM   3000  OD1 ASP A 385       1.716  22.048 -51.777  1.00  0.31           O  
ATOM   3001  OD2 ASP A 385       2.962  23.583 -52.601  1.00  0.31           O  
ATOM   3002  N   LEU A 386       4.192  18.038 -51.925  1.00  0.43           N  
ATOM   3003  CA  LEU A 386       4.123  16.620 -51.588  1.00  0.43           C  
ATOM   3004  C   LEU A 386       5.528  16.007 -51.441  1.00  0.43           C  
ATOM   3005  O   LEU A 386       5.782  15.348 -50.448  1.00  0.43           O  
ATOM   3006  CB  LEU A 386       3.278  15.986 -52.750  1.00  0.43           C  
ATOM   3007  CG  LEU A 386       2.542  14.633 -52.687  1.00  0.43           C  
ATOM   3008  CD1 LEU A 386       1.008  14.770 -52.851  1.00  0.43           C  
ATOM   3009  CD2 LEU A 386       2.978  13.721 -53.844  1.00  0.43           C  
ATOM   3010  N   GLN A 387       6.546  16.350 -52.291  1.00  0.45           N  
ATOM   3011  CA  GLN A 387       7.975  16.087 -52.068  1.00  0.45           C  
ATOM   3012  C   GLN A 387       8.427  16.630 -50.716  1.00  0.45           C  
ATOM   3013  O   GLN A 387       9.330  16.081 -50.118  1.00  0.45           O  
ATOM   3014  CB  GLN A 387       9.017  16.679 -53.100  1.00  0.45           C  
ATOM   3015  CG  GLN A 387       9.023  16.118 -54.549  1.00  0.45           C  
ATOM   3016  CD  GLN A 387       9.325  17.181 -55.619  1.00  0.45           C  
ATOM   3017  OE1 GLN A 387       9.895  18.239 -55.380  1.00  0.45           O  
ATOM   3018  NE2 GLN A 387       8.885  16.924 -56.875  1.00  0.45           N  
ATOM   3019  N   ALA A 388       7.821  17.692 -50.151  1.00  0.50           N  
ATOM   3020  CA  ALA A 388       8.288  18.267 -48.910  1.00  0.50           C  
ATOM   3021  C   ALA A 388       7.625  17.749 -47.637  1.00  0.50           C  
ATOM   3022  O   ALA A 388       8.125  18.008 -46.549  1.00  0.50           O  
ATOM   3023  CB  ALA A 388       8.188  19.792 -48.966  1.00  0.50           C  
ATOM   3024  N   LEU A 389       6.555  16.921 -47.701  1.00  0.48           N  
ATOM   3025  CA  LEU A 389       6.255  16.018 -46.583  1.00  0.48           C  
ATOM   3026  C   LEU A 389       7.068  14.756 -46.777  1.00  0.48           C  
ATOM   3027  O   LEU A 389       7.361  14.029 -45.844  1.00  0.48           O  
ATOM   3028  CB  LEU A 389       4.762  15.616 -46.463  1.00  0.48           C  
ATOM   3029  CG  LEU A 389       4.320  14.540 -45.417  1.00  0.48           C  
ATOM   3030  CD1 LEU A 389       4.828  14.795 -43.998  1.00  0.48           C  
ATOM   3031  CD2 LEU A 389       2.786  14.395 -45.346  1.00  0.48           C  
ATOM   3032  N   LEU A 390       7.515  14.454 -48.001  1.00  0.46           N  
ATOM   3033  CA  LEU A 390       8.417  13.345 -48.253  1.00  0.46           C  
ATOM   3034  C   LEU A 390       9.826  13.588 -47.796  1.00  0.46           C  
ATOM   3035  O   LEU A 390      10.418  12.755 -47.129  1.00  0.46           O  
ATOM   3036  CB  LEU A 390       8.309  12.898 -49.719  1.00  0.46           C  
ATOM   3037  CG  LEU A 390       6.867  12.488 -50.033  1.00  0.46           C  
ATOM   3038  CD1 LEU A 390       6.668  12.179 -51.521  1.00  0.46           C  
ATOM   3039  CD2 LEU A 390       6.449  11.380 -49.063  1.00  0.46           C  
ATOM   3040  N   ALA A 391      10.355  14.788 -48.034  1.00  0.54           N  
ATOM   3041  CA  ALA A 391      11.567  15.304 -47.464  1.00  0.54           C  
ATOM   3042  C   ALA A 391      11.488  15.367 -45.936  1.00  0.54           C  
ATOM   3043  O   ALA A 391      12.428  15.027 -45.231  1.00  0.54           O  
ATOM   3044  CB  ALA A 391      11.808  16.663 -48.139  1.00  0.54           C  
ATOM   3045  N   LEU A 392      10.312  15.717 -45.378  1.00  0.50           N  
ATOM   3046  CA  LEU A 392      10.010  15.549 -43.962  1.00  0.50           C  
ATOM   3047  C   LEU A 392      10.015  14.078 -43.479  1.00  0.50           C  
ATOM   3048  O   LEU A 392      10.576  13.752 -42.441  1.00  0.50           O  
ATOM   3049  CB  LEU A 392       8.638  16.231 -43.687  1.00  0.50           C  
ATOM   3050  CG  LEU A 392       8.268  16.510 -42.219  1.00  0.50           C  
ATOM   3051  CD1 LEU A 392       9.227  17.511 -41.591  1.00  0.50           C  
ATOM   3052  CD2 LEU A 392       6.847  17.082 -42.093  1.00  0.50           C  
ATOM   3053  N   THR A 393       9.402  13.151 -44.250  1.00  0.46           N  
ATOM   3054  CA  THR A 393       9.269  11.709 -43.987  1.00  0.46           C  
ATOM   3055  C   THR A 393      10.577  10.930 -44.101  1.00  0.46           C  
ATOM   3056  O   THR A 393      10.894  10.086 -43.267  1.00  0.46           O  
ATOM   3057  CB  THR A 393       8.236  11.050 -44.932  1.00  0.46           C  
ATOM   3058  OG1 THR A 393       6.933  11.620 -44.780  1.00  0.46           O  
ATOM   3059  CG2 THR A 393       8.060   9.544 -44.686  1.00  0.46           C  
ATOM   3060  N   CYS A 394      11.391  11.181 -45.146  1.00  0.44           N  
ATOM   3061  CA  CYS A 394      12.620  10.443 -45.411  1.00  0.44           C  
ATOM   3062  C   CYS A 394      13.868  11.229 -45.030  1.00  0.44           C  
ATOM   3063  O   CYS A 394      14.992  10.774 -45.226  1.00  0.44           O  
ATOM   3064  CB  CYS A 394      12.676   9.951 -46.888  1.00  0.44           C  
ATOM   3065  SG  CYS A 394      12.952  11.242 -48.147  1.00  0.44           S  
ATOM   3066  N   GLY A 395      13.697  12.420 -44.423  1.00  0.52           N  
ATOM   3067  CA  GLY A 395      14.774  13.144 -43.758  1.00  0.52           C  
ATOM   3068  C   GLY A 395      15.585  14.122 -44.569  1.00  0.52           C  
ATOM   3069  O   GLY A 395      16.569  14.661 -44.070  1.00  0.52           O  
ATOM   3070  N   ARG A 396      15.186  14.438 -45.814  1.00  0.43           N  
ATOM   3071  CA  ARG A 396      15.786  15.498 -46.628  1.00  0.43           C  
ATOM   3072  C   ARG A 396      15.236  16.878 -46.234  1.00  0.43           C  
ATOM   3073  O   ARG A 396      14.737  17.657 -47.042  1.00  0.43           O  
ATOM   3074  CB  ARG A 396      15.615  15.181 -48.147  1.00  0.43           C  
ATOM   3075  CG  ARG A 396      16.544  14.025 -48.591  1.00  0.43           C  
ATOM   3076  CD  ARG A 396      16.176  13.249 -49.869  1.00  0.43           C  
ATOM   3077  NE  ARG A 396      16.158  14.153 -51.062  1.00  0.43           N  
ATOM   3078  CZ  ARG A 396      16.304  13.742 -52.332  1.00  0.43           C  
ATOM   3079  NH1 ARG A 396      16.429  12.461 -52.654  1.00  0.43           N  
ATOM   3080  NH2 ARG A 396      16.310  14.656 -53.295  1.00  0.43           N  
ATOM   3081  N   TYR A 397      15.314  17.213 -44.929  1.00  0.46           N  
ATOM   3082  CA  TYR A 397      14.658  18.343 -44.284  1.00  0.46           C  
ATOM   3083  C   TYR A 397      15.015  19.711 -44.853  1.00  0.46           C  
ATOM   3084  O   TYR A 397      14.204  20.634 -44.841  1.00  0.46           O  
ATOM   3085  CB  TYR A 397      14.967  18.381 -42.765  1.00  0.46           C  
ATOM   3086  CG  TYR A 397      14.496  17.139 -42.060  1.00  0.46           C  
ATOM   3087  CD1 TYR A 397      13.127  16.900 -41.865  1.00  0.46           C  
ATOM   3088  CD2 TYR A 397      15.426  16.231 -41.528  1.00  0.46           C  
ATOM   3089  CE1 TYR A 397      12.700  15.793 -41.114  1.00  0.46           C  
ATOM   3090  CE2 TYR A 397      15.002  15.132 -40.767  1.00  0.46           C  
ATOM   3091  CZ  TYR A 397      13.636  14.921 -40.554  1.00  0.46           C  
ATOM   3092  OH  TYR A 397      13.196  13.831 -39.779  1.00  0.46           O  
ATOM   3093  N   ASP A 398      16.237  19.859 -45.378  1.00  0.51           N  
ATOM   3094  CA  ASP A 398      16.795  21.025 -46.023  1.00  0.51           C  
ATOM   3095  C   ASP A 398      16.012  21.483 -47.258  1.00  0.51           C  
ATOM   3096  O   ASP A 398      15.797  22.678 -47.466  1.00  0.51           O  
ATOM   3097  CB  ASP A 398      18.288  20.728 -46.345  1.00  0.51           C  
ATOM   3098  CG  ASP A 398      18.484  19.359 -46.988  1.00  0.51           C  
ATOM   3099  OD1 ASP A 398      18.246  18.340 -46.284  1.00  0.51           O  
ATOM   3100  OD2 ASP A 398      18.859  19.326 -48.182  1.00  0.51           O  
ATOM   3101  N   GLU A 399      15.504  20.539 -48.077  1.00  0.55           N  
ATOM   3102  CA  GLU A 399      14.622  20.828 -49.194  1.00  0.55           C  
ATOM   3103  C   GLU A 399      13.264  21.400 -48.769  1.00  0.55           C  
ATOM   3104  O   GLU A 399      12.652  22.187 -49.493  1.00  0.55           O  
ATOM   3105  CB  GLU A 399      14.408  19.579 -50.093  1.00  0.55           C  
ATOM   3106  CG  GLU A 399      15.705  19.049 -50.759  1.00  0.55           C  
ATOM   3107  CD  GLU A 399      15.443  17.924 -51.761  1.00  0.55           C  
ATOM   3108  OE1 GLU A 399      15.821  16.756 -51.471  1.00  0.55           O  
ATOM   3109  OE2 GLU A 399      14.882  18.206 -52.850  1.00  0.55           O  
ATOM   3110  N   VAL A 400      12.754  21.047 -47.562  1.00  0.57           N  
ATOM   3111  CA  VAL A 400      11.407  21.394 -47.101  1.00  0.57           C  
ATOM   3112  C   VAL A 400      11.107  22.898 -47.103  1.00  0.57           C  
ATOM   3113  O   VAL A 400      10.060  23.239 -47.655  1.00  0.57           O  
ATOM   3114  CB  VAL A 400      11.061  20.772 -45.733  1.00  0.57           C  
ATOM   3115  CG1 VAL A 400       9.639  21.137 -45.250  1.00  0.57           C  
ATOM   3116  CG2 VAL A 400      11.187  19.241 -45.800  1.00  0.57           C  
ATOM   3117  N   PRO A 401      11.897  23.868 -46.617  1.00  0.50           N  
ATOM   3118  CA  PRO A 401      11.546  25.281 -46.737  1.00  0.50           C  
ATOM   3119  C   PRO A 401      11.575  25.828 -48.148  1.00  0.50           C  
ATOM   3120  O   PRO A 401      10.831  26.761 -48.424  1.00  0.50           O  
ATOM   3121  CB  PRO A 401      12.566  26.013 -45.852  1.00  0.50           C  
ATOM   3122  CG  PRO A 401      12.972  24.959 -44.824  1.00  0.50           C  
ATOM   3123  CD  PRO A 401      12.994  23.683 -45.663  1.00  0.50           C  
ATOM   3124  N   LEU A 402      12.427  25.316 -49.059  1.00  0.49           N  
ATOM   3125  CA  LEU A 402      12.438  25.776 -50.442  1.00  0.49           C  
ATOM   3126  C   LEU A 402      11.181  25.379 -51.180  1.00  0.49           C  
ATOM   3127  O   LEU A 402      10.497  26.191 -51.801  1.00  0.49           O  
ATOM   3128  CB  LEU A 402      13.632  25.164 -51.210  1.00  0.49           C  
ATOM   3129  CG  LEU A 402      15.002  25.686 -50.751  1.00  0.49           C  
ATOM   3130  CD1 LEU A 402      16.113  24.836 -51.379  1.00  0.49           C  
ATOM   3131  CD2 LEU A 402      15.190  27.169 -51.110  1.00  0.49           C  
ATOM   3132  N   LEU A 403      10.812  24.095 -51.044  1.00  0.49           N  
ATOM   3133  CA  LEU A 403       9.597  23.540 -51.576  1.00  0.49           C  
ATOM   3134  C   LEU A 403       8.368  24.193 -50.917  1.00  0.49           C  
ATOM   3135  O   LEU A 403       7.430  24.564 -51.611  1.00  0.49           O  
ATOM   3136  CB  LEU A 403       9.650  22.004 -51.387  1.00  0.49           C  
ATOM   3137  CG  LEU A 403      10.859  21.260 -52.030  1.00  0.49           C  
ATOM   3138  CD1 LEU A 403      10.941  19.804 -51.537  1.00  0.49           C  
ATOM   3139  CD2 LEU A 403      10.876  21.252 -53.563  1.00  0.49           C  
ATOM   3140  N   LEU A 404       8.374  24.426 -49.576  1.00  0.45           N  
ATOM   3141  CA  LEU A 404       7.315  25.138 -48.854  1.00  0.45           C  
ATOM   3142  C   LEU A 404       7.238  26.649 -49.119  1.00  0.45           C  
ATOM   3143  O   LEU A 404       6.184  27.267 -49.010  1.00  0.45           O  
ATOM   3144  CB  LEU A 404       7.347  24.856 -47.323  1.00  0.45           C  
ATOM   3145  CG  LEU A 404       6.183  25.448 -46.480  1.00  0.45           C  
ATOM   3146  CD1 LEU A 404       4.776  24.970 -46.871  1.00  0.45           C  
ATOM   3147  CD2 LEU A 404       6.388  25.105 -45.004  1.00  0.45           C  
ATOM   3148  N   GLY A 405       8.335  27.314 -49.510  1.00  0.44           N  
ATOM   3149  CA  GLY A 405       8.310  28.715 -49.929  1.00  0.44           C  
ATOM   3150  C   GLY A 405       7.749  28.918 -51.316  1.00  0.44           C  
ATOM   3151  O   GLY A 405       6.942  29.815 -51.556  1.00  0.44           O  
ATOM   3152  N   GLU A 406       8.130  28.044 -52.268  1.00  0.40           N  
ATOM   3153  CA  GLU A 406       7.518  27.968 -53.583  1.00  0.40           C  
ATOM   3154  C   GLU A 406       6.063  27.540 -53.545  1.00  0.40           C  
ATOM   3155  O   GLU A 406       5.251  28.079 -54.300  1.00  0.40           O  
ATOM   3156  CB  GLU A 406       8.368  27.123 -54.568  1.00  0.40           C  
ATOM   3157  CG  GLU A 406       9.538  27.939 -55.184  1.00  0.40           C  
ATOM   3158  CD  GLU A 406       9.009  29.140 -55.948  1.00  0.40           C  
ATOM   3159  OE1 GLU A 406       9.110  30.288 -55.442  1.00  0.40           O  
ATOM   3160  OE2 GLU A 406       8.333  28.934 -56.991  1.00  0.40           O  
ATOM   3161  N   ALA A 407       5.713  26.615 -52.637  1.00  0.42           N  
ATOM   3162  CA  ALA A 407       4.360  26.286 -52.243  1.00  0.42           C  
ATOM   3163  C   ALA A 407       3.507  27.399 -51.657  1.00  0.42           C  
ATOM   3164  O   ALA A 407       2.383  27.640 -52.062  1.00  0.42           O  
ATOM   3165  CB  ALA A 407       4.465  25.291 -51.085  1.00  0.42           C  
ATOM   3166  N   ARG A 408       4.002  28.147 -50.659  1.00  0.39           N  
ATOM   3167  CA  ARG A 408       3.122  29.025 -49.911  1.00  0.39           C  
ATOM   3168  C   ARG A 408       2.771  30.327 -50.613  1.00  0.39           C  
ATOM   3169  O   ARG A 408       1.801  30.981 -50.242  1.00  0.39           O  
ATOM   3170  CB  ARG A 408       3.719  29.332 -48.522  1.00  0.39           C  
ATOM   3171  CG  ARG A 408       3.387  28.279 -47.445  1.00  0.39           C  
ATOM   3172  CD  ARG A 408       4.011  28.663 -46.098  1.00  0.39           C  
ATOM   3173  NE  ARG A 408       3.426  27.791 -45.026  1.00  0.39           N  
ATOM   3174  CZ  ARG A 408       3.405  28.107 -43.717  1.00  0.39           C  
ATOM   3175  NH1 ARG A 408       3.973  29.210 -43.239  1.00  0.39           N  
ATOM   3176  NH2 ARG A 408       2.781  27.298 -42.870  1.00  0.39           N  
ATOM   3177  N   SER A 409       3.509  30.745 -51.669  1.00  0.35           N  
ATOM   3178  CA  SER A 409       2.970  31.761 -52.567  1.00  0.35           C  
ATOM   3179  C   SER A 409       2.328  31.177 -53.807  1.00  0.35           C  
ATOM   3180  O   SER A 409       1.641  31.910 -54.506  1.00  0.35           O  
ATOM   3181  CB  SER A 409       3.872  33.001 -52.849  1.00  0.35           C  
ATOM   3182  OG  SER A 409       5.046  32.785 -53.644  1.00  0.35           O  
ATOM   3183  N   ARG A 410       2.371  29.825 -54.001  1.00  0.37           N  
ATOM   3184  CA  ARG A 410       1.400  28.998 -54.736  1.00  0.37           C  
ATOM   3185  C   ARG A 410       0.172  28.815 -53.880  1.00  0.37           C  
ATOM   3186  O   ARG A 410      -0.270  27.688 -53.717  1.00  0.37           O  
ATOM   3187  CB  ARG A 410       1.969  27.607 -55.191  1.00  0.37           C  
ATOM   3188  CG  ARG A 410       2.859  27.621 -56.457  1.00  0.37           C  
ATOM   3189  CD  ARG A 410       3.614  26.293 -56.687  1.00  0.37           C  
ATOM   3190  NE  ARG A 410       4.545  26.310 -57.877  1.00  0.37           N  
ATOM   3191  CZ  ARG A 410       5.630  27.085 -58.022  1.00  0.37           C  
ATOM   3192  NH1 ARG A 410       5.937  27.997 -57.115  1.00  0.37           N  
ATOM   3193  NH2 ARG A 410       6.489  26.835 -59.013  1.00  0.37           N  
ATOM   3194  N   GLN A 411      -0.355  29.974 -53.385  1.00  0.35           N  
ATOM   3195  CA  GLN A 411      -1.365  30.372 -52.394  1.00  0.35           C  
ATOM   3196  C   GLN A 411      -2.153  29.352 -51.567  1.00  0.35           C  
ATOM   3197  O   GLN A 411      -2.831  29.690 -50.600  1.00  0.35           O  
ATOM   3198  CB  GLN A 411      -2.382  31.345 -53.054  1.00  0.35           C  
ATOM   3199  CG  GLN A 411      -1.858  32.658 -53.685  1.00  0.35           C  
ATOM   3200  CD  GLN A 411      -2.962  33.325 -54.521  1.00  0.35           C  
ATOM   3201  OE1 GLN A 411      -4.003  32.759 -54.853  1.00  0.35           O  
ATOM   3202  NE2 GLN A 411      -2.744  34.607 -54.903  1.00  0.35           N  
ATOM   3203  N   ALA A 412      -2.064  28.074 -51.892  1.00  0.43           N  
ATOM   3204  CA  ALA A 412      -2.232  26.943 -51.049  1.00  0.43           C  
ATOM   3205  C   ALA A 412      -1.333  26.937 -49.813  1.00  0.43           C  
ATOM   3206  O   ALA A 412      -0.266  27.539 -49.732  1.00  0.43           O  
ATOM   3207  CB  ALA A 412      -1.985  25.739 -51.968  1.00  0.43           C  
ATOM   3208  N   GLY A 413      -1.777  26.242 -48.759  1.00  0.39           N  
ATOM   3209  CA  GLY A 413      -0.992  26.246 -47.537  1.00  0.39           C  
ATOM   3210  C   GLY A 413      -1.325  25.146 -46.588  1.00  0.39           C  
ATOM   3211  O   GLY A 413      -0.503  24.783 -45.777  1.00  0.39           O  
ATOM   3212  N   SER A 414      -2.525  24.564 -46.675  1.00  0.38           N  
ATOM   3213  CA  SER A 414      -3.071  23.594 -45.741  1.00  0.38           C  
ATOM   3214  C   SER A 414      -2.303  22.322 -45.381  1.00  0.38           C  
ATOM   3215  O   SER A 414      -2.001  22.144 -44.212  1.00  0.38           O  
ATOM   3216  CB  SER A 414      -4.538  23.289 -46.185  1.00  0.38           C  
ATOM   3217  OG  SER A 414      -4.883  21.912 -46.391  1.00  0.38           O  
ATOM   3218  N   LEU A 415      -1.958  21.401 -46.308  1.00  0.41           N  
ATOM   3219  CA  LEU A 415      -1.650  20.031 -45.904  1.00  0.41           C  
ATOM   3220  C   LEU A 415      -0.521  19.799 -44.920  1.00  0.41           C  
ATOM   3221  O   LEU A 415      -0.719  19.180 -43.885  1.00  0.41           O  
ATOM   3222  CB  LEU A 415      -1.257  19.133 -47.095  1.00  0.41           C  
ATOM   3223  CG  LEU A 415      -0.905  17.683 -46.695  1.00  0.41           C  
ATOM   3224  CD1 LEU A 415      -2.053  16.927 -46.013  1.00  0.41           C  
ATOM   3225  CD2 LEU A 415      -0.364  16.954 -47.907  1.00  0.41           C  
ATOM   3226  N   THR A 416       0.708  20.247 -45.224  1.00  0.41           N  
ATOM   3227  CA  THR A 416       1.869  19.881 -44.402  1.00  0.41           C  
ATOM   3228  C   THR A 416       2.235  21.082 -43.590  1.00  0.41           C  
ATOM   3229  O   THR A 416       3.082  21.022 -42.713  1.00  0.41           O  
ATOM   3230  CB  THR A 416       3.076  19.351 -45.160  1.00  0.41           C  
ATOM   3231  OG1 THR A 416       2.665  18.313 -46.037  1.00  0.41           O  
ATOM   3232  CG2 THR A 416       4.227  18.760 -44.332  1.00  0.41           C  
ATOM   3233  N   THR A 417       1.494  22.199 -43.761  1.00  0.43           N  
ATOM   3234  CA  THR A 417       1.285  23.115 -42.638  1.00  0.43           C  
ATOM   3235  C   THR A 417       0.513  22.382 -41.560  1.00  0.43           C  
ATOM   3236  O   THR A 417       1.020  22.248 -40.458  1.00  0.43           O  
ATOM   3237  CB  THR A 417       0.581  24.413 -42.996  1.00  0.43           C  
ATOM   3238  OG1 THR A 417       1.359  25.125 -43.956  1.00  0.43           O  
ATOM   3239  CG2 THR A 417       0.376  25.334 -41.791  1.00  0.43           C  
ATOM   3240  N   ALA A 418      -0.622  21.732 -41.902  1.00  0.45           N  
ATOM   3241  CA  ALA A 418      -1.390  20.881 -41.014  1.00  0.45           C  
ATOM   3242  C   ALA A 418      -0.657  19.642 -40.509  1.00  0.45           C  
ATOM   3243  O   ALA A 418      -0.773  19.287 -39.348  1.00  0.45           O  
ATOM   3244  CB  ALA A 418      -2.726  20.466 -41.663  1.00  0.45           C  
ATOM   3245  N   THR A 419       0.134  18.922 -41.334  1.00  0.43           N  
ATOM   3246  CA  THR A 419       1.005  17.844 -40.853  1.00  0.43           C  
ATOM   3247  C   THR A 419       2.095  18.349 -39.927  1.00  0.43           C  
ATOM   3248  O   THR A 419       2.326  17.754 -38.882  1.00  0.43           O  
ATOM   3249  CB  THR A 419       1.654  16.979 -41.930  1.00  0.43           C  
ATOM   3250  OG1 THR A 419       0.671  16.472 -42.816  1.00  0.43           O  
ATOM   3251  CG2 THR A 419       2.353  15.753 -41.322  1.00  0.43           C  
ATOM   3252  N   VAL A 420       2.779  19.478 -40.231  1.00  0.52           N  
ATOM   3253  CA  VAL A 420       3.731  20.100 -39.307  1.00  0.52           C  
ATOM   3254  C   VAL A 420       3.061  20.613 -38.036  1.00  0.52           C  
ATOM   3255  O   VAL A 420       3.596  20.411 -36.954  1.00  0.52           O  
ATOM   3256  CB  VAL A 420       4.614  21.163 -39.969  1.00  0.52           C  
ATOM   3257  CG1 VAL A 420       5.445  21.973 -38.952  1.00  0.52           C  
ATOM   3258  CG2 VAL A 420       5.590  20.447 -40.926  1.00  0.52           C  
ATOM   3259  N   GLU A 421       1.864  21.229 -38.104  1.00  0.40           N  
ATOM   3260  CA  GLU A 421       1.033  21.566 -36.953  1.00  0.40           C  
ATOM   3261  C   GLU A 421       0.573  20.351 -36.154  1.00  0.40           C  
ATOM   3262  O   GLU A 421       0.736  20.299 -34.945  1.00  0.40           O  
ATOM   3263  CB  GLU A 421      -0.212  22.365 -37.406  1.00  0.40           C  
ATOM   3264  CG  GLU A 421       0.123  23.811 -37.848  1.00  0.40           C  
ATOM   3265  CD  GLU A 421      -0.974  24.485 -38.670  1.00  0.40           C  
ATOM   3266  OE1 GLU A 421      -0.841  25.723 -38.858  1.00  0.40           O  
ATOM   3267  OE2 GLU A 421      -1.896  23.793 -39.170  1.00  0.40           O  
ATOM   3268  N   SER A 422       0.071  19.288 -36.811  1.00  0.37           N  
ATOM   3269  CA  SER A 422      -0.313  18.018 -36.194  1.00  0.37           C  
ATOM   3270  C   SER A 422       0.862  17.338 -35.525  1.00  0.37           C  
ATOM   3271  O   SER A 422       0.750  16.793 -34.431  1.00  0.37           O  
ATOM   3272  CB  SER A 422      -0.944  17.050 -37.237  1.00  0.37           C  
ATOM   3273  OG  SER A 422      -1.463  15.834 -36.681  1.00  0.37           O  
ATOM   3274  N   LEU A 423       2.058  17.384 -36.146  1.00  0.36           N  
ATOM   3275  CA  LEU A 423       3.292  17.050 -35.467  1.00  0.36           C  
ATOM   3276  C   LEU A 423       3.595  18.003 -34.316  1.00  0.36           C  
ATOM   3277  O   LEU A 423       3.798  17.545 -33.208  1.00  0.36           O  
ATOM   3278  CB  LEU A 423       4.490  16.997 -36.453  1.00  0.36           C  
ATOM   3279  CG  LEU A 423       4.466  15.803 -37.434  1.00  0.36           C  
ATOM   3280  CD1 LEU A 423       5.514  15.996 -38.542  1.00  0.36           C  
ATOM   3281  CD2 LEU A 423       4.697  14.462 -36.720  1.00  0.36           C  
ATOM   3282  N   ALA A 424       3.548  19.336 -34.481  1.00  0.39           N  
ATOM   3283  CA  ALA A 424       3.855  20.307 -33.441  1.00  0.39           C  
ATOM   3284  C   ALA A 424       2.978  20.200 -32.192  1.00  0.39           C  
ATOM   3285  O   ALA A 424       3.489  20.205 -31.074  1.00  0.39           O  
ATOM   3286  CB  ALA A 424       3.766  21.731 -34.025  1.00  0.39           C  
ATOM   3287  N   ASP A 425       1.658  20.006 -32.372  1.00  0.33           N  
ATOM   3288  CA  ASP A 425       0.670  19.718 -31.349  1.00  0.33           C  
ATOM   3289  C   ASP A 425       0.952  18.413 -30.595  1.00  0.33           C  
ATOM   3290  O   ASP A 425       0.673  18.280 -29.404  1.00  0.33           O  
ATOM   3291  CB  ASP A 425      -0.737  19.639 -31.999  1.00  0.33           C  
ATOM   3292  CG  ASP A 425      -1.269  21.004 -32.417  1.00  0.33           C  
ATOM   3293  OD1 ASP A 425      -0.637  22.039 -32.090  1.00  0.33           O  
ATOM   3294  OD2 ASP A 425      -2.362  21.002 -33.041  1.00  0.33           O  
ATOM   3295  N   ARG A 426       1.540  17.402 -31.268  1.00  0.23           N  
ATOM   3296  CA  ARG A 426       1.935  16.147 -30.643  1.00  0.23           C  
ATOM   3297  C   ARG A 426       3.375  16.152 -30.119  1.00  0.23           C  
ATOM   3298  O   ARG A 426       3.765  15.285 -29.337  1.00  0.23           O  
ATOM   3299  CB  ARG A 426       1.808  14.998 -31.674  1.00  0.23           C  
ATOM   3300  CG  ARG A 426       0.364  14.736 -32.146  1.00  0.23           C  
ATOM   3301  CD  ARG A 426       0.326  13.766 -33.330  1.00  0.23           C  
ATOM   3302  NE  ARG A 426      -1.088  13.715 -33.826  1.00  0.23           N  
ATOM   3303  CZ  ARG A 426      -1.663  12.647 -34.395  1.00  0.23           C  
ATOM   3304  NH1 ARG A 426      -1.016  11.494 -34.537  1.00  0.23           N  
ATOM   3305  NH2 ARG A 426      -2.916  12.742 -34.836  1.00  0.23           N  
ATOM   3306  N   LEU A 427       4.186  17.153 -30.503  1.00  0.25           N  
ATOM   3307  CA  LEU A 427       5.569  17.333 -30.105  1.00  0.25           C  
ATOM   3308  C   LEU A 427       5.875  18.537 -29.179  1.00  0.25           C  
ATOM   3309  O   LEU A 427       7.035  18.955 -29.240  1.00  0.25           O  
ATOM   3310  CB  LEU A 427       6.451  17.485 -31.379  1.00  0.25           C  
ATOM   3311  CG  LEU A 427       6.454  16.296 -32.364  1.00  0.25           C  
ATOM   3312  CD1 LEU A 427       7.262  16.691 -33.609  1.00  0.25           C  
ATOM   3313  CD2 LEU A 427       7.010  15.025 -31.719  1.00  0.25           C  
ATOM   3314  N   PRO A 428       5.051  19.170 -28.296  1.00  0.27           N  
ATOM   3315  CA  PRO A 428       5.427  20.393 -27.567  1.00  0.27           C  
ATOM   3316  C   PRO A 428       6.667  20.221 -26.712  1.00  0.27           C  
ATOM   3317  O   PRO A 428       7.380  21.177 -26.419  1.00  0.27           O  
ATOM   3318  CB  PRO A 428       4.227  20.714 -26.644  1.00  0.27           C  
ATOM   3319  CG  PRO A 428       3.042  19.883 -27.144  1.00  0.27           C  
ATOM   3320  CD  PRO A 428       3.655  18.808 -28.042  1.00  0.27           C  
ATOM   3321  N   SER A 429       6.881  18.980 -26.269  1.00  0.28           N  
ATOM   3322  CA  SER A 429       7.767  18.618 -25.191  1.00  0.28           C  
ATOM   3323  C   SER A 429       9.024  17.917 -25.672  1.00  0.28           C  
ATOM   3324  O   SER A 429       9.734  17.306 -24.878  1.00  0.28           O  
ATOM   3325  CB  SER A 429       7.039  17.647 -24.248  1.00  0.28           C  
ATOM   3326  OG  SER A 429       5.784  18.170 -23.809  1.00  0.28           O  
ATOM   3327  N   TRP A 430       9.375  18.006 -26.982  1.00  0.20           N  
ATOM   3328  CA  TRP A 430      10.626  17.469 -27.535  1.00  0.20           C  
ATOM   3329  C   TRP A 430      11.868  18.047 -26.861  1.00  0.20           C  
ATOM   3330  O   TRP A 430      12.874  17.367 -26.684  1.00  0.20           O  
ATOM   3331  CB  TRP A 430      10.770  17.720 -29.072  1.00  0.20           C  
ATOM   3332  CG  TRP A 430      10.563  16.604 -30.111  1.00  0.20           C  
ATOM   3333  CD1 TRP A 430      10.469  16.875 -31.451  1.00  0.20           C  
ATOM   3334  CD2 TRP A 430      10.563  15.150 -30.006  1.00  0.20           C  
ATOM   3335  NE1 TRP A 430      10.423  15.715 -32.186  1.00  0.20           N  
ATOM   3336  CE2 TRP A 430      10.472  14.647 -31.328  1.00  0.20           C  
ATOM   3337  CE3 TRP A 430      10.635  14.260 -28.926  1.00  0.20           C  
ATOM   3338  CZ2 TRP A 430      10.427  13.284 -31.585  1.00  0.20           C  
ATOM   3339  CZ3 TRP A 430      10.606  12.880 -29.193  1.00  0.20           C  
ATOM   3340  CH2 TRP A 430      10.495  12.398 -30.502  1.00  0.20           C  
ATOM   3341  N   ARG A 431      11.800  19.327 -26.439  1.00  0.23           N  
ATOM   3342  CA  ARG A 431      12.852  20.025 -25.716  1.00  0.23           C  
ATOM   3343  C   ARG A 431      13.266  19.322 -24.432  1.00  0.23           C  
ATOM   3344  O   ARG A 431      14.439  19.309 -24.065  1.00  0.23           O  
ATOM   3345  CB  ARG A 431      12.356  21.444 -25.327  1.00  0.23           C  
ATOM   3346  CG  ARG A 431      13.410  22.322 -24.607  1.00  0.23           C  
ATOM   3347  CD  ARG A 431      12.843  23.573 -23.924  1.00  0.23           C  
ATOM   3348  NE  ARG A 431      11.992  23.100 -22.788  1.00  0.23           N  
ATOM   3349  CZ  ARG A 431      10.990  23.769 -22.215  1.00  0.23           C  
ATOM   3350  NH1 ARG A 431      10.170  23.121 -21.396  1.00  0.23           N  
ATOM   3351  NH2 ARG A 431      10.814  25.068 -22.427  1.00  0.23           N  
ATOM   3352  N   ASP A 432      12.287  18.712 -23.740  1.00  0.30           N  
ATOM   3353  CA  ASP A 432      12.425  18.233 -22.387  1.00  0.30           C  
ATOM   3354  C   ASP A 432      12.852  16.770 -22.372  1.00  0.30           C  
ATOM   3355  O   ASP A 432      12.890  16.106 -21.335  1.00  0.30           O  
ATOM   3356  CB  ASP A 432      11.100  18.510 -21.627  1.00  0.30           C  
ATOM   3357  CG  ASP A 432      10.875  20.007 -21.562  1.00  0.30           C  
ATOM   3358  OD1 ASP A 432      11.871  20.778 -21.567  1.00  0.30           O  
ATOM   3359  OD2 ASP A 432       9.706  20.464 -21.535  1.00  0.30           O  
ATOM   3360  N   LEU A 433      13.302  16.246 -23.536  1.00  0.32           N  
ATOM   3361  CA  LEU A 433      14.221  15.128 -23.592  1.00  0.32           C  
ATOM   3362  C   LEU A 433      15.514  15.446 -22.834  1.00  0.32           C  
ATOM   3363  O   LEU A 433      16.102  16.500 -23.077  1.00  0.32           O  
ATOM   3364  CB  LEU A 433      14.592  14.765 -25.050  1.00  0.32           C  
ATOM   3365  CG  LEU A 433      13.484  14.044 -25.844  1.00  0.32           C  
ATOM   3366  CD1 LEU A 433      13.862  13.973 -27.330  1.00  0.32           C  
ATOM   3367  CD2 LEU A 433      13.220  12.622 -25.324  1.00  0.32           C  
ATOM   3368  N   PRO A 434      16.013  14.614 -21.912  1.00  0.56           N  
ATOM   3369  CA  PRO A 434      17.340  14.786 -21.348  1.00  0.56           C  
ATOM   3370  C   PRO A 434      18.379  14.765 -22.450  1.00  0.56           C  
ATOM   3371  O   PRO A 434      18.463  13.806 -23.216  1.00  0.56           O  
ATOM   3372  CB  PRO A 434      17.480  13.616 -20.361  1.00  0.56           C  
ATOM   3373  CG  PRO A 434      16.665  12.502 -21.012  1.00  0.56           C  
ATOM   3374  CD  PRO A 434      15.511  13.270 -21.665  1.00  0.56           C  
ATOM   3375  N   GLN A 435      19.179  15.830 -22.562  1.00  0.48           N  
ATOM   3376  CA  GLN A 435      20.175  15.915 -23.596  1.00  0.48           C  
ATOM   3377  C   GLN A 435      21.367  15.090 -23.153  1.00  0.48           C  
ATOM   3378  O   GLN A 435      21.939  15.322 -22.093  1.00  0.48           O  
ATOM   3379  CB  GLN A 435      20.476  17.394 -23.919  1.00  0.48           C  
ATOM   3380  CG  GLN A 435      19.156  18.143 -24.239  1.00  0.48           C  
ATOM   3381  CD  GLN A 435      19.373  19.517 -24.866  1.00  0.48           C  
ATOM   3382  OE1 GLN A 435      20.486  19.991 -25.088  1.00  0.48           O  
ATOM   3383  NE2 GLN A 435      18.243  20.192 -25.182  1.00  0.48           N  
ATOM   3384  N   THR A 436      21.667  14.020 -23.915  1.00  0.43           N  
ATOM   3385  CA  THR A 436      22.509  12.910 -23.486  1.00  0.43           C  
ATOM   3386  C   THR A 436      23.934  13.282 -23.127  1.00  0.43           C  
ATOM   3387  O   THR A 436      24.730  13.720 -23.953  1.00  0.43           O  
ATOM   3388  CB  THR A 436      22.472  11.715 -24.438  1.00  0.43           C  
ATOM   3389  OG1 THR A 436      22.241  12.127 -25.781  1.00  0.43           O  
ATOM   3390  CG2 THR A 436      21.276  10.830 -24.052  1.00  0.43           C  
ATOM   3391  N   SER A 437      24.250  13.125 -21.830  1.00  0.28           N  
ATOM   3392  CA  SER A 437      25.498  13.485 -21.202  1.00  0.28           C  
ATOM   3393  C   SER A 437      26.229  12.204 -20.731  1.00  0.28           C  
ATOM   3394  O   SER A 437      25.608  11.440 -19.934  1.00  0.28           O  
ATOM   3395  CB  SER A 437      25.230  14.342 -19.934  1.00  0.28           C  
ATOM   3396  OG  SER A 437      24.435  13.615 -18.993  1.00  0.28           O  
ATOM   3397  OXT SER A 437      27.412  12.013 -21.111  1.00  0.28           O  
TER    3398      SER A 437                                                      
ATOM   3399  N   MET B   1      40.837   1.652 -80.099  1.00  0.61           N  
ATOM   3400  CA  MET B   1      40.742   2.181 -78.685  1.00  0.61           C  
ATOM   3401  C   MET B   1      39.350   2.768 -78.424  1.00  0.61           C  
ATOM   3402  O   MET B   1      38.656   3.083 -79.385  1.00  0.61           O  
ATOM   3403  CB  MET B   1      41.875   3.244 -78.510  1.00  0.61           C  
ATOM   3404  CG  MET B   1      41.912   4.003 -77.168  1.00  0.61           C  
ATOM   3405  SD  MET B   1      43.191   5.292 -77.033  1.00  0.61           S  
ATOM   3406  CE  MET B   1      44.579   4.147 -76.850  1.00  0.61           C  
ATOM   3407  N   LYS B   2      38.864   2.925 -77.168  1.00  0.66           N  
ATOM   3408  CA  LYS B   2      37.563   3.531 -76.900  1.00  0.66           C  
ATOM   3409  C   LYS B   2      37.655   5.028 -76.652  1.00  0.66           C  
ATOM   3410  O   LYS B   2      38.713   5.587 -76.368  1.00  0.66           O  
ATOM   3411  CB  LYS B   2      36.845   2.889 -75.683  1.00  0.66           C  
ATOM   3412  CG  LYS B   2      36.550   1.390 -75.832  1.00  0.66           C  
ATOM   3413  CD  LYS B   2      35.560   1.137 -76.970  1.00  0.66           C  
ATOM   3414  CE  LYS B   2      35.025  -0.290 -77.045  1.00  0.66           C  
ATOM   3415  NZ  LYS B   2      34.071  -0.356 -78.162  1.00  0.66           N  
ATOM   3416  N   PHE B   3      36.516   5.742 -76.764  1.00  0.65           N  
ATOM   3417  CA  PHE B   3      36.426   7.164 -76.468  1.00  0.65           C  
ATOM   3418  C   PHE B   3      36.723   7.502 -75.005  1.00  0.65           C  
ATOM   3419  O   PHE B   3      37.369   8.510 -74.718  1.00  0.65           O  
ATOM   3420  CB  PHE B   3      35.060   7.732 -76.942  1.00  0.65           C  
ATOM   3421  CG  PHE B   3      34.928   9.235 -76.788  1.00  0.65           C  
ATOM   3422  CD1 PHE B   3      33.749   9.777 -76.250  1.00  0.65           C  
ATOM   3423  CD2 PHE B   3      35.961  10.115 -77.164  1.00  0.65           C  
ATOM   3424  CE1 PHE B   3      33.601  11.159 -76.080  1.00  0.65           C  
ATOM   3425  CE2 PHE B   3      35.826  11.497 -76.974  1.00  0.65           C  
ATOM   3426  CZ  PHE B   3      34.643  12.020 -76.440  1.00  0.65           C  
ATOM   3427  N   SER B   4      36.317   6.645 -74.040  1.00  0.67           N  
ATOM   3428  CA  SER B   4      36.684   6.786 -72.629  1.00  0.67           C  
ATOM   3429  C   SER B   4      38.181   6.842 -72.404  1.00  0.67           C  
ATOM   3430  O   SER B   4      38.697   7.761 -71.777  1.00  0.67           O  
ATOM   3431  CB  SER B   4      36.147   5.599 -71.777  1.00  0.67           C  
ATOM   3432  OG  SER B   4      36.323   4.333 -72.430  1.00  0.67           O  
ATOM   3433  N   ASP B   5      38.918   5.902 -73.013  1.00  0.68           N  
ATOM   3434  CA  ASP B   5      40.348   5.734 -72.924  1.00  0.68           C  
ATOM   3435  C   ASP B   5      41.091   6.970 -73.424  1.00  0.68           C  
ATOM   3436  O   ASP B   5      42.097   7.405 -72.864  1.00  0.68           O  
ATOM   3437  CB  ASP B   5      40.799   4.534 -73.809  1.00  0.68           C  
ATOM   3438  CG  ASP B   5      39.892   3.309 -73.809  1.00  0.68           C  
ATOM   3439  OD1 ASP B   5      38.962   3.198 -72.972  1.00  0.68           O  
ATOM   3440  OD2 ASP B   5      40.093   2.495 -74.753  1.00  0.68           O  
ATOM   3441  N   VAL B   6      40.585   7.559 -74.528  1.00  0.71           N  
ATOM   3442  CA  VAL B   6      41.050   8.808 -75.108  1.00  0.71           C  
ATOM   3443  C   VAL B   6      40.859   9.998 -74.180  1.00  0.71           C  
ATOM   3444  O   VAL B   6      41.775  10.799 -73.996  1.00  0.71           O  
ATOM   3445  CB  VAL B   6      40.346   9.059 -76.439  1.00  0.71           C  
ATOM   3446  CG1 VAL B   6      40.673  10.439 -77.037  1.00  0.71           C  
ATOM   3447  CG2 VAL B   6      40.796   7.984 -77.435  1.00  0.71           C  
ATOM   3448  N   LEU B   7      39.679  10.140 -73.538  1.00  0.68           N  
ATOM   3449  CA  LEU B   7      39.447  11.187 -72.554  1.00  0.68           C  
ATOM   3450  C   LEU B   7      40.307  11.035 -71.309  1.00  0.68           C  
ATOM   3451  O   LEU B   7      40.948  11.991 -70.879  1.00  0.68           O  
ATOM   3452  CB  LEU B   7      37.959  11.267 -72.133  1.00  0.68           C  
ATOM   3453  CG  LEU B   7      36.991  11.715 -73.249  1.00  0.68           C  
ATOM   3454  CD1 LEU B   7      35.546  11.665 -72.733  1.00  0.68           C  
ATOM   3455  CD2 LEU B   7      37.306  13.124 -73.779  1.00  0.68           C  
ATOM   3456  N   ASP B   8      40.408   9.818 -70.743  1.00  0.66           N  
ATOM   3457  CA  ASP B   8      41.225   9.536 -69.576  1.00  0.66           C  
ATOM   3458  C   ASP B   8      42.707   9.819 -69.817  1.00  0.66           C  
ATOM   3459  O   ASP B   8      43.379  10.447 -69.004  1.00  0.66           O  
ATOM   3460  CB  ASP B   8      41.025   8.062 -69.140  1.00  0.66           C  
ATOM   3461  CG  ASP B   8      39.636   7.822 -68.560  1.00  0.66           C  
ATOM   3462  OD1 ASP B   8      38.876   8.802 -68.359  1.00  0.66           O  
ATOM   3463  OD2 ASP B   8      39.342   6.631 -68.286  1.00  0.66           O  
ATOM   3464  N   GLN B   9      43.255   9.421 -70.985  1.00  0.63           N  
ATOM   3465  CA  GLN B   9      44.606   9.785 -71.388  1.00  0.63           C  
ATOM   3466  C   GLN B   9      44.807  11.283 -71.617  1.00  0.63           C  
ATOM   3467  O   GLN B   9      45.802  11.846 -71.169  1.00  0.63           O  
ATOM   3468  CB  GLN B   9      45.062   8.945 -72.603  1.00  0.63           C  
ATOM   3469  CG  GLN B   9      45.307   7.472 -72.192  1.00  0.63           C  
ATOM   3470  CD  GLN B   9      45.551   6.557 -73.391  1.00  0.63           C  
ATOM   3471  OE1 GLN B   9      46.650   6.437 -73.932  1.00  0.63           O  
ATOM   3472  NE2 GLN B   9      44.473   5.865 -73.824  1.00  0.63           N  
ATOM   3473  N   ALA B  10      43.844  11.987 -72.251  1.00  0.69           N  
ATOM   3474  CA  ALA B  10      43.868  13.436 -72.394  1.00  0.69           C  
ATOM   3475  C   ALA B  10      43.871  14.181 -71.059  1.00  0.69           C  
ATOM   3476  O   ALA B  10      44.600  15.150 -70.844  1.00  0.69           O  
ATOM   3477  CB  ALA B  10      42.644  13.891 -73.216  1.00  0.69           C  
ATOM   3478  N   TRP B  11      43.075  13.715 -70.082  1.00  0.56           N  
ATOM   3479  CA  TRP B  11      43.053  14.261 -68.739  1.00  0.56           C  
ATOM   3480  C   TRP B  11      44.272  13.881 -67.898  1.00  0.56           C  
ATOM   3481  O   TRP B  11      44.535  14.544 -66.904  1.00  0.56           O  
ATOM   3482  CB  TRP B  11      41.736  13.877 -68.012  1.00  0.56           C  
ATOM   3483  CG  TRP B  11      40.555  14.762 -68.396  1.00  0.56           C  
ATOM   3484  CD1 TRP B  11      39.587  14.585 -69.349  1.00  0.56           C  
ATOM   3485  CD2 TRP B  11      40.266  16.021 -67.758  1.00  0.56           C  
ATOM   3486  NE1 TRP B  11      38.719  15.660 -69.356  1.00  0.56           N  
ATOM   3487  CE2 TRP B  11      39.112  16.543 -68.381  1.00  0.56           C  
ATOM   3488  CE3 TRP B  11      40.897  16.706 -66.721  1.00  0.56           C  
ATOM   3489  CZ2 TRP B  11      38.568  17.754 -67.977  1.00  0.56           C  
ATOM   3490  CZ3 TRP B  11      40.343  17.929 -66.310  1.00  0.56           C  
ATOM   3491  CH2 TRP B  11      39.196  18.447 -66.931  1.00  0.56           C  
ATOM   3492  N   ALA B  12      45.068  12.867 -68.301  1.00  0.61           N  
ATOM   3493  CA  ALA B  12      46.255  12.418 -67.584  1.00  0.61           C  
ATOM   3494  C   ALA B  12      47.588  12.899 -68.174  1.00  0.61           C  
ATOM   3495  O   ALA B  12      48.668  12.497 -67.738  1.00  0.61           O  
ATOM   3496  CB  ALA B  12      46.246  10.876 -67.561  1.00  0.61           C  
ATOM   3497  N   GLU B  13      47.578  13.792 -69.188  1.00  0.55           N  
ATOM   3498  CA  GLU B  13      48.778  14.493 -69.636  1.00  0.55           C  
ATOM   3499  C   GLU B  13      49.285  15.534 -68.626  1.00  0.55           C  
ATOM   3500  O   GLU B  13      49.078  16.737 -68.790  1.00  0.55           O  
ATOM   3501  CB  GLU B  13      48.565  15.244 -70.974  1.00  0.55           C  
ATOM   3502  CG  GLU B  13      48.157  14.378 -72.185  1.00  0.55           C  
ATOM   3503  CD  GLU B  13      48.064  15.246 -73.429  1.00  0.55           C  
ATOM   3504  OE1 GLU B  13      48.298  14.734 -74.551  1.00  0.55           O  
ATOM   3505  OE2 GLU B  13      47.766  16.459 -73.294  1.00  0.55           O  
ATOM   3506  N   ASP B  14      49.943  15.094 -67.538  1.00  0.50           N  
ATOM   3507  CA  ASP B  14      50.377  15.986 -66.473  1.00  0.50           C  
ATOM   3508  C   ASP B  14      51.881  16.245 -66.490  1.00  0.50           C  
ATOM   3509  O   ASP B  14      52.419  17.043 -65.725  1.00  0.50           O  
ATOM   3510  CB  ASP B  14      49.967  15.371 -65.116  1.00  0.50           C  
ATOM   3511  CG  ASP B  14      48.452  15.244 -65.086  1.00  0.50           C  
ATOM   3512  OD1 ASP B  14      47.773  16.228 -65.493  1.00  0.50           O  
ATOM   3513  OD2 ASP B  14      47.969  14.158 -64.683  1.00  0.50           O  
ATOM   3514  N   SER B  15      52.624  15.600 -67.405  1.00  0.39           N  
ATOM   3515  CA  SER B  15      54.078  15.657 -67.477  1.00  0.39           C  
ATOM   3516  C   SER B  15      54.619  16.783 -68.350  1.00  0.39           C  
ATOM   3517  O   SER B  15      55.612  16.631 -69.058  1.00  0.39           O  
ATOM   3518  CB  SER B  15      54.665  14.293 -67.935  1.00  0.39           C  
ATOM   3519  OG  SER B  15      53.939  13.762 -69.048  1.00  0.39           O  
ATOM   3520  N   GLY B  16      54.004  17.981 -68.284  1.00  0.47           N  
ATOM   3521  CA  GLY B  16      54.435  19.138 -69.054  1.00  0.47           C  
ATOM   3522  C   GLY B  16      53.255  20.011 -69.381  1.00  0.47           C  
ATOM   3523  O   GLY B  16      52.246  19.945 -68.680  1.00  0.47           O  
ATOM   3524  N   PRO B  17      53.296  20.843 -70.416  1.00  0.54           N  
ATOM   3525  CA  PRO B  17      52.086  21.402 -71.003  1.00  0.54           C  
ATOM   3526  C   PRO B  17      51.321  20.305 -71.749  1.00  0.54           C  
ATOM   3527  O   PRO B  17      51.986  19.438 -72.319  1.00  0.54           O  
ATOM   3528  CB  PRO B  17      52.621  22.485 -71.957  1.00  0.54           C  
ATOM   3529  CG  PRO B  17      53.997  21.964 -72.391  1.00  0.54           C  
ATOM   3530  CD  PRO B  17      54.507  21.222 -71.151  1.00  0.54           C  
ATOM   3531  N   PRO B  18      49.990  20.249 -71.745  1.00  0.60           N  
ATOM   3532  CA  PRO B  18      49.242  19.238 -72.484  1.00  0.60           C  
ATOM   3533  C   PRO B  18      49.404  19.373 -73.990  1.00  0.60           C  
ATOM   3534  O   PRO B  18      49.805  20.427 -74.487  1.00  0.60           O  
ATOM   3535  CB  PRO B  18      47.789  19.492 -72.044  1.00  0.60           C  
ATOM   3536  CG  PRO B  18      47.741  21.001 -71.803  1.00  0.60           C  
ATOM   3537  CD  PRO B  18      49.117  21.289 -71.197  1.00  0.60           C  
ATOM   3538  N   THR B  19      49.081  18.320 -74.756  1.00  0.62           N  
ATOM   3539  CA  THR B  19      49.098  18.376 -76.209  1.00  0.62           C  
ATOM   3540  C   THR B  19      47.919  19.174 -76.723  1.00  0.62           C  
ATOM   3541  O   THR B  19      46.963  19.447 -76.001  1.00  0.62           O  
ATOM   3542  CB  THR B  19      49.122  17.025 -76.914  1.00  0.62           C  
ATOM   3543  OG1 THR B  19      47.929  16.272 -76.709  1.00  0.62           O  
ATOM   3544  CG2 THR B  19      50.321  16.199 -76.426  1.00  0.62           C  
ATOM   3545  N   THR B  20      47.928  19.596 -78.005  1.00  0.66           N  
ATOM   3546  CA  THR B  20      46.810  20.352 -78.573  1.00  0.66           C  
ATOM   3547  C   THR B  20      45.512  19.569 -78.528  1.00  0.66           C  
ATOM   3548  O   THR B  20      44.475  20.066 -78.104  1.00  0.66           O  
ATOM   3549  CB  THR B  20      47.041  20.781 -80.017  1.00  0.66           C  
ATOM   3550  OG1 THR B  20      48.365  21.267 -80.183  1.00  0.66           O  
ATOM   3551  CG2 THR B  20      46.099  21.937 -80.373  1.00  0.66           C  
ATOM   3552  N   LEU B  21      45.563  18.269 -78.891  1.00  0.69           N  
ATOM   3553  CA  LEU B  21      44.430  17.374 -78.743  1.00  0.69           C  
ATOM   3554  C   LEU B  21      44.046  17.143 -77.285  1.00  0.69           C  
ATOM   3555  O   LEU B  21      42.872  17.209 -76.930  1.00  0.69           O  
ATOM   3556  CB  LEU B  21      44.720  16.014 -79.425  1.00  0.69           C  
ATOM   3557  CG  LEU B  21      43.535  15.023 -79.425  1.00  0.69           C  
ATOM   3558  CD1 LEU B  21      42.311  15.550 -80.192  1.00  0.69           C  
ATOM   3559  CD2 LEU B  21      43.972  13.673 -79.998  1.00  0.69           C  
ATOM   3560  N   GLY B  22      45.030  16.902 -76.392  1.00  0.70           N  
ATOM   3561  CA  GLY B  22      44.847  16.833 -74.943  1.00  0.70           C  
ATOM   3562  C   GLY B  22      44.122  17.991 -74.325  1.00  0.70           C  
ATOM   3563  O   GLY B  22      43.136  17.820 -73.615  1.00  0.70           O  
ATOM   3564  N   ARG B  23      44.571  19.222 -74.619  1.00  0.60           N  
ATOM   3565  CA  ARG B  23      43.953  20.460 -74.191  1.00  0.60           C  
ATOM   3566  C   ARG B  23      42.514  20.600 -74.665  1.00  0.60           C  
ATOM   3567  O   ARG B  23      41.614  20.913 -73.886  1.00  0.60           O  
ATOM   3568  CB  ARG B  23      44.777  21.639 -74.773  1.00  0.60           C  
ATOM   3569  CG  ARG B  23      44.303  23.049 -74.355  1.00  0.60           C  
ATOM   3570  CD  ARG B  23      44.943  24.184 -75.166  1.00  0.60           C  
ATOM   3571  NE  ARG B  23      44.385  24.080 -76.546  1.00  0.60           N  
ATOM   3572  CZ  ARG B  23      44.796  24.738 -77.631  1.00  0.60           C  
ATOM   3573  NH1 ARG B  23      45.782  25.628 -77.579  1.00  0.60           N  
ATOM   3574  NH2 ARG B  23      44.189  24.498 -78.789  1.00  0.60           N  
ATOM   3575  N   ASP B  24      42.261  20.322 -75.954  1.00  0.71           N  
ATOM   3576  CA  ASP B  24      40.979  20.588 -76.571  1.00  0.71           C  
ATOM   3577  C   ASP B  24      39.958  19.481 -76.285  1.00  0.71           C  
ATOM   3578  O   ASP B  24      38.747  19.693 -76.334  1.00  0.71           O  
ATOM   3579  CB  ASP B  24      41.223  20.867 -78.079  1.00  0.71           C  
ATOM   3580  CG  ASP B  24      42.060  22.129 -78.240  1.00  0.71           C  
ATOM   3581  OD1 ASP B  24      42.127  22.947 -77.285  1.00  0.71           O  
ATOM   3582  OD2 ASP B  24      42.661  22.356 -79.320  1.00  0.71           O  
ATOM   3583  N   LEU B  25      40.416  18.279 -75.872  1.00  0.71           N  
ATOM   3584  CA  LEU B  25      39.559  17.254 -75.294  1.00  0.71           C  
ATOM   3585  C   LEU B  25      39.268  17.460 -73.810  1.00  0.71           C  
ATOM   3586  O   LEU B  25      38.260  16.972 -73.307  1.00  0.71           O  
ATOM   3587  CB  LEU B  25      40.178  15.849 -75.456  1.00  0.71           C  
ATOM   3588  CG  LEU B  25      40.181  15.303 -76.896  1.00  0.71           C  
ATOM   3589  CD1 LEU B  25      41.009  14.014 -76.923  1.00  0.71           C  
ATOM   3590  CD2 LEU B  25      38.767  15.035 -77.435  1.00  0.71           C  
ATOM   3591  N   ARG B  26      40.081  18.247 -73.067  1.00  0.60           N  
ATOM   3592  CA  ARG B  26      39.811  18.581 -71.666  1.00  0.60           C  
ATOM   3593  C   ARG B  26      38.643  19.551 -71.530  1.00  0.60           C  
ATOM   3594  O   ARG B  26      38.106  19.783 -70.449  1.00  0.60           O  
ATOM   3595  CB  ARG B  26      41.046  19.195 -70.954  1.00  0.60           C  
ATOM   3596  CG  ARG B  26      42.131  18.167 -70.571  1.00  0.60           C  
ATOM   3597  CD  ARG B  26      43.446  18.828 -70.133  1.00  0.60           C  
ATOM   3598  NE  ARG B  26      44.428  17.732 -69.877  1.00  0.60           N  
ATOM   3599  CZ  ARG B  26      45.474  17.776 -69.040  1.00  0.60           C  
ATOM   3600  NH1 ARG B  26      45.891  18.886 -68.451  1.00  0.60           N  
ATOM   3601  NH2 ARG B  26      46.139  16.654 -68.805  1.00  0.60           N  
ATOM   3602  N   LEU B  27      38.192  20.127 -72.658  1.00  0.68           N  
ATOM   3603  CA  LEU B  27      36.971  20.893 -72.734  1.00  0.68           C  
ATOM   3604  C   LEU B  27      35.719  20.031 -72.638  1.00  0.68           C  
ATOM   3605  O   LEU B  27      34.648  20.539 -72.315  1.00  0.68           O  
ATOM   3606  CB  LEU B  27      36.938  21.683 -74.061  1.00  0.68           C  
ATOM   3607  CG  LEU B  27      38.082  22.707 -74.202  1.00  0.68           C  
ATOM   3608  CD1 LEU B  27      38.046  23.363 -75.590  1.00  0.68           C  
ATOM   3609  CD2 LEU B  27      38.016  23.765 -73.093  1.00  0.68           C  
ATOM   3610  N   VAL B  28      35.812  18.705 -72.877  1.00  0.67           N  
ATOM   3611  CA  VAL B  28      34.723  17.771 -72.626  1.00  0.67           C  
ATOM   3612  C   VAL B  28      34.533  17.561 -71.126  1.00  0.67           C  
ATOM   3613  O   VAL B  28      35.433  17.132 -70.407  1.00  0.67           O  
ATOM   3614  CB  VAL B  28      34.929  16.432 -73.335  1.00  0.67           C  
ATOM   3615  CG1 VAL B  28      33.797  15.436 -73.001  1.00  0.67           C  
ATOM   3616  CG2 VAL B  28      34.991  16.676 -74.858  1.00  0.67           C  
ATOM   3617  N   ARG B  29      33.331  17.884 -70.612  1.00  0.56           N  
ATOM   3618  CA  ARG B  29      33.015  17.801 -69.199  1.00  0.56           C  
ATOM   3619  C   ARG B  29      32.244  16.540 -68.877  1.00  0.56           C  
ATOM   3620  O   ARG B  29      32.361  15.991 -67.784  1.00  0.56           O  
ATOM   3621  CB  ARG B  29      32.120  19.005 -68.808  1.00  0.56           C  
ATOM   3622  CG  ARG B  29      32.853  20.364 -68.841  1.00  0.56           C  
ATOM   3623  CD  ARG B  29      33.935  20.553 -67.770  1.00  0.56           C  
ATOM   3624  NE  ARG B  29      33.240  20.427 -66.451  1.00  0.56           N  
ATOM   3625  CZ  ARG B  29      33.840  20.558 -65.263  1.00  0.56           C  
ATOM   3626  NH1 ARG B  29      35.121  20.896 -65.167  1.00  0.56           N  
ATOM   3627  NH2 ARG B  29      33.139  20.343 -64.152  1.00  0.56           N  
ATOM   3628  N   ALA B  30      31.460  16.040 -69.843  1.00  0.59           N  
ATOM   3629  CA  ALA B  30      30.730  14.810 -69.698  1.00  0.59           C  
ATOM   3630  C   ALA B  30      30.354  14.343 -71.086  1.00  0.59           C  
ATOM   3631  O   ALA B  30      30.323  15.124 -72.035  1.00  0.59           O  
ATOM   3632  CB  ALA B  30      29.458  14.996 -68.841  1.00  0.59           C  
ATOM   3633  N   ALA B  31      30.055  13.048 -71.245  1.00  0.65           N  
ATOM   3634  CA  ALA B  31      29.572  12.522 -72.494  1.00  0.65           C  
ATOM   3635  C   ALA B  31      28.695  11.341 -72.161  1.00  0.65           C  
ATOM   3636  O   ALA B  31      28.891  10.678 -71.143  1.00  0.65           O  
ATOM   3637  CB  ALA B  31      30.726  12.096 -73.425  1.00  0.65           C  
ATOM   3638  N   ALA B  32      27.674  11.079 -72.992  1.00  0.68           N  
ATOM   3639  CA  ALA B  32      26.775   9.960 -72.824  1.00  0.68           C  
ATOM   3640  C   ALA B  32      27.464   8.579 -72.883  1.00  0.68           C  
ATOM   3641  O   ALA B  32      28.442   8.437 -73.628  1.00  0.68           O  
ATOM   3642  CB  ALA B  32      25.662  10.071 -73.877  1.00  0.68           C  
ATOM   3643  N   PRO B  33      27.036   7.544 -72.142  1.00  0.66           N  
ATOM   3644  CA  PRO B  33      27.705   6.240 -72.086  1.00  0.66           C  
ATOM   3645  C   PRO B  33      27.889   5.560 -73.426  1.00  0.66           C  
ATOM   3646  O   PRO B  33      28.897   4.883 -73.632  1.00  0.66           O  
ATOM   3647  CB  PRO B  33      26.809   5.400 -71.159  1.00  0.66           C  
ATOM   3648  CG  PRO B  33      26.151   6.436 -70.249  1.00  0.66           C  
ATOM   3649  CD  PRO B  33      25.908   7.602 -71.206  1.00  0.66           C  
ATOM   3650  N   GLU B  34      26.932   5.734 -74.349  1.00  0.62           N  
ATOM   3651  CA  GLU B  34      26.937   5.203 -75.691  1.00  0.62           C  
ATOM   3652  C   GLU B  34      28.106   5.741 -76.500  1.00  0.62           C  
ATOM   3653  O   GLU B  34      28.812   4.993 -77.172  1.00  0.62           O  
ATOM   3654  CB  GLU B  34      25.602   5.555 -76.408  1.00  0.62           C  
ATOM   3655  CG  GLU B  34      24.316   5.080 -75.668  1.00  0.62           C  
ATOM   3656  CD  GLU B  34      23.923   5.913 -74.444  1.00  0.62           C  
ATOM   3657  OE1 GLU B  34      23.045   5.449 -73.677  1.00  0.62           O  
ATOM   3658  OE2 GLU B  34      24.527   7.001 -74.247  1.00  0.62           O  
ATOM   3659  N   LEU B  35      28.375   7.060 -76.398  1.00  0.65           N  
ATOM   3660  CA  LEU B  35      29.526   7.712 -77.001  1.00  0.65           C  
ATOM   3661  C   LEU B  35      30.842   7.264 -76.398  1.00  0.65           C  
ATOM   3662  O   LEU B  35      31.811   7.028 -77.113  1.00  0.65           O  
ATOM   3663  CB  LEU B  35      29.438   9.254 -76.899  1.00  0.65           C  
ATOM   3664  CG  LEU B  35      28.266   9.866 -77.689  1.00  0.65           C  
ATOM   3665  CD1 LEU B  35      28.133  11.360 -77.375  1.00  0.65           C  
ATOM   3666  CD2 LEU B  35      28.408   9.660 -79.205  1.00  0.65           C  
ATOM   3667  N   LEU B  36      30.906   7.102 -75.060  1.00  0.62           N  
ATOM   3668  CA  LEU B  36      32.084   6.614 -74.353  1.00  0.62           C  
ATOM   3669  C   LEU B  36      32.506   5.216 -74.789  1.00  0.62           C  
ATOM   3670  O   LEU B  36      33.693   4.910 -74.884  1.00  0.62           O  
ATOM   3671  CB  LEU B  36      31.866   6.646 -72.820  1.00  0.62           C  
ATOM   3672  CG  LEU B  36      31.699   8.063 -72.231  1.00  0.62           C  
ATOM   3673  CD1 LEU B  36      31.286   7.989 -70.754  1.00  0.62           C  
ATOM   3674  CD2 LEU B  36      32.981   8.898 -72.366  1.00  0.62           C  
ATOM   3675  N   ALA B  37      31.526   4.351 -75.109  1.00  0.64           N  
ATOM   3676  CA  ALA B  37      31.759   2.988 -75.529  1.00  0.64           C  
ATOM   3677  C   ALA B  37      32.020   2.832 -77.030  1.00  0.64           C  
ATOM   3678  O   ALA B  37      32.340   1.733 -77.495  1.00  0.64           O  
ATOM   3679  CB  ALA B  37      30.520   2.158 -75.143  1.00  0.64           C  
ATOM   3680  N   LEU B  38      31.927   3.917 -77.829  1.00  0.62           N  
ATOM   3681  CA  LEU B  38      32.382   3.931 -79.211  1.00  0.62           C  
ATOM   3682  C   LEU B  38      33.888   3.776 -79.359  1.00  0.62           C  
ATOM   3683  O   LEU B  38      34.683   4.257 -78.550  1.00  0.62           O  
ATOM   3684  CB  LEU B  38      31.975   5.213 -79.984  1.00  0.62           C  
ATOM   3685  CG  LEU B  38      30.461   5.414 -80.183  1.00  0.62           C  
ATOM   3686  CD1 LEU B  38      30.195   6.762 -80.869  1.00  0.62           C  
ATOM   3687  CD2 LEU B  38      29.809   4.278 -80.985  1.00  0.62           C  
ATOM   3688  N   ASP B  39      34.307   3.095 -80.437  1.00  0.63           N  
ATOM   3689  CA  ASP B  39      35.690   2.952 -80.819  1.00  0.63           C  
ATOM   3690  C   ASP B  39      36.154   4.160 -81.629  1.00  0.63           C  
ATOM   3691  O   ASP B  39      35.470   4.643 -82.530  1.00  0.63           O  
ATOM   3692  CB  ASP B  39      35.893   1.650 -81.630  1.00  0.63           C  
ATOM   3693  CG  ASP B  39      35.421   0.490 -80.790  1.00  0.63           C  
ATOM   3694  OD1 ASP B  39      36.211  -0.030 -79.964  1.00  0.63           O  
ATOM   3695  OD2 ASP B  39      34.210   0.151 -80.839  1.00  0.63           O  
ATOM   3696  N   VAL B  40      37.347   4.687 -81.305  1.00  0.68           N  
ATOM   3697  CA  VAL B  40      37.956   5.814 -81.991  1.00  0.68           C  
ATOM   3698  C   VAL B  40      38.842   5.287 -83.113  1.00  0.68           C  
ATOM   3699  O   VAL B  40      39.199   4.107 -83.077  1.00  0.68           O  
ATOM   3700  CB  VAL B  40      38.758   6.711 -81.041  1.00  0.68           C  
ATOM   3701  CG1 VAL B  40      37.822   7.184 -79.913  1.00  0.68           C  
ATOM   3702  CG2 VAL B  40      39.999   5.991 -80.476  1.00  0.68           C  
ATOM   3703  N   PRO B  41      39.274   6.049 -84.119  1.00  0.67           N  
ATOM   3704  CA  PRO B  41      39.895   5.443 -85.300  1.00  0.67           C  
ATOM   3705  C   PRO B  41      41.408   5.417 -85.125  1.00  0.67           C  
ATOM   3706  O   PRO B  41      42.150   5.855 -86.001  1.00  0.67           O  
ATOM   3707  CB  PRO B  41      39.469   6.407 -86.426  1.00  0.67           C  
ATOM   3708  CG  PRO B  41      39.388   7.768 -85.736  1.00  0.67           C  
ATOM   3709  CD  PRO B  41      38.771   7.401 -84.391  1.00  0.67           C  
ATOM   3710  N   ALA B  42      41.866   4.872 -83.988  1.00  0.64           N  
ATOM   3711  CA  ALA B  42      43.253   4.674 -83.653  1.00  0.64           C  
ATOM   3712  C   ALA B  42      43.312   3.684 -82.497  1.00  0.64           C  
ATOM   3713  O   ALA B  42      42.309   3.479 -81.800  1.00  0.64           O  
ATOM   3714  CB  ALA B  42      43.910   6.003 -83.235  1.00  0.64           C  
ATOM   3715  N   ASP B  43      44.486   3.066 -82.254  1.00  0.57           N  
ATOM   3716  CA  ASP B  43      44.685   2.155 -81.138  1.00  0.57           C  
ATOM   3717  C   ASP B  43      45.789   2.607 -80.194  1.00  0.57           C  
ATOM   3718  O   ASP B  43      45.961   2.040 -79.117  1.00  0.57           O  
ATOM   3719  CB  ASP B  43      44.886   0.696 -81.616  1.00  0.57           C  
ATOM   3720  CG  ASP B  43      43.497   0.094 -81.781  1.00  0.57           C  
ATOM   3721  OD1 ASP B  43      42.768   0.039 -80.750  1.00  0.57           O  
ATOM   3722  OD2 ASP B  43      43.102  -0.257 -82.913  1.00  0.57           O  
ATOM   3723  N   ALA B  44      46.491   3.712 -80.493  1.00  0.61           N  
ATOM   3724  CA  ALA B  44      47.263   4.436 -79.512  1.00  0.61           C  
ATOM   3725  C   ALA B  44      46.849   5.900 -79.467  1.00  0.61           C  
ATOM   3726  O   ALA B  44      46.539   6.546 -80.464  1.00  0.61           O  
ATOM   3727  CB  ALA B  44      48.777   4.297 -79.761  1.00  0.61           C  
ATOM   3728  N   TYR B  45      46.846   6.508 -78.262  1.00  0.61           N  
ATOM   3729  CA  TYR B  45      46.526   7.917 -78.088  1.00  0.61           C  
ATOM   3730  C   TYR B  45      47.508   8.833 -78.830  1.00  0.61           C  
ATOM   3731  O   TYR B  45      47.126   9.833 -79.432  1.00  0.61           O  
ATOM   3732  CB  TYR B  45      46.434   8.237 -76.572  1.00  0.61           C  
ATOM   3733  CG  TYR B  45      46.008   9.654 -76.302  1.00  0.61           C  
ATOM   3734  CD1 TYR B  45      46.878  10.537 -75.641  1.00  0.61           C  
ATOM   3735  CD2 TYR B  45      44.754  10.122 -76.732  1.00  0.61           C  
ATOM   3736  CE1 TYR B  45      46.510  11.873 -75.433  1.00  0.61           C  
ATOM   3737  CE2 TYR B  45      44.394  11.464 -76.537  1.00  0.61           C  
ATOM   3738  CZ  TYR B  45      45.276  12.334 -75.893  1.00  0.61           C  
ATOM   3739  OH  TYR B  45      44.926  13.681 -75.721  1.00  0.61           O  
ATOM   3740  N   GLY B  46      48.807   8.459 -78.863  1.00  0.62           N  
ATOM   3741  CA  GLY B  46      49.832   9.171 -79.624  1.00  0.62           C  
ATOM   3742  C   GLY B  46      49.610   9.232 -81.121  1.00  0.62           C  
ATOM   3743  O   GLY B  46      50.016  10.194 -81.766  1.00  0.62           O  
ATOM   3744  N   GLU B  47      48.924   8.231 -81.714  1.00  0.57           N  
ATOM   3745  CA  GLU B  47      48.500   8.254 -83.107  1.00  0.57           C  
ATOM   3746  C   GLU B  47      47.493   9.361 -83.367  1.00  0.57           C  
ATOM   3747  O   GLU B  47      47.623  10.128 -84.318  1.00  0.57           O  
ATOM   3748  CB  GLU B  47      47.842   6.910 -83.499  1.00  0.57           C  
ATOM   3749  CG  GLU B  47      48.806   5.702 -83.430  1.00  0.57           C  
ATOM   3750  CD  GLU B  47      48.099   4.355 -83.281  1.00  0.57           C  
ATOM   3751  OE1 GLU B  47      48.830   3.337 -83.260  1.00  0.57           O  
ATOM   3752  OE2 GLU B  47      46.851   4.323 -83.127  1.00  0.57           O  
ATOM   3753  N   LEU B  48      46.491   9.510 -82.471  1.00  0.64           N  
ATOM   3754  CA  LEU B  48      45.529  10.597 -82.509  1.00  0.64           C  
ATOM   3755  C   LEU B  48      46.174  11.958 -82.313  1.00  0.64           C  
ATOM   3756  O   LEU B  48      45.873  12.902 -83.035  1.00  0.64           O  
ATOM   3757  CB  LEU B  48      44.422  10.438 -81.436  1.00  0.64           C  
ATOM   3758  CG  LEU B  48      43.516   9.210 -81.613  1.00  0.64           C  
ATOM   3759  CD1 LEU B  48      42.651   9.007 -80.362  1.00  0.64           C  
ATOM   3760  CD2 LEU B  48      42.621   9.327 -82.858  1.00  0.64           C  
ATOM   3761  N   VAL B  49      47.110  12.098 -81.354  1.00  0.65           N  
ATOM   3762  CA  VAL B  49      47.863  13.333 -81.151  1.00  0.65           C  
ATOM   3763  C   VAL B  49      48.693  13.710 -82.376  1.00  0.65           C  
ATOM   3764  O   VAL B  49      48.669  14.850 -82.838  1.00  0.65           O  
ATOM   3765  CB  VAL B  49      48.760  13.224 -79.920  1.00  0.65           C  
ATOM   3766  CG1 VAL B  49      49.684  14.451 -79.774  1.00  0.65           C  
ATOM   3767  CG2 VAL B  49      47.878  13.105 -78.661  1.00  0.65           C  
ATOM   3768  N   GLY B  50      49.407  12.734 -82.980  1.00  0.63           N  
ATOM   3769  CA  GLY B  50      50.218  12.950 -84.174  1.00  0.63           C  
ATOM   3770  C   GLY B  50      49.447  13.280 -85.428  1.00  0.63           C  
ATOM   3771  O   GLY B  50      49.938  13.998 -86.303  1.00  0.63           O  
ATOM   3772  N   SER B  51      48.202  12.787 -85.557  1.00  0.64           N  
ATOM   3773  CA  SER B  51      47.361  13.042 -86.718  1.00  0.64           C  
ATOM   3774  C   SER B  51      46.443  14.239 -86.551  1.00  0.64           C  
ATOM   3775  O   SER B  51      45.881  14.722 -87.530  1.00  0.64           O  
ATOM   3776  CB  SER B  51      46.494  11.803 -87.081  1.00  0.64           C  
ATOM   3777  OG  SER B  51      45.562  11.469 -86.050  1.00  0.64           O  
ATOM   3778  N   TYR B  52      46.297  14.787 -85.324  1.00  0.30           N  
ATOM   3779  CA  TYR B  52      45.438  15.929 -85.051  1.00  0.30           C  
ATOM   3780  C   TYR B  52      45.873  17.211 -85.748  1.00  0.30           C  
ATOM   3781  O   TYR B  52      47.011  17.667 -85.630  1.00  0.30           O  
ATOM   3782  CB  TYR B  52      45.308  16.181 -83.521  1.00  0.30           C  
ATOM   3783  CG  TYR B  52      44.254  17.211 -83.183  1.00  0.30           C  
ATOM   3784  CD1 TYR B  52      44.565  18.341 -82.407  1.00  0.30           C  
ATOM   3785  CD2 TYR B  52      42.938  17.051 -83.645  1.00  0.30           C  
ATOM   3786  CE1 TYR B  52      43.573  19.282 -82.089  1.00  0.30           C  
ATOM   3787  CE2 TYR B  52      41.945  17.983 -83.323  1.00  0.30           C  
ATOM   3788  CZ  TYR B  52      42.264  19.097 -82.543  1.00  0.30           C  
ATOM   3789  OH  TYR B  52      41.273  20.036 -82.205  1.00  0.30           O  
ATOM   3790  N   ARG B  53      44.958  17.835 -86.502  1.00  0.27           N  
ATOM   3791  CA  ARG B  53      45.232  19.071 -87.196  1.00  0.27           C  
ATOM   3792  C   ARG B  53      44.145  20.080 -86.848  1.00  0.27           C  
ATOM   3793  O   ARG B  53      43.035  19.962 -87.369  1.00  0.27           O  
ATOM   3794  CB  ARG B  53      45.301  18.809 -88.723  1.00  0.27           C  
ATOM   3795  CG  ARG B  53      46.514  17.947 -89.147  1.00  0.27           C  
ATOM   3796  CD  ARG B  53      47.883  18.573 -88.827  1.00  0.27           C  
ATOM   3797  NE  ARG B  53      48.939  17.553 -89.176  1.00  0.27           N  
ATOM   3798  CZ  ARG B  53      49.378  16.602 -88.339  1.00  0.27           C  
ATOM   3799  NH1 ARG B  53      48.989  16.502 -87.076  1.00  0.27           N  
ATOM   3800  NH2 ARG B  53      50.250  15.686 -88.761  1.00  0.27           N  
ATOM   3801  N   PRO B  54      44.377  21.086 -85.991  1.00  0.39           N  
ATOM   3802  CA  PRO B  54      43.348  22.045 -85.601  1.00  0.39           C  
ATOM   3803  C   PRO B  54      43.175  23.090 -86.688  1.00  0.39           C  
ATOM   3804  O   PRO B  54      42.209  23.850 -86.654  1.00  0.39           O  
ATOM   3805  CB  PRO B  54      43.901  22.646 -84.297  1.00  0.39           C  
ATOM   3806  CG  PRO B  54      45.419  22.591 -84.482  1.00  0.39           C  
ATOM   3807  CD  PRO B  54      45.620  21.275 -85.233  1.00  0.39           C  
ATOM   3808  N   ASP B  55      44.105  23.136 -87.661  1.00  0.36           N  
ATOM   3809  CA  ASP B  55      44.034  23.864 -88.905  1.00  0.36           C  
ATOM   3810  C   ASP B  55      42.885  23.376 -89.789  1.00  0.36           C  
ATOM   3811  O   ASP B  55      42.157  24.158 -90.397  1.00  0.36           O  
ATOM   3812  CB  ASP B  55      45.420  23.780 -89.631  1.00  0.36           C  
ATOM   3813  CG  ASP B  55      46.021  22.377 -89.677  1.00  0.36           C  
ATOM   3814  OD1 ASP B  55      46.350  21.850 -88.580  1.00  0.36           O  
ATOM   3815  OD2 ASP B  55      46.155  21.799 -90.789  1.00  0.36           O  
ATOM   3816  N   ARG B  56      42.666  22.049 -89.838  1.00  0.31           N  
ATOM   3817  CA  ARG B  56      41.660  21.407 -90.664  1.00  0.31           C  
ATOM   3818  C   ARG B  56      40.330  21.225 -89.952  1.00  0.31           C  
ATOM   3819  O   ARG B  56      39.711  20.164 -90.010  1.00  0.31           O  
ATOM   3820  CB  ARG B  56      42.169  20.036 -91.165  1.00  0.31           C  
ATOM   3821  CG  ARG B  56      43.483  20.170 -91.947  1.00  0.31           C  
ATOM   3822  CD  ARG B  56      43.993  18.856 -92.521  1.00  0.31           C  
ATOM   3823  NE  ARG B  56      45.293  19.198 -93.176  1.00  0.31           N  
ATOM   3824  CZ  ARG B  56      45.828  18.508 -94.193  1.00  0.31           C  
ATOM   3825  NH1 ARG B  56      45.314  17.346 -94.587  1.00  0.31           N  
ATOM   3826  NH2 ARG B  56      46.893  18.991 -94.825  1.00  0.31           N  
ATOM   3827  N   ALA B  57      39.859  22.275 -89.261  1.00  0.44           N  
ATOM   3828  CA  ALA B  57      38.569  22.306 -88.608  1.00  0.44           C  
ATOM   3829  C   ALA B  57      37.370  22.137 -89.544  1.00  0.44           C  
ATOM   3830  O   ALA B  57      37.329  22.681 -90.648  1.00  0.44           O  
ATOM   3831  CB  ALA B  57      38.429  23.634 -87.836  1.00  0.44           C  
ATOM   3832  N   GLY B  58      36.334  21.382 -89.107  1.00  0.47           N  
ATOM   3833  CA  GLY B  58      35.027  21.386 -89.760  1.00  0.47           C  
ATOM   3834  C   GLY B  58      34.349  22.731 -89.649  1.00  0.47           C  
ATOM   3835  O   GLY B  58      34.441  23.400 -88.625  1.00  0.47           O  
ATOM   3836  N   ALA B  59      33.637  23.172 -90.705  1.00  0.65           N  
ATOM   3837  CA  ALA B  59      33.018  24.486 -90.726  1.00  0.65           C  
ATOM   3838  C   ALA B  59      31.898  24.663 -89.700  1.00  0.65           C  
ATOM   3839  O   ALA B  59      30.951  23.879 -89.638  1.00  0.65           O  
ATOM   3840  CB  ALA B  59      32.489  24.805 -92.141  1.00  0.65           C  
ATOM   3841  N   VAL B  60      31.969  25.719 -88.874  1.00  0.62           N  
ATOM   3842  CA  VAL B  60      31.033  25.957 -87.795  1.00  0.62           C  
ATOM   3843  C   VAL B  60      30.145  27.127 -88.170  1.00  0.62           C  
ATOM   3844  O   VAL B  60      30.556  28.286 -88.215  1.00  0.62           O  
ATOM   3845  CB  VAL B  60      31.734  26.245 -86.467  1.00  0.62           C  
ATOM   3846  CG1 VAL B  60      30.703  26.410 -85.330  1.00  0.62           C  
ATOM   3847  CG2 VAL B  60      32.706  25.096 -86.132  1.00  0.62           C  
ATOM   3848  N   THR B  61      28.860  26.845 -88.442  1.00  0.66           N  
ATOM   3849  CA  THR B  61      27.874  27.877 -88.730  1.00  0.66           C  
ATOM   3850  C   THR B  61      27.138  28.198 -87.458  1.00  0.66           C  
ATOM   3851  O   THR B  61      26.486  27.340 -86.863  1.00  0.66           O  
ATOM   3852  CB  THR B  61      26.828  27.466 -89.763  1.00  0.66           C  
ATOM   3853  OG1 THR B  61      27.423  27.319 -91.044  1.00  0.66           O  
ATOM   3854  CG2 THR B  61      25.725  28.523 -89.942  1.00  0.66           C  
ATOM   3855  N   ALA B  62      27.179  29.467 -87.015  1.00  0.69           N  
ATOM   3856  CA  ALA B  62      26.302  29.928 -85.963  1.00  0.69           C  
ATOM   3857  C   ALA B  62      24.913  30.184 -86.515  1.00  0.69           C  
ATOM   3858  O   ALA B  62      24.746  30.867 -87.524  1.00  0.69           O  
ATOM   3859  CB  ALA B  62      26.812  31.221 -85.309  1.00  0.69           C  
ATOM   3860  N   VAL B  63      23.888  29.626 -85.862  1.00  0.71           N  
ATOM   3861  CA  VAL B  63      22.505  29.792 -86.245  1.00  0.71           C  
ATOM   3862  C   VAL B  63      21.854  30.617 -85.165  1.00  0.71           C  
ATOM   3863  O   VAL B  63      21.732  30.182 -84.021  1.00  0.71           O  
ATOM   3864  CB  VAL B  63      21.776  28.459 -86.366  1.00  0.71           C  
ATOM   3865  CG1 VAL B  63      20.298  28.695 -86.740  1.00  0.71           C  
ATOM   3866  CG2 VAL B  63      22.486  27.586 -87.419  1.00  0.71           C  
ATOM   3867  N   VAL B  64      21.428  31.845 -85.504  1.00  0.72           N  
ATOM   3868  CA  VAL B  64      20.814  32.747 -84.551  1.00  0.72           C  
ATOM   3869  C   VAL B  64      19.378  32.977 -84.959  1.00  0.72           C  
ATOM   3870  O   VAL B  64      19.086  33.523 -86.022  1.00  0.72           O  
ATOM   3871  CB  VAL B  64      21.546  34.082 -84.428  1.00  0.72           C  
ATOM   3872  CG1 VAL B  64      20.913  34.927 -83.302  1.00  0.72           C  
ATOM   3873  CG2 VAL B  64      23.030  33.821 -84.099  1.00  0.72           C  
ATOM   3874  N   LEU B  65      18.415  32.564 -84.117  1.00  0.68           N  
ATOM   3875  CA  LEU B  65      17.016  32.893 -84.324  1.00  0.68           C  
ATOM   3876  C   LEU B  65      16.776  34.276 -83.755  1.00  0.68           C  
ATOM   3877  O   LEU B  65      17.282  34.610 -82.687  1.00  0.68           O  
ATOM   3878  CB  LEU B  65      16.056  31.879 -83.652  1.00  0.68           C  
ATOM   3879  CG  LEU B  65      15.681  30.665 -84.529  1.00  0.68           C  
ATOM   3880  CD1 LEU B  65      16.887  29.810 -84.949  1.00  0.68           C  
ATOM   3881  CD2 LEU B  65      14.639  29.806 -83.797  1.00  0.68           C  
ATOM   3882  N   THR B  66      16.030  35.134 -84.470  1.00  0.66           N  
ATOM   3883  CA  THR B  66      15.922  36.530 -84.075  1.00  0.66           C  
ATOM   3884  C   THR B  66      14.561  37.084 -84.444  1.00  0.66           C  
ATOM   3885  O   THR B  66      13.879  36.561 -85.327  1.00  0.66           O  
ATOM   3886  CB  THR B  66      17.055  37.382 -84.651  1.00  0.66           C  
ATOM   3887  OG1 THR B  66      17.127  38.647 -84.019  1.00  0.66           O  
ATOM   3888  CG2 THR B  66      16.918  37.607 -86.163  1.00  0.66           C  
ATOM   3889  N   HIS B  67      14.133  38.141 -83.730  1.00  0.53           N  
ATOM   3890  CA  HIS B  67      12.826  38.758 -83.854  1.00  0.53           C  
ATOM   3891  C   HIS B  67      12.746  39.936 -82.898  1.00  0.53           C  
ATOM   3892  O   HIS B  67      12.514  39.742 -81.708  1.00  0.53           O  
ATOM   3893  CB  HIS B  67      11.644  37.820 -83.478  1.00  0.53           C  
ATOM   3894  CG  HIS B  67      10.341  38.488 -83.781  1.00  0.53           C  
ATOM   3895  ND1 HIS B  67       9.937  38.524 -85.096  1.00  0.53           N  
ATOM   3896  CD2 HIS B  67       9.705  39.448 -83.065  1.00  0.53           C  
ATOM   3897  CE1 HIS B  67       9.071  39.520 -85.165  1.00  0.53           C  
ATOM   3898  NE2 HIS B  67       8.902  40.118 -83.961  1.00  0.53           N  
ATOM   3899  N   ASP B  68      12.931  41.172 -83.399  1.00  0.54           N  
ATOM   3900  CA  ASP B  68      12.892  42.405 -82.618  1.00  0.54           C  
ATOM   3901  C   ASP B  68      13.937  42.474 -81.485  1.00  0.54           C  
ATOM   3902  O   ASP B  68      13.641  42.745 -80.321  1.00  0.54           O  
ATOM   3903  CB  ASP B  68      11.461  42.799 -82.144  1.00  0.54           C  
ATOM   3904  CG  ASP B  68      10.494  42.956 -83.303  1.00  0.54           C  
ATOM   3905  OD1 ASP B  68      10.934  43.353 -84.412  1.00  0.54           O  
ATOM   3906  OD2 ASP B  68       9.281  42.687 -83.092  1.00  0.54           O  
ATOM   3907  N   GLU B  69      15.212  42.215 -81.841  1.00  0.59           N  
ATOM   3908  CA  GLU B  69      16.321  41.985 -80.931  1.00  0.59           C  
ATOM   3909  C   GLU B  69      17.447  43.000 -81.113  1.00  0.59           C  
ATOM   3910  O   GLU B  69      18.605  42.728 -80.775  1.00  0.59           O  
ATOM   3911  CB  GLU B  69      16.917  40.577 -81.182  1.00  0.59           C  
ATOM   3912  CG  GLU B  69      15.950  39.416 -80.841  1.00  0.59           C  
ATOM   3913  CD  GLU B  69      15.833  39.089 -79.352  1.00  0.59           C  
ATOM   3914  OE1 GLU B  69      15.175  38.055 -79.060  1.00  0.59           O  
ATOM   3915  OE2 GLU B  69      16.421  39.819 -78.515  1.00  0.59           O  
ATOM   3916  N   GLU B  70      17.175  44.208 -81.662  1.00  0.57           N  
ATOM   3917  CA  GLU B  70      18.193  45.151 -82.124  1.00  0.57           C  
ATOM   3918  C   GLU B  70      19.282  45.507 -81.122  1.00  0.57           C  
ATOM   3919  O   GLU B  70      20.459  45.611 -81.462  1.00  0.57           O  
ATOM   3920  CB  GLU B  70      17.555  46.468 -82.647  1.00  0.57           C  
ATOM   3921  CG  GLU B  70      16.756  47.291 -81.597  1.00  0.57           C  
ATOM   3922  CD  GLU B  70      16.078  48.543 -82.147  1.00  0.57           C  
ATOM   3923  OE1 GLU B  70      15.652  49.368 -81.298  1.00  0.57           O  
ATOM   3924  OE2 GLU B  70      15.993  48.700 -83.393  1.00  0.57           O  
ATOM   3925  N   GLN B  71      18.915  45.669 -79.843  1.00  0.57           N  
ATOM   3926  CA  GLN B  71      19.818  46.009 -78.767  1.00  0.57           C  
ATOM   3927  C   GLN B  71      20.827  44.914 -78.415  1.00  0.57           C  
ATOM   3928  O   GLN B  71      21.985  45.204 -78.116  1.00  0.57           O  
ATOM   3929  CB  GLN B  71      19.003  46.486 -77.540  1.00  0.57           C  
ATOM   3930  CG  GLN B  71      18.034  47.636 -77.924  1.00  0.57           C  
ATOM   3931  CD  GLN B  71      17.376  48.316 -76.726  1.00  0.57           C  
ATOM   3932  OE1 GLN B  71      17.760  48.159 -75.566  1.00  0.57           O  
ATOM   3933  NE2 GLN B  71      16.316  49.103 -77.026  1.00  0.57           N  
ATOM   3934  N   VAL B  72      20.437  43.621 -78.455  1.00  0.65           N  
ATOM   3935  CA  VAL B  72      21.321  42.537 -78.037  1.00  0.65           C  
ATOM   3936  C   VAL B  72      22.014  41.834 -79.194  1.00  0.65           C  
ATOM   3937  O   VAL B  72      23.106  41.286 -79.026  1.00  0.65           O  
ATOM   3938  CB  VAL B  72      20.593  41.483 -77.209  1.00  0.65           C  
ATOM   3939  CG1 VAL B  72      20.145  42.109 -75.875  1.00  0.65           C  
ATOM   3940  CG2 VAL B  72      19.391  40.895 -77.970  1.00  0.65           C  
ATOM   3941  N   ILE B  73      21.455  41.880 -80.427  1.00  0.67           N  
ATOM   3942  CA  ILE B  73      21.936  41.089 -81.561  1.00  0.67           C  
ATOM   3943  C   ILE B  73      23.392  41.353 -81.937  1.00  0.67           C  
ATOM   3944  O   ILE B  73      24.166  40.441 -82.226  1.00  0.67           O  
ATOM   3945  CB  ILE B  73      21.008  41.214 -82.778  1.00  0.67           C  
ATOM   3946  CG1 ILE B  73      21.323  40.196 -83.904  1.00  0.67           C  
ATOM   3947  CG2 ILE B  73      20.995  42.653 -83.344  1.00  0.67           C  
ATOM   3948  CD1 ILE B  73      21.147  38.731 -83.490  1.00  0.67           C  
ATOM   3949  N   GLY B  74      23.839  42.626 -81.882  1.00  0.65           N  
ATOM   3950  CA  GLY B  74      25.223  42.982 -82.169  1.00  0.65           C  
ATOM   3951  C   GLY B  74      26.236  42.481 -81.168  1.00  0.65           C  
ATOM   3952  O   GLY B  74      27.397  42.272 -81.507  1.00  0.65           O  
ATOM   3953  N   ALA B  75      25.834  42.275 -79.898  1.00  0.69           N  
ATOM   3954  CA  ALA B  75      26.678  41.661 -78.891  1.00  0.69           C  
ATOM   3955  C   ALA B  75      26.863  40.168 -79.124  1.00  0.69           C  
ATOM   3956  O   ALA B  75      27.980  39.658 -79.068  1.00  0.69           O  
ATOM   3957  CB  ALA B  75      26.096  41.914 -77.487  1.00  0.69           C  
ATOM   3958  N   CYS B  76      25.762  39.458 -79.456  1.00  0.69           N  
ATOM   3959  CA  CYS B  76      25.755  38.036 -79.772  1.00  0.69           C  
ATOM   3960  C   CYS B  76      26.660  37.698 -80.953  1.00  0.69           C  
ATOM   3961  O   CYS B  76      27.540  36.845 -80.864  1.00  0.69           O  
ATOM   3962  CB  CYS B  76      24.283  37.620 -80.081  1.00  0.69           C  
ATOM   3963  SG  CYS B  76      23.998  35.868 -80.536  1.00  0.69           S  
ATOM   3964  N   LEU B  77      26.525  38.427 -82.079  1.00  0.68           N  
ATOM   3965  CA  LEU B  77      27.324  38.198 -83.273  1.00  0.68           C  
ATOM   3966  C   LEU B  77      28.812  38.472 -83.110  1.00  0.68           C  
ATOM   3967  O   LEU B  77      29.645  37.709 -83.592  1.00  0.68           O  
ATOM   3968  CB  LEU B  77      26.763  38.984 -84.478  1.00  0.68           C  
ATOM   3969  CG  LEU B  77      25.314  38.606 -84.850  1.00  0.68           C  
ATOM   3970  CD1 LEU B  77      24.836  39.483 -86.013  1.00  0.68           C  
ATOM   3971  CD2 LEU B  77      25.151  37.116 -85.192  1.00  0.68           C  
ATOM   3972  N   ARG B  78      29.199  39.538 -82.378  1.00  0.61           N  
ATOM   3973  CA  ARG B  78      30.601  39.864 -82.146  1.00  0.61           C  
ATOM   3974  C   ARG B  78      31.309  38.915 -81.193  1.00  0.61           C  
ATOM   3975  O   ARG B  78      32.532  38.922 -81.102  1.00  0.61           O  
ATOM   3976  CB  ARG B  78      30.769  41.293 -81.581  1.00  0.61           C  
ATOM   3977  CG  ARG B  78      30.568  42.384 -82.644  1.00  0.61           C  
ATOM   3978  CD  ARG B  78      31.010  43.778 -82.192  1.00  0.61           C  
ATOM   3979  NE  ARG B  78      30.090  44.202 -81.081  1.00  0.61           N  
ATOM   3980  CZ  ARG B  78      29.048  45.031 -81.229  1.00  0.61           C  
ATOM   3981  NH1 ARG B  78      28.743  45.560 -82.407  1.00  0.61           N  
ATOM   3982  NH2 ARG B  78      28.303  45.340 -80.168  1.00  0.61           N  
ATOM   3983  N   ALA B  79      30.568  38.069 -80.462  1.00  0.68           N  
ATOM   3984  CA  ALA B  79      31.173  37.078 -79.605  1.00  0.68           C  
ATOM   3985  C   ALA B  79      31.300  35.733 -80.308  1.00  0.68           C  
ATOM   3986  O   ALA B  79      31.877  34.793 -79.775  1.00  0.68           O  
ATOM   3987  CB  ALA B  79      30.291  36.940 -78.354  1.00  0.68           C  
ATOM   3988  N   LEU B  80      30.789  35.610 -81.549  1.00  0.64           N  
ATOM   3989  CA  LEU B  80      30.837  34.365 -82.293  1.00  0.64           C  
ATOM   3990  C   LEU B  80      31.831  34.411 -83.441  1.00  0.64           C  
ATOM   3991  O   LEU B  80      32.065  33.403 -84.101  1.00  0.64           O  
ATOM   3992  CB  LEU B  80      29.432  34.057 -82.868  1.00  0.64           C  
ATOM   3993  CG  LEU B  80      28.380  33.720 -81.791  1.00  0.64           C  
ATOM   3994  CD1 LEU B  80      26.959  33.800 -82.367  1.00  0.64           C  
ATOM   3995  CD2 LEU B  80      28.632  32.342 -81.160  1.00  0.64           C  
ATOM   3996  N   THR B  81      32.474  35.565 -83.709  1.00  0.60           N  
ATOM   3997  CA  THR B  81      33.401  35.736 -84.830  1.00  0.60           C  
ATOM   3998  C   THR B  81      34.663  34.907 -84.751  1.00  0.60           C  
ATOM   3999  O   THR B  81      35.136  34.398 -85.761  1.00  0.60           O  
ATOM   4000  CB  THR B  81      33.812  37.182 -85.074  1.00  0.60           C  
ATOM   4001  OG1 THR B  81      34.193  37.842 -83.873  1.00  0.60           O  
ATOM   4002  CG2 THR B  81      32.597  37.947 -85.619  1.00  0.60           C  
ATOM   4003  N   ASP B  82      35.255  34.752 -83.552  1.00  0.48           N  
ATOM   4004  CA  ASP B  82      36.433  33.932 -83.340  1.00  0.48           C  
ATOM   4005  C   ASP B  82      36.184  32.441 -83.612  1.00  0.48           C  
ATOM   4006  O   ASP B  82      36.986  31.730 -84.220  1.00  0.48           O  
ATOM   4007  CB  ASP B  82      36.890  34.106 -81.874  1.00  0.48           C  
ATOM   4008  CG  ASP B  82      37.081  35.569 -81.514  1.00  0.48           C  
ATOM   4009  OD1 ASP B  82      38.139  36.142 -81.864  1.00  0.48           O  
ATOM   4010  OD2 ASP B  82      36.206  36.119 -80.790  1.00  0.48           O  
ATOM   4011  N   ASP B  83      35.025  31.933 -83.155  1.00  0.54           N  
ATOM   4012  CA  ASP B  83      34.729  30.521 -83.173  1.00  0.54           C  
ATOM   4013  C   ASP B  83      33.940  30.049 -84.383  1.00  0.54           C  
ATOM   4014  O   ASP B  83      33.991  28.861 -84.702  1.00  0.54           O  
ATOM   4015  CB  ASP B  83      33.921  30.185 -81.901  1.00  0.54           C  
ATOM   4016  CG  ASP B  83      34.891  29.990 -80.761  1.00  0.54           C  
ATOM   4017  OD1 ASP B  83      35.496  28.885 -80.711  1.00  0.54           O  
ATOM   4018  OD2 ASP B  83      35.051  30.907 -79.923  1.00  0.54           O  
ATOM   4019  N   CYS B  84      33.233  30.920 -85.128  1.00  0.59           N  
ATOM   4020  CA  CYS B  84      32.312  30.483 -86.173  1.00  0.59           C  
ATOM   4021  C   CYS B  84      32.639  31.083 -87.530  1.00  0.59           C  
ATOM   4022  O   CYS B  84      32.718  32.296 -87.698  1.00  0.59           O  
ATOM   4023  CB  CYS B  84      30.846  30.833 -85.812  1.00  0.59           C  
ATOM   4024  SG  CYS B  84      30.326  30.037 -84.249  1.00  0.59           S  
ATOM   4025  N   ASP B  85      32.815  30.217 -88.552  1.00  0.62           N  
ATOM   4026  CA  ASP B  85      33.180  30.557 -89.917  1.00  0.62           C  
ATOM   4027  C   ASP B  85      32.079  31.332 -90.633  1.00  0.62           C  
ATOM   4028  O   ASP B  85      32.323  32.141 -91.526  1.00  0.62           O  
ATOM   4029  CB  ASP B  85      33.495  29.274 -90.751  1.00  0.62           C  
ATOM   4030  CG  ASP B  85      34.366  28.308 -89.984  1.00  0.62           C  
ATOM   4031  OD1 ASP B  85      35.585  28.186 -90.242  1.00  0.62           O  
ATOM   4032  OD2 ASP B  85      33.822  27.669 -89.045  1.00  0.62           O  
ATOM   4033  N   ARG B  86      30.815  31.069 -90.253  1.00  0.61           N  
ATOM   4034  CA  ARG B  86      29.668  31.650 -90.906  1.00  0.61           C  
ATOM   4035  C   ARG B  86      28.603  31.997 -89.880  1.00  0.61           C  
ATOM   4036  O   ARG B  86      28.348  31.243 -88.941  1.00  0.61           O  
ATOM   4037  CB  ARG B  86      29.110  30.646 -91.942  1.00  0.61           C  
ATOM   4038  CG  ARG B  86      28.269  31.291 -93.056  1.00  0.61           C  
ATOM   4039  CD  ARG B  86      27.757  30.293 -94.099  1.00  0.61           C  
ATOM   4040  NE  ARG B  86      26.643  29.543 -93.442  1.00  0.61           N  
ATOM   4041  CZ  ARG B  86      25.737  28.823 -94.109  1.00  0.61           C  
ATOM   4042  NH1 ARG B  86      25.818  28.617 -95.417  1.00  0.61           N  
ATOM   4043  NH2 ARG B  86      24.699  28.310 -93.457  1.00  0.61           N  
ATOM   4044  N   LEU B  87      27.950  33.165 -90.026  1.00  0.71           N  
ATOM   4045  CA  LEU B  87      26.934  33.625 -89.100  1.00  0.71           C  
ATOM   4046  C   LEU B  87      25.611  33.732 -89.838  1.00  0.71           C  
ATOM   4047  O   LEU B  87      25.453  34.556 -90.738  1.00  0.71           O  
ATOM   4048  CB  LEU B  87      27.294  35.014 -88.507  1.00  0.71           C  
ATOM   4049  CG  LEU B  87      28.640  35.083 -87.751  1.00  0.71           C  
ATOM   4050  CD1 LEU B  87      28.917  36.523 -87.298  1.00  0.71           C  
ATOM   4051  CD2 LEU B  87      28.703  34.136 -86.545  1.00  0.71           C  
ATOM   4052  N   LEU B  88      24.627  32.889 -89.474  1.00  0.70           N  
ATOM   4053  CA  LEU B  88      23.350  32.797 -90.152  1.00  0.70           C  
ATOM   4054  C   LEU B  88      22.233  33.225 -89.217  1.00  0.70           C  
ATOM   4055  O   LEU B  88      22.002  32.633 -88.164  1.00  0.70           O  
ATOM   4056  CB  LEU B  88      23.097  31.336 -90.611  1.00  0.70           C  
ATOM   4057  CG  LEU B  88      21.740  31.071 -91.303  1.00  0.70           C  
ATOM   4058  CD1 LEU B  88      21.607  31.835 -92.629  1.00  0.70           C  
ATOM   4059  CD2 LEU B  88      21.524  29.567 -91.530  1.00  0.70           C  
ATOM   4060  N   LEU B  89      21.490  34.276 -89.595  1.00  0.70           N  
ATOM   4061  CA  LEU B  89      20.320  34.726 -88.872  1.00  0.70           C  
ATOM   4062  C   LEU B  89      19.078  34.144 -89.510  1.00  0.70           C  
ATOM   4063  O   LEU B  89      18.826  34.312 -90.703  1.00  0.70           O  
ATOM   4064  CB  LEU B  89      20.174  36.272 -88.853  1.00  0.70           C  
ATOM   4065  CG  LEU B  89      20.946  36.976 -87.719  1.00  0.70           C  
ATOM   4066  CD1 LEU B  89      22.445  36.671 -87.757  1.00  0.70           C  
ATOM   4067  CD2 LEU B  89      20.717  38.493 -87.783  1.00  0.70           C  
ATOM   4068  N   VAL B  90      18.241  33.474 -88.703  1.00  0.69           N  
ATOM   4069  CA  VAL B  90      16.898  33.105 -89.103  1.00  0.69           C  
ATOM   4070  C   VAL B  90      15.992  34.167 -88.515  1.00  0.69           C  
ATOM   4071  O   VAL B  90      15.747  34.216 -87.309  1.00  0.69           O  
ATOM   4072  CB  VAL B  90      16.483  31.713 -88.640  1.00  0.69           C  
ATOM   4073  CG1 VAL B  90      15.069  31.388 -89.168  1.00  0.69           C  
ATOM   4074  CG2 VAL B  90      17.499  30.681 -89.172  1.00  0.69           C  
ATOM   4075  N   ASP B  91      15.507  35.084 -89.368  1.00  0.63           N  
ATOM   4076  CA  ASP B  91      14.703  36.208 -88.955  1.00  0.63           C  
ATOM   4077  C   ASP B  91      13.241  35.806 -89.063  1.00  0.63           C  
ATOM   4078  O   ASP B  91      12.811  35.214 -90.053  1.00  0.63           O  
ATOM   4079  CB  ASP B  91      15.060  37.442 -89.826  1.00  0.63           C  
ATOM   4080  CG  ASP B  91      14.332  38.682 -89.356  1.00  0.63           C  
ATOM   4081  OD1 ASP B  91      14.838  39.351 -88.425  1.00  0.63           O  
ATOM   4082  OD2 ASP B  91      13.239  38.966 -89.904  1.00  0.63           O  
ATOM   4083  N   ALA B  92      12.447  36.105 -88.021  1.00  0.59           N  
ATOM   4084  CA  ALA B  92      11.059  35.709 -87.940  1.00  0.59           C  
ATOM   4085  C   ALA B  92      10.106  36.813 -88.385  1.00  0.59           C  
ATOM   4086  O   ALA B  92       8.913  36.737 -88.092  1.00  0.59           O  
ATOM   4087  CB  ALA B  92      10.749  35.274 -86.496  1.00  0.59           C  
ATOM   4088  N   GLU B  93      10.648  37.823 -89.113  1.00  0.49           N  
ATOM   4089  CA  GLU B  93      10.005  39.039 -89.583  1.00  0.49           C  
ATOM   4090  C   GLU B  93      10.117  40.165 -88.559  1.00  0.49           C  
ATOM   4091  O   GLU B  93       9.126  40.710 -88.081  1.00  0.49           O  
ATOM   4092  CB  GLU B  93       8.586  38.871 -90.212  1.00  0.49           C  
ATOM   4093  CG  GLU B  93       8.573  37.892 -91.419  1.00  0.49           C  
ATOM   4094  CD  GLU B  93       7.192  37.651 -92.030  1.00  0.49           C  
ATOM   4095  OE1 GLU B  93       7.072  37.817 -93.272  1.00  0.49           O  
ATOM   4096  OE2 GLU B  93       6.270  37.227 -91.285  1.00  0.49           O  
ATOM   4097  N   SER B  94      11.368  40.549 -88.197  1.00  0.56           N  
ATOM   4098  CA  SER B  94      11.641  41.694 -87.320  1.00  0.56           C  
ATOM   4099  C   SER B  94      11.145  43.019 -87.874  1.00  0.56           C  
ATOM   4100  O   SER B  94      11.297  43.302 -89.063  1.00  0.56           O  
ATOM   4101  CB  SER B  94      13.147  41.922 -87.044  1.00  0.56           C  
ATOM   4102  OG  SER B  94      13.730  40.759 -86.454  1.00  0.56           O  
ATOM   4103  N   GLU B  95      10.579  43.890 -87.018  1.00  0.50           N  
ATOM   4104  CA  GLU B  95      10.092  45.197 -87.426  1.00  0.50           C  
ATOM   4105  C   GLU B  95      10.996  46.322 -86.935  1.00  0.50           C  
ATOM   4106  O   GLU B  95      10.826  47.479 -87.320  1.00  0.50           O  
ATOM   4107  CB  GLU B  95       8.663  45.463 -86.881  1.00  0.50           C  
ATOM   4108  CG  GLU B  95       7.572  44.523 -87.462  1.00  0.50           C  
ATOM   4109  CD  GLU B  95       6.136  44.973 -87.171  1.00  0.50           C  
ATOM   4110  OE1 GLU B  95       5.208  44.250 -87.621  1.00  0.50           O  
ATOM   4111  OE2 GLU B  95       5.938  46.041 -86.535  1.00  0.50           O  
ATOM   4112  N   ASP B  96      12.003  46.018 -86.091  1.00  0.51           N  
ATOM   4113  CA  ASP B  96      12.948  46.992 -85.575  1.00  0.51           C  
ATOM   4114  C   ASP B  96      14.150  47.247 -86.512  1.00  0.51           C  
ATOM   4115  O   ASP B  96      14.077  47.127 -87.735  1.00  0.51           O  
ATOM   4116  CB  ASP B  96      13.373  46.576 -84.133  1.00  0.51           C  
ATOM   4117  CG  ASP B  96      14.269  45.356 -84.092  1.00  0.51           C  
ATOM   4118  OD1 ASP B  96      14.548  44.757 -85.161  1.00  0.51           O  
ATOM   4119  OD2 ASP B  96      14.773  45.006 -82.999  1.00  0.51           O  
ATOM   4120  N   THR B  97      15.334  47.585 -85.944  1.00  0.63           N  
ATOM   4121  CA  THR B  97      16.563  47.758 -86.712  1.00  0.63           C  
ATOM   4122  C   THR B  97      17.466  46.532 -86.713  1.00  0.63           C  
ATOM   4123  O   THR B  97      18.589  46.604 -87.211  1.00  0.63           O  
ATOM   4124  CB  THR B  97      17.402  48.986 -86.335  1.00  0.63           C  
ATOM   4125  OG1 THR B  97      17.974  48.933 -85.035  1.00  0.63           O  
ATOM   4126  CG2 THR B  97      16.540  50.253 -86.426  1.00  0.63           C  
ATOM   4127  N   THR B  98      17.005  45.349 -86.224  1.00  0.63           N  
ATOM   4128  CA  THR B  98      17.784  44.111 -86.016  1.00  0.63           C  
ATOM   4129  C   THR B  98      18.688  43.731 -87.152  1.00  0.63           C  
ATOM   4130  O   THR B  98      19.884  43.508 -86.969  1.00  0.63           O  
ATOM   4131  CB  THR B  98      16.910  42.888 -85.736  1.00  0.63           C  
ATOM   4132  OG1 THR B  98      16.370  43.026 -84.436  1.00  0.63           O  
ATOM   4133  CG2 THR B  98      17.668  41.552 -85.692  1.00  0.63           C  
ATOM   4134  N   LEU B  99      18.153  43.683 -88.383  1.00  0.59           N  
ATOM   4135  CA  LEU B  99      18.921  43.336 -89.562  1.00  0.59           C  
ATOM   4136  C   LEU B  99      19.983  44.361 -89.940  1.00  0.59           C  
ATOM   4137  O   LEU B  99      21.024  44.008 -90.487  1.00  0.59           O  
ATOM   4138  CB  LEU B  99      17.995  43.065 -90.771  1.00  0.59           C  
ATOM   4139  CG  LEU B  99      17.018  41.886 -90.568  1.00  0.59           C  
ATOM   4140  CD1 LEU B  99      16.099  41.719 -91.788  1.00  0.59           C  
ATOM   4141  CD2 LEU B  99      17.742  40.560 -90.281  1.00  0.59           C  
ATOM   4142  N   GLY B 100      19.770  45.659 -89.637  1.00  0.63           N  
ATOM   4143  CA  GLY B 100      20.783  46.691 -89.842  1.00  0.63           C  
ATOM   4144  C   GLY B 100      21.869  46.636 -88.803  1.00  0.63           C  
ATOM   4145  O   GLY B 100      23.052  46.664 -89.124  1.00  0.63           O  
ATOM   4146  N   THR B 101      21.487  46.487 -87.521  1.00  0.64           N  
ATOM   4147  CA  THR B 101      22.413  46.329 -86.398  1.00  0.64           C  
ATOM   4148  C   THR B 101      23.261  45.084 -86.516  1.00  0.64           C  
ATOM   4149  O   THR B 101      24.457  45.107 -86.243  1.00  0.64           O  
ATOM   4150  CB  THR B 101      21.713  46.349 -85.047  1.00  0.64           C  
ATOM   4151  OG1 THR B 101      21.104  47.620 -84.892  1.00  0.64           O  
ATOM   4152  CG2 THR B 101      22.711  46.202 -83.887  1.00  0.64           C  
ATOM   4153  N   ALA B 102      22.680  43.957 -86.973  1.00  0.64           N  
ATOM   4154  CA  ALA B 102      23.411  42.741 -87.264  1.00  0.64           C  
ATOM   4155  C   ALA B 102      24.485  42.894 -88.340  1.00  0.64           C  
ATOM   4156  O   ALA B 102      25.614  42.447 -88.163  1.00  0.64           O  
ATOM   4157  CB  ALA B 102      22.410  41.655 -87.703  1.00  0.64           C  
ATOM   4158  N   ARG B 103      24.165  43.571 -89.463  1.00  0.56           N  
ATOM   4159  CA  ARG B 103      25.116  43.881 -90.522  1.00  0.56           C  
ATOM   4160  C   ARG B 103      26.220  44.834 -90.095  1.00  0.56           C  
ATOM   4161  O   ARG B 103      27.382  44.645 -90.430  1.00  0.56           O  
ATOM   4162  CB  ARG B 103      24.389  44.465 -91.756  1.00  0.56           C  
ATOM   4163  CG  ARG B 103      23.495  43.434 -92.472  1.00  0.56           C  
ATOM   4164  CD  ARG B 103      22.581  44.082 -93.513  1.00  0.56           C  
ATOM   4165  NE  ARG B 103      21.638  43.021 -93.998  1.00  0.56           N  
ATOM   4166  CZ  ARG B 103      20.454  43.290 -94.560  1.00  0.56           C  
ATOM   4167  NH1 ARG B 103      20.139  44.522 -94.953  1.00  0.56           N  
ATOM   4168  NH2 ARG B 103      19.567  42.317 -94.739  1.00  0.56           N  
ATOM   4169  N   SER B 104      25.895  45.879 -89.316  1.00  0.62           N  
ATOM   4170  CA  SER B 104      26.885  46.840 -88.842  1.00  0.62           C  
ATOM   4171  C   SER B 104      27.743  46.317 -87.703  1.00  0.62           C  
ATOM   4172  O   SER B 104      28.752  46.915 -87.339  1.00  0.62           O  
ATOM   4173  CB  SER B 104      26.223  48.145 -88.335  1.00  0.62           C  
ATOM   4174  OG  SER B 104      25.532  48.797 -89.400  1.00  0.62           O  
ATOM   4175  N   ALA B 105      27.356  45.194 -87.069  1.00  0.59           N  
ATOM   4176  CA  ALA B 105      28.094  44.628 -85.964  1.00  0.59           C  
ATOM   4177  C   ALA B 105      29.300  43.779 -86.343  1.00  0.59           C  
ATOM   4178  O   ALA B 105      30.220  43.653 -85.533  1.00  0.59           O  
ATOM   4179  CB  ALA B 105      27.143  43.759 -85.118  1.00  0.59           C  
ATOM   4180  N   VAL B 106      29.325  43.178 -87.550  1.00  0.51           N  
ATOM   4181  CA  VAL B 106      30.325  42.192 -87.940  1.00  0.51           C  
ATOM   4182  C   VAL B 106      30.637  42.324 -89.422  1.00  0.51           C  
ATOM   4183  O   VAL B 106      29.883  42.905 -90.190  1.00  0.51           O  
ATOM   4184  CB  VAL B 106      29.915  40.737 -87.662  1.00  0.51           C  
ATOM   4185  CG1 VAL B 106      29.910  40.463 -86.145  1.00  0.51           C  
ATOM   4186  CG2 VAL B 106      28.536  40.429 -88.277  1.00  0.51           C  
ATOM   4187  N   ALA B 107      31.794  41.789 -89.872  1.00  0.34           N  
ATOM   4188  CA  ALA B 107      32.254  41.889 -91.249  1.00  0.34           C  
ATOM   4189  C   ALA B 107      31.393  41.186 -92.305  1.00  0.34           C  
ATOM   4190  O   ALA B 107      31.260  41.662 -93.428  1.00  0.34           O  
ATOM   4191  CB  ALA B 107      33.704  41.371 -91.333  1.00  0.34           C  
ATOM   4192  N   HIS B 108      30.807  40.020 -91.975  1.00  0.45           N  
ATOM   4193  CA  HIS B 108      29.924  39.299 -92.873  1.00  0.45           C  
ATOM   4194  C   HIS B 108      28.871  38.615 -92.030  1.00  0.45           C  
ATOM   4195  O   HIS B 108      29.161  38.099 -90.951  1.00  0.45           O  
ATOM   4196  CB  HIS B 108      30.674  38.242 -93.729  1.00  0.45           C  
ATOM   4197  CG  HIS B 108      29.789  37.330 -94.533  1.00  0.45           C  
ATOM   4198  ND1 HIS B 108      28.838  37.881 -95.368  1.00  0.45           N  
ATOM   4199  CD2 HIS B 108      29.692  35.973 -94.538  1.00  0.45           C  
ATOM   4200  CE1 HIS B 108      28.181  36.849 -95.866  1.00  0.45           C  
ATOM   4201  NE2 HIS B 108      28.657  35.670 -95.396  1.00  0.45           N  
ATOM   4202  N   VAL B 109      27.614  38.621 -92.503  1.00  0.66           N  
ATOM   4203  CA  VAL B 109      26.510  37.963 -91.841  1.00  0.66           C  
ATOM   4204  C   VAL B 109      25.457  37.646 -92.888  1.00  0.66           C  
ATOM   4205  O   VAL B 109      25.251  38.400 -93.838  1.00  0.66           O  
ATOM   4206  CB  VAL B 109      25.955  38.790 -90.677  1.00  0.66           C  
ATOM   4207  CG1 VAL B 109      25.412  40.154 -91.142  1.00  0.66           C  
ATOM   4208  CG2 VAL B 109      24.894  38.007 -89.887  1.00  0.66           C  
ATOM   4209  N   GLU B 110      24.761  36.505 -92.749  1.00  0.67           N  
ATOM   4210  CA  GLU B 110      23.776  36.038 -93.701  1.00  0.67           C  
ATOM   4211  C   GLU B 110      22.428  36.018 -93.013  1.00  0.67           C  
ATOM   4212  O   GLU B 110      22.311  35.593 -91.866  1.00  0.67           O  
ATOM   4213  CB  GLU B 110      24.147  34.614 -94.185  1.00  0.67           C  
ATOM   4214  CG  GLU B 110      25.495  34.602 -94.944  1.00  0.67           C  
ATOM   4215  CD  GLU B 110      26.068  33.217 -95.211  1.00  0.67           C  
ATOM   4216  OE1 GLU B 110      27.258  33.186 -95.633  1.00  0.67           O  
ATOM   4217  OE2 GLU B 110      25.384  32.187 -94.979  1.00  0.67           O  
ATOM   4218  N   HIS B 111      21.358  36.510 -93.667  1.00  0.68           N  
ATOM   4219  CA  HIS B 111      20.031  36.507 -93.078  1.00  0.68           C  
ATOM   4220  C   HIS B 111      19.052  35.778 -93.980  1.00  0.68           C  
ATOM   4221  O   HIS B 111      19.038  35.964 -95.194  1.00  0.68           O  
ATOM   4222  CB  HIS B 111      19.504  37.937 -92.748  1.00  0.68           C  
ATOM   4223  CG  HIS B 111      18.976  38.708 -93.926  1.00  0.68           C  
ATOM   4224  ND1 HIS B 111      19.831  39.377 -94.787  1.00  0.68           N  
ATOM   4225  CD2 HIS B 111      17.733  38.625 -94.468  1.00  0.68           C  
ATOM   4226  CE1 HIS B 111      19.092  39.653 -95.848  1.00  0.68           C  
ATOM   4227  NE2 HIS B 111      17.815  39.230 -95.701  1.00  0.68           N  
ATOM   4228  N   VAL B 112      18.188  34.931 -93.396  1.00  0.70           N  
ATOM   4229  CA  VAL B 112      17.065  34.343 -94.104  1.00  0.70           C  
ATOM   4230  C   VAL B 112      15.815  34.724 -93.337  1.00  0.70           C  
ATOM   4231  O   VAL B 112      15.674  34.429 -92.152  1.00  0.70           O  
ATOM   4232  CB  VAL B 112      17.166  32.825 -94.241  1.00  0.70           C  
ATOM   4233  CG1 VAL B 112      15.934  32.257 -94.977  1.00  0.70           C  
ATOM   4234  CG2 VAL B 112      18.437  32.484 -95.040  1.00  0.70           C  
ATOM   4235  N   THR B 113      14.874  35.424 -93.997  1.00  0.62           N  
ATOM   4236  CA  THR B 113      13.626  35.875 -93.385  1.00  0.62           C  
ATOM   4237  C   THR B 113      12.543  34.853 -93.641  1.00  0.62           C  
ATOM   4238  O   THR B 113      12.291  34.475 -94.783  1.00  0.62           O  
ATOM   4239  CB  THR B 113      13.149  37.220 -93.923  1.00  0.62           C  
ATOM   4240  OG1 THR B 113      14.144  38.210 -93.717  1.00  0.62           O  
ATOM   4241  CG2 THR B 113      11.903  37.731 -93.192  1.00  0.62           C  
ATOM   4242  N   ARG B 114      11.884  34.350 -92.581  1.00  0.51           N  
ATOM   4243  CA  ARG B 114      10.816  33.377 -92.700  1.00  0.51           C  
ATOM   4244  C   ARG B 114       9.710  33.727 -91.732  1.00  0.51           C  
ATOM   4245  O   ARG B 114       9.954  33.880 -90.540  1.00  0.51           O  
ATOM   4246  CB  ARG B 114      11.283  31.949 -92.321  1.00  0.51           C  
ATOM   4247  CG  ARG B 114      12.344  31.363 -93.266  1.00  0.51           C  
ATOM   4248  CD  ARG B 114      12.853  29.982 -92.845  1.00  0.51           C  
ATOM   4249  NE  ARG B 114      11.801  28.952 -93.164  1.00  0.51           N  
ATOM   4250  CZ  ARG B 114      11.300  28.110 -92.251  1.00  0.51           C  
ATOM   4251  NH1 ARG B 114      11.214  28.418 -90.962  1.00  0.51           N  
ATOM   4252  NH2 ARG B 114      10.970  26.873 -92.625  1.00  0.51           N  
ATOM   4253  N   ALA B 115       8.456  33.818 -92.211  1.00  0.51           N  
ATOM   4254  CA  ALA B 115       7.310  34.161 -91.395  1.00  0.51           C  
ATOM   4255  C   ALA B 115       7.069  33.278 -90.175  1.00  0.51           C  
ATOM   4256  O   ALA B 115       7.291  32.065 -90.182  1.00  0.51           O  
ATOM   4257  CB  ALA B 115       6.047  34.181 -92.279  1.00  0.51           C  
ATOM   4258  N   TRP B 116       6.617  33.885 -89.063  1.00  0.36           N  
ATOM   4259  CA  TRP B 116       6.278  33.161 -87.855  1.00  0.36           C  
ATOM   4260  C   TRP B 116       5.003  32.317 -88.005  1.00  0.36           C  
ATOM   4261  O   TRP B 116       3.898  32.819 -88.183  1.00  0.36           O  
ATOM   4262  CB  TRP B 116       6.190  34.139 -86.652  1.00  0.36           C  
ATOM   4263  CG  TRP B 116       5.798  33.494 -85.332  1.00  0.36           C  
ATOM   4264  CD1 TRP B 116       4.573  33.509 -84.728  1.00  0.36           C  
ATOM   4265  CD2 TRP B 116       6.609  32.569 -84.590  1.00  0.36           C  
ATOM   4266  NE1 TRP B 116       4.561  32.651 -83.651  1.00  0.36           N  
ATOM   4267  CE2 TRP B 116       5.801  32.067 -83.546  1.00  0.36           C  
ATOM   4268  CE3 TRP B 116       7.919  32.127 -84.766  1.00  0.36           C  
ATOM   4269  CZ2 TRP B 116       6.285  31.109 -82.669  1.00  0.36           C  
ATOM   4270  CZ3 TRP B 116       8.398  31.140 -83.893  1.00  0.36           C  
ATOM   4271  CH2 TRP B 116       7.590  30.639 -82.863  1.00  0.36           C  
ATOM   4272  N   THR B 117       5.137  30.979 -87.915  1.00  0.38           N  
ATOM   4273  CA  THR B 117       4.069  30.024 -88.202  1.00  0.38           C  
ATOM   4274  C   THR B 117       3.462  29.412 -86.951  1.00  0.38           C  
ATOM   4275  O   THR B 117       2.706  28.438 -87.033  1.00  0.38           O  
ATOM   4276  CB  THR B 117       4.585  28.871 -89.065  1.00  0.38           C  
ATOM   4277  OG1 THR B 117       5.785  28.324 -88.526  1.00  0.38           O  
ATOM   4278  CG2 THR B 117       4.926  29.396 -90.467  1.00  0.38           C  
ATOM   4279  N   ASP B 118       3.778  29.972 -85.760  1.00  0.32           N  
ATOM   4280  CA  ASP B 118       3.544  29.351 -84.466  1.00  0.32           C  
ATOM   4281  C   ASP B 118       4.342  28.050 -84.300  1.00  0.32           C  
ATOM   4282  O   ASP B 118       3.792  26.965 -84.091  1.00  0.32           O  
ATOM   4283  CB  ASP B 118       2.030  29.243 -84.094  1.00  0.32           C  
ATOM   4284  CG  ASP B 118       1.531  30.403 -83.261  1.00  0.32           C  
ATOM   4285  OD1 ASP B 118       2.270  31.382 -82.991  1.00  0.32           O  
ATOM   4286  OD2 ASP B 118       0.353  30.319 -82.830  1.00  0.32           O  
ATOM   4287  N   ASP B 119       5.689  28.154 -84.408  1.00  0.35           N  
ATOM   4288  CA  ASP B 119       6.579  27.007 -84.423  1.00  0.35           C  
ATOM   4289  C   ASP B 119       8.060  27.421 -84.293  1.00  0.35           C  
ATOM   4290  O   ASP B 119       8.678  27.942 -85.224  1.00  0.35           O  
ATOM   4291  CB  ASP B 119       6.375  26.233 -85.755  1.00  0.35           C  
ATOM   4292  CG  ASP B 119       6.706  24.764 -85.611  1.00  0.35           C  
ATOM   4293  OD1 ASP B 119       7.809  24.449 -85.104  1.00  0.35           O  
ATOM   4294  OD2 ASP B 119       5.847  23.939 -86.017  1.00  0.35           O  
ATOM   4295  N   PHE B 120       8.679  27.208 -83.109  1.00  0.37           N  
ATOM   4296  CA  PHE B 120      10.106  27.405 -82.887  1.00  0.37           C  
ATOM   4297  C   PHE B 120      10.964  26.365 -83.600  1.00  0.37           C  
ATOM   4298  O   PHE B 120      11.999  26.685 -84.189  1.00  0.37           O  
ATOM   4299  CB  PHE B 120      10.454  27.419 -81.375  1.00  0.37           C  
ATOM   4300  CG  PHE B 120      10.039  28.720 -80.740  1.00  0.37           C  
ATOM   4301  CD1 PHE B 120      10.817  29.870 -80.949  1.00  0.37           C  
ATOM   4302  CD2 PHE B 120       8.890  28.818 -79.937  1.00  0.37           C  
ATOM   4303  CE1 PHE B 120      10.449  31.098 -80.383  1.00  0.37           C  
ATOM   4304  CE2 PHE B 120       8.513  30.045 -79.373  1.00  0.37           C  
ATOM   4305  CZ  PHE B 120       9.293  31.186 -79.597  1.00  0.37           C  
ATOM   4306  N   ALA B 121      10.531  25.087 -83.605  1.00  0.54           N  
ATOM   4307  CA  ALA B 121      11.216  24.003 -84.278  1.00  0.54           C  
ATOM   4308  C   ALA B 121      11.314  24.196 -85.784  1.00  0.54           C  
ATOM   4309  O   ALA B 121      12.376  24.017 -86.376  1.00  0.54           O  
ATOM   4310  CB  ALA B 121      10.509  22.670 -83.977  1.00  0.54           C  
ATOM   4311  N   ALA B 122      10.226  24.631 -86.447  1.00  0.56           N  
ATOM   4312  CA  ALA B 122      10.222  24.967 -87.858  1.00  0.56           C  
ATOM   4313  C   ALA B 122      11.160  26.110 -88.237  1.00  0.56           C  
ATOM   4314  O   ALA B 122      11.698  26.143 -89.344  1.00  0.56           O  
ATOM   4315  CB  ALA B 122       8.800  25.303 -88.334  1.00  0.56           C  
ATOM   4316  N   GLN B 123      11.373  27.099 -87.343  1.00  0.58           N  
ATOM   4317  CA  GLN B 123      12.429  28.085 -87.511  1.00  0.58           C  
ATOM   4318  C   GLN B 123      13.839  27.524 -87.321  1.00  0.58           C  
ATOM   4319  O   GLN B 123      14.716  27.766 -88.146  1.00  0.58           O  
ATOM   4320  CB  GLN B 123      12.204  29.330 -86.615  1.00  0.58           C  
ATOM   4321  CG  GLN B 123      10.920  30.147 -86.936  1.00  0.58           C  
ATOM   4322  CD  GLN B 123      10.947  30.868 -88.295  1.00  0.58           C  
ATOM   4323  OE1 GLN B 123      11.685  30.538 -89.227  1.00  0.58           O  
ATOM   4324  NE2 GLN B 123      10.074  31.895 -88.425  1.00  0.58           N  
ATOM   4325  N   ARG B 124      14.103  26.711 -86.274  1.00  0.55           N  
ATOM   4326  CA  ARG B 124      15.408  26.079 -86.092  1.00  0.55           C  
ATOM   4327  C   ARG B 124      15.788  25.077 -87.181  1.00  0.55           C  
ATOM   4328  O   ARG B 124      16.938  25.020 -87.618  1.00  0.55           O  
ATOM   4329  CB  ARG B 124      15.562  25.398 -84.712  1.00  0.55           C  
ATOM   4330  CG  ARG B 124      15.519  26.374 -83.521  1.00  0.55           C  
ATOM   4331  CD  ARG B 124      16.145  25.790 -82.250  1.00  0.55           C  
ATOM   4332  NE  ARG B 124      15.742  26.649 -81.098  1.00  0.55           N  
ATOM   4333  CZ  ARG B 124      16.461  27.609 -80.507  1.00  0.55           C  
ATOM   4334  NH1 ARG B 124      17.591  28.083 -81.005  1.00  0.55           N  
ATOM   4335  NH2 ARG B 124      15.990  28.120 -79.372  1.00  0.55           N  
ATOM   4336  N   ASN B 125      14.821  24.273 -87.667  1.00  0.60           N  
ATOM   4337  CA  ASN B 125      15.014  23.298 -88.730  1.00  0.60           C  
ATOM   4338  C   ASN B 125      15.380  23.909 -90.079  1.00  0.60           C  
ATOM   4339  O   ASN B 125      16.059  23.278 -90.885  1.00  0.60           O  
ATOM   4340  CB  ASN B 125      13.768  22.393 -88.904  1.00  0.60           C  
ATOM   4341  CG  ASN B 125      13.692  21.410 -87.741  1.00  0.60           C  
ATOM   4342  OD1 ASN B 125      14.713  20.903 -87.269  1.00  0.60           O  
ATOM   4343  ND2 ASN B 125      12.461  21.093 -87.284  1.00  0.60           N  
ATOM   4344  N   ALA B 126      14.994  25.172 -90.340  1.00  0.69           N  
ATOM   4345  CA  ALA B 126      15.315  25.867 -91.572  1.00  0.69           C  
ATOM   4346  C   ALA B 126      16.801  26.146 -91.770  1.00  0.69           C  
ATOM   4347  O   ALA B 126      17.307  26.313 -92.875  1.00  0.69           O  
ATOM   4348  CB  ALA B 126      14.564  27.201 -91.577  1.00  0.69           C  
ATOM   4349  N   ALA B 127      17.579  26.164 -90.677  1.00  0.65           N  
ATOM   4350  CA  ALA B 127      19.014  26.306 -90.742  1.00  0.65           C  
ATOM   4351  C   ALA B 127      19.726  25.138 -91.425  1.00  0.65           C  
ATOM   4352  O   ALA B 127      20.777  25.317 -92.037  1.00  0.65           O  
ATOM   4353  CB  ALA B 127      19.542  26.497 -89.319  1.00  0.65           C  
ATOM   4354  N   PHE B 128      19.144  23.919 -91.363  1.00  0.45           N  
ATOM   4355  CA  PHE B 128      19.618  22.739 -92.072  1.00  0.45           C  
ATOM   4356  C   PHE B 128      19.523  22.883 -93.589  1.00  0.45           C  
ATOM   4357  O   PHE B 128      20.410  22.442 -94.313  1.00  0.45           O  
ATOM   4358  CB  PHE B 128      18.865  21.451 -91.648  1.00  0.45           C  
ATOM   4359  CG  PHE B 128      19.199  21.042 -90.237  1.00  0.45           C  
ATOM   4360  CD1 PHE B 128      20.174  20.061 -89.986  1.00  0.45           C  
ATOM   4361  CD2 PHE B 128      18.497  21.586 -89.150  1.00  0.45           C  
ATOM   4362  CE1 PHE B 128      20.405  19.602 -88.682  1.00  0.45           C  
ATOM   4363  CE2 PHE B 128      18.717  21.129 -87.846  1.00  0.45           C  
ATOM   4364  CZ  PHE B 128      19.663  20.125 -87.616  1.00  0.45           C  
ATOM   4365  N   GLU B 129      18.461  23.546 -94.101  1.00  0.60           N  
ATOM   4366  CA  GLU B 129      18.254  23.851 -95.514  1.00  0.60           C  
ATOM   4367  C   GLU B 129      19.385  24.706 -96.083  1.00  0.60           C  
ATOM   4368  O   GLU B 129      19.808  24.563 -97.226  1.00  0.60           O  
ATOM   4369  CB  GLU B 129      16.931  24.651 -95.707  1.00  0.60           C  
ATOM   4370  CG  GLU B 129      15.634  23.997 -95.149  1.00  0.60           C  
ATOM   4371  CD  GLU B 129      14.485  25.004 -94.961  1.00  0.60           C  
ATOM   4372  OE1 GLU B 129      13.451  24.616 -94.351  1.00  0.60           O  
ATOM   4373  OE2 GLU B 129      14.637  26.188 -95.365  1.00  0.60           O  
ATOM   4374  N   GLN B 130      19.907  25.626 -95.251  1.00  0.68           N  
ATOM   4375  CA  GLN B 130      20.926  26.588 -95.615  1.00  0.68           C  
ATOM   4376  C   GLN B 130      22.326  26.131 -95.221  1.00  0.68           C  
ATOM   4377  O   GLN B 130      23.291  26.898 -95.289  1.00  0.68           O  
ATOM   4378  CB  GLN B 130      20.648  27.913 -94.858  1.00  0.68           C  
ATOM   4379  CG  GLN B 130      19.197  28.440 -94.981  1.00  0.68           C  
ATOM   4380  CD  GLN B 130      18.813  28.708 -96.436  1.00  0.68           C  
ATOM   4381  OE1 GLN B 130      19.486  29.462 -97.139  1.00  0.68           O  
ATOM   4382  NE2 GLN B 130      17.703  28.097 -96.909  1.00  0.68           N  
ATOM   4383  N   ALA B 131      22.476  24.884 -94.741  1.00  0.59           N  
ATOM   4384  CA  ALA B 131      23.703  24.381 -94.169  1.00  0.59           C  
ATOM   4385  C   ALA B 131      24.759  23.965 -95.187  1.00  0.59           C  
ATOM   4386  O   ALA B 131      24.496  23.737 -96.363  1.00  0.59           O  
ATOM   4387  CB  ALA B 131      23.389  23.213 -93.219  1.00  0.59           C  
ATOM   4388  N   ARG B 132      26.023  23.852 -94.735  1.00  0.52           N  
ATOM   4389  CA  ARG B 132      27.107  23.367 -95.563  1.00  0.52           C  
ATOM   4390  C   ARG B 132      27.485  21.981 -95.051  1.00  0.52           C  
ATOM   4391  O   ARG B 132      27.940  21.914 -93.909  1.00  0.52           O  
ATOM   4392  CB  ARG B 132      28.320  24.328 -95.474  1.00  0.52           C  
ATOM   4393  CG  ARG B 132      29.469  23.993 -96.448  1.00  0.52           C  
ATOM   4394  CD  ARG B 132      30.597  25.030 -96.418  1.00  0.52           C  
ATOM   4395  NE  ARG B 132      31.590  24.627 -97.465  1.00  0.52           N  
ATOM   4396  CZ  ARG B 132      32.632  25.378 -97.849  1.00  0.52           C  
ATOM   4397  NH1 ARG B 132      33.433  24.944 -98.820  1.00  0.52           N  
ATOM   4398  NH2 ARG B 132      32.889  26.553 -97.284  1.00  0.52           N  
ATOM   4399  N   PRO B 133      27.288  20.873 -95.779  1.00  0.42           N  
ATOM   4400  CA  PRO B 133      27.780  19.532 -95.434  1.00  0.42           C  
ATOM   4401  C   PRO B 133      29.222  19.440 -94.958  1.00  0.42           C  
ATOM   4402  O   PRO B 133      30.066  20.188 -95.454  1.00  0.42           O  
ATOM   4403  CB  PRO B 133      27.534  18.715 -96.711  1.00  0.42           C  
ATOM   4404  CG  PRO B 133      26.295  19.370 -97.325  1.00  0.42           C  
ATOM   4405  CD  PRO B 133      26.514  20.851 -97.023  1.00  0.42           C  
ATOM   4406  N   GLY B 134      29.525  18.537 -94.001  1.00  0.31           N  
ATOM   4407  CA  GLY B 134      30.865  18.369 -93.455  1.00  0.31           C  
ATOM   4408  C   GLY B 134      31.186  19.355 -92.367  1.00  0.31           C  
ATOM   4409  O   GLY B 134      32.339  19.736 -92.173  1.00  0.31           O  
ATOM   4410  N   GLY B 135      30.158  19.832 -91.642  1.00  0.66           N  
ATOM   4411  CA  GLY B 135      30.347  20.844 -90.619  1.00  0.66           C  
ATOM   4412  C   GLY B 135      29.356  20.763 -89.497  1.00  0.66           C  
ATOM   4413  O   GLY B 135      28.672  19.765 -89.281  1.00  0.66           O  
ATOM   4414  N   TRP B 136      29.261  21.861 -88.737  1.00  0.56           N  
ATOM   4415  CA  TRP B 136      28.448  21.964 -87.548  1.00  0.56           C  
ATOM   4416  C   TRP B 136      27.482  23.127 -87.645  1.00  0.56           C  
ATOM   4417  O   TRP B 136      27.793  24.202 -88.161  1.00  0.56           O  
ATOM   4418  CB  TRP B 136      29.323  22.163 -86.285  1.00  0.56           C  
ATOM   4419  CG  TRP B 136      30.234  20.990 -85.981  1.00  0.56           C  
ATOM   4420  CD1 TRP B 136      31.519  20.768 -86.392  1.00  0.56           C  
ATOM   4421  CD2 TRP B 136      29.870  19.863 -85.162  1.00  0.56           C  
ATOM   4422  NE1 TRP B 136      31.981  19.580 -85.874  1.00  0.56           N  
ATOM   4423  CE2 TRP B 136      30.995  19.018 -85.102  1.00  0.56           C  
ATOM   4424  CE3 TRP B 136      28.693  19.539 -84.494  1.00  0.56           C  
ATOM   4425  CZ2 TRP B 136      30.969  17.846 -84.358  1.00  0.56           C  
ATOM   4426  CZ3 TRP B 136      28.658  18.347 -83.754  1.00  0.56           C  
ATOM   4427  CH2 TRP B 136      29.784  17.512 -83.683  1.00  0.56           C  
ATOM   4428  N   LEU B 137      26.268  22.936 -87.107  1.00  0.61           N  
ATOM   4429  CA  LEU B 137      25.301  23.987 -86.895  1.00  0.61           C  
ATOM   4430  C   LEU B 137      25.219  24.229 -85.407  1.00  0.61           C  
ATOM   4431  O   LEU B 137      24.851  23.339 -84.644  1.00  0.61           O  
ATOM   4432  CB  LEU B 137      23.889  23.582 -87.383  1.00  0.61           C  
ATOM   4433  CG  LEU B 137      23.787  23.315 -88.895  1.00  0.61           C  
ATOM   4434  CD1 LEU B 137      22.370  22.851 -89.254  1.00  0.61           C  
ATOM   4435  CD2 LEU B 137      24.176  24.546 -89.724  1.00  0.61           C  
ATOM   4436  N   ALA B 138      25.573  25.443 -84.954  1.00  0.64           N  
ATOM   4437  CA  ALA B 138      25.527  25.806 -83.558  1.00  0.64           C  
ATOM   4438  C   ALA B 138      24.394  26.787 -83.328  1.00  0.64           C  
ATOM   4439  O   ALA B 138      24.459  27.944 -83.736  1.00  0.64           O  
ATOM   4440  CB  ALA B 138      26.870  26.444 -83.143  1.00  0.64           C  
ATOM   4441  N   HIS B 139      23.309  26.347 -82.663  1.00  0.63           N  
ATOM   4442  CA  HIS B 139      22.174  27.204 -82.371  1.00  0.63           C  
ATOM   4443  C   HIS B 139      22.431  28.059 -81.144  1.00  0.63           C  
ATOM   4444  O   HIS B 139      22.710  27.557 -80.058  1.00  0.63           O  
ATOM   4445  CB  HIS B 139      20.870  26.395 -82.190  1.00  0.63           C  
ATOM   4446  CG  HIS B 139      20.393  25.804 -83.483  1.00  0.63           C  
ATOM   4447  ND1 HIS B 139      19.232  26.287 -84.061  1.00  0.63           N  
ATOM   4448  CD2 HIS B 139      20.966  24.868 -84.287  1.00  0.63           C  
ATOM   4449  CE1 HIS B 139      19.126  25.639 -85.206  1.00  0.63           C  
ATOM   4450  NE2 HIS B 139      20.148  24.769 -85.393  1.00  0.63           N  
ATOM   4451  N   VAL B 140      22.356  29.388 -81.313  1.00  0.66           N  
ATOM   4452  CA  VAL B 140      22.593  30.370 -80.271  1.00  0.66           C  
ATOM   4453  C   VAL B 140      21.380  31.273 -80.274  1.00  0.66           C  
ATOM   4454  O   VAL B 140      20.935  31.709 -81.335  1.00  0.66           O  
ATOM   4455  CB  VAL B 140      23.854  31.195 -80.538  1.00  0.66           C  
ATOM   4456  CG1 VAL B 140      24.099  32.194 -79.389  1.00  0.66           C  
ATOM   4457  CG2 VAL B 140      25.068  30.255 -80.687  1.00  0.66           C  
ATOM   4458  N   ASP B 141      20.780  31.570 -79.108  1.00  0.68           N  
ATOM   4459  CA  ASP B 141      19.612  32.431 -79.074  1.00  0.68           C  
ATOM   4460  C   ASP B 141      20.062  33.891 -78.966  1.00  0.68           C  
ATOM   4461  O   ASP B 141      21.187  34.205 -78.584  1.00  0.68           O  
ATOM   4462  CB  ASP B 141      18.587  31.959 -78.003  1.00  0.68           C  
ATOM   4463  CG  ASP B 141      17.911  30.667 -78.443  1.00  0.68           C  
ATOM   4464  OD1 ASP B 141      18.032  30.263 -79.629  1.00  0.68           O  
ATOM   4465  OD2 ASP B 141      17.219  30.016 -77.613  1.00  0.68           O  
ATOM   4466  N   ALA B 142      19.216  34.842 -79.408  1.00  0.72           N  
ATOM   4467  CA  ALA B 142      19.631  36.204 -79.699  1.00  0.72           C  
ATOM   4468  C   ALA B 142      20.214  37.009 -78.541  1.00  0.72           C  
ATOM   4469  O   ALA B 142      21.141  37.794 -78.743  1.00  0.72           O  
ATOM   4470  CB  ALA B 142      18.469  36.970 -80.347  1.00  0.72           C  
ATOM   4471  N   ASP B 143      19.716  36.825 -77.301  1.00  0.62           N  
ATOM   4472  CA  ASP B 143      20.186  37.557 -76.148  1.00  0.62           C  
ATOM   4473  C   ASP B 143      21.296  36.814 -75.380  1.00  0.62           C  
ATOM   4474  O   ASP B 143      21.715  37.232 -74.295  1.00  0.62           O  
ATOM   4475  CB  ASP B 143      18.959  38.014 -75.305  1.00  0.62           C  
ATOM   4476  CG  ASP B 143      18.221  36.903 -74.586  1.00  0.62           C  
ATOM   4477  OD1 ASP B 143      17.844  35.901 -75.242  1.00  0.62           O  
ATOM   4478  OD2 ASP B 143      18.002  37.061 -73.353  1.00  0.62           O  
ATOM   4479  N   GLU B 144      21.851  35.728 -75.973  1.00  0.60           N  
ATOM   4480  CA  GLU B 144      23.012  34.997 -75.489  1.00  0.60           C  
ATOM   4481  C   GLU B 144      24.319  35.506 -76.087  1.00  0.60           C  
ATOM   4482  O   GLU B 144      24.459  35.701 -77.292  1.00  0.60           O  
ATOM   4483  CB  GLU B 144      22.935  33.488 -75.840  1.00  0.60           C  
ATOM   4484  CG  GLU B 144      21.777  32.754 -75.132  1.00  0.60           C  
ATOM   4485  CD  GLU B 144      21.523  31.346 -75.640  1.00  0.60           C  
ATOM   4486  OE1 GLU B 144      20.635  30.674 -75.051  1.00  0.60           O  
ATOM   4487  OE2 GLU B 144      22.145  30.888 -76.637  1.00  0.60           O  
ATOM   4488  N   THR B 145      25.348  35.695 -75.240  1.00  0.62           N  
ATOM   4489  CA  THR B 145      26.670  36.154 -75.666  1.00  0.62           C  
ATOM   4490  C   THR B 145      27.698  35.124 -75.244  1.00  0.62           C  
ATOM   4491  O   THR B 145      27.755  34.749 -74.074  1.00  0.62           O  
ATOM   4492  CB  THR B 145      27.062  37.486 -75.026  1.00  0.62           C  
ATOM   4493  OG1 THR B 145      26.104  38.485 -75.337  1.00  0.62           O  
ATOM   4494  CG2 THR B 145      28.393  38.016 -75.572  1.00  0.62           C  
ATOM   4495  N   LEU B 146      28.556  34.618 -76.165  1.00  0.60           N  
ATOM   4496  CA  LEU B 146      29.666  33.729 -75.816  1.00  0.60           C  
ATOM   4497  C   LEU B 146      30.658  34.392 -74.856  1.00  0.60           C  
ATOM   4498  O   LEU B 146      31.001  35.564 -74.996  1.00  0.60           O  
ATOM   4499  CB  LEU B 146      30.416  33.234 -77.085  1.00  0.60           C  
ATOM   4500  CG  LEU B 146      31.541  32.194 -76.858  1.00  0.60           C  
ATOM   4501  CD1 LEU B 146      30.996  30.841 -76.394  1.00  0.60           C  
ATOM   4502  CD2 LEU B 146      32.374  31.988 -78.131  1.00  0.60           C  
ATOM   4503  N   SER B 147      31.109  33.668 -73.813  1.00  0.57           N  
ATOM   4504  CA  SER B 147      32.019  34.209 -72.813  1.00  0.57           C  
ATOM   4505  C   SER B 147      33.434  34.498 -73.315  1.00  0.57           C  
ATOM   4506  O   SER B 147      33.941  33.855 -74.232  1.00  0.57           O  
ATOM   4507  CB  SER B 147      31.994  33.409 -71.476  1.00  0.57           C  
ATOM   4508  OG  SER B 147      33.040  32.449 -71.326  1.00  0.57           O  
ATOM   4509  N   ALA B 148      34.130  35.485 -72.710  1.00  0.48           N  
ATOM   4510  CA  ALA B 148      35.477  35.888 -73.085  1.00  0.48           C  
ATOM   4511  C   ALA B 148      36.507  34.778 -72.894  1.00  0.48           C  
ATOM   4512  O   ALA B 148      37.401  34.562 -73.710  1.00  0.48           O  
ATOM   4513  CB  ALA B 148      35.879  37.128 -72.261  1.00  0.48           C  
ATOM   4514  N   GLU B 149      36.341  34.003 -71.811  1.00  0.30           N  
ATOM   4515  CA  GLU B 149      37.136  32.867 -71.408  1.00  0.30           C  
ATOM   4516  C   GLU B 149      36.881  31.663 -72.304  1.00  0.30           C  
ATOM   4517  O   GLU B 149      37.649  30.696 -72.327  1.00  0.30           O  
ATOM   4518  CB  GLU B 149      36.759  32.455 -69.954  1.00  0.30           C  
ATOM   4519  CG  GLU B 149      36.640  33.621 -68.927  1.00  0.30           C  
ATOM   4520  CD  GLU B 149      35.334  34.420 -69.002  1.00  0.30           C  
ATOM   4521  OE1 GLU B 149      35.181  35.389 -68.227  1.00  0.30           O  
ATOM   4522  OE2 GLU B 149      34.477  34.083 -69.864  1.00  0.30           O  
ATOM   4523  N   SER B 150      35.767  31.709 -73.065  1.00  0.54           N  
ATOM   4524  CA  SER B 150      35.323  30.654 -73.955  1.00  0.54           C  
ATOM   4525  C   SER B 150      35.690  30.902 -75.394  1.00  0.54           C  
ATOM   4526  O   SER B 150      35.431  30.051 -76.241  1.00  0.54           O  
ATOM   4527  CB  SER B 150      33.795  30.433 -73.921  1.00  0.54           C  
ATOM   4528  OG  SER B 150      33.394  30.026 -72.616  1.00  0.54           O  
ATOM   4529  N   ARG B 151      36.348  32.037 -75.704  1.00  0.31           N  
ATOM   4530  CA  ARG B 151      36.828  32.347 -77.039  1.00  0.31           C  
ATOM   4531  C   ARG B 151      37.813  31.314 -77.587  1.00  0.31           C  
ATOM   4532  O   ARG B 151      38.871  31.052 -77.017  1.00  0.31           O  
ATOM   4533  CB  ARG B 151      37.498  33.746 -77.070  1.00  0.31           C  
ATOM   4534  CG  ARG B 151      38.041  34.135 -78.461  1.00  0.31           C  
ATOM   4535  CD  ARG B 151      38.760  35.485 -78.539  1.00  0.31           C  
ATOM   4536  NE  ARG B 151      37.702  36.536 -78.592  1.00  0.31           N  
ATOM   4537  CZ  ARG B 151      37.861  37.796 -78.184  1.00  0.31           C  
ATOM   4538  NH1 ARG B 151      39.050  38.257 -77.809  1.00  0.31           N  
ATOM   4539  NH2 ARG B 151      36.804  38.605 -78.183  1.00  0.31           N  
ATOM   4540  N   GLY B 152      37.464  30.689 -78.726  1.00  0.57           N  
ATOM   4541  CA  GLY B 152      38.255  29.686 -79.421  1.00  0.57           C  
ATOM   4542  C   GLY B 152      38.074  28.298 -78.872  1.00  0.57           C  
ATOM   4543  O   GLY B 152      38.561  27.326 -79.446  1.00  0.57           O  
ATOM   4544  N   ARG B 153      37.328  28.148 -77.759  1.00  0.47           N  
ATOM   4545  CA  ARG B 153      37.024  26.860 -77.171  1.00  0.47           C  
ATOM   4546  C   ARG B 153      36.013  26.079 -77.985  1.00  0.47           C  
ATOM   4547  O   ARG B 153      36.087  24.856 -78.087  1.00  0.47           O  
ATOM   4548  CB  ARG B 153      36.433  26.965 -75.747  1.00  0.47           C  
ATOM   4549  CG  ARG B 153      37.362  27.523 -74.655  1.00  0.47           C  
ATOM   4550  CD  ARG B 153      36.705  27.274 -73.296  1.00  0.47           C  
ATOM   4551  NE  ARG B 153      37.494  27.901 -72.194  1.00  0.47           N  
ATOM   4552  CZ  ARG B 153      37.345  27.496 -70.923  1.00  0.47           C  
ATOM   4553  NH1 ARG B 153      36.495  26.522 -70.614  1.00  0.47           N  
ATOM   4554  NH2 ARG B 153      38.041  28.084 -69.958  1.00  0.47           N  
ATOM   4555  N   LEU B 154      35.009  26.772 -78.558  1.00  0.55           N  
ATOM   4556  CA  LEU B 154      33.941  26.147 -79.312  1.00  0.55           C  
ATOM   4557  C   LEU B 154      34.457  25.507 -80.593  1.00  0.55           C  
ATOM   4558  O   LEU B 154      34.184  24.342 -80.875  1.00  0.55           O  
ATOM   4559  CB  LEU B 154      32.825  27.186 -79.588  1.00  0.55           C  
ATOM   4560  CG  LEU B 154      31.644  26.704 -80.450  1.00  0.55           C  
ATOM   4561  CD1 LEU B 154      30.928  25.502 -79.829  1.00  0.55           C  
ATOM   4562  CD2 LEU B 154      30.643  27.845 -80.689  1.00  0.55           C  
ATOM   4563  N   ARG B 155      35.304  26.221 -81.359  1.00  0.50           N  
ATOM   4564  CA  ARG B 155      36.000  25.659 -82.505  1.00  0.50           C  
ATOM   4565  C   ARG B 155      36.956  24.529 -82.138  1.00  0.50           C  
ATOM   4566  O   ARG B 155      37.040  23.508 -82.828  1.00  0.50           O  
ATOM   4567  CB  ARG B 155      36.780  26.760 -83.267  1.00  0.50           C  
ATOM   4568  CG  ARG B 155      37.499  26.245 -84.538  1.00  0.50           C  
ATOM   4569  CD  ARG B 155      38.240  27.311 -85.356  1.00  0.50           C  
ATOM   4570  NE  ARG B 155      37.205  28.262 -85.855  1.00  0.50           N  
ATOM   4571  CZ  ARG B 155      36.517  28.091 -86.990  1.00  0.50           C  
ATOM   4572  NH1 ARG B 155      36.994  27.475 -88.063  1.00  0.50           N  
ATOM   4573  NH2 ARG B 155      35.278  28.550 -87.047  1.00  0.50           N  
ATOM   4574  N   ALA B 156      37.711  24.684 -81.033  1.00  0.54           N  
ATOM   4575  CA  ALA B 156      38.640  23.680 -80.561  1.00  0.54           C  
ATOM   4576  C   ALA B 156      37.990  22.355 -80.169  1.00  0.54           C  
ATOM   4577  O   ALA B 156      38.384  21.289 -80.644  1.00  0.54           O  
ATOM   4578  CB  ALA B 156      39.391  24.266 -79.354  1.00  0.54           C  
ATOM   4579  N   VAL B 157      36.920  22.390 -79.344  1.00  0.51           N  
ATOM   4580  CA  VAL B 157      36.231  21.183 -78.908  1.00  0.51           C  
ATOM   4581  C   VAL B 157      35.521  20.444 -80.035  1.00  0.51           C  
ATOM   4582  O   VAL B 157      35.596  19.221 -80.124  1.00  0.51           O  
ATOM   4583  CB  VAL B 157      35.336  21.403 -77.688  1.00  0.51           C  
ATOM   4584  CG1 VAL B 157      34.022  22.141 -78.017  1.00  0.51           C  
ATOM   4585  CG2 VAL B 157      35.077  20.047 -77.002  1.00  0.51           C  
ATOM   4586  N   LEU B 158      34.855  21.157 -80.972  1.00  0.49           N  
ATOM   4587  CA  LEU B 158      34.217  20.534 -82.123  1.00  0.49           C  
ATOM   4588  C   LEU B 158      35.210  19.846 -83.054  1.00  0.49           C  
ATOM   4589  O   LEU B 158      35.030  18.688 -83.421  1.00  0.49           O  
ATOM   4590  CB  LEU B 158      33.363  21.561 -82.906  1.00  0.49           C  
ATOM   4591  CG  LEU B 158      32.159  22.126 -82.116  1.00  0.49           C  
ATOM   4592  CD1 LEU B 158      31.470  23.239 -82.921  1.00  0.49           C  
ATOM   4593  CD2 LEU B 158      31.144  21.040 -81.735  1.00  0.49           C  
ATOM   4594  N   THR B 159      36.346  20.508 -83.370  1.00  0.54           N  
ATOM   4595  CA  THR B 159      37.442  19.923 -84.152  1.00  0.54           C  
ATOM   4596  C   THR B 159      38.055  18.709 -83.469  1.00  0.54           C  
ATOM   4597  O   THR B 159      38.348  17.688 -84.091  1.00  0.54           O  
ATOM   4598  CB  THR B 159      38.566  20.914 -84.446  1.00  0.54           C  
ATOM   4599  OG1 THR B 159      38.059  22.108 -85.052  1.00  0.54           O  
ATOM   4600  CG2 THR B 159      39.595  20.323 -85.420  1.00  0.54           C  
ATOM   4601  N   ALA B 160      38.245  18.759 -82.131  1.00  0.56           N  
ATOM   4602  CA  ALA B 160      38.669  17.613 -81.347  1.00  0.56           C  
ATOM   4603  C   ALA B 160      37.686  16.438 -81.386  1.00  0.56           C  
ATOM   4604  O   ALA B 160      38.092  15.294 -81.583  1.00  0.56           O  
ATOM   4605  CB  ALA B 160      38.927  18.055 -79.894  1.00  0.56           C  
ATOM   4606  N   LEU B 161      36.367  16.699 -81.262  1.00  0.74           N  
ATOM   4607  CA  LEU B 161      35.313  15.705 -81.417  1.00  0.74           C  
ATOM   4608  C   LEU B 161      35.239  15.084 -82.807  1.00  0.74           C  
ATOM   4609  O   LEU B 161      35.098  13.870 -82.925  1.00  0.74           O  
ATOM   4610  CB  LEU B 161      33.925  16.272 -81.029  1.00  0.74           C  
ATOM   4611  CG  LEU B 161      33.748  16.543 -79.519  1.00  0.74           C  
ATOM   4612  CD1 LEU B 161      32.456  17.334 -79.271  1.00  0.74           C  
ATOM   4613  CD2 LEU B 161      33.739  15.250 -78.686  1.00  0.74           C  
ATOM   4614  N   ASP B 162      35.381  15.867 -83.896  1.00  0.73           N  
ATOM   4615  CA  ASP B 162      35.468  15.345 -85.254  1.00  0.73           C  
ATOM   4616  C   ASP B 162      36.640  14.406 -85.472  1.00  0.73           C  
ATOM   4617  O   ASP B 162      36.514  13.368 -86.115  1.00  0.73           O  
ATOM   4618  CB  ASP B 162      35.581  16.506 -86.272  1.00  0.73           C  
ATOM   4619  CG  ASP B 162      34.235  17.151 -86.466  1.00  0.73           C  
ATOM   4620  OD1 ASP B 162      33.213  16.436 -86.289  1.00  0.73           O  
ATOM   4621  OD2 ASP B 162      34.183  18.346 -86.833  1.00  0.73           O  
ATOM   4622  N   HIS B 163      37.809  14.743 -84.909  1.00  0.71           N  
ATOM   4623  CA  HIS B 163      38.986  13.899 -84.958  1.00  0.71           C  
ATOM   4624  C   HIS B 163      38.837  12.547 -84.259  1.00  0.71           C  
ATOM   4625  O   HIS B 163      39.253  11.511 -84.771  1.00  0.71           O  
ATOM   4626  CB  HIS B 163      40.159  14.670 -84.328  1.00  0.71           C  
ATOM   4627  CG  HIS B 163      41.481  14.022 -84.540  1.00  0.71           C  
ATOM   4628  ND1 HIS B 163      42.007  14.000 -85.814  1.00  0.71           N  
ATOM   4629  CD2 HIS B 163      42.337  13.445 -83.660  1.00  0.71           C  
ATOM   4630  CE1 HIS B 163      43.172  13.400 -85.691  1.00  0.71           C  
ATOM   4631  NE2 HIS B 163      43.422  13.052 -84.408  1.00  0.71           N  
ATOM   4632  N   VAL B 164      38.228  12.512 -83.055  1.00  0.74           N  
ATOM   4633  CA  VAL B 164      38.153  11.276 -82.281  1.00  0.74           C  
ATOM   4634  C   VAL B 164      36.855  10.504 -82.484  1.00  0.74           C  
ATOM   4635  O   VAL B 164      36.811   9.300 -82.247  1.00  0.74           O  
ATOM   4636  CB  VAL B 164      38.399  11.513 -80.791  1.00  0.74           C  
ATOM   4637  CG1 VAL B 164      39.775  12.189 -80.617  1.00  0.74           C  
ATOM   4638  CG2 VAL B 164      37.288  12.366 -80.152  1.00  0.74           C  
ATOM   4639  N   LEU B 165      35.786  11.144 -82.999  1.00  0.71           N  
ATOM   4640  CA  LEU B 165      34.513  10.499 -83.297  1.00  0.71           C  
ATOM   4641  C   LEU B 165      34.000  10.906 -84.689  1.00  0.71           C  
ATOM   4642  O   LEU B 165      32.890  11.445 -84.803  1.00  0.71           O  
ATOM   4643  CB  LEU B 165      33.440  10.876 -82.236  1.00  0.71           C  
ATOM   4644  CG  LEU B 165      33.676  10.319 -80.816  1.00  0.71           C  
ATOM   4645  CD1 LEU B 165      32.676  10.941 -79.829  1.00  0.71           C  
ATOM   4646  CD2 LEU B 165      33.583   8.787 -80.767  1.00  0.71           C  
ATOM   4647  N   PRO B 166      34.748  10.700 -85.783  1.00  0.73           N  
ATOM   4648  CA  PRO B 166      34.312  11.053 -87.134  1.00  0.73           C  
ATOM   4649  C   PRO B 166      33.015  10.380 -87.556  1.00  0.73           C  
ATOM   4650  O   PRO B 166      32.903   9.159 -87.512  1.00  0.73           O  
ATOM   4651  CB  PRO B 166      35.491  10.632 -88.025  1.00  0.73           C  
ATOM   4652  CG  PRO B 166      36.093   9.436 -87.285  1.00  0.73           C  
ATOM   4653  CD  PRO B 166      35.946   9.850 -85.821  1.00  0.73           C  
ATOM   4654  N   GLY B 167      31.999  11.161 -87.971  1.00  0.72           N  
ATOM   4655  CA  GLY B 167      30.743  10.612 -88.479  1.00  0.72           C  
ATOM   4656  C   GLY B 167      29.788  10.128 -87.423  1.00  0.72           C  
ATOM   4657  O   GLY B 167      28.686   9.688 -87.732  1.00  0.72           O  
ATOM   4658  N   ALA B 168      30.152  10.226 -86.131  1.00  0.73           N  
ATOM   4659  CA  ALA B 168      29.228   9.960 -85.053  1.00  0.73           C  
ATOM   4660  C   ALA B 168      28.188  11.065 -84.952  1.00  0.73           C  
ATOM   4661  O   ALA B 168      28.531  12.246 -84.842  1.00  0.73           O  
ATOM   4662  CB  ALA B 168      29.974   9.825 -83.713  1.00  0.73           C  
ATOM   4663  N   ASP B 169      26.891  10.702 -85.009  1.00  0.68           N  
ATOM   4664  CA  ASP B 169      25.807  11.642 -84.850  1.00  0.68           C  
ATOM   4665  C   ASP B 169      25.572  11.858 -83.358  1.00  0.68           C  
ATOM   4666  O   ASP B 169      25.341  10.925 -82.588  1.00  0.68           O  
ATOM   4667  CB  ASP B 169      24.537  11.152 -85.603  1.00  0.68           C  
ATOM   4668  CG  ASP B 169      23.694  12.318 -86.094  1.00  0.68           C  
ATOM   4669  OD1 ASP B 169      24.045  13.488 -85.791  1.00  0.68           O  
ATOM   4670  OD2 ASP B 169      22.697  12.083 -86.822  1.00  0.68           O  
ATOM   4671  N   LEU B 170      25.712  13.109 -82.907  1.00  0.71           N  
ATOM   4672  CA  LEU B 170      25.759  13.432 -81.505  1.00  0.71           C  
ATOM   4673  C   LEU B 170      25.429  14.890 -81.384  1.00  0.71           C  
ATOM   4674  O   LEU B 170      25.514  15.643 -82.356  1.00  0.71           O  
ATOM   4675  CB  LEU B 170      27.136  13.105 -80.843  1.00  0.71           C  
ATOM   4676  CG  LEU B 170      28.388  13.858 -81.363  1.00  0.71           C  
ATOM   4677  CD1 LEU B 170      28.607  15.221 -80.685  1.00  0.71           C  
ATOM   4678  CD2 LEU B 170      29.651  13.007 -81.148  1.00  0.71           C  
ATOM   4679  N   VAL B 171      25.043  15.332 -80.179  1.00  0.74           N  
ATOM   4680  CA  VAL B 171      24.753  16.732 -79.941  1.00  0.74           C  
ATOM   4681  C   VAL B 171      25.690  17.282 -78.893  1.00  0.74           C  
ATOM   4682  O   VAL B 171      25.941  16.685 -77.847  1.00  0.74           O  
ATOM   4683  CB  VAL B 171      23.300  17.009 -79.585  1.00  0.74           C  
ATOM   4684  CG1 VAL B 171      22.445  16.717 -80.829  1.00  0.74           C  
ATOM   4685  CG2 VAL B 171      22.839  16.160 -78.388  1.00  0.74           C  
ATOM   4686  N   VAL B 172      26.271  18.459 -79.166  1.00  0.76           N  
ATOM   4687  CA  VAL B 172      27.175  19.107 -78.236  1.00  0.76           C  
ATOM   4688  C   VAL B 172      26.393  20.154 -77.472  1.00  0.76           C  
ATOM   4689  O   VAL B 172      25.620  20.938 -78.028  1.00  0.76           O  
ATOM   4690  CB  VAL B 172      28.430  19.678 -78.891  1.00  0.76           C  
ATOM   4691  CG1 VAL B 172      29.384  20.249 -77.826  1.00  0.76           C  
ATOM   4692  CG2 VAL B 172      29.127  18.555 -79.678  1.00  0.76           C  
ATOM   4693  N   SER B 173      26.555  20.154 -76.141  1.00  0.72           N  
ATOM   4694  CA  SER B 173      25.856  21.042 -75.241  1.00  0.72           C  
ATOM   4695  C   SER B 173      26.837  22.010 -74.605  1.00  0.72           C  
ATOM   4696  O   SER B 173      27.605  21.611 -73.726  1.00  0.72           O  
ATOM   4697  CB  SER B 173      25.202  20.274 -74.066  1.00  0.72           C  
ATOM   4698  OG  SER B 173      24.135  19.427 -74.494  1.00  0.72           O  
ATOM   4699  N   PRO B 174      26.870  23.283 -74.983  1.00  0.73           N  
ATOM   4700  CA  PRO B 174      27.465  24.344 -74.180  1.00  0.73           C  
ATOM   4701  C   PRO B 174      26.743  24.583 -72.871  1.00  0.73           C  
ATOM   4702  O   PRO B 174      25.588  24.186 -72.717  1.00  0.73           O  
ATOM   4703  CB  PRO B 174      27.368  25.593 -75.073  1.00  0.73           C  
ATOM   4704  CG  PRO B 174      27.248  25.034 -76.487  1.00  0.73           C  
ATOM   4705  CD  PRO B 174      26.406  23.781 -76.275  1.00  0.73           C  
ATOM   4706  N   ARG B 175      27.406  25.279 -71.940  1.00  0.62           N  
ATOM   4707  CA  ARG B 175      26.842  25.700 -70.681  1.00  0.62           C  
ATOM   4708  C   ARG B 175      26.227  27.082 -70.846  1.00  0.62           C  
ATOM   4709  O   ARG B 175      26.873  28.002 -71.343  1.00  0.62           O  
ATOM   4710  CB  ARG B 175      27.963  25.807 -69.614  1.00  0.62           C  
ATOM   4711  CG  ARG B 175      28.708  24.482 -69.331  1.00  0.62           C  
ATOM   4712  CD  ARG B 175      30.011  24.645 -68.532  1.00  0.62           C  
ATOM   4713  NE  ARG B 175      29.632  25.268 -67.227  1.00  0.62           N  
ATOM   4714  CZ  ARG B 175      30.496  25.886 -66.412  1.00  0.62           C  
ATOM   4715  NH1 ARG B 175      31.811  25.853 -66.593  1.00  0.62           N  
ATOM   4716  NH2 ARG B 175      30.009  26.565 -65.373  1.00  0.62           N  
ATOM   4717  N   ILE B 176      24.969  27.283 -70.421  1.00  0.64           N  
ATOM   4718  CA  ILE B 176      24.349  28.602 -70.460  1.00  0.64           C  
ATOM   4719  C   ILE B 176      24.195  29.098 -69.034  1.00  0.64           C  
ATOM   4720  O   ILE B 176      23.540  28.462 -68.210  1.00  0.64           O  
ATOM   4721  CB  ILE B 176      23.002  28.613 -71.184  1.00  0.64           C  
ATOM   4722  CG1 ILE B 176      23.159  28.152 -72.653  1.00  0.64           C  
ATOM   4723  CG2 ILE B 176      22.389  30.030 -71.133  1.00  0.64           C  
ATOM   4724  CD1 ILE B 176      21.819  27.861 -73.342  1.00  0.64           C  
ATOM   4725  N   LEU B 177      24.812  30.250 -68.710  1.00  0.58           N  
ATOM   4726  CA  LEU B 177      24.637  30.952 -67.450  1.00  0.58           C  
ATOM   4727  C   LEU B 177      23.625  32.056 -67.658  1.00  0.58           C  
ATOM   4728  O   LEU B 177      23.652  32.718 -68.691  1.00  0.58           O  
ATOM   4729  CB  LEU B 177      25.950  31.622 -66.969  1.00  0.58           C  
ATOM   4730  CG  LEU B 177      27.029  30.648 -66.461  1.00  0.58           C  
ATOM   4731  CD1 LEU B 177      28.354  31.397 -66.264  1.00  0.58           C  
ATOM   4732  CD2 LEU B 177      26.610  29.977 -65.145  1.00  0.58           C  
ATOM   4733  N   ASP B 178      22.698  32.291 -66.710  1.00  0.56           N  
ATOM   4734  CA  ASP B 178      21.745  33.380 -66.817  1.00  0.56           C  
ATOM   4735  C   ASP B 178      22.143  34.586 -65.956  1.00  0.56           C  
ATOM   4736  O   ASP B 178      23.290  34.763 -65.546  1.00  0.56           O  
ATOM   4737  CB  ASP B 178      20.298  32.863 -66.545  1.00  0.56           C  
ATOM   4738  CG  ASP B 178      20.025  32.683 -65.062  1.00  0.56           C  
ATOM   4739  OD1 ASP B 178      20.973  32.332 -64.319  1.00  0.56           O  
ATOM   4740  OD2 ASP B 178      18.913  33.057 -64.615  1.00  0.56           O  
ATOM   4741  N   THR B 179      21.160  35.454 -65.656  1.00  0.53           N  
ATOM   4742  CA  THR B 179      21.320  36.598 -64.776  1.00  0.53           C  
ATOM   4743  C   THR B 179      21.042  36.278 -63.316  1.00  0.53           C  
ATOM   4744  O   THR B 179      21.400  37.064 -62.441  1.00  0.53           O  
ATOM   4745  CB  THR B 179      20.413  37.752 -65.184  1.00  0.53           C  
ATOM   4746  OG1 THR B 179      19.070  37.322 -65.372  1.00  0.53           O  
ATOM   4747  CG2 THR B 179      20.888  38.296 -66.536  1.00  0.53           C  
ATOM   4748  N   SER B 180      20.445  35.109 -62.989  1.00  0.43           N  
ATOM   4749  CA  SER B 180      20.293  34.654 -61.608  1.00  0.43           C  
ATOM   4750  C   SER B 180      21.507  33.890 -61.105  1.00  0.43           C  
ATOM   4751  O   SER B 180      21.765  33.855 -59.900  1.00  0.43           O  
ATOM   4752  CB  SER B 180      19.020  33.778 -61.417  1.00  0.43           C  
ATOM   4753  OG  SER B 180      19.108  32.479 -62.007  1.00  0.43           O  
ATOM   4754  N   ARG B 181      22.286  33.331 -62.057  1.00  0.39           N  
ATOM   4755  CA  ARG B 181      23.500  32.536 -61.938  1.00  0.39           C  
ATOM   4756  C   ARG B 181      23.211  31.040 -61.947  1.00  0.39           C  
ATOM   4757  O   ARG B 181      24.043  30.232 -61.529  1.00  0.39           O  
ATOM   4758  CB  ARG B 181      24.437  32.865 -60.740  1.00  0.39           C  
ATOM   4759  CG  ARG B 181      24.968  34.309 -60.699  1.00  0.39           C  
ATOM   4760  CD  ARG B 181      25.814  34.545 -59.448  1.00  0.39           C  
ATOM   4761  NE  ARG B 181      26.338  35.946 -59.516  1.00  0.39           N  
ATOM   4762  CZ  ARG B 181      27.273  36.436 -58.691  1.00  0.39           C  
ATOM   4763  NH1 ARG B 181      27.794  35.697 -57.717  1.00  0.39           N  
ATOM   4764  NH2 ARG B 181      27.697  37.688 -58.845  1.00  0.39           N  
ATOM   4765  N   GLU B 182      22.050  30.617 -62.477  1.00  0.46           N  
ATOM   4766  CA  GLU B 182      21.774  29.232 -62.792  1.00  0.46           C  
ATOM   4767  C   GLU B 182      22.594  28.778 -63.996  1.00  0.46           C  
ATOM   4768  O   GLU B 182      22.903  29.552 -64.901  1.00  0.46           O  
ATOM   4769  CB  GLU B 182      20.260  28.988 -62.997  1.00  0.46           C  
ATOM   4770  CG  GLU B 182      19.864  27.490 -63.066  1.00  0.46           C  
ATOM   4771  CD  GLU B 182      18.354  27.265 -63.014  1.00  0.46           C  
ATOM   4772  OE1 GLU B 182      17.914  26.444 -62.168  1.00  0.46           O  
ATOM   4773  OE2 GLU B 182      17.647  27.880 -63.853  1.00  0.46           O  
ATOM   4774  N   CYS B 183      23.020  27.501 -64.025  1.00  0.58           N  
ATOM   4775  CA  CYS B 183      23.882  26.989 -65.071  1.00  0.58           C  
ATOM   4776  C   CYS B 183      23.194  25.839 -65.775  1.00  0.58           C  
ATOM   4777  O   CYS B 183      23.107  24.727 -65.260  1.00  0.58           O  
ATOM   4778  CB  CYS B 183      25.237  26.524 -64.465  1.00  0.58           C  
ATOM   4779  SG  CYS B 183      26.457  25.904 -65.687  1.00  0.58           S  
ATOM   4780  N   HIS B 184      22.732  26.076 -67.012  1.00  0.57           N  
ATOM   4781  CA  HIS B 184      21.998  25.102 -67.794  1.00  0.57           C  
ATOM   4782  C   HIS B 184      22.948  24.309 -68.656  1.00  0.57           C  
ATOM   4783  O   HIS B 184      23.568  24.858 -69.568  1.00  0.57           O  
ATOM   4784  CB  HIS B 184      20.982  25.806 -68.712  1.00  0.57           C  
ATOM   4785  CG  HIS B 184      19.980  26.533 -67.884  1.00  0.57           C  
ATOM   4786  ND1 HIS B 184      19.014  25.771 -67.268  1.00  0.57           N  
ATOM   4787  CD2 HIS B 184      19.952  27.812 -67.420  1.00  0.57           C  
ATOM   4788  CE1 HIS B 184      18.410  26.597 -66.433  1.00  0.57           C  
ATOM   4789  NE2 HIS B 184      18.940  27.843 -66.487  1.00  0.57           N  
ATOM   4790  N   THR B 185      23.122  23.005 -68.365  1.00  0.63           N  
ATOM   4791  CA  THR B 185      24.095  22.168 -69.057  1.00  0.63           C  
ATOM   4792  C   THR B 185      23.516  21.336 -70.187  1.00  0.63           C  
ATOM   4793  O   THR B 185      24.064  21.353 -71.282  1.00  0.63           O  
ATOM   4794  CB  THR B 185      24.900  21.278 -68.125  1.00  0.63           C  
ATOM   4795  OG1 THR B 185      24.104  20.283 -67.497  1.00  0.63           O  
ATOM   4796  CG2 THR B 185      25.533  22.132 -67.014  1.00  0.63           C  
ATOM   4797  N   ASP B 186      22.377  20.621 -70.007  1.00  0.64           N  
ATOM   4798  CA  ASP B 186      21.728  19.824 -71.051  1.00  0.64           C  
ATOM   4799  C   ASP B 186      20.996  20.697 -72.090  1.00  0.64           C  
ATOM   4800  O   ASP B 186      19.775  20.687 -72.245  1.00  0.64           O  
ATOM   4801  CB  ASP B 186      20.802  18.745 -70.407  1.00  0.64           C  
ATOM   4802  CG  ASP B 186      20.254  17.744 -71.411  1.00  0.64           C  
ATOM   4803  OD1 ASP B 186      21.050  17.103 -72.145  1.00  0.64           O  
ATOM   4804  OD2 ASP B 186      19.006  17.589 -71.502  1.00  0.64           O  
ATOM   4805  N   THR B 187      21.763  21.513 -72.832  1.00  0.67           N  
ATOM   4806  CA  THR B 187      21.273  22.460 -73.822  1.00  0.67           C  
ATOM   4807  C   THR B 187      20.982  21.838 -75.174  1.00  0.67           C  
ATOM   4808  O   THR B 187      19.954  22.137 -75.778  1.00  0.67           O  
ATOM   4809  CB  THR B 187      22.208  23.654 -73.985  1.00  0.67           C  
ATOM   4810  OG1 THR B 187      23.515  23.271 -74.385  1.00  0.67           O  
ATOM   4811  CG2 THR B 187      22.356  24.352 -72.630  1.00  0.67           C  
ATOM   4812  N   ARG B 188      21.874  20.950 -75.672  1.00  0.65           N  
ATOM   4813  CA  ARG B 188      21.759  20.203 -76.920  1.00  0.65           C  
ATOM   4814  C   ARG B 188      21.528  21.035 -78.174  1.00  0.65           C  
ATOM   4815  O   ARG B 188      20.635  20.770 -78.975  1.00  0.65           O  
ATOM   4816  CB  ARG B 188      20.737  19.045 -76.824  1.00  0.65           C  
ATOM   4817  CG  ARG B 188      21.077  18.071 -75.685  1.00  0.65           C  
ATOM   4818  CD  ARG B 188      20.262  16.782 -75.715  1.00  0.65           C  
ATOM   4819  NE  ARG B 188      20.706  16.008 -74.525  1.00  0.65           N  
ATOM   4820  CZ  ARG B 188      20.117  14.856 -74.206  1.00  0.65           C  
ATOM   4821  NH1 ARG B 188      19.801  13.941 -75.112  1.00  0.65           N  
ATOM   4822  NH2 ARG B 188      19.781  14.676 -72.933  1.00  0.65           N  
ATOM   4823  N   ARG B 189      22.355  22.078 -78.371  1.00  0.66           N  
ATOM   4824  CA  ARG B 189      22.119  23.064 -79.407  1.00  0.66           C  
ATOM   4825  C   ARG B 189      23.083  23.001 -80.574  1.00  0.66           C  
ATOM   4826  O   ARG B 189      22.932  23.747 -81.541  1.00  0.66           O  
ATOM   4827  CB  ARG B 189      22.242  24.467 -78.788  1.00  0.66           C  
ATOM   4828  CG  ARG B 189      21.086  24.797 -77.832  1.00  0.66           C  
ATOM   4829  CD  ARG B 189      21.164  26.240 -77.352  1.00  0.66           C  
ATOM   4830  NE  ARG B 189      19.888  26.536 -76.635  1.00  0.66           N  
ATOM   4831  CZ  ARG B 189      19.457  27.797 -76.504  1.00  0.66           C  
ATOM   4832  NH1 ARG B 189      20.226  28.824 -76.824  1.00  0.66           N  
ATOM   4833  NH2 ARG B 189      18.218  28.056 -76.109  1.00  0.66           N  
ATOM   4834  N   ILE B 190      24.093  22.118 -80.533  1.00  0.74           N  
ATOM   4835  CA  ILE B 190      25.080  22.033 -81.594  1.00  0.74           C  
ATOM   4836  C   ILE B 190      25.024  20.645 -82.190  1.00  0.74           C  
ATOM   4837  O   ILE B 190      25.069  19.646 -81.476  1.00  0.74           O  
ATOM   4838  CB  ILE B 190      26.493  22.314 -81.107  1.00  0.74           C  
ATOM   4839  CG1 ILE B 190      26.600  23.665 -80.369  1.00  0.74           C  
ATOM   4840  CG2 ILE B 190      27.474  22.254 -82.302  1.00  0.74           C  
ATOM   4841  CD1 ILE B 190      27.932  23.804 -79.632  1.00  0.74           C  
ATOM   4842  N   VAL B 191      24.919  20.552 -83.526  1.00  0.76           N  
ATOM   4843  CA  VAL B 191      24.666  19.303 -84.219  1.00  0.76           C  
ATOM   4844  C   VAL B 191      25.353  19.349 -85.569  1.00  0.76           C  
ATOM   4845  O   VAL B 191      25.648  20.426 -86.088  1.00  0.76           O  
ATOM   4846  CB  VAL B 191      23.162  19.079 -84.353  1.00  0.76           C  
ATOM   4847  CG1 VAL B 191      22.495  20.186 -85.197  1.00  0.76           C  
ATOM   4848  CG2 VAL B 191      22.830  17.677 -84.893  1.00  0.76           C  
ATOM   4849  N   ARG B 192      25.691  18.188 -86.168  1.00  0.67           N  
ATOM   4850  CA  ARG B 192      26.248  18.131 -87.508  1.00  0.67           C  
ATOM   4851  C   ARG B 192      25.309  18.670 -88.587  1.00  0.67           C  
ATOM   4852  O   ARG B 192      24.091  18.522 -88.520  1.00  0.67           O  
ATOM   4853  CB  ARG B 192      26.689  16.702 -87.898  1.00  0.67           C  
ATOM   4854  CG  ARG B 192      27.681  16.055 -86.918  1.00  0.67           C  
ATOM   4855  CD  ARG B 192      28.246  14.739 -87.473  1.00  0.67           C  
ATOM   4856  NE  ARG B 192      29.355  14.289 -86.567  1.00  0.67           N  
ATOM   4857  CZ  ARG B 192      30.571  14.845 -86.566  1.00  0.67           C  
ATOM   4858  NH1 ARG B 192      30.910  15.840 -87.380  1.00  0.67           N  
ATOM   4859  NH2 ARG B 192      31.515  14.437 -85.723  1.00  0.67           N  
ATOM   4860  N   SER B 193      25.857  19.319 -89.630  1.00  0.71           N  
ATOM   4861  CA  SER B 193      25.081  19.868 -90.737  1.00  0.71           C  
ATOM   4862  C   SER B 193      24.408  18.820 -91.609  1.00  0.71           C  
ATOM   4863  O   SER B 193      23.330  19.044 -92.154  1.00  0.71           O  
ATOM   4864  CB  SER B 193      25.930  20.798 -91.633  1.00  0.71           C  
ATOM   4865  OG  SER B 193      27.135  20.170 -92.062  1.00  0.71           O  
ATOM   4866  N   ASP B 194      25.032  17.640 -91.723  1.00  0.66           N  
ATOM   4867  CA  ASP B 194      24.609  16.503 -92.515  1.00  0.66           C  
ATOM   4868  C   ASP B 194      23.801  15.494 -91.698  1.00  0.66           C  
ATOM   4869  O   ASP B 194      23.324  14.482 -92.212  1.00  0.66           O  
ATOM   4870  CB  ASP B 194      25.871  15.830 -93.137  1.00  0.66           C  
ATOM   4871  CG  ASP B 194      27.102  15.989 -92.252  1.00  0.66           C  
ATOM   4872  OD1 ASP B 194      27.050  15.600 -91.058  1.00  0.66           O  
ATOM   4873  OD2 ASP B 194      28.084  16.594 -92.750  1.00  0.66           O  
ATOM   4874  N   SER B 195      23.575  15.789 -90.405  1.00  0.66           N  
ATOM   4875  CA  SER B 195      22.773  14.990 -89.489  1.00  0.66           C  
ATOM   4876  C   SER B 195      21.323  14.780 -89.922  1.00  0.66           C  
ATOM   4877  O   SER B 195      20.689  15.625 -90.559  1.00  0.66           O  
ATOM   4878  CB  SER B 195      22.785  15.602 -88.068  1.00  0.66           C  
ATOM   4879  OG  SER B 195      22.033  14.834 -87.128  1.00  0.66           O  
ATOM   4880  N   ALA B 196      20.740  13.622 -89.547  1.00  0.63           N  
ATOM   4881  CA  ALA B 196      19.337  13.338 -89.754  1.00  0.63           C  
ATOM   4882  C   ALA B 196      18.466  13.919 -88.643  1.00  0.63           C  
ATOM   4883  O   ALA B 196      17.252  14.044 -88.797  1.00  0.63           O  
ATOM   4884  CB  ALA B 196      19.136  11.812 -89.837  1.00  0.63           C  
ATOM   4885  N   LEU B 197      19.073  14.325 -87.507  1.00  0.64           N  
ATOM   4886  CA  LEU B 197      18.386  14.906 -86.369  1.00  0.64           C  
ATOM   4887  C   LEU B 197      17.678  16.217 -86.675  1.00  0.64           C  
ATOM   4888  O   LEU B 197      18.202  17.094 -87.361  1.00  0.64           O  
ATOM   4889  CB  LEU B 197      19.365  15.170 -85.201  1.00  0.64           C  
ATOM   4890  CG  LEU B 197      20.098  13.921 -84.674  1.00  0.64           C  
ATOM   4891  CD1 LEU B 197      21.309  14.350 -83.834  1.00  0.64           C  
ATOM   4892  CD2 LEU B 197      19.158  12.996 -83.891  1.00  0.64           C  
ATOM   4893  N   ARG B 198      16.458  16.409 -86.155  1.00  0.61           N  
ATOM   4894  CA  ARG B 198      15.698  17.618 -86.386  1.00  0.61           C  
ATOM   4895  C   ARG B 198      15.004  18.010 -85.105  1.00  0.61           C  
ATOM   4896  O   ARG B 198      14.733  17.188 -84.234  1.00  0.61           O  
ATOM   4897  CB  ARG B 198      14.636  17.448 -87.510  1.00  0.61           C  
ATOM   4898  CG  ARG B 198      15.224  17.263 -88.928  1.00  0.61           C  
ATOM   4899  CD  ARG B 198      16.022  18.470 -89.443  1.00  0.61           C  
ATOM   4900  NE  ARG B 198      16.557  18.127 -90.806  1.00  0.61           N  
ATOM   4901  CZ  ARG B 198      17.736  17.522 -91.015  1.00  0.61           C  
ATOM   4902  NH1 ARG B 198      18.529  17.133 -90.032  1.00  0.61           N  
ATOM   4903  NH2 ARG B 198      18.158  17.295 -92.258  1.00  0.61           N  
ATOM   4904  N   PHE B 199      14.725  19.312 -84.941  1.00  0.67           N  
ATOM   4905  CA  PHE B 199      13.995  19.835 -83.807  1.00  0.67           C  
ATOM   4906  C   PHE B 199      12.530  19.414 -83.862  1.00  0.67           C  
ATOM   4907  O   PHE B 199      11.872  19.578 -84.888  1.00  0.67           O  
ATOM   4908  CB  PHE B 199      14.111  21.380 -83.730  1.00  0.67           C  
ATOM   4909  CG  PHE B 199      15.498  21.790 -83.312  1.00  0.67           C  
ATOM   4910  CD1 PHE B 199      15.814  21.917 -81.949  1.00  0.67           C  
ATOM   4911  CD2 PHE B 199      16.493  22.067 -84.265  1.00  0.67           C  
ATOM   4912  CE1 PHE B 199      17.093  22.320 -81.542  1.00  0.67           C  
ATOM   4913  CE2 PHE B 199      17.774  22.470 -83.863  1.00  0.67           C  
ATOM   4914  CZ  PHE B 199      18.073  22.598 -82.501  1.00  0.67           C  
ATOM   4915  N   ARG B 200      11.980  18.850 -82.765  1.00  0.62           N  
ATOM   4916  CA  ARG B 200      10.585  18.434 -82.722  1.00  0.62           C  
ATOM   4917  C   ARG B 200       9.852  19.101 -81.569  1.00  0.62           C  
ATOM   4918  O   ARG B 200      10.334  19.162 -80.436  1.00  0.62           O  
ATOM   4919  CB  ARG B 200      10.433  16.886 -82.660  1.00  0.62           C  
ATOM   4920  CG  ARG B 200       8.992  16.361 -82.885  1.00  0.62           C  
ATOM   4921  CD  ARG B 200       8.884  14.826 -82.874  1.00  0.62           C  
ATOM   4922  NE  ARG B 200       7.425  14.446 -82.905  1.00  0.62           N  
ATOM   4923  CZ  ARG B 200       6.986  13.190 -82.731  1.00  0.62           C  
ATOM   4924  NH1 ARG B 200       7.807  12.146 -82.807  1.00  0.62           N  
ATOM   4925  NH2 ARG B 200       5.705  12.974 -82.440  1.00  0.62           N  
ATOM   4926  N   GLY B 201       8.639  19.622 -81.860  1.00  0.71           N  
ATOM   4927  CA  GLY B 201       7.776  20.322 -80.918  1.00  0.71           C  
ATOM   4928  C   GLY B 201       7.773  21.804 -81.161  1.00  0.71           C  
ATOM   4929  O   GLY B 201       8.817  22.433 -81.250  1.00  0.71           O  
ATOM   4930  N   ARG B 202       6.576  22.424 -81.245  1.00  0.67           N  
ATOM   4931  CA  ARG B 202       6.430  23.830 -81.609  1.00  0.67           C  
ATOM   4932  C   ARG B 202       7.031  24.814 -80.624  1.00  0.67           C  
ATOM   4933  O   ARG B 202       7.355  25.945 -80.975  1.00  0.67           O  
ATOM   4934  CB  ARG B 202       4.944  24.250 -81.703  1.00  0.67           C  
ATOM   4935  CG  ARG B 202       4.124  23.466 -82.733  1.00  0.67           C  
ATOM   4936  CD  ARG B 202       2.713  24.053 -82.892  1.00  0.67           C  
ATOM   4937  NE  ARG B 202       2.087  23.443 -84.096  1.00  0.67           N  
ATOM   4938  CZ  ARG B 202       2.559  23.588 -85.339  1.00  0.67           C  
ATOM   4939  NH1 ARG B 202       3.334  24.595 -85.704  1.00  0.67           N  
ATOM   4940  NH2 ARG B 202       2.251  22.640 -86.215  1.00  0.67           N  
ATOM   4941  N   LEU B 203       7.122  24.408 -79.352  1.00  0.68           N  
ATOM   4942  CA  LEU B 203       7.568  25.242 -78.271  1.00  0.68           C  
ATOM   4943  C   LEU B 203       8.383  24.372 -77.329  1.00  0.68           C  
ATOM   4944  O   LEU B 203       7.944  23.281 -76.958  1.00  0.68           O  
ATOM   4945  CB  LEU B 203       6.322  25.829 -77.559  1.00  0.68           C  
ATOM   4946  CG  LEU B 203       6.621  26.722 -76.343  1.00  0.68           C  
ATOM   4947  CD1 LEU B 203       7.312  28.044 -76.691  1.00  0.68           C  
ATOM   4948  CD2 LEU B 203       5.364  26.954 -75.493  1.00  0.68           C  
ATOM   4949  N   HIS B 204       9.602  24.823 -76.953  1.00  0.64           N  
ATOM   4950  CA  HIS B 204      10.553  24.101 -76.113  1.00  0.64           C  
ATOM   4951  C   HIS B 204      11.055  22.834 -76.790  1.00  0.64           C  
ATOM   4952  O   HIS B 204      11.046  21.722 -76.250  1.00  0.64           O  
ATOM   4953  CB  HIS B 204      10.069  23.804 -74.683  1.00  0.64           C  
ATOM   4954  CG  HIS B 204       9.411  24.956 -73.975  1.00  0.64           C  
ATOM   4955  ND1 HIS B 204      10.158  26.007 -73.478  1.00  0.64           N  
ATOM   4956  CD2 HIS B 204       8.088  25.199 -73.786  1.00  0.64           C  
ATOM   4957  CE1 HIS B 204       9.275  26.868 -73.014  1.00  0.64           C  
ATOM   4958  NE2 HIS B 204       8.005  26.429 -73.176  1.00  0.64           N  
ATOM   4959  N   GLU B 205      11.466  23.033 -78.043  1.00  0.64           N  
ATOM   4960  CA  GLU B 205      12.059  22.133 -78.984  1.00  0.64           C  
ATOM   4961  C   GLU B 205      13.395  21.536 -78.550  1.00  0.64           C  
ATOM   4962  O   GLU B 205      14.215  22.149 -77.869  1.00  0.64           O  
ATOM   4963  CB  GLU B 205      12.196  22.880 -80.340  1.00  0.64           C  
ATOM   4964  CG  GLU B 205      13.189  24.086 -80.381  1.00  0.64           C  
ATOM   4965  CD  GLU B 205      12.793  25.358 -79.616  1.00  0.64           C  
ATOM   4966  OE1 GLU B 205      13.666  26.267 -79.554  1.00  0.64           O  
ATOM   4967  OE2 GLU B 205      11.649  25.463 -79.108  1.00  0.64           O  
ATOM   4968  N   ARG B 206      13.658  20.284 -78.961  1.00  0.61           N  
ATOM   4969  CA  ARG B 206      14.955  19.659 -78.810  1.00  0.61           C  
ATOM   4970  C   ARG B 206      15.166  18.831 -80.056  1.00  0.61           C  
ATOM   4971  O   ARG B 206      14.207  18.516 -80.759  1.00  0.61           O  
ATOM   4972  CB  ARG B 206      15.061  18.735 -77.568  1.00  0.61           C  
ATOM   4973  CG  ARG B 206      15.112  19.488 -76.227  1.00  0.61           C  
ATOM   4974  CD  ARG B 206      15.226  18.534 -75.039  1.00  0.61           C  
ATOM   4975  NE  ARG B 206      15.716  19.346 -73.873  1.00  0.61           N  
ATOM   4976  CZ  ARG B 206      16.487  18.837 -72.905  1.00  0.61           C  
ATOM   4977  NH1 ARG B 206      16.665  17.531 -72.764  1.00  0.61           N  
ATOM   4978  NH2 ARG B 206      17.149  19.621 -72.062  1.00  0.61           N  
ATOM   4979  N   LEU B 207      16.431  18.498 -80.377  1.00  0.68           N  
ATOM   4980  CA  LEU B 207      16.787  17.587 -81.450  1.00  0.68           C  
ATOM   4981  C   LEU B 207      16.374  16.141 -81.198  1.00  0.68           C  
ATOM   4982  O   LEU B 207      16.629  15.583 -80.132  1.00  0.68           O  
ATOM   4983  CB  LEU B 207      18.312  17.631 -81.703  1.00  0.68           C  
ATOM   4984  CG  LEU B 207      18.788  18.953 -82.334  1.00  0.68           C  
ATOM   4985  CD1 LEU B 207      20.286  19.164 -82.109  1.00  0.68           C  
ATOM   4986  CD2 LEU B 207      18.478  19.002 -83.836  1.00  0.68           C  
ATOM   4987  N   TYR B 208      15.756  15.505 -82.209  1.00  0.66           N  
ATOM   4988  CA  TYR B 208      15.320  14.123 -82.181  1.00  0.66           C  
ATOM   4989  C   TYR B 208      15.602  13.494 -83.517  1.00  0.66           C  
ATOM   4990  O   TYR B 208      15.744  14.188 -84.524  1.00  0.66           O  
ATOM   4991  CB  TYR B 208      13.784  14.010 -82.002  1.00  0.66           C  
ATOM   4992  CG  TYR B 208      13.455  14.366 -80.598  1.00  0.66           C  
ATOM   4993  CD1 TYR B 208      13.662  13.424 -79.586  1.00  0.66           C  
ATOM   4994  CD2 TYR B 208      13.063  15.666 -80.259  1.00  0.66           C  
ATOM   4995  CE1 TYR B 208      13.563  13.799 -78.250  1.00  0.66           C  
ATOM   4996  CE2 TYR B 208      12.976  16.049 -78.912  1.00  0.66           C  
ATOM   4997  CZ  TYR B 208      13.298  15.116 -77.915  1.00  0.66           C  
ATOM   4998  OH  TYR B 208      13.428  15.455 -76.562  1.00  0.66           O  
ATOM   4999  N   ASP B 209      15.659  12.151 -83.574  1.00  0.63           N  
ATOM   5000  CA  ASP B 209      15.613  11.432 -84.827  1.00  0.63           C  
ATOM   5001  C   ASP B 209      14.193  11.397 -85.420  1.00  0.63           C  
ATOM   5002  O   ASP B 209      13.237  11.973 -84.893  1.00  0.63           O  
ATOM   5003  CB  ASP B 209      16.330  10.048 -84.749  1.00  0.63           C  
ATOM   5004  CG  ASP B 209      15.467   8.904 -84.247  1.00  0.63           C  
ATOM   5005  OD1 ASP B 209      14.435   9.169 -83.585  1.00  0.63           O  
ATOM   5006  OD2 ASP B 209      15.776   7.746 -84.608  1.00  0.63           O  
ATOM   5007  N   ALA B 210      14.031  10.698 -86.557  1.00  0.60           N  
ATOM   5008  CA  ALA B 210      12.752  10.454 -87.192  1.00  0.60           C  
ATOM   5009  C   ALA B 210      11.739   9.707 -86.315  1.00  0.60           C  
ATOM   5010  O   ALA B 210      10.534   9.936 -86.406  1.00  0.60           O  
ATOM   5011  CB  ALA B 210      12.998   9.658 -88.489  1.00  0.60           C  
ATOM   5012  N   HIS B 211      12.211   8.811 -85.426  1.00  0.59           N  
ATOM   5013  CA  HIS B 211      11.360   7.994 -84.580  1.00  0.59           C  
ATOM   5014  C   HIS B 211      11.053   8.682 -83.261  1.00  0.59           C  
ATOM   5015  O   HIS B 211      10.184   8.260 -82.501  1.00  0.59           O  
ATOM   5016  CB  HIS B 211      12.077   6.664 -84.267  1.00  0.59           C  
ATOM   5017  CG  HIS B 211      12.416   5.916 -85.515  1.00  0.59           C  
ATOM   5018  ND1 HIS B 211      11.397   5.398 -86.292  1.00  0.59           N  
ATOM   5019  CD2 HIS B 211      13.619   5.688 -86.103  1.00  0.59           C  
ATOM   5020  CE1 HIS B 211      11.998   4.866 -87.334  1.00  0.59           C  
ATOM   5021  NE2 HIS B 211      13.344   5.013 -87.272  1.00  0.59           N  
ATOM   5022  N   GLY B 212      11.745   9.800 -82.970  1.00  0.69           N  
ATOM   5023  CA  GLY B 212      11.605  10.545 -81.732  1.00  0.69           C  
ATOM   5024  C   GLY B 212      12.568  10.118 -80.663  1.00  0.69           C  
ATOM   5025  O   GLY B 212      12.333  10.396 -79.494  1.00  0.69           O  
ATOM   5026  N   ALA B 213      13.674   9.444 -81.005  1.00  0.71           N  
ATOM   5027  CA  ALA B 213      14.712   9.089 -80.060  1.00  0.71           C  
ATOM   5028  C   ALA B 213      15.690  10.238 -79.828  1.00  0.71           C  
ATOM   5029  O   ALA B 213      15.927  11.077 -80.704  1.00  0.71           O  
ATOM   5030  CB  ALA B 213      15.466   7.834 -80.532  1.00  0.71           C  
ATOM   5031  N   GLN B 214      16.274  10.333 -78.615  1.00  0.66           N  
ATOM   5032  CA  GLN B 214      17.204  11.404 -78.296  1.00  0.66           C  
ATOM   5033  C   GLN B 214      18.611  11.099 -78.799  1.00  0.66           C  
ATOM   5034  O   GLN B 214      19.096   9.977 -78.649  1.00  0.66           O  
ATOM   5035  CB  GLN B 214      17.298  11.742 -76.781  1.00  0.66           C  
ATOM   5036  CG  GLN B 214      16.148  12.657 -76.312  1.00  0.66           C  
ATOM   5037  CD  GLN B 214      16.269  13.131 -74.865  1.00  0.66           C  
ATOM   5038  OE1 GLN B 214      17.311  13.051 -74.209  1.00  0.66           O  
ATOM   5039  NE2 GLN B 214      15.150  13.699 -74.354  1.00  0.66           N  
ATOM   5040  N   PRO B 215      19.347  12.048 -79.367  1.00  0.72           N  
ATOM   5041  CA  PRO B 215      20.747  11.839 -79.681  1.00  0.72           C  
ATOM   5042  C   PRO B 215      21.598  11.892 -78.417  1.00  0.72           C  
ATOM   5043  O   PRO B 215      21.258  12.659 -77.503  1.00  0.72           O  
ATOM   5044  CB  PRO B 215      21.085  12.995 -80.626  1.00  0.72           C  
ATOM   5045  CG  PRO B 215      20.123  14.114 -80.216  1.00  0.72           C  
ATOM   5046  CD  PRO B 215      18.863  13.351 -79.823  1.00  0.72           C  
ATOM   5047  N   PRO B 216      22.672  11.114 -78.311  1.00  0.73           N  
ATOM   5048  CA  PRO B 216      23.554  11.143 -77.157  1.00  0.73           C  
ATOM   5049  C   PRO B 216      24.345  12.442 -77.120  1.00  0.73           C  
ATOM   5050  O   PRO B 216      24.716  12.988 -78.162  1.00  0.73           O  
ATOM   5051  CB  PRO B 216      24.443   9.909 -77.368  1.00  0.73           C  
ATOM   5052  CG  PRO B 216      24.537   9.763 -78.888  1.00  0.73           C  
ATOM   5053  CD  PRO B 216      23.143  10.185 -79.347  1.00  0.73           C  
ATOM   5054  N   SER B 217      24.559  12.998 -75.917  1.00  0.71           N  
ATOM   5055  CA  SER B 217      25.100  14.332 -75.753  1.00  0.71           C  
ATOM   5056  C   SER B 217      26.527  14.349 -75.249  1.00  0.71           C  
ATOM   5057  O   SER B 217      27.022  13.416 -74.616  1.00  0.71           O  
ATOM   5058  CB  SER B 217      24.223  15.208 -74.815  1.00  0.71           C  
ATOM   5059  OG  SER B 217      23.987  14.566 -73.560  1.00  0.71           O  
ATOM   5060  N   VAL B 218      27.232  15.456 -75.550  1.00  0.70           N  
ATOM   5061  CA  VAL B 218      28.534  15.782 -74.999  1.00  0.70           C  
ATOM   5062  C   VAL B 218      28.410  17.143 -74.343  1.00  0.70           C  
ATOM   5063  O   VAL B 218      28.060  18.124 -74.997  1.00  0.70           O  
ATOM   5064  CB  VAL B 218      29.631  15.849 -76.064  1.00  0.70           C  
ATOM   5065  CG1 VAL B 218      30.995  16.156 -75.415  1.00  0.70           C  
ATOM   5066  CG2 VAL B 218      29.709  14.505 -76.810  1.00  0.70           C  
ATOM   5067  N   GLU B 219      28.700  17.257 -73.032  1.00  0.65           N  
ATOM   5068  CA  GLU B 219      28.732  18.540 -72.352  1.00  0.65           C  
ATOM   5069  C   GLU B 219      30.122  19.125 -72.455  1.00  0.65           C  
ATOM   5070  O   GLU B 219      31.121  18.445 -72.215  1.00  0.65           O  
ATOM   5071  CB  GLU B 219      28.378  18.468 -70.851  1.00  0.65           C  
ATOM   5072  CG  GLU B 219      26.905  18.107 -70.551  1.00  0.65           C  
ATOM   5073  CD  GLU B 219      26.554  18.349 -69.084  1.00  0.65           C  
ATOM   5074  OE1 GLU B 219      25.350  18.224 -68.740  1.00  0.65           O  
ATOM   5075  OE2 GLU B 219      27.462  18.734 -68.302  1.00  0.65           O  
ATOM   5076  N   VAL B 220      30.230  20.410 -72.835  1.00  0.71           N  
ATOM   5077  CA  VAL B 220      31.516  21.048 -73.051  1.00  0.71           C  
ATOM   5078  C   VAL B 220      31.652  22.311 -72.230  1.00  0.71           C  
ATOM   5079  O   VAL B 220      30.690  23.040 -71.985  1.00  0.71           O  
ATOM   5080  CB  VAL B 220      31.812  21.343 -74.521  1.00  0.71           C  
ATOM   5081  CG1 VAL B 220      31.904  20.004 -75.277  1.00  0.71           C  
ATOM   5082  CG2 VAL B 220      30.732  22.248 -75.144  1.00  0.71           C  
ATOM   5083  N   ASP B 221      32.884  22.624 -71.772  1.00  0.71           N  
ATOM   5084  CA  ASP B 221      33.188  23.842 -71.044  1.00  0.71           C  
ATOM   5085  C   ASP B 221      33.321  25.036 -71.991  1.00  0.71           C  
ATOM   5086  O   ASP B 221      34.367  25.667 -72.135  1.00  0.71           O  
ATOM   5087  CB  ASP B 221      34.426  23.653 -70.125  1.00  0.71           C  
ATOM   5088  CG  ASP B 221      34.283  24.515 -68.885  1.00  0.71           C  
ATOM   5089  OD1 ASP B 221      33.230  24.369 -68.208  1.00  0.71           O  
ATOM   5090  OD2 ASP B 221      35.195  25.329 -68.596  1.00  0.71           O  
ATOM   5091  N   VAL B 222      32.213  25.350 -72.672  1.00  0.74           N  
ATOM   5092  CA  VAL B 222      32.024  26.494 -73.532  1.00  0.74           C  
ATOM   5093  C   VAL B 222      30.847  27.196 -72.903  1.00  0.74           C  
ATOM   5094  O   VAL B 222      29.790  26.593 -72.722  1.00  0.74           O  
ATOM   5095  CB  VAL B 222      31.682  26.088 -74.965  1.00  0.74           C  
ATOM   5096  CG1 VAL B 222      31.391  27.325 -75.836  1.00  0.74           C  
ATOM   5097  CG2 VAL B 222      32.855  25.288 -75.562  1.00  0.74           C  
ATOM   5098  N   VAL B 223      31.009  28.465 -72.498  1.00  0.72           N  
ATOM   5099  CA  VAL B 223      30.035  29.151 -71.672  1.00  0.72           C  
ATOM   5100  C   VAL B 223      29.399  30.285 -72.449  1.00  0.72           C  
ATOM   5101  O   VAL B 223      30.063  31.135 -73.039  1.00  0.72           O  
ATOM   5102  CB  VAL B 223      30.659  29.682 -70.382  1.00  0.72           C  
ATOM   5103  CG1 VAL B 223      29.614  30.412 -69.514  1.00  0.72           C  
ATOM   5104  CG2 VAL B 223      31.270  28.509 -69.586  1.00  0.72           C  
ATOM   5105  N   PHE B 224      28.059  30.326 -72.447  1.00  0.68           N  
ATOM   5106  CA  PHE B 224      27.280  31.413 -72.991  1.00  0.68           C  
ATOM   5107  C   PHE B 224      26.643  32.141 -71.828  1.00  0.68           C  
ATOM   5108  O   PHE B 224      26.082  31.536 -70.916  1.00  0.68           O  
ATOM   5109  CB  PHE B 224      26.157  30.915 -73.936  1.00  0.68           C  
ATOM   5110  CG  PHE B 224      26.727  30.526 -75.272  1.00  0.68           C  
ATOM   5111  CD1 PHE B 224      26.636  31.414 -76.356  1.00  0.68           C  
ATOM   5112  CD2 PHE B 224      27.342  29.278 -75.465  1.00  0.68           C  
ATOM   5113  CE1 PHE B 224      27.144  31.061 -77.611  1.00  0.68           C  
ATOM   5114  CE2 PHE B 224      27.854  28.921 -76.721  1.00  0.68           C  
ATOM   5115  CZ  PHE B 224      27.749  29.812 -77.796  1.00  0.68           C  
ATOM   5116  N   HIS B 225      26.721  33.480 -71.840  1.00  0.65           N  
ATOM   5117  CA  HIS B 225      26.053  34.319 -70.871  1.00  0.65           C  
ATOM   5118  C   HIS B 225      24.741  34.771 -71.468  1.00  0.65           C  
ATOM   5119  O   HIS B 225      24.710  35.510 -72.451  1.00  0.65           O  
ATOM   5120  CB  HIS B 225      26.881  35.574 -70.517  1.00  0.65           C  
ATOM   5121  CG  HIS B 225      28.142  35.259 -69.778  1.00  0.65           C  
ATOM   5122  ND1 HIS B 225      28.051  34.630 -68.555  1.00  0.65           N  
ATOM   5123  CD2 HIS B 225      29.438  35.560 -70.059  1.00  0.65           C  
ATOM   5124  CE1 HIS B 225      29.288  34.559 -68.109  1.00  0.65           C  
ATOM   5125  NE2 HIS B 225      30.170  35.108 -68.979  1.00  0.65           N  
ATOM   5126  N   HIS B 226      23.625  34.319 -70.882  1.00  0.62           N  
ATOM   5127  CA  HIS B 226      22.282  34.657 -71.289  1.00  0.62           C  
ATOM   5128  C   HIS B 226      21.859  35.939 -70.613  1.00  0.62           C  
ATOM   5129  O   HIS B 226      21.793  36.019 -69.387  1.00  0.62           O  
ATOM   5130  CB  HIS B 226      21.300  33.535 -70.883  1.00  0.62           C  
ATOM   5131  CG  HIS B 226      19.915  33.776 -71.355  1.00  0.62           C  
ATOM   5132  ND1 HIS B 226      19.773  33.934 -72.705  1.00  0.62           N  
ATOM   5133  CD2 HIS B 226      18.726  33.958 -70.721  1.00  0.62           C  
ATOM   5134  CE1 HIS B 226      18.502  34.209 -72.894  1.00  0.62           C  
ATOM   5135  NE2 HIS B 226      17.819  34.237 -71.722  1.00  0.62           N  
ATOM   5136  N   THR B 227      21.583  37.002 -71.391  1.00  0.62           N  
ATOM   5137  CA  THR B 227      21.309  38.312 -70.802  1.00  0.62           C  
ATOM   5138  C   THR B 227      19.903  38.456 -70.261  1.00  0.62           C  
ATOM   5139  O   THR B 227      19.668  39.273 -69.372  1.00  0.62           O  
ATOM   5140  CB  THR B 227      21.637  39.502 -71.699  1.00  0.62           C  
ATOM   5141  OG1 THR B 227      20.909  39.510 -72.914  1.00  0.62           O  
ATOM   5142  CG2 THR B 227      23.128  39.488 -72.065  1.00  0.62           C  
ATOM   5143  N   GLY B 228      18.935  37.639 -70.731  1.00  0.61           N  
ATOM   5144  CA  GLY B 228      17.586  37.592 -70.176  1.00  0.61           C  
ATOM   5145  C   GLY B 228      16.772  38.792 -70.556  1.00  0.61           C  
ATOM   5146  O   GLY B 228      16.023  39.339 -69.746  1.00  0.61           O  
ATOM   5147  N   TYR B 229      16.936  39.254 -71.807  1.00  0.54           N  
ATOM   5148  CA  TYR B 229      16.481  40.552 -72.266  1.00  0.54           C  
ATOM   5149  C   TYR B 229      14.976  40.630 -72.540  1.00  0.54           C  
ATOM   5150  O   TYR B 229      14.504  40.715 -73.670  1.00  0.54           O  
ATOM   5151  CB  TYR B 229      17.350  41.045 -73.459  1.00  0.54           C  
ATOM   5152  CG  TYR B 229      17.093  42.496 -73.790  1.00  0.54           C  
ATOM   5153  CD1 TYR B 229      16.414  42.833 -74.973  1.00  0.54           C  
ATOM   5154  CD2 TYR B 229      17.460  43.521 -72.900  1.00  0.54           C  
ATOM   5155  CE1 TYR B 229      16.061  44.163 -75.238  1.00  0.54           C  
ATOM   5156  CE2 TYR B 229      17.121  44.857 -73.173  1.00  0.54           C  
ATOM   5157  CZ  TYR B 229      16.402  45.169 -74.331  1.00  0.54           C  
ATOM   5158  OH  TYR B 229      15.953  46.483 -74.559  1.00  0.54           O  
ATOM   5159  N   GLU B 230      14.170  40.656 -71.466  1.00  0.49           N  
ATOM   5160  CA  GLU B 230      12.777  41.046 -71.522  1.00  0.49           C  
ATOM   5161  C   GLU B 230      12.633  42.456 -70.959  1.00  0.49           C  
ATOM   5162  O   GLU B 230      12.600  42.613 -69.734  1.00  0.49           O  
ATOM   5163  CB  GLU B 230      11.906  40.110 -70.656  1.00  0.49           C  
ATOM   5164  CG  GLU B 230      11.731  38.689 -71.240  1.00  0.49           C  
ATOM   5165  CD  GLU B 230      10.982  37.780 -70.281  1.00  0.49           C  
ATOM   5166  OE1 GLU B 230      10.769  36.596 -70.656  1.00  0.49           O  
ATOM   5167  OE2 GLU B 230      10.613  38.238 -69.171  1.00  0.49           O  
ATOM   5168  N   PRO B 231      12.525  43.515 -71.756  1.00  0.48           N  
ATOM   5169  CA  PRO B 231      12.068  44.800 -71.266  1.00  0.48           C  
ATOM   5170  C   PRO B 231      10.559  44.790 -71.074  1.00  0.48           C  
ATOM   5171  O   PRO B 231       9.840  44.214 -71.883  1.00  0.48           O  
ATOM   5172  CB  PRO B 231      12.523  45.782 -72.359  1.00  0.48           C  
ATOM   5173  CG  PRO B 231      12.598  44.960 -73.657  1.00  0.48           C  
ATOM   5174  CD  PRO B 231      12.668  43.494 -73.212  1.00  0.48           C  
ATOM   5175  N   GLU B 232      10.079  45.428 -69.990  1.00  0.41           N  
ATOM   5176  CA  GLU B 232       8.671  45.659 -69.720  1.00  0.41           C  
ATOM   5177  C   GLU B 232       7.795  44.470 -69.329  1.00  0.41           C  
ATOM   5178  O   GLU B 232       7.996  43.303 -69.660  1.00  0.41           O  
ATOM   5179  CB  GLU B 232       7.946  46.477 -70.811  1.00  0.41           C  
ATOM   5180  CG  GLU B 232       8.609  47.832 -71.144  1.00  0.41           C  
ATOM   5181  CD  GLU B 232       7.736  48.643 -72.100  1.00  0.41           C  
ATOM   5182  OE1 GLU B 232       8.220  49.711 -72.548  1.00  0.41           O  
ATOM   5183  OE2 GLU B 232       6.585  48.207 -72.368  1.00  0.41           O  
ATOM   5184  N   VAL B 233       6.729  44.785 -68.566  1.00  0.35           N  
ATOM   5185  CA  VAL B 233       5.666  43.866 -68.197  1.00  0.35           C  
ATOM   5186  C   VAL B 233       4.878  43.386 -69.413  1.00  0.35           C  
ATOM   5187  O   VAL B 233       4.508  42.218 -69.513  1.00  0.35           O  
ATOM   5188  CB  VAL B 233       4.745  44.520 -67.167  1.00  0.35           C  
ATOM   5189  CG1 VAL B 233       3.603  43.571 -66.750  1.00  0.35           C  
ATOM   5190  CG2 VAL B 233       5.577  44.902 -65.924  1.00  0.35           C  
ATOM   5191  N   ILE B 234       4.617  44.286 -70.387  1.00  0.37           N  
ATOM   5192  CA  ILE B 234       3.836  44.016 -71.589  1.00  0.37           C  
ATOM   5193  C   ILE B 234       4.458  42.949 -72.487  1.00  0.37           C  
ATOM   5194  O   ILE B 234       3.782  42.012 -72.912  1.00  0.37           O  
ATOM   5195  CB  ILE B 234       3.604  45.314 -72.366  1.00  0.37           C  
ATOM   5196  CG1 ILE B 234       2.834  46.338 -71.491  1.00  0.37           C  
ATOM   5197  CG2 ILE B 234       2.841  45.036 -73.685  1.00  0.37           C  
ATOM   5198  CD1 ILE B 234       2.815  47.750 -72.091  1.00  0.37           C  
ATOM   5199  N   ALA B 235       5.780  43.023 -72.755  1.00  0.43           N  
ATOM   5200  CA  ALA B 235       6.484  42.034 -73.554  1.00  0.43           C  
ATOM   5201  C   ALA B 235       6.502  40.651 -72.915  1.00  0.43           C  
ATOM   5202  O   ALA B 235       6.265  39.630 -73.562  1.00  0.43           O  
ATOM   5203  CB  ALA B 235       7.930  42.500 -73.790  1.00  0.43           C  
ATOM   5204  N   ARG B 236       6.743  40.602 -71.590  1.00  0.35           N  
ATOM   5205  CA  ARG B 236       6.675  39.395 -70.793  1.00  0.35           C  
ATOM   5206  C   ARG B 236       5.285  38.768 -70.766  1.00  0.35           C  
ATOM   5207  O   ARG B 236       5.130  37.553 -70.878  1.00  0.35           O  
ATOM   5208  CB  ARG B 236       7.137  39.710 -69.354  1.00  0.35           C  
ATOM   5209  CG  ARG B 236       7.240  38.469 -68.443  1.00  0.35           C  
ATOM   5210  CD  ARG B 236       7.767  38.776 -67.038  1.00  0.35           C  
ATOM   5211  NE  ARG B 236       9.186  39.155 -67.214  1.00  0.35           N  
ATOM   5212  CZ  ARG B 236       9.900  40.020 -66.490  1.00  0.35           C  
ATOM   5213  NH1 ARG B 236       9.439  40.541 -65.359  1.00  0.35           N  
ATOM   5214  NH2 ARG B 236      11.115  40.331 -66.936  1.00  0.35           N  
ATOM   5215  N   LYS B 237       4.223  39.590 -70.642  1.00  0.44           N  
ATOM   5216  CA  LYS B 237       2.849  39.133 -70.732  1.00  0.44           C  
ATOM   5217  C   LYS B 237       2.505  38.526 -72.089  1.00  0.44           C  
ATOM   5218  O   LYS B 237       2.002  37.406 -72.159  1.00  0.44           O  
ATOM   5219  CB  LYS B 237       1.890  40.309 -70.419  1.00  0.44           C  
ATOM   5220  CG  LYS B 237       0.408  39.915 -70.451  1.00  0.44           C  
ATOM   5221  CD  LYS B 237      -0.550  41.067 -70.112  1.00  0.44           C  
ATOM   5222  CE  LYS B 237      -1.982  40.669 -70.477  1.00  0.44           C  
ATOM   5223  NZ  LYS B 237      -2.957  41.712 -70.114  1.00  0.44           N  
ATOM   5224  N   GLY B 238       2.859  39.211 -73.200  1.00  0.50           N  
ATOM   5225  CA  GLY B 238       2.605  38.717 -74.553  1.00  0.50           C  
ATOM   5226  C   GLY B 238       3.380  37.471 -74.912  1.00  0.50           C  
ATOM   5227  O   GLY B 238       2.947  36.643 -75.711  1.00  0.50           O  
ATOM   5228  N   LYS B 239       4.564  37.282 -74.300  1.00  0.47           N  
ATOM   5229  CA  LYS B 239       5.326  36.050 -74.370  1.00  0.47           C  
ATOM   5230  C   LYS B 239       4.606  34.865 -73.736  1.00  0.47           C  
ATOM   5231  O   LYS B 239       4.547  33.790 -74.329  1.00  0.47           O  
ATOM   5232  CB  LYS B 239       6.710  36.271 -73.716  1.00  0.47           C  
ATOM   5233  CG  LYS B 239       7.690  35.086 -73.780  1.00  0.47           C  
ATOM   5234  CD  LYS B 239       9.066  35.514 -73.244  1.00  0.47           C  
ATOM   5235  CE  LYS B 239      10.102  34.391 -73.121  1.00  0.47           C  
ATOM   5236  NZ  LYS B 239      11.348  34.949 -72.557  1.00  0.47           N  
ATOM   5237  N   ARG B 240       3.993  35.050 -72.546  1.00  0.42           N  
ATOM   5238  CA  ARG B 240       3.162  34.048 -71.889  1.00  0.42           C  
ATOM   5239  C   ARG B 240       1.902  33.713 -72.676  1.00  0.42           C  
ATOM   5240  O   ARG B 240       1.562  32.547 -72.863  1.00  0.42           O  
ATOM   5241  CB  ARG B 240       2.718  34.526 -70.484  1.00  0.42           C  
ATOM   5242  CG  ARG B 240       3.874  34.777 -69.499  1.00  0.42           C  
ATOM   5243  CD  ARG B 240       3.401  35.545 -68.264  1.00  0.42           C  
ATOM   5244  NE  ARG B 240       4.617  35.889 -67.466  1.00  0.42           N  
ATOM   5245  CZ  ARG B 240       4.575  36.534 -66.293  1.00  0.42           C  
ATOM   5246  NH1 ARG B 240       3.442  37.023 -65.802  1.00  0.42           N  
ATOM   5247  NH2 ARG B 240       5.674  36.602 -65.547  1.00  0.42           N  
ATOM   5248  N   GLU B 241       1.198  34.741 -73.195  1.00  0.48           N  
ATOM   5249  CA  GLU B 241       0.014  34.601 -74.029  1.00  0.48           C  
ATOM   5250  C   GLU B 241       0.307  33.881 -75.346  1.00  0.48           C  
ATOM   5251  O   GLU B 241      -0.444  33.013 -75.792  1.00  0.48           O  
ATOM   5252  CB  GLU B 241      -0.644  35.991 -74.235  1.00  0.48           C  
ATOM   5253  CG  GLU B 241      -1.238  36.542 -72.907  1.00  0.48           C  
ATOM   5254  CD  GLU B 241      -1.745  37.985 -72.948  1.00  0.48           C  
ATOM   5255  OE1 GLU B 241      -2.642  38.295 -72.113  1.00  0.48           O  
ATOM   5256  OE2 GLU B 241      -1.214  38.809 -73.734  1.00  0.48           O  
ATOM   5257  N   ARG B 242       1.460  34.169 -75.988  1.00  0.42           N  
ATOM   5258  CA  ARG B 242       1.966  33.375 -77.097  1.00  0.42           C  
ATOM   5259  C   ARG B 242       2.285  31.929 -76.728  1.00  0.42           C  
ATOM   5260  O   ARG B 242       1.905  31.006 -77.443  1.00  0.42           O  
ATOM   5261  CB  ARG B 242       3.240  34.038 -77.687  1.00  0.42           C  
ATOM   5262  CG  ARG B 242       3.851  33.299 -78.900  1.00  0.42           C  
ATOM   5263  CD  ARG B 242       5.029  34.023 -79.567  1.00  0.42           C  
ATOM   5264  NE  ARG B 242       6.138  34.068 -78.557  1.00  0.42           N  
ATOM   5265  CZ  ARG B 242       7.198  34.886 -78.631  1.00  0.42           C  
ATOM   5266  NH1 ARG B 242       7.358  35.740 -79.636  1.00  0.42           N  
ATOM   5267  NH2 ARG B 242       8.122  34.845 -77.673  1.00  0.42           N  
ATOM   5268  N   TYR B 243       2.973  31.684 -75.593  1.00  0.47           N  
ATOM   5269  CA  TYR B 243       3.329  30.344 -75.143  1.00  0.47           C  
ATOM   5270  C   TYR B 243       2.109  29.487 -74.832  1.00  0.47           C  
ATOM   5271  O   TYR B 243       2.033  28.340 -75.262  1.00  0.47           O  
ATOM   5272  CB  TYR B 243       4.293  30.379 -73.921  1.00  0.47           C  
ATOM   5273  CG  TYR B 243       5.744  30.673 -74.261  1.00  0.47           C  
ATOM   5274  CD1 TYR B 243       6.184  31.258 -75.469  1.00  0.47           C  
ATOM   5275  CD2 TYR B 243       6.715  30.315 -73.308  1.00  0.47           C  
ATOM   5276  CE1 TYR B 243       7.550  31.475 -75.707  1.00  0.47           C  
ATOM   5277  CE2 TYR B 243       8.081  30.518 -73.548  1.00  0.47           C  
ATOM   5278  CZ  TYR B 243       8.494  31.104 -74.748  1.00  0.47           C  
ATOM   5279  OH  TYR B 243       9.862  31.297 -75.017  1.00  0.47           O  
ATOM   5280  N   ALA B 244       1.089  30.048 -74.152  1.00  0.61           N  
ATOM   5281  CA  ALA B 244      -0.175  29.381 -73.898  1.00  0.61           C  
ATOM   5282  C   ALA B 244      -0.920  28.979 -75.173  1.00  0.61           C  
ATOM   5283  O   ALA B 244      -1.368  27.845 -75.313  1.00  0.61           O  
ATOM   5284  CB  ALA B 244      -1.059  30.298 -73.031  1.00  0.61           C  
ATOM   5285  N   ARG B 245      -0.991  29.869 -76.184  1.00  0.59           N  
ATOM   5286  CA  ARG B 245      -1.572  29.538 -77.478  1.00  0.59           C  
ATOM   5287  C   ARG B 245      -0.844  28.417 -78.220  1.00  0.59           C  
ATOM   5288  O   ARG B 245      -1.456  27.515 -78.794  1.00  0.59           O  
ATOM   5289  CB  ARG B 245      -1.589  30.790 -78.386  1.00  0.59           C  
ATOM   5290  CG  ARG B 245      -2.275  30.546 -79.747  1.00  0.59           C  
ATOM   5291  CD  ARG B 245      -2.255  31.737 -80.706  1.00  0.59           C  
ATOM   5292  NE  ARG B 245      -0.838  31.971 -81.135  1.00  0.59           N  
ATOM   5293  CZ  ARG B 245      -0.141  33.095 -80.994  1.00  0.59           C  
ATOM   5294  NH1 ARG B 245      -0.580  34.092 -80.232  1.00  0.59           N  
ATOM   5295  NH2 ARG B 245       1.014  33.243 -81.631  1.00  0.59           N  
ATOM   5296  N   LEU B 246       0.508  28.424 -78.208  1.00  0.63           N  
ATOM   5297  CA  LEU B 246       1.320  27.367 -78.793  1.00  0.63           C  
ATOM   5298  C   LEU B 246       1.048  26.017 -78.151  1.00  0.63           C  
ATOM   5299  O   LEU B 246       0.897  24.999 -78.821  1.00  0.63           O  
ATOM   5300  CB  LEU B 246       2.828  27.688 -78.634  1.00  0.63           C  
ATOM   5301  CG  LEU B 246       3.322  28.856 -79.507  1.00  0.63           C  
ATOM   5302  CD1 LEU B 246       4.728  29.304 -79.093  1.00  0.63           C  
ATOM   5303  CD2 LEU B 246       3.325  28.476 -80.985  1.00  0.63           C  
ATOM   5304  N   VAL B 247       0.925  26.007 -76.820  1.00  0.66           N  
ATOM   5305  CA  VAL B 247       0.538  24.870 -76.016  1.00  0.66           C  
ATOM   5306  C   VAL B 247      -0.854  24.317 -76.319  1.00  0.66           C  
ATOM   5307  O   VAL B 247      -1.019  23.110 -76.508  1.00  0.66           O  
ATOM   5308  CB  VAL B 247       0.636  25.336 -74.581  1.00  0.66           C  
ATOM   5309  CG1 VAL B 247      -0.228  24.503 -73.631  1.00  0.66           C  
ATOM   5310  CG2 VAL B 247       2.124  25.348 -74.176  1.00  0.66           C  
ATOM   5311  N   GLU B 248      -1.889  25.178 -76.417  1.00  0.66           N  
ATOM   5312  CA  GLU B 248      -3.251  24.797 -76.772  1.00  0.66           C  
ATOM   5313  C   GLU B 248      -3.331  24.198 -78.165  1.00  0.66           C  
ATOM   5314  O   GLU B 248      -3.999  23.193 -78.428  1.00  0.66           O  
ATOM   5315  CB  GLU B 248      -4.177  26.028 -76.702  1.00  0.66           C  
ATOM   5316  CG  GLU B 248      -4.444  26.519 -75.259  1.00  0.66           C  
ATOM   5317  CD  GLU B 248      -5.217  27.837 -75.224  1.00  0.66           C  
ATOM   5318  OE1 GLU B 248      -5.738  28.160 -74.126  1.00  0.66           O  
ATOM   5319  OE2 GLU B 248      -5.292  28.522 -76.277  1.00  0.66           O  
ATOM   5320  N   ARG B 249      -2.578  24.788 -79.106  1.00  0.60           N  
ATOM   5321  CA  ARG B 249      -2.395  24.240 -80.427  1.00  0.60           C  
ATOM   5322  C   ARG B 249      -1.721  22.869 -80.437  1.00  0.60           C  
ATOM   5323  O   ARG B 249      -2.202  21.937 -81.075  1.00  0.60           O  
ATOM   5324  CB  ARG B 249      -1.576  25.248 -81.255  1.00  0.60           C  
ATOM   5325  CG  ARG B 249      -1.382  24.807 -82.708  1.00  0.60           C  
ATOM   5326  CD  ARG B 249      -0.700  25.853 -83.581  1.00  0.60           C  
ATOM   5327  NE  ARG B 249      -0.619  25.182 -84.902  1.00  0.60           N  
ATOM   5328  CZ  ARG B 249      -0.180  25.724 -86.039  1.00  0.60           C  
ATOM   5329  NH1 ARG B 249       0.253  26.976 -86.106  1.00  0.60           N  
ATOM   5330  NH2 ARG B 249      -0.181  24.941 -87.113  1.00  0.60           N  
ATOM   5331  N   CYS B 250      -0.624  22.676 -79.680  1.00  0.64           N  
ATOM   5332  CA  CYS B 250       0.036  21.383 -79.558  1.00  0.64           C  
ATOM   5333  C   CYS B 250      -0.804  20.300 -78.904  1.00  0.64           C  
ATOM   5334  O   CYS B 250      -0.750  19.145 -79.313  1.00  0.64           O  
ATOM   5335  CB  CYS B 250       1.347  21.462 -78.768  1.00  0.64           C  
ATOM   5336  SG  CYS B 250       2.635  22.438 -79.579  1.00  0.64           S  
ATOM   5337  N   LEU B 251      -1.632  20.644 -77.894  1.00  0.62           N  
ATOM   5338  CA  LEU B 251      -2.638  19.741 -77.348  1.00  0.62           C  
ATOM   5339  C   LEU B 251      -3.611  19.250 -78.400  1.00  0.62           C  
ATOM   5340  O   LEU B 251      -3.996  18.089 -78.417  1.00  0.62           O  
ATOM   5341  CB  LEU B 251      -3.523  20.459 -76.300  1.00  0.62           C  
ATOM   5342  CG  LEU B 251      -2.975  20.491 -74.873  1.00  0.62           C  
ATOM   5343  CD1 LEU B 251      -3.872  21.424 -74.051  1.00  0.62           C  
ATOM   5344  CD2 LEU B 251      -2.954  19.084 -74.262  1.00  0.62           C  
ATOM   5345  N   THR B 252      -4.043  20.147 -79.298  1.00  0.63           N  
ATOM   5346  CA  THR B 252      -4.919  19.805 -80.413  1.00  0.63           C  
ATOM   5347  C   THR B 252      -4.237  18.897 -81.429  1.00  0.63           C  
ATOM   5348  O   THR B 252      -4.810  17.912 -81.888  1.00  0.63           O  
ATOM   5349  CB  THR B 252      -5.442  21.052 -81.117  1.00  0.63           C  
ATOM   5350  OG1 THR B 252      -6.087  21.915 -80.185  1.00  0.63           O  
ATOM   5351  CG2 THR B 252      -6.494  20.691 -82.176  1.00  0.63           C  
ATOM   5352  N   GLU B 253      -2.977  19.207 -81.799  1.00  0.60           N  
ATOM   5353  CA  GLU B 253      -2.184  18.451 -82.756  1.00  0.60           C  
ATOM   5354  C   GLU B 253      -1.662  17.086 -82.264  1.00  0.60           C  
ATOM   5355  O   GLU B 253      -1.743  16.097 -82.990  1.00  0.60           O  
ATOM   5356  CB  GLU B 253      -1.056  19.356 -83.334  1.00  0.60           C  
ATOM   5357  CG  GLU B 253      -1.609  20.582 -84.131  1.00  0.60           C  
ATOM   5358  CD  GLU B 253      -0.544  21.506 -84.709  1.00  0.60           C  
ATOM   5359  OE1 GLU B 253      -0.899  22.559 -85.314  1.00  0.60           O  
ATOM   5360  OE2 GLU B 253       0.672  21.223 -84.559  1.00  0.60           O  
ATOM   5361  N   GLU B 254      -1.149  16.966 -81.017  1.00  0.52           N  
ATOM   5362  CA  GLU B 254      -0.687  15.698 -80.447  1.00  0.52           C  
ATOM   5363  C   GLU B 254      -1.397  15.378 -79.107  1.00  0.52           C  
ATOM   5364  O   GLU B 254      -0.745  15.415 -78.060  1.00  0.52           O  
ATOM   5365  CB  GLU B 254       0.863  15.688 -80.223  1.00  0.52           C  
ATOM   5366  CG  GLU B 254       1.759  15.718 -81.499  1.00  0.52           C  
ATOM   5367  CD  GLU B 254       3.256  15.554 -81.210  1.00  0.52           C  
ATOM   5368  OE1 GLU B 254       3.979  14.916 -82.024  1.00  0.52           O  
ATOM   5369  OE2 GLU B 254       3.747  16.061 -80.165  1.00  0.52           O  
ATOM   5370  N   PRO B 255      -2.694  15.030 -79.024  1.00  0.65           N  
ATOM   5371  CA  PRO B 255      -3.448  15.054 -77.762  1.00  0.65           C  
ATOM   5372  C   PRO B 255      -3.164  13.883 -76.849  1.00  0.65           C  
ATOM   5373  O   PRO B 255      -3.453  13.969 -75.656  1.00  0.65           O  
ATOM   5374  CB  PRO B 255      -4.924  15.004 -78.208  1.00  0.65           C  
ATOM   5375  CG  PRO B 255      -4.880  14.345 -79.589  1.00  0.65           C  
ATOM   5376  CD  PRO B 255      -3.587  14.910 -80.177  1.00  0.65           C  
ATOM   5377  N   SER B 256      -2.641  12.763 -77.375  1.00  0.57           N  
ATOM   5378  CA  SER B 256      -2.304  11.584 -76.592  1.00  0.57           C  
ATOM   5379  C   SER B 256      -0.836  11.573 -76.247  1.00  0.57           C  
ATOM   5380  O   SER B 256      -0.346  10.654 -75.602  1.00  0.57           O  
ATOM   5381  CB  SER B 256      -2.621  10.268 -77.348  1.00  0.57           C  
ATOM   5382  OG  SER B 256      -2.035  10.259 -78.653  1.00  0.57           O  
ATOM   5383  N   ASN B 257      -0.088  12.627 -76.629  1.00  0.50           N  
ATOM   5384  CA  ASN B 257       1.269  12.811 -76.176  1.00  0.50           C  
ATOM   5385  C   ASN B 257       1.188  13.472 -74.797  1.00  0.50           C  
ATOM   5386  O   ASN B 257       0.724  14.615 -74.702  1.00  0.50           O  
ATOM   5387  CB  ASN B 257       2.046  13.692 -77.191  1.00  0.50           C  
ATOM   5388  CG  ASN B 257       3.507  13.898 -76.811  1.00  0.50           C  
ATOM   5389  OD1 ASN B 257       3.983  13.439 -75.771  1.00  0.50           O  
ATOM   5390  ND2 ASN B 257       4.254  14.637 -77.660  1.00  0.50           N  
ATOM   5391  N   PRO B 258       1.612  12.849 -73.697  1.00  0.47           N  
ATOM   5392  CA  PRO B 258       1.504  13.443 -72.375  1.00  0.47           C  
ATOM   5393  C   PRO B 258       2.344  14.688 -72.245  1.00  0.47           C  
ATOM   5394  O   PRO B 258       1.967  15.546 -71.453  1.00  0.47           O  
ATOM   5395  CB  PRO B 258       1.923  12.334 -71.415  1.00  0.47           C  
ATOM   5396  CG  PRO B 258       2.812  11.414 -72.257  1.00  0.47           C  
ATOM   5397  CD  PRO B 258       2.193  11.503 -73.647  1.00  0.47           C  
ATOM   5398  N   LYS B 259       3.419  14.849 -73.053  1.00  0.44           N  
ATOM   5399  CA  LYS B 259       4.256  16.034 -73.104  1.00  0.44           C  
ATOM   5400  C   LYS B 259       3.473  17.318 -73.347  1.00  0.44           C  
ATOM   5401  O   LYS B 259       3.914  18.374 -72.911  1.00  0.44           O  
ATOM   5402  CB  LYS B 259       5.388  15.900 -74.164  1.00  0.44           C  
ATOM   5403  CG  LYS B 259       6.337  17.114 -74.236  1.00  0.44           C  
ATOM   5404  CD  LYS B 259       7.425  17.022 -75.317  1.00  0.44           C  
ATOM   5405  CE  LYS B 259       8.073  18.395 -75.556  1.00  0.44           C  
ATOM   5406  NZ  LYS B 259       9.258  18.310 -76.431  1.00  0.44           N  
ATOM   5407  N   TRP B 260       2.289  17.286 -74.010  1.00  0.44           N  
ATOM   5408  CA  TRP B 260       1.507  18.502 -74.204  1.00  0.44           C  
ATOM   5409  C   TRP B 260       0.386  18.715 -73.208  1.00  0.44           C  
ATOM   5410  O   TRP B 260       0.023  19.855 -72.954  1.00  0.44           O  
ATOM   5411  CB  TRP B 260       0.984  18.670 -75.637  1.00  0.44           C  
ATOM   5412  CG  TRP B 260       2.122  18.629 -76.628  1.00  0.44           C  
ATOM   5413  CD1 TRP B 260       2.414  17.600 -77.461  1.00  0.44           C  
ATOM   5414  CD2 TRP B 260       3.155  19.618 -76.830  1.00  0.44           C  
ATOM   5415  NE1 TRP B 260       3.549  17.870 -78.179  1.00  0.44           N  
ATOM   5416  CE2 TRP B 260       4.032  19.096 -77.802  1.00  0.44           C  
ATOM   5417  CE3 TRP B 260       3.356  20.890 -76.299  1.00  0.44           C  
ATOM   5418  CZ2 TRP B 260       5.141  19.815 -78.227  1.00  0.44           C  
ATOM   5419  CZ3 TRP B 260       4.465  21.629 -76.747  1.00  0.44           C  
ATOM   5420  CH2 TRP B 260       5.359  21.089 -77.683  1.00  0.44           C  
ATOM   5421  N   HIS B 261      -0.121  17.686 -72.490  1.00  0.48           N  
ATOM   5422  CA  HIS B 261      -0.871  17.932 -71.249  1.00  0.48           C  
ATOM   5423  C   HIS B 261       0.051  18.487 -70.200  1.00  0.48           C  
ATOM   5424  O   HIS B 261      -0.239  19.429 -69.471  1.00  0.48           O  
ATOM   5425  CB  HIS B 261      -1.526  16.672 -70.669  1.00  0.48           C  
ATOM   5426  CG  HIS B 261      -2.633  16.225 -71.546  1.00  0.48           C  
ATOM   5427  ND1 HIS B 261      -3.820  16.946 -71.602  1.00  0.48           N  
ATOM   5428  CD2 HIS B 261      -2.629  15.221 -72.456  1.00  0.48           C  
ATOM   5429  CE1 HIS B 261      -4.516  16.339 -72.556  1.00  0.48           C  
ATOM   5430  NE2 HIS B 261      -3.838  15.300 -73.103  1.00  0.48           N  
ATOM   5431  N   PHE B 262       1.266  17.941 -70.212  1.00  0.36           N  
ATOM   5432  CA  PHE B 262       2.351  18.370 -69.401  1.00  0.36           C  
ATOM   5433  C   PHE B 262       3.123  19.494 -70.126  1.00  0.36           C  
ATOM   5434  O   PHE B 262       4.194  19.908 -69.716  1.00  0.36           O  
ATOM   5435  CB  PHE B 262       3.175  17.101 -69.070  1.00  0.36           C  
ATOM   5436  CG  PHE B 262       4.246  17.418 -68.095  1.00  0.36           C  
ATOM   5437  CD1 PHE B 262       5.559  17.224 -68.511  1.00  0.36           C  
ATOM   5438  CD2 PHE B 262       3.993  18.094 -66.890  1.00  0.36           C  
ATOM   5439  CE1 PHE B 262       6.606  17.804 -67.799  1.00  0.36           C  
ATOM   5440  CE2 PHE B 262       5.062  18.680 -66.199  1.00  0.36           C  
ATOM   5441  CZ  PHE B 262       6.366  18.563 -66.662  1.00  0.36           C  
ATOM   5442  N   TYR B 263       2.542  20.118 -71.179  1.00  0.34           N  
ATOM   5443  CA  TYR B 263       2.881  21.471 -71.599  1.00  0.34           C  
ATOM   5444  C   TYR B 263       1.680  22.389 -71.421  1.00  0.34           C  
ATOM   5445  O   TYR B 263       1.776  23.557 -71.742  1.00  0.34           O  
ATOM   5446  CB  TYR B 263       3.517  21.662 -73.023  1.00  0.34           C  
ATOM   5447  CG  TYR B 263       4.965  22.125 -73.018  1.00  0.34           C  
ATOM   5448  CD1 TYR B 263       5.425  23.105 -72.121  1.00  0.34           C  
ATOM   5449  CD2 TYR B 263       5.915  21.501 -73.854  1.00  0.34           C  
ATOM   5450  CE1 TYR B 263       6.795  23.233 -71.857  1.00  0.34           C  
ATOM   5451  CE2 TYR B 263       7.290  21.696 -73.652  1.00  0.34           C  
ATOM   5452  CZ  TYR B 263       7.720  22.471 -72.569  1.00  0.34           C  
ATOM   5453  OH  TYR B 263       9.065  22.450 -72.151  1.00  0.34           O  
ATOM   5454  N   ALA B 264       0.555  21.939 -70.810  1.00  0.52           N  
ATOM   5455  CA  ALA B 264      -0.670  22.707 -70.683  1.00  0.52           C  
ATOM   5456  C   ALA B 264      -1.007  23.310 -69.326  1.00  0.52           C  
ATOM   5457  O   ALA B 264      -2.117  23.792 -69.160  1.00  0.52           O  
ATOM   5458  CB  ALA B 264      -1.830  21.816 -71.132  1.00  0.52           C  
ATOM   5459  N   VAL B 265      -0.069  23.309 -68.346  1.00  0.45           N  
ATOM   5460  CA  VAL B 265      -0.103  23.920 -66.991  1.00  0.45           C  
ATOM   5461  C   VAL B 265       0.995  24.974 -66.348  1.00  0.45           C  
ATOM   5462  O   VAL B 265       0.596  25.968 -65.775  1.00  0.45           O  
ATOM   5463  CB  VAL B 265      -0.436  22.737 -66.136  1.00  0.45           C  
ATOM   5464  CG1 VAL B 265       0.125  22.944 -64.746  1.00  0.45           C  
ATOM   5465  CG2 VAL B 265      -1.969  22.554 -66.184  1.00  0.45           C  
ATOM   5466  N   ARG B 266       2.369  24.955 -66.414  1.00  0.37           N  
ATOM   5467  CA  ARG B 266       3.306  26.051 -65.991  1.00  0.37           C  
ATOM   5468  C   ARG B 266       3.259  27.426 -66.607  1.00  0.37           C  
ATOM   5469  O   ARG B 266       3.362  28.382 -65.867  1.00  0.37           O  
ATOM   5470  CB  ARG B 266       4.823  25.778 -66.233  1.00  0.37           C  
ATOM   5471  CG  ARG B 266       5.945  26.803 -65.878  1.00  0.37           C  
ATOM   5472  CD  ARG B 266       7.278  26.513 -66.603  1.00  0.37           C  
ATOM   5473  NE  ARG B 266       7.189  26.851 -68.052  1.00  0.37           N  
ATOM   5474  CZ  ARG B 266       7.903  26.268 -69.020  1.00  0.37           C  
ATOM   5475  NH1 ARG B 266       8.963  25.505 -68.761  1.00  0.37           N  
ATOM   5476  NH2 ARG B 266       7.577  26.495 -70.281  1.00  0.37           N  
ATOM   5477  N   ASP B 267       3.183  27.666 -67.926  1.00  0.44           N  
ATOM   5478  CA  ASP B 267       3.330  29.024 -68.455  1.00  0.44           C  
ATOM   5479  C   ASP B 267       2.189  29.973 -68.084  1.00  0.44           C  
ATOM   5480  O   ASP B 267       2.305  31.195 -68.149  1.00  0.44           O  
ATOM   5481  CB  ASP B 267       3.660  29.022 -69.975  1.00  0.44           C  
ATOM   5482  CG  ASP B 267       5.085  28.540 -70.169  1.00  0.44           C  
ATOM   5483  OD1 ASP B 267       5.924  28.817 -69.275  1.00  0.44           O  
ATOM   5484  OD2 ASP B 267       5.405  27.865 -71.180  1.00  0.44           O  
ATOM   5485  N   GLY B 268       1.085  29.405 -67.562  1.00  0.38           N  
ATOM   5486  CA  GLY B 268       0.070  30.117 -66.801  1.00  0.38           C  
ATOM   5487  C   GLY B 268       0.391  30.367 -65.342  1.00  0.38           C  
ATOM   5488  O   GLY B 268      -0.380  31.049 -64.677  1.00  0.38           O  
ATOM   5489  N   LEU B 269       1.502  29.826 -64.817  1.00  0.30           N  
ATOM   5490  CA  LEU B 269       2.086  30.051 -63.506  1.00  0.30           C  
ATOM   5491  C   LEU B 269       3.360  30.860 -63.543  1.00  0.30           C  
ATOM   5492  O   LEU B 269       3.859  31.228 -62.486  1.00  0.30           O  
ATOM   5493  CB  LEU B 269       2.583  28.771 -62.782  1.00  0.30           C  
ATOM   5494  CG  LEU B 269       1.479  27.952 -62.141  1.00  0.30           C  
ATOM   5495  CD1 LEU B 269       1.502  26.531 -62.684  1.00  0.30           C  
ATOM   5496  CD2 LEU B 269       1.675  27.917 -60.637  1.00  0.30           C  
ATOM   5497  N   VAL B 270       3.975  31.166 -64.706  1.00  0.29           N  
ATOM   5498  CA  VAL B 270       5.240  31.903 -64.692  1.00  0.29           C  
ATOM   5499  C   VAL B 270       5.039  33.289 -64.081  1.00  0.29           C  
ATOM   5500  O   VAL B 270       4.450  34.180 -64.678  1.00  0.29           O  
ATOM   5501  CB  VAL B 270       5.925  31.958 -66.062  1.00  0.29           C  
ATOM   5502  CG1 VAL B 270       7.198  32.831 -66.058  1.00  0.29           C  
ATOM   5503  CG2 VAL B 270       6.327  30.529 -66.464  1.00  0.29           C  
ATOM   5504  N   GLY B 271       5.458  33.490 -62.812  1.00  0.25           N  
ATOM   5505  CA  GLY B 271       5.114  34.687 -62.054  1.00  0.25           C  
ATOM   5506  C   GLY B 271       3.708  34.753 -61.490  1.00  0.25           C  
ATOM   5507  O   GLY B 271       3.292  35.822 -61.061  1.00  0.25           O  
ATOM   5508  N   ARG B 272       2.923  33.654 -61.450  1.00  0.24           N  
ATOM   5509  CA  ARG B 272       1.670  33.664 -60.704  1.00  0.24           C  
ATOM   5510  C   ARG B 272       1.362  32.318 -60.091  1.00  0.24           C  
ATOM   5511  O   ARG B 272       1.674  31.282 -60.644  1.00  0.24           O  
ATOM   5512  CB  ARG B 272       0.452  34.226 -61.492  1.00  0.24           C  
ATOM   5513  CG  ARG B 272      -0.264  33.339 -62.528  1.00  0.24           C  
ATOM   5514  CD  ARG B 272      -1.507  33.978 -63.162  1.00  0.24           C  
ATOM   5515  NE  ARG B 272      -2.210  32.911 -63.951  1.00  0.24           N  
ATOM   5516  CZ  ARG B 272      -3.538  32.709 -64.010  1.00  0.24           C  
ATOM   5517  NH1 ARG B 272      -4.384  33.522 -63.389  1.00  0.24           N  
ATOM   5518  NH2 ARG B 272      -4.028  31.659 -64.664  1.00  0.24           N  
ATOM   5519  N   LYS B 273       0.775  32.260 -58.882  1.00  0.38           N  
ATOM   5520  CA  LYS B 273       0.867  31.026 -58.119  1.00  0.38           C  
ATOM   5521  C   LYS B 273      -0.474  30.728 -57.327  1.00  0.38           C  
ATOM   5522  O   LYS B 273      -0.996  31.704 -56.794  1.00  0.38           O  
ATOM   5523  CB  LYS B 273       2.180  31.215 -57.299  1.00  0.38           C  
ATOM   5524  CG  LYS B 273       3.620  31.348 -57.858  1.00  0.38           C  
ATOM   5525  CD  LYS B 273       4.513  31.283 -56.605  1.00  0.38           C  
ATOM   5526  CE  LYS B 273       6.009  31.475 -56.802  1.00  0.38           C  
ATOM   5527  NZ  LYS B 273       6.673  31.170 -55.528  1.00  0.38           N  
ATOM   5528  N   PRO B 274      -1.160  29.529 -57.261  1.00  0.32           N  
ATOM   5529  CA  PRO B 274      -2.648  29.449 -57.133  1.00  0.32           C  
ATOM   5530  C   PRO B 274      -3.257  29.136 -55.751  1.00  0.32           C  
ATOM   5531  O   PRO B 274      -2.654  28.450 -54.949  1.00  0.32           O  
ATOM   5532  CB  PRO B 274      -3.002  28.276 -58.069  1.00  0.32           C  
ATOM   5533  CG  PRO B 274      -1.842  27.312 -57.928  1.00  0.32           C  
ATOM   5534  CD  PRO B 274      -0.653  28.272 -57.842  1.00  0.32           C  
ATOM   5535  N   GLY B 275      -4.478  29.655 -55.441  1.00  0.39           N  
ATOM   5536  CA  GLY B 275      -5.194  29.516 -54.147  1.00  0.39           C  
ATOM   5537  C   GLY B 275      -5.815  28.164 -53.857  1.00  0.39           C  
ATOM   5538  O   GLY B 275      -6.074  27.470 -54.821  1.00  0.39           O  
ATOM   5539  N   PRO B 276      -6.127  27.712 -52.631  1.00  0.29           N  
ATOM   5540  CA  PRO B 276      -6.491  26.318 -52.308  1.00  0.29           C  
ATOM   5541  C   PRO B 276      -7.503  25.593 -53.188  1.00  0.29           C  
ATOM   5542  O   PRO B 276      -7.197  24.501 -53.663  1.00  0.29           O  
ATOM   5543  CB  PRO B 276      -6.934  26.354 -50.837  1.00  0.29           C  
ATOM   5544  CG  PRO B 276      -6.192  27.565 -50.264  1.00  0.29           C  
ATOM   5545  CD  PRO B 276      -6.145  28.553 -51.435  1.00  0.29           C  
ATOM   5546  N   ASP B 277      -8.690  26.167 -53.443  1.00  0.39           N  
ATOM   5547  CA  ASP B 277      -9.723  25.534 -54.240  1.00  0.39           C  
ATOM   5548  C   ASP B 277      -9.608  25.917 -55.716  1.00  0.39           C  
ATOM   5549  O   ASP B 277     -10.295  25.374 -56.578  1.00  0.39           O  
ATOM   5550  CB  ASP B 277     -11.105  25.901 -53.649  1.00  0.39           C  
ATOM   5551  CG  ASP B 277     -11.125  25.480 -52.188  1.00  0.39           C  
ATOM   5552  OD1 ASP B 277     -11.442  24.297 -51.917  1.00  0.39           O  
ATOM   5553  OD2 ASP B 277     -10.770  26.347 -51.345  1.00  0.39           O  
ATOM   5554  N   GLU B 278      -8.635  26.791 -56.077  1.00  0.33           N  
ATOM   5555  CA  GLU B 278      -8.103  26.787 -57.426  1.00  0.33           C  
ATOM   5556  C   GLU B 278      -7.192  25.569 -57.509  1.00  0.33           C  
ATOM   5557  O   GLU B 278      -7.527  24.553 -58.116  1.00  0.33           O  
ATOM   5558  CB  GLU B 278      -7.321  28.096 -57.744  1.00  0.33           C  
ATOM   5559  CG  GLU B 278      -6.808  28.177 -59.207  1.00  0.33           C  
ATOM   5560  CD  GLU B 278      -6.029  29.448 -59.555  1.00  0.33           C  
ATOM   5561  OE1 GLU B 278      -5.835  29.687 -60.780  1.00  0.33           O  
ATOM   5562  OE2 GLU B 278      -5.564  30.179 -58.640  1.00  0.33           O  
ATOM   5563  N   ALA B 279      -6.093  25.604 -56.744  1.00  0.30           N  
ATOM   5564  CA  ALA B 279      -5.023  24.653 -56.626  1.00  0.30           C  
ATOM   5565  C   ALA B 279      -5.428  23.194 -56.644  1.00  0.30           C  
ATOM   5566  O   ALA B 279      -4.930  22.412 -57.456  1.00  0.30           O  
ATOM   5567  CB  ALA B 279      -4.313  24.955 -55.282  1.00  0.30           C  
ATOM   5568  N   LEU B 280      -6.379  22.818 -55.775  1.00  0.29           N  
ATOM   5569  CA  LEU B 280      -6.947  21.498 -55.688  1.00  0.29           C  
ATOM   5570  C   LEU B 280      -7.222  20.822 -57.034  1.00  0.29           C  
ATOM   5571  O   LEU B 280      -6.585  19.834 -57.369  1.00  0.29           O  
ATOM   5572  CB  LEU B 280      -8.233  21.591 -54.835  1.00  0.29           C  
ATOM   5573  CG  LEU B 280      -8.948  20.272 -54.512  1.00  0.29           C  
ATOM   5574  CD1 LEU B 280      -8.119  19.404 -53.574  1.00  0.29           C  
ATOM   5575  CD2 LEU B 280     -10.237  20.606 -53.768  1.00  0.29           C  
ATOM   5576  N   ALA B 281      -8.112  21.338 -57.898  1.00  0.38           N  
ATOM   5577  CA  ALA B 281      -8.734  20.546 -58.952  1.00  0.38           C  
ATOM   5578  C   ALA B 281      -7.875  19.633 -59.866  1.00  0.38           C  
ATOM   5579  O   ALA B 281      -8.167  18.439 -60.002  1.00  0.38           O  
ATOM   5580  CB  ALA B 281      -9.544  21.501 -59.840  1.00  0.38           C  
ATOM   5581  N   LEU B 282      -6.772  20.136 -60.468  1.00  0.38           N  
ATOM   5582  CA  LEU B 282      -6.214  19.588 -61.703  1.00  0.38           C  
ATOM   5583  C   LEU B 282      -5.141  18.491 -61.622  1.00  0.38           C  
ATOM   5584  O   LEU B 282      -4.729  17.999 -62.663  1.00  0.38           O  
ATOM   5585  CB  LEU B 282      -5.637  20.721 -62.585  1.00  0.38           C  
ATOM   5586  CG  LEU B 282      -6.624  21.654 -63.302  1.00  0.38           C  
ATOM   5587  CD1 LEU B 282      -5.807  22.589 -64.205  1.00  0.38           C  
ATOM   5588  CD2 LEU B 282      -7.639  20.915 -64.177  1.00  0.38           C  
ATOM   5589  N   PHE B 283      -4.705  17.955 -60.452  1.00  0.31           N  
ATOM   5590  CA  PHE B 283      -3.946  16.669 -60.449  1.00  0.31           C  
ATOM   5591  C   PHE B 283      -4.719  15.547 -61.062  1.00  0.31           C  
ATOM   5592  O   PHE B 283      -4.133  14.640 -61.612  1.00  0.31           O  
ATOM   5593  CB  PHE B 283      -3.572  16.129 -59.050  1.00  0.31           C  
ATOM   5594  CG  PHE B 283      -2.855  14.827 -58.765  1.00  0.31           C  
ATOM   5595  CD1 PHE B 283      -3.603  13.708 -58.344  1.00  0.31           C  
ATOM   5596  CD2 PHE B 283      -1.471  14.833 -58.530  1.00  0.31           C  
ATOM   5597  CE1 PHE B 283      -2.992  12.647 -57.662  1.00  0.31           C  
ATOM   5598  CE2 PHE B 283      -0.859  13.778 -57.842  1.00  0.31           C  
ATOM   5599  CZ  PHE B 283      -1.620  12.690 -57.399  1.00  0.31           C  
ATOM   5600  N   ARG B 284      -6.061  15.579 -61.013  1.00  0.35           N  
ATOM   5601  CA  ARG B 284      -6.882  14.597 -61.683  1.00  0.35           C  
ATOM   5602  C   ARG B 284      -6.581  14.587 -63.179  1.00  0.35           C  
ATOM   5603  O   ARG B 284      -6.359  13.524 -63.736  1.00  0.35           O  
ATOM   5604  CB  ARG B 284      -8.365  14.861 -61.317  1.00  0.35           C  
ATOM   5605  CG  ARG B 284      -8.630  14.591 -59.816  1.00  0.35           C  
ATOM   5606  CD  ARG B 284      -9.968  15.117 -59.290  1.00  0.35           C  
ATOM   5607  NE  ARG B 284      -9.934  14.881 -57.804  1.00  0.35           N  
ATOM   5608  CZ  ARG B 284     -10.799  15.409 -56.926  1.00  0.35           C  
ATOM   5609  NH1 ARG B 284     -11.754  16.247 -57.312  1.00  0.35           N  
ATOM   5610  NH2 ARG B 284     -10.669  15.126 -55.631  1.00  0.35           N  
ATOM   5611  N   ARG B 285      -6.389  15.776 -63.795  1.00  0.48           N  
ATOM   5612  CA  ARG B 285      -5.879  15.914 -65.147  1.00  0.48           C  
ATOM   5613  C   ARG B 285      -4.465  15.370 -65.375  1.00  0.48           C  
ATOM   5614  O   ARG B 285      -4.220  14.689 -66.364  1.00  0.48           O  
ATOM   5615  CB  ARG B 285      -5.911  17.409 -65.570  1.00  0.48           C  
ATOM   5616  CG  ARG B 285      -5.518  17.636 -67.042  1.00  0.48           C  
ATOM   5617  CD  ARG B 285      -5.564  19.093 -67.497  1.00  0.48           C  
ATOM   5618  NE  ARG B 285      -5.109  19.055 -68.924  1.00  0.48           N  
ATOM   5619  CZ  ARG B 285      -5.073  20.094 -69.766  1.00  0.48           C  
ATOM   5620  NH1 ARG B 285      -5.422  21.321 -69.394  1.00  0.48           N  
ATOM   5621  NH2 ARG B 285      -4.673  19.883 -71.018  1.00  0.48           N  
ATOM   5622  N   LEU B 286      -3.463  15.630 -64.498  1.00  0.44           N  
ATOM   5623  CA  LEU B 286      -2.142  15.052 -64.745  1.00  0.44           C  
ATOM   5624  C   LEU B 286      -1.974  13.634 -64.252  1.00  0.44           C  
ATOM   5625  O   LEU B 286      -1.121  12.908 -64.728  1.00  0.44           O  
ATOM   5626  CB  LEU B 286      -0.949  15.891 -64.240  1.00  0.44           C  
ATOM   5627  CG  LEU B 286       0.280  15.789 -65.183  1.00  0.44           C  
ATOM   5628  CD1 LEU B 286       0.079  16.517 -66.523  1.00  0.44           C  
ATOM   5629  CD2 LEU B 286       1.540  16.345 -64.526  1.00  0.44           C  
ATOM   5630  N   ARG B 287      -2.785  13.146 -63.311  1.00  0.41           N  
ATOM   5631  CA  ARG B 287      -2.802  11.754 -62.918  1.00  0.41           C  
ATOM   5632  C   ARG B 287      -3.419  10.890 -64.006  1.00  0.41           C  
ATOM   5633  O   ARG B 287      -2.907   9.821 -64.332  1.00  0.41           O  
ATOM   5634  CB  ARG B 287      -3.499  11.593 -61.540  1.00  0.41           C  
ATOM   5635  CG  ARG B 287      -3.074  10.343 -60.747  1.00  0.41           C  
ATOM   5636  CD  ARG B 287      -1.603  10.407 -60.313  1.00  0.41           C  
ATOM   5637  NE  ARG B 287      -1.256   9.081 -59.707  1.00  0.41           N  
ATOM   5638  CZ  ARG B 287      -0.160   8.388 -60.046  1.00  0.41           C  
ATOM   5639  NH1 ARG B 287       0.835   8.927 -60.743  1.00  0.41           N  
ATOM   5640  NH2 ARG B 287      -0.060   7.111 -59.674  1.00  0.41           N  
ATOM   5641  N   GLU B 288      -4.496  11.398 -64.641  1.00  0.54           N  
ATOM   5642  CA  GLU B 288      -5.069  10.892 -65.874  1.00  0.54           C  
ATOM   5643  C   GLU B 288      -4.096  10.960 -67.051  1.00  0.54           C  
ATOM   5644  O   GLU B 288      -3.834   9.969 -67.726  1.00  0.54           O  
ATOM   5645  CB  GLU B 288      -6.305  11.774 -66.162  1.00  0.54           C  
ATOM   5646  CG  GLU B 288      -7.182  11.424 -67.382  1.00  0.54           C  
ATOM   5647  CD  GLU B 288      -8.312  12.443 -67.572  1.00  0.54           C  
ATOM   5648  OE1 GLU B 288      -9.243  12.118 -68.353  1.00  0.54           O  
ATOM   5649  OE2 GLU B 288      -8.254  13.544 -66.962  1.00  0.54           O  
ATOM   5650  N   ALA B 289      -3.444  12.120 -67.280  1.00  0.54           N  
ATOM   5651  CA  ALA B 289      -2.481  12.275 -68.354  1.00  0.54           C  
ATOM   5652  C   ALA B 289      -1.152  11.569 -68.114  1.00  0.54           C  
ATOM   5653  O   ALA B 289      -0.444  11.218 -69.052  1.00  0.54           O  
ATOM   5654  CB  ALA B 289      -2.211  13.768 -68.618  1.00  0.54           C  
ATOM   5655  N   HIS B 290      -0.771  11.301 -66.851  1.00  0.42           N  
ATOM   5656  CA  HIS B 290       0.430  10.548 -66.539  1.00  0.42           C  
ATOM   5657  C   HIS B 290       0.257   9.072 -66.821  1.00  0.42           C  
ATOM   5658  O   HIS B 290       1.224   8.370 -67.085  1.00  0.42           O  
ATOM   5659  CB  HIS B 290       0.908  10.702 -65.076  1.00  0.42           C  
ATOM   5660  CG  HIS B 290       2.287  10.154 -64.861  1.00  0.42           C  
ATOM   5661  ND1 HIS B 290       3.374  10.978 -65.099  1.00  0.42           N  
ATOM   5662  CD2 HIS B 290       2.701   8.881 -64.629  1.00  0.42           C  
ATOM   5663  CE1 HIS B 290       4.427  10.184 -65.016  1.00  0.42           C  
ATOM   5664  NE2 HIS B 290       4.075   8.907 -64.733  1.00  0.42           N  
ATOM   5665  N   ALA B 291      -0.995   8.576 -66.867  1.00  0.45           N  
ATOM   5666  CA  ALA B 291      -1.279   7.198 -67.216  1.00  0.45           C  
ATOM   5667  C   ALA B 291      -0.965   6.906 -68.683  1.00  0.45           C  
ATOM   5668  O   ALA B 291      -0.747   5.767 -69.080  1.00  0.45           O  
ATOM   5669  CB  ALA B 291      -2.755   6.895 -66.900  1.00  0.45           C  
ATOM   5670  N   LEU B 292      -0.824   7.965 -69.510  1.00  0.36           N  
ATOM   5671  CA  LEU B 292      -0.336   7.878 -70.874  1.00  0.36           C  
ATOM   5672  C   LEU B 292       1.157   7.532 -70.945  1.00  0.36           C  
ATOM   5673  O   LEU B 292       1.655   7.111 -71.983  1.00  0.36           O  
ATOM   5674  CB  LEU B 292      -0.536   9.224 -71.616  1.00  0.36           C  
ATOM   5675  CG  LEU B 292      -1.974   9.788 -71.632  1.00  0.36           C  
ATOM   5676  CD1 LEU B 292      -1.971  11.232 -72.163  1.00  0.36           C  
ATOM   5677  CD2 LEU B 292      -2.921   8.918 -72.465  1.00  0.36           C  
ATOM   5678  N   TYR B 293       1.930   7.665 -69.838  1.00  0.33           N  
ATOM   5679  CA  TYR B 293       3.301   7.167 -69.776  1.00  0.33           C  
ATOM   5680  C   TYR B 293       3.360   5.673 -69.517  1.00  0.33           C  
ATOM   5681  O   TYR B 293       4.386   5.042 -69.759  1.00  0.33           O  
ATOM   5682  CB  TYR B 293       4.157   7.851 -68.681  1.00  0.33           C  
ATOM   5683  CG  TYR B 293       4.429   9.280 -69.037  1.00  0.33           C  
ATOM   5684  CD1 TYR B 293       5.402   9.621 -69.990  1.00  0.33           C  
ATOM   5685  CD2 TYR B 293       3.718  10.299 -68.404  1.00  0.33           C  
ATOM   5686  CE1 TYR B 293       5.651  10.967 -70.299  1.00  0.33           C  
ATOM   5687  CE2 TYR B 293       3.947  11.638 -68.725  1.00  0.33           C  
ATOM   5688  CZ  TYR B 293       4.927  11.978 -69.660  1.00  0.33           C  
ATOM   5689  OH  TYR B 293       5.187  13.330 -69.952  1.00  0.33           O  
ATOM   5690  N   ASP B 294       2.242   5.078 -69.064  1.00  0.36           N  
ATOM   5691  CA  ASP B 294       2.113   3.654 -68.853  1.00  0.36           C  
ATOM   5692  C   ASP B 294       1.490   2.998 -70.099  1.00  0.36           C  
ATOM   5693  O   ASP B 294       1.340   1.778 -70.186  1.00  0.36           O  
ATOM   5694  CB  ASP B 294       1.221   3.403 -67.605  1.00  0.36           C  
ATOM   5695  CG  ASP B 294       1.805   4.064 -66.364  1.00  0.36           C  
ATOM   5696  OD1 ASP B 294       2.933   3.679 -65.966  1.00  0.36           O  
ATOM   5697  OD2 ASP B 294       1.118   4.944 -65.779  1.00  0.36           O  
ATOM   5698  N   GLU B 295       1.151   3.805 -71.132  1.00  0.34           N  
ATOM   5699  CA  GLU B 295       0.600   3.346 -72.395  1.00  0.34           C  
ATOM   5700  C   GLU B 295       1.670   3.187 -73.465  1.00  0.34           C  
ATOM   5701  O   GLU B 295       2.220   4.160 -73.971  1.00  0.34           O  
ATOM   5702  CB  GLU B 295      -0.472   4.311 -72.967  1.00  0.34           C  
ATOM   5703  CG  GLU B 295      -1.788   4.355 -72.154  1.00  0.34           C  
ATOM   5704  CD  GLU B 295      -2.886   5.188 -72.818  1.00  0.34           C  
ATOM   5705  OE1 GLU B 295      -3.989   5.257 -72.215  1.00  0.34           O  
ATOM   5706  OE2 GLU B 295      -2.652   5.747 -73.920  1.00  0.34           O  
ATOM   5707  N   ALA B 296       1.925   1.920 -73.874  1.00  0.29           N  
ATOM   5708  CA  ALA B 296       2.848   1.541 -74.936  1.00  0.29           C  
ATOM   5709  C   ALA B 296       4.338   1.848 -74.679  1.00  0.29           C  
ATOM   5710  O   ALA B 296       4.677   2.579 -73.750  1.00  0.29           O  
ATOM   5711  CB  ALA B 296       2.346   2.138 -76.275  1.00  0.29           C  
ATOM   5712  N   PRO B 297       5.325   1.306 -75.403  1.00  0.27           N  
ATOM   5713  CA  PRO B 297       6.609   1.986 -75.530  1.00  0.27           C  
ATOM   5714  C   PRO B 297       6.459   3.370 -76.156  1.00  0.27           C  
ATOM   5715  O   PRO B 297       5.997   3.487 -77.289  1.00  0.27           O  
ATOM   5716  CB  PRO B 297       7.456   1.023 -76.378  1.00  0.27           C  
ATOM   5717  CG  PRO B 297       6.428   0.307 -77.261  1.00  0.27           C  
ATOM   5718  CD  PRO B 297       5.208   0.183 -76.341  1.00  0.27           C  
ATOM   5719  N   LEU B 298       6.886   4.420 -75.442  1.00  0.32           N  
ATOM   5720  CA  LEU B 298       6.915   5.775 -75.945  1.00  0.32           C  
ATOM   5721  C   LEU B 298       8.285   6.086 -76.522  1.00  0.32           C  
ATOM   5722  O   LEU B 298       9.287   5.465 -76.169  1.00  0.32           O  
ATOM   5723  CB  LEU B 298       6.642   6.778 -74.799  1.00  0.32           C  
ATOM   5724  CG  LEU B 298       5.209   6.779 -74.234  1.00  0.32           C  
ATOM   5725  CD1 LEU B 298       5.128   7.758 -73.056  1.00  0.32           C  
ATOM   5726  CD2 LEU B 298       4.151   7.148 -75.283  1.00  0.32           C  
ATOM   5727  N   SER B 299       8.366   7.085 -77.423  1.00  0.28           N  
ATOM   5728  CA  SER B 299       9.633   7.620 -77.908  1.00  0.28           C  
ATOM   5729  C   SER B 299      10.278   8.532 -76.882  1.00  0.28           C  
ATOM   5730  O   SER B 299       9.621   9.005 -75.959  1.00  0.28           O  
ATOM   5731  CB  SER B 299       9.475   8.412 -79.238  1.00  0.28           C  
ATOM   5732  OG  SER B 299       8.719   9.618 -79.085  1.00  0.28           O  
ATOM   5733  N   ASP B 300      11.576   8.863 -77.022  1.00  0.29           N  
ATOM   5734  CA  ASP B 300      12.252   9.760 -76.099  1.00  0.29           C  
ATOM   5735  C   ASP B 300      11.824  11.219 -76.236  1.00  0.29           C  
ATOM   5736  O   ASP B 300      12.260  12.064 -75.465  1.00  0.29           O  
ATOM   5737  CB  ASP B 300      13.782   9.770 -76.278  1.00  0.29           C  
ATOM   5738  CG  ASP B 300      14.418   8.401 -76.209  1.00  0.29           C  
ATOM   5739  OD1 ASP B 300      14.009   7.578 -75.358  1.00  0.29           O  
ATOM   5740  OD2 ASP B 300      15.365   8.200 -77.014  1.00  0.29           O  
ATOM   5741  N   TYR B 301      11.007  11.565 -77.249  1.00  0.24           N  
ATOM   5742  CA  TYR B 301      10.268  12.810 -77.363  1.00  0.24           C  
ATOM   5743  C   TYR B 301       9.010  12.821 -76.491  1.00  0.24           C  
ATOM   5744  O   TYR B 301       8.691  13.804 -75.828  1.00  0.24           O  
ATOM   5745  CB  TYR B 301       9.929  13.030 -78.861  1.00  0.24           C  
ATOM   5746  CG  TYR B 301       8.952  14.144 -79.113  1.00  0.24           C  
ATOM   5747  CD1 TYR B 301       7.633  13.819 -79.449  1.00  0.24           C  
ATOM   5748  CD2 TYR B 301       9.318  15.496 -79.024  1.00  0.24           C  
ATOM   5749  CE1 TYR B 301       6.706  14.816 -79.751  1.00  0.24           C  
ATOM   5750  CE2 TYR B 301       8.397  16.499 -79.357  1.00  0.24           C  
ATOM   5751  CZ  TYR B 301       7.090  16.155 -79.718  1.00  0.24           C  
ATOM   5752  OH  TYR B 301       6.158  17.144 -80.063  1.00  0.24           O  
ATOM   5753  N   GLU B 302       8.245  11.720 -76.473  1.00  0.61           N  
ATOM   5754  CA  GLU B 302       7.058  11.587 -75.648  1.00  0.61           C  
ATOM   5755  C   GLU B 302       7.423  11.300 -74.199  1.00  0.61           C  
ATOM   5756  O   GLU B 302       6.909  11.904 -73.262  1.00  0.61           O  
ATOM   5757  CB  GLU B 302       6.187  10.459 -76.232  1.00  0.61           C  
ATOM   5758  CG  GLU B 302       5.669  10.796 -77.652  1.00  0.61           C  
ATOM   5759  CD  GLU B 302       5.442   9.573 -78.531  1.00  0.61           C  
ATOM   5760  OE1 GLU B 302       4.417   9.549 -79.252  1.00  0.61           O  
ATOM   5761  OE2 GLU B 302       6.346   8.694 -78.549  1.00  0.61           O  
ATOM   5762  N   ALA B 303       8.412  10.413 -73.985  1.00  0.58           N  
ATOM   5763  CA  ALA B 303       8.932  10.043 -72.688  1.00  0.58           C  
ATOM   5764  C   ALA B 303      10.100  10.926 -72.271  1.00  0.58           C  
ATOM   5765  O   ALA B 303      10.685  10.726 -71.208  1.00  0.58           O  
ATOM   5766  CB  ALA B 303       9.381   8.570 -72.697  1.00  0.58           C  
ATOM   5767  N   GLU B 304      10.363  12.011 -73.044  1.00  0.33           N  
ATOM   5768  CA  GLU B 304      11.320  13.097 -72.816  1.00  0.33           C  
ATOM   5769  C   GLU B 304      11.197  13.692 -71.435  1.00  0.33           C  
ATOM   5770  O   GLU B 304      12.134  14.247 -70.861  1.00  0.33           O  
ATOM   5771  CB  GLU B 304      10.960  14.246 -73.811  1.00  0.33           C  
ATOM   5772  CG  GLU B 304      11.822  15.532 -73.797  1.00  0.33           C  
ATOM   5773  CD  GLU B 304      11.197  16.642 -74.633  1.00  0.33           C  
ATOM   5774  OE1 GLU B 304      10.625  17.604 -74.061  1.00  0.33           O  
ATOM   5775  OE2 GLU B 304      11.259  16.596 -75.886  1.00  0.33           O  
ATOM   5776  N   ARG B 305       9.949  13.614 -70.949  1.00  0.30           N  
ATOM   5777  CA  ARG B 305       9.393  14.313 -69.838  1.00  0.30           C  
ATOM   5778  C   ARG B 305       8.464  13.392 -69.059  1.00  0.30           C  
ATOM   5779  O   ARG B 305       7.465  13.824 -68.490  1.00  0.30           O  
ATOM   5780  CB  ARG B 305       8.610  15.516 -70.403  1.00  0.30           C  
ATOM   5781  CG  ARG B 305       9.472  16.460 -71.270  1.00  0.30           C  
ATOM   5782  CD  ARG B 305      10.599  17.176 -70.525  1.00  0.30           C  
ATOM   5783  NE  ARG B 305      11.145  18.177 -71.490  1.00  0.30           N  
ATOM   5784  CZ  ARG B 305      12.444  18.428 -71.661  1.00  0.30           C  
ATOM   5785  NH1 ARG B 305      12.759  19.670 -72.015  1.00  0.30           N  
ATOM   5786  NH2 ARG B 305      13.379  17.513 -71.441  1.00  0.30           N  
ATOM   5787  N   CYS B 306       8.753  12.067 -69.005  1.00  0.28           N  
ATOM   5788  CA  CYS B 306       8.118  11.149 -68.049  1.00  0.28           C  
ATOM   5789  C   CYS B 306       8.532  11.513 -66.637  1.00  0.28           C  
ATOM   5790  O   CYS B 306       7.718  11.671 -65.729  1.00  0.28           O  
ATOM   5791  CB  CYS B 306       8.506   9.667 -68.346  1.00  0.28           C  
ATOM   5792  SG  CYS B 306       7.637   8.435 -67.305  1.00  0.28           S  
ATOM   5793  N   THR B 307       9.844  11.752 -66.498  1.00  0.28           N  
ATOM   5794  CA  THR B 307      10.548  12.265 -65.341  1.00  0.28           C  
ATOM   5795  C   THR B 307      10.023  13.625 -64.900  1.00  0.28           C  
ATOM   5796  O   THR B 307       9.664  13.838 -63.750  1.00  0.28           O  
ATOM   5797  CB  THR B 307      12.026  12.428 -65.709  1.00  0.28           C  
ATOM   5798  OG1 THR B 307      12.436  11.452 -66.659  1.00  0.28           O  
ATOM   5799  CG2 THR B 307      12.917  12.216 -64.492  1.00  0.28           C  
ATOM   5800  N   ASP B 308       9.892  14.563 -65.860  1.00  0.27           N  
ATOM   5801  CA  ASP B 308       9.305  15.873 -65.692  1.00  0.27           C  
ATOM   5802  C   ASP B 308       7.815  15.932 -65.386  1.00  0.27           C  
ATOM   5803  O   ASP B 308       7.396  16.713 -64.544  1.00  0.27           O  
ATOM   5804  CB  ASP B 308       9.658  16.788 -66.878  1.00  0.27           C  
ATOM   5805  CG  ASP B 308      11.137  16.858 -67.173  1.00  0.27           C  
ATOM   5806  OD1 ASP B 308      11.753  17.932 -66.955  1.00  0.27           O  
ATOM   5807  OD2 ASP B 308      11.634  15.853 -67.748  1.00  0.27           O  
ATOM   5808  N   SER B 309       6.951  15.084 -65.999  1.00  0.28           N  
ATOM   5809  CA  SER B 309       5.512  14.986 -65.672  1.00  0.28           C  
ATOM   5810  C   SER B 309       5.310  14.646 -64.230  1.00  0.28           C  
ATOM   5811  O   SER B 309       4.341  15.007 -63.563  1.00  0.28           O  
ATOM   5812  CB  SER B 309       4.783  13.896 -66.497  1.00  0.28           C  
ATOM   5813  OG  SER B 309       3.405  13.702 -66.141  1.00  0.28           O  
ATOM   5814  N   LEU B 310       6.287  13.936 -63.688  1.00  0.28           N  
ATOM   5815  CA  LEU B 310       6.409  13.781 -62.287  1.00  0.28           C  
ATOM   5816  C   LEU B 310       6.700  15.106 -61.476  1.00  0.28           C  
ATOM   5817  O   LEU B 310       5.953  15.350 -60.532  1.00  0.28           O  
ATOM   5818  CB  LEU B 310       7.192  12.457 -62.062  1.00  0.28           C  
ATOM   5819  CG  LEU B 310       6.427  11.156 -62.427  1.00  0.28           C  
ATOM   5820  CD1 LEU B 310       7.354   9.939 -62.320  1.00  0.28           C  
ATOM   5821  CD2 LEU B 310       5.183  10.860 -61.570  1.00  0.28           C  
ATOM   5822  N   VAL B 311       7.601  16.103 -61.792  1.00  0.25           N  
ATOM   5823  CA  VAL B 311       7.370  17.474 -61.216  1.00  0.25           C  
ATOM   5824  C   VAL B 311       6.280  18.175 -62.059  1.00  0.25           C  
ATOM   5825  O   VAL B 311       6.395  19.333 -62.445  1.00  0.25           O  
ATOM   5826  CB  VAL B 311       8.471  18.562 -60.880  1.00  0.25           C  
ATOM   5827  CG1 VAL B 311       7.947  19.555 -59.828  1.00  0.25           C  
ATOM   5828  CG2 VAL B 311       9.787  18.206 -60.195  1.00  0.25           C  
ATOM   5829  N   LEU B 312       5.131  17.493 -62.318  1.00  0.26           N  
ATOM   5830  CA  LEU B 312       3.811  18.069 -62.127  1.00  0.26           C  
ATOM   5831  C   LEU B 312       2.817  17.233 -61.309  1.00  0.26           C  
ATOM   5832  O   LEU B 312       1.599  17.288 -61.494  1.00  0.26           O  
ATOM   5833  CB  LEU B 312       3.429  19.294 -63.015  1.00  0.26           C  
ATOM   5834  CG  LEU B 312       3.154  20.742 -62.457  1.00  0.26           C  
ATOM   5835  CD1 LEU B 312       4.278  21.768 -62.064  1.00  0.26           C  
ATOM   5836  CD2 LEU B 312       2.683  21.455 -63.673  1.00  0.26           C  
ATOM   5837  N   GLN B 313       3.337  16.495 -60.278  1.00  0.30           N  
ATOM   5838  CA  GLN B 313       2.579  15.686 -59.317  1.00  0.30           C  
ATOM   5839  C   GLN B 313       2.999  15.689 -57.786  1.00  0.30           C  
ATOM   5840  O   GLN B 313       2.353  15.007 -57.009  1.00  0.30           O  
ATOM   5841  CB  GLN B 313       2.567  14.233 -59.863  1.00  0.30           C  
ATOM   5842  CG  GLN B 313       1.489  13.990 -60.953  1.00  0.30           C  
ATOM   5843  CD  GLN B 313       1.727  12.719 -61.768  1.00  0.30           C  
ATOM   5844  OE1 GLN B 313       1.230  11.639 -61.426  1.00  0.30           O  
ATOM   5845  NE2 GLN B 313       2.498  12.829 -62.874  1.00  0.30           N  
ATOM   5846  N   CYS B 314       3.980  16.514 -57.272  1.00  0.22           N  
ATOM   5847  CA  CYS B 314       4.102  17.154 -55.870  1.00  0.22           C  
ATOM   5848  C   CYS B 314       3.625  18.667 -55.220  1.00  0.22           C  
ATOM   5849  O   CYS B 314       2.968  18.478 -54.234  1.00  0.22           O  
ATOM   5850  CB  CYS B 314       5.483  16.742 -55.332  1.00  0.22           C  
ATOM   5851  SG  CYS B 314       5.629  14.937 -55.261  1.00  0.22           S  
ATOM   5852  N   GLU B 315       3.633  20.142 -55.434  1.00  0.24           N  
ATOM   5853  CA  GLU B 315       4.177  21.536 -55.981  1.00  0.24           C  
ATOM   5854  C   GLU B 315       3.436  22.723 -55.405  1.00  0.24           C  
ATOM   5855  O   GLU B 315       4.110  23.669 -55.030  1.00  0.24           O  
ATOM   5856  CB  GLU B 315       4.439  22.265 -57.393  1.00  0.24           C  
ATOM   5857  CG  GLU B 315       5.802  22.247 -58.149  1.00  0.24           C  
ATOM   5858  CD  GLU B 315       6.009  23.369 -59.182  1.00  0.24           C  
ATOM   5859  OE1 GLU B 315       7.098  23.452 -59.797  1.00  0.24           O  
ATOM   5860  OE2 GLU B 315       5.102  24.225 -59.323  1.00  0.24           O  
ATOM   5861  N   LEU B 316       2.120  22.810 -55.371  1.00  0.23           N  
ATOM   5862  CA  LEU B 316       1.093  21.918 -55.849  1.00  0.23           C  
ATOM   5863  C   LEU B 316       0.584  21.215 -54.412  1.00  0.23           C  
ATOM   5864  O   LEU B 316      -0.352  21.765 -53.855  1.00  0.23           O  
ATOM   5865  CB  LEU B 316       1.222  21.537 -57.553  1.00  0.23           C  
ATOM   5866  CG  LEU B 316       0.518  20.884 -58.964  1.00  0.23           C  
ATOM   5867  CD1 LEU B 316       0.448  19.418 -59.594  1.00  0.23           C  
ATOM   5868  CD2 LEU B 316      -0.920  21.130 -59.383  1.00  0.23           C  
ATOM   5869  N   ALA B 317       1.051  20.105 -53.677  1.00  0.27           N  
ATOM   5870  CA  ALA B 317       0.518  19.639 -52.323  1.00  0.27           C  
ATOM   5871  C   ALA B 317       1.377  19.078 -51.079  1.00  0.27           C  
ATOM   5872  O   ALA B 317       1.567  17.870 -51.038  1.00  0.27           O  
ATOM   5873  CB  ALA B 317      -0.341  18.408 -52.686  1.00  0.27           C  
ATOM   5874  N   LEU B 318       1.902  19.686 -49.935  1.00  0.21           N  
ATOM   5875  CA  LEU B 318       2.055  21.009 -49.278  1.00  0.21           C  
ATOM   5876  C   LEU B 318       0.772  21.676 -48.876  1.00  0.21           C  
ATOM   5877  O   LEU B 318       0.450  21.779 -47.705  1.00  0.21           O  
ATOM   5878  CB  LEU B 318       3.029  21.025 -48.065  1.00  0.21           C  
ATOM   5879  CG  LEU B 318       4.544  21.178 -48.359  1.00  0.21           C  
ATOM   5880  CD1 LEU B 318       4.989  22.418 -49.137  1.00  0.21           C  
ATOM   5881  CD2 LEU B 318       5.446  21.036 -47.116  1.00  0.21           C  
ATOM   5882  N   GLY B 319       0.045  22.225 -49.852  1.00  0.22           N  
ATOM   5883  CA  GLY B 319      -0.943  23.237 -49.629  1.00  0.22           C  
ATOM   5884  C   GLY B 319      -2.375  22.906 -49.832  1.00  0.22           C  
ATOM   5885  O   GLY B 319      -3.207  23.619 -49.285  1.00  0.22           O  
ATOM   5886  N   PHE B 320      -2.781  21.873 -50.590  1.00  0.20           N  
ATOM   5887  CA  PHE B 320      -4.220  21.650 -50.663  1.00  0.20           C  
ATOM   5888  C   PHE B 320      -4.804  20.881 -49.471  1.00  0.20           C  
ATOM   5889  O   PHE B 320      -5.763  21.321 -48.850  1.00  0.20           O  
ATOM   5890  CB  PHE B 320      -4.621  21.096 -52.047  1.00  0.20           C  
ATOM   5891  CG  PHE B 320      -4.562  19.616 -52.172  1.00  0.20           C  
ATOM   5892  CD1 PHE B 320      -3.470  19.028 -52.778  1.00  0.20           C  
ATOM   5893  CD2 PHE B 320      -5.634  18.818 -51.773  1.00  0.20           C  
ATOM   5894  CE1 PHE B 320      -3.471  17.655 -53.074  1.00  0.20           C  
ATOM   5895  CE2 PHE B 320      -5.651  17.453 -52.070  1.00  0.20           C  
ATOM   5896  CZ  PHE B 320      -4.571  16.874 -52.734  1.00  0.20           C  
ATOM   5897  N   GLY B 321      -4.203  19.721 -49.129  1.00  0.25           N  
ATOM   5898  CA  GLY B 321      -4.711  18.760 -48.153  1.00  0.25           C  
ATOM   5899  C   GLY B 321      -4.618  17.343 -48.651  1.00  0.25           C  
ATOM   5900  O   GLY B 321      -5.486  16.548 -48.333  1.00  0.25           O  
ATOM   5901  N   GLY B 322      -3.576  16.943 -49.420  1.00  0.29           N  
ATOM   5902  CA  GLY B 322      -3.526  15.565 -49.935  1.00  0.29           C  
ATOM   5903  C   GLY B 322      -2.540  14.649 -49.295  1.00  0.29           C  
ATOM   5904  O   GLY B 322      -1.557  14.278 -49.924  1.00  0.29           O  
ATOM   5905  N   GLY B 323      -2.753  14.249 -48.027  1.00  0.30           N  
ATOM   5906  CA  GLY B 323      -1.746  13.533 -47.237  1.00  0.30           C  
ATOM   5907  C   GLY B 323      -1.596  12.067 -47.494  1.00  0.30           C  
ATOM   5908  O   GLY B 323      -0.719  11.428 -46.922  1.00  0.30           O  
ATOM   5909  N   ARG B 324      -2.432  11.476 -48.354  1.00  0.24           N  
ATOM   5910  CA  ARG B 324      -2.371  10.055 -48.627  1.00  0.24           C  
ATOM   5911  C   ARG B 324      -1.729   9.851 -49.965  1.00  0.24           C  
ATOM   5912  O   ARG B 324      -0.841   9.019 -50.124  1.00  0.24           O  
ATOM   5913  CB  ARG B 324      -3.804   9.516 -48.593  1.00  0.24           C  
ATOM   5914  CG  ARG B 324      -4.347   9.624 -47.161  1.00  0.24           C  
ATOM   5915  CD  ARG B 324      -5.816   9.265 -47.038  1.00  0.24           C  
ATOM   5916  NE  ARG B 324      -6.078   9.275 -45.564  1.00  0.24           N  
ATOM   5917  CZ  ARG B 324      -7.162   8.744 -44.988  1.00  0.24           C  
ATOM   5918  NH1 ARG B 324      -8.124   8.179 -45.710  1.00  0.24           N  
ATOM   5919  NH2 ARG B 324      -7.280   8.787 -43.664  1.00  0.24           N  
ATOM   5920  N   GLU B 325      -2.041  10.775 -50.888  1.00  0.33           N  
ATOM   5921  CA  GLU B 325      -1.393  11.006 -52.149  1.00  0.33           C  
ATOM   5922  C   GLU B 325       0.099  11.217 -51.950  1.00  0.33           C  
ATOM   5923  O   GLU B 325       0.916  10.787 -52.757  1.00  0.33           O  
ATOM   5924  CB  GLU B 325      -2.050  12.225 -52.860  1.00  0.33           C  
ATOM   5925  CG  GLU B 325      -3.602  12.139 -52.994  1.00  0.33           C  
ATOM   5926  CD  GLU B 325