CNRS Nantes University UFIP UFIP
home |  start a new run |  job status |  references&downloads |  examples |  help  

Should you encounter any unexpected behaviour,
please let us know.


***  p99  ***

elNémo ID: 21090706220163086

Job options:

ID        	=	 21090706220163086
JOBID     	=	 p99
USERID    	=	 ashgang72
PRIVAT    	=	 0

NMODES    	=	 5
DQMIN     	=	 -100
DQMAX     	=	 100
DQSTEP    	=	 20
DOGRAPHS  	=	 on

DOPROJMODS	=	 0
DORMSD    	=	 0

NRBL      	=	 0
CUTOFF    	=	 0
CAONLY    	=	 0


Input data for this run:

HEADER p99

TITLE     SWISS-MODEL SERVER (https://swissmodel.expasy.org)
TITLE    2 P99
EXPDTA    THEORETICAL MODEL (SWISS-MODEL SERVER)
AUTHOR    SWISS-MODEL SERVER (SEE REFERENCE IN JRNL Records)
REVDAT   1   07-SEP-21 1MOD    1       06:17
JRNL        AUTH   A.WATERHOUSE,M.BERTONI,S.BIENERT,G.STUDER,G.TAURIELLO,
JRNL        AUTH 2 R.GUMIENNY,F.T.HEER,T.A.P.DE BEER,C.REMPFER,L.BORDOLI,
JRNL        AUTH 3 R.LEPORE,T.SCHWEDE
JRNL        TITL   SWISS-MODEL: HOMOLOGY MODELLING OF PROTEIN STRUCTURES AND
JRNL        TITL 2 COMPLEXES
JRNL        REF    NUCLEIC.ACIDS.RES..           V.  46 W296  2018
JRNL        PMID   29788355
JRNL        DOI    10.1093/nar/gky427
REMARK   1
REMARK   1 REFERENCE 1
REMARK   1  AUTH   S.BIENERT,A.WATERHOUSE,T.A.P.DE BEER,G.TAURIELLO,G.STUDER,
REMARK   1  AUTH 2 L.BORDOLI,T.SCHWEDE
REMARK   1  TITL   THE SWISS-MODEL REPOSITORY - NEW FEATURES AND FUNCTIONALITY
REMARK   1  REF    NUCLEIC.ACIDS.RES..           V.  45       2017
REMARK   1  REFN                   ISSN 0305-1048
REMARK   1  PMID   27899672
REMARK   1  DOI    10.1093/nar/gkw1132
REMARK   1
REMARK   1 REFERENCE 2
REMARK   1  AUTH   N.GUEX,M.C.PEITSCH,T.SCHWEDE
REMARK   1  TITL   AUTOMATED COMPARATIVE PROTEIN STRUCTURE MODELING WITH
REMARK   1  TITL 2 SWISS-MODEL AND SWISS-PDBVIEWER: A HISTORICAL PERSPECTIVE
REMARK   1  REF    ELECTROPHORESIS               V.  30       2009
REMARK   1  REFN                   ISSN 0173-0835
REMARK   1  PMID   19517507
REMARK   1  DOI    10.1002/elps.200900140
REMARK   1
REMARK   1 REFERENCE 3
REMARK   1  AUTH   G.STUDER,G.TAURIELLO,S.BIENERT,M.BIASINI,N.JOHNER,T.SCHWEDE
REMARK   1  TITL   PROMOD3 - A VERSATILE HOMOLOGY MODELLING TOOLBOX
REMARK   1  REF    PLOS COMP. BIOL.              V.  17       2021
REMARK   1  REFN                   ISSN 
REMARK   1  PMID   33507980
REMARK   1  DOI    https://doi.org/10.1371/journal.pcbi.1008667
REMARK   1
REMARK   1 REFERENCE 4
REMARK   1  AUTH   G.STUDER,C.REMPFER,A.WATERHOUSE,R.GUMIENNY,J.HAAS,T.SCHWEDE
REMARK   1  TITL   QMEANDISCO - DISTANCE CONSTRAINTS APPLIED ON MODEL QUALITY 
REMARK   1  TITL 2 ESTIMATION
REMARK   1  REF    BIOINFORMATICS                V.  36       2020
REMARK   1  REFN                   ISSN 
REMARK   1  PMID   31697312
REMARK   1  DOI    https://doi.org/10.1093/bioinformatics/btz828
REMARK   1
REMARK   1 REFERENCE 5
REMARK   1  AUTH   P.BENKERT,M.BIASINI,T.SCHWEDE
REMARK   1  TITL   TOWARD THE ESTIMATION OF THE ABSOLUTE QUALITY OF INDIVIDUAL
REMARK   1  TITL 2 PROTEIN STRUCTURE MODELS
REMARK   1  REF    BIOINFORMATICS                V.  27       2011
REMARK   1  REFN                   ISSN 1367-4803
REMARK   1  PMID   21134891
REMARK   1  DOI    10.1093/bioinformatics/btq662
REMARK   1
REMARK   1 REFERENCE 6
REMARK   1  AUTH   M.BERTONI,F.KIEFER,M.BIASINI,L.BORDOLI,T.SCHWEDE
REMARK   1  TITL   MODELING PROTEIN QUATERNARY STRUCTURE OF HOMO- AND
REMARK   1  TITL 2 HETERO-OLIGOMERS BEYOND BINARY INTERACTIONS BY HOMOLOGY
REMARK   1  REF    SCI.REP.                      V.   7       2017
REMARK   1  REFN                   ISSN
REMARK   1  PMID   28874689
REMARK   1  DOI    10.1038/s41598-017-09654-8
REMARK   1
REMARK   1 DISCLAIMER
REMARK   1 The SWISS-MODEL SERVER produces theoretical models for proteins.
REMARK   1 The results of any theoretical modelling procedure is
REMARK   1 NON-EXPERIMENTAL and MUST be considered with care. These models may
REMARK   1 contain significant errors. This is especially true for automated
REMARK   1 modeling since there is no human intervention during model
REMARK   1 building. Please read the header section and the logfile carefully
REMARK   1 to know what templates and alignments were used during the model
REMARK   1 building process. All information by the SWISS-MODEL SERVER is
REMARK   1 provided "AS-IS", without any warranty, expressed or implied.
REMARK   2
REMARK   2 COPYRIGHT NOTICE
REMARK   2 This SWISS-MODEL protein model is copyright. It is produced by the
REMARK   2 SWISS-MODEL server, developed by the Computational Structural
REMARK   2 Biology Group at the SIB Swiss Institute of Bioinformatics at the
REMARK   2 Biozentrum, University of Basel (https://swissmodel.expasy.org). This
REMARK   2 model is licensed under the CC BY-SA 4.0 Creative Commons
REMARK   2 Attribution-ShareAlike 4.0 International License
REMARK   2 (https://creativecommons.org/licenses/by-sa/4.0/legalcode), i.e. you
REMARK   2 can copy and redistribute the model in any medium or format,
REMARK   2 transform and build upon the model for any purpose, even
REMARK   2 commercially, under the following terms:
REMARK   2 Attribution - You must give appropriate credit, provide a link to
REMARK   2 the license, and indicate if changes were made. You may do so in any
REMARK   2 reasonable manner, but not in any way that suggests the licensor
REMARK   2 endorses you or your use. When you publish, patent or distribute
REMARK   2 results that were fully or partially based on the model, please cite
REMARK   2 the corresponding papers mentioned under JRNL.
REMARK   2 ShareAlike - If you remix, transform, or build upon the material,
REMARK   2 you must distribute your contributions under the same license as the
REMARK   2 original.
REMARK   2 No additional restrictions - you may not apply legal terms or
REMARK   2 technological measures that legally restrict others from doing
REMARK   2 anything the license permits.
REMARK   2 Find a human-readable summary of (and not a substitute for) the
REMARK   2 CC BY-SA 4.0 license at this link:
REMARK   2 https://creativecommons.org/licenses/by-sa/4.0/
REMARK   3 
REMARK   3 MODEL INFORMATION
REMARK   3  ENGIN   PROMOD3
REMARK   3  VERSN   3.2.0
REMARK   3  OSTAT   monomer
REMARK   3  OSRSN   PREDICTION
REMARK   3  QSPRD   0.000
REMARK   3  GMQE    0.95
REMARK   3  QMNV    4.2.0
REMARK   3  QMNDG   0.90
REMARK   3  MODT    FALSE
REMARK   3 
REMARK   3 TEMPLATE 1
REMARK   3  PDBID   4xux
REMARK   3  CHAIN   A
REMARK   3  MMCIF   A
REMARK   3  PDBV    2021-08-27
REMARK   3  SMTLE   4xux.1.A
REMARK   3  SMTLV   2021-09-01
REMARK   3  MTHD    X-RAY DIFFRACTION 1.75 A
REMARK   3  FOUND   BLAST
REMARK   3  GMQE    0.96
REMARK   3  SIM     0.62
REMARK   3  SID     100.00
REMARK   3  OSTAT   monomer
REMARK   3  LIGND   4D6
REMARK   3  ALN A TRG TPVSEKQLAEVVANTITPLMKAQSVPGMAVAVIYQGKPHYYTFGKADIAANKPVTPQT
REMARK   3  ALN A TRG LFELGSISKTFTGVLGGDAIARGEISLDDAVTRYWPQLTGKQWQGIRMLDLATYTAGG
REMARK   3  ALN A TRG LPLQVPDEVTDNASLLRFYQNWQPQWKPGTTRLYANASIGLFGALAVKPSGMPYEQAM
REMARK   3  ALN A TRG TTRVLKPLKLDHTWINVPKAEEAHYAWGYRDGKAVRVSPGMLDAQAYGVKTNVQDMAN
REMARK   3  ALN A TRG WVMANMAPENVADASLKQGIALAQSRYWRIGSMYQGLGWEMLNWPVEANTVVEGSDSK
REMARK   3  ALN A TRG VALAPLPVAEVNPPAPPVKASWVHKTGSTGGFGSYVAFIPEKQIGIVMLANTSYPNPA
REMARK   3  ALN A TRG RVEAAYHILEALQ
REMARK   3  ALN A TPL TPVSEKQLAEVVANTITPLMKAQSVPGMAVAVIYQGKPHYYTFGKADIAANKPVTPQT
REMARK   3  ALN A TPL LFELGSISKTFTGVLGGDAIARGEISLDDAVTRYWPQLTGKQWQGIRMLDLATYTAGG
REMARK   3  ALN A TPL LPLQVPDEVTDNASLLRFYQNWQPQWKPGTTRLYANASIGLFGALAVKPSGMPYEQAM
REMARK   3  ALN A TPL TTRVLKPLKLDHTWINVPKAEEAHYAWGYRDGKAVRVSPGMLDAQAYGVKTNVQDMAN
REMARK   3  ALN A TPL WVMANMAPENVADASLKQGIALAQSRYWRIGSMYQGLGWEMLNWPVEANTVVEGSDSK
REMARK   3  ALN A TPL VALAPLPVAEVNPPAPPVKASWVHKTGSTGGFGSYVAFIPEKQIGIVMLANTSYPNPA
REMARK   3  ALN A TPL RVEAAYHILEALQ
REMARK   3  ALN A OFF 2
ATOM      1  N   PRO A   2      34.774   2.186   4.789  1.00  0.80           N  
ATOM      2  CA  PRO A   2      36.267   2.290   4.932  1.00  0.80           C  
ATOM      3  C   PRO A   2      36.633   3.530   5.727  1.00  0.80           C  
ATOM      4  O   PRO A   2      37.689   4.090   5.467  1.00  0.80           O  
ATOM      5  CB  PRO A   2      36.684   2.438   3.462  1.00  0.80           C  
ATOM      6  CG  PRO A   2      35.623   3.385   2.875  1.00  0.80           C  
ATOM      7  CD  PRO A   2      34.324   3.040   3.623  1.00  0.80           C  
ATOM      8  N   VAL A   3      35.804   4.004   6.677  1.00  0.82           N  
ATOM      9  CA  VAL A   3      36.068   5.256   7.369  1.00  0.82           C  
ATOM     10  C   VAL A   3      36.722   4.986   8.706  1.00  0.82           C  
ATOM     11  O   VAL A   3      36.247   4.160   9.483  1.00  0.82           O  
ATOM     12  CB  VAL A   3      34.774   6.025   7.587  1.00  0.82           C  
ATOM     13  CG1 VAL A   3      35.019   7.373   8.288  1.00  0.82           C  
ATOM     14  CG2 VAL A   3      34.109   6.269   6.223  1.00  0.82           C  
ATOM     15  N   SER A   4      37.847   5.661   9.002  1.00  0.81           N  
ATOM     16  CA  SER A   4      38.520   5.533  10.284  1.00  0.81           C  
ATOM     17  C   SER A   4      37.886   6.392  11.366  1.00  0.81           C  
ATOM     18  O   SER A   4      37.167   7.349  11.086  1.00  0.81           O  
ATOM     19  CB  SER A   4      40.041   5.854  10.179  1.00  0.81           C  
ATOM     20  OG  SER A   4      40.325   7.258  10.112  1.00  0.81           O  
ATOM     21  N   GLU A   5      38.193   6.096  12.650  1.00  0.78           N  
ATOM     22  CA  GLU A   5      37.766   6.887  13.801  1.00  0.78           C  
ATOM     23  C   GLU A   5      38.202   8.351  13.674  1.00  0.78           C  
ATOM     24  O   GLU A   5      37.436   9.279  13.920  1.00  0.78           O  
ATOM     25  CB  GLU A   5      38.382   6.304  15.105  1.00  0.78           C  
ATOM     26  CG  GLU A   5      37.859   4.895  15.536  1.00  0.78           C  
ATOM     27  CD  GLU A   5      36.755   4.854  16.608  1.00  0.78           C  
ATOM     28  OE1 GLU A   5      36.378   5.936  17.111  1.00  0.78           O  
ATOM     29  OE2 GLU A   5      36.334   3.714  16.977  1.00  0.78           O  
ATOM     30  N   LYS A   6      39.448   8.589  13.201  1.00  0.83           N  
ATOM     31  CA  LYS A   6      39.963   9.922  12.932  1.00  0.83           C  
ATOM     32  C   LYS A   6      39.187  10.666  11.857  1.00  0.83           C  
ATOM     33  O   LYS A   6      38.755  11.794  12.069  1.00  0.83           O  
ATOM     34  CB  LYS A   6      41.463   9.845  12.530  1.00  0.83           C  
ATOM     35  CG  LYS A   6      42.092  11.214  12.216  1.00  0.83           C  
ATOM     36  CD  LYS A   6      43.631  11.246  12.245  1.00  0.83           C  
ATOM     37  CE  LYS A   6      44.299  10.450  11.124  1.00  0.83           C  
ATOM     38  NZ  LYS A   6      45.768  10.593  11.235  1.00  0.83           N  
ATOM     39  N   GLN A   7      38.915  10.016  10.707  1.00  0.77           N  
ATOM     40  CA  GLN A   7      38.145  10.608   9.626  1.00  0.77           C  
ATOM     41  C   GLN A   7      36.715  10.937  10.029  1.00  0.77           C  
ATOM     42  O   GLN A   7      36.193  12.005   9.719  1.00  0.77           O  
ATOM     43  CB  GLN A   7      38.122   9.657   8.407  1.00  0.77           C  
ATOM     44  CG  GLN A   7      39.494   9.564   7.704  1.00  0.77           C  
ATOM     45  CD  GLN A   7      39.542   8.386   6.734  1.00  0.77           C  
ATOM     46  OE1 GLN A   7      38.947   7.330   6.961  1.00  0.77           O  
ATOM     47  NE2 GLN A   7      40.315   8.539   5.636  1.00  0.77           N  
ATOM     48  N   LEU A   8      36.038  10.041  10.777  1.00  0.84           N  
ATOM     49  CA  LEU A   8      34.719  10.326  11.316  1.00  0.84           C  
ATOM     50  C   LEU A   8      34.714  11.493  12.294  1.00  0.84           C  
ATOM     51  O   LEU A   8      33.877  12.392  12.204  1.00  0.84           O  
ATOM     52  CB  LEU A   8      34.116   9.062  11.974  1.00  0.84           C  
ATOM     53  CG  LEU A   8      32.696   9.232  12.560  1.00  0.84           C  
ATOM     54  CD1 LEU A   8      31.696   9.818  11.552  1.00  0.84           C  
ATOM     55  CD2 LEU A   8      32.187   7.894  13.120  1.00  0.84           C  
ATOM     56  N   ALA A   9      35.699  11.552  13.210  1.00  0.89           N  
ATOM     57  CA  ALA A   9      35.855  12.653  14.135  1.00  0.89           C  
ATOM     58  C   ALA A   9      36.073  13.998  13.449  1.00  0.89           C  
ATOM     59  O   ALA A   9      35.454  15.001  13.811  1.00  0.89           O  
ATOM     60  CB  ALA A   9      37.024  12.340  15.084  1.00  0.89           C  
ATOM     61  N   GLU A  10      36.912  14.028  12.393  1.00  0.82           N  
ATOM     62  CA  GLU A  10      37.114  15.188  11.544  1.00  0.82           C  
ATOM     63  C   GLU A  10      35.839  15.642  10.838  1.00  0.82           C  
ATOM     64  O   GLU A  10      35.492  16.820  10.872  1.00  0.82           O  
ATOM     65  CB  GLU A  10      38.210  14.894  10.484  1.00  0.82           C  
ATOM     66  CG  GLU A  10      39.646  14.767  11.068  1.00  0.82           C  
ATOM     67  CD  GLU A  10      40.657  14.123  10.111  1.00  0.82           C  
ATOM     68  OE1 GLU A  10      40.274  13.748   8.973  1.00  0.82           O  
ATOM     69  OE2 GLU A  10      41.836  13.968  10.535  1.00  0.82           O  
ATOM     70  N   VAL A  11      35.048  14.730  10.227  1.00  0.86           N  
ATOM     71  CA  VAL A  11      33.777  15.104   9.603  1.00  0.86           C  
ATOM     72  C   VAL A  11      32.753  15.627  10.605  1.00  0.86           C  
ATOM     73  O   VAL A  11      32.068  16.615  10.347  1.00  0.86           O  
ATOM     74  CB  VAL A  11      33.155  13.992   8.760  1.00  0.86           C  
ATOM     75  CG1 VAL A  11      31.849  14.469   8.087  1.00  0.86           C  
ATOM     76  CG2 VAL A  11      34.134  13.582   7.646  1.00  0.86           C  
ATOM     77  N   VAL A  12      32.627  15.016  11.802  1.00  0.89           N  
ATOM     78  CA  VAL A  12      31.746  15.542  12.842  1.00  0.89           C  
ATOM     79  C   VAL A  12      32.170  16.929  13.316  1.00  0.89           C  
ATOM     80  O   VAL A  12      31.354  17.848  13.356  1.00  0.89           O  
ATOM     81  CB  VAL A  12      31.613  14.584  14.026  1.00  0.89           C  
ATOM     82  CG1 VAL A  12      30.760  15.194  15.157  1.00  0.89           C  
ATOM     83  CG2 VAL A  12      30.935  13.287  13.548  1.00  0.89           C  
ATOM     84  N   ALA A  13      33.467  17.152  13.612  1.00  0.89           N  
ATOM     85  CA  ALA A  13      33.970  18.452  14.026  1.00  0.89           C  
ATOM     86  C   ALA A  13      33.817  19.544  12.969  1.00  0.89           C  
ATOM     87  O   ALA A  13      33.377  20.657  13.257  1.00  0.89           O  
ATOM     88  CB  ALA A  13      35.446  18.320  14.440  1.00  0.89           C  
ATOM     89  N   ASN A  14      34.121  19.220  11.698  1.00  0.83           N  
ATOM     90  CA  ASN A  14      34.031  20.140  10.578  1.00  0.83           C  
ATOM     91  C   ASN A  14      32.596  20.520  10.236  1.00  0.83           C  
ATOM     92  O   ASN A  14      32.356  21.566   9.644  1.00  0.83           O  
ATOM     93  CB  ASN A  14      34.693  19.536   9.310  1.00  0.83           C  
ATOM     94  CG  ASN A  14      36.206  19.433   9.481  1.00  0.83           C  
ATOM     95  OD1 ASN A  14      36.817  20.009  10.380  1.00  0.83           O  
ATOM     96  ND2 ASN A  14      36.856  18.691   8.552  1.00  0.83           N  
ATOM     97  N   THR A  15      31.603  19.689  10.600  1.00  0.87           N  
ATOM     98  CA  THR A  15      30.189  19.999  10.400  1.00  0.87           C  
ATOM     99  C   THR A  15      29.572  20.707  11.591  1.00  0.87           C  
ATOM    100  O   THR A  15      28.897  21.728  11.459  1.00  0.87           O  
ATOM    101  CB  THR A  15      29.379  18.739  10.142  1.00  0.87           C  
ATOM    102  OG1 THR A  15      29.916  18.061   9.022  1.00  0.87           O  
ATOM    103  CG2 THR A  15      27.921  19.048   9.789  1.00  0.87           C  
ATOM    104  N   ILE A  16      29.778  20.180  12.814  1.00  0.87           N  
ATOM    105  CA  ILE A  16      29.170  20.698  14.034  1.00  0.87           C  
ATOM    106  C   ILE A  16      29.711  22.058  14.465  1.00  0.87           C  
ATOM    107  O   ILE A  16      28.945  22.949  14.828  1.00  0.87           O  
ATOM    108  CB  ILE A  16      29.242  19.663  15.157  1.00  0.87           C  
ATOM    109  CG1 ILE A  16      28.472  18.364  14.792  1.00  0.87           C  
ATOM    110  CG2 ILE A  16      28.723  20.239  16.490  1.00  0.87           C  
ATOM    111  CD1 ILE A  16      26.955  18.521  14.605  1.00  0.87           C  
ATOM    112  N   THR A  17      31.037  22.290  14.396  1.00  0.83           N  
ATOM    113  CA  THR A  17      31.647  23.570  14.780  1.00  0.83           C  
ATOM    114  C   THR A  17      31.156  24.774  13.973  1.00  0.83           C  
ATOM    115  O   THR A  17      30.784  25.773  14.597  1.00  0.83           O  
ATOM    116  CB  THR A  17      33.175  23.493  14.801  1.00  0.83           C  
ATOM    117  OG1 THR A  17      33.573  22.526  15.764  1.00  0.83           O  
ATOM    118  CG2 THR A  17      33.833  24.821  15.202  1.00  0.83           C  
ATOM    119  N   PRO A  18      31.038  24.790  12.639  1.00  0.87           N  
ATOM    120  CA  PRO A  18      30.359  25.874  11.936  1.00  0.87           C  
ATOM    121  C   PRO A  18      28.879  25.964  12.239  1.00  0.87           C  
ATOM    122  O   PRO A  18      28.356  27.075  12.297  1.00  0.87           O  
ATOM    123  CB  PRO A  18      30.576  25.597  10.440  1.00  0.87           C  
ATOM    124  CG  PRO A  18      31.718  24.582  10.369  1.00  0.87           C  
ATOM    125  CD  PRO A  18      31.683  23.859  11.713  1.00  0.87           C  
ATOM    126  N   LEU A  19      28.174  24.827  12.416  1.00  0.89           N  
ATOM    127  CA  LEU A  19      26.749  24.814  12.705  1.00  0.89           C  
ATOM    128  C   LEU A  19      26.413  25.517  14.006  1.00  0.89           C  
ATOM    129  O   LEU A  19      25.527  26.368  14.059  1.00  0.89           O  
ATOM    130  CB  LEU A  19      26.239  23.352  12.769  1.00  0.89           C  
ATOM    131  CG  LEU A  19      24.750  23.154  13.124  1.00  0.89           C  
ATOM    132  CD1 LEU A  19      23.824  23.687  12.022  1.00  0.89           C  
ATOM    133  CD2 LEU A  19      24.468  21.671  13.401  1.00  0.89           C  
ATOM    134  N   MET A  20      27.168  25.226  15.080  1.00  0.87           N  
ATOM    135  CA  MET A  20      27.004  25.874  16.364  1.00  0.87           C  
ATOM    136  C   MET A  20      27.274  27.363  16.312  1.00  0.87           C  
ATOM    137  O   MET A  20      26.543  28.155  16.904  1.00  0.87           O  
ATOM    138  CB  MET A  20      27.911  25.226  17.429  1.00  0.87           C  
ATOM    139  CG  MET A  20      27.489  23.788  17.767  1.00  0.87           C  
ATOM    140  SD  MET A  20      28.582  22.968  18.951  1.00  0.87           S  
ATOM    141  CE  MET A  20      28.115  23.911  20.427  1.00  0.87           C  
ATOM    142  N   LYS A  21      28.316  27.782  15.564  1.00  0.81           N  
ATOM    143  CA  LYS A  21      28.610  29.185  15.342  1.00  0.81           C  
ATOM    144  C   LYS A  21      27.521  29.929  14.582  1.00  0.81           C  
ATOM    145  O   LYS A  21      27.098  31.011  14.976  1.00  0.81           O  
ATOM    146  CB  LYS A  21      29.946  29.329  14.567  1.00  0.81           C  
ATOM    147  CG  LYS A  21      30.423  30.784  14.440  1.00  0.81           C  
ATOM    148  CD  LYS A  21      31.696  30.932  13.597  1.00  0.81           C  
ATOM    149  CE  LYS A  21      32.050  32.407  13.389  1.00  0.81           C  
ATOM    150  NZ  LYS A  21      33.510  32.569  13.232  1.00  0.81           N  
ATOM    151  N   ALA A  22      27.021  29.350  13.474  1.00  0.90           N  
ATOM    152  CA  ALA A  22      25.993  29.950  12.650  1.00  0.90           C  
ATOM    153  C   ALA A  22      24.642  30.067  13.337  1.00  0.90           C  
ATOM    154  O   ALA A  22      23.896  31.019  13.128  1.00  0.90           O  
ATOM    155  CB  ALA A  22      25.855  29.137  11.350  1.00  0.90           C  
ATOM    156  N   GLN A  23      24.294  29.071  14.165  1.00  0.87           N  
ATOM    157  CA  GLN A  23      22.984  28.981  14.775  1.00  0.87           C  
ATOM    158  C   GLN A  23      22.964  29.401  16.235  1.00  0.87           C  
ATOM    159  O   GLN A  23      21.951  29.237  16.914  1.00  0.87           O  
ATOM    160  CB  GLN A  23      22.486  27.522  14.672  1.00  0.87           C  
ATOM    161  CG  GLN A  23      22.379  26.983  13.227  1.00  0.87           C  
ATOM    162  CD  GLN A  23      21.351  27.739  12.391  1.00  0.87           C  
ATOM    163  OE1 GLN A  23      20.378  28.310  12.881  1.00  0.87           O  
ATOM    164  NE2 GLN A  23      21.540  27.709  11.052  1.00  0.87           N  
ATOM    165  N   SER A  24      24.082  29.945  16.760  1.00  0.83           N  
ATOM    166  CA  SER A  24      24.221  30.399  18.145  1.00  0.83           C  
ATOM    167  C   SER A  24      23.896  29.338  19.183  1.00  0.83           C  
ATOM    168  O   SER A  24      23.087  29.536  20.092  1.00  0.83           O  
ATOM    169  CB  SER A  24      23.418  31.684  18.467  1.00  0.83           C  
ATOM    170  OG  SER A  24      23.907  32.781  17.697  1.00  0.83           O  
ATOM    171  N   VAL A  25      24.524  28.158  19.060  1.00  0.92           N  
ATOM    172  CA  VAL A  25      24.234  27.011  19.905  1.00  0.92           C  
ATOM    173  C   VAL A  25      25.281  26.890  21.007  1.00  0.92           C  
ATOM    174  O   VAL A  25      26.460  26.734  20.682  1.00  0.92           O  
ATOM    175  CB  VAL A  25      24.196  25.714  19.111  1.00  0.92           C  
ATOM    176  CG1 VAL A  25      23.813  24.533  20.017  1.00  0.92           C  
ATOM    177  CG2 VAL A  25      23.179  25.834  17.962  1.00  0.92           C  
ATOM    178  N   PRO A  26      24.958  26.944  22.306  1.00  0.93           N  
ATOM    179  CA  PRO A  26      25.975  26.913  23.350  1.00  0.93           C  
ATOM    180  C   PRO A  26      26.635  25.565  23.497  1.00  0.93           C  
ATOM    181  O   PRO A  26      27.835  25.511  23.757  1.00  0.93           O  
ATOM    182  CB  PRO A  26      25.212  27.274  24.637  1.00  0.93           C  
ATOM    183  CG  PRO A  26      24.024  28.097  24.146  1.00  0.93           C  
ATOM    184  CD  PRO A  26      23.678  27.432  22.823  1.00  0.93           C  
ATOM    185  N   GLY A  27      25.864  24.471  23.393  1.00  0.95           N  
ATOM    186  CA  GLY A  27      26.353  23.128  23.619  1.00  0.95           C  
ATOM    187  C   GLY A  27      25.651  22.112  22.768  1.00  0.95           C  
ATOM    188  O   GLY A  27      24.456  22.203  22.495  1.00  0.95           O  
ATOM    189  N   MET A  28      26.391  21.069  22.357  1.00  0.93           N  
ATOM    190  CA  MET A  28      25.837  19.959  21.612  1.00  0.93           C  
ATOM    191  C   MET A  28      26.458  18.655  22.056  1.00  0.93           C  
ATOM    192  O   MET A  28      27.644  18.570  22.375  1.00  0.93           O  
ATOM    193  CB  MET A  28      26.040  20.058  20.075  1.00  0.93           C  
ATOM    194  CG  MET A  28      25.170  21.142  19.415  1.00  0.93           C  
ATOM    195  SD  MET A  28      25.127  21.121  17.594  1.00  0.93           S  
ATOM    196  CE  MET A  28      24.284  19.535  17.338  1.00  0.93           C  
ATOM    197  N   ALA A  29      25.650  17.583  22.064  1.00  0.96           N  
ATOM    198  CA  ALA A  29      26.127  16.233  22.228  1.00  0.96           C  
ATOM    199  C   ALA A  29      25.697  15.437  21.015  1.00  0.96           C  
ATOM    200  O   ALA A  29      24.530  15.432  20.623  1.00  0.96           O  
ATOM    201  CB  ALA A  29      25.570  15.589  23.504  1.00  0.96           C  
ATOM    202  N   VAL A  30      26.663  14.773  20.367  1.00  0.95           N  
ATOM    203  CA  VAL A  30      26.458  14.054  19.131  1.00  0.95           C  
ATOM    204  C   VAL A  30      26.873  12.616  19.344  1.00  0.95           C  
ATOM    205  O   VAL A  30      27.912  12.328  19.936  1.00  0.95           O  
ATOM    206  CB  VAL A  30      27.241  14.676  17.974  1.00  0.95           C  
ATOM    207  CG1 VAL A  30      27.134  13.845  16.677  1.00  0.95           C  
ATOM    208  CG2 VAL A  30      26.700  16.096  17.724  1.00  0.95           C  
ATOM    209  N   ALA A  31      26.061  11.661  18.860  1.00  0.96           N  
ATOM    210  CA  ALA A  31      26.470  10.282  18.753  1.00  0.96           C  
ATOM    211  C   ALA A  31      26.315   9.855  17.318  1.00  0.96           C  
ATOM    212  O   ALA A  31      25.304  10.132  16.680  1.00  0.96           O  
ATOM    213  CB  ALA A  31      25.653   9.338  19.650  1.00  0.96           C  
ATOM    214  N   VAL A  32      27.320   9.160  16.772  1.00  0.94           N  
ATOM    215  CA  VAL A  32      27.220   8.551  15.461  1.00  0.94           C  
ATOM    216  C   VAL A  32      27.285   7.063  15.686  1.00  0.94           C  
ATOM    217  O   VAL A  32      28.129   6.577  16.433  1.00  0.94           O  
ATOM    218  CB  VAL A  32      28.331   8.988  14.516  1.00  0.94           C  
ATOM    219  CG1 VAL A  32      28.174   8.308  13.143  1.00  0.94           C  
ATOM    220  CG2 VAL A  32      28.275  10.516  14.340  1.00  0.94           C  
ATOM    221  N   ILE A  33      26.370   6.298  15.071  1.00  0.92           N  
ATOM    222  CA  ILE A  33      26.339   4.851  15.166  1.00  0.92           C  
ATOM    223  C   ILE A  33      26.951   4.310  13.900  1.00  0.92           C  
ATOM    224  O   ILE A  33      26.474   4.584  12.801  1.00  0.92           O  
ATOM    225  CB  ILE A  33      24.935   4.277  15.315  1.00  0.92           C  
ATOM    226  CG1 ILE A  33      24.136   4.968  16.445  1.00  0.92           C  
ATOM    227  CG2 ILE A  33      25.022   2.749  15.534  1.00  0.92           C  
ATOM    228  CD1 ILE A  33      24.824   4.948  17.811  1.00  0.92           C  
ATOM    229  N   TYR A  34      28.061   3.568  14.025  1.00  0.88           N  
ATOM    230  CA  TYR A  34      28.779   3.061  12.879  1.00  0.88           C  
ATOM    231  C   TYR A  34      29.499   1.801  13.313  1.00  0.88           C  
ATOM    232  O   TYR A  34      30.095   1.750  14.388  1.00  0.88           O  
ATOM    233  CB  TYR A  34      29.748   4.164  12.373  1.00  0.88           C  
ATOM    234  CG  TYR A  34      30.613   3.796  11.193  1.00  0.88           C  
ATOM    235  CD1 TYR A  34      30.096   3.363   9.956  1.00  0.88           C  
ATOM    236  CD2 TYR A  34      31.997   3.954  11.327  1.00  0.88           C  
ATOM    237  CE1 TYR A  34      30.962   3.065   8.884  1.00  0.88           C  
ATOM    238  CE2 TYR A  34      32.859   3.652  10.269  1.00  0.88           C  
ATOM    239  CZ  TYR A  34      32.350   3.193   9.051  1.00  0.88           C  
ATOM    240  OH  TYR A  34      33.292   2.835   8.060  1.00  0.88           O  
ATOM    241  N   GLN A  35      29.431   0.735  12.487  1.00  0.71           N  
ATOM    242  CA  GLN A  35      30.086  -0.546  12.728  1.00  0.71           C  
ATOM    243  C   GLN A  35      29.697  -1.219  14.040  1.00  0.71           C  
ATOM    244  O   GLN A  35      30.512  -1.833  14.722  1.00  0.71           O  
ATOM    245  CB  GLN A  35      31.627  -0.459  12.581  1.00  0.71           C  
ATOM    246  CG  GLN A  35      32.055   0.211  11.253  1.00  0.71           C  
ATOM    247  CD  GLN A  35      33.266  -0.431  10.578  1.00  0.71           C  
ATOM    248  OE1 GLN A  35      34.322   0.177  10.409  1.00  0.71           O  
ATOM    249  NE2 GLN A  35      33.092  -1.689  10.114  1.00  0.71           N  
ATOM    250  N   GLY A  36      28.402  -1.127  14.404  1.00  0.74           N  
ATOM    251  CA  GLY A  36      27.845  -1.771  15.589  1.00  0.74           C  
ATOM    252  C   GLY A  36      28.074  -1.072  16.902  1.00  0.74           C  
ATOM    253  O   GLY A  36      27.686  -1.594  17.942  1.00  0.74           O  
ATOM    254  N   LYS A  37      28.688   0.127  16.912  1.00  0.82           N  
ATOM    255  CA  LYS A  37      28.964   0.823  18.158  1.00  0.82           C  
ATOM    256  C   LYS A  37      28.661   2.315  18.067  1.00  0.82           C  
ATOM    257  O   LYS A  37      28.680   2.891  16.973  1.00  0.82           O  
ATOM    258  CB  LYS A  37      30.430   0.600  18.629  1.00  0.82           C  
ATOM    259  CG  LYS A  37      31.512   1.216  17.726  1.00  0.82           C  
ATOM    260  CD  LYS A  37      32.950   0.882  18.176  1.00  0.82           C  
ATOM    261  CE  LYS A  37      33.624   2.006  18.980  1.00  0.82           C  
ATOM    262  NZ  LYS A  37      35.008   1.632  19.353  1.00  0.82           N  
ATOM    263  N   PRO A  38      28.355   2.980  19.182  1.00  0.92           N  
ATOM    264  CA  PRO A  38      28.237   4.423  19.217  1.00  0.92           C  
ATOM    265  C   PRO A  38      29.579   5.102  19.389  1.00  0.92           C  
ATOM    266  O   PRO A  38      30.451   4.627  20.116  1.00  0.92           O  
ATOM    267  CB  PRO A  38      27.337   4.679  20.430  1.00  0.92           C  
ATOM    268  CG  PRO A  38      27.673   3.544  21.399  1.00  0.92           C  
ATOM    269  CD  PRO A  38      28.014   2.374  20.476  1.00  0.92           C  
ATOM    270  N   HIS A  39      29.733   6.245  18.714  1.00  0.90           N  
ATOM    271  CA  HIS A  39      30.897   7.096  18.776  1.00  0.90           C  
ATOM    272  C   HIS A  39      30.432   8.463  19.246  1.00  0.90           C  
ATOM    273  O   HIS A  39      29.538   9.047  18.633  1.00  0.90           O  
ATOM    274  CB  HIS A  39      31.513   7.237  17.370  1.00  0.90           C  
ATOM    275  CG  HIS A  39      31.809   5.913  16.717  1.00  0.90           C  
ATOM    276  ND1 HIS A  39      33.105   5.469  16.694  1.00  0.90           N  
ATOM    277  CD2 HIS A  39      31.006   5.018  16.082  1.00  0.90           C  
ATOM    278  CE1 HIS A  39      33.087   4.323  16.048  1.00  0.90           C  
ATOM    279  NE2 HIS A  39      31.832   3.999  15.653  1.00  0.90           N  
ATOM    280  N   TYR A  40      30.990   9.002  20.351  1.00  0.92           N  
ATOM    281  CA  TYR A  40      30.425  10.159  21.036  1.00  0.92           C  
ATOM    282  C   TYR A  40      31.290  11.396  20.916  1.00  0.92           C  
ATOM    283  O   TYR A  40      32.503  11.361  21.107  1.00  0.92           O  
ATOM    284  CB  TYR A  40      30.253   9.923  22.560  1.00  0.92           C  
ATOM    285  CG  TYR A  40      29.278   8.822  22.844  1.00  0.92           C  
ATOM    286  CD1 TYR A  40      27.906   9.015  22.620  1.00  0.92           C  
ATOM    287  CD2 TYR A  40      29.720   7.599  23.373  1.00  0.92           C  
ATOM    288  CE1 TYR A  40      26.990   7.996  22.915  1.00  0.92           C  
ATOM    289  CE2 TYR A  40      28.807   6.575  23.659  1.00  0.92           C  
ATOM    290  CZ  TYR A  40      27.443   6.777  23.430  1.00  0.92           C  
ATOM    291  OH  TYR A  40      26.524   5.750  23.706  1.00  0.92           O  
ATOM    292  N   TYR A  41      30.651  12.541  20.618  1.00  0.91           N  
ATOM    293  CA  TYR A  41      31.330  13.805  20.427  1.00  0.91           C  
ATOM    294  C   TYR A  41      30.577  14.876  21.196  1.00  0.91           C  
ATOM    295  O   TYR A  41      29.365  15.030  21.047  1.00  0.91           O  
ATOM    296  CB  TYR A  41      31.389  14.206  18.930  1.00  0.91           C  
ATOM    297  CG  TYR A  41      31.908  13.072  18.087  1.00  0.91           C  
ATOM    298  CD1 TYR A  41      33.289  12.885  17.928  1.00  0.91           C  
ATOM    299  CD2 TYR A  41      31.019  12.165  17.476  1.00  0.91           C  
ATOM    300  CE1 TYR A  41      33.774  11.808  17.176  1.00  0.91           C  
ATOM    301  CE2 TYR A  41      31.506  11.087  16.724  1.00  0.91           C  
ATOM    302  CZ  TYR A  41      32.886  10.913  16.577  1.00  0.91           C  
ATOM    303  OH  TYR A  41      33.412   9.839  15.841  1.00  0.91           O  
ATOM    304  N   THR A  42      31.263  15.637  22.065  1.00  0.92           N  
ATOM    305  CA  THR A  42      30.631  16.665  22.885  1.00  0.92           C  
ATOM    306  C   THR A  42      31.270  18.009  22.645  1.00  0.92           C  
ATOM    307  O   THR A  42      32.472  18.137  22.429  1.00  0.92           O  
ATOM    308  CB  THR A  42      30.619  16.388  24.382  1.00  0.92           C  
ATOM    309  OG1 THR A  42      31.908  16.046  24.877  1.00  0.92           O  
ATOM    310  CG2 THR A  42      29.694  15.194  24.656  1.00  0.92           C  
ATOM    311  N   PHE A  43      30.438  19.066  22.641  1.00  0.89           N  
ATOM    312  CA  PHE A  43      30.856  20.390  22.241  1.00  0.89           C  
ATOM    313  C   PHE A  43      30.222  21.415  23.164  1.00  0.89           C  
ATOM    314  O   PHE A  43      29.042  21.329  23.495  1.00  0.89           O  
ATOM    315  CB  PHE A  43      30.383  20.746  20.804  1.00  0.89           C  
ATOM    316  CG  PHE A  43      30.886  19.795  19.754  1.00  0.89           C  
ATOM    317  CD1 PHE A  43      30.191  18.604  19.484  1.00  0.89           C  
ATOM    318  CD2 PHE A  43      32.022  20.108  18.988  1.00  0.89           C  
ATOM    319  CE1 PHE A  43      30.645  17.720  18.499  1.00  0.89           C  
ATOM    320  CE2 PHE A  43      32.479  19.227  17.999  1.00  0.89           C  
ATOM    321  CZ  PHE A  43      31.796  18.029  17.762  1.00  0.89           C  
ATOM    322  N   GLY A  44      30.990  22.448  23.567  1.00  0.94           N  
ATOM    323  CA  GLY A  44      30.476  23.605  24.300  1.00  0.94           C  
ATOM    324  C   GLY A  44      29.884  23.388  25.676  1.00  0.94           C  
ATOM    325  O   GLY A  44      30.379  22.603  26.482  1.00  0.94           O  
ATOM    326  N   LYS A  45      28.846  24.177  26.009  1.00  0.90           N  
ATOM    327  CA  LYS A  45      28.383  24.395  27.368  1.00  0.90           C  
ATOM    328  C   LYS A  45      26.960  23.906  27.597  1.00  0.90           C  
ATOM    329  O   LYS A  45      26.029  24.253  26.877  1.00  0.90           O  
ATOM    330  CB  LYS A  45      28.378  25.906  27.726  1.00  0.90           C  
ATOM    331  CG  LYS A  45      29.694  26.659  27.471  1.00  0.90           C  
ATOM    332  CD  LYS A  45      30.867  26.191  28.346  1.00  0.90           C  
ATOM    333  CE  LYS A  45      32.084  27.106  28.180  1.00  0.90           C  
ATOM    334  NZ  LYS A  45      33.265  26.540  28.858  1.00  0.90           N  
ATOM    335  N   ALA A  46      26.752  23.096  28.651  1.00  0.96           N  
ATOM    336  CA  ALA A  46      25.443  22.722  29.151  1.00  0.96           C  
ATOM    337  C   ALA A  46      24.780  23.851  29.933  1.00  0.96           C  
ATOM    338  O   ALA A  46      23.572  24.081  29.866  1.00  0.96           O  
ATOM    339  CB  ALA A  46      25.601  21.487  30.056  1.00  0.96           C  
ATOM    340  N   ASP A  47      25.608  24.575  30.700  1.00  0.91           N  
ATOM    341  CA  ASP A  47      25.241  25.746  31.454  1.00  0.91           C  
ATOM    342  C   ASP A  47      26.328  26.785  31.210  1.00  0.91           C  
ATOM    343  O   ASP A  47      27.505  26.549  31.476  1.00  0.91           O  
ATOM    344  CB  ASP A  47      25.112  25.338  32.937  1.00  0.91           C  
ATOM    345  CG  ASP A  47      24.635  26.446  33.855  1.00  0.91           C  
ATOM    346  OD1 ASP A  47      24.855  27.644  33.547  1.00  0.91           O  
ATOM    347  OD2 ASP A  47      24.089  26.073  34.922  1.00  0.91           O  
ATOM    348  N   ILE A  48      25.955  27.955  30.649  1.00  0.86           N  
ATOM    349  CA  ILE A  48      26.889  29.035  30.372  1.00  0.86           C  
ATOM    350  C   ILE A  48      27.328  29.727  31.648  1.00  0.86           C  
ATOM    351  O   ILE A  48      28.516  29.956  31.867  1.00  0.86           O  
ATOM    352  CB  ILE A  48      26.288  30.065  29.408  1.00  0.86           C  
ATOM    353  CG1 ILE A  48      25.973  29.414  28.043  1.00  0.86           C  
ATOM    354  CG2 ILE A  48      27.242  31.269  29.209  1.00  0.86           C  
ATOM    355  CD1 ILE A  48      25.159  30.327  27.118  1.00  0.86           C  
ATOM    356  N   ALA A  49      26.369  30.049  32.537  1.00  0.84           N  
ATOM    357  CA  ALA A  49      26.595  30.810  33.748  1.00  0.84           C  
ATOM    358  C   ALA A  49      27.440  30.069  34.768  1.00  0.84           C  
ATOM    359  O   ALA A  49      28.317  30.638  35.414  1.00  0.84           O  
ATOM    360  CB  ALA A  49      25.244  31.211  34.366  1.00  0.84           C  
ATOM    361  N   ALA A  50      27.212  28.750  34.898  1.00  0.86           N  
ATOM    362  CA  ALA A  50      27.975  27.917  35.803  1.00  0.86           C  
ATOM    363  C   ALA A  50      29.198  27.296  35.135  1.00  0.86           C  
ATOM    364  O   ALA A  50      29.946  26.546  35.761  1.00  0.86           O  
ATOM    365  CB  ALA A  50      27.052  26.803  36.329  1.00  0.86           C  
ATOM    366  N   ASN A  51      29.434  27.608  33.840  1.00  0.84           N  
ATOM    367  CA  ASN A  51      30.548  27.141  33.027  1.00  0.84           C  
ATOM    368  C   ASN A  51      30.658  25.615  32.961  1.00  0.84           C  
ATOM    369  O   ASN A  51      31.741  25.030  32.980  1.00  0.84           O  
ATOM    370  CB  ASN A  51      31.870  27.825  33.482  1.00  0.84           C  
ATOM    371  CG  ASN A  51      33.017  27.639  32.498  1.00  0.84           C  
ATOM    372  OD1 ASN A  51      32.843  27.476  31.288  1.00  0.84           O  
ATOM    373  ND2 ASN A  51      34.264  27.664  33.021  1.00  0.84           N  
ATOM    374  N   LYS A  52      29.514  24.925  32.834  1.00  0.87           N  
ATOM    375  CA  LYS A  52      29.491  23.479  32.811  1.00  0.87           C  
ATOM    376  C   LYS A  52      29.607  22.983  31.375  1.00  0.87           C  
ATOM    377  O   LYS A  52      28.773  23.360  30.548  1.00  0.87           O  
ATOM    378  CB  LYS A  52      28.193  22.894  33.416  1.00  0.87           C  
ATOM    379  CG  LYS A  52      27.963  23.208  34.904  1.00  0.87           C  
ATOM    380  CD  LYS A  52      26.764  22.401  35.436  1.00  0.87           C  
ATOM    381  CE  LYS A  52      26.354  22.724  36.874  1.00  0.87           C  
ATOM    382  NZ  LYS A  52      25.339  21.740  37.320  1.00  0.87           N  
ATOM    383  N   PRO A  53      30.588  22.171  30.991  1.00  0.94           N  
ATOM    384  CA  PRO A  53      30.664  21.628  29.644  1.00  0.94           C  
ATOM    385  C   PRO A  53      29.573  20.613  29.361  1.00  0.94           C  
ATOM    386  O   PRO A  53      29.013  20.017  30.279  1.00  0.94           O  
ATOM    387  CB  PRO A  53      32.050  20.969  29.619  1.00  0.94           C  
ATOM    388  CG  PRO A  53      32.246  20.461  31.048  1.00  0.94           C  
ATOM    389  CD  PRO A  53      31.555  21.533  31.893  1.00  0.94           C  
ATOM    390  N   VAL A  54      29.240  20.400  28.077  1.00  0.94           N  
ATOM    391  CA  VAL A  54      28.476  19.232  27.671  1.00  0.94           C  
ATOM    392  C   VAL A  54      29.302  17.962  27.847  1.00  0.94           C  
ATOM    393  O   VAL A  54      30.448  17.865  27.408  1.00  0.94           O  
ATOM    394  CB  VAL A  54      27.948  19.340  26.246  1.00  0.94           C  
ATOM    395  CG1 VAL A  54      27.222  18.054  25.813  1.00  0.94           C  
ATOM    396  CG2 VAL A  54      26.966  20.520  26.161  1.00  0.94           C  
ATOM    397  N   THR A  55      28.728  16.937  28.502  1.00  0.93           N  
ATOM    398  CA  THR A  55      29.374  15.654  28.722  1.00  0.93           C  
ATOM    399  C   THR A  55      28.467  14.581  28.157  1.00  0.93           C  
ATOM    400  O   THR A  55      27.330  14.886  27.789  1.00  0.93           O  
ATOM    401  CB  THR A  55      29.675  15.336  30.196  1.00  0.93           C  
ATOM    402  OG1 THR A  55      28.519  14.964  30.944  1.00  0.93           O  
ATOM    403  CG2 THR A  55      30.296  16.560  30.879  1.00  0.93           C  
ATOM    404  N   PRO A  56      28.859  13.310  28.067  1.00  0.93           N  
ATOM    405  CA  PRO A  56      27.929  12.277  27.625  1.00  0.93           C  
ATOM    406  C   PRO A  56      26.794  12.007  28.595  1.00  0.93           C  
ATOM    407  O   PRO A  56      25.850  11.319  28.217  1.00  0.93           O  
ATOM    408  CB  PRO A  56      28.818  11.041  27.442  1.00  0.93           C  
ATOM    409  CG  PRO A  56      30.175  11.632  27.061  1.00  0.93           C  
ATOM    410  CD  PRO A  56      30.256  12.872  27.948  1.00  0.93           C  
ATOM    411  N   GLN A  57      26.854  12.558  29.824  1.00  0.88           N  
ATOM    412  CA  GLN A  57      25.817  12.395  30.819  1.00  0.88           C  
ATOM    413  C   GLN A  57      24.857  13.573  30.868  1.00  0.88           C  
ATOM    414  O   GLN A  57      23.818  13.490  31.520  1.00  0.88           O  
ATOM    415  CB  GLN A  57      26.448  12.243  32.226  1.00  0.88           C  
ATOM    416  CG  GLN A  57      27.271  10.944  32.388  1.00  0.88           C  
ATOM    417  CD  GLN A  57      27.935  10.845  33.761  1.00  0.88           C  
ATOM    418  OE1 GLN A  57      29.158  10.810  33.890  1.00  0.88           O  
ATOM    419  NE2 GLN A  57      27.112  10.784  34.833  1.00  0.88           N  
ATOM    420  N   THR A  58      25.140  14.677  30.141  1.00  0.93           N  
ATOM    421  CA  THR A  58      24.277  15.856  30.076  1.00  0.93           C  
ATOM    422  C   THR A  58      22.887  15.538  29.563  1.00  0.93           C  
ATOM    423  O   THR A  58      22.726  14.988  28.476  1.00  0.93           O  
ATOM    424  CB  THR A  58      24.838  16.949  29.172  1.00  0.93           C  
ATOM    425  OG1 THR A  58      26.104  17.380  29.645  1.00  0.93           O  
ATOM    426  CG2 THR A  58      23.947  18.197  29.142  1.00  0.93           C  
ATOM    427  N   LEU A  59      21.835  15.908  30.321  1.00  0.94           N  
ATOM    428  CA  LEU A  59      20.462  15.694  29.922  1.00  0.94           C  
ATOM    429  C   LEU A  59      19.957  16.855  29.082  1.00  0.94           C  
ATOM    430  O   LEU A  59      20.086  18.027  29.444  1.00  0.94           O  
ATOM    431  CB  LEU A  59      19.498  15.523  31.124  1.00  0.94           C  
ATOM    432  CG  LEU A  59      19.821  14.367  32.089  1.00  0.94           C  
ATOM    433  CD1 LEU A  59      18.973  14.498  33.362  1.00  0.94           C  
ATOM    434  CD2 LEU A  59      19.585  13.002  31.435  1.00  0.94           C  
ATOM    435  N   PHE A  60      19.348  16.527  27.933  1.00  0.95           N  
ATOM    436  CA  PHE A  60      18.758  17.469  27.012  1.00  0.95           C  
ATOM    437  C   PHE A  60      17.281  17.154  26.912  1.00  0.95           C  
ATOM    438  O   PHE A  60      16.877  15.992  26.972  1.00  0.95           O  
ATOM    439  CB  PHE A  60      19.345  17.337  25.579  1.00  0.95           C  
ATOM    440  CG  PHE A  60      20.792  17.749  25.505  1.00  0.95           C  
ATOM    441  CD1 PHE A  60      21.811  16.861  25.889  1.00  0.95           C  
ATOM    442  CD2 PHE A  60      21.155  18.997  24.970  1.00  0.95           C  
ATOM    443  CE1 PHE A  60      23.158  17.218  25.761  1.00  0.95           C  
ATOM    444  CE2 PHE A  60      22.500  19.361  24.840  1.00  0.95           C  
ATOM    445  CZ  PHE A  60      23.502  18.471  25.240  1.00  0.95           C  
ATOM    446  N   GLU A  61      16.426  18.184  26.753  1.00  0.93           N  
ATOM    447  CA  GLU A  61      15.031  17.994  26.399  1.00  0.93           C  
ATOM    448  C   GLU A  61      14.893  17.495  24.969  1.00  0.93           C  
ATOM    449  O   GLU A  61      15.428  18.071  24.022  1.00  0.93           O  
ATOM    450  CB  GLU A  61      14.213  19.293  26.577  1.00  0.93           C  
ATOM    451  CG  GLU A  61      14.221  19.799  28.039  1.00  0.93           C  
ATOM    452  CD  GLU A  61      13.611  21.180  28.230  1.00  0.93           C  
ATOM    453  OE1 GLU A  61      13.120  21.785  27.245  1.00  0.93           O  
ATOM    454  OE2 GLU A  61      13.620  21.655  29.397  1.00  0.93           O  
ATOM    455  N   LEU A  62      14.171  16.378  24.763  1.00  0.95           N  
ATOM    456  CA  LEU A  62      14.028  15.808  23.439  1.00  0.95           C  
ATOM    457  C   LEU A  62      12.933  16.448  22.626  1.00  0.95           C  
ATOM    458  O   LEU A  62      12.862  16.261  21.410  1.00  0.95           O  
ATOM    459  CB  LEU A  62      13.670  14.307  23.528  1.00  0.95           C  
ATOM    460  CG  LEU A  62      14.826  13.383  23.930  1.00  0.95           C  
ATOM    461  CD1 LEU A  62      14.308  11.941  23.971  1.00  0.95           C  
ATOM    462  CD2 LEU A  62      16.015  13.489  22.961  1.00  0.95           C  
ATOM    463  N   GLY A  63      12.018  17.201  23.271  1.00  0.96           N  
ATOM    464  CA  GLY A  63      10.804  17.700  22.639  1.00  0.96           C  
ATOM    465  C   GLY A  63      10.048  16.628  21.901  1.00  0.96           C  
ATOM    466  O   GLY A  63       9.851  15.521  22.393  1.00  0.96           O  
ATOM    467  N   SER A  64       9.621  16.911  20.662  1.00  0.94           N  
ATOM    468  CA  SER A  64       8.906  15.953  19.829  1.00  0.94           C  
ATOM    469  C   SER A  64       9.592  14.637  19.464  1.00  0.94           C  
ATOM    470  O   SER A  64       8.950  13.786  18.857  1.00  0.94           O  
ATOM    471  CB  SER A  64       8.415  16.556  18.496  1.00  0.94           C  
ATOM    472  OG  SER A  64       7.407  17.555  18.693  1.00  0.94           O  
ATOM    473  N   ILE A  65      10.861  14.376  19.849  1.00  0.94           N  
ATOM    474  CA  ILE A  65      11.443  13.040  19.703  1.00  0.94           C  
ATOM    475  C   ILE A  65      10.864  12.089  20.753  1.00  0.94           C  
ATOM    476  O   ILE A  65      10.824  10.877  20.565  1.00  0.94           O  
ATOM    477  CB  ILE A  65      12.968  13.064  19.685  1.00  0.94           C  
ATOM    478  CG1 ILE A  65      13.476  13.789  18.422  1.00  0.94           C  
ATOM    479  CG2 ILE A  65      13.540  11.636  19.690  1.00  0.94           C  
ATOM    480  CD1 ILE A  65      14.947  14.200  18.520  1.00  0.94           C  
ATOM    481  N   SER A  66      10.240  12.632  21.823  1.00  0.95           N  
ATOM    482  CA  SER A  66       9.406  11.907  22.789  1.00  0.95           C  
ATOM    483  C   SER A  66       8.324  11.059  22.145  1.00  0.95           C  
ATOM    484  O   SER A  66       7.965   9.990  22.624  1.00  0.95           O  
ATOM    485  CB  SER A  66       8.643  12.862  23.741  1.00  0.95           C  
ATOM    486  OG  SER A  66       9.545  13.668  24.496  1.00  0.95           O  
ATOM    487  N   LYS A  67       7.800  11.513  20.993  1.00  0.91           N  
ATOM    488  CA  LYS A  67       6.799  10.815  20.215  1.00  0.91           C  
ATOM    489  C   LYS A  67       7.241   9.458  19.685  1.00  0.91           C  
ATOM    490  O   LYS A  67       6.416   8.568  19.491  1.00  0.91           O  
ATOM    491  CB  LYS A  67       6.357  11.693  19.025  1.00  0.91           C  
ATOM    492  CG  LYS A  67       5.645  12.984  19.459  1.00  0.91           C  
ATOM    493  CD  LYS A  67       5.299  13.861  18.248  1.00  0.91           C  
ATOM    494  CE  LYS A  67       4.421  15.077  18.543  1.00  0.91           C  
ATOM    495  NZ  LYS A  67       5.092  16.020  19.451  1.00  0.91           N  
ATOM    496  N   THR A  68       8.551   9.246  19.437  1.00  0.95           N  
ATOM    497  CA  THR A  68       9.075   7.937  19.040  1.00  0.95           C  
ATOM    498  C   THR A  68       8.914   6.905  20.144  1.00  0.95           C  
ATOM    499  O   THR A  68       8.493   5.775  19.911  1.00  0.95           O  
ATOM    500  CB  THR A  68      10.514   7.960  18.525  1.00  0.95           C  
ATOM    501  OG1 THR A  68      11.473   8.239  19.536  1.00  0.95           O  
ATOM    502  CG2 THR A  68      10.655   9.048  17.448  1.00  0.95           C  
ATOM    503  N   PHE A  69       9.170   7.304  21.407  1.00  0.94           N  
ATOM    504  CA  PHE A  69       8.892   6.517  22.594  1.00  0.94           C  
ATOM    505  C   PHE A  69       7.407   6.203  22.749  1.00  0.94           C  
ATOM    506  O   PHE A  69       7.026   5.067  23.015  1.00  0.94           O  
ATOM    507  CB  PHE A  69       9.388   7.247  23.871  1.00  0.94           C  
ATOM    508  CG  PHE A  69      10.886   7.351  23.914  1.00  0.94           C  
ATOM    509  CD1 PHE A  69      11.634   6.373  24.589  1.00  0.94           C  
ATOM    510  CD2 PHE A  69      11.560   8.434  23.323  1.00  0.94           C  
ATOM    511  CE1 PHE A  69      13.029   6.465  24.663  1.00  0.94           C  
ATOM    512  CE2 PHE A  69      12.956   8.527  23.390  1.00  0.94           C  
ATOM    513  CZ  PHE A  69      13.691   7.543  24.063  1.00  0.94           C  
ATOM    514  N   THR A  70       6.525   7.202  22.518  1.00  0.94           N  
ATOM    515  CA  THR A  70       5.066   7.051  22.527  1.00  0.94           C  
ATOM    516  C   THR A  70       4.585   6.038  21.510  1.00  0.94           C  
ATOM    517  O   THR A  70       3.750   5.177  21.793  1.00  0.94           O  
ATOM    518  CB  THR A  70       4.348   8.373  22.243  1.00  0.94           C  
ATOM    519  OG1 THR A  70       4.886   9.396  23.067  1.00  0.94           O  
ATOM    520  CG2 THR A  70       2.848   8.283  22.554  1.00  0.94           C  
ATOM    521  N   GLY A  71       5.152   6.070  20.287  1.00  0.97           N  
ATOM    522  CA  GLY A  71       4.800   5.122  19.240  1.00  0.97           C  
ATOM    523  C   GLY A  71       5.251   3.713  19.505  1.00  0.97           C  
ATOM    524  O   GLY A  71       4.508   2.764  19.277  1.00  0.97           O  
ATOM    525  N   VAL A  72       6.473   3.534  20.036  1.00  0.95           N  
ATOM    526  CA  VAL A  72       6.983   2.234  20.455  1.00  0.95           C  
ATOM    527  C   VAL A  72       6.212   1.649  21.632  1.00  0.95           C  
ATOM    528  O   VAL A  72       5.869   0.469  21.631  1.00  0.95           O  
ATOM    529  CB  VAL A  72       8.474   2.303  20.752  1.00  0.95           C  
ATOM    530  CG1 VAL A  72       8.994   0.996  21.384  1.00  0.95           C  
ATOM    531  CG2 VAL A  72       9.223   2.569  19.431  1.00  0.95           C  
ATOM    532  N   LEU A  73       5.865   2.462  22.655  1.00  0.94           N  
ATOM    533  CA  LEU A  73       5.032   2.030  23.772  1.00  0.94           C  
ATOM    534  C   LEU A  73       3.636   1.600  23.343  1.00  0.94           C  
ATOM    535  O   LEU A  73       3.114   0.572  23.779  1.00  0.94           O  
ATOM    536  CB  LEU A  73       4.924   3.149  24.837  1.00  0.94           C  
ATOM    537  CG  LEU A  73       4.118   2.799  26.110  1.00  0.94           C  
ATOM    538  CD1 LEU A  73       4.721   1.631  26.901  1.00  0.94           C  
ATOM    539  CD2 LEU A  73       4.021   4.030  27.017  1.00  0.94           C  
ATOM    540  N   GLY A  74       3.005   2.352  22.413  1.00  0.97           N  
ATOM    541  CA  GLY A  74       1.751   1.930  21.798  1.00  0.97           C  
ATOM    542  C   GLY A  74       1.878   0.677  20.974  1.00  0.97           C  
ATOM    543  O   GLY A  74       0.980  -0.160  20.961  1.00  0.97           O  
ATOM    544  N   GLY A  75       3.030   0.475  20.310  1.00  0.96           N  
ATOM    545  CA  GLY A  75       3.328  -0.761  19.603  1.00  0.96           C  
ATOM    546  C   GLY A  75       3.502  -1.962  20.498  1.00  0.96           C  
ATOM    547  O   GLY A  75       3.046  -3.052  20.162  1.00  0.96           O  
ATOM    548  N   ASP A  76       4.131  -1.803  21.682  1.00  0.92           N  
ATOM    549  CA  ASP A  76       4.245  -2.860  22.679  1.00  0.92           C  
ATOM    550  C   ASP A  76       2.861  -3.289  23.165  1.00  0.92           C  
ATOM    551  O   ASP A  76       2.547  -4.472  23.252  1.00  0.92           O  
ATOM    552  CB  ASP A  76       5.142  -2.386  23.859  1.00  0.92           C  
ATOM    553  CG  ASP A  76       5.160  -3.344  25.034  1.00  0.92           C  
ATOM    554  OD1 ASP A  76       5.631  -4.494  24.925  1.00  0.92           O  
ATOM    555  OD2 ASP A  76       4.638  -2.956  26.105  1.00  0.92           O  
ATOM    556  N   ALA A  77       1.963  -2.321  23.424  1.00  0.95           N  
ATOM    557  CA  ALA A  77       0.593  -2.603  23.798  1.00  0.95           C  
ATOM    558  C   ALA A  77      -0.193  -3.390  22.744  1.00  0.95           C  
ATOM    559  O   ALA A  77      -0.932  -4.319  23.067  1.00  0.95           O  
ATOM    560  CB  ALA A  77      -0.106  -1.285  24.159  1.00  0.95           C  
ATOM    561  N   ILE A  78      -0.007  -3.085  21.441  1.00  0.92           N  
ATOM    562  CA  ILE A  78      -0.547  -3.891  20.347  1.00  0.92           C  
ATOM    563  C   ILE A  78      -0.005  -5.315  20.355  1.00  0.92           C  
ATOM    564  O   ILE A  78      -0.751  -6.288  20.261  1.00  0.92           O  
ATOM    565  CB  ILE A  78      -0.253  -3.253  18.988  1.00  0.92           C  
ATOM    566  CG1 ILE A  78      -0.909  -1.863  18.871  1.00  0.92           C  
ATOM    567  CG2 ILE A  78      -0.759  -4.149  17.835  1.00  0.92           C  
ATOM    568  CD1 ILE A  78      -0.292  -1.003  17.767  1.00  0.92           C  
ATOM    569  N   ALA A  79       1.318  -5.483  20.534  1.00  0.93           N  
ATOM    570  CA  ALA A  79       1.967  -6.780  20.519  1.00  0.93           C  
ATOM    571  C   ALA A  79       1.659  -7.643  21.743  1.00  0.93           C  
ATOM    572  O   ALA A  79       1.736  -8.869  21.704  1.00  0.93           O  
ATOM    573  CB  ALA A  79       3.478  -6.553  20.373  1.00  0.93           C  
ATOM    574  N   ARG A  80       1.238  -7.018  22.856  1.00  0.86           N  
ATOM    575  CA  ARG A  80       0.697  -7.703  24.014  1.00  0.86           C  
ATOM    576  C   ARG A  80      -0.762  -8.114  23.839  1.00  0.86           C  
ATOM    577  O   ARG A  80      -1.285  -8.898  24.626  1.00  0.86           O  
ATOM    578  CB  ARG A  80       0.766  -6.781  25.255  1.00  0.86           C  
ATOM    579  CG  ARG A  80       2.191  -6.535  25.776  1.00  0.86           C  
ATOM    580  CD  ARG A  80       2.236  -5.371  26.763  1.00  0.86           C  
ATOM    581  NE  ARG A  80       3.655  -5.187  27.188  1.00  0.86           N  
ATOM    582  CZ  ARG A  80       4.286  -5.846  28.162  1.00  0.86           C  
ATOM    583  NH1 ARG A  80       3.630  -6.679  28.965  1.00  0.86           N  
ATOM    584  NH2 ARG A  80       5.584  -5.632  28.357  1.00  0.86           N  
ATOM    585  N   GLY A  81      -1.468  -7.588  22.812  1.00  0.93           N  
ATOM    586  CA  GLY A  81      -2.893  -7.840  22.603  1.00  0.93           C  
ATOM    587  C   GLY A  81      -3.812  -6.940  23.380  1.00  0.93           C  
ATOM    588  O   GLY A  81      -5.021  -7.148  23.412  1.00  0.93           O  
ATOM    589  N   GLU A  82      -3.264  -5.913  24.044  1.00  0.90           N  
ATOM    590  CA  GLU A  82      -4.028  -4.955  24.819  1.00  0.90           C  
ATOM    591  C   GLU A  82      -4.853  -3.976  24.006  1.00  0.90           C  
ATOM    592  O   GLU A  82      -5.968  -3.626  24.391  1.00  0.90           O  
ATOM    593  CB  GLU A  82      -3.081  -4.149  25.725  1.00  0.90           C  
ATOM    594  CG  GLU A  82      -2.556  -4.998  26.904  1.00  0.90           C  
ATOM    595  CD  GLU A  82      -1.474  -4.294  27.710  1.00  0.90           C  
ATOM    596  OE1 GLU A  82      -0.940  -3.244  27.269  1.00  0.90           O  
ATOM    597  OE2 GLU A  82      -1.084  -4.808  28.792  1.00  0.90           O  
ATOM    598  N   ILE A  83      -4.307  -3.488  22.875  1.00  0.93           N  
ATOM    599  CA  ILE A  83      -4.987  -2.522  22.024  1.00  0.93           C  
ATOM    600  C   ILE A  83      -4.851  -2.907  20.563  1.00  0.93           C  
ATOM    601  O   ILE A  83      -3.944  -3.637  20.169  1.00  0.93           O  
ATOM    602  CB  ILE A  83      -4.485  -1.076  22.177  1.00  0.93           C  
ATOM    603  CG1 ILE A  83      -3.025  -0.886  21.709  1.00  0.93           C  
ATOM    604  CG2 ILE A  83      -4.651  -0.639  23.643  1.00  0.93           C  
ATOM    605  CD1 ILE A  83      -2.544   0.567  21.742  1.00  0.93           C  
ATOM    606  N   SER A  84      -5.733  -2.387  19.691  1.00  0.92           N  
ATOM    607  CA  SER A  84      -5.539  -2.427  18.252  1.00  0.92           C  
ATOM    608  C   SER A  84      -5.558  -1.017  17.705  1.00  0.92           C  
ATOM    609  O   SER A  84      -6.203  -0.115  18.235  1.00  0.92           O  
ATOM    610  CB  SER A  84      -6.624  -3.269  17.529  1.00  0.92           C  
ATOM    611  OG  SER A  84      -6.432  -3.301  16.109  1.00  0.92           O  
ATOM    612  N   LEU A  85      -4.844  -0.775  16.587  1.00  0.92           N  
ATOM    613  CA  LEU A  85      -4.903   0.499  15.895  1.00  0.92           C  
ATOM    614  C   LEU A  85      -6.215   0.676  15.163  1.00  0.92           C  
ATOM    615  O   LEU A  85      -6.649   1.802  14.924  1.00  0.92           O  
ATOM    616  CB  LEU A  85      -3.754   0.645  14.873  1.00  0.92           C  
ATOM    617  CG  LEU A  85      -2.359   0.756  15.508  1.00  0.92           C  
ATOM    618  CD1 LEU A  85      -1.275   0.699  14.429  1.00  0.92           C  
ATOM    619  CD2 LEU A  85      -2.185   2.031  16.348  1.00  0.92           C  
ATOM    620  N   ASP A  86      -6.897  -0.436  14.835  1.00  0.90           N  
ATOM    621  CA  ASP A  86      -8.158  -0.396  14.134  1.00  0.90           C  
ATOM    622  C   ASP A  86      -9.352  -0.195  15.051  1.00  0.90           C  
ATOM    623  O   ASP A  86     -10.450   0.124  14.596  1.00  0.90           O  
ATOM    624  CB  ASP A  86      -8.335  -1.665  13.283  1.00  0.90           C  
ATOM    625  CG  ASP A  86      -7.337  -1.589  12.146  1.00  0.90           C  
ATOM    626  OD1 ASP A  86      -7.358  -0.556  11.415  1.00  0.90           O  
ATOM    627  OD2 ASP A  86      -6.533  -2.541  12.013  1.00  0.90           O  
ATOM    628  N   ASP A  87      -9.158  -0.313  16.380  1.00  0.91           N  
ATOM    629  CA  ASP A  87     -10.163   0.054  17.352  1.00  0.91           C  
ATOM    630  C   ASP A  87     -10.570   1.520  17.285  1.00  0.91           C  
ATOM    631  O   ASP A  87      -9.763   2.426  17.073  1.00  0.91           O  
ATOM    632  CB  ASP A  87      -9.684  -0.155  18.803  1.00  0.91           C  
ATOM    633  CG  ASP A  87      -9.562  -1.602  19.205  1.00  0.91           C  
ATOM    634  OD1 ASP A  87     -10.495  -2.395  18.936  1.00  0.91           O  
ATOM    635  OD2 ASP A  87      -8.566  -1.886  19.920  1.00  0.91           O  
ATOM    636  N   ALA A  88     -11.862   1.787  17.536  1.00  0.93           N  
ATOM    637  CA  ALA A  88     -12.362   3.113  17.797  1.00  0.93           C  
ATOM    638  C   ALA A  88     -11.726   3.763  19.023  1.00  0.93           C  
ATOM    639  O   ALA A  88     -11.467   3.115  20.038  1.00  0.93           O  
ATOM    640  CB  ALA A  88     -13.889   3.048  17.985  1.00  0.93           C  
ATOM    641  N   VAL A  89     -11.497   5.091  18.978  1.00  0.93           N  
ATOM    642  CA  VAL A  89     -10.963   5.862  20.102  1.00  0.93           C  
ATOM    643  C   VAL A  89     -11.838   5.738  21.346  1.00  0.93           C  
ATOM    644  O   VAL A  89     -11.376   5.596  22.480  1.00  0.93           O  
ATOM    645  CB  VAL A  89     -10.834   7.333  19.712  1.00  0.93           C  
ATOM    646  CG1 VAL A  89     -10.386   8.210  20.894  1.00  0.93           C  
ATOM    647  CG2 VAL A  89      -9.799   7.455  18.583  1.00  0.93           C  
ATOM    648  N   THR A  90     -13.161   5.711  21.129  1.00  0.91           N  
ATOM    649  CA  THR A  90     -14.193   5.648  22.152  1.00  0.91           C  
ATOM    650  C   THR A  90     -14.242   4.331  22.908  1.00  0.91           C  
ATOM    651  O   THR A  90     -14.802   4.257  23.996  1.00  0.91           O  
ATOM    652  CB  THR A  90     -15.568   5.907  21.560  1.00  0.91           C  
ATOM    653  OG1 THR A  90     -15.827   5.020  20.475  1.00  0.91           O  
ATOM    654  CG2 THR A  90     -15.600   7.332  20.989  1.00  0.91           C  
ATOM    655  N   ARG A  91     -13.590   3.261  22.397  1.00  0.83           N  
ATOM    656  CA  ARG A  91     -13.378   2.020  23.134  1.00  0.83           C  
ATOM    657  C   ARG A  91     -12.559   2.251  24.400  1.00  0.83           C  
ATOM    658  O   ARG A  91     -12.801   1.674  25.460  1.00  0.83           O  
ATOM    659  CB  ARG A  91     -12.657   0.981  22.234  1.00  0.83           C  
ATOM    660  CG  ARG A  91     -12.438  -0.411  22.868  1.00  0.83           C  
ATOM    661  CD  ARG A  91     -11.596  -1.332  21.976  1.00  0.83           C  
ATOM    662  NE  ARG A  91     -11.281  -2.585  22.738  1.00  0.83           N  
ATOM    663  CZ  ARG A  91     -12.068  -3.668  22.764  1.00  0.83           C  
ATOM    664  NH1 ARG A  91     -13.271  -3.666  22.199  1.00  0.83           N  
ATOM    665  NH2 ARG A  91     -11.654  -4.770  23.384  1.00  0.83           N  
ATOM    666  N   TYR A  92     -11.560   3.146  24.313  1.00  0.90           N  
ATOM    667  CA  TYR A  92     -10.661   3.427  25.410  1.00  0.90           C  
ATOM    668  C   TYR A  92     -11.139   4.621  26.217  1.00  0.90           C  
ATOM    669  O   TYR A  92     -10.789   4.768  27.389  1.00  0.90           O  
ATOM    670  CB  TYR A  92      -9.228   3.659  24.867  1.00  0.90           C  
ATOM    671  CG  TYR A  92      -8.783   2.396  24.180  1.00  0.90           C  
ATOM    672  CD1 TYR A  92      -8.443   1.277  24.958  1.00  0.90           C  
ATOM    673  CD2 TYR A  92      -8.825   2.266  22.779  1.00  0.90           C  
ATOM    674  CE1 TYR A  92      -8.236   0.032  24.354  1.00  0.90           C  
ATOM    675  CE2 TYR A  92      -8.594   1.021  22.176  1.00  0.90           C  
ATOM    676  CZ  TYR A  92      -8.330  -0.098  22.969  1.00  0.90           C  
ATOM    677  OH  TYR A  92      -8.211  -1.388  22.422  1.00  0.90           O  
ATOM    678  N   TRP A  93     -12.041   5.453  25.670  1.00  0.87           N  
ATOM    679  CA  TRP A  93     -12.640   6.551  26.406  1.00  0.87           C  
ATOM    680  C   TRP A  93     -14.150   6.616  26.175  1.00  0.87           C  
ATOM    681  O   TRP A  93     -14.604   7.358  25.307  1.00  0.87           O  
ATOM    682  CB  TRP A  93     -11.957   7.885  26.000  1.00  0.87           C  
ATOM    683  CG  TRP A  93     -12.045   9.030  27.003  1.00  0.87           C  
ATOM    684  CD1 TRP A  93     -12.641   9.051  28.236  1.00  0.87           C  
ATOM    685  CD2 TRP A  93     -11.420  10.324  26.847  1.00  0.87           C  
ATOM    686  NE1 TRP A  93     -12.427  10.258  28.861  1.00  0.87           N  
ATOM    687  CE2 TRP A  93     -11.675  11.048  28.026  1.00  0.87           C  
ATOM    688  CE3 TRP A  93     -10.673  10.883  25.808  1.00  0.87           C  
ATOM    689  CZ2 TRP A  93     -11.188  12.335  28.203  1.00  0.87           C  
ATOM    690  CZ3 TRP A  93     -10.192  12.192  25.983  1.00  0.87           C  
ATOM    691  CH2 TRP A  93     -10.440  12.905  27.164  1.00  0.87           C  
ATOM    692  N   PRO A  94     -14.975   5.893  26.942  1.00  0.88           N  
ATOM    693  CA  PRO A  94     -16.417   5.807  26.697  1.00  0.88           C  
ATOM    694  C   PRO A  94     -17.140   7.112  26.949  1.00  0.88           C  
ATOM    695  O   PRO A  94     -18.233   7.328  26.434  1.00  0.88           O  
ATOM    696  CB  PRO A  94     -16.917   4.722  27.668  1.00  0.88           C  
ATOM    697  CG  PRO A  94     -15.679   3.922  28.084  1.00  0.88           C  
ATOM    698  CD  PRO A  94     -14.519   4.893  27.909  1.00  0.88           C  
ATOM    699  N   GLN A  95     -16.550   7.993  27.772  1.00  0.83           N  
ATOM    700  CA  GLN A  95     -17.087   9.295  28.098  1.00  0.83           C  
ATOM    701  C   GLN A  95     -16.986  10.272  26.931  1.00  0.83           C  
ATOM    702  O   GLN A  95     -17.631  11.319  26.919  1.00  0.83           O  
ATOM    703  CB  GLN A  95     -16.329   9.891  29.312  1.00  0.83           C  
ATOM    704  CG  GLN A  95     -16.590   9.181  30.666  1.00  0.83           C  
ATOM    705  CD  GLN A  95     -15.872   7.840  30.849  1.00  0.83           C  
ATOM    706  OE1 GLN A  95     -14.947   7.445  30.136  1.00  0.83           O  
ATOM    707  NE2 GLN A  95     -16.312   7.092  31.887  1.00  0.83           N  
ATOM    708  N   LEU A  96     -16.179   9.939  25.906  1.00  0.88           N  
ATOM    709  CA  LEU A  96     -16.073  10.681  24.668  1.00  0.88           C  
ATOM    710  C   LEU A  96     -17.243  10.377  23.730  1.00  0.88           C  
ATOM    711  O   LEU A  96     -17.150   9.617  22.768  1.00  0.88           O  
ATOM    712  CB  LEU A  96     -14.692  10.367  24.045  1.00  0.88           C  
ATOM    713  CG  LEU A  96     -14.185  11.321  22.952  1.00  0.88           C  
ATOM    714  CD1 LEU A  96     -14.071  12.766  23.451  1.00  0.88           C  
ATOM    715  CD2 LEU A  96     -12.815  10.842  22.448  1.00  0.88           C  
ATOM    716  N   THR A  97     -18.421  10.951  24.036  1.00  0.85           N  
ATOM    717  CA  THR A  97     -19.696  10.535  23.459  1.00  0.85           C  
ATOM    718  C   THR A  97     -20.099  11.292  22.215  1.00  0.85           C  
ATOM    719  O   THR A  97     -21.062  10.905  21.545  1.00  0.85           O  
ATOM    720  CB  THR A  97     -20.852  10.702  24.446  1.00  0.85           C  
ATOM    721  OG1 THR A  97     -20.912  12.030  24.964  1.00  0.85           O  
ATOM    722  CG2 THR A  97     -20.652   9.754  25.637  1.00  0.85           C  
ATOM    723  N   GLY A  98     -19.378  12.380  21.861  1.00  0.88           N  
ATOM    724  CA  GLY A  98     -19.609  13.158  20.652  1.00  0.88           C  
ATOM    725  C   GLY A  98     -19.571  12.328  19.397  1.00  0.88           C  
ATOM    726  O   GLY A  98     -18.674  11.519  19.175  1.00  0.88           O  
ATOM    727  N   LYS A  99     -20.537  12.514  18.487  1.00  0.79           N  
ATOM    728  CA  LYS A  99     -20.695  11.578  17.390  1.00  0.79           C  
ATOM    729  C   LYS A  99     -19.873  11.961  16.182  1.00  0.79           C  
ATOM    730  O   LYS A  99     -19.864  11.265  15.172  1.00  0.79           O  
ATOM    731  CB  LYS A  99     -22.192  11.361  17.084  1.00  0.79           C  
ATOM    732  CG  LYS A  99     -22.723  10.242  17.994  1.00  0.79           C  
ATOM    733  CD  LYS A  99     -24.246  10.178  18.156  1.00  0.79           C  
ATOM    734  CE  LYS A  99     -24.640   9.508  19.477  1.00  0.79           C  
ATOM    735  NZ  LYS A  99     -24.043   8.155  19.560  1.00  0.79           N  
ATOM    736  N   GLN A 100     -19.041  13.006  16.317  1.00  0.84           N  
ATOM    737  CA  GLN A 100     -17.935  13.250  15.423  1.00  0.84           C  
ATOM    738  C   GLN A 100     -16.775  12.277  15.639  1.00  0.84           C  
ATOM    739  O   GLN A 100     -15.901  12.142  14.790  1.00  0.84           O  
ATOM    740  CB  GLN A 100     -17.433  14.710  15.544  1.00  0.84           C  
ATOM    741  CG  GLN A 100     -16.602  15.072  16.805  1.00  0.84           C  
ATOM    742  CD  GLN A 100     -17.446  15.453  18.023  1.00  0.84           C  
ATOM    743  OE1 GLN A 100     -18.586  15.023  18.208  1.00  0.84           O  
ATOM    744  NE2 GLN A 100     -16.849  16.299  18.889  1.00  0.84           N  
ATOM    745  N   TRP A 101     -16.755  11.550  16.780  1.00  0.86           N  
ATOM    746  CA  TRP A 101     -15.701  10.600  17.095  1.00  0.86           C  
ATOM    747  C   TRP A 101     -16.014   9.206  16.590  1.00  0.86           C  
ATOM    748  O   TRP A 101     -15.177   8.302  16.628  1.00  0.86           O  
ATOM    749  CB  TRP A 101     -15.458  10.559  18.625  1.00  0.86           C  
ATOM    750  CG  TRP A 101     -14.768  11.814  19.116  1.00  0.86           C  
ATOM    751  CD1 TRP A 101     -15.291  12.982  19.603  1.00  0.86           C  
ATOM    752  CD2 TRP A 101     -13.341  12.003  19.064  1.00  0.86           C  
ATOM    753  NE1 TRP A 101     -14.284  13.902  19.828  1.00  0.86           N  
ATOM    754  CE2 TRP A 101     -13.085  13.308  19.506  1.00  0.86           C  
ATOM    755  CE3 TRP A 101     -12.305  11.148  18.677  1.00  0.86           C  
ATOM    756  CZ2 TRP A 101     -11.787  13.798  19.568  1.00  0.86           C  
ATOM    757  CZ3 TRP A 101     -10.992  11.640  18.756  1.00  0.86           C  
ATOM    758  CH2 TRP A 101     -10.736  12.948  19.191  1.00  0.86           C  
ATOM    759  N   GLN A 102     -17.222   8.991  16.037  1.00  0.84           N  
ATOM    760  CA  GLN A 102     -17.538   7.759  15.350  1.00  0.84           C  
ATOM    761  C   GLN A 102     -16.745   7.622  14.054  1.00  0.84           C  
ATOM    762  O   GLN A 102     -16.704   8.517  13.217  1.00  0.84           O  
ATOM    763  CB  GLN A 102     -19.058   7.637  15.096  1.00  0.84           C  
ATOM    764  CG  GLN A 102     -19.493   6.265  14.527  1.00  0.84           C  
ATOM    765  CD  GLN A 102     -21.015   6.144  14.428  1.00  0.84           C  
ATOM    766  OE1 GLN A 102     -21.789   6.939  14.960  1.00  0.84           O  
ATOM    767  NE2 GLN A 102     -21.472   5.070  13.739  1.00  0.84           N  
ATOM    768  N   GLY A 103     -16.059   6.478  13.869  1.00  0.92           N  
ATOM    769  CA  GLY A 103     -15.204   6.261  12.704  1.00  0.92           C  
ATOM    770  C   GLY A 103     -13.794   6.765  12.851  1.00  0.92           C  
ATOM    771  O   GLY A 103     -12.980   6.567  11.957  1.00  0.92           O  
ATOM    772  N   ILE A 104     -13.448   7.381  13.997  1.00  0.92           N  
ATOM    773  CA  ILE A 104     -12.077   7.767  14.299  1.00  0.92           C  
ATOM    774  C   ILE A 104     -11.405   6.638  15.063  1.00  0.92           C  
ATOM    775  O   ILE A 104     -11.863   6.201  16.123  1.00  0.92           O  
ATOM    776  CB  ILE A 104     -11.979   9.084  15.070  1.00  0.92           C  
ATOM    777  CG1 ILE A 104     -12.697  10.192  14.265  1.00  0.92           C  
ATOM    778  CG2 ILE A 104     -10.494   9.454  15.298  1.00  0.92           C  
ATOM    779  CD1 ILE A 104     -12.581  11.601  14.851  1.00  0.92           C  
ATOM    780  N   ARG A 105     -10.293   6.111  14.518  1.00  0.85           N  
ATOM    781  CA  ARG A 105      -9.579   4.996  15.098  1.00  0.85           C  
ATOM    782  C   ARG A 105      -8.401   5.433  15.949  1.00  0.85           C  
ATOM    783  O   ARG A 105      -7.928   6.568  15.899  1.00  0.85           O  
ATOM    784  CB  ARG A 105      -9.018   4.071  13.998  1.00  0.85           C  
ATOM    785  CG  ARG A 105     -10.078   3.488  13.048  1.00  0.85           C  
ATOM    786  CD  ARG A 105      -9.455   2.686  11.899  1.00  0.85           C  
ATOM    787  NE  ARG A 105      -8.698   3.642  11.028  1.00  0.85           N  
ATOM    788  CZ  ARG A 105      -7.952   3.242   9.987  1.00  0.85           C  
ATOM    789  NH1 ARG A 105      -7.557   1.979   9.817  1.00  0.85           N  
ATOM    790  NH2 ARG A 105      -7.592   4.148   9.077  1.00  0.85           N  
ATOM    791  N   MET A 106      -7.846   4.495  16.741  1.00  0.92           N  
ATOM    792  CA  MET A 106      -6.591   4.687  17.448  1.00  0.92           C  
ATOM    793  C   MET A 106      -5.429   4.985  16.505  1.00  0.92           C  
ATOM    794  O   MET A 106      -4.547   5.780  16.830  1.00  0.92           O  
ATOM    795  CB  MET A 106      -6.260   3.478  18.352  1.00  0.92           C  
ATOM    796  CG  MET A 106      -7.155   3.400  19.606  1.00  0.92           C  
ATOM    797  SD  MET A 106      -6.851   4.712  20.835  1.00  0.92           S  
ATOM    798  CE  MET A 106      -5.435   3.891  21.624  1.00  0.92           C  
ATOM    799  N   LEU A 107      -5.437   4.408  15.280  1.00  0.94           N  
ATOM    800  CA  LEU A 107      -4.497   4.761  14.227  1.00  0.94           C  
ATOM    801  C   LEU A 107      -4.507   6.235  13.888  1.00  0.94           C  
ATOM    802  O   LEU A 107      -3.457   6.871  13.816  1.00  0.94           O  
ATOM    803  CB  LEU A 107      -4.823   4.018  12.903  1.00  0.94           C  
ATOM    804  CG  LEU A 107      -3.833   4.319  11.753  1.00  0.94           C  
ATOM    805  CD1 LEU A 107      -2.404   3.908  12.111  1.00  0.94           C  
ATOM    806  CD2 LEU A 107      -4.249   3.633  10.450  1.00  0.94           C  
ATOM    807  N   ASP A 108      -5.706   6.811  13.714  1.00  0.94           N  
ATOM    808  CA  ASP A 108      -5.904   8.184  13.324  1.00  0.94           C  
ATOM    809  C   ASP A 108      -5.377   9.182  14.363  1.00  0.94           C  
ATOM    810  O   ASP A 108      -4.772  10.203  14.029  1.00  0.94           O  
ATOM    811  CB  ASP A 108      -7.387   8.409  12.928  1.00  0.94           C  
ATOM    812  CG  ASP A 108      -7.813   7.421  11.846  1.00  0.94           C  
ATOM    813  OD1 ASP A 108      -7.180   7.395  10.759  1.00  0.94           O  
ATOM    814  OD2 ASP A 108      -8.776   6.649  12.100  1.00  0.94           O  
ATOM    815  N   LEU A 109      -5.527   8.887  15.674  1.00  0.95           N  
ATOM    816  CA  LEU A 109      -4.821   9.634  16.706  1.00  0.95           C  
ATOM    817  C   LEU A 109      -3.301   9.506  16.618  1.00  0.95           C  
ATOM    818  O   LEU A 109      -2.580  10.505  16.623  1.00  0.95           O  
ATOM    819  CB  LEU A 109      -5.251   9.186  18.122  1.00  0.95           C  
ATOM    820  CG  LEU A 109      -6.671   9.584  18.555  1.00  0.95           C  
ATOM    821  CD1 LEU A 109      -6.883   9.110  19.997  1.00  0.95           C  
ATOM    822  CD2 LEU A 109      -6.911  11.098  18.469  1.00  0.95           C  
ATOM    823  N   ALA A 110      -2.774   8.277  16.465  1.00  0.97           N  
ATOM    824  CA  ALA A 110      -1.351   7.993  16.454  1.00  0.97           C  
ATOM    825  C   ALA A 110      -0.582   8.683  15.330  1.00  0.97           C  
ATOM    826  O   ALA A 110       0.561   9.104  15.498  1.00  0.97           O  
ATOM    827  CB  ALA A 110      -1.130   6.470  16.359  1.00  0.97           C  
ATOM    828  N   THR A 111      -1.211   8.786  14.143  1.00  0.94           N  
ATOM    829  CA  THR A 111      -0.558   9.196  12.904  1.00  0.94           C  
ATOM    830  C   THR A 111      -1.049  10.525  12.358  1.00  0.94           C  
ATOM    831  O   THR A 111      -0.644  10.935  11.269  1.00  0.94           O  
ATOM    832  CB  THR A 111      -0.709   8.148  11.811  1.00  0.94           C  
ATOM    833  OG1 THR A 111      -2.067   7.856  11.540  1.00  0.94           O  
ATOM    834  CG2 THR A 111      -0.064   6.833  12.260  1.00  0.94           C  
ATOM    835  N   TYR A 112      -1.894  11.244  13.130  1.00  0.93           N  
ATOM    836  CA  TYR A 112      -2.267  12.641  12.924  1.00  0.93           C  
ATOM    837  C   TYR A 112      -3.383  12.845  11.900  1.00  0.93           C  
ATOM    838  O   TYR A 112      -3.535  13.926  11.326  1.00  0.93           O  
ATOM    839  CB  TYR A 112      -1.088  13.599  12.567  1.00  0.93           C  
ATOM    840  CG  TYR A 112       0.195  13.385  13.323  1.00  0.93           C  
ATOM    841  CD1 TYR A 112       0.294  13.627  14.702  1.00  0.93           C  
ATOM    842  CD2 TYR A 112       1.350  12.996  12.622  1.00  0.93           C  
ATOM    843  CE1 TYR A 112       1.516  13.448  15.369  1.00  0.93           C  
ATOM    844  CE2 TYR A 112       2.567  12.810  13.286  1.00  0.93           C  
ATOM    845  CZ  TYR A 112       2.645  13.020  14.662  1.00  0.93           C  
ATOM    846  OH  TYR A 112       3.878  12.801  15.304  1.00  0.93           O  
ATOM    847  N   THR A 113      -4.204  11.812  11.648  1.00  0.94           N  
ATOM    848  CA  THR A 113      -5.151  11.772  10.534  1.00  0.94           C  
ATOM    849  C   THR A 113      -6.596  11.774  10.979  1.00  0.94           C  
ATOM    850  O   THR A 113      -7.503  11.492  10.200  1.00  0.94           O  
ATOM    851  CB  THR A 113      -4.953  10.575   9.611  1.00  0.94           C  
ATOM    852  OG1 THR A 113      -4.861   9.368  10.356  1.00  0.94           O  
ATOM    853  CG2 THR A 113      -3.622  10.742   8.867  1.00  0.94           C  
ATOM    854  N   ALA A 114      -6.876  12.156  12.242  1.00  0.97           N  
ATOM    855  CA  ALA A 114      -8.221  12.195  12.792  1.00  0.97           C  
ATOM    856  C   ALA A 114      -9.162  13.217  12.152  1.00  0.97           C  
ATOM    857  O   ALA A 114     -10.374  13.118  12.301  1.00  0.97           O  
ATOM    858  CB  ALA A 114      -8.143  12.461  14.309  1.00  0.97           C  
ATOM    859  N   GLY A 115      -8.630  14.204  11.398  1.00  0.95           N  
ATOM    860  CA  GLY A 115      -9.463  15.162  10.669  1.00  0.95           C  
ATOM    861  C   GLY A 115      -9.302  16.597  11.082  1.00  0.95           C  
ATOM    862  O   GLY A 115     -10.216  17.400  10.924  1.00  0.95           O  
ATOM    863  N   GLY A 116      -8.128  16.988  11.621  1.00  0.94           N  
ATOM    864  CA  GLY A 116      -7.867  18.392  11.944  1.00  0.94           C  
ATOM    865  C   GLY A 116      -7.710  18.697  13.398  1.00  0.94           C  
ATOM    866  O   GLY A 116      -7.933  19.829  13.813  1.00  0.94           O  
ATOM    867  N   LEU A 117      -7.329  17.715  14.240  1.00  0.93           N  
ATOM    868  CA  LEU A 117      -6.928  18.007  15.609  1.00  0.93           C  
ATOM    869  C   LEU A 117      -5.728  18.968  15.643  1.00  0.93           C  
ATOM    870  O   LEU A 117      -4.808  18.794  14.844  1.00  0.93           O  
ATOM    871  CB  LEU A 117      -6.560  16.722  16.397  1.00  0.93           C  
ATOM    872  CG  LEU A 117      -7.757  15.887  16.893  1.00  0.93           C  
ATOM    873  CD1 LEU A 117      -7.268  14.564  17.494  1.00  0.93           C  
ATOM    874  CD2 LEU A 117      -8.582  16.643  17.944  1.00  0.93           C  
ATOM    875  N   PRO A 118      -5.685  19.993  16.487  1.00  0.91           N  
ATOM    876  CA  PRO A 118      -4.720  21.075  16.325  1.00  0.91           C  
ATOM    877  C   PRO A 118      -3.364  20.725  16.900  1.00  0.91           C  
ATOM    878  O   PRO A 118      -3.217  19.745  17.629  1.00  0.91           O  
ATOM    879  CB  PRO A 118      -5.375  22.232  17.101  1.00  0.91           C  
ATOM    880  CG  PRO A 118      -6.177  21.537  18.200  1.00  0.91           C  
ATOM    881  CD  PRO A 118      -6.721  20.313  17.473  1.00  0.91           C  
ATOM    882  N   LEU A 119      -2.338  21.549  16.587  1.00  0.92           N  
ATOM    883  CA  LEU A 119      -0.955  21.324  16.967  1.00  0.92           C  
ATOM    884  C   LEU A 119      -0.758  21.138  18.459  1.00  0.92           C  
ATOM    885  O   LEU A 119      -0.007  20.268  18.894  1.00  0.92           O  
ATOM    886  CB  LEU A 119      -0.064  22.502  16.494  1.00  0.92           C  
ATOM    887  CG  LEU A 119       1.435  22.392  16.861  1.00  0.92           C  
ATOM    888  CD1 LEU A 119       2.094  21.167  16.214  1.00  0.92           C  
ATOM    889  CD2 LEU A 119       2.184  23.670  16.463  1.00  0.92           C  
ATOM    890  N   GLN A 120      -1.454  21.941  19.276  1.00  0.89           N  
ATOM    891  CA  GLN A 120      -1.338  21.904  20.713  1.00  0.89           C  
ATOM    892  C   GLN A 120      -2.671  21.605  21.357  1.00  0.89           C  
ATOM    893  O   GLN A 120      -3.736  21.953  20.852  1.00  0.89           O  
ATOM    894  CB  GLN A 120      -0.815  23.249  21.277  1.00  0.89           C  
ATOM    895  CG  GLN A 120       0.601  23.649  20.792  1.00  0.89           C  
ATOM    896  CD  GLN A 120       1.692  22.682  21.253  1.00  0.89           C  
ATOM    897  OE1 GLN A 120       1.493  21.733  22.013  1.00  0.89           O  
ATOM    898  NE2 GLN A 120       2.931  22.916  20.753  1.00  0.89           N  
ATOM    899  N   VAL A 121      -2.632  20.949  22.532  1.00  0.91           N  
ATOM    900  CA  VAL A 121      -3.724  20.985  23.489  1.00  0.91           C  
ATOM    901  C   VAL A 121      -3.845  22.415  24.035  1.00  0.91           C  
ATOM    902  O   VAL A 121      -2.805  22.973  24.381  1.00  0.91           O  
ATOM    903  CB  VAL A 121      -3.471  20.000  24.625  1.00  0.91           C  
ATOM    904  CG1 VAL A 121      -4.605  20.035  25.663  1.00  0.91           C  
ATOM    905  CG2 VAL A 121      -3.329  18.570  24.069  1.00  0.91           C  
ATOM    906  N   PRO A 122      -5.002  23.081  24.098  1.00  0.86           N  
ATOM    907  CA  PRO A 122      -5.130  24.423  24.664  1.00  0.86           C  
ATOM    908  C   PRO A 122      -4.580  24.581  26.073  1.00  0.86           C  
ATOM    909  O   PRO A 122      -4.806  23.700  26.897  1.00  0.86           O  
ATOM    910  CB  PRO A 122      -6.639  24.720  24.618  1.00  0.86           C  
ATOM    911  CG  PRO A 122      -7.214  23.781  23.556  1.00  0.86           C  
ATOM    912  CD  PRO A 122      -6.271  22.580  23.570  1.00  0.86           C  
ATOM    913  N   ASP A 123      -3.924  25.714  26.399  1.00  0.81           N  
ATOM    914  CA  ASP A 123      -3.373  25.982  27.723  1.00  0.81           C  
ATOM    915  C   ASP A 123      -4.425  26.059  28.833  1.00  0.81           C  
ATOM    916  O   ASP A 123      -4.146  25.874  30.015  1.00  0.81           O  
ATOM    917  CB  ASP A 123      -2.590  27.315  27.723  1.00  0.81           C  
ATOM    918  CG  ASP A 123      -1.460  27.267  26.715  1.00  0.81           C  
ATOM    919  OD1 ASP A 123      -0.687  26.280  26.735  1.00  0.81           O  
ATOM    920  OD2 ASP A 123      -1.375  28.222  25.903  1.00  0.81           O  
ATOM    921  N   GLU A 124      -5.696  26.305  28.465  1.00  0.76           N  
ATOM    922  CA  GLU A 124      -6.824  26.277  29.376  1.00  0.76           C  
ATOM    923  C   GLU A 124      -7.241  24.864  29.777  1.00  0.76           C  
ATOM    924  O   GLU A 124      -8.022  24.665  30.708  1.00  0.76           O  
ATOM    925  CB  GLU A 124      -8.023  27.019  28.750  1.00  0.76           C  
ATOM    926  CG  GLU A 124      -8.629  26.304  27.518  1.00  0.76           C  
ATOM    927  CD  GLU A 124      -9.745  27.092  26.842  1.00  0.76           C  
ATOM    928  OE1 GLU A 124     -10.043  28.229  27.282  1.00  0.76           O  
ATOM    929  OE2 GLU A 124     -10.309  26.531  25.866  1.00  0.76           O  
ATOM    930  N   VAL A 125      -6.713  23.832  29.089  1.00  0.84           N  
ATOM    931  CA  VAL A 125      -6.894  22.447  29.475  1.00  0.84           C  
ATOM    932  C   VAL A 125      -5.896  22.069  30.553  1.00  0.84           C  
ATOM    933  O   VAL A 125      -4.683  22.060  30.357  1.00  0.84           O  
ATOM    934  CB  VAL A 125      -6.770  21.496  28.299  1.00  0.84           C  
ATOM    935  CG1 VAL A 125      -6.929  20.045  28.770  1.00  0.84           C  
ATOM    936  CG2 VAL A 125      -7.865  21.820  27.270  1.00  0.84           C  
ATOM    937  N   THR A 126      -6.412  21.745  31.748  1.00  0.81           N  
ATOM    938  CA  THR A 126      -5.604  21.584  32.950  1.00  0.81           C  
ATOM    939  C   THR A 126      -5.897  20.303  33.703  1.00  0.81           C  
ATOM    940  O   THR A 126      -5.194  19.968  34.655  1.00  0.81           O  
ATOM    941  CB  THR A 126      -5.825  22.727  33.936  1.00  0.81           C  
ATOM    942  OG1 THR A 126      -7.203  22.861  34.274  1.00  0.81           O  
ATOM    943  CG2 THR A 126      -5.382  24.052  33.298  1.00  0.81           C  
ATOM    944  N   ASP A 127      -6.913  19.537  33.273  1.00  0.83           N  
ATOM    945  CA  ASP A 127      -7.341  18.323  33.931  1.00  0.83           C  
ATOM    946  C   ASP A 127      -8.068  17.426  32.935  1.00  0.83           C  
ATOM    947  O   ASP A 127      -8.311  17.790  31.785  1.00  0.83           O  
ATOM    948  CB  ASP A 127      -8.186  18.591  35.217  1.00  0.83           C  
ATOM    949  CG  ASP A 127      -9.570  19.188  34.992  1.00  0.83           C  
ATOM    950  OD1 ASP A 127      -9.941  19.495  33.825  1.00  0.83           O  
ATOM    951  OD2 ASP A 127     -10.327  19.282  35.983  1.00  0.83           O  
ATOM    952  N   ASN A 128      -8.437  16.195  33.345  1.00  0.81           N  
ATOM    953  CA  ASN A 128      -9.169  15.267  32.495  1.00  0.81           C  
ATOM    954  C   ASN A 128     -10.552  15.782  32.088  1.00  0.81           C  
ATOM    955  O   ASN A 128     -11.011  15.543  30.972  1.00  0.81           O  
ATOM    956  CB  ASN A 128      -9.299  13.864  33.155  1.00  0.81           C  
ATOM    957  CG  ASN A 128      -7.964  13.123  33.113  1.00  0.81           C  
ATOM    958  OD1 ASN A 128      -6.968  13.575  32.555  1.00  0.81           O  
ATOM    959  ND2 ASN A 128      -7.939  11.912  33.719  1.00  0.81           N  
ATOM    960  N   ALA A 129     -11.256  16.513  32.975  1.00  0.86           N  
ATOM    961  CA  ALA A 129     -12.559  17.074  32.678  1.00  0.86           C  
ATOM    962  C   ALA A 129     -12.531  18.170  31.617  1.00  0.86           C  
ATOM    963  O   ALA A 129     -13.360  18.211  30.707  1.00  0.86           O  
ATOM    964  CB  ALA A 129     -13.185  17.601  33.981  1.00  0.86           C  
ATOM    965  N   SER A 130     -11.553  19.090  31.689  1.00  0.87           N  
ATOM    966  CA  SER A 130     -11.278  20.073  30.653  1.00  0.87           C  
ATOM    967  C   SER A 130     -10.742  19.462  29.374  1.00  0.87           C  
ATOM    968  O   SER A 130     -11.122  19.881  28.281  1.00  0.87           O  
ATOM    969  CB  SER A 130     -10.405  21.261  31.137  1.00  0.87           C  
ATOM    970  OG  SER A 130      -9.164  20.857  31.713  1.00  0.87           O  
ATOM    971  N   LEU A 131      -9.903  18.409  29.464  1.00  0.88           N  
ATOM    972  CA  LEU A 131      -9.432  17.644  28.318  1.00  0.88           C  
ATOM    973  C   LEU A 131     -10.559  16.971  27.547  1.00  0.88           C  
ATOM    974  O   LEU A 131     -10.630  17.050  26.321  1.00  0.88           O  
ATOM    975  CB  LEU A 131      -8.393  16.588  28.772  1.00  0.88           C  
ATOM    976  CG  LEU A 131      -7.622  15.885  27.638  1.00  0.88           C  
ATOM    977  CD1 LEU A 131      -6.662  16.839  26.913  1.00  0.88           C  
ATOM    978  CD2 LEU A 131      -6.849  14.672  28.173  1.00  0.88           C  
ATOM    979  N   LEU A 132     -11.527  16.352  28.255  1.00  0.88           N  
ATOM    980  CA  LEU A 132     -12.740  15.821  27.653  1.00  0.88           C  
ATOM    981  C   LEU A 132     -13.559  16.889  26.954  1.00  0.88           C  
ATOM    982  O   LEU A 132     -14.008  16.718  25.824  1.00  0.88           O  
ATOM    983  CB  LEU A 132     -13.614  15.148  28.742  1.00  0.88           C  
ATOM    984  CG  LEU A 132     -14.932  14.509  28.252  1.00  0.88           C  
ATOM    985  CD1 LEU A 132     -14.693  13.433  27.186  1.00  0.88           C  
ATOM    986  CD2 LEU A 132     -15.709  13.907  29.430  1.00  0.88           C  
ATOM    987  N   ARG A 133     -13.717  18.060  27.593  1.00  0.80           N  
ATOM    988  CA  ARG A 133     -14.448  19.193  27.059  1.00  0.80           C  
ATOM    989  C   ARG A 133     -13.871  19.722  25.751  1.00  0.80           C  
ATOM    990  O   ARG A 133     -14.599  20.024  24.809  1.00  0.80           O  
ATOM    991  CB  ARG A 133     -14.470  20.296  28.143  1.00  0.80           C  
ATOM    992  CG  ARG A 133     -15.816  21.019  28.321  1.00  0.80           C  
ATOM    993  CD  ARG A 133     -16.044  21.499  29.762  1.00  0.80           C  
ATOM    994  NE  ARG A 133     -14.914  22.421  30.129  1.00  0.80           N  
ATOM    995  CZ  ARG A 133     -14.154  22.323  31.230  1.00  0.80           C  
ATOM    996  NH1 ARG A 133     -14.272  21.323  32.099  1.00  0.80           N  
ATOM    997  NH2 ARG A 133     -13.220  23.248  31.444  1.00  0.80           N  
ATOM    998  N   PHE A 134     -12.530  19.794  25.647  1.00  0.90           N  
ATOM    999  CA  PHE A 134     -11.826  20.113  24.418  1.00  0.90           C  
ATOM   1000  C   PHE A 134     -12.108  19.128  23.278  1.00  0.90           C  
ATOM   1001  O   PHE A 134     -12.494  19.533  22.183  1.00  0.90           O  
ATOM   1002  CB  PHE A 134     -10.310  20.184  24.775  1.00  0.90           C  
ATOM   1003  CG  PHE A 134      -9.377  20.179  23.596  1.00  0.90           C  
ATOM   1004  CD1 PHE A 134      -9.470  21.148  22.585  1.00  0.90           C  
ATOM   1005  CD2 PHE A 134      -8.427  19.153  23.478  1.00  0.90           C  
ATOM   1006  CE1 PHE A 134      -8.636  21.080  21.460  1.00  0.90           C  
ATOM   1007  CE2 PHE A 134      -7.585  19.089  22.364  1.00  0.90           C  
ATOM   1008  CZ  PHE A 134      -7.694  20.048  21.352  1.00  0.90           C  
ATOM   1009  N   TYR A 135     -11.976  17.809  23.510  1.00  0.91           N  
ATOM   1010  CA  TYR A 135     -12.241  16.812  22.484  1.00  0.91           C  
ATOM   1011  C   TYR A 135     -13.714  16.716  22.090  1.00  0.91           C  
ATOM   1012  O   TYR A 135     -14.042  16.568  20.913  1.00  0.91           O  
ATOM   1013  CB  TYR A 135     -11.679  15.426  22.887  1.00  0.91           C  
ATOM   1014  CG  TYR A 135     -10.167  15.433  22.894  1.00  0.91           C  
ATOM   1015  CD1 TYR A 135      -9.419  15.696  21.728  1.00  0.91           C  
ATOM   1016  CD2 TYR A 135      -9.473  15.164  24.082  1.00  0.91           C  
ATOM   1017  CE1 TYR A 135      -8.016  15.733  21.768  1.00  0.91           C  
ATOM   1018  CE2 TYR A 135      -8.073  15.185  24.118  1.00  0.91           C  
ATOM   1019  CZ  TYR A 135      -7.346  15.501  22.972  1.00  0.91           C  
ATOM   1020  OH  TYR A 135      -5.945  15.612  23.048  1.00  0.91           O  
ATOM   1021  N   GLN A 136     -14.648  16.844  23.051  1.00  0.85           N  
ATOM   1022  CA  GLN A 136     -16.080  16.917  22.793  1.00  0.85           C  
ATOM   1023  C   GLN A 136     -16.496  18.128  21.960  1.00  0.85           C  
ATOM   1024  O   GLN A 136     -17.396  18.035  21.129  1.00  0.85           O  
ATOM   1025  CB  GLN A 136     -16.879  16.930  24.119  1.00  0.85           C  
ATOM   1026  CG  GLN A 136     -16.815  15.604  24.918  1.00  0.85           C  
ATOM   1027  CD  GLN A 136     -17.729  14.515  24.355  1.00  0.85           C  
ATOM   1028  OE1 GLN A 136     -17.492  13.939  23.294  1.00  0.85           O  
ATOM   1029  NE2 GLN A 136     -18.808  14.192  25.106  1.00  0.85           N  
ATOM   1030  N   ASN A 137     -15.838  19.291  22.146  1.00  0.85           N  
ATOM   1031  CA  ASN A 137     -16.166  20.504  21.407  1.00  0.85           C  
ATOM   1032  C   ASN A 137     -15.368  20.650  20.118  1.00  0.85           C  
ATOM   1033  O   ASN A 137     -15.574  21.587  19.346  1.00  0.85           O  
ATOM   1034  CB  ASN A 137     -15.856  21.755  22.266  1.00  0.85           C  
ATOM   1035  CG  ASN A 137     -16.892  21.913  23.369  1.00  0.85           C  
ATOM   1036  OD1 ASN A 137     -18.063  21.559  23.246  1.00  0.85           O  
ATOM   1037  ND2 ASN A 137     -16.466  22.523  24.497  1.00  0.85           N  
ATOM   1038  N   TRP A 138     -14.443  19.721  19.825  1.00  0.86           N  
ATOM   1039  CA  TRP A 138     -13.739  19.696  18.563  1.00  0.86           C  
ATOM   1040  C   TRP A 138     -14.646  19.339  17.393  1.00  0.86           C  
ATOM   1041  O   TRP A 138     -15.313  18.306  17.368  1.00  0.86           O  
ATOM   1042  CB  TRP A 138     -12.539  18.722  18.629  1.00  0.86           C  
ATOM   1043  CG  TRP A 138     -11.767  18.528  17.332  1.00  0.86           C  
ATOM   1044  CD1 TRP A 138     -11.104  19.437  16.550  1.00  0.86           C  
ATOM   1045  CD2 TRP A 138     -11.673  17.266  16.650  1.00  0.86           C  
ATOM   1046  NE1 TRP A 138     -10.588  18.820  15.429  1.00  0.86           N  
ATOM   1047  CE2 TRP A 138     -10.935  17.487  15.475  1.00  0.86           C  
ATOM   1048  CE3 TRP A 138     -12.156  16.000  16.978  1.00  0.86           C  
ATOM   1049  CZ2 TRP A 138     -10.657  16.446  14.602  1.00  0.86           C  
ATOM   1050  CZ3 TRP A 138     -11.855  14.943  16.108  1.00  0.86           C  
ATOM   1051  CH2 TRP A 138     -11.115  15.163  14.939  1.00  0.86           C  
ATOM   1052  N   GLN A 139     -14.638  20.209  16.373  1.00  0.83           N  
ATOM   1053  CA  GLN A 139     -15.359  20.020  15.138  1.00  0.83           C  
ATOM   1054  C   GLN A 139     -14.349  19.620  14.065  1.00  0.83           C  
ATOM   1055  O   GLN A 139     -13.532  20.460  13.683  1.00  0.83           O  
ATOM   1056  CB  GLN A 139     -16.091  21.327  14.739  1.00  0.83           C  
ATOM   1057  CG  GLN A 139     -17.219  21.708  15.732  1.00  0.83           C  
ATOM   1058  CD  GLN A 139     -17.877  23.044  15.377  1.00  0.83           C  
ATOM   1059  OE1 GLN A 139     -18.343  23.276  14.263  1.00  0.83           O  
ATOM   1060  NE2 GLN A 139     -17.941  23.964  16.369  1.00  0.83           N  
ATOM   1061  N   PRO A 140     -14.313  18.376  13.575  1.00  0.91           N  
ATOM   1062  CA  PRO A 140     -13.414  17.959  12.508  1.00  0.91           C  
ATOM   1063  C   PRO A 140     -13.580  18.754  11.232  1.00  0.91           C  
ATOM   1064  O   PRO A 140     -14.694  18.877  10.727  1.00  0.91           O  
ATOM   1065  CB  PRO A 140     -13.708  16.466  12.289  1.00  0.91           C  
ATOM   1066  CG  PRO A 140     -14.405  16.019  13.572  1.00  0.91           C  
ATOM   1067  CD  PRO A 140     -15.159  17.268  14.012  1.00  0.91           C  
ATOM   1068  N   GLN A 141     -12.481  19.289  10.680  1.00  0.86           N  
ATOM   1069  CA  GLN A 141     -12.521  20.015   9.426  1.00  0.86           C  
ATOM   1070  C   GLN A 141     -12.460  19.069   8.235  1.00  0.86           C  
ATOM   1071  O   GLN A 141     -12.828  19.399   7.108  1.00  0.86           O  
ATOM   1072  CB  GLN A 141     -11.351  21.026   9.393  1.00  0.86           C  
ATOM   1073  CG  GLN A 141     -11.319  21.910   8.125  1.00  0.86           C  
ATOM   1074  CD  GLN A 141     -10.364  23.091   8.276  1.00  0.86           C  
ATOM   1075  OE1 GLN A 141     -10.080  23.595   9.361  1.00  0.86           O  
ATOM   1076  NE2 GLN A 141      -9.848  23.577   7.125  1.00  0.86           N  
ATOM   1077  N   TRP A 142     -12.032  17.822   8.482  1.00  0.87           N  
ATOM   1078  CA  TRP A 142     -11.979  16.793   7.478  1.00  0.87           C  
ATOM   1079  C   TRP A 142     -12.516  15.500   8.052  1.00  0.87           C  
ATOM   1080  O   TRP A 142     -12.545  15.280   9.259  1.00  0.87           O  
ATOM   1081  CB  TRP A 142     -10.524  16.566   6.994  1.00  0.87           C  
ATOM   1082  CG  TRP A 142      -9.933  17.748   6.247  1.00  0.87           C  
ATOM   1083  CD1 TRP A 142     -10.112  18.118   4.941  1.00  0.87           C  
ATOM   1084  CD2 TRP A 142      -9.051  18.736   6.822  1.00  0.87           C  
ATOM   1085  NE1 TRP A 142      -9.385  19.256   4.659  1.00  0.87           N  
ATOM   1086  CE2 TRP A 142      -8.748  19.659   5.807  1.00  0.87           C  
ATOM   1087  CE3 TRP A 142      -8.524  18.878   8.105  1.00  0.87           C  
ATOM   1088  CZ2 TRP A 142      -7.925  20.750   6.050  1.00  0.87           C  
ATOM   1089  CZ3 TRP A 142      -7.704  19.990   8.358  1.00  0.87           C  
ATOM   1090  CH2 TRP A 142      -7.416  20.916   7.347  1.00  0.87           C  
ATOM   1091  N   LYS A 143     -12.957  14.588   7.163  1.00  0.89           N  
ATOM   1092  CA  LYS A 143     -13.276  13.212   7.500  1.00  0.89           C  
ATOM   1093  C   LYS A 143     -12.054  12.462   8.051  1.00  0.89           C  
ATOM   1094  O   LYS A 143     -10.938  12.818   7.668  1.00  0.89           O  
ATOM   1095  CB  LYS A 143     -13.829  12.467   6.252  1.00  0.89           C  
ATOM   1096  CG  LYS A 143     -15.088  13.107   5.635  1.00  0.89           C  
ATOM   1097  CD  LYS A 143     -15.704  12.281   4.486  1.00  0.89           C  
ATOM   1098  CE  LYS A 143     -14.761  11.932   3.324  1.00  0.89           C  
ATOM   1099  NZ  LYS A 143     -14.234  13.158   2.680  1.00  0.89           N  
ATOM   1100  N   PRO A 144     -12.164  11.472   8.941  1.00  0.94           N  
ATOM   1101  CA  PRO A 144     -11.032  10.625   9.320  1.00  0.94           C  
ATOM   1102  C   PRO A 144     -10.268  10.042   8.138  1.00  0.94           C  
ATOM   1103  O   PRO A 144     -10.884   9.679   7.136  1.00  0.94           O  
ATOM   1104  CB  PRO A 144     -11.625   9.521  10.219  1.00  0.94           C  
ATOM   1105  CG  PRO A 144     -13.086   9.916  10.472  1.00  0.94           C  
ATOM   1106  CD  PRO A 144     -13.436  10.865   9.331  1.00  0.94           C  
ATOM   1107  N   GLY A 145      -8.928   9.950   8.227  1.00  0.96           N  
ATOM   1108  CA  GLY A 145      -8.130   9.223   7.247  1.00  0.96           C  
ATOM   1109  C   GLY A 145      -7.834   9.948   5.961  1.00  0.96           C  
ATOM   1110  O   GLY A 145      -7.378   9.338   5.000  1.00  0.96           O  
ATOM   1111  N   THR A 146      -8.104  11.264   5.878  1.00  0.93           N  
ATOM   1112  CA  THR A 146      -7.971  11.999   4.615  1.00  0.93           C  
ATOM   1113  C   THR A 146      -6.917  13.090   4.629  1.00  0.93           C  
ATOM   1114  O   THR A 146      -6.328  13.397   3.594  1.00  0.93           O  
ATOM   1115  CB  THR A 146      -9.281  12.651   4.177  1.00  0.93           C  
ATOM   1116  OG1 THR A 146      -9.725  13.630   5.104  1.00  0.93           O  
ATOM   1117  CG2 THR A 146     -10.383  11.584   4.110  1.00  0.93           C  
ATOM   1118  N   THR A 147      -6.628  13.667   5.808  1.00  0.93           N  
ATOM   1119  CA  THR A 147      -5.751  14.825   5.953  1.00  0.93           C  
ATOM   1120  C   THR A 147      -4.851  14.601   7.144  1.00  0.93           C  
ATOM   1121  O   THR A 147      -5.321  14.352   8.251  1.00  0.93           O  
ATOM   1122  CB  THR A 147      -6.509  16.139   6.171  1.00  0.93           C  
ATOM   1123  OG1 THR A 147      -7.278  16.452   5.018  1.00  0.93           O  
ATOM   1124  CG2 THR A 147      -5.560  17.328   6.393  1.00  0.93           C  
ATOM   1125  N   ARG A 148      -3.519  14.707   6.957  1.00  0.87           N  
ATOM   1126  CA  ARG A 148      -2.548  14.675   8.036  1.00  0.87           C  
ATOM   1127  C   ARG A 148      -2.287  16.090   8.512  1.00  0.87           C  
ATOM   1128  O   ARG A 148      -1.875  16.942   7.731  1.00  0.87           O  
ATOM   1129  CB  ARG A 148      -1.200  14.063   7.568  1.00  0.87           C  
ATOM   1130  CG  ARG A 148      -0.080  14.029   8.634  1.00  0.87           C  
ATOM   1131  CD  ARG A 148       1.239  13.481   8.076  1.00  0.87           C  
ATOM   1132  NE  ARG A 148       2.309  13.520   9.124  1.00  0.87           N  
ATOM   1133  CZ  ARG A 148       3.158  14.534   9.343  1.00  0.87           C  
ATOM   1134  NH1 ARG A 148       2.970  15.747   8.837  1.00  0.87           N  
ATOM   1135  NH2 ARG A 148       4.213  14.310  10.120  1.00  0.87           N  
ATOM   1136  N   LEU A 149      -2.499  16.369   9.811  1.00  0.92           N  
ATOM   1137  CA  LEU A 149      -2.073  17.621  10.411  1.00  0.92           C  
ATOM   1138  C   LEU A 149      -1.279  17.308  11.656  1.00  0.92           C  
ATOM   1139  O   LEU A 149      -1.823  16.813  12.636  1.00  0.92           O  
ATOM   1140  CB  LEU A 149      -3.282  18.507  10.786  1.00  0.92           C  
ATOM   1141  CG  LEU A 149      -2.927  19.848  11.467  1.00  0.92           C  
ATOM   1142  CD1 LEU A 149      -2.086  20.760  10.565  1.00  0.92           C  
ATOM   1143  CD2 LEU A 149      -4.204  20.574  11.907  1.00  0.92           C  
ATOM   1144  N   TYR A 150       0.041  17.579  11.650  1.00  0.88           N  
ATOM   1145  CA  TYR A 150       0.934  17.253  12.750  1.00  0.88           C  
ATOM   1146  C   TYR A 150       0.509  17.853  14.095  1.00  0.88           C  
ATOM   1147  O   TYR A 150       0.371  19.066  14.245  1.00  0.88           O  
ATOM   1148  CB  TYR A 150       2.357  17.706  12.348  1.00  0.88           C  
ATOM   1149  CG  TYR A 150       3.400  17.386  13.377  1.00  0.88           C  
ATOM   1150  CD1 TYR A 150       4.066  16.154  13.373  1.00  0.88           C  
ATOM   1151  CD2 TYR A 150       3.731  18.344  14.346  1.00  0.88           C  
ATOM   1152  CE1 TYR A 150       5.076  15.895  14.307  1.00  0.88           C  
ATOM   1153  CE2 TYR A 150       4.732  18.087  15.292  1.00  0.88           C  
ATOM   1154  CZ  TYR A 150       5.414  16.865  15.252  1.00  0.88           C  
ATOM   1155  OH  TYR A 150       6.464  16.607  16.145  1.00  0.88           O  
ATOM   1156  N   ALA A 151       0.271  16.990  15.105  1.00  0.95           N  
ATOM   1157  CA  ALA A 151      -0.448  17.436  16.275  1.00  0.95           C  
ATOM   1158  C   ALA A 151      -0.119  16.718  17.575  1.00  0.95           C  
ATOM   1159  O   ALA A 151      -0.226  15.497  17.697  1.00  0.95           O  
ATOM   1160  CB  ALA A 151      -1.952  17.300  15.985  1.00  0.95           C  
ATOM   1161  N   ASN A 152       0.214  17.495  18.634  1.00  0.92           N  
ATOM   1162  CA  ASN A 152       0.350  17.016  20.003  1.00  0.92           C  
ATOM   1163  C   ASN A 152      -0.981  16.560  20.574  1.00  0.92           C  
ATOM   1164  O   ASN A 152      -1.045  15.582  21.311  1.00  0.92           O  
ATOM   1165  CB  ASN A 152       0.941  18.085  20.963  1.00  0.92           C  
ATOM   1166  CG  ASN A 152       2.379  18.409  20.591  1.00  0.92           C  
ATOM   1167  OD1 ASN A 152       3.080  17.644  19.928  1.00  0.92           O  
ATOM   1168  ND2 ASN A 152       2.894  19.555  21.079  1.00  0.92           N  
ATOM   1169  N   ALA A 153      -2.087  17.236  20.199  1.00  0.95           N  
ATOM   1170  CA  ALA A 153      -3.434  16.876  20.604  1.00  0.95           C  
ATOM   1171  C   ALA A 153      -3.906  15.552  19.998  1.00  0.95           C  
ATOM   1172  O   ALA A 153      -4.834  14.910  20.474  1.00  0.95           O  
ATOM   1173  CB  ALA A 153      -4.405  17.999  20.192  1.00  0.95           C  
ATOM   1174  N   SER A 154      -3.243  15.084  18.925  1.00  0.95           N  
ATOM   1175  CA  SER A 154      -3.579  13.803  18.316  1.00  0.95           C  
ATOM   1176  C   SER A 154      -2.772  12.660  18.924  1.00  0.95           C  
ATOM   1177  O   SER A 154      -3.317  11.767  19.575  1.00  0.95           O  
ATOM   1178  CB  SER A 154      -3.384  13.877  16.777  1.00  0.95           C  
ATOM   1179  OG  SER A 154      -4.216  12.957  16.072  1.00  0.95           O  
ATOM   1180  N   ILE A 155      -1.423  12.682  18.813  1.00  0.95           N  
ATOM   1181  CA  ILE A 155      -0.590  11.594  19.328  1.00  0.95           C  
ATOM   1182  C   ILE A 155      -0.500  11.571  20.851  1.00  0.95           C  
ATOM   1183  O   ILE A 155      -0.383  10.513  21.471  1.00  0.95           O  
ATOM   1184  CB  ILE A 155       0.790  11.542  18.679  1.00  0.95           C  
ATOM   1185  CG1 ILE A 155       1.519  10.213  19.000  1.00  0.95           C  
ATOM   1186  CG2 ILE A 155       1.633  12.766  19.080  1.00  0.95           C  
ATOM   1187  CD1 ILE A 155       2.809  10.004  18.201  1.00  0.95           C  
ATOM   1188  N   GLY A 156      -0.626  12.742  21.520  1.00  0.96           N  
ATOM   1189  CA  GLY A 156      -0.682  12.814  22.976  1.00  0.96           C  
ATOM   1190  C   GLY A 156      -1.843  12.056  23.561  1.00  0.96           C  
ATOM   1191  O   GLY A 156      -1.711  11.348  24.557  1.00  0.96           O  
ATOM   1192  N   LEU A 157      -3.024  12.152  22.914  1.00  0.93           N  
ATOM   1193  CA  LEU A 157      -4.189  11.383  23.304  1.00  0.93           C  
ATOM   1194  C   LEU A 157      -4.025   9.898  23.042  1.00  0.93           C  
ATOM   1195  O   LEU A 157      -4.373   9.074  23.885  1.00  0.93           O  
ATOM   1196  CB  LEU A 157      -5.484  11.914  22.647  1.00  0.93           C  
ATOM   1197  CG  LEU A 157      -6.783  11.241  23.152  1.00  0.93           C  
ATOM   1198  CD1 LEU A 157      -6.965  11.374  24.672  1.00  0.93           C  
ATOM   1199  CD2 LEU A 157      -8.019  11.789  22.425  1.00  0.93           C  
ATOM   1200  N   PHE A 158      -3.417   9.511  21.897  1.00  0.95           N  
ATOM   1201  CA  PHE A 158      -3.076   8.121  21.620  1.00  0.95           C  
ATOM   1202  C   PHE A 158      -2.209   7.516  22.718  1.00  0.95           C  
ATOM   1203  O   PHE A 158      -2.506   6.435  23.219  1.00  0.95           O  
ATOM   1204  CB  PHE A 158      -2.345   8.009  20.248  1.00  0.95           C  
ATOM   1205  CG  PHE A 158      -1.787   6.636  19.969  1.00  0.95           C  
ATOM   1206  CD1 PHE A 158      -2.635   5.561  19.662  1.00  0.95           C  
ATOM   1207  CD2 PHE A 158      -0.404   6.412  20.074  1.00  0.95           C  
ATOM   1208  CE1 PHE A 158      -2.106   4.278  19.465  1.00  0.95           C  
ATOM   1209  CE2 PHE A 158       0.127   5.131  19.882  1.00  0.95           C  
ATOM   1210  CZ  PHE A 158      -0.727   4.061  19.584  1.00  0.95           C  
ATOM   1211  N   GLY A 159      -1.153   8.228  23.166  1.00  0.96           N  
ATOM   1212  CA  GLY A 159      -0.290   7.729  24.229  1.00  0.96           C  
ATOM   1213  C   GLY A 159      -0.975   7.562  25.558  1.00  0.96           C  
ATOM   1214  O   GLY A 159      -0.722   6.609  26.288  1.00  0.96           O  
ATOM   1215  N   ALA A 160      -1.894   8.476  25.906  1.00  0.95           N  
ATOM   1216  CA  ALA A 160      -2.690   8.360  27.108  1.00  0.95           C  
ATOM   1217  C   ALA A 160      -3.686   7.203  27.090  1.00  0.95           C  
ATOM   1218  O   ALA A 160      -3.817   6.454  28.055  1.00  0.95           O  
ATOM   1219  CB  ALA A 160      -3.420   9.693  27.337  1.00  0.95           C  
ATOM   1220  N   LEU A 161      -4.404   7.016  25.971  1.00  0.92           N  
ATOM   1221  CA  LEU A 161      -5.357   5.936  25.815  1.00  0.92           C  
ATOM   1222  C   LEU A 161      -4.717   4.566  25.672  1.00  0.92           C  
ATOM   1223  O   LEU A 161      -5.216   3.579  26.214  1.00  0.92           O  
ATOM   1224  CB  LEU A 161      -6.296   6.214  24.623  1.00  0.92           C  
ATOM   1225  CG  LEU A 161      -7.163   7.483  24.765  1.00  0.92           C  
ATOM   1226  CD1 LEU A 161      -8.052   7.639  23.530  1.00  0.92           C  
ATOM   1227  CD2 LEU A 161      -8.018   7.500  26.040  1.00  0.92           C  
ATOM   1228  N   ALA A 162      -3.572   4.469  24.967  1.00  0.96           N  
ATOM   1229  CA  ALA A 162      -2.856   3.233  24.720  1.00  0.96           C  
ATOM   1230  C   ALA A 162      -2.402   2.503  25.977  1.00  0.96           C  
ATOM   1231  O   ALA A 162      -2.333   1.277  26.010  1.00  0.96           O  
ATOM   1232  CB  ALA A 162      -1.642   3.511  23.814  1.00  0.96           C  
ATOM   1233  N   VAL A 163      -2.109   3.242  27.063  1.00  0.94           N  
ATOM   1234  CA  VAL A 163      -1.682   2.639  28.313  1.00  0.94           C  
ATOM   1235  C   VAL A 163      -2.840   2.318  29.242  1.00  0.94           C  
ATOM   1236  O   VAL A 163      -2.643   1.700  30.281  1.00  0.94           O  
ATOM   1237  CB  VAL A 163      -0.679   3.506  29.070  1.00  0.94           C  
ATOM   1238  CG1 VAL A 163       0.565   3.704  28.188  1.00  0.94           C  
ATOM   1239  CG2 VAL A 163      -1.281   4.865  29.474  1.00  0.94           C  
ATOM   1240  N   LYS A 164      -4.097   2.662  28.896  1.00  0.88           N  
ATOM   1241  CA  LYS A 164      -5.237   2.376  29.759  1.00  0.88           C  
ATOM   1242  C   LYS A 164      -5.481   0.893  30.060  1.00  0.88           C  
ATOM   1243  O   LYS A 164      -5.740   0.595  31.228  1.00  0.88           O  
ATOM   1244  CB  LYS A 164      -6.534   3.069  29.262  1.00  0.88           C  
ATOM   1245  CG  LYS A 164      -7.745   2.884  30.195  1.00  0.88           C  
ATOM   1246  CD  LYS A 164      -8.994   3.604  29.681  1.00  0.88           C  
ATOM   1247  CE  LYS A 164     -10.216   3.384  30.573  1.00  0.88           C  
ATOM   1248  NZ  LYS A 164     -11.355   4.122  29.998  1.00  0.88           N  
ATOM   1249  N   PRO A 165      -5.393  -0.089  29.153  1.00  0.92           N  
ATOM   1250  CA  PRO A 165      -5.534  -1.496  29.522  1.00  0.92           C  
ATOM   1251  C   PRO A 165      -4.464  -2.014  30.455  1.00  0.92           C  
ATOM   1252  O   PRO A 165      -4.696  -3.011  31.129  1.00  0.92           O  
ATOM   1253  CB  PRO A 165      -5.503  -2.239  28.182  1.00  0.92           C  
ATOM   1254  CG  PRO A 165      -6.036  -1.214  27.184  1.00  0.92           C  
ATOM   1255  CD  PRO A 165      -5.421   0.085  27.694  1.00  0.92           C  
ATOM   1256  N   SER A 166      -3.276  -1.381  30.504  1.00  0.92           N  
ATOM   1257  CA  SER A 166      -2.198  -1.851  31.359  1.00  0.92           C  
ATOM   1258  C   SER A 166      -2.456  -1.609  32.832  1.00  0.92           C  
ATOM   1259  O   SER A 166      -1.921  -2.297  33.699  1.00  0.92           O  
ATOM   1260  CB  SER A 166      -0.832  -1.213  30.974  1.00  0.92           C  
ATOM   1261  OG  SER A 166      -0.619   0.102  31.497  1.00  0.92           O  
ATOM   1262  N   GLY A 167      -3.279  -0.582  33.130  1.00  0.91           N  
ATOM   1263  CA  GLY A 167      -3.608  -0.153  34.479  1.00  0.91           C  
ATOM   1264  C   GLY A 167      -2.568   0.728  35.112  1.00  0.91           C  
ATOM   1265  O   GLY A 167      -2.713   1.148  36.257  1.00  0.91           O  
ATOM   1266  N   MET A 168      -1.488   1.049  34.382  1.00  0.88           N  
ATOM   1267  CA  MET A 168      -0.422   1.890  34.875  1.00  0.88           C  
ATOM   1268  C   MET A 168      -0.579   3.323  34.385  1.00  0.88           C  
ATOM   1269  O   MET A 168      -0.997   3.545  33.246  1.00  0.88           O  
ATOM   1270  CB  MET A 168       0.956   1.377  34.400  1.00  0.88           C  
ATOM   1271  CG  MET A 168       1.386   0.061  35.072  1.00  0.88           C  
ATOM   1272  SD  MET A 168       3.004  -0.552  34.507  1.00  0.88           S  
ATOM   1273  CE  MET A 168       2.406  -1.241  32.942  1.00  0.88           C  
ATOM   1274  N   PRO A 169      -0.236   4.352  35.167  1.00  0.91           N  
ATOM   1275  CA  PRO A 169       0.034   5.685  34.640  1.00  0.91           C  
ATOM   1276  C   PRO A 169       1.072   5.687  33.529  1.00  0.91           C  
ATOM   1277  O   PRO A 169       1.937   4.812  33.493  1.00  0.91           O  
ATOM   1278  CB  PRO A 169       0.504   6.500  35.860  1.00  0.91           C  
ATOM   1279  CG  PRO A 169       0.035   5.695  37.077  1.00  0.91           C  
ATOM   1280  CD  PRO A 169       0.103   4.254  36.587  1.00  0.91           C  
ATOM   1281  N   TYR A 170       1.029   6.683  32.625  1.00  0.91           N  
ATOM   1282  CA  TYR A 170       1.863   6.716  31.434  1.00  0.91           C  
ATOM   1283  C   TYR A 170       3.364   6.640  31.711  1.00  0.91           C  
ATOM   1284  O   TYR A 170       4.077   5.872  31.067  1.00  0.91           O  
ATOM   1285  CB  TYR A 170       1.518   7.996  30.624  1.00  0.91           C  
ATOM   1286  CG  TYR A 170       2.241   8.032  29.307  1.00  0.91           C  
ATOM   1287  CD1 TYR A 170       1.749   7.297  28.221  1.00  0.91           C  
ATOM   1288  CD2 TYR A 170       3.441   8.753  29.163  1.00  0.91           C  
ATOM   1289  CE1 TYR A 170       2.448   7.272  27.009  1.00  0.91           C  
ATOM   1290  CE2 TYR A 170       4.146   8.726  27.952  1.00  0.91           C  
ATOM   1291  CZ  TYR A 170       3.640   7.987  26.879  1.00  0.91           C  
ATOM   1292  OH  TYR A 170       4.299   7.974  25.645  1.00  0.91           O  
ATOM   1293  N   GLU A 171       3.874   7.394  32.707  1.00  0.89           N  
ATOM   1294  CA  GLU A 171       5.278   7.345  33.078  1.00  0.89           C  
ATOM   1295  C   GLU A 171       5.726   5.972  33.552  1.00  0.89           C  
ATOM   1296  O   GLU A 171       6.732   5.433  33.100  1.00  0.89           O  
ATOM   1297  CB  GLU A 171       5.575   8.410  34.163  1.00  0.89           C  
ATOM   1298  CG  GLU A 171       7.036   8.408  34.689  1.00  0.89           C  
ATOM   1299  CD  GLU A 171       7.357   9.643  35.525  1.00  0.89           C  
ATOM   1300  OE1 GLU A 171       6.604   9.915  36.491  1.00  0.89           O  
ATOM   1301  OE2 GLU A 171       8.350  10.349  35.199  1.00  0.89           O  
ATOM   1302  N   GLN A 172       4.936   5.318  34.422  1.00  0.87           N  
ATOM   1303  CA  GLN A 172       5.230   3.975  34.873  1.00  0.87           C  
ATOM   1304  C   GLN A 172       5.166   2.934  33.765  1.00  0.87           C  
ATOM   1305  O   GLN A 172       6.036   2.070  33.666  1.00  0.87           O  
ATOM   1306  CB  GLN A 172       4.307   3.583  36.043  1.00  0.87           C  
ATOM   1307  CG  GLN A 172       4.677   2.221  36.672  1.00  0.87           C  
ATOM   1308  CD  GLN A 172       3.847   1.956  37.925  1.00  0.87           C  
ATOM   1309  OE1 GLN A 172       2.618   1.951  37.896  1.00  0.87           O  
ATOM   1310  NE2 GLN A 172       4.534   1.724  39.067  1.00  0.87           N  
ATOM   1311  N   ALA A 173       4.164   3.019  32.867  1.00  0.95           N  
ATOM   1312  CA  ALA A 173       4.075   2.158  31.705  1.00  0.95           C  
ATOM   1313  C   ALA A 173       5.264   2.293  30.761  1.00  0.95           C  
ATOM   1314  O   ALA A 173       5.854   1.294  30.352  1.00  0.95           O  
ATOM   1315  CB  ALA A 173       2.769   2.451  30.944  1.00  0.95           C  
ATOM   1316  N   MET A 174       5.689   3.535  30.455  1.00  0.92           N  
ATOM   1317  CA  MET A 174       6.871   3.801  29.656  1.00  0.92           C  
ATOM   1318  C   MET A 174       8.153   3.264  30.276  1.00  0.92           C  
ATOM   1319  O   MET A 174       8.955   2.579  29.641  1.00  0.92           O  
ATOM   1320  CB  MET A 174       7.023   5.331  29.482  1.00  0.92           C  
ATOM   1321  CG  MET A 174       8.201   5.761  28.583  1.00  0.92           C  
ATOM   1322  SD  MET A 174       8.126   5.116  26.889  1.00  0.92           S  
ATOM   1323  CE  MET A 174       6.871   6.313  26.366  1.00  0.92           C  
ATOM   1324  N   THR A 175       8.364   3.535  31.575  1.00  0.92           N  
ATOM   1325  CA  THR A 175       9.550   3.096  32.291  1.00  0.92           C  
ATOM   1326  C   THR A 175       9.627   1.589  32.430  1.00  0.92           C  
ATOM   1327  O   THR A 175      10.662   0.982  32.166  1.00  0.92           O  
ATOM   1328  CB  THR A 175       9.658   3.748  33.663  1.00  0.92           C  
ATOM   1329  OG1 THR A 175       9.650   5.159  33.516  1.00  0.92           O  
ATOM   1330  CG2 THR A 175      10.992   3.411  34.330  1.00  0.92           C  
ATOM   1331  N   THR A 176       8.519   0.930  32.818  1.00  0.92           N  
ATOM   1332  CA  THR A 176       8.433  -0.521  32.973  1.00  0.92           C  
ATOM   1333  C   THR A 176       8.567  -1.277  31.666  1.00  0.92           C  
ATOM   1334  O   THR A 176       9.249  -2.295  31.616  1.00  0.92           O  
ATOM   1335  CB  THR A 176       7.150  -0.941  33.693  1.00  0.92           C  
ATOM   1336  OG1 THR A 176       7.182  -0.472  35.038  1.00  0.92           O  
ATOM   1337  CG2 THR A 176       6.969  -2.464  33.777  1.00  0.92           C  
ATOM   1338  N   ARG A 177       7.925  -0.813  30.573  1.00  0.88           N  
ATOM   1339  CA  ARG A 177       7.843  -1.602  29.348  1.00  0.88           C  
ATOM   1340  C   ARG A 177       8.778  -1.177  28.228  1.00  0.88           C  
ATOM   1341  O   ARG A 177       8.963  -1.922  27.272  1.00  0.88           O  
ATOM   1342  CB  ARG A 177       6.410  -1.532  28.778  1.00  0.88           C  
ATOM   1343  CG  ARG A 177       5.342  -2.096  29.729  1.00  0.88           C  
ATOM   1344  CD  ARG A 177       3.957  -1.919  29.125  1.00  0.88           C  
ATOM   1345  NE  ARG A 177       3.014  -2.782  29.881  1.00  0.88           N  
ATOM   1346  CZ  ARG A 177       1.788  -3.047  29.412  1.00  0.88           C  
ATOM   1347  NH1 ARG A 177       1.331  -2.460  28.312  1.00  0.88           N  
ATOM   1348  NH2 ARG A 177       1.030  -3.923  30.057  1.00  0.88           N  
ATOM   1349  N   VAL A 178       9.413   0.008  28.303  1.00  0.94           N  
ATOM   1350  CA  VAL A 178      10.291   0.463  27.225  1.00  0.94           C  
ATOM   1351  C   VAL A 178      11.657   0.837  27.760  1.00  0.94           C  
ATOM   1352  O   VAL A 178      12.675   0.348  27.273  1.00  0.94           O  
ATOM   1353  CB  VAL A 178       9.699   1.652  26.457  1.00  0.94           C  
ATOM   1354  CG1 VAL A 178      10.652   2.138  25.345  1.00  0.94           C  
ATOM   1355  CG2 VAL A 178       8.358   1.241  25.821  1.00  0.94           C  
ATOM   1356  N   LEU A 179      11.747   1.700  28.793  1.00  0.92           N  
ATOM   1357  CA  LEU A 179      13.042   2.181  29.254  1.00  0.92           C  
ATOM   1358  C   LEU A 179      13.868   1.143  30.007  1.00  0.92           C  
ATOM   1359  O   LEU A 179      15.013   0.876  29.650  1.00  0.92           O  
ATOM   1360  CB  LEU A 179      12.890   3.460  30.113  1.00  0.92           C  
ATOM   1361  CG  LEU A 179      12.077   4.598  29.453  1.00  0.92           C  
ATOM   1362  CD1 LEU A 179      12.010   5.799  30.405  1.00  0.92           C  
ATOM   1363  CD2 LEU A 179      12.655   5.034  28.099  1.00  0.92           C  
ATOM   1364  N   LYS A 180      13.290   0.466  31.024  1.00  0.88           N  
ATOM   1365  CA  LYS A 180      13.989  -0.564  31.782  1.00  0.88           C  
ATOM   1366  C   LYS A 180      14.405  -1.793  30.957  1.00  0.88           C  
ATOM   1367  O   LYS A 180      15.541  -2.236  31.140  1.00  0.88           O  
ATOM   1368  CB  LYS A 180      13.194  -1.002  33.047  1.00  0.88           C  
ATOM   1369  CG  LYS A 180      13.082   0.064  34.154  1.00  0.88           C  
ATOM   1370  CD  LYS A 180      12.185  -0.424  35.307  1.00  0.88           C  
ATOM   1371  CE  LYS A 180      12.091   0.549  36.483  1.00  0.88           C  
ATOM   1372  NZ  LYS A 180      11.111   0.031  37.462  1.00  0.88           N  
ATOM   1373  N   PRO A 181      13.639  -2.390  30.028  1.00  0.92           N  
ATOM   1374  CA  PRO A 181      14.118  -3.517  29.223  1.00  0.92           C  
ATOM   1375  C   PRO A 181      15.304  -3.180  28.340  1.00  0.92           C  
ATOM   1376  O   PRO A 181      16.115  -4.058  28.040  1.00  0.92           O  
ATOM   1377  CB  PRO A 181      12.894  -3.939  28.395  1.00  0.92           C  
ATOM   1378  CG  PRO A 181      11.701  -3.500  29.244  1.00  0.92           C  
ATOM   1379  CD  PRO A 181      12.192  -2.199  29.865  1.00  0.92           C  
ATOM   1380  N   LEU A 182      15.423  -1.915  27.905  1.00  0.90           N  
ATOM   1381  CA  LEU A 182      16.493  -1.488  27.029  1.00  0.90           C  
ATOM   1382  C   LEU A 182      17.662  -0.887  27.786  1.00  0.90           C  
ATOM   1383  O   LEU A 182      18.659  -0.520  27.170  1.00  0.90           O  
ATOM   1384  CB  LEU A 182      15.968  -0.438  26.021  1.00  0.90           C  
ATOM   1385  CG  LEU A 182      14.945  -0.982  25.006  1.00  0.90           C  
ATOM   1386  CD1 LEU A 182      14.397   0.159  24.142  1.00  0.90           C  
ATOM   1387  CD2 LEU A 182      15.534  -2.072  24.103  1.00  0.90           C  
ATOM   1388  N   LYS A 183      17.577  -0.816  29.133  1.00  0.87           N  
ATOM   1389  CA  LYS A 183      18.581  -0.222  30.009  1.00  0.87           C  
ATOM   1390  C   LYS A 183      18.801   1.255  29.738  1.00  0.87           C  
ATOM   1391  O   LYS A 183      19.926   1.745  29.659  1.00  0.87           O  
ATOM   1392  CB  LYS A 183      19.931  -0.983  30.008  1.00  0.87           C  
ATOM   1393  CG  LYS A 183      19.794  -2.476  30.326  1.00  0.87           C  
ATOM   1394  CD  LYS A 183      21.171  -3.128  30.503  1.00  0.87           C  
ATOM   1395  CE  LYS A 183      21.104  -4.611  30.860  1.00  0.87           C  
ATOM   1396  NZ  LYS A 183      20.640  -5.386  29.689  1.00  0.87           N  
ATOM   1397  N   LEU A 184      17.693   1.999  29.589  1.00  0.92           N  
ATOM   1398  CA  LEU A 184      17.711   3.431  29.392  1.00  0.92           C  
ATOM   1399  C   LEU A 184      17.416   4.086  30.723  1.00  0.92           C  
ATOM   1400  O   LEU A 184      16.327   4.610  30.978  1.00  0.92           O  
ATOM   1401  CB  LEU A 184      16.692   3.876  28.315  1.00  0.92           C  
ATOM   1402  CG  LEU A 184      16.907   3.221  26.937  1.00  0.92           C  
ATOM   1403  CD1 LEU A 184      15.851   3.708  25.940  1.00  0.92           C  
ATOM   1404  CD2 LEU A 184      18.308   3.490  26.372  1.00  0.92           C  
ATOM   1405  N   ASP A 185      18.415   4.032  31.619  1.00  0.89           N  
ATOM   1406  CA  ASP A 185      18.260   4.274  33.035  1.00  0.89           C  
ATOM   1407  C   ASP A 185      18.493   5.744  33.383  1.00  0.89           C  
ATOM   1408  O   ASP A 185      18.335   6.168  34.529  1.00  0.89           O  
ATOM   1409  CB  ASP A 185      19.268   3.370  33.797  1.00  0.89           C  
ATOM   1410  CG  ASP A 185      18.923   1.891  33.663  1.00  0.89           C  
ATOM   1411  OD1 ASP A 185      17.711   1.548  33.650  1.00  0.89           O  
ATOM   1412  OD2 ASP A 185      19.879   1.074  33.609  1.00  0.89           O  
ATOM   1413  N   HIS A 186      18.813   6.575  32.372  1.00  0.91           N  
ATOM   1414  CA  HIS A 186      18.988   8.008  32.504  1.00  0.91           C  
ATOM   1415  C   HIS A 186      18.104   8.762  31.514  1.00  0.91           C  
ATOM   1416  O   HIS A 186      18.370   9.905  31.134  1.00  0.91           O  
ATOM   1417  CB  HIS A 186      20.477   8.397  32.363  1.00  0.91           C  
ATOM   1418  CG  HIS A 186      21.318   7.840  33.486  1.00  0.91           C  
ATOM   1419  ND1 HIS A 186      21.887   6.586  33.370  1.00  0.91           N  
ATOM   1420  CD2 HIS A 186      21.543   8.336  34.732  1.00  0.91           C  
ATOM   1421  CE1 HIS A 186      22.428   6.337  34.543  1.00  0.91           C  
ATOM   1422  NE2 HIS A 186      22.253   7.365  35.406  1.00  0.91           N  
ATOM   1423  N   THR A 187      16.986   8.135  31.101  1.00  0.94           N  
ATOM   1424  CA  THR A 187      15.947   8.731  30.270  1.00  0.94           C  
ATOM   1425  C   THR A 187      14.741   9.002  31.153  1.00  0.94           C  
ATOM   1426  O   THR A 187      14.231   8.112  31.827  1.00  0.94           O  
ATOM   1427  CB  THR A 187      15.508   7.825  29.127  1.00  0.94           C  
ATOM   1428  OG1 THR A 187      16.583   7.625  28.203  1.00  0.94           O  
ATOM   1429  CG2 THR A 187      14.331   8.442  28.357  1.00  0.94           C  
ATOM   1430  N   TRP A 188      14.247  10.257  31.195  1.00  0.88           N  
ATOM   1431  CA  TRP A 188      13.329  10.700  32.231  1.00  0.88           C  
ATOM   1432  C   TRP A 188      12.146  11.473  31.679  1.00  0.88           C  
ATOM   1433  O   TRP A 188      12.303  12.374  30.858  1.00  0.88           O  
ATOM   1434  CB  TRP A 188      14.032  11.677  33.209  1.00  0.88           C  
ATOM   1435  CG  TRP A 188      15.334  11.179  33.792  1.00  0.88           C  
ATOM   1436  CD1 TRP A 188      16.611  11.556  33.477  1.00  0.88           C  
ATOM   1437  CD2 TRP A 188      15.452  10.166  34.809  1.00  0.88           C  
ATOM   1438  NE1 TRP A 188      17.519  10.867  34.250  1.00  0.88           N  
ATOM   1439  CE2 TRP A 188      16.825   9.994  35.055  1.00  0.88           C  
ATOM   1440  CE3 TRP A 188      14.492   9.422  35.497  1.00  0.88           C  
ATOM   1441  CZ2 TRP A 188      17.275   9.066  35.982  1.00  0.88           C  
ATOM   1442  CZ3 TRP A 188      14.948   8.495  36.449  1.00  0.88           C  
ATOM   1443  CH2 TRP A 188      16.320   8.317  36.684  1.00  0.88           C  
ATOM   1444  N   ILE A 189      10.917  11.187  32.154  1.00  0.93           N  
ATOM   1445  CA  ILE A 189       9.783  12.093  31.980  1.00  0.93           C  
ATOM   1446  C   ILE A 189       9.846  13.166  33.059  1.00  0.93           C  
ATOM   1447  O   ILE A 189       9.914  14.365  32.772  1.00  0.93           O  
ATOM   1448  CB  ILE A 189       8.478  11.304  31.992  1.00  0.93           C  
ATOM   1449  CG1 ILE A 189       8.350  10.541  30.652  1.00  0.93           C  
ATOM   1450  CG2 ILE A 189       7.246  12.203  32.244  1.00  0.93           C  
ATOM   1451  CD1 ILE A 189       7.413   9.333  30.713  1.00  0.93           C  
ATOM   1452  N   ASN A 190       9.957  12.753  34.332  1.00  0.90           N  
ATOM   1453  CA  ASN A 190      10.305  13.643  35.419  1.00  0.90           C  
ATOM   1454  C   ASN A 190      11.746  13.387  35.847  1.00  0.90           C  
ATOM   1455  O   ASN A 190      12.125  12.276  36.200  1.00  0.90           O  
ATOM   1456  CB  ASN A 190       9.350  13.424  36.608  1.00  0.90           C  
ATOM   1457  CG  ASN A 190       7.944  13.819  36.170  1.00  0.90           C  
ATOM   1458  OD1 ASN A 190       7.674  14.999  35.933  1.00  0.90           O  
ATOM   1459  ND2 ASN A 190       7.040  12.827  36.039  1.00  0.90           N  
ATOM   1460  N   VAL A 191      12.615  14.423  35.800  1.00  0.91           N  
ATOM   1461  CA  VAL A 191      14.006  14.310  36.227  1.00  0.91           C  
ATOM   1462  C   VAL A 191      14.076  14.316  37.753  1.00  0.91           C  
ATOM   1463  O   VAL A 191      13.610  15.285  38.358  1.00  0.91           O  
ATOM   1464  CB  VAL A 191      14.890  15.423  35.657  1.00  0.91           C  
ATOM   1465  CG1 VAL A 191      16.347  15.293  36.146  1.00  0.91           C  
ATOM   1466  CG2 VAL A 191      14.875  15.366  34.118  1.00  0.91           C  
ATOM   1467  N   PRO A 192      14.599  13.300  38.448  1.00  0.83           N  
ATOM   1468  CA  PRO A 192      14.713  13.331  39.897  1.00  0.83           C  
ATOM   1469  C   PRO A 192      15.643  14.422  40.379  1.00  0.83           C  
ATOM   1470  O   PRO A 192      16.575  14.800  39.674  1.00  0.83           O  
ATOM   1471  CB  PRO A 192      15.255  11.942  40.288  1.00  0.83           C  
ATOM   1472  CG  PRO A 192      15.001  11.046  39.073  1.00  0.83           C  
ATOM   1473  CD  PRO A 192      15.019  12.012  37.892  1.00  0.83           C  
ATOM   1474  N   LYS A 193      15.450  14.904  41.619  1.00  0.76           N  
ATOM   1475  CA  LYS A 193      16.277  15.933  42.231  1.00  0.76           C  
ATOM   1476  C   LYS A 193      17.758  15.574  42.277  1.00  0.76           C  
ATOM   1477  O   LYS A 193      18.631  16.420  42.118  1.00  0.76           O  
ATOM   1478  CB  LYS A 193      15.757  16.210  43.663  1.00  0.76           C  
ATOM   1479  CG  LYS A 193      16.509  17.314  44.425  1.00  0.76           C  
ATOM   1480  CD  LYS A 193      15.839  17.623  45.773  1.00  0.76           C  
ATOM   1481  CE  LYS A 193      16.450  18.815  46.514  1.00  0.76           C  
ATOM   1482  NZ  LYS A 193      17.840  18.516  46.931  1.00  0.76           N  
ATOM   1483  N   ALA A 194      18.068  14.280  42.466  1.00  0.79           N  
ATOM   1484  CA  ALA A 194      19.417  13.762  42.446  1.00  0.79           C  
ATOM   1485  C   ALA A 194      20.119  13.869  41.091  1.00  0.79           C  
ATOM   1486  O   ALA A 194      21.338  14.006  41.024  1.00  0.79           O  
ATOM   1487  CB  ALA A 194      19.361  12.303  42.928  1.00  0.79           C  
ATOM   1488  N   GLU A 195      19.353  13.858  39.985  1.00  0.79           N  
ATOM   1489  CA  GLU A 195      19.896  13.892  38.640  1.00  0.79           C  
ATOM   1490  C   GLU A 195      19.865  15.286  38.026  1.00  0.79           C  
ATOM   1491  O   GLU A 195      20.344  15.501  36.912  1.00  0.79           O  
ATOM   1492  CB  GLU A 195      19.068  12.967  37.720  1.00  0.79           C  
ATOM   1493  CG  GLU A 195      19.055  11.479  38.147  1.00  0.79           C  
ATOM   1494  CD  GLU A 195      20.410  10.786  38.011  1.00  0.79           C  
ATOM   1495  OE1 GLU A 195      21.120  11.048  37.007  1.00  0.79           O  
ATOM   1496  OE2 GLU A 195      20.726   9.956  38.902  1.00  0.79           O  
ATOM   1497  N   GLU A 196      19.332  16.302  38.745  1.00  0.82           N  
ATOM   1498  CA  GLU A 196      19.156  17.660  38.233  1.00  0.82           C  
ATOM   1499  C   GLU A 196      20.462  18.330  37.839  1.00  0.82           C  
ATOM   1500  O   GLU A 196      20.545  19.050  36.849  1.00  0.82           O  
ATOM   1501  CB  GLU A 196      18.345  18.545  39.211  1.00  0.82           C  
ATOM   1502  CG  GLU A 196      17.816  19.883  38.614  1.00  0.82           C  
ATOM   1503  CD  GLU A 196      18.855  21.004  38.538  1.00  0.82           C  
ATOM   1504  OE1 GLU A 196      19.773  21.031  39.393  1.00  0.82           O  
ATOM   1505  OE2 GLU A 196      18.718  21.861  37.617  1.00  0.82           O  
ATOM   1506  N   ALA A 197      21.564  18.016  38.545  1.00  0.89           N  
ATOM   1507  CA  ALA A 197      22.882  18.523  38.239  1.00  0.89           C  
ATOM   1508  C   ALA A 197      23.389  18.228  36.825  1.00  0.89           C  
ATOM   1509  O   ALA A 197      24.226  18.976  36.306  1.00  0.89           O  
ATOM   1510  CB  ALA A 197      23.874  17.951  39.264  1.00  0.89           C  
ATOM   1511  N   HIS A 198      22.865  17.155  36.188  1.00  0.90           N  
ATOM   1512  CA  HIS A 198      23.159  16.785  34.813  1.00  0.90           C  
ATOM   1513  C   HIS A 198      22.247  17.455  33.796  1.00  0.90           C  
ATOM   1514  O   HIS A 198      22.472  17.367  32.591  1.00  0.90           O  
ATOM   1515  CB  HIS A 198      22.958  15.265  34.604  1.00  0.90           C  
ATOM   1516  CG  HIS A 198      23.870  14.417  35.430  1.00  0.90           C  
ATOM   1517  ND1 HIS A 198      25.239  14.517  35.262  1.00  0.90           N  
ATOM   1518  CD2 HIS A 198      23.577  13.482  36.370  1.00  0.90           C  
ATOM   1519  CE1 HIS A 198      25.751  13.642  36.103  1.00  0.90           C  
ATOM   1520  NE2 HIS A 198      24.789  12.988  36.799  1.00  0.90           N  
ATOM   1521  N   TYR A 199      21.185  18.151  34.234  1.00  0.92           N  
ATOM   1522  CA  TYR A 199      20.231  18.808  33.364  1.00  0.92           C  
ATOM   1523  C   TYR A 199      20.817  20.086  32.793  1.00  0.92           C  
ATOM   1524  O   TYR A 199      21.130  21.047  33.495  1.00  0.92           O  
ATOM   1525  CB  TYR A 199      18.920  19.062  34.168  1.00  0.92           C  
ATOM   1526  CG  TYR A 199      17.621  19.271  33.416  1.00  0.92           C  
ATOM   1527  CD1 TYR A 199      17.510  19.505  32.031  1.00  0.92           C  
ATOM   1528  CD2 TYR A 199      16.437  19.203  34.175  1.00  0.92           C  
ATOM   1529  CE1 TYR A 199      16.249  19.657  31.429  1.00  0.92           C  
ATOM   1530  CE2 TYR A 199      15.181  19.335  33.572  1.00  0.92           C  
ATOM   1531  CZ  TYR A 199      15.085  19.567  32.202  1.00  0.92           C  
ATOM   1532  OH  TYR A 199      13.798  19.649  31.636  1.00  0.92           O  
ATOM   1533  N   ALA A 200      20.981  20.139  31.461  1.00  0.96           N  
ATOM   1534  CA  ALA A 200      21.331  21.359  30.781  1.00  0.96           C  
ATOM   1535  C   ALA A 200      20.300  22.470  30.950  1.00  0.96           C  
ATOM   1536  O   ALA A 200      19.126  22.257  31.261  1.00  0.96           O  
ATOM   1537  CB  ALA A 200      21.588  21.094  29.289  1.00  0.96           C  
ATOM   1538  N   TRP A 201      20.732  23.719  30.757  1.00  0.88           N  
ATOM   1539  CA  TRP A 201      19.792  24.786  30.506  1.00  0.88           C  
ATOM   1540  C   TRP A 201      19.627  24.916  29.013  1.00  0.88           C  
ATOM   1541  O   TRP A 201      20.591  24.817  28.257  1.00  0.88           O  
ATOM   1542  CB  TRP A 201      20.235  26.122  31.138  1.00  0.88           C  
ATOM   1543  CG  TRP A 201      19.969  26.157  32.631  1.00  0.88           C  
ATOM   1544  CD1 TRP A 201      20.799  25.872  33.681  1.00  0.88           C  
ATOM   1545  CD2 TRP A 201      18.685  26.472  33.210  1.00  0.88           C  
ATOM   1546  NE1 TRP A 201      20.118  25.988  34.875  1.00  0.88           N  
ATOM   1547  CE2 TRP A 201      18.821  26.353  34.603  1.00  0.88           C  
ATOM   1548  CE3 TRP A 201      17.471  26.841  32.632  1.00  0.88           C  
ATOM   1549  CZ2 TRP A 201      17.749  26.596  35.453  1.00  0.88           C  
ATOM   1550  CZ3 TRP A 201      16.389  27.101  33.490  1.00  0.88           C  
ATOM   1551  CH2 TRP A 201      16.524  26.973  34.880  1.00  0.88           C  
ATOM   1552  N   GLY A 202      18.376  25.106  28.557  1.00  0.95           N  
ATOM   1553  CA  GLY A 202      18.097  25.477  27.184  1.00  0.95           C  
ATOM   1554  C   GLY A 202      18.256  26.948  27.021  1.00  0.95           C  
ATOM   1555  O   GLY A 202      18.109  27.699  27.979  1.00  0.95           O  
ATOM   1556  N   TYR A 203      18.558  27.411  25.806  1.00  0.90           N  
ATOM   1557  CA  TYR A 203      18.814  28.812  25.569  1.00  0.90           C  
ATOM   1558  C   TYR A 203      17.968  29.329  24.429  1.00  0.90           C  
ATOM   1559  O   TYR A 203      17.848  28.741  23.356  1.00  0.90           O  
ATOM   1560  CB  TYR A 203      20.315  29.095  25.318  1.00  0.90           C  
ATOM   1561  CG  TYR A 203      21.077  28.904  26.608  1.00  0.90           C  
ATOM   1562  CD1 TYR A 203      21.182  29.954  27.537  1.00  0.90           C  
ATOM   1563  CD2 TYR A 203      21.647  27.660  26.928  1.00  0.90           C  
ATOM   1564  CE1 TYR A 203      21.845  29.762  28.758  1.00  0.90           C  
ATOM   1565  CE2 TYR A 203      22.305  27.464  28.151  1.00  0.90           C  
ATOM   1566  CZ  TYR A 203      22.397  28.517  29.066  1.00  0.90           C  
ATOM   1567  OH  TYR A 203      23.022  28.337  30.315  1.00  0.90           O  
ATOM   1568  N   ARG A 204      17.318  30.476  24.671  1.00  0.78           N  
ATOM   1569  CA  ARG A 204      16.556  31.172  23.664  1.00  0.78           C  
ATOM   1570  C   ARG A 204      16.829  32.648  23.806  1.00  0.78           C  
ATOM   1571  O   ARG A 204      16.620  33.222  24.873  1.00  0.78           O  
ATOM   1572  CB  ARG A 204      15.060  30.874  23.854  1.00  0.78           C  
ATOM   1573  CG  ARG A 204      14.139  31.566  22.834  1.00  0.78           C  
ATOM   1574  CD  ARG A 204      12.676  31.124  22.896  1.00  0.78           C  
ATOM   1575  NE  ARG A 204      12.238  31.311  24.314  1.00  0.78           N  
ATOM   1576  CZ  ARG A 204      11.159  30.746  24.861  1.00  0.78           C  
ATOM   1577  NH1 ARG A 204      10.278  30.066  24.133  1.00  0.78           N  
ATOM   1578  NH2 ARG A 204      10.960  30.878  26.170  1.00  0.78           N  
ATOM   1579  N   ASP A 205      17.352  33.282  22.738  1.00  0.78           N  
ATOM   1580  CA  ASP A 205      17.635  34.708  22.649  1.00  0.78           C  
ATOM   1581  C   ASP A 205      18.468  35.258  23.812  1.00  0.78           C  
ATOM   1582  O   ASP A 205      18.251  36.346  24.343  1.00  0.78           O  
ATOM   1583  CB  ASP A 205      16.333  35.501  22.396  1.00  0.78           C  
ATOM   1584  CG  ASP A 205      15.554  34.824  21.281  1.00  0.78           C  
ATOM   1585  OD1 ASP A 205      16.179  34.526  20.232  1.00  0.78           O  
ATOM   1586  OD2 ASP A 205      14.349  34.536  21.501  1.00  0.78           O  
ATOM   1587  N   GLY A 206      19.471  34.460  24.240  1.00  0.79           N  
ATOM   1588  CA  GLY A 206      20.353  34.761  25.364  1.00  0.79           C  
ATOM   1589  C   GLY A 206      19.803  34.444  26.731  1.00  0.79           C  
ATOM   1590  O   GLY A 206      20.487  34.633  27.732  1.00  0.79           O  
ATOM   1591  N   LYS A 207      18.571  33.924  26.831  1.00  0.79           N  
ATOM   1592  CA  LYS A 207      17.951  33.610  28.101  1.00  0.79           C  
ATOM   1593  C   LYS A 207      17.902  32.113  28.321  1.00  0.79           C  
ATOM   1594  O   LYS A 207      17.497  31.344  27.450  1.00  0.79           O  
ATOM   1595  CB  LYS A 207      16.501  34.147  28.182  1.00  0.79           C  
ATOM   1596  CG  LYS A 207      16.408  35.679  28.132  1.00  0.79           C  
ATOM   1597  CD  LYS A 207      14.958  36.173  28.244  1.00  0.79           C  
ATOM   1598  CE  LYS A 207      14.861  37.698  28.194  1.00  0.79           C  
ATOM   1599  NZ  LYS A 207      13.445  38.112  28.278  1.00  0.79           N  
ATOM   1600  N   ALA A 208      18.319  31.667  29.520  1.00  0.89           N  
ATOM   1601  CA  ALA A 208      18.114  30.314  29.982  1.00  0.89           C  
ATOM   1602  C   ALA A 208      16.638  29.945  30.165  1.00  0.89           C  
ATOM   1603  O   ALA A 208      15.838  30.714  30.698  1.00  0.89           O  
ATOM   1604  CB  ALA A 208      18.888  30.084  31.292  1.00  0.89           C  
ATOM   1605  N   VAL A 209      16.245  28.743  29.719  1.00  0.91           N  
ATOM   1606  CA  VAL A 209      14.874  28.280  29.783  1.00  0.91           C  
ATOM   1607  C   VAL A 209      14.868  26.756  29.863  1.00  0.91           C  
ATOM   1608  O   VAL A 209      15.808  26.080  29.450  1.00  0.91           O  
ATOM   1609  CB  VAL A 209      14.037  28.821  28.612  1.00  0.91           C  
ATOM   1610  CG1 VAL A 209      14.537  28.272  27.266  1.00  0.91           C  
ATOM   1611  CG2 VAL A 209      12.533  28.537  28.793  1.00  0.91           C  
ATOM   1612  N   ARG A 210      13.804  26.172  30.438  1.00  0.86           N  
ATOM   1613  CA  ARG A 210      13.536  24.748  30.410  1.00  0.86           C  
ATOM   1614  C   ARG A 210      12.043  24.617  30.152  1.00  0.86           C  
ATOM   1615  O   ARG A 210      11.294  25.582  30.308  1.00  0.86           O  
ATOM   1616  CB  ARG A 210      13.910  24.026  31.737  1.00  0.86           C  
ATOM   1617  CG  ARG A 210      15.425  23.779  31.936  1.00  0.86           C  
ATOM   1618  CD  ARG A 210      15.756  23.162  33.300  1.00  0.86           C  
ATOM   1619  NE  ARG A 210      17.241  23.004  33.426  1.00  0.86           N  
ATOM   1620  CZ  ARG A 210      17.846  22.864  34.613  1.00  0.86           C  
ATOM   1621  NH1 ARG A 210      17.161  22.825  35.750  1.00  0.86           N  
ATOM   1622  NH2 ARG A 210      19.158  22.707  34.705  1.00  0.86           N  
ATOM   1623  N   VAL A 211      11.580  23.438  29.701  1.00  0.92           N  
ATOM   1624  CA  VAL A 211      10.182  23.158  29.419  1.00  0.92           C  
ATOM   1625  C   VAL A 211       9.261  23.248  30.636  1.00  0.92           C  
ATOM   1626  O   VAL A 211       9.586  22.822  31.745  1.00  0.92           O  
ATOM   1627  CB  VAL A 211      10.016  21.835  28.671  1.00  0.92           C  
ATOM   1628  CG1 VAL A 211      10.252  20.621  29.593  1.00  0.92           C  
ATOM   1629  CG2 VAL A 211       8.652  21.750  27.963  1.00  0.92           C  
ATOM   1630  N   SER A 212       8.060  23.825  30.437  1.00  0.87           N  
ATOM   1631  CA  SER A 212       7.029  23.946  31.455  1.00  0.87           C  
ATOM   1632  C   SER A 212       6.092  22.749  31.398  1.00  0.87           C  
ATOM   1633  O   SER A 212       5.876  22.241  30.297  1.00  0.87           O  
ATOM   1634  CB  SER A 212       6.140  25.203  31.253  1.00  0.87           C  
ATOM   1635  OG  SER A 212       6.906  26.402  31.368  1.00  0.87           O  
ATOM   1636  N   PRO A 213       5.515  22.252  32.500  1.00  0.85           N  
ATOM   1637  CA  PRO A 213       4.397  21.303  32.477  1.00  0.85           C  
ATOM   1638  C   PRO A 213       3.237  21.672  31.564  1.00  0.85           C  
ATOM   1639  O   PRO A 213       2.888  22.850  31.486  1.00  0.85           O  
ATOM   1640  CB  PRO A 213       3.925  21.225  33.941  1.00  0.85           C  
ATOM   1641  CG  PRO A 213       5.130  21.681  34.765  1.00  0.85           C  
ATOM   1642  CD  PRO A 213       5.784  22.723  33.862  1.00  0.85           C  
ATOM   1643  N   GLY A 214       2.601  20.684  30.912  1.00  0.89           N  
ATOM   1644  CA  GLY A 214       1.379  20.917  30.153  1.00  0.89           C  
ATOM   1645  C   GLY A 214       0.564  19.661  30.069  1.00  0.89           C  
ATOM   1646  O   GLY A 214       1.045  18.563  30.319  1.00  0.89           O  
ATOM   1647  N   MET A 215      -0.729  19.742  29.701  1.00  0.86           N  
ATOM   1648  CA  MET A 215      -1.498  18.521  29.509  1.00  0.86           C  
ATOM   1649  C   MET A 215      -1.025  17.688  28.324  1.00  0.86           C  
ATOM   1650  O   MET A 215      -0.866  18.175  27.205  1.00  0.86           O  
ATOM   1651  CB  MET A 215      -3.024  18.753  29.454  1.00  0.86           C  
ATOM   1652  CG  MET A 215      -3.611  19.045  30.850  1.00  0.86           C  
ATOM   1653  SD  MET A 215      -3.595  17.655  32.024  1.00  0.86           S  
ATOM   1654  CE  MET A 215      -4.941  16.712  31.253  1.00  0.86           C  
ATOM   1655  N   LEU A 216      -0.772  16.391  28.599  1.00  0.92           N  
ATOM   1656  CA  LEU A 216      -0.248  15.403  27.673  1.00  0.92           C  
ATOM   1657  C   LEU A 216       1.193  15.676  27.247  1.00  0.92           C  
ATOM   1658  O   LEU A 216       1.624  15.302  26.154  1.00  0.92           O  
ATOM   1659  CB  LEU A 216      -1.168  15.169  26.439  1.00  0.92           C  
ATOM   1660  CG  LEU A 216      -2.653  14.883  26.760  1.00  0.92           C  
ATOM   1661  CD1 LEU A 216      -3.487  14.801  25.475  1.00  0.92           C  
ATOM   1662  CD2 LEU A 216      -2.831  13.591  27.566  1.00  0.92           C  
ATOM   1663  N   ASP A 217       1.991  16.317  28.127  1.00  0.91           N  
ATOM   1664  CA  ASP A 217       3.374  16.646  27.865  1.00  0.91           C  
ATOM   1665  C   ASP A 217       4.274  15.436  27.696  1.00  0.91           C  
ATOM   1666  O   ASP A 217       4.972  15.305  26.693  1.00  0.91           O  
ATOM   1667  CB  ASP A 217       3.911  17.653  28.919  1.00  0.91           C  
ATOM   1668  CG  ASP A 217       3.812  17.230  30.380  1.00  0.91           C  
ATOM   1669  OD1 ASP A 217       3.448  16.061  30.668  1.00  0.91           O  
ATOM   1670  OD2 ASP A 217       4.127  18.108  31.225  1.00  0.91           O  
ATOM   1671  N   ALA A 218       4.214  14.458  28.607  1.00  0.94           N  
ATOM   1672  CA  ALA A 218       4.988  13.237  28.562  1.00  0.94           C  
ATOM   1673  C   ALA A 218       4.787  12.427  27.287  1.00  0.94           C  
ATOM   1674  O   ALA A 218       5.724  11.876  26.713  1.00  0.94           O  
ATOM   1675  CB  ALA A 218       4.598  12.383  29.776  1.00  0.94           C  
ATOM   1676  N   GLN A 219       3.538  12.373  26.801  1.00  0.90           N  
ATOM   1677  CA  GLN A 219       3.151  11.666  25.606  1.00  0.90           C  
ATOM   1678  C   GLN A 219       3.529  12.377  24.312  1.00  0.90           C  
ATOM   1679  O   GLN A 219       3.580  11.759  23.248  1.00  0.90           O  
ATOM   1680  CB  GLN A 219       1.614  11.481  25.585  1.00  0.90           C  
ATOM   1681  CG  GLN A 219       1.019  10.624  26.726  1.00  0.90           C  
ATOM   1682  CD  GLN A 219       0.736  11.381  28.023  1.00  0.90           C  
ATOM   1683  OE1 GLN A 219       1.175  12.498  28.278  1.00  0.90           O  
ATOM   1684  NE2 GLN A 219      -0.058  10.730  28.904  1.00  0.90           N  
ATOM   1685  N   ALA A 220       3.798  13.696  24.350  1.00  0.96           N  
ATOM   1686  CA  ALA A 220       4.009  14.451  23.133  1.00  0.96           C  
ATOM   1687  C   ALA A 220       5.356  15.153  23.056  1.00  0.96           C  
ATOM   1688  O   ALA A 220       5.889  15.315  21.954  1.00  0.96           O  
ATOM   1689  CB  ALA A 220       2.877  15.487  22.985  1.00  0.96           C  
ATOM   1690  N   TYR A 221       5.965  15.569  24.183  1.00  0.93           N  
ATOM   1691  CA  TYR A 221       7.178  16.372  24.129  1.00  0.93           C  
ATOM   1692  C   TYR A 221       8.048  16.388  25.390  1.00  0.93           C  
ATOM   1693  O   TYR A 221       9.050  17.097  25.448  1.00  0.93           O  
ATOM   1694  CB  TYR A 221       6.873  17.843  23.697  1.00  0.93           C  
ATOM   1695  CG  TYR A 221       5.846  18.539  24.559  1.00  0.93           C  
ATOM   1696  CD1 TYR A 221       6.223  19.169  25.758  1.00  0.93           C  
ATOM   1697  CD2 TYR A 221       4.502  18.616  24.149  1.00  0.93           C  
ATOM   1698  CE1 TYR A 221       5.277  19.855  26.533  1.00  0.93           C  
ATOM   1699  CE2 TYR A 221       3.552  19.296  24.926  1.00  0.93           C  
ATOM   1700  CZ  TYR A 221       3.943  19.914  26.117  1.00  0.93           C  
ATOM   1701  OH  TYR A 221       2.995  20.584  26.910  1.00  0.93           O  
ATOM   1702  N   GLY A 222       7.707  15.598  26.421  1.00  0.95           N  
ATOM   1703  CA  GLY A 222       8.252  15.747  27.766  1.00  0.95           C  
ATOM   1704  C   GLY A 222       9.450  14.930  28.170  1.00  0.95           C  
ATOM   1705  O   GLY A 222       9.865  15.032  29.321  1.00  0.95           O  
ATOM   1706  N   VAL A 223      10.040  14.089  27.308  1.00  0.96           N  
ATOM   1707  CA  VAL A 223      11.175  13.250  27.686  1.00  0.96           C  
ATOM   1708  C   VAL A 223      12.510  14.006  27.675  1.00  0.96           C  
ATOM   1709  O   VAL A 223      12.791  14.836  26.810  1.00  0.96           O  
ATOM   1710  CB  VAL A 223      11.269  12.004  26.807  1.00  0.96           C  
ATOM   1711  CG1 VAL A 223      12.416  11.065  27.228  1.00  0.96           C  
ATOM   1712  CG2 VAL A 223       9.943  11.224  26.887  1.00  0.96           C  
ATOM   1713  N   LYS A 224      13.380  13.728  28.668  1.00  0.93           N  
ATOM   1714  CA  LYS A 224      14.722  14.265  28.781  1.00  0.93           C  
ATOM   1715  C   LYS A 224      15.686  13.090  28.808  1.00  0.93           C  
ATOM   1716  O   LYS A 224      15.389  12.057  29.403  1.00  0.93           O  
ATOM   1717  CB  LYS A 224      14.942  15.123  30.061  1.00  0.93           C  
ATOM   1718  CG  LYS A 224      14.011  16.343  30.203  1.00  0.93           C  
ATOM   1719  CD  LYS A 224      12.667  16.000  30.872  1.00  0.93           C  
ATOM   1720  CE  LYS A 224      11.703  17.183  30.980  1.00  0.93           C  
ATOM   1721  NZ  LYS A 224      10.368  16.703  31.390  1.00  0.93           N  
ATOM   1722  N   THR A 225      16.857  13.178  28.157  1.00  0.95           N  
ATOM   1723  CA  THR A 225      17.772  12.037  28.105  1.00  0.95           C  
ATOM   1724  C   THR A 225      19.164  12.549  27.825  1.00  0.95           C  
ATOM   1725  O   THR A 225      19.342  13.704  27.437  1.00  0.95           O  
ATOM   1726  CB  THR A 225      17.375  10.980  27.069  1.00  0.95           C  
ATOM   1727  OG1 THR A 225      18.134   9.782  27.184  1.00  0.95           O  
ATOM   1728  CG2 THR A 225      17.563  11.526  25.652  1.00  0.95           C  
ATOM   1729  N   ASN A 226      20.194  11.712  28.040  1.00  0.93           N  
ATOM   1730  CA  ASN A 226      21.553  12.013  27.654  1.00  0.93           C  
ATOM   1731  C   ASN A 226      21.879  11.396  26.302  1.00  0.93           C  
ATOM   1732  O   ASN A 226      21.097  10.658  25.705  1.00  0.93           O  
ATOM   1733  CB  ASN A 226      22.578  11.672  28.770  1.00  0.93           C  
ATOM   1734  CG  ASN A 226      22.706  10.179  29.057  1.00  0.93           C  
ATOM   1735  OD1 ASN A 226      22.698   9.336  28.161  1.00  0.93           O  
ATOM   1736  ND2 ASN A 226      22.864   9.826  30.350  1.00  0.93           N  
ATOM   1737  N   VAL A 227      23.064  11.698  25.749  1.00  0.96           N  
ATOM   1738  CA  VAL A 227      23.438  11.187  24.443  1.00  0.96           C  
ATOM   1739  C   VAL A 227      23.681   9.677  24.407  1.00  0.96           C  
ATOM   1740  O   VAL A 227      23.459   9.029  23.386  1.00  0.96           O  
ATOM   1741  CB  VAL A 227      24.606  11.982  23.881  1.00  0.96           C  
ATOM   1742  CG1 VAL A 227      25.938  11.581  24.540  1.00  0.96           C  
ATOM   1743  CG2 VAL A 227      24.658  11.850  22.350  1.00  0.96           C  
ATOM   1744  N   GLN A 228      24.124   9.063  25.528  1.00  0.91           N  
ATOM   1745  CA  GLN A 228      24.355   7.629  25.614  1.00  0.91           C  
ATOM   1746  C   GLN A 228      23.088   6.799  25.529  1.00  0.91           C  
ATOM   1747  O   GLN A 228      22.976   5.879  24.717  1.00  0.91           O  
ATOM   1748  CB  GLN A 228      25.085   7.257  26.930  1.00  0.91           C  
ATOM   1749  CG  GLN A 228      26.459   7.947  27.080  1.00  0.91           C  
ATOM   1750  CD  GLN A 228      27.105   7.655  28.435  1.00  0.91           C  
ATOM   1751  OE1 GLN A 228      27.154   8.491  29.337  1.00  0.91           O  
ATOM   1752  NE2 GLN A 228      27.661   6.433  28.585  1.00  0.91           N  
ATOM   1753  N   ASP A 229      22.063   7.149  26.321  1.00  0.94           N  
ATOM   1754  CA  ASP A 229      20.761   6.525  26.260  1.00  0.94           C  
ATOM   1755  C   ASP A 229      20.096   6.773  24.916  1.00  0.94           C  
ATOM   1756  O   ASP A 229      19.504   5.879  24.315  1.00  0.94           O  
ATOM   1757  CB  ASP A 229      19.862   7.054  27.394  1.00  0.94           C  
ATOM   1758  CG  ASP A 229      20.072   6.320  28.701  1.00  0.94           C  
ATOM   1759  OD1 ASP A 229      21.129   5.678  28.889  1.00  0.94           O  
ATOM   1760  OD2 ASP A 229      19.116   6.396  29.521  1.00  0.94           O  
ATOM   1761  N   MET A 230      20.224   7.994  24.362  1.00  0.94           N  
ATOM   1762  CA  MET A 230      19.709   8.276  23.042  1.00  0.94           C  
ATOM   1763  C   MET A 230      20.357   7.477  21.917  1.00  0.94           C  
ATOM   1764  O   MET A 230      19.682   6.985  21.013  1.00  0.94           O  
ATOM   1765  CB  MET A 230      19.758   9.788  22.753  1.00  0.94           C  
ATOM   1766  CG  MET A 230      18.693  10.212  21.735  1.00  0.94           C  
ATOM   1767  SD  MET A 230      17.008   9.862  22.324  1.00  0.94           S  
ATOM   1768  CE  MET A 230      16.300   9.941  20.676  1.00  0.94           C  
ATOM   1769  N   ALA A 231      21.687   7.273  21.962  1.00  0.96           N  
ATOM   1770  CA  ALA A 231      22.379   6.381  21.055  1.00  0.96           C  
ATOM   1771  C   ALA A 231      21.911   4.932  21.143  1.00  0.96           C  
ATOM   1772  O   ALA A 231      21.619   4.302  20.130  1.00  0.96           O  
ATOM   1773  CB  ALA A 231      23.884   6.443  21.352  1.00  0.96           C  
ATOM   1774  N   ASN A 232      21.757   4.394  22.367  1.00  0.92           N  
ATOM   1775  CA  ASN A 232      21.198   3.070  22.599  1.00  0.92           C  
ATOM   1776  C   ASN A 232      19.736   2.935  22.161  1.00  0.92           C  
ATOM   1777  O   ASN A 232      19.340   1.919  21.590  1.00  0.92           O  
ATOM   1778  CB  ASN A 232      21.390   2.651  24.074  1.00  0.92           C  
ATOM   1779  CG  ASN A 232      22.865   2.336  24.305  1.00  0.92           C  
ATOM   1780  OD1 ASN A 232      23.456   1.487  23.636  1.00  0.92           O  
ATOM   1781  ND2 ASN A 232      23.496   3.024  25.279  1.00  0.92           N  
ATOM   1782  N   TRP A 233      18.893   3.973  22.352  1.00  0.90           N  
ATOM   1783  CA  TRP A 233      17.554   4.026  21.780  1.00  0.90           C  
ATOM   1784  C   TRP A 233      17.547   3.950  20.259  1.00  0.90           C  
ATOM   1785  O   TRP A 233      16.791   3.181  19.662  1.00  0.90           O  
ATOM   1786  CB  TRP A 233      16.834   5.331  22.223  1.00  0.90           C  
ATOM   1787  CG  TRP A 233      15.450   5.590  21.644  1.00  0.90           C  
ATOM   1788  CD1 TRP A 233      15.048   6.603  20.816  1.00  0.90           C  
ATOM   1789  CD2 TRP A 233      14.287   4.768  21.860  1.00  0.90           C  
ATOM   1790  NE1 TRP A 233      13.705   6.488  20.530  1.00  0.90           N  
ATOM   1791  CE2 TRP A 233      13.227   5.372  21.167  1.00  0.90           C  
ATOM   1792  CE3 TRP A 233      14.105   3.589  22.584  1.00  0.90           C  
ATOM   1793  CZ2 TRP A 233      11.955   4.820  21.184  1.00  0.90           C  
ATOM   1794  CZ3 TRP A 233      12.815   3.041  22.614  1.00  0.90           C  
ATOM   1795  CH2 TRP A 233      11.760   3.647  21.925  1.00  0.90           C  
ATOM   1796  N   VAL A 234      18.425   4.715  19.584  1.00  0.95           N  
ATOM   1797  CA  VAL A 234      18.575   4.633  18.142  1.00  0.95           C  
ATOM   1798  C   VAL A 234      19.046   3.256  17.696  1.00  0.95           C  
ATOM   1799  O   VAL A 234      18.469   2.679  16.782  1.00  0.95           O  
ATOM   1800  CB  VAL A 234      19.469   5.746  17.609  1.00  0.95           C  
ATOM   1801  CG1 VAL A 234      19.785   5.556  16.117  1.00  0.95           C  
ATOM   1802  CG2 VAL A 234      18.750   7.096  17.790  1.00  0.95           C  
ATOM   1803  N   MET A 235      20.032   2.640  18.376  1.00  0.93           N  
ATOM   1804  CA  MET A 235      20.494   1.289  18.082  1.00  0.93           C  
ATOM   1805  C   MET A 235      19.424   0.209  18.225  1.00  0.93           C  
ATOM   1806  O   MET A 235      19.304  -0.673  17.377  1.00  0.93           O  
ATOM   1807  CB  MET A 235      21.706   0.923  18.967  1.00  0.93           C  
ATOM   1808  CG  MET A 235      22.975   1.716  18.603  1.00  0.93           C  
ATOM   1809  SD  MET A 235      24.356   1.489  19.760  1.00  0.93           S  
ATOM   1810  CE  MET A 235      24.787  -0.199  19.248  1.00  0.93           C  
ATOM   1811  N   ALA A 236      18.580   0.270  19.275  1.00  0.96           N  
ATOM   1812  CA  ALA A 236      17.438  -0.615  19.429  1.00  0.96           C  
ATOM   1813  C   ALA A 236      16.408  -0.476  18.313  1.00  0.96           C  
ATOM   1814  O   ALA A 236      15.834  -1.453  17.842  1.00  0.96           O  
ATOM   1815  CB  ALA A 236      16.761  -0.362  20.788  1.00  0.96           C  
ATOM   1816  N   ASN A 237      16.154   0.762  17.854  1.00  0.94           N  
ATOM   1817  CA  ASN A 237      15.316   1.022  16.699  1.00  0.94           C  
ATOM   1818  C   ASN A 237      15.941   0.603  15.361  1.00  0.94           C  
ATOM   1819  O   ASN A 237      15.238   0.121  14.478  1.00  0.94           O  
ATOM   1820  CB  ASN A 237      14.830   2.492  16.678  1.00  0.94           C  
ATOM   1821  CG  ASN A 237      13.714   2.703  17.700  1.00  0.94           C  
ATOM   1822  OD1 ASN A 237      12.528   2.636  17.364  1.00  0.94           O  
ATOM   1823  ND2 ASN A 237      14.072   2.991  18.966  1.00  0.94           N  
ATOM   1824  N   MET A 238      17.266   0.760  15.171  1.00  0.93           N  
ATOM   1825  CA  MET A 238      18.001   0.288  14.002  1.00  0.93           C  
ATOM   1826  C   MET A 238      18.008  -1.221  13.823  1.00  0.93           C  
ATOM   1827  O   MET A 238      17.908  -1.721  12.702  1.00  0.93           O  
ATOM   1828  CB  MET A 238      19.489   0.709  14.085  1.00  0.93           C  
ATOM   1829  CG  MET A 238      19.732   2.213  13.883  1.00  0.93           C  
ATOM   1830  SD  MET A 238      21.400   2.772  14.332  1.00  0.93           S  
ATOM   1831  CE  MET A 238      22.242   1.860  13.025  1.00  0.93           C  
ATOM   1832  N   ALA A 239      18.165  -1.965  14.930  1.00  0.95           N  
ATOM   1833  CA  ALA A 239      18.290  -3.408  14.910  1.00  0.95           C  
ATOM   1834  C   ALA A 239      17.397  -4.076  15.957  1.00  0.95           C  
ATOM   1835  O   ALA A 239      17.900  -4.656  16.930  1.00  0.95           O  
ATOM   1836  CB  ALA A 239      19.766  -3.774  15.145  1.00  0.95           C  
ATOM   1837  N   PRO A 240      16.064  -4.029  15.823  1.00  0.93           N  
ATOM   1838  CA  PRO A 240      15.132  -4.558  16.810  1.00  0.93           C  
ATOM   1839  C   PRO A 240      15.208  -6.050  16.981  1.00  0.93           C  
ATOM   1840  O   PRO A 240      14.750  -6.550  18.007  1.00  0.93           O  
ATOM   1841  CB  PRO A 240      13.747  -4.139  16.296  1.00  0.93           C  
ATOM   1842  CG  PRO A 240      13.934  -3.913  14.795  1.00  0.93           C  
ATOM   1843  CD  PRO A 240      15.360  -3.380  14.713  1.00  0.93           C  
ATOM   1844  N   GLU A 241      15.775  -6.804  16.027  1.00  0.85           N  
ATOM   1845  CA  GLU A 241      15.965  -8.232  16.123  1.00  0.85           C  
ATOM   1846  C   GLU A 241      16.782  -8.644  17.339  1.00  0.85           C  
ATOM   1847  O   GLU A 241      16.502  -9.672  17.962  1.00  0.85           O  
ATOM   1848  CB  GLU A 241      16.558  -8.822  14.820  1.00  0.85           C  
ATOM   1849  CG  GLU A 241      17.902  -8.217  14.327  1.00  0.85           C  
ATOM   1850  CD  GLU A 241      17.762  -6.955  13.470  1.00  0.85           C  
ATOM   1851  OE1 GLU A 241      16.693  -6.294  13.523  1.00  0.85           O  
ATOM   1852  OE2 GLU A 241      18.716  -6.654  12.710  1.00  0.85           O  
ATOM   1853  N   ASN A 242      17.747  -7.798  17.747  1.00  0.85           N  
ATOM   1854  CA  ASN A 242      18.582  -8.006  18.913  1.00  0.85           C  
ATOM   1855  C   ASN A 242      17.902  -7.709  20.252  1.00  0.85           C  
ATOM   1856  O   ASN A 242      18.389  -8.111  21.306  1.00  0.85           O  
ATOM   1857  CB  ASN A 242      19.831  -7.099  18.816  1.00  0.85           C  
ATOM   1858  CG  ASN A 242      20.664  -7.489  17.603  1.00  0.85           C  
ATOM   1859  OD1 ASN A 242      20.707  -8.643  17.179  1.00  0.85           O  
ATOM   1860  ND2 ASN A 242      21.382  -6.498  17.030  1.00  0.85           N  
ATOM   1861  N   VAL A 243      16.756  -6.997  20.269  1.00  0.89           N  
ATOM   1862  CA  VAL A 243      15.996  -6.742  21.490  1.00  0.89           C  
ATOM   1863  C   VAL A 243      15.392  -8.027  22.056  1.00  0.89           C  
ATOM   1864  O   VAL A 243      14.768  -8.820  21.352  1.00  0.89           O  
ATOM   1865  CB  VAL A 243      14.937  -5.660  21.287  1.00  0.89           C  
ATOM   1866  CG1 VAL A 243      14.079  -5.442  22.550  1.00  0.89           C  
ATOM   1867  CG2 VAL A 243      15.639  -4.342  20.904  1.00  0.89           C  
ATOM   1868  N   ALA A 244      15.606  -8.301  23.358  1.00  0.86           N  
ATOM   1869  CA  ALA A 244      15.152  -9.527  23.986  1.00  0.86           C  
ATOM   1870  C   ALA A 244      13.650  -9.595  24.215  1.00  0.86           C  
ATOM   1871  O   ALA A 244      13.013 -10.607  23.930  1.00  0.86           O  
ATOM   1872  CB  ALA A 244      15.893  -9.717  25.320  1.00  0.86           C  
ATOM   1873  N   ASP A 245      13.052  -8.495  24.715  1.00  0.86           N  
ATOM   1874  CA  ASP A 245      11.630  -8.377  24.964  1.00  0.86           C  
ATOM   1875  C   ASP A 245      10.804  -8.536  23.682  1.00  0.86           C  
ATOM   1876  O   ASP A 245      10.920  -7.783  22.712  1.00  0.86           O  
ATOM   1877  CB  ASP A 245      11.368  -7.049  25.717  1.00  0.86           C  
ATOM   1878  CG  ASP A 245       9.927  -6.860  26.184  1.00  0.86           C  
ATOM   1879  OD1 ASP A 245       8.991  -7.237  25.435  1.00  0.86           O  
ATOM   1880  OD2 ASP A 245       9.754  -6.316  27.302  1.00  0.86           O  
ATOM   1881  N   ALA A 246       9.976  -9.597  23.663  1.00  0.90           N  
ATOM   1882  CA  ALA A 246       9.226 -10.039  22.518  1.00  0.90           C  
ATOM   1883  C   ALA A 246       8.118  -9.099  22.082  1.00  0.90           C  
ATOM   1884  O   ALA A 246       7.919  -8.888  20.885  1.00  0.90           O  
ATOM   1885  CB  ALA A 246       8.678 -11.453  22.775  1.00  0.90           C  
ATOM   1886  N   SER A 247       7.366  -8.497  23.022  1.00  0.91           N  
ATOM   1887  CA  SER A 247       6.385  -7.489  22.645  1.00  0.91           C  
ATOM   1888  C   SER A 247       7.022  -6.161  22.294  1.00  0.91           C  
ATOM   1889  O   SER A 247       6.612  -5.511  21.330  1.00  0.91           O  
ATOM   1890  CB  SER A 247       5.238  -7.295  23.653  1.00  0.91           C  
ATOM   1891  OG  SER A 247       5.728  -7.105  24.982  1.00  0.91           O  
ATOM   1892  N   LEU A 248       8.088  -5.743  23.006  1.00  0.92           N  
ATOM   1893  CA  LEU A 248       8.800  -4.513  22.701  1.00  0.92           C  
ATOM   1894  C   LEU A 248       9.450  -4.498  21.323  1.00  0.92           C  
ATOM   1895  O   LEU A 248       9.338  -3.527  20.576  1.00  0.92           O  
ATOM   1896  CB  LEU A 248       9.876  -4.243  23.772  1.00  0.92           C  
ATOM   1897  CG  LEU A 248      10.664  -2.923  23.635  1.00  0.92           C  
ATOM   1898  CD1 LEU A 248       9.744  -1.697  23.600  1.00  0.92           C  
ATOM   1899  CD2 LEU A 248      11.651  -2.785  24.798  1.00  0.92           C  
ATOM   1900  N   LYS A 249      10.118  -5.593  20.902  1.00  0.88           N  
ATOM   1901  CA  LYS A 249      10.712  -5.664  19.574  1.00  0.88           C  
ATOM   1902  C   LYS A 249       9.703  -5.587  18.437  1.00  0.88           C  
ATOM   1903  O   LYS A 249       9.931  -4.938  17.416  1.00  0.88           O  
ATOM   1904  CB  LYS A 249      11.642  -6.886  19.419  1.00  0.88           C  
ATOM   1905  CG  LYS A 249      10.967  -8.266  19.390  1.00  0.88           C  
ATOM   1906  CD  LYS A 249      11.952  -9.412  19.689  1.00  0.88           C  
ATOM   1907  CE  LYS A 249      13.110  -9.538  18.692  1.00  0.88           C  
ATOM   1908  NZ  LYS A 249      14.164 -10.411  19.247  1.00  0.88           N  
ATOM   1909  N   GLN A 250       8.520  -6.210  18.611  1.00  0.89           N  
ATOM   1910  CA  GLN A 250       7.396  -6.029  17.715  1.00  0.89           C  
ATOM   1911  C   GLN A 250       6.864  -4.603  17.726  1.00  0.89           C  
ATOM   1912  O   GLN A 250       6.542  -4.042  16.682  1.00  0.89           O  
ATOM   1913  CB  GLN A 250       6.262  -7.026  18.032  1.00  0.89           C  
ATOM   1914  CG  GLN A 250       6.645  -8.488  17.710  1.00  0.89           C  
ATOM   1915  CD  GLN A 250       5.448  -9.423  17.885  1.00  0.89           C  
ATOM   1916  OE1 GLN A 250       4.287  -9.027  17.814  1.00  0.89           O  
ATOM   1917  NE2 GLN A 250       5.739 -10.727  18.092  1.00  0.89           N  
ATOM   1918  N   GLY A 251       6.803  -3.950  18.904  1.00  0.95           N  
ATOM   1919  CA  GLY A 251       6.419  -2.549  19.026  1.00  0.95           C  
ATOM   1920  C   GLY A 251       7.325  -1.560  18.349  1.00  0.95           C  
ATOM   1921  O   GLY A 251       6.864  -0.576  17.774  1.00  0.95           O  
ATOM   1922  N   ILE A 252       8.643  -1.828  18.339  1.00  0.94           N  
ATOM   1923  CA  ILE A 252       9.613  -1.093  17.538  1.00  0.94           C  
ATOM   1924  C   ILE A 252       9.330  -1.246  16.050  1.00  0.94           C  
ATOM   1925  O   ILE A 252       9.305  -0.273  15.300  1.00  0.94           O  
ATOM   1926  CB  ILE A 252      11.040  -1.518  17.870  1.00  0.94           C  
ATOM   1927  CG1 ILE A 252      11.393  -1.088  19.314  1.00  0.94           C  
ATOM   1928  CG2 ILE A 252      12.039  -0.898  16.869  1.00  0.94           C  
ATOM   1929  CD1 ILE A 252      12.681  -1.726  19.846  1.00  0.94           C  
ATOM   1930  N   ALA A 253       9.036  -2.483  15.596  1.00  0.95           N  
ATOM   1931  CA  ALA A 253       8.651  -2.735  14.224  1.00  0.95           C  
ATOM   1932  C   ALA A 253       7.362  -2.034  13.816  1.00  0.95           C  
ATOM   1933  O   ALA A 253       7.298  -1.374  12.787  1.00  0.95           O  
ATOM   1934  CB  ALA A 253       8.523  -4.251  13.985  1.00  0.95           C  
ATOM   1935  N   LEU A 254       6.316  -2.083  14.657  1.00  0.93           N  
ATOM   1936  CA  LEU A 254       5.063  -1.387  14.420  1.00  0.93           C  
ATOM   1937  C   LEU A 254       5.208   0.127  14.328  1.00  0.93           C  
ATOM   1938  O   LEU A 254       4.543   0.779  13.523  1.00  0.93           O  
ATOM   1939  CB  LEU A 254       4.023  -1.750  15.503  1.00  0.93           C  
ATOM   1940  CG  LEU A 254       3.544  -3.215  15.426  1.00  0.93           C  
ATOM   1941  CD1 LEU A 254       2.808  -3.610  16.710  1.00  0.93           C  
ATOM   1942  CD2 LEU A 254       2.649  -3.472  14.205  1.00  0.93           C  
ATOM   1943  N   ALA A 255       6.104   0.731  15.130  1.00  0.97           N  
ATOM   1944  CA  ALA A 255       6.403   2.145  15.068  1.00  0.97           C  
ATOM   1945  C   ALA A 255       7.093   2.599  13.784  1.00  0.97           C  
ATOM   1946  O   ALA A 255       6.923   3.739  13.354  1.00  0.97           O  
ATOM   1947  CB  ALA A 255       7.204   2.555  16.315  1.00  0.97           C  
ATOM   1948  N   GLN A 256       7.851   1.705  13.122  1.00  0.93           N  
ATOM   1949  CA  GLN A 256       8.506   1.982  11.851  1.00  0.93           C  
ATOM   1950  C   GLN A 256       7.765   1.426  10.640  1.00  0.93           C  
ATOM   1951  O   GLN A 256       8.229   1.527   9.502  1.00  0.93           O  
ATOM   1952  CB  GLN A 256       9.937   1.397  11.867  1.00  0.93           C  
ATOM   1953  CG  GLN A 256      10.953   2.329  12.558  1.00  0.93           C  
ATOM   1954  CD  GLN A 256      12.326   1.665  12.633  1.00  0.93           C  
ATOM   1955  OE1 GLN A 256      13.013   1.473  11.630  1.00  0.93           O  
ATOM   1956  NE2 GLN A 256      12.747   1.312  13.867  1.00  0.93           N  
ATOM   1957  N   SER A 257       6.571   0.845  10.837  1.00  0.95           N  
ATOM   1958  CA  SER A 257       5.657   0.498   9.762  1.00  0.95           C  
ATOM   1959  C   SER A 257       5.101   1.731   9.081  1.00  0.95           C  
ATOM   1960  O   SER A 257       4.924   2.782   9.688  1.00  0.95           O  
ATOM   1961  CB  SER A 257       4.466  -0.373  10.222  1.00  0.95           C  
ATOM   1962  OG  SER A 257       4.928  -1.624  10.731  1.00  0.95           O  
ATOM   1963  N   ARG A 258       4.809   1.645   7.775  1.00  0.90           N  
ATOM   1964  CA  ARG A 258       4.260   2.764   7.036  1.00  0.90           C  
ATOM   1965  C   ARG A 258       2.744   2.685   6.974  1.00  0.90           C  
ATOM   1966  O   ARG A 258       2.188   1.740   6.421  1.00  0.90           O  
ATOM   1967  CB  ARG A 258       4.802   2.837   5.588  1.00  0.90           C  
ATOM   1968  CG  ARG A 258       6.315   3.121   5.479  1.00  0.90           C  
ATOM   1969  CD  ARG A 258       7.236   1.906   5.297  1.00  0.90           C  
ATOM   1970  NE  ARG A 258       8.617   2.441   5.034  1.00  0.90           N  
ATOM   1971  CZ  ARG A 258       9.048   2.923   3.861  1.00  0.90           C  
ATOM   1972  NH1 ARG A 258       8.278   2.954   2.778  1.00  0.90           N  
ATOM   1973  NH2 ARG A 258      10.286   3.395   3.767  1.00  0.90           N  
ATOM   1974  N   TYR A 259       2.048   3.694   7.536  1.00  0.92           N  
ATOM   1975  CA  TYR A 259       0.591   3.698   7.619  1.00  0.92           C  
ATOM   1976  C   TYR A 259      -0.039   4.643   6.611  1.00  0.92           C  
ATOM   1977  O   TYR A 259      -1.163   4.445   6.152  1.00  0.92           O  
ATOM   1978  CB  TYR A 259       0.150   4.176   9.027  1.00  0.92           C  
ATOM   1979  CG  TYR A 259       0.608   3.200  10.070  1.00  0.92           C  
ATOM   1980  CD1 TYR A 259      -0.187   2.096  10.407  1.00  0.92           C  
ATOM   1981  CD2 TYR A 259       1.844   3.366  10.711  1.00  0.92           C  
ATOM   1982  CE1 TYR A 259       0.258   1.161  11.352  1.00  0.92           C  
ATOM   1983  CE2 TYR A 259       2.303   2.423  11.638  1.00  0.92           C  
ATOM   1984  CZ  TYR A 259       1.506   1.320  11.960  1.00  0.92           C  
ATOM   1985  OH  TYR A 259       1.956   0.362  12.887  1.00  0.92           O  
ATOM   1986  N   TRP A 260       0.699   5.687   6.204  1.00  0.90           N  
ATOM   1987  CA  TRP A 260       0.209   6.683   5.272  1.00  0.90           C  
ATOM   1988  C   TRP A 260       1.388   7.199   4.480  1.00  0.90           C  
ATOM   1989  O   TRP A 260       2.499   7.269   5.000  1.00  0.90           O  
ATOM   1990  CB  TRP A 260      -0.450   7.906   5.973  1.00  0.90           C  
ATOM   1991  CG  TRP A 260      -1.521   7.562   6.985  1.00  0.90           C  
ATOM   1992  CD1 TRP A 260      -1.364   7.371   8.323  1.00  0.90           C  
ATOM   1993  CD2 TRP A 260      -2.925   7.366   6.716  1.00  0.90           C  
ATOM   1994  NE1 TRP A 260      -2.574   7.081   8.911  1.00  0.90           N  
ATOM   1995  CE2 TRP A 260      -3.533   7.023   7.933  1.00  0.90           C  
ATOM   1996  CE3 TRP A 260      -3.668   7.470   5.547  1.00  0.90           C  
ATOM   1997  CZ2 TRP A 260      -4.894   6.748   8.011  1.00  0.90           C  
ATOM   1998  CZ3 TRP A 260      -5.046   7.214   5.622  1.00  0.90           C  
ATOM   1999  CH2 TRP A 260      -5.647   6.839   6.831  1.00  0.90           C  
ATOM   2000  N   ARG A 261       1.168   7.598   3.215  1.00  0.86           N  
ATOM   2001  CA  ARG A 261       2.150   8.314   2.426  1.00  0.86           C  
ATOM   2002  C   ARG A 261       1.673   9.738   2.249  1.00  0.86           C  
ATOM   2003  O   ARG A 261       0.527   9.986   1.874  1.00  0.86           O  
ATOM   2004  CB  ARG A 261       2.350   7.699   1.021  1.00  0.86           C  
ATOM   2005  CG  ARG A 261       3.437   8.426   0.196  1.00  0.86           C  
ATOM   2006  CD  ARG A 261       3.590   7.958  -1.255  1.00  0.86           C  
ATOM   2007  NE  ARG A 261       2.308   8.223  -1.994  1.00  0.86           N  
ATOM   2008  CZ  ARG A 261       1.965   9.401  -2.532  1.00  0.86           C  
ATOM   2009  NH1 ARG A 261       2.715  10.489  -2.414  1.00  0.86           N  
ATOM   2010  NH2 ARG A 261       0.830   9.485  -3.225  1.00  0.86           N  
ATOM   2011  N   ILE A 262       2.559  10.709   2.525  1.00  0.87           N  
ATOM   2012  CA  ILE A 262       2.285  12.120   2.369  1.00  0.87           C  
ATOM   2013  C   ILE A 262       3.449  12.682   1.578  1.00  0.87           C  
ATOM   2014  O   ILE A 262       4.575  12.776   2.059  1.00  0.87           O  
ATOM   2015  CB  ILE A 262       2.138  12.853   3.700  1.00  0.87           C  
ATOM   2016  CG1 ILE A 262       1.191  12.105   4.665  1.00  0.87           C  
ATOM   2017  CG2 ILE A 262       1.597  14.269   3.431  1.00  0.87           C  
ATOM   2018  CD1 ILE A 262       1.896  11.102   5.588  1.00  0.87           C  
ATOM   2019  N   GLY A 263       3.235  13.050   0.296  1.00  0.85           N  
ATOM   2020  CA  GLY A 263       4.347  13.370  -0.605  1.00  0.85           C  
ATOM   2021  C   GLY A 263       5.387  12.275  -0.744  1.00  0.85           C  
ATOM   2022  O   GLY A 263       5.091  11.170  -1.200  1.00  0.85           O  
ATOM   2023  N   SER A 264       6.637  12.581  -0.363  1.00  0.87           N  
ATOM   2024  CA  SER A 264       7.769  11.670  -0.428  1.00  0.87           C  
ATOM   2025  C   SER A 264       8.083  11.019   0.905  1.00  0.87           C  
ATOM   2026  O   SER A 264       9.023  10.231   1.002  1.00  0.87           O  
ATOM   2027  CB  SER A 264       9.043  12.424  -0.889  1.00  0.87           C  
ATOM   2028  OG  SER A 264       9.246  13.607  -0.109  1.00  0.87           O  
ATOM   2029  N   MET A 265       7.286  11.300   1.955  1.00  0.88           N  
ATOM   2030  CA  MET A 265       7.482  10.709   3.262  1.00  0.88           C  
ATOM   2031  C   MET A 265       6.318   9.834   3.669  1.00  0.88           C  
ATOM   2032  O   MET A 265       5.208   9.886   3.134  1.00  0.88           O  
ATOM   2033  CB  MET A 265       7.842  11.738   4.368  1.00  0.88           C  
ATOM   2034  CG  MET A 265       6.801  12.835   4.681  1.00  0.88           C  
ATOM   2035  SD  MET A 265       5.313  12.324   5.598  1.00  0.88           S  
ATOM   2036  CE  MET A 265       6.023  11.881   7.203  1.00  0.88           C  
ATOM   2037  N   TYR A 266       6.586   8.949   4.635  1.00  0.92           N  
ATOM   2038  CA  TYR A 266       5.639   8.003   5.153  1.00  0.92           C  
ATOM   2039  C   TYR A 266       5.523   8.174   6.649  1.00  0.92           C  
ATOM   2040  O   TYR A 266       6.515   8.338   7.359  1.00  0.92           O  
ATOM   2041  CB  TYR A 266       6.063   6.541   4.893  1.00  0.92           C  
ATOM   2042  CG  TYR A 266       6.210   6.254   3.425  1.00  0.92           C  
ATOM   2043  CD1 TYR A 266       7.433   6.500   2.779  1.00  0.92           C  
ATOM   2044  CD2 TYR A 266       5.149   5.702   2.687  1.00  0.92           C  
ATOM   2045  CE1 TYR A 266       7.589   6.223   1.416  1.00  0.92           C  
ATOM   2046  CE2 TYR A 266       5.311   5.404   1.324  1.00  0.92           C  
ATOM   2047  CZ  TYR A 266       6.532   5.668   0.692  1.00  0.92           C  
ATOM   2048  OH  TYR A 266       6.714   5.362  -0.671  1.00  0.92           O  
ATOM   2049  N   GLN A 267       4.292   8.125   7.179  1.00  0.93           N  
ATOM   2050  CA  GLN A 267       4.072   8.271   8.599  1.00  0.93           C  
ATOM   2051  C   GLN A 267       4.075   6.930   9.310  1.00  0.93           C  
ATOM   2052  O   GLN A 267       3.315   6.023   8.961  1.00  0.93           O  
ATOM   2053  CB  GLN A 267       2.732   9.001   8.844  1.00  0.93           C  
ATOM   2054  CG  GLN A 267       2.447   9.378  10.315  1.00  0.93           C  
ATOM   2055  CD  GLN A 267       3.510  10.324  10.866  1.00  0.93           C  
ATOM   2056  OE1 GLN A 267       3.648  11.456  10.394  1.00  0.93           O  
ATOM   2057  NE2 GLN A 267       4.277   9.854  11.873  1.00  0.93           N  
ATOM   2058  N   GLY A 268       4.946   6.795  10.334  1.00  0.98           N  
ATOM   2059  CA  GLY A 268       4.936   5.692  11.284  1.00  0.98           C  
ATOM   2060  C   GLY A 268       4.264   6.092  12.566  1.00  0.98           C  
ATOM   2061  O   GLY A 268       3.548   7.090  12.634  1.00  0.98           O  
ATOM   2062  N   LEU A 269       4.500   5.344  13.658  1.00  0.96           N  
ATOM   2063  CA  LEU A 269       4.004   5.741  14.965  1.00  0.96           C  
ATOM   2064  C   LEU A 269       5.085   6.562  15.644  1.00  0.96           C  
ATOM   2065  O   LEU A 269       6.066   6.038  16.170  1.00  0.96           O  
ATOM   2066  CB  LEU A 269       3.591   4.552  15.870  1.00  0.96           C  
ATOM   2067  CG  LEU A 269       2.711   3.477  15.198  1.00  0.96           C  
ATOM   2068  CD1 LEU A 269       2.475   2.305  16.162  1.00  0.96           C  
ATOM   2069  CD2 LEU A 269       1.368   4.031  14.706  1.00  0.96           C  
ATOM   2070  N   GLY A 270       4.972   7.903  15.592  1.00  0.98           N  
ATOM   2071  CA  GLY A 270       6.017   8.790  16.095  1.00  0.98           C  
ATOM   2072  C   GLY A 270       7.107   9.021  15.090  1.00  0.98           C  
ATOM   2073  O   GLY A 270       7.351  10.152  14.682  1.00  0.98           O  
ATOM   2074  N   TRP A 271       7.794   7.941  14.676  1.00  0.93           N  
ATOM   2075  CA  TRP A 271       8.774   7.946  13.606  1.00  0.93           C  
ATOM   2076  C   TRP A 271       8.196   8.356  12.253  1.00  0.93           C  
ATOM   2077  O   TRP A 271       7.044   8.075  11.919  1.00  0.93           O  
ATOM   2078  CB  TRP A 271       9.461   6.560  13.436  1.00  0.93           C  
ATOM   2079  CG  TRP A 271      10.313   6.088  14.603  1.00  0.93           C  
ATOM   2080  CD1 TRP A 271      10.124   5.027  15.448  1.00  0.93           C  
ATOM   2081  CD2 TRP A 271      11.567   6.686  14.995  1.00  0.93           C  
ATOM   2082  NE1 TRP A 271      11.162   4.938  16.355  1.00  0.93           N  
ATOM   2083  CE2 TRP A 271      12.047   5.958  16.096  1.00  0.93           C  
ATOM   2084  CE3 TRP A 271      12.278   7.768  14.477  1.00  0.93           C  
ATOM   2085  CZ2 TRP A 271      13.231   6.314  16.735  1.00  0.93           C  
ATOM   2086  CZ3 TRP A 271      13.482   8.116  15.108  1.00  0.93           C  
ATOM   2087  CH2 TRP A 271      13.944   7.415  16.233  1.00  0.93           C  
ATOM   2088  N   GLU A 272       9.013   9.033  11.430  1.00  0.93           N  
ATOM   2089  CA  GLU A 272       8.688   9.356  10.057  1.00  0.93           C  
ATOM   2090  C   GLU A 272       9.754   8.717   9.184  1.00  0.93           C  
ATOM   2091  O   GLU A 272      10.891   8.516   9.618  1.00  0.93           O  
ATOM   2092  CB  GLU A 272       8.576  10.887   9.849  1.00  0.93           C  
ATOM   2093  CG  GLU A 272       7.378  11.468  10.652  1.00  0.93           C  
ATOM   2094  CD  GLU A 272       7.253  12.987  10.652  1.00  0.93           C  
ATOM   2095  OE1 GLU A 272       7.828  13.659   9.763  1.00  0.93           O  
ATOM   2096  OE2 GLU A 272       6.529  13.501  11.552  1.00  0.93           O  
ATOM   2097  N   MET A 273       9.398   8.307   7.950  1.00  0.92           N  
ATOM   2098  CA  MET A 273      10.302   7.553   7.098  1.00  0.92           C  
ATOM   2099  C   MET A 273      10.260   8.063   5.673  1.00  0.92           C  
ATOM   2100  O   MET A 273       9.220   8.461   5.161  1.00  0.92           O  
ATOM   2101  CB  MET A 273       9.976   6.030   7.040  1.00  0.92           C  
ATOM   2102  CG  MET A 273      10.226   5.248   8.350  1.00  0.92           C  
ATOM   2103  SD  MET A 273       8.989   5.416   9.677  1.00  0.92           S  
ATOM   2104  CE  MET A 273       7.585   4.707   8.782  1.00  0.92           C  
ATOM   2105  N   LEU A 274      11.403   8.024   4.974  1.00  0.91           N  
ATOM   2106  CA  LEU A 274      11.472   8.204   3.538  1.00  0.91           C  
ATOM   2107  C   LEU A 274      12.173   6.975   3.011  1.00  0.91           C  
ATOM   2108  O   LEU A 274      12.954   6.351   3.722  1.00  0.91           O  
ATOM   2109  CB  LEU A 274      12.258   9.468   3.099  1.00  0.91           C  
ATOM   2110  CG  LEU A 274      11.641  10.802   3.570  1.00  0.91           C  
ATOM   2111  CD1 LEU A 274      12.144  11.232   4.955  1.00  0.91           C  
ATOM   2112  CD2 LEU A 274      11.931  11.921   2.563  1.00  0.91           C  
ATOM   2113  N   ASN A 275      11.910   6.544   1.763  1.00  0.89           N  
ATOM   2114  CA  ASN A 275      12.676   5.455   1.168  1.00  0.89           C  
ATOM   2115  C   ASN A 275      14.150   5.824   0.988  1.00  0.89           C  
ATOM   2116  O   ASN A 275      14.470   6.953   0.633  1.00  0.89           O  
ATOM   2117  CB  ASN A 275      12.083   5.021  -0.198  1.00  0.89           C  
ATOM   2118  CG  ASN A 275      10.660   4.499  -0.033  1.00  0.89           C  
ATOM   2119  OD1 ASN A 275      10.231   4.043   1.031  1.00  0.89           O  
ATOM   2120  ND2 ASN A 275       9.873   4.572  -1.130  1.00  0.89           N  
ATOM   2121  N   TRP A 276      15.077   4.884   1.241  1.00  0.86           N  
ATOM   2122  CA  TRP A 276      16.483   5.059   0.930  1.00  0.86           C  
ATOM   2123  C   TRP A 276      16.761   4.395  -0.422  1.00  0.86           C  
ATOM   2124  O   TRP A 276      16.164   3.352  -0.698  1.00  0.86           O  
ATOM   2125  CB  TRP A 276      17.400   4.484   2.050  1.00  0.86           C  
ATOM   2126  CG  TRP A 276      18.881   4.695   1.809  1.00  0.86           C  
ATOM   2127  CD1 TRP A 276      19.750   3.848   1.177  1.00  0.86           C  
ATOM   2128  CD2 TRP A 276      19.586   5.943   1.980  1.00  0.86           C  
ATOM   2129  NE1 TRP A 276      20.923   4.507   0.880  1.00  0.86           N  
ATOM   2130  CE2 TRP A 276      20.851   5.780   1.390  1.00  0.86           C  
ATOM   2131  CE3 TRP A 276      19.200   7.164   2.536  1.00  0.86           C  
ATOM   2132  CZ2 TRP A 276      21.772   6.816   1.363  1.00  0.86           C  
ATOM   2133  CZ3 TRP A 276      20.122   8.226   2.478  1.00  0.86           C  
ATOM   2134  CH2 TRP A 276      21.390   8.052   1.905  1.00  0.86           C  
ATOM   2135  N   PRO A 277      17.613   4.906  -1.308  1.00  0.85           N  
ATOM   2136  CA  PRO A 277      18.317   6.183  -1.247  1.00  0.85           C  
ATOM   2137  C   PRO A 277      17.423   7.398  -1.372  1.00  0.85           C  
ATOM   2138  O   PRO A 277      16.468   7.402  -2.141  1.00  0.85           O  
ATOM   2139  CB  PRO A 277      19.351   6.139  -2.386  1.00  0.85           C  
ATOM   2140  CG  PRO A 277      19.099   4.846  -3.177  1.00  0.85           C  
ATOM   2141  CD  PRO A 277      17.891   4.169  -2.530  1.00  0.85           C  
ATOM   2142  N   VAL A 278      17.747   8.455  -0.610  1.00  0.86           N  
ATOM   2143  CA  VAL A 278      17.069   9.730  -0.697  1.00  0.86           C  
ATOM   2144  C   VAL A 278      18.131  10.803  -0.753  1.00  0.86           C  
ATOM   2145  O   VAL A 278      19.119  10.754  -0.022  1.00  0.86           O  
ATOM   2146  CB  VAL A 278      16.080   9.964   0.443  1.00  0.86           C  
ATOM   2147  CG1 VAL A 278      16.773  10.080   1.813  1.00  0.86           C  
ATOM   2148  CG2 VAL A 278      15.218  11.203   0.161  1.00  0.86           C  
ATOM   2149  N   GLU A 279      17.975  11.781  -1.658  1.00  0.75           N  
ATOM   2150  CA  GLU A 279      18.833  12.944  -1.766  1.00  0.75           C  
ATOM   2151  C   GLU A 279      18.630  13.917  -0.614  1.00  0.75           C  
ATOM   2152  O   GLU A 279      17.571  13.945   0.018  1.00  0.75           O  
ATOM   2153  CB  GLU A 279      18.572  13.687  -3.095  1.00  0.75           C  
ATOM   2154  CG  GLU A 279      18.791  12.821  -4.361  1.00  0.75           C  
ATOM   2155  CD  GLU A 279      20.259  12.602  -4.728  1.00  0.75           C  
ATOM   2156  OE1 GLU A 279      21.144  12.894  -3.888  1.00  0.75           O  
ATOM   2157  OE2 GLU A 279      20.487  12.143  -5.876  1.00  0.75           O  
ATOM   2158  N   ALA A 280      19.638  14.761  -0.304  1.00  0.85           N  
ATOM   2159  CA  ALA A 280      19.546  15.719   0.786  1.00  0.85           C  
ATOM   2160  C   ALA A 280      18.388  16.697   0.666  1.00  0.85           C  
ATOM   2161  O   ALA A 280      17.637  16.896   1.619  1.00  0.85           O  
ATOM   2162  CB  ALA A 280      20.850  16.526   0.911  1.00  0.85           C  
ATOM   2163  N   ASN A 281      18.154  17.276  -0.530  1.00  0.86           N  
ATOM   2164  CA  ASN A 281      17.110  18.268  -0.727  1.00  0.86           C  
ATOM   2165  C   ASN A 281      15.704  17.774  -0.403  1.00  0.86           C  
ATOM   2166  O   ASN A 281      14.963  18.439   0.307  1.00  0.86           O  
ATOM   2167  CB  ASN A 281      17.194  18.954  -2.114  1.00  0.86           C  
ATOM   2168  CG  ASN A 281      16.985  18.017  -3.299  1.00  0.86           C  
ATOM   2169  OD1 ASN A 281      17.196  16.806  -3.233  1.00  0.86           O  
ATOM   2170  ND2 ASN A 281      16.586  18.605  -4.448  1.00  0.86           N  
ATOM   2171  N   THR A 282      15.348  16.540  -0.808  1.00  0.86           N  
ATOM   2172  CA  THR A 282      14.078  15.898  -0.464  1.00  0.86           C  
ATOM   2173  C   THR A 282      13.810  15.852   1.032  1.00  0.86           C  
ATOM   2174  O   THR A 282      12.718  16.174   1.497  1.00  0.86           O  
ATOM   2175  CB  THR A 282      14.048  14.451  -0.955  1.00  0.86           C  
ATOM   2176  OG1 THR A 282      14.252  14.411  -2.359  1.00  0.86           O  
ATOM   2177  CG2 THR A 282      12.702  13.761  -0.678  1.00  0.86           C  
ATOM   2178  N   VAL A 283      14.811  15.463   1.846  1.00  0.88           N  
ATOM   2179  CA  VAL A 283      14.647  15.417   3.293  1.00  0.88           C  
ATOM   2180  C   VAL A 283      14.655  16.807   3.924  1.00  0.88           C  
ATOM   2181  O   VAL A 283      13.842  17.121   4.792  1.00  0.88           O  
ATOM   2182  CB  VAL A 283      15.694  14.544   3.977  1.00  0.88           C  
ATOM   2183  CG1 VAL A 283      15.224  14.192   5.401  1.00  0.88           C  
ATOM   2184  CG2 VAL A 283      15.916  13.236   3.197  1.00  0.88           C  
ATOM   2185  N   VAL A 284      15.580  17.688   3.486  1.00  0.89           N  
ATOM   2186  CA  VAL A 284      15.723  19.052   3.987  1.00  0.89           C  
ATOM   2187  C   VAL A 284      14.506  19.930   3.702  1.00  0.89           C  
ATOM   2188  O   VAL A 284      13.981  20.601   4.587  1.00  0.89           O  
ATOM   2189  CB  VAL A 284      16.995  19.690   3.419  1.00  0.89           C  
ATOM   2190  CG1 VAL A 284      17.139  21.169   3.814  1.00  0.89           C  
ATOM   2191  CG2 VAL A 284      18.230  18.944   3.960  1.00  0.89           C  
ATOM   2192  N   GLU A 285      13.977  19.909   2.464  1.00  0.75           N  
ATOM   2193  CA  GLU A 285      12.798  20.660   2.060  1.00  0.75           C  
ATOM   2194  C   GLU A 285      11.531  20.157   2.733  1.00  0.75           C  
ATOM   2195  O   GLU A 285      10.645  20.928   3.099  1.00  0.75           O  
ATOM   2196  CB  GLU A 285      12.658  20.675   0.519  1.00  0.75           C  
ATOM   2197  CG  GLU A 285      13.824  21.438  -0.168  1.00  0.75           C  
ATOM   2198  CD  GLU A 285      13.850  21.308  -1.691  1.00  0.75           C  
ATOM   2199  OE1 GLU A 285      12.811  20.936  -2.291  1.00  0.75           O  
ATOM   2200  OE2 GLU A 285      14.937  21.580  -2.269  1.00  0.75           O  
ATOM   2201  N   GLY A 286      11.442  18.834   2.995  1.00  0.80           N  
ATOM   2202  CA  GLY A 286      10.324  18.261   3.736  1.00  0.80           C  
ATOM   2203  C   GLY A 286      10.325  18.572   5.212  1.00  0.80           C  
ATOM   2204  O   GLY A 286       9.321  18.368   5.888  1.00  0.80           O  
ATOM   2205  N   SER A 287      11.434  19.103   5.766  1.00  0.80           N  
ATOM   2206  CA  SER A 287      11.498  19.446   7.179  1.00  0.80           C  
ATOM   2207  C   SER A 287      11.266  20.919   7.462  1.00  0.80           C  
ATOM   2208  O   SER A 287      11.202  21.333   8.624  1.00  0.80           O  
ATOM   2209  CB  SER A 287      12.832  18.981   7.821  1.00  0.80           C  
ATOM   2210  OG  SER A 287      13.938  19.835   7.523  1.00  0.80           O  
ATOM   2211  N   ASP A 288      11.074  21.745   6.408  1.00  0.74           N  
ATOM   2212  CA  ASP A 288      10.625  23.120   6.526  1.00  0.74           C  
ATOM   2213  C   ASP A 288       9.246  23.187   7.184  1.00  0.74           C  
ATOM   2214  O   ASP A 288       8.374  22.343   6.974  1.00  0.74           O  
ATOM   2215  CB  ASP A 288      10.673  23.811   5.134  1.00  0.74           C  
ATOM   2216  CG  ASP A 288      10.310  25.281   5.146  1.00  0.74           C  
ATOM   2217  OD1 ASP A 288       9.133  25.633   5.411  1.00  0.74           O  
ATOM   2218  OD2 ASP A 288      11.172  26.134   4.823  1.00  0.74           O  
ATOM   2219  N   SER A 289       9.007  24.211   8.024  1.00  0.73           N  
ATOM   2220  CA  SER A 289       7.776  24.350   8.784  1.00  0.73           C  
ATOM   2221  C   SER A 289       6.542  24.534   7.928  1.00  0.73           C  
ATOM   2222  O   SER A 289       5.455  24.101   8.304  1.00  0.73           O  
ATOM   2223  CB  SER A 289       7.847  25.494   9.824  1.00  0.73           C  
ATOM   2224  OG  SER A 289       8.182  26.744   9.216  1.00  0.73           O  
ATOM   2225  N   LYS A 290       6.695  25.129   6.729  1.00  0.70           N  
ATOM   2226  CA  LYS A 290       5.621  25.321   5.776  1.00  0.70           C  
ATOM   2227  C   LYS A 290       5.145  24.016   5.151  1.00  0.70           C  
ATOM   2228  O   LYS A 290       4.022  23.933   4.663  1.00  0.70           O  
ATOM   2229  CB  LYS A 290       6.077  26.265   4.635  1.00  0.70           C  
ATOM   2230  CG  LYS A 290       6.532  27.651   5.127  1.00  0.70           C  
ATOM   2231  CD  LYS A 290       6.939  28.605   3.989  1.00  0.70           C  
ATOM   2232  CE  LYS A 290       8.094  28.116   3.098  1.00  0.70           C  
ATOM   2233  NZ  LYS A 290       9.306  27.838   3.884  1.00  0.70           N  
ATOM   2234  N   VAL A 291       5.984  22.961   5.160  1.00  0.76           N  
ATOM   2235  CA  VAL A 291       5.574  21.621   4.767  1.00  0.76           C  
ATOM   2236  C   VAL A 291       5.149  20.823   5.988  1.00  0.76           C  
ATOM   2237  O   VAL A 291       4.052  20.270   6.050  1.00  0.76           O  
ATOM   2238  CB  VAL A 291       6.701  20.882   4.045  1.00  0.76           C  
ATOM   2239  CG1 VAL A 291       6.290  19.434   3.702  1.00  0.76           C  
ATOM   2240  CG2 VAL A 291       7.055  21.642   2.752  1.00  0.76           C  
ATOM   2241  N   ALA A 292       6.016  20.756   7.015  1.00  0.79           N  
ATOM   2242  CA  ALA A 292       5.880  19.875   8.158  1.00  0.79           C  
ATOM   2243  C   ALA A 292       4.648  20.117   9.024  1.00  0.79           C  
ATOM   2244  O   ALA A 292       4.048  19.172   9.544  1.00  0.79           O  
ATOM   2245  CB  ALA A 292       7.163  19.960   9.007  1.00  0.79           C  
ATOM   2246  N   LEU A 293       4.247  21.395   9.193  1.00  0.78           N  
ATOM   2247  CA  LEU A 293       3.094  21.765   9.998  1.00  0.78           C  
ATOM   2248  C   LEU A 293       1.847  22.033   9.171  1.00  0.78           C  
ATOM   2249  O   LEU A 293       0.806  22.411   9.711  1.00  0.78           O  
ATOM   2250  CB  LEU A 293       3.377  23.037  10.838  1.00  0.78           C  
ATOM   2251  CG  LEU A 293       4.554  22.928  11.828  1.00  0.78           C  
ATOM   2252  CD1 LEU A 293       4.650  24.211  12.665  1.00  0.78           C  
ATOM   2253  CD2 LEU A 293       4.445  21.709  12.755  1.00  0.78           C  
ATOM   2254  N   ALA A 294       1.893  21.840   7.842  1.00  0.90           N  
ATOM   2255  CA  ALA A 294       0.739  22.058   6.996  1.00  0.90           C  
ATOM   2256  C   ALA A 294      -0.275  20.914   7.058  1.00  0.90           C  
ATOM   2257  O   ALA A 294       0.124  19.750   7.157  1.00  0.90           O  
ATOM   2258  CB  ALA A 294       1.182  22.276   5.540  1.00  0.90           C  
ATOM   2259  N   PRO A 295      -1.592  21.153   7.023  1.00  0.89           N  
ATOM   2260  CA  PRO A 295      -2.541  20.113   6.662  1.00  0.89           C  
ATOM   2261  C   PRO A 295      -2.328  19.610   5.242  1.00  0.89           C  
ATOM   2262  O   PRO A 295      -2.388  20.400   4.303  1.00  0.89           O  
ATOM   2263  CB  PRO A 295      -3.906  20.781   6.858  1.00  0.89           C  
ATOM   2264  CG  PRO A 295      -3.656  22.254   6.522  1.00  0.89           C  
ATOM   2265  CD  PRO A 295      -2.205  22.486   6.961  1.00  0.89           C  
ATOM   2266  N   LEU A 296      -2.117  18.298   5.052  1.00  0.86           N  
ATOM   2267  CA  LEU A 296      -1.806  17.765   3.737  1.00  0.86           C  
ATOM   2268  C   LEU A 296      -2.606  16.500   3.470  1.00  0.86           C  
ATOM   2269  O   LEU A 296      -2.838  15.729   4.406  1.00  0.86           O  
ATOM   2270  CB  LEU A 296      -0.298  17.422   3.597  1.00  0.86           C  
ATOM   2271  CG  LEU A 296       0.651  18.639   3.588  1.00  0.86           C  
ATOM   2272  CD1 LEU A 296       2.117  18.185   3.600  1.00  0.86           C  
ATOM   2273  CD2 LEU A 296       0.404  19.571   2.391  1.00  0.86           C  
ATOM   2274  N   PRO A 297      -3.059  16.232   2.237  1.00  0.91           N  
ATOM   2275  CA  PRO A 297      -3.772  15.004   1.915  1.00  0.91           C  
ATOM   2276  C   PRO A 297      -2.892  13.774   2.017  1.00  0.91           C  
ATOM   2277  O   PRO A 297      -1.687  13.835   1.767  1.00  0.91           O  
ATOM   2278  CB  PRO A 297      -4.267  15.218   0.476  1.00  0.91           C  
ATOM   2279  CG  PRO A 297      -3.261  16.190  -0.147  1.00  0.91           C  
ATOM   2280  CD  PRO A 297      -2.783  17.035   1.038  1.00  0.91           C  
ATOM   2281  N   VAL A 298      -3.489  12.641   2.408  1.00  0.91           N  
ATOM   2282  CA  VAL A 298      -2.771  11.404   2.634  1.00  0.91           C  
ATOM   2283  C   VAL A 298      -3.170  10.361   1.615  1.00  0.91           C  
ATOM   2284  O   VAL A 298      -4.255  10.382   1.037  1.00  0.91           O  
ATOM   2285  CB  VAL A 298      -2.991  10.829   4.032  1.00  0.91           C  
ATOM   2286  CG1 VAL A 298      -2.568  11.860   5.086  1.00  0.91           C  
ATOM   2287  CG2 VAL A 298      -4.462  10.450   4.252  1.00  0.91           C  
ATOM   2288  N   ALA A 299      -2.285   9.381   1.387  1.00  0.93           N  
ATOM   2289  CA  ALA A 299      -2.651   8.150   0.731  1.00  0.93           C  
ATOM   2290  C   ALA A 299      -2.481   7.034   1.737  1.00  0.93           C  
ATOM   2291  O   ALA A 299      -1.406   6.867   2.314  1.00  0.93           O  
ATOM   2292  CB  ALA A 299      -1.766   7.895  -0.501  1.00  0.93           C  
ATOM   2293  N   GLU A 300      -3.560   6.271   2.002  1.00  0.89           N  
ATOM   2294  CA  GLU A 300      -3.542   5.157   2.933  1.00  0.89           C  
ATOM   2295  C   GLU A 300      -2.588   4.052   2.509  1.00  0.89           C  
ATOM   2296  O   GLU A 300      -2.513   3.688   1.336  1.00  0.89           O  
ATOM   2297  CB  GLU A 300      -4.967   4.580   3.159  1.00  0.89           C  
ATOM   2298  CG  GLU A 300      -5.131   3.828   4.510  1.00  0.89           C  
ATOM   2299  CD  GLU A 300      -6.533   3.274   4.772  1.00  0.89           C  
ATOM   2300  OE1 GLU A 300      -7.288   3.058   3.792  1.00  0.89           O  
ATOM   2301  OE2 GLU A 300      -6.845   3.037   5.974  1.00  0.89           O  
ATOM   2302  N   VAL A 301      -1.827   3.486   3.463  1.00  0.91           N  
ATOM   2303  CA  VAL A 301      -1.108   2.248   3.231  1.00  0.91           C  
ATOM   2304  C   VAL A 301      -1.856   1.194   4.018  1.00  0.91           C  
ATOM   2305  O   VAL A 301      -1.760   1.110   5.241  1.00  0.91           O  
ATOM   2306  CB  VAL A 301       0.353   2.314   3.659  1.00  0.91           C  
ATOM   2307  CG1 VAL A 301       1.080   1.008   3.287  1.00  0.91           C  
ATOM   2308  CG2 VAL A 301       1.046   3.508   2.973  1.00  0.91           C  
ATOM   2309  N   ASN A 302      -2.667   0.383   3.314  1.00  0.79           N  
ATOM   2310  CA  ASN A 302      -3.587  -0.548   3.928  1.00  0.79           C  
ATOM   2311  C   ASN A 302      -3.449  -1.908   3.240  1.00  0.79           C  
ATOM   2312  O   ASN A 302      -3.630  -1.988   2.023  1.00  0.79           O  
ATOM   2313  CB  ASN A 302      -5.034   0.000   3.840  1.00  0.79           C  
ATOM   2314  CG  ASN A 302      -6.053  -0.942   4.471  1.00  0.79           C  
ATOM   2315  OD1 ASN A 302      -5.798  -1.592   5.486  1.00  0.79           O  
ATOM   2316  ND2 ASN A 302      -7.235  -1.062   3.830  1.00  0.79           N  
ATOM   2317  N   PRO A 303      -3.163  -2.999   3.953  1.00  0.84           N  
ATOM   2318  CA  PRO A 303      -2.604  -3.046   5.305  1.00  0.84           C  
ATOM   2319  C   PRO A 303      -1.329  -2.223   5.459  1.00  0.84           C  
ATOM   2320  O   PRO A 303      -0.656  -2.033   4.443  1.00  0.84           O  
ATOM   2321  CB  PRO A 303      -2.337  -4.541   5.568  1.00  0.84           C  
ATOM   2322  CG  PRO A 303      -3.049  -5.286   4.433  1.00  0.84           C  
ATOM   2323  CD  PRO A 303      -3.039  -4.284   3.285  1.00  0.84           C  
ATOM   2324  N   PRO A 304      -0.966  -1.716   6.633  1.00  0.87           N  
ATOM   2325  CA  PRO A 304       0.314  -1.054   6.865  1.00  0.87           C  
ATOM   2326  C   PRO A 304       1.515  -1.816   6.343  1.00  0.87           C  
ATOM   2327  O   PRO A 304       1.581  -3.031   6.518  1.00  0.87           O  
ATOM   2328  CB  PRO A 304       0.377  -0.870   8.388  1.00  0.87           C  
ATOM   2329  CG  PRO A 304      -1.089  -0.869   8.827  1.00  0.87           C  
ATOM   2330  CD  PRO A 304      -1.741  -1.855   7.867  1.00  0.87           C  
ATOM   2331  N   ALA A 305       2.489  -1.143   5.711  1.00  0.94           N  
ATOM   2332  CA  ALA A 305       3.687  -1.820   5.267  1.00  0.94           C  
ATOM   2333  C   ALA A 305       4.657  -2.034   6.427  1.00  0.94           C  
ATOM   2334  O   ALA A 305       5.021  -1.037   7.055  1.00  0.94           O  
ATOM   2335  CB  ALA A 305       4.387  -1.034   4.147  1.00  0.94           C  
ATOM   2336  N   PRO A 306       5.097  -3.251   6.770  1.00  0.92           N  
ATOM   2337  CA  PRO A 306       6.100  -3.494   7.809  1.00  0.92           C  
ATOM   2338  C   PRO A 306       7.428  -2.779   7.585  1.00  0.92           C  
ATOM   2339  O   PRO A 306       7.617  -2.259   6.481  1.00  0.92           O  
ATOM   2340  CB  PRO A 306       6.254  -5.027   7.813  1.00  0.92           C  
ATOM   2341  CG  PRO A 306       4.916  -5.544   7.294  1.00  0.92           C  
ATOM   2342  CD  PRO A 306       4.565  -4.510   6.234  1.00  0.92           C  
ATOM   2343  N   PRO A 307       8.353  -2.699   8.543  1.00  0.93           N  
ATOM   2344  CA  PRO A 307       9.575  -1.921   8.395  1.00  0.93           C  
ATOM   2345  C   PRO A 307      10.400  -2.203   7.156  1.00  0.93           C  
ATOM   2346  O   PRO A 307      10.864  -3.322   6.938  1.00  0.93           O  
ATOM   2347  CB  PRO A 307      10.395  -2.234   9.648  1.00  0.93           C  
ATOM   2348  CG  PRO A 307       9.354  -2.610  10.693  1.00  0.93           C  
ATOM   2349  CD  PRO A 307       8.226  -3.262   9.892  1.00  0.93           C  
ATOM   2350  N   VAL A 308      10.643  -1.165   6.353  1.00  0.92           N  
ATOM   2351  CA  VAL A 308      11.486  -1.250   5.184  1.00  0.92           C  
ATOM   2352  C   VAL A 308      12.897  -0.889   5.592  1.00  0.92           C  
ATOM   2353  O   VAL A 308      13.155   0.233   6.020  1.00  0.92           O  
ATOM   2354  CB  VAL A 308      10.979  -0.308   4.102  1.00  0.92           C  
ATOM   2355  CG1 VAL A 308      11.915  -0.284   2.882  1.00  0.92           C  
ATOM   2356  CG2 VAL A 308       9.565  -0.745   3.673  1.00  0.92           C  
ATOM   2357  N   LYS A 309      13.871  -1.820   5.485  1.00  0.89           N  
ATOM   2358  CA  LYS A 309      15.241  -1.567   5.919  1.00  0.89           C  
ATOM   2359  C   LYS A 309      15.909  -0.435   5.148  1.00  0.89           C  
ATOM   2360  O   LYS A 309      16.627   0.388   5.713  1.00  0.89           O  
ATOM   2361  CB  LYS A 309      16.179  -2.797   5.815  1.00  0.89           C  
ATOM   2362  CG  LYS A 309      15.937  -3.953   6.807  1.00  0.89           C  
ATOM   2363  CD  LYS A 309      17.258  -4.720   7.043  1.00  0.89           C  
ATOM   2364  CE  LYS A 309      17.159  -6.238   7.257  1.00  0.89           C  
ATOM   2365  NZ  LYS A 309      16.602  -6.585   8.587  1.00  0.89           N  
ATOM   2366  N   ALA A 310      15.660  -0.360   3.829  1.00  0.92           N  
ATOM   2367  CA  ALA A 310      16.040   0.763   3.003  1.00  0.92           C  
ATOM   2368  C   ALA A 310      15.127   1.969   3.230  1.00  0.92           C  
ATOM   2369  O   ALA A 310      14.325   2.383   2.392  1.00  0.92           O  
ATOM   2370  CB  ALA A 310      16.067   0.335   1.531  1.00  0.92           C  
ATOM   2371  N   SER A 311      15.245   2.563   4.425  1.00  0.93           N  
ATOM   2372  CA  SER A 311      14.520   3.740   4.848  1.00  0.93           C  
ATOM   2373  C   SER A 311      15.504   4.722   5.429  1.00  0.93           C  
ATOM   2374  O   SER A 311      16.428   4.344   6.139  1.00  0.93           O  
ATOM   2375  CB  SER A 311      13.474   3.496   5.966  1.00  0.93           C  
ATOM   2376  OG  SER A 311      12.377   2.700   5.518  1.00  0.93           O  
ATOM   2377  N   TRP A 312      15.293   6.024   5.190  1.00  0.90           N  
ATOM   2378  CA  TRP A 312      15.762   7.063   6.085  1.00  0.90           C  
ATOM   2379  C   TRP A 312      14.697   7.211   7.156  1.00  0.90           C  
ATOM   2380  O   TRP A 312      13.579   7.633   6.871  1.00  0.90           O  
ATOM   2381  CB  TRP A 312      15.948   8.399   5.313  1.00  0.90           C  
ATOM   2382  CG  TRP A 312      16.367   9.616   6.132  1.00  0.90           C  
ATOM   2383  CD1 TRP A 312      15.582  10.482   6.847  1.00  0.90           C  
ATOM   2384  CD2 TRP A 312      17.719  10.101   6.272  1.00  0.90           C  
ATOM   2385  NE1 TRP A 312      16.348  11.475   7.417  1.00  0.90           N  
ATOM   2386  CE2 TRP A 312      17.662  11.255   7.073  1.00  0.90           C  
ATOM   2387  CE3 TRP A 312      18.933   9.628   5.769  1.00  0.90           C  
ATOM   2388  CZ2 TRP A 312      18.813  11.964   7.390  1.00  0.90           C  
ATOM   2389  CZ3 TRP A 312      20.099  10.339   6.103  1.00  0.90           C  
ATOM   2390  CH2 TRP A 312      20.037  11.488   6.902  1.00  0.90           C  
ATOM   2391  N   VAL A 313      15.011   6.833   8.406  1.00  0.97           N  
ATOM   2392  CA  VAL A 313      14.067   6.890   9.509  1.00  0.97           C  
ATOM   2393  C   VAL A 313      14.507   8.024  10.395  1.00  0.97           C  
ATOM   2394  O   VAL A 313      15.677   8.106  10.761  1.00  0.97           O  
ATOM   2395  CB  VAL A 313      14.042   5.615  10.345  1.00  0.97           C  
ATOM   2396  CG1 VAL A 313      12.882   5.669  11.361  1.00  0.97           C  
ATOM   2397  CG2 VAL A 313      13.913   4.375   9.443  1.00  0.97           C  
ATOM   2398  N   HIS A 314      13.608   8.961  10.749  1.00  0.95           N  
ATOM   2399  CA  HIS A 314      14.055  10.163  11.430  1.00  0.95           C  
ATOM   2400  C   HIS A 314      12.991  10.823  12.272  1.00  0.95           C  
ATOM   2401  O   HIS A 314      11.794  10.574  12.127  1.00  0.95           O  
ATOM   2402  CB  HIS A 314      14.635  11.218  10.447  1.00  0.95           C  
ATOM   2403  CG  HIS A 314      13.655  11.860   9.492  1.00  0.95           C  
ATOM   2404  ND1 HIS A 314      14.003  13.041   8.870  1.00  0.95           N  
ATOM   2405  CD2 HIS A 314      12.401  11.501   9.120  1.00  0.95           C  
ATOM   2406  CE1 HIS A 314      12.962  13.380   8.141  1.00  0.95           C  
ATOM   2407  NE2 HIS A 314      11.960  12.481   8.257  1.00  0.95           N  
ATOM   2408  N   LYS A 315      13.427  11.684  13.214  1.00  0.93           N  
ATOM   2409  CA  LYS A 315      12.516  12.578  13.888  1.00  0.93           C  
ATOM   2410  C   LYS A 315      13.205  13.847  14.369  1.00  0.93           C  
ATOM   2411  O   LYS A 315      14.294  13.824  14.939  1.00  0.93           O  
ATOM   2412  CB  LYS A 315      11.818  11.872  15.080  1.00  0.93           C  
ATOM   2413  CG  LYS A 315      10.662  12.660  15.720  1.00  0.93           C  
ATOM   2414  CD  LYS A 315       9.472  12.834  14.762  1.00  0.93           C  
ATOM   2415  CE  LYS A 315       8.364  13.748  15.282  1.00  0.93           C  
ATOM   2416  NZ  LYS A 315       8.707  15.166  15.039  1.00  0.93           N  
ATOM   2417  N   THR A 316      12.548  15.010  14.174  1.00  0.95           N  
ATOM   2418  CA  THR A 316      12.923  16.276  14.795  1.00  0.95           C  
ATOM   2419  C   THR A 316      12.224  16.466  16.130  1.00  0.95           C  
ATOM   2420  O   THR A 316      11.060  16.088  16.317  1.00  0.95           O  
ATOM   2421  CB  THR A 316      12.583  17.504  13.950  1.00  0.95           C  
ATOM   2422  OG1 THR A 316      11.211  17.508  13.572  1.00  0.95           O  
ATOM   2423  CG2 THR A 316      13.406  17.499  12.656  1.00  0.95           C  
ATOM   2424  N   GLY A 317      12.921  17.084  17.106  1.00  0.95           N  
ATOM   2425  CA  GLY A 317      12.334  17.430  18.392  1.00  0.95           C  
ATOM   2426  C   GLY A 317      12.822  18.751  18.882  1.00  0.95           C  
ATOM   2427  O   GLY A 317      13.994  19.077  18.757  1.00  0.95           O  
ATOM   2428  N   SER A 318      11.929  19.566  19.459  1.00  0.94           N  
ATOM   2429  CA  SER A 318      12.283  20.901  19.894  1.00  0.94           C  
ATOM   2430  C   SER A 318      11.455  21.236  21.095  1.00  0.94           C  
ATOM   2431  O   SER A 318      10.333  20.747  21.237  1.00  0.94           O  
ATOM   2432  CB  SER A 318      11.972  22.019  18.860  1.00  0.94           C  
ATOM   2433  OG  SER A 318      12.568  21.734  17.594  1.00  0.94           O  
ATOM   2434  N   THR A 319      11.993  22.097  21.964  1.00  0.94           N  
ATOM   2435  CA  THR A 319      11.249  22.782  23.011  1.00  0.94           C  
ATOM   2436  C   THR A 319      11.561  24.256  22.862  1.00  0.94           C  
ATOM   2437  O   THR A 319      12.075  24.700  21.837  1.00  0.94           O  
ATOM   2438  CB  THR A 319      11.551  22.319  24.435  1.00  0.94           C  
ATOM   2439  OG1 THR A 319      12.921  22.498  24.760  1.00  0.94           O  
ATOM   2440  CG2 THR A 319      11.205  20.832  24.595  1.00  0.94           C  
ATOM   2441  N   GLY A 320      11.256  25.090  23.879  1.00  0.94           N  
ATOM   2442  CA  GLY A 320      11.576  26.511  23.823  1.00  0.94           C  
ATOM   2443  C   GLY A 320      13.045  26.817  23.879  1.00  0.94           C  
ATOM   2444  O   GLY A 320      13.451  27.897  23.470  1.00  0.94           O  
ATOM   2445  N   GLY A 321      13.871  25.888  24.387  1.00  0.95           N  
ATOM   2446  CA  GLY A 321      15.298  26.121  24.552  1.00  0.95           C  
ATOM   2447  C   GLY A 321      16.160  25.030  24.017  1.00  0.95           C  
ATOM   2448  O   GLY A 321      17.373  25.105  24.133  1.00  0.95           O  
ATOM   2449  N   PHE A 322      15.578  23.972  23.442  1.00  0.94           N  
ATOM   2450  CA  PHE A 322      16.342  22.830  22.974  1.00  0.94           C  
ATOM   2451  C   PHE A 322      15.940  22.464  21.564  1.00  0.94           C  
ATOM   2452  O   PHE A 322      14.805  22.673  21.132  1.00  0.94           O  
ATOM   2453  CB  PHE A 322      16.128  21.568  23.845  1.00  0.94           C  
ATOM   2454  CG  PHE A 322      16.769  21.699  25.199  1.00  0.94           C  
ATOM   2455  CD1 PHE A 322      16.131  22.376  26.249  1.00  0.94           C  
ATOM   2456  CD2 PHE A 322      17.998  21.076  25.451  1.00  0.94           C  
ATOM   2457  CE1 PHE A 322      16.692  22.405  27.531  1.00  0.94           C  
ATOM   2458  CE2 PHE A 322      18.579  21.119  26.725  1.00  0.94           C  
ATOM   2459  CZ  PHE A 322      17.916  21.773  27.771  1.00  0.94           C  
ATOM   2460  N   GLY A 323      16.889  21.883  20.812  1.00  0.97           N  
ATOM   2461  CA  GLY A 323      16.688  21.485  19.433  1.00  0.97           C  
ATOM   2462  C   GLY A 323      17.465  20.249  19.142  1.00  0.97           C  
ATOM   2463  O   GLY A 323      18.688  20.232  19.192  1.00  0.97           O  
ATOM   2464  N   SER A 324      16.765  19.165  18.806  1.00  0.95           N  
ATOM   2465  CA  SER A 324      17.383  17.867  18.659  1.00  0.95           C  
ATOM   2466  C   SER A 324      16.914  17.216  17.380  1.00  0.95           C  
ATOM   2467  O   SER A 324      15.889  17.579  16.788  1.00  0.95           O  
ATOM   2468  CB  SER A 324      17.048  16.939  19.854  1.00  0.95           C  
ATOM   2469  OG  SER A 324      17.635  17.445  21.054  1.00  0.95           O  
ATOM   2470  N   TYR A 325      17.700  16.242  16.900  1.00  0.95           N  
ATOM   2471  CA  TYR A 325      17.407  15.482  15.708  1.00  0.95           C  
ATOM   2472  C   TYR A 325      18.021  14.104  15.834  1.00  0.95           C  
ATOM   2473  O   TYR A 325      19.108  13.928  16.382  1.00  0.95           O  
ATOM   2474  CB  TYR A 325      17.975  16.207  14.459  1.00  0.95           C  
ATOM   2475  CG  TYR A 325      17.635  15.544  13.147  1.00  0.95           C  
ATOM   2476  CD1 TYR A 325      16.303  15.415  12.721  1.00  0.95           C  
ATOM   2477  CD2 TYR A 325      18.660  15.065  12.316  1.00  0.95           C  
ATOM   2478  CE1 TYR A 325      16.000  14.859  11.469  1.00  0.95           C  
ATOM   2479  CE2 TYR A 325      18.356  14.495  11.074  1.00  0.95           C  
ATOM   2480  CZ  TYR A 325      17.035  14.409  10.650  1.00  0.95           C  
ATOM   2481  OH  TYR A 325      16.770  13.882   9.378  1.00  0.95           O  
ATOM   2482  N   VAL A 326      17.321  13.092  15.301  1.00  0.97           N  
ATOM   2483  CA  VAL A 326      17.828  11.740  15.211  1.00  0.97           C  
ATOM   2484  C   VAL A 326      17.480  11.201  13.841  1.00  0.97           C  
ATOM   2485  O   VAL A 326      16.393  11.449  13.315  1.00  0.97           O  
ATOM   2486  CB  VAL A 326      17.310  10.796  16.296  1.00  0.97           C  
ATOM   2487  CG1 VAL A 326      17.840  11.254  17.663  1.00  0.97           C  
ATOM   2488  CG2 VAL A 326      15.772  10.744  16.320  1.00  0.97           C  
ATOM   2489  N   ALA A 327      18.412  10.461  13.215  1.00  0.98           N  
ATOM   2490  CA  ALA A 327      18.161   9.834  11.939  1.00  0.98           C  
ATOM   2491  C   ALA A 327      18.976   8.566  11.809  1.00  0.98           C  
ATOM   2492  O   ALA A 327      20.083   8.470  12.334  1.00  0.98           O  
ATOM   2493  CB  ALA A 327      18.487  10.780  10.769  1.00  0.98           C  
ATOM   2494  N   PHE A 328      18.446   7.548  11.110  1.00  0.94           N  
ATOM   2495  CA  PHE A 328      19.161   6.307  10.896  1.00  0.94           C  
ATOM   2496  C   PHE A 328      18.701   5.583   9.646  1.00  0.94           C  
ATOM   2497  O   PHE A 328      17.606   5.800   9.130  1.00  0.94           O  
ATOM   2498  CB  PHE A 328      19.130   5.360  12.129  1.00  0.94           C  
ATOM   2499  CG  PHE A 328      17.746   4.930  12.536  1.00  0.94           C  
ATOM   2500  CD1 PHE A 328      17.198   3.729  12.054  1.00  0.94           C  
ATOM   2501  CD2 PHE A 328      17.008   5.696  13.449  1.00  0.94           C  
ATOM   2502  CE1 PHE A 328      15.940   3.293  12.489  1.00  0.94           C  
ATOM   2503  CE2 PHE A 328      15.742   5.274  13.868  1.00  0.94           C  
ATOM   2504  CZ  PHE A 328      15.210   4.072  13.392  1.00  0.94           C  
ATOM   2505  N   ILE A 329      19.576   4.706   9.115  1.00  0.93           N  
ATOM   2506  CA  ILE A 329      19.306   3.932   7.914  1.00  0.93           C  
ATOM   2507  C   ILE A 329      19.510   2.449   8.243  1.00  0.93           C  
ATOM   2508  O   ILE A 329      20.664   2.016   8.345  1.00  0.93           O  
ATOM   2509  CB  ILE A 329      20.208   4.359   6.749  1.00  0.93           C  
ATOM   2510  CG1 ILE A 329      20.120   5.888   6.492  1.00  0.93           C  
ATOM   2511  CG2 ILE A 329      19.801   3.584   5.476  1.00  0.93           C  
ATOM   2512  CD1 ILE A 329      21.202   6.420   5.545  1.00  0.93           C  
ATOM   2513  N   PRO A 330      18.475   1.610   8.420  1.00  0.93           N  
ATOM   2514  CA  PRO A 330      18.650   0.229   8.884  1.00  0.93           C  
ATOM   2515  C   PRO A 330      19.400  -0.691   7.945  1.00  0.93           C  
ATOM   2516  O   PRO A 330      20.048  -1.619   8.417  1.00  0.93           O  
ATOM   2517  CB  PRO A 330      17.225  -0.285   9.131  1.00  0.93           C  
ATOM   2518  CG  PRO A 330      16.420   0.974   9.451  1.00  0.93           C  
ATOM   2519  CD  PRO A 330      17.083   2.055   8.595  1.00  0.93           C  
ATOM   2520  N   GLU A 331      19.327  -0.483   6.619  1.00  0.85           N  
ATOM   2521  CA  GLU A 331      20.068  -1.261   5.635  1.00  0.85           C  
ATOM   2522  C   GLU A 331      21.575  -1.182   5.829  1.00  0.85           C  
ATOM   2523  O   GLU A 331      22.308  -2.161   5.713  1.00  0.85           O  
ATOM   2524  CB  GLU A 331      19.718  -0.710   4.236  1.00  0.85           C  
ATOM   2525  CG  GLU A 331      20.547  -1.285   3.061  1.00  0.85           C  
ATOM   2526  CD  GLU A 331      20.274  -0.542   1.756  1.00  0.85           C  
ATOM   2527  OE1 GLU A 331      19.419   0.382   1.760  1.00  0.85           O  
ATOM   2528  OE2 GLU A 331      20.965  -0.862   0.758  1.00  0.85           O  
ATOM   2529  N   LYS A 332      22.061   0.021   6.160  1.00  0.83           N  
ATOM   2530  CA  LYS A 332      23.472   0.320   6.214  1.00  0.83           C  
ATOM   2531  C   LYS A 332      24.030   0.183   7.613  1.00  0.83           C  
ATOM   2532  O   LYS A 332      25.241   0.171   7.816  1.00  0.83           O  
ATOM   2533  CB  LYS A 332      23.644   1.804   5.829  1.00  0.83           C  
ATOM   2534  CG  LYS A 332      22.996   2.201   4.497  1.00  0.83           C  
ATOM   2535  CD  LYS A 332      23.904   2.008   3.281  1.00  0.83           C  
ATOM   2536  CE  LYS A 332      23.759   3.218   2.364  1.00  0.83           C  
ATOM   2537  NZ  LYS A 332      24.742   3.184   1.281  1.00  0.83           N  
ATOM   2538  N   GLN A 333      23.131   0.109   8.617  1.00  0.87           N  
ATOM   2539  CA  GLN A 333      23.449   0.150  10.034  1.00  0.87           C  
ATOM   2540  C   GLN A 333      24.271   1.365  10.436  1.00  0.87           C  
ATOM   2541  O   GLN A 333      25.246   1.288  11.185  1.00  0.87           O  
ATOM   2542  CB  GLN A 333      24.023  -1.182  10.569  1.00  0.87           C  
ATOM   2543  CG  GLN A 333      22.978  -2.324  10.587  1.00  0.87           C  
ATOM   2544  CD  GLN A 333      21.874  -2.069  11.621  1.00  0.87           C  
ATOM   2545  OE1 GLN A 333      22.139  -1.848  12.803  1.00  0.87           O  
ATOM   2546  NE2 GLN A 333      20.599  -2.087  11.171  1.00  0.87           N  
ATOM   2547  N   ILE A 334      23.828   2.546   9.956  1.00  0.92           N  
ATOM   2548  CA  ILE A 334      24.382   3.826  10.353  1.00  0.92           C  
ATOM   2549  C   ILE A 334      23.292   4.723  10.901  1.00  0.92           C  
ATOM   2550  O   ILE A 334      22.128   4.661  10.499  1.00  0.92           O  
ATOM   2551  CB  ILE A 334      25.184   4.550   9.274  1.00  0.92           C  
ATOM   2552  CG1 ILE A 334      24.328   5.035   8.083  1.00  0.92           C  
ATOM   2553  CG2 ILE A 334      26.317   3.608   8.819  1.00  0.92           C  
ATOM   2554  CD1 ILE A 334      25.135   5.810   7.036  1.00  0.92           C  
ATOM   2555  N   GLY A 335      23.640   5.582  11.875  1.00  0.97           N  
ATOM   2556  CA  GLY A 335      22.667   6.478  12.473  1.00  0.97           C  
ATOM   2557  C   GLY A 335      23.335   7.598  13.191  1.00  0.97           C  
ATOM   2558  O   GLY A 335      24.535   7.568  13.443  1.00  0.97           O  
ATOM   2559  N   ILE A 336      22.566   8.631  13.546  1.00  0.96           N  
ATOM   2560  CA  ILE A 336      23.104   9.806  14.189  1.00  0.96           C  
ATOM   2561  C   ILE A 336      22.097  10.366  15.174  1.00  0.96           C  
ATOM   2562  O   ILE A 336      20.885  10.359  14.956  1.00  0.96           O  
ATOM   2563  CB  ILE A 336      23.576  10.866  13.189  1.00  0.96           C  
ATOM   2564  CG1 ILE A 336      24.344  12.017  13.880  1.00  0.96           C  
ATOM   2565  CG2 ILE A 336      22.393  11.380  12.341  1.00  0.96           C  
ATOM   2566  CD1 ILE A 336      25.029  12.970  12.899  1.00  0.96           C  
ATOM   2567  N   VAL A 337      22.617  10.850  16.312  1.00  0.97           N  
ATOM   2568  CA  VAL A 337      21.905  11.611  17.312  1.00  0.97           C  
ATOM   2569  C   VAL A 337      22.582  12.954  17.397  1.00  0.97           C  
ATOM   2570  O   VAL A 337      23.796  13.029  17.560  1.00  0.97           O  
ATOM   2571  CB  VAL A 337      22.001  10.975  18.697  1.00  0.97           C  
ATOM   2572  CG1 VAL A 337      21.321  11.847  19.770  1.00  0.97           C  
ATOM   2573  CG2 VAL A 337      21.366   9.577  18.674  1.00  0.97           C  
ATOM   2574  N   MET A 338      21.811  14.049  17.302  1.00  0.94           N  
ATOM   2575  CA  MET A 338      22.297  15.388  17.554  1.00  0.94           C  
ATOM   2576  C   MET A 338      21.386  16.026  18.583  1.00  0.94           C  
ATOM   2577  O   MET A 338      20.196  16.221  18.339  1.00  0.94           O  
ATOM   2578  CB  MET A 338      22.279  16.246  16.265  1.00  0.94           C  
ATOM   2579  CG  MET A 338      23.349  15.838  15.231  1.00  0.94           C  
ATOM   2580  SD  MET A 338      22.974  16.319  13.518  1.00  0.94           S  
ATOM   2581  CE  MET A 338      22.714  18.097  13.755  1.00  0.94           C  
ATOM   2582  N   LEU A 339      21.933  16.364  19.765  1.00  0.96           N  
ATOM   2583  CA  LEU A 339      21.196  17.010  20.834  1.00  0.96           C  
ATOM   2584  C   LEU A 339      21.802  18.377  21.071  1.00  0.96           C  
ATOM   2585  O   LEU A 339      23.017  18.494  21.208  1.00  0.96           O  
ATOM   2586  CB  LEU A 339      21.277  16.224  22.173  1.00  0.96           C  
ATOM   2587  CG  LEU A 339      20.857  14.740  22.114  1.00  0.96           C  
ATOM   2588  CD1 LEU A 339      20.983  14.087  23.498  1.00  0.96           C  
ATOM   2589  CD2 LEU A 339      19.433  14.548  21.581  1.00  0.96           C  
ATOM   2590  N   ALA A 340      20.980  19.445  21.122  1.00  0.97           N  
ATOM   2591  CA  ALA A 340      21.472  20.795  21.308  1.00  0.97           C  
ATOM   2592  C   ALA A 340      20.600  21.596  22.255  1.00  0.97           C  
ATOM   2593  O   ALA A 340      19.384  21.422  22.319  1.00  0.97           O  
ATOM   2594  CB  ALA A 340      21.503  21.559  19.973  1.00  0.97           C  
ATOM   2595  N   ASN A 341      21.210  22.530  23.011  1.00  0.93           N  
ATOM   2596  CA  ASN A 341      20.504  23.415  23.926  1.00  0.93           C  
ATOM   2597  C   ASN A 341      20.199  24.797  23.348  1.00  0.93           C  
ATOM   2598  O   ASN A 341      20.223  25.801  24.054  1.00  0.93           O  
ATOM   2599  CB  ASN A 341      21.171  23.481  25.320  1.00  0.93           C  
ATOM   2600  CG  ASN A 341      22.584  24.043  25.289  1.00  0.93           C  
ATOM   2601  OD1 ASN A 341      23.190  24.249  24.239  1.00  0.93           O  
ATOM   2602  ND2 ASN A 341      23.146  24.274  26.497  1.00  0.93           N  
ATOM   2603  N   THR A 342      19.853  24.836  22.049  1.00  0.93           N  
ATOM   2604  CA  THR A 342      19.199  25.964  21.392  1.00  0.93           C  
ATOM   2605  C   THR A 342      18.273  25.341  20.382  1.00  0.93           C  
ATOM   2606  O   THR A 342      18.641  24.387  19.704  1.00  0.93           O  
ATOM   2607  CB  THR A 342      20.138  26.905  20.637  1.00  0.93           C  
ATOM   2608  OG1 THR A 342      20.837  27.718  21.560  1.00  0.93           O  
ATOM   2609  CG2 THR A 342      19.406  27.889  19.711  1.00  0.93           C  
ATOM   2610  N   SER A 343      17.035  25.857  20.225  1.00  0.94           N  
ATOM   2611  CA  SER A 343      16.165  25.427  19.135  1.00  0.94           C  
ATOM   2612  C   SER A 343      16.494  26.190  17.867  1.00  0.94           C  
ATOM   2613  O   SER A 343      16.191  27.372  17.729  1.00  0.94           O  
ATOM   2614  CB  SER A 343      14.660  25.617  19.440  1.00  0.94           C  
ATOM   2615  OG  SER A 343      13.830  25.047  18.419  1.00  0.94           O  
ATOM   2616  N   TYR A 344      17.149  25.520  16.904  1.00  0.93           N  
ATOM   2617  CA  TYR A 344      17.573  26.122  15.654  1.00  0.93           C  
ATOM   2618  C   TYR A 344      16.844  25.452  14.493  1.00  0.93           C  
ATOM   2619  O   TYR A 344      16.342  24.344  14.702  1.00  0.93           O  
ATOM   2620  CB  TYR A 344      19.120  26.088  15.519  1.00  0.93           C  
ATOM   2621  CG  TYR A 344      19.708  24.709  15.424  1.00  0.93           C  
ATOM   2622  CD1 TYR A 344      19.950  23.951  16.578  1.00  0.93           C  
ATOM   2623  CD2 TYR A 344      20.063  24.179  14.173  1.00  0.93           C  
ATOM   2624  CE1 TYR A 344      20.512  22.672  16.486  1.00  0.93           C  
ATOM   2625  CE2 TYR A 344      20.650  22.910  14.079  1.00  0.93           C  
ATOM   2626  CZ  TYR A 344      20.869  22.158  15.240  1.00  0.93           C  
ATOM   2627  OH  TYR A 344      21.411  20.863  15.152  1.00  0.93           O  
ATOM   2628  N   PRO A 345      16.686  26.040  13.303  1.00  0.93           N  
ATOM   2629  CA  PRO A 345      15.846  25.510  12.230  1.00  0.93           C  
ATOM   2630  C   PRO A 345      16.011  24.044  11.873  1.00  0.93           C  
ATOM   2631  O   PRO A 345      17.134  23.574  11.695  1.00  0.93           O  
ATOM   2632  CB  PRO A 345      16.153  26.419  11.030  1.00  0.93           C  
ATOM   2633  CG  PRO A 345      16.541  27.750  11.669  1.00  0.93           C  
ATOM   2634  CD  PRO A 345      17.320  27.300  12.902  1.00  0.93           C  
ATOM   2635  N   ASN A 346      14.894  23.310  11.699  1.00  0.91           N  
ATOM   2636  CA  ASN A 346      14.913  21.913  11.292  1.00  0.91           C  
ATOM   2637  C   ASN A 346      15.671  21.631   9.988  1.00  0.91           C  
ATOM   2638  O   ASN A 346      16.414  20.648   9.993  1.00  0.91           O  
ATOM   2639  CB  ASN A 346      13.484  21.308  11.197  1.00  0.91           C  
ATOM   2640  CG  ASN A 346      12.842  21.150  12.568  1.00  0.91           C  
ATOM   2641  OD1 ASN A 346      13.474  21.235  13.616  1.00  0.91           O  
ATOM   2642  ND2 ASN A 346      11.521  20.858  12.574  1.00  0.91           N  
ATOM   2643  N   PRO A 347      15.618  22.403   8.893  1.00  0.93           N  
ATOM   2644  CA  PRO A 347      16.443  22.149   7.711  1.00  0.93           C  
ATOM   2645  C   PRO A 347      17.939  22.111   7.975  1.00  0.93           C  
ATOM   2646  O   PRO A 347      18.638  21.286   7.394  1.00  0.93           O  
ATOM   2647  CB  PRO A 347      16.032  23.263   6.736  1.00  0.93           C  
ATOM   2648  CG  PRO A 347      14.571  23.534   7.095  1.00  0.93           C  
ATOM   2649  CD  PRO A 347      14.572  23.397   8.611  1.00  0.93           C  
ATOM   2650  N   ALA A 348      18.451  22.971   8.876  1.00  0.95           N  
ATOM   2651  CA  ALA A 348      19.843  22.975   9.283  1.00  0.95           C  
ATOM   2652  C   ALA A 348      20.273  21.712  10.027  1.00  0.95           C  
ATOM   2653  O   ALA A 348      21.374  21.197   9.835  1.00  0.95           O  
ATOM   2654  CB  ALA A 348      20.120  24.221  10.143  1.00  0.95           C  
ATOM   2655  N   ARG A 349      19.390  21.166  10.891  1.00  0.90           N  
ATOM   2656  CA  ARG A 349      19.609  19.890  11.558  1.00  0.90           C  
ATOM   2657  C   ARG A 349      19.721  18.733  10.582  1.00  0.90           C  
ATOM   2658  O   ARG A 349      20.630  17.909  10.665  1.00  0.90           O  
ATOM   2659  CB  ARG A 349      18.442  19.537  12.516  1.00  0.90           C  
ATOM   2660  CG  ARG A 349      18.086  20.640  13.521  1.00  0.90           C  
ATOM   2661  CD  ARG A 349      16.943  20.247  14.451  1.00  0.90           C  
ATOM   2662  NE  ARG A 349      16.525  21.487  15.158  1.00  0.90           N  
ATOM   2663  CZ  ARG A 349      15.512  21.512  16.027  1.00  0.90           C  
ATOM   2664  NH1 ARG A 349      14.944  20.402  16.476  1.00  0.90           N  
ATOM   2665  NH2 ARG A 349      15.092  22.687  16.480  1.00  0.90           N  
ATOM   2666  N   VAL A 350      18.791  18.681   9.607  1.00  0.96           N  
ATOM   2667  CA  VAL A 350      18.738  17.634   8.604  1.00  0.96           C  
ATOM   2668  C   VAL A 350      19.959  17.645   7.707  1.00  0.96           C  
ATOM   2669  O   VAL A 350      20.567  16.603   7.474  1.00  0.96           O  
ATOM   2670  CB  VAL A 350      17.470  17.735   7.769  1.00  0.96           C  
ATOM   2671  CG1 VAL A 350      17.444  16.647   6.681  1.00  0.96           C  
ATOM   2672  CG2 VAL A 350      16.241  17.543   8.674  1.00  0.96           C  
ATOM   2673  N   GLU A 351      20.381  18.834   7.232  1.00  0.90           N  
ATOM   2674  CA  GLU A 351      21.550  18.974   6.381  1.00  0.90           C  
ATOM   2675  C   GLU A 351      22.851  18.524   7.041  1.00  0.90           C  
ATOM   2676  O   GLU A 351      23.619  17.725   6.511  1.00  0.90           O  
ATOM   2677  CB  GLU A 351      21.690  20.451   5.950  1.00  0.90           C  
ATOM   2678  CG  GLU A 351      22.824  20.699   4.929  1.00  0.90           C  
ATOM   2679  CD  GLU A 351      22.639  19.851   3.673  1.00  0.90           C  
ATOM   2680  OE1 GLU A 351      21.613  20.057   2.974  1.00  0.90           O  
ATOM   2681  OE2 GLU A 351      23.505  18.982   3.417  1.00  0.90           O  
ATOM   2682  N   ALA A 352      23.093  18.958   8.295  1.00  0.93           N  
ATOM   2683  CA  ALA A 352      24.255  18.539   9.053  1.00  0.93           C  
ATOM   2684  C   ALA A 352      24.308  17.037   9.315  1.00  0.93           C  
ATOM   2685  O   ALA A 352      25.342  16.389   9.151  1.00  0.93           O  
ATOM   2686  CB  ALA A 352      24.276  19.307  10.384  1.00  0.93           C  
ATOM   2687  N   ALA A 353      23.166  16.433   9.684  1.00  0.95           N  
ATOM   2688  CA  ALA A 353      23.045  15.003   9.829  1.00  0.95           C  
ATOM   2689  C   ALA A 353      23.238  14.212   8.545  1.00  0.95           C  
ATOM   2690  O   ALA A 353      23.928  13.194   8.533  1.00  0.95           O  
ATOM   2691  CB  ALA A 353      21.660  14.705  10.396  1.00  0.95           C  
ATOM   2692  N   TYR A 354      22.655  14.676   7.419  1.00  0.92           N  
ATOM   2693  CA  TYR A 354      22.824  14.052   6.121  1.00  0.92           C  
ATOM   2694  C   TYR A 354      24.277  14.073   5.678  1.00  0.92           C  
ATOM   2695  O   TYR A 354      24.826  13.039   5.308  1.00  0.92           O  
ATOM   2696  CB  TYR A 354      21.890  14.738   5.085  1.00  0.92           C  
ATOM   2697  CG  TYR A 354      21.786  13.940   3.813  1.00  0.92           C  
ATOM   2698  CD1 TYR A 354      22.790  14.045   2.835  1.00  0.92           C  
ATOM   2699  CD2 TYR A 354      20.702  13.072   3.590  1.00  0.92           C  
ATOM   2700  CE1 TYR A 354      22.734  13.271   1.670  1.00  0.92           C  
ATOM   2701  CE2 TYR A 354      20.640  12.305   2.419  1.00  0.92           C  
ATOM   2702  CZ  TYR A 354      21.660  12.402   1.466  1.00  0.92           C  
ATOM   2703  OH  TYR A 354      21.601  11.627   0.298  1.00  0.92           O  
ATOM   2704  N   HIS A 355      24.954  15.227   5.810  1.00  0.86           N  
ATOM   2705  CA  HIS A 355      26.360  15.379   5.479  1.00  0.86           C  
ATOM   2706  C   HIS A 355      27.285  14.468   6.291  1.00  0.86           C  
ATOM   2707  O   HIS A 355      28.201  13.834   5.770  1.00  0.86           O  
ATOM   2708  CB  HIS A 355      26.766  16.856   5.679  1.00  0.86           C  
ATOM   2709  CG  HIS A 355      28.170  17.147   5.256  1.00  0.86           C  
ATOM   2710  ND1 HIS A 355      28.445  17.401   3.933  1.00  0.86           N  
ATOM   2711  CD2 HIS A 355      29.322  17.100   5.970  1.00  0.86           C  
ATOM   2712  CE1 HIS A 355      29.751  17.503   3.859  1.00  0.86           C  
ATOM   2713  NE2 HIS A 355      30.336  17.331   5.068  1.00  0.86           N  
ATOM   2714  N   ILE A 356      27.053  14.336   7.615  1.00  0.89           N  
ATOM   2715  CA  ILE A 356      27.805  13.398   8.445  1.00  0.89           C  
ATOM   2716  C   ILE A 356      27.558  11.940   8.068  1.00  0.89           C  
ATOM   2717  O   ILE A 356      28.499  11.159   7.951  1.00  0.89           O  
ATOM   2718  CB  ILE A 356      27.547  13.637   9.934  1.00  0.89           C  
ATOM   2719  CG1 ILE A 356      28.122  15.010  10.358  1.00  0.89           C  
ATOM   2720  CG2 ILE A 356      28.171  12.518  10.802  1.00  0.89           C  
ATOM   2721  CD1 ILE A 356      27.511  15.536  11.662  1.00  0.89           C  
ATOM   2722  N   LEU A 357      26.295  11.525   7.834  1.00  0.88           N  
ATOM   2723  CA  LEU A 357      26.002  10.165   7.404  1.00  0.88           C  
ATOM   2724  C   LEU A 357      26.509   9.830   6.006  1.00  0.88           C  
ATOM   2725  O   LEU A 357      26.994   8.726   5.784  1.00  0.88           O  
ATOM   2726  CB  LEU A 357      24.502   9.805   7.543  1.00  0.88           C  
ATOM   2727  CG  LEU A 357      23.979   9.742   8.998  1.00  0.88           C  
ATOM   2728  CD1 LEU A 357      22.508   9.301   9.023  1.00  0.88           C  
ATOM   2729  CD2 LEU A 357      24.800   8.803   9.895  1.00  0.88           C  
ATOM   2730  N   GLU A 358      26.475  10.783   5.050  1.00  0.79           N  
ATOM   2731  CA  GLU A 358      27.003  10.636   3.696  1.00  0.79           C  
ATOM   2732  C   GLU A 358      28.473  10.236   3.668  1.00  0.79           C  
ATOM   2733  O   GLU A 358      28.913   9.411   2.867  1.00  0.79           O  
ATOM   2734  CB  GLU A 358      26.811  11.951   2.902  1.00  0.79           C  
ATOM   2735  CG  GLU A 358      27.282  11.876   1.429  1.00  0.79           C  
ATOM   2736  CD  GLU A 358      27.022  13.173   0.671  1.00  0.79           C  
ATOM   2737  OE1 GLU A 358      27.848  14.109   0.815  1.00  0.79           O  
ATOM   2738  OE2 GLU A 358      26.017  13.220  -0.081  1.00  0.79           O  
ATOM   2739  N   ALA A 359      29.268  10.750   4.625  1.00  0.84           N  
ATOM   2740  CA  ALA A 359      30.651  10.363   4.806  1.00  0.84           C  
ATOM   2741  C   ALA A 359      30.879   8.879   5.118  1.00  0.84           C  
ATOM   2742  O   ALA A 359      31.965   8.350   4.889  1.00  0.84           O  
ATOM   2743  CB  ALA A 359      31.262  11.228   5.922  1.00  0.84           C  
ATOM   2744  N   LEU A 360      29.851   8.167   5.623  1.00  0.82           N  
ATOM   2745  CA  LEU A 360      29.930   6.761   5.962  1.00  0.82           C  
ATOM   2746  C   LEU A 360      29.380   5.842   4.873  1.00  0.82           C  
ATOM   2747  O   LEU A 360      29.482   4.625   5.034  1.00  0.82           O  
ATOM   2748  CB  LEU A 360      29.132   6.488   7.262  1.00  0.82           C  
ATOM   2749  CG  LEU A 360      29.611   7.269   8.501  1.00  0.82           C  
ATOM   2750  CD1 LEU A 360      28.707   6.947   9.696  1.00  0.82           C  
ATOM   2751  CD2 LEU A 360      31.071   6.951   8.846  1.00  0.82           C  
ATOM   2752  N   GLN A 361      28.873   6.418   3.754  1.00  0.67           N  
ATOM   2753  CA  GLN A 361      28.322   5.781   2.554  1.00  0.67           C  
ATOM   2754  C   GLN A 361      26.784   5.526   2.515  1.00  0.67           C  
ATOM   2755  O   GLN A 361      26.087   5.451   3.556  1.00  0.67           O  
ATOM   2756  CB  GLN A 361      29.037   4.475   2.091  1.00  0.67           C  
ATOM   2757  CG  GLN A 361      30.521   4.650   1.694  1.00  0.67           C  
ATOM   2758  CD  GLN A 361      31.194   3.311   1.390  1.00  0.67           C  
ATOM   2759  OE1 GLN A 361      31.035   2.292   2.064  1.00  0.67           O  
ATOM   2760  NE2 GLN A 361      32.058   3.298   0.350  1.00  0.67           N  
ATOM   2761  OXT GLN A 361      26.275   5.318   1.374  1.00  0.67           O  
TER    2762      GLN A 361                                                      
END   



If you find results from this site helpful for your research, please cite one of our papers:

elNémo is maintained by Yves-Henri Sanejouand.
It was developed by Karsten Suhre.
Between 2003 and 2014, it was hosted by IGS (Marseille).
Last modification: October 18th, 2018.