CNRS Nantes University UFIP UFIP
home |  start a new run |  job status |  references&downloads |  examples |  help  

Should you encounter any unexpected behaviour,
please let us know.
elNémo will be down on october 27th, due to electrical maintenance.
Sorry for the inconvenience.


***  gdp  ***

elNémo ID: 2010051533351913

Job options:

ID        	=	 2010051533351913
JOBID     	=	 gdp
USERID    	=	 ashgang72
PRIVAT    	=	 0

NMODES    	=	 5
DQMIN     	=	 -100
DQMAX     	=	 100
DQSTEP    	=	 20
DOGRAPHS  	=	 on

DOPROJMODS	=	 0
DORMSD    	=	 0

NRBL      	=	 0
CUTOFF    	=	 0
CAONLY    	=	 0


Input data for this run:

HEADER gdp

TITLE     SWISS-MODEL SERVER (https://swissmodel.expasy.org)
TITLE    2 Untitled Project
EXPDTA    THEORETICAL MODEL (SWISS-MODEL SERVER)
AUTHOR    SWISS-MODEL SERVER (SEE REFERENCE IN JRNL Records)
REVDAT   1   13-JUL-19 1MOD    1       14:08
JRNL        AUTH   A.WATERHOUSE,M.BERTONI,S.BIENERT,G.STUDER,G.TAURIELLO,
JRNL        AUTH 2 R.GUMIENNY,F.T.HEER,T.A.P.DE BEER,C.REMPFER,L.BORDOLI,
JRNL        AUTH 3 R.LEPORE,T.SCHWEDE
JRNL        TITL   SWISS-MODEL: HOMOLOGY MODELLING OF PROTEIN STRUCTURES AND
JRNL        TITL 2 COMPLEXES
JRNL        REF    NUCLEIC.ACIDS.RES..           V.  46 W296  2018
JRNL        PMID   29788355
JRNL        DOI    10.1093/nar/gky427
REMARK   1
REMARK   1 REFERENCE 1
REMARK   1  AUTH   S.BIENERT,A.WATERHOUSE,T.A.P.DE BEER,G.TAURIELLO,G.STUDER,
REMARK   1  AUTH 2 L.BORDOLI,T.SCHWEDE
REMARK   1  TITL   THE SWISS-MODEL REPOSITORY - NEW FEATURES AND FUNCTIONALITY
REMARK   1  REF    NUCLEIC.ACIDS.RES..           V.  22       2017
REMARK   1  REFN                   ISSN 0305-1048
REMARK   1  PMID   27899672
REMARK   1  DOI    10.1093/nar/gkw1132
REMARK   1
REMARK   1 REFERENCE 2
REMARK   1  AUTH   N.GUEX,M.C.PEITSCH,T.SCHWEDE
REMARK   1  TITL   AUTOMATED COMPARATIVE PROTEIN STRUCTURE MODELING WITH
REMARK   1  TITL 2 SWISS-MODEL AND SWISS-PDBVIEWER: A HISTORICAL PERSPECTIVE
REMARK   1  REF    ELECTROPHORESIS               V.  30       2009
REMARK   1  REFN                   ISSN 0173-0835
REMARK   1  PMID   19517507
REMARK   1  DOI    10.1002/elps.200900140
REMARK   1
REMARK   1 REFERENCE 3
REMARK   1  AUTH   P.BENKERT,M.BIASINI,T.SCHWEDE
REMARK   1  TITL   TOWARD THE ESTIMATION OF THE ABSOLUTE QUALITY OF INDIVIDUAL
REMARK   1  TITL 2 PROTEIN STRUCTURE MODELS
REMARK   1  REF    BIOINFORMATICS                V.  27       2011
REMARK   1  REFN                   ISSN 1367-4803
REMARK   1  PMID   21134891
REMARK   1  DOI    10.1093/bioinformatics/btq662
REMARK   1
REMARK   1 REFERENCE 4
REMARK   1  AUTH   M.BERTONI,F.KIEFER,M.BIASINI,L.BORDOLI,T.SCHWEDE
REMARK   1  TITL   MODELING PROTEIN QUATERNARY STRUCTURE OF HOMO- AND
REMARK   1  TITL 2 HETERO-OLIGOMERS BEYOND BINARY INTERACTIONS BY HOMOLOGY
REMARK   1  REF    SCI.REP.                      V.   7       2017
REMARK   1  REFN                   ISSN
REMARK   1  PMID   28874689
REMARK   1  DOI    10.1038/s41598-017-09654-8
REMARK   1
REMARK   1 DISCLAIMER
REMARK   1 The SWISS-MODEL SERVER produces theoretical models for proteins.
REMARK   1 The results of any theoretical modelling procedure is
REMARK   1 NON-EXPERIMENTAL and MUST be considered with care. These models may
REMARK   1 contain significant errors. This is especially true for automated
REMARK   1 modeling since there is no human intervention during model
REMARK   1 building. Please read the header section and the logfile carefully
REMARK   1 to know what templates and alignments were used during the model
REMARK   1 building process. All information by the SWISS-MODEL SERVER is
REMARK   1 provided "AS-IS", without any warranty, expressed or implied.
REMARK   2
REMARK   2 COPYRIGHT NOTICE
REMARK   2 This SWISS-MODEL protein model is copyright. It is produced by the
REMARK   2 SWISS-MODEL server, developed by the Computational Structural
REMARK   2 Biology Group at the SIB Swiss Institute of Bioinformatics at the
REMARK   2 Biozentrum, University of Basel (https://swissmodel.expasy.org). This
REMARK   2 model is licensed under the CC BY-SA 4.0 Creative Commons
REMARK   2 Attribution-ShareAlike 4.0 International License
REMARK   2 (https://creativecommons.org/licenses/by-sa/4.0/legalcode), i.e. you
REMARK   2 can copy and redistribute the model in any medium or format,
REMARK   2 transform and build upon the model for any purpose, even
REMARK   2 commercially, under the following terms:
REMARK   2 Attribution - You must give appropriate credit, provide a link to
REMARK   2 the license, and indicate if changes were made. You may do so in any
REMARK   2 reasonable manner, but not in any way that suggests the licensor
REMARK   2 endorses you or your use. When you publish, patent or distribute
REMARK   2 results that were fully or partially based on the model, please cite
REMARK   2 the corresponding papers mentioned under JRNL.
REMARK   2 ShareAlike - If you remix, transform, or build upon the material,
REMARK   2 you must distribute your contributions under the same license as the
REMARK   2 original.
REMARK   2 No additional restrictions - you may not apply legal terms or
REMARK   2 technological measures that legally restrict others from doing
REMARK   2 anything the license permits.
REMARK   2 Find a human-readable summary of (and not a substitute for) the
REMARK   2 CC BY-SA 4.0 license at this link:
REMARK   2 https://creativecommons.org/licenses/by-sa/4.0/
REMARK   3 
REMARK   3 MODEL INFORMATION
REMARK   3  ENGIN   PROMOD3
REMARK   3  VERSN   1.3.0
REMARK   3  OSTAT   monomer
REMARK   3  OSRSN   PREDICTION
REMARK   3  QSPRD   0.000
REMARK   3  QMN4    -3.68
REMARK   3  MODT    FALSE
REMARK   3 
REMARK   3 TEMPLATE 1
REMARK   3  PDBID   template_upload
REMARK   3  CHAIN    
REMARK   3  MMCIF    
REMARK   3  PDBV    2019-07-05
REMARK   3  SMTLE   template_upload.1.A
REMARK   3  SMTLV   2019-07-11
REMARK   3  MTHD    Unknown
REMARK   3  FOUND   BLAST
REMARK   3  SIM     0.61
REMARK   3  SID     100.00
REMARK   3  OSTAT   monomer
REMARK   3  ALN A TRG MGSSHHHHHHSSGLVPRGSHMARPEYDLVCIGLTGSGKTSLLSKLCSESPDNVVSTTG
REMARK   3  ALN A TRG FSIKAVPFQNAILNVKELGGADNIRKYWSRYYQGSQGVIFVLDSASSEDDLEAARNEL
REMARK   3  ALN A TRG HSALQHPQLCTLPFLILANHQDKPAARSVQEIKKYFELEPLARGKRWILQPCSLDDMD
REMARK   3  ALN A TRG ALKDSFSQLINLLEEKDHEAVRM
REMARK   3  ALN A TPL MGSSHHHHHHSSGLVPRGSHMARPEYDLVCIGLTGSGKTSLLSKLCSESPDNVVSTTG
REMARK   3  ALN A TPL FSIKAVPFQNAILNVKELGGADNIRKYWSRYYQGSQGVIFVLDSASSEDDLEAARNEL
REMARK   3  ALN A TPL HSALQHPQLCTLPFLILANHQDKPAARSVQEIKKYFELEPLARGKRWILQPCSLDDMD
REMARK   3  ALN A TPL ALKDSFSQLINLLEEKDHE----
REMARK   3  ALN A OFF 0
ATOM      1  N   MET A   1     -13.000 -32.917   9.108  1.00  0.36           N  
ATOM      2  CA  MET A   1     -14.103 -33.548   9.891  1.00  0.36           C  
ATOM      3  C   MET A   1     -14.357 -34.946   9.372  1.00  0.36           C  
ATOM      4  O   MET A   1     -13.832 -35.284   8.316  1.00  0.36           O  
ATOM      5  CB  MET A   1     -15.372 -32.664   9.765  1.00  0.36           C  
ATOM      6  CG  MET A   1     -15.307 -31.288  10.477  1.00  0.36           C  
ATOM      7  SD  MET A   1     -14.175 -30.050   9.758  1.00  0.36           S  
ATOM      8  CE  MET A   1     -12.891 -30.095  11.046  1.00  0.36           C  
ATOM      9  N   GLY A   2     -15.124 -35.782  10.101  1.00  0.46           N  
ATOM     10  CA  GLY A   2     -15.622 -37.058   9.590  1.00  0.46           C  
ATOM     11  C   GLY A   2     -17.005 -36.863   9.038  1.00  0.46           C  
ATOM     12  O   GLY A   2     -17.249 -35.966   8.237  1.00  0.46           O  
ATOM     13  N   SER A   3     -17.981 -37.677   9.486  1.00  0.49           N  
ATOM     14  CA  SER A   3     -19.395 -37.366   9.288  1.00  0.49           C  
ATOM     15  C   SER A   3     -19.764 -36.064   9.967  1.00  0.49           C  
ATOM     16  O   SER A   3     -19.498 -35.909  11.152  1.00  0.49           O  
ATOM     17  CB  SER A   3     -20.340 -38.415   9.932  1.00  0.49           C  
ATOM     18  OG  SER A   3     -20.149 -39.699   9.346  1.00  0.49           O  
ATOM     19  N   SER A   4     -20.400 -35.099   9.269  1.00  0.48           N  
ATOM     20  CA  SER A   4     -20.663 -33.774   9.832  1.00  0.48           C  
ATOM     21  C   SER A   4     -21.475 -33.803  11.115  1.00  0.48           C  
ATOM     22  O   SER A   4     -21.062 -33.282  12.147  1.00  0.48           O  
ATOM     23  CB  SER A   4     -21.432 -32.869   8.828  1.00  0.48           C  
ATOM     24  OG  SER A   4     -20.705 -32.758   7.605  1.00  0.48           O  
ATOM     25  N   HIS A   5     -22.624 -34.502  11.081  1.00  0.44           N  
ATOM     26  CA  HIS A   5     -23.549 -34.656  12.181  1.00  0.44           C  
ATOM     27  C   HIS A   5     -23.045 -35.500  13.339  1.00  0.44           C  
ATOM     28  O   HIS A   5     -23.289 -35.205  14.505  1.00  0.44           O  
ATOM     29  CB  HIS A   5     -24.870 -35.234  11.641  1.00  0.44           C  
ATOM     30  CG  HIS A   5     -24.663 -36.456  10.792  1.00  0.44           C  
ATOM     31  ND1 HIS A   5     -24.314 -36.326   9.460  1.00  0.44           N  
ATOM     32  CD2 HIS A   5     -24.722 -37.764  11.131  1.00  0.44           C  
ATOM     33  CE1 HIS A   5     -24.186 -37.562   9.015  1.00  0.44           C  
ATOM     34  NE2 HIS A   5     -24.415 -38.472   9.991  1.00  0.44           N  
ATOM     35  N   HIS A   6     -22.317 -36.595  13.061  1.00  0.43           N  
ATOM     36  CA  HIS A   6     -21.731 -37.404  14.113  1.00  0.43           C  
ATOM     37  C   HIS A   6     -20.251 -37.089  14.223  1.00  0.43           C  
ATOM     38  O   HIS A   6     -19.402 -37.973  14.181  1.00  0.43           O  
ATOM     39  CB  HIS A   6     -21.971 -38.916  13.894  1.00  0.43           C  
ATOM     40  CG  HIS A   6     -23.432 -39.277  13.875  1.00  0.43           C  
ATOM     41  ND1 HIS A   6     -23.873 -40.324  13.087  1.00  0.43           N  
ATOM     42  CD2 HIS A   6     -24.475 -38.745  14.571  1.00  0.43           C  
ATOM     43  CE1 HIS A   6     -25.170 -40.410  13.317  1.00  0.43           C  
ATOM     44  NE2 HIS A   6     -25.587 -39.475  14.206  1.00  0.43           N  
ATOM     45  N   HIS A   7     -19.925 -35.795  14.400  1.00  0.42           N  
ATOM     46  CA  HIS A   7     -18.594 -35.355  14.785  1.00  0.42           C  
ATOM     47  C   HIS A   7     -18.691 -34.036  15.520  1.00  0.42           C  
ATOM     48  O   HIS A   7     -17.886 -33.728  16.391  1.00  0.42           O  
ATOM     49  CB  HIS A   7     -17.695 -35.119  13.541  1.00  0.42           C  
ATOM     50  CG  HIS A   7     -16.247 -34.814  13.824  1.00  0.42           C  
ATOM     51  ND1 HIS A   7     -15.379 -34.490  12.790  1.00  0.42           N  
ATOM     52  CD2 HIS A   7     -15.584 -34.788  15.009  1.00  0.42           C  
ATOM     53  CE1 HIS A   7     -14.218 -34.270  13.381  1.00  0.42           C  
ATOM     54  NE2 HIS A   7     -14.288 -34.436  14.717  1.00  0.42           N  
ATOM     55  N   HIS A   8     -19.739 -33.227  15.257  1.00  0.39           N  
ATOM     56  CA  HIS A   8     -19.925 -31.981  15.988  1.00  0.39           C  
ATOM     57  C   HIS A   8     -20.489 -32.199  17.383  1.00  0.39           C  
ATOM     58  O   HIS A   8     -20.638 -31.275  18.179  1.00  0.39           O  
ATOM     59  CB  HIS A   8     -20.837 -30.996  15.220  1.00  0.39           C  
ATOM     60  CG  HIS A   8     -22.304 -31.288  15.316  1.00  0.39           C  
ATOM     61  ND1 HIS A   8     -22.933 -31.985  14.312  1.00  0.39           N  
ATOM     62  CD2 HIS A   8     -23.178 -31.017  16.320  1.00  0.39           C  
ATOM     63  CE1 HIS A   8     -24.177 -32.128  14.716  1.00  0.39           C  
ATOM     64  NE2 HIS A   8     -24.381 -31.563  15.929  1.00  0.39           N  
ATOM     65  N   HIS A   9     -20.862 -33.452  17.674  1.00  0.38           N  
ATOM     66  CA  HIS A   9     -21.446 -33.878  18.920  1.00  0.38           C  
ATOM     67  C   HIS A   9     -20.453 -33.919  20.075  1.00  0.38           C  
ATOM     68  O   HIS A   9     -19.239 -33.820  19.911  1.00  0.38           O  
ATOM     69  CB  HIS A   9     -22.133 -35.247  18.717  1.00  0.38           C  
ATOM     70  CG  HIS A   9     -23.356 -35.457  19.557  1.00  0.38           C  
ATOM     71  ND1 HIS A   9     -23.213 -35.839  20.869  1.00  0.38           N  
ATOM     72  CD2 HIS A   9     -24.672 -35.330  19.251  1.00  0.38           C  
ATOM     73  CE1 HIS A   9     -24.430 -35.951  21.344  1.00  0.38           C  
ATOM     74  NE2 HIS A   9     -25.359 -35.649  20.405  1.00  0.38           N  
ATOM     75  N   HIS A  10     -20.966 -34.045  21.304  1.00  0.39           N  
ATOM     76  CA  HIS A  10     -20.152 -34.054  22.495  1.00  0.39           C  
ATOM     77  C   HIS A  10     -19.829 -35.470  22.919  1.00  0.39           C  
ATOM     78  O   HIS A  10     -20.389 -36.450  22.439  1.00  0.39           O  
ATOM     79  CB  HIS A  10     -20.816 -33.266  23.651  1.00  0.39           C  
ATOM     80  CG  HIS A  10     -22.160 -33.780  24.068  1.00  0.39           C  
ATOM     81  ND1 HIS A  10     -22.237 -34.843  24.943  1.00  0.39           N  
ATOM     82  CD2 HIS A  10     -23.404 -33.382  23.698  1.00  0.39           C  
ATOM     83  CE1 HIS A  10     -23.522 -35.081  25.083  1.00  0.39           C  
ATOM     84  NE2 HIS A  10     -24.277 -34.224  24.353  1.00  0.39           N  
ATOM     85  N   SER A  11     -18.887 -35.616  23.858  1.00  0.47           N  
ATOM     86  CA  SER A  11     -18.710 -36.874  24.533  1.00  0.47           C  
ATOM     87  C   SER A  11     -17.987 -36.525  25.806  1.00  0.47           C  
ATOM     88  O   SER A  11     -17.376 -35.459  25.906  1.00  0.47           O  
ATOM     89  CB  SER A  11     -17.929 -37.921  23.696  1.00  0.47           C  
ATOM     90  OG  SER A  11     -17.857 -39.185  24.358  1.00  0.47           O  
ATOM     91  N   SER A  12     -18.078 -37.384  26.831  1.00  0.52           N  
ATOM     92  CA  SER A  12     -17.308 -37.240  28.053  1.00  0.52           C  
ATOM     93  C   SER A  12     -16.352 -38.417  28.135  1.00  0.52           C  
ATOM     94  O   SER A  12     -16.095 -39.128  27.169  1.00  0.52           O  
ATOM     95  CB  SER A  12     -18.214 -37.203  29.318  1.00  0.52           C  
ATOM     96  OG  SER A  12     -17.521 -36.705  30.470  1.00  0.52           O  
ATOM     97  N   GLY A  13     -15.810 -38.671  29.324  1.00  0.58           N  
ATOM     98  CA  GLY A  13     -15.105 -39.887  29.650  1.00  0.58           C  
ATOM     99  C   GLY A  13     -15.059 -39.882  31.142  1.00  0.58           C  
ATOM    100  O   GLY A  13     -15.608 -38.980  31.776  1.00  0.58           O  
ATOM    101  N   LEU A  14     -14.360 -40.842  31.774  1.00  0.50           N  
ATOM    102  CA  LEU A  14     -13.906 -40.642  33.148  1.00  0.50           C  
ATOM    103  C   LEU A  14     -12.827 -39.552  33.136  1.00  0.50           C  
ATOM    104  O   LEU A  14     -12.787 -38.577  33.892  1.00  0.50           O  
ATOM    105  CB  LEU A  14     -13.304 -41.968  33.689  1.00  0.50           C  
ATOM    106  CG  LEU A  14     -13.340 -42.148  35.224  1.00  0.50           C  
ATOM    107  CD1 LEU A  14     -12.675 -43.478  35.603  1.00  0.50           C  
ATOM    108  CD2 LEU A  14     -12.674 -41.005  36.005  1.00  0.50           C  
ATOM    109  N   VAL A  15     -11.961 -39.719  32.135  1.00  0.50           N  
ATOM    110  CA  VAL A  15     -10.777 -38.976  31.839  1.00  0.50           C  
ATOM    111  C   VAL A  15     -10.857 -38.815  30.319  1.00  0.50           C  
ATOM    112  O   VAL A  15     -11.706 -39.492  29.730  1.00  0.50           O  
ATOM    113  CB  VAL A  15      -9.571 -39.782  32.337  1.00  0.50           C  
ATOM    114  CG1 VAL A  15      -8.894 -40.624  31.233  1.00  0.50           C  
ATOM    115  CG2 VAL A  15      -8.581 -38.890  33.110  1.00  0.50           C  
ATOM    116  N   PRO A  16     -10.091 -38.011  29.589  1.00  0.46           N  
ATOM    117  CA  PRO A  16      -8.962 -37.212  30.042  1.00  0.46           C  
ATOM    118  C   PRO A  16      -9.281 -36.143  31.053  1.00  0.46           C  
ATOM    119  O   PRO A  16     -10.442 -35.842  31.333  1.00  0.46           O  
ATOM    120  CB  PRO A  16      -8.404 -36.610  28.753  1.00  0.46           C  
ATOM    121  CG  PRO A  16      -8.714 -37.687  27.717  1.00  0.46           C  
ATOM    122  CD  PRO A  16     -10.121 -38.110  28.129  1.00  0.46           C  
ATOM    123  N   ARG A  17      -8.239 -35.511  31.618  1.00  0.40           N  
ATOM    124  CA  ARG A  17      -8.397 -34.295  32.383  1.00  0.40           C  
ATOM    125  C   ARG A  17      -8.731 -33.135  31.452  1.00  0.40           C  
ATOM    126  O   ARG A  17      -7.919 -32.287  31.112  1.00  0.40           O  
ATOM    127  CB  ARG A  17      -7.196 -34.044  33.325  1.00  0.40           C  
ATOM    128  CG  ARG A  17      -7.067 -35.132  34.420  1.00  0.40           C  
ATOM    129  CD  ARG A  17      -7.965 -34.976  35.658  1.00  0.40           C  
ATOM    130  NE  ARG A  17      -9.407 -35.270  35.320  1.00  0.40           N  
ATOM    131  CZ  ARG A  17     -10.429 -34.423  35.504  1.00  0.40           C  
ATOM    132  NH1 ARG A  17     -10.221 -33.148  35.819  1.00  0.40           N  
ATOM    133  NH2 ARG A  17     -11.680 -34.865  35.404  1.00  0.40           N  
ATOM    134  N   GLY A  18     -10.017 -33.118  31.054  1.00  0.47           N  
ATOM    135  CA  GLY A  18     -10.582 -32.479  29.872  1.00  0.47           C  
ATOM    136  C   GLY A  18     -11.971 -33.030  29.707  1.00  0.47           C  
ATOM    137  O   GLY A  18     -12.506 -33.196  28.621  1.00  0.47           O  
ATOM    138  N   SER A  19     -12.590 -33.302  30.868  1.00  0.47           N  
ATOM    139  CA  SER A  19     -13.956 -33.768  31.023  1.00  0.47           C  
ATOM    140  C   SER A  19     -14.921 -32.616  31.202  1.00  0.47           C  
ATOM    141  O   SER A  19     -14.520 -31.458  31.369  1.00  0.47           O  
ATOM    142  CB  SER A  19     -14.049 -34.743  32.237  1.00  0.47           C  
ATOM    143  OG  SER A  19     -15.348 -35.319  32.420  1.00  0.47           O  
ATOM    144  N   HIS A  20     -16.228 -32.936  31.210  1.00  0.35           N  
ATOM    145  CA  HIS A  20     -17.245 -32.048  31.728  1.00  0.35           C  
ATOM    146  C   HIS A  20     -17.349 -32.315  33.229  1.00  0.35           C  
ATOM    147  O   HIS A  20     -16.326 -32.269  33.884  1.00  0.35           O  
ATOM    148  CB  HIS A  20     -18.594 -32.175  30.996  1.00  0.35           C  
ATOM    149  CG  HIS A  20     -18.427 -31.968  29.513  1.00  0.35           C  
ATOM    150  ND1 HIS A  20     -18.188 -30.690  29.047  1.00  0.35           N  
ATOM    151  CD2 HIS A  20     -18.301 -32.867  28.499  1.00  0.35           C  
ATOM    152  CE1 HIS A  20     -17.923 -30.835  27.762  1.00  0.35           C  
ATOM    153  NE2 HIS A  20     -17.974 -32.133  27.379  1.00  0.35           N  
ATOM    154  N   MET A  21     -18.538 -32.614  33.823  1.00  0.30           N  
ATOM    155  CA  MET A  21     -18.853 -32.574  35.271  1.00  0.30           C  
ATOM    156  C   MET A  21     -17.817 -33.132  36.259  1.00  0.30           C  
ATOM    157  O   MET A  21     -17.667 -32.636  37.370  1.00  0.30           O  
ATOM    158  CB  MET A  21     -20.217 -33.278  35.567  1.00  0.30           C  
ATOM    159  CG  MET A  21     -21.471 -32.589  34.977  1.00  0.30           C  
ATOM    160  SD  MET A  21     -23.025 -33.537  35.143  1.00  0.30           S  
ATOM    161  CE  MET A  21     -23.145 -33.508  36.957  1.00  0.30           C  
ATOM    162  N   ALA A  22     -17.030 -34.144  35.869  1.00  0.46           N  
ATOM    163  CA  ALA A  22     -15.933 -34.651  36.665  1.00  0.46           C  
ATOM    164  C   ALA A  22     -14.655 -33.797  36.678  1.00  0.46           C  
ATOM    165  O   ALA A  22     -13.694 -34.111  37.375  1.00  0.46           O  
ATOM    166  CB  ALA A  22     -15.580 -36.045  36.127  1.00  0.46           C  
ATOM    167  N   ARG A  23     -14.531 -32.728  35.872  1.00  0.38           N  
ATOM    168  CA  ARG A  23     -13.372 -31.848  35.895  1.00  0.38           C  
ATOM    169  C   ARG A  23     -13.553 -30.476  36.508  1.00  0.38           C  
ATOM    170  O   ARG A  23     -12.639 -30.111  37.254  1.00  0.38           O  
ATOM    171  CB  ARG A  23     -12.780 -31.677  34.471  1.00  0.38           C  
ATOM    172  CG  ARG A  23     -11.678 -30.594  34.350  1.00  0.38           C  
ATOM    173  CD  ARG A  23     -11.024 -30.528  32.977  1.00  0.38           C  
ATOM    174  NE  ARG A  23     -12.086 -30.107  32.013  1.00  0.38           N  
ATOM    175  CZ  ARG A  23     -12.501 -28.844  31.878  1.00  0.38           C  
ATOM    176  NH1 ARG A  23     -13.598 -28.615  31.164  1.00  0.38           N  
ATOM    177  NH2 ARG A  23     -11.881 -27.826  32.463  1.00  0.38           N  
ATOM    178  N   PRO A  24     -14.582 -29.665  36.253  1.00  0.44           N  
ATOM    179  CA  PRO A  24     -14.695 -28.349  36.838  1.00  0.44           C  
ATOM    180  C   PRO A  24     -14.784 -28.323  38.345  1.00  0.44           C  
ATOM    181  O   PRO A  24     -14.859 -29.349  39.020  1.00  0.44           O  
ATOM    182  CB  PRO A  24     -16.012 -27.783  36.264  1.00  0.44           C  
ATOM    183  CG  PRO A  24     -16.222 -28.506  34.944  1.00  0.44           C  
ATOM    184  CD  PRO A  24     -15.609 -29.870  35.236  1.00  0.44           C  
ATOM    185  N   GLU A  25     -14.850 -27.109  38.887  1.00  0.54           N  
ATOM    186  CA  GLU A  25     -15.391 -26.874  40.197  1.00  0.54           C  
ATOM    187  C   GLU A  25     -16.825 -27.339  40.374  1.00  0.54           C  
ATOM    188  O   GLU A  25     -17.667 -27.243  39.479  1.00  0.54           O  
ATOM    189  CB  GLU A  25     -15.301 -25.378  40.535  1.00  0.54           C  
ATOM    190  CG  GLU A  25     -14.048 -24.736  39.902  1.00  0.54           C  
ATOM    191  CD  GLU A  25     -13.685 -23.429  40.584  1.00  0.54           C  
ATOM    192  OE1 GLU A  25     -14.600 -22.589  40.759  1.00  0.54           O  
ATOM    193  OE2 GLU A  25     -12.486 -23.265  40.925  1.00  0.54           O  
ATOM    194  N   TYR A  26     -17.129 -27.869  41.562  1.00  0.58           N  
ATOM    195  CA  TYR A  26     -18.458 -28.290  41.894  1.00  0.58           C  
ATOM    196  C   TYR A  26     -18.763 -27.885  43.330  1.00  0.58           C  
ATOM    197  O   TYR A  26     -17.942 -28.010  44.239  1.00  0.58           O  
ATOM    198  CB  TYR A  26     -18.694 -29.781  41.507  1.00  0.58           C  
ATOM    199  CG  TYR A  26     -18.099 -30.836  42.382  1.00  0.58           C  
ATOM    200  CD1 TYR A  26     -18.778 -31.208  43.554  1.00  0.58           C  
ATOM    201  CD2 TYR A  26     -17.007 -31.610  41.943  1.00  0.58           C  
ATOM    202  CE1 TYR A  26     -18.379 -32.346  44.257  1.00  0.58           C  
ATOM    203  CE2 TYR A  26     -16.636 -32.766  42.644  1.00  0.58           C  
ATOM    204  CZ  TYR A  26     -17.328 -33.123  43.796  1.00  0.58           C  
ATOM    205  OH  TYR A  26     -16.891 -34.196  44.572  1.00  0.58           O  
ATOM    206  N   ASP A  27     -19.961 -27.312  43.561  1.00  0.71           N  
ATOM    207  CA  ASP A  27     -20.344 -26.772  44.844  1.00  0.71           C  
ATOM    208  C   ASP A  27     -20.962 -27.875  45.681  1.00  0.71           C  
ATOM    209  O   ASP A  27     -21.834 -28.618  45.229  1.00  0.71           O  
ATOM    210  CB  ASP A  27     -21.347 -25.620  44.608  1.00  0.71           C  
ATOM    211  CG  ASP A  27     -21.614 -24.750  45.814  1.00  0.71           C  
ATOM    212  OD1 ASP A  27     -20.921 -24.828  46.853  1.00  0.71           O  
ATOM    213  OD2 ASP A  27     -22.542 -23.911  45.683  1.00  0.71           O  
ATOM    214  N   LEU A  28     -20.500 -28.022  46.921  1.00  0.74           N  
ATOM    215  CA  LEU A  28     -20.971 -29.033  47.822  1.00  0.74           C  
ATOM    216  C   LEU A  28     -21.520 -28.331  49.031  1.00  0.74           C  
ATOM    217  O   LEU A  28     -20.891 -27.475  49.651  1.00  0.74           O  
ATOM    218  CB  LEU A  28     -19.819 -29.933  48.310  1.00  0.74           C  
ATOM    219  CG  LEU A  28     -19.345 -31.053  47.380  1.00  0.74           C  
ATOM    220  CD1 LEU A  28     -18.160 -31.819  47.988  1.00  0.74           C  
ATOM    221  CD2 LEU A  28     -20.490 -32.025  47.115  1.00  0.74           C  
ATOM    222  N   VAL A  29     -22.727 -28.714  49.438  1.00  0.77           N  
ATOM    223  CA  VAL A  29     -23.314 -28.163  50.633  1.00  0.77           C  
ATOM    224  C   VAL A  29     -23.220 -29.235  51.686  1.00  0.77           C  
ATOM    225  O   VAL A  29     -23.655 -30.367  51.486  1.00  0.77           O  
ATOM    226  CB  VAL A  29     -24.755 -27.760  50.398  1.00  0.77           C  
ATOM    227  CG1 VAL A  29     -25.358 -27.184  51.686  1.00  0.77           C  
ATOM    228  CG2 VAL A  29     -24.821 -26.723  49.264  1.00  0.77           C  
ATOM    229  N   CYS A  30     -22.631 -28.920  52.845  1.00  0.76           N  
ATOM    230  CA  CYS A  30     -22.452 -29.885  53.899  1.00  0.76           C  
ATOM    231  C   CYS A  30     -23.346 -29.485  55.064  1.00  0.76           C  
ATOM    232  O   CYS A  30     -23.293 -28.374  55.597  1.00  0.76           O  
ATOM    233  CB  CYS A  30     -20.965 -30.027  54.261  1.00  0.76           C  
ATOM    234  SG  CYS A  30     -20.604 -31.406  55.403  1.00  0.76           S  
ATOM    235  N   ILE A  31     -24.276 -30.388  55.430  1.00  0.77           N  
ATOM    236  CA  ILE A  31     -25.355 -30.119  56.364  1.00  0.77           C  
ATOM    237  C   ILE A  31     -25.495 -31.298  57.306  1.00  0.77           C  
ATOM    238  O   ILE A  31     -24.847 -32.333  57.171  1.00  0.77           O  
ATOM    239  CB  ILE A  31     -26.717 -29.832  55.735  1.00  0.77           C  
ATOM    240  CG1 ILE A  31     -27.203 -30.983  54.833  1.00  0.77           C  
ATOM    241  CG2 ILE A  31     -26.643 -28.508  54.962  1.00  0.77           C  
ATOM    242  CD1 ILE A  31     -28.703 -30.897  54.529  1.00  0.77           C  
ATOM    243  N   GLY A  32     -26.305 -31.145  58.363  1.00  0.81           N  
ATOM    244  CA  GLY A  32     -26.397 -32.128  59.428  1.00  0.81           C  
ATOM    245  C   GLY A  32     -26.667 -31.399  60.704  1.00  0.81           C  
ATOM    246  O   GLY A  32     -26.602 -30.174  60.763  1.00  0.81           O  
ATOM    247  N   LEU A  33     -26.976 -32.114  61.789  1.00  0.75           N  
ATOM    248  CA  LEU A  33     -27.255 -31.487  63.071  1.00  0.75           C  
ATOM    249  C   LEU A  33     -26.031 -30.797  63.704  1.00  0.75           C  
ATOM    250  O   LEU A  33     -24.908 -30.824  63.180  1.00  0.75           O  
ATOM    251  CB  LEU A  33     -27.908 -32.514  64.029  1.00  0.75           C  
ATOM    252  CG  LEU A  33     -29.218 -33.149  63.493  1.00  0.75           C  
ATOM    253  CD1 LEU A  33     -29.821 -34.096  64.540  1.00  0.75           C  
ATOM    254  CD2 LEU A  33     -30.276 -32.113  63.080  1.00  0.75           C  
ATOM    255  N   THR A  34     -26.193 -30.102  64.852  1.00  0.72           N  
ATOM    256  CA  THR A  34     -25.044 -29.626  65.630  1.00  0.72           C  
ATOM    257  C   THR A  34     -24.187 -30.772  66.140  1.00  0.72           C  
ATOM    258  O   THR A  34     -24.647 -31.890  66.322  1.00  0.72           O  
ATOM    259  CB  THR A  34     -25.336 -28.730  66.827  1.00  0.72           C  
ATOM    260  OG1 THR A  34     -26.274 -29.339  67.697  1.00  0.72           O  
ATOM    261  CG2 THR A  34     -25.973 -27.438  66.346  1.00  0.72           C  
ATOM    262  N   GLY A  35     -22.863 -30.547  66.297  1.00  0.73           N  
ATOM    263  CA  GLY A  35     -21.949 -31.522  66.906  1.00  0.73           C  
ATOM    264  C   GLY A  35     -21.572 -32.683  66.023  1.00  0.73           C  
ATOM    265  O   GLY A  35     -20.684 -33.468  66.330  1.00  0.73           O  
ATOM    266  N   SER A  36     -22.187 -32.746  64.832  1.00  0.77           N  
ATOM    267  CA  SER A  36     -22.063 -33.819  63.862  1.00  0.77           C  
ATOM    268  C   SER A  36     -20.637 -34.050  63.364  1.00  0.77           C  
ATOM    269  O   SER A  36     -20.206 -35.155  63.043  1.00  0.77           O  
ATOM    270  CB  SER A  36     -23.007 -33.528  62.677  1.00  0.77           C  
ATOM    271  OG  SER A  36     -23.086 -34.684  61.877  1.00  0.77           O  
ATOM    272  N   GLY A  37     -19.830 -32.972  63.324  1.00  0.77           N  
ATOM    273  CA  GLY A  37     -18.415 -33.066  62.977  1.00  0.77           C  
ATOM    274  C   GLY A  37     -18.103 -32.472  61.641  1.00  0.77           C  
ATOM    275  O   GLY A  37     -17.010 -32.636  61.123  1.00  0.77           O  
ATOM    276  N   LYS A  38     -19.063 -31.737  61.065  1.00  0.72           N  
ATOM    277  CA  LYS A  38     -18.984 -31.051  59.787  1.00  0.72           C  
ATOM    278  C   LYS A  38     -17.817 -30.091  59.615  1.00  0.72           C  
ATOM    279  O   LYS A  38     -16.977 -30.206  58.734  1.00  0.72           O  
ATOM    280  CB  LYS A  38     -20.266 -30.198  59.750  1.00  0.72           C  
ATOM    281  CG  LYS A  38     -21.490 -31.011  59.345  1.00  0.72           C  
ATOM    282  CD  LYS A  38     -22.696 -30.127  59.017  1.00  0.72           C  
ATOM    283  CE  LYS A  38     -23.659 -29.873  60.165  1.00  0.72           C  
ATOM    284  NZ  LYS A  38     -23.094 -28.938  61.142  1.00  0.72           N  
ATOM    285  N   THR A  39     -17.692 -29.142  60.550  1.00  0.70           N  
ATOM    286  CA  THR A  39     -16.602 -28.179  60.604  1.00  0.70           C  
ATOM    287  C   THR A  39     -15.251 -28.850  60.782  1.00  0.70           C  
ATOM    288  O   THR A  39     -14.264 -28.482  60.149  1.00  0.70           O  
ATOM    289  CB  THR A  39     -16.872 -27.183  61.720  1.00  0.70           C  
ATOM    290  OG1 THR A  39     -15.929 -26.126  61.749  1.00  0.70           O  
ATOM    291  CG2 THR A  39     -16.919 -27.874  63.095  1.00  0.70           C  
ATOM    292  N   SER A  40     -15.206 -29.908  61.623  1.00  0.69           N  
ATOM    293  CA  SER A  40     -14.038 -30.722  61.871  1.00  0.69           C  
ATOM    294  C   SER A  40     -13.601 -31.417  60.625  1.00  0.69           C  
ATOM    295  O   SER A  40     -12.431 -31.400  60.269  1.00  0.69           O  
ATOM    296  CB  SER A  40     -14.306 -31.825  62.916  1.00  0.69           C  
ATOM    297  OG  SER A  40     -14.878 -31.269  64.097  1.00  0.69           O  
ATOM    298  N   LEU A  41     -14.564 -31.998  59.887  1.00  0.69           N  
ATOM    299  CA  LEU A  41     -14.348 -32.478  58.553  1.00  0.69           C  
ATOM    300  C   LEU A  41     -13.798 -31.385  57.643  1.00  0.69           C  
ATOM    301  O   LEU A  41     -12.660 -31.476  57.223  1.00  0.69           O  
ATOM    302  CB  LEU A  41     -15.650 -33.092  57.997  1.00  0.69           C  
ATOM    303  CG  LEU A  41     -15.456 -33.648  56.586  1.00  0.69           C  
ATOM    304  CD1 LEU A  41     -14.506 -34.860  56.581  1.00  0.69           C  
ATOM    305  CD2 LEU A  41     -16.785 -33.933  55.901  1.00  0.69           C  
ATOM    306  N   LEU A  42     -14.475 -30.251  57.403  1.00  0.63           N  
ATOM    307  CA  LEU A  42     -13.927 -29.220  56.526  1.00  0.63           C  
ATOM    308  C   LEU A  42     -12.528 -28.723  56.869  1.00  0.63           C  
ATOM    309  O   LEU A  42     -11.682 -28.508  55.995  1.00  0.63           O  
ATOM    310  CB  LEU A  42     -14.828 -27.981  56.551  1.00  0.63           C  
ATOM    311  CG  LEU A  42     -14.462 -26.886  55.526  1.00  0.63           C  
ATOM    312  CD1 LEU A  42     -14.842 -27.341  54.115  1.00  0.63           C  
ATOM    313  CD2 LEU A  42     -15.089 -25.530  55.880  1.00  0.63           C  
ATOM    314  N   SER A  43     -12.221 -28.524  58.164  1.00  0.59           N  
ATOM    315  CA  SER A  43     -10.859 -28.234  58.553  1.00  0.59           C  
ATOM    316  C   SER A  43      -9.877 -29.351  58.332  1.00  0.59           C  
ATOM    317  O   SER A  43      -8.876 -29.081  57.679  1.00  0.59           O  
ATOM    318  CB  SER A  43     -10.696 -27.696  59.978  1.00  0.59           C  
ATOM    319  OG  SER A  43     -10.956 -28.672  60.981  1.00  0.59           O  
ATOM    320  N   LYS A  44     -10.193 -30.625  58.707  1.00  0.56           N  
ATOM    321  CA  LYS A  44      -9.358 -31.807  58.476  1.00  0.56           C  
ATOM    322  C   LYS A  44      -8.915 -31.841  57.055  1.00  0.56           C  
ATOM    323  O   LYS A  44      -7.788 -32.174  56.709  1.00  0.56           O  
ATOM    324  CB  LYS A  44     -10.140 -33.169  58.612  1.00  0.56           C  
ATOM    325  CG  LYS A  44     -10.326 -33.764  60.014  1.00  0.56           C  
ATOM    326  CD  LYS A  44      -9.058 -33.696  60.851  1.00  0.56           C  
ATOM    327  CE  LYS A  44      -7.870 -34.430  60.241  1.00  0.56           C  
ATOM    328  NZ  LYS A  44      -8.053 -35.858  60.441  1.00  0.56           N  
ATOM    329  N   LEU A  45      -9.877 -31.500  56.209  1.00  0.54           N  
ATOM    330  CA  LEU A  45      -9.735 -31.548  54.816  1.00  0.54           C  
ATOM    331  C   LEU A  45      -8.914 -30.422  54.191  1.00  0.54           C  
ATOM    332  O   LEU A  45      -8.060 -30.629  53.345  1.00  0.54           O  
ATOM    333  CB  LEU A  45     -11.163 -31.595  54.292  1.00  0.54           C  
ATOM    334  CG  LEU A  45     -11.932 -32.876  54.719  1.00  0.54           C  
ATOM    335  CD1 LEU A  45     -13.308 -32.788  54.133  1.00  0.54           C  
ATOM    336  CD2 LEU A  45     -11.376 -34.261  54.440  1.00  0.54           C  
ATOM    337  N   CYS A  46      -9.142 -29.163  54.578  1.00  0.54           N  
ATOM    338  CA  CYS A  46      -8.325 -28.047  54.111  1.00  0.54           C  
ATOM    339  C   CYS A  46      -6.922 -27.951  54.711  1.00  0.54           C  
ATOM    340  O   CYS A  46      -5.985 -27.536  54.036  1.00  0.54           O  
ATOM    341  CB  CYS A  46      -9.066 -26.715  54.360  1.00  0.54           C  
ATOM    342  SG  CYS A  46      -8.308 -25.256  53.539  1.00  0.54           S  
ATOM    343  N   SER A  47      -6.748 -28.264  56.010  1.00  0.53           N  
ATOM    344  CA  SER A  47      -5.478 -28.052  56.703  1.00  0.53           C  
ATOM    345  C   SER A  47      -4.652 -29.306  56.862  1.00  0.53           C  
ATOM    346  O   SER A  47      -3.518 -29.224  57.327  1.00  0.53           O  
ATOM    347  CB  SER A  47      -5.697 -27.512  58.152  1.00  0.53           C  
ATOM    348  OG  SER A  47      -6.543 -28.373  58.918  1.00  0.53           O  
ATOM    349  N   GLU A  48      -5.216 -30.479  56.505  1.00  0.46           N  
ATOM    350  CA  GLU A  48      -4.629 -31.797  56.703  1.00  0.46           C  
ATOM    351  C   GLU A  48      -4.454 -32.175  58.182  1.00  0.46           C  
ATOM    352  O   GLU A  48      -3.742 -33.114  58.531  1.00  0.46           O  
ATOM    353  CB  GLU A  48      -3.303 -32.015  55.923  1.00  0.46           C  
ATOM    354  CG  GLU A  48      -3.416 -31.947  54.377  1.00  0.46           C  
ATOM    355  CD  GLU A  48      -2.042 -31.989  53.697  1.00  0.46           C  
ATOM    356  OE1 GLU A  48      -1.012 -32.115  54.412  1.00  0.46           O  
ATOM    357  OE2 GLU A  48      -2.006 -31.875  52.446  1.00  0.46           O  
ATOM    358  N   SER A  49      -5.133 -31.499  59.134  1.00  0.46           N  
ATOM    359  CA  SER A  49      -4.838 -31.683  60.551  1.00  0.46           C  
ATOM    360  C   SER A  49      -6.107 -31.614  61.384  1.00  0.46           C  
ATOM    361  O   SER A  49      -7.052 -30.934  60.993  1.00  0.46           O  
ATOM    362  CB  SER A  49      -3.828 -30.637  61.102  1.00  0.46           C  
ATOM    363  OG  SER A  49      -4.288 -29.298  60.905  1.00  0.46           O  
ATOM    364  N   PRO A  50      -6.259 -32.332  62.507  1.00  0.49           N  
ATOM    365  CA  PRO A  50      -7.411 -32.129  63.377  1.00  0.49           C  
ATOM    366  C   PRO A  50      -7.303 -30.835  64.134  1.00  0.49           C  
ATOM    367  O   PRO A  50      -6.264 -30.582  64.735  1.00  0.49           O  
ATOM    368  CB  PRO A  50      -7.404 -33.349  64.325  1.00  0.49           C  
ATOM    369  CG  PRO A  50      -6.519 -34.392  63.632  1.00  0.49           C  
ATOM    370  CD  PRO A  50      -5.507 -33.535  62.867  1.00  0.49           C  
ATOM    371  N   ASP A  51      -8.399 -30.063  64.167  1.00  0.43           N  
ATOM    372  CA  ASP A  51      -8.477 -28.836  64.913  1.00  0.43           C  
ATOM    373  C   ASP A  51      -9.547 -29.016  65.974  1.00  0.43           C  
ATOM    374  O   ASP A  51     -10.565 -29.674  65.752  1.00  0.43           O  
ATOM    375  CB  ASP A  51      -8.905 -27.650  64.019  1.00  0.43           C  
ATOM    376  CG  ASP A  51      -7.847 -27.342  62.977  1.00  0.43           C  
ATOM    377  OD1 ASP A  51      -6.687 -27.064  63.362  1.00  0.43           O  
ATOM    378  OD2 ASP A  51      -8.216 -27.333  61.775  1.00  0.43           O  
ATOM    379  N   ASN A  52      -9.362 -28.436  67.176  1.00  0.42           N  
ATOM    380  CA  ASN A  52     -10.461 -28.262  68.112  1.00  0.42           C  
ATOM    381  C   ASN A  52     -11.426 -27.197  67.612  1.00  0.42           C  
ATOM    382  O   ASN A  52     -11.004 -26.152  67.126  1.00  0.42           O  
ATOM    383  CB  ASN A  52      -9.981 -27.821  69.514  1.00  0.42           C  
ATOM    384  CG  ASN A  52      -9.355 -29.001  70.238  1.00  0.42           C  
ATOM    385  OD1 ASN A  52      -8.336 -29.559  69.838  1.00  0.42           O  
ATOM    386  ND2 ASN A  52      -9.981 -29.413  71.365  1.00  0.42           N  
ATOM    387  N   VAL A  53     -12.751 -27.418  67.730  1.00  0.50           N  
ATOM    388  CA  VAL A  53     -13.710 -26.516  67.114  1.00  0.50           C  
ATOM    389  C   VAL A  53     -14.810 -26.127  68.087  1.00  0.50           C  
ATOM    390  O   VAL A  53     -15.217 -26.894  68.957  1.00  0.50           O  
ATOM    391  CB  VAL A  53     -14.337 -27.119  65.865  1.00  0.50           C  
ATOM    392  CG1 VAL A  53     -15.123 -26.056  65.084  1.00  0.50           C  
ATOM    393  CG2 VAL A  53     -13.271 -27.667  64.899  1.00  0.50           C  
ATOM    394  N   VAL A  54     -15.315 -24.890  67.943  1.00  0.46           N  
ATOM    395  CA  VAL A  54     -16.430 -24.331  68.680  1.00  0.46           C  
ATOM    396  C   VAL A  54     -17.668 -24.444  67.802  1.00  0.46           C  
ATOM    397  O   VAL A  54     -17.567 -24.670  66.601  1.00  0.46           O  
ATOM    398  CB  VAL A  54     -16.185 -22.868  69.044  1.00  0.46           C  
ATOM    399  CG1 VAL A  54     -14.964 -22.776  69.980  1.00  0.46           C  
ATOM    400  CG2 VAL A  54     -15.949 -22.021  67.775  1.00  0.46           C  
ATOM    401  N   SER A  55     -18.900 -24.311  68.338  1.00  0.55           N  
ATOM    402  CA  SER A  55     -20.083 -24.351  67.469  1.00  0.55           C  
ATOM    403  C   SER A  55     -20.109 -23.245  66.411  1.00  0.55           C  
ATOM    404  O   SER A  55     -19.903 -22.070  66.710  1.00  0.55           O  
ATOM    405  CB  SER A  55     -21.423 -24.295  68.247  1.00  0.55           C  
ATOM    406  OG  SER A  55     -22.528 -24.660  67.411  1.00  0.55           O  
ATOM    407  N   THR A  56     -20.368 -23.596  65.133  1.00  0.64           N  
ATOM    408  CA  THR A  56     -20.348 -22.623  64.045  1.00  0.64           C  
ATOM    409  C   THR A  56     -21.661 -21.881  63.996  1.00  0.64           C  
ATOM    410  O   THR A  56     -22.690 -22.433  63.614  1.00  0.64           O  
ATOM    411  CB  THR A  56     -20.109 -23.218  62.659  1.00  0.64           C  
ATOM    412  OG1 THR A  56     -18.982 -24.079  62.664  1.00  0.64           O  
ATOM    413  CG2 THR A  56     -19.801 -22.117  61.633  1.00  0.64           C  
ATOM    414  N   THR A  57     -21.653 -20.599  64.407  1.00  0.63           N  
ATOM    415  CA  THR A  57     -22.825 -19.731  64.457  1.00  0.63           C  
ATOM    416  C   THR A  57     -23.402 -19.418  63.095  1.00  0.63           C  
ATOM    417  O   THR A  57     -24.612 -19.445  62.891  1.00  0.63           O  
ATOM    418  CB  THR A  57     -22.523 -18.402  65.139  1.00  0.63           C  
ATOM    419  OG1 THR A  57     -21.401 -17.756  64.543  1.00  0.63           O  
ATOM    420  CG2 THR A  57     -22.149 -18.666  66.602  1.00  0.63           C  
ATOM    421  N   GLY A  58     -22.520 -19.111  62.127  1.00  0.68           N  
ATOM    422  CA  GLY A  58     -22.876 -18.921  60.734  1.00  0.68           C  
ATOM    423  C   GLY A  58     -22.499 -20.127  59.927  1.00  0.68           C  
ATOM    424  O   GLY A  58     -22.997 -21.233  60.121  1.00  0.68           O  
ATOM    425  N   PHE A  59     -21.579 -19.940  58.977  1.00  0.66           N  
ATOM    426  CA  PHE A  59     -21.127 -20.988  58.095  1.00  0.66           C  
ATOM    427  C   PHE A  59     -19.631 -20.863  57.926  1.00  0.66           C  
ATOM    428  O   PHE A  59     -19.036 -19.836  58.247  1.00  0.66           O  
ATOM    429  CB  PHE A  59     -21.819 -20.948  56.702  1.00  0.66           C  
ATOM    430  CG  PHE A  59     -21.681 -19.616  56.022  1.00  0.66           C  
ATOM    431  CD1 PHE A  59     -22.512 -18.527  56.328  1.00  0.66           C  
ATOM    432  CD2 PHE A  59     -20.664 -19.452  55.082  1.00  0.66           C  
ATOM    433  CE1 PHE A  59     -22.313 -17.287  55.706  1.00  0.66           C  
ATOM    434  CE2 PHE A  59     -20.460 -18.221  54.450  1.00  0.66           C  
ATOM    435  CZ  PHE A  59     -21.286 -17.135  54.765  1.00  0.66           C  
ATOM    436  N   SER A  60     -18.984 -21.908  57.400  1.00  0.66           N  
ATOM    437  CA  SER A  60     -17.607 -21.825  56.960  1.00  0.66           C  
ATOM    438  C   SER A  60     -17.543 -22.265  55.514  1.00  0.66           C  
ATOM    439  O   SER A  60     -18.183 -23.229  55.104  1.00  0.66           O  
ATOM    440  CB  SER A  60     -16.610 -22.631  57.839  1.00  0.66           C  
ATOM    441  OG  SER A  60     -17.070 -23.955  58.101  1.00  0.66           O  
ATOM    442  N   ILE A  61     -16.786 -21.528  54.674  1.00  0.66           N  
ATOM    443  CA  ILE A  61     -16.579 -21.907  53.283  1.00  0.66           C  
ATOM    444  C   ILE A  61     -15.105 -22.104  53.108  1.00  0.66           C  
ATOM    445  O   ILE A  61     -14.304 -21.259  53.503  1.00  0.66           O  
ATOM    446  CB  ILE A  61     -17.059 -20.901  52.227  1.00  0.66           C  
ATOM    447  CG1 ILE A  61     -18.585 -20.744  52.341  1.00  0.66           C  
ATOM    448  CG2 ILE A  61     -16.671 -21.365  50.797  1.00  0.66           C  
ATOM    449  CD1 ILE A  61     -19.193 -19.665  51.438  1.00  0.66           C  
ATOM    450  N   LYS A  62     -14.707 -23.228  52.493  1.00  0.58           N  
ATOM    451  CA  LYS A  62     -13.342 -23.426  52.067  1.00  0.58           C  
ATOM    452  C   LYS A  62     -13.397 -24.165  50.745  1.00  0.58           C  
ATOM    453  O   LYS A  62     -14.292 -24.972  50.499  1.00  0.58           O  
ATOM    454  CB  LYS A  62     -12.488 -24.230  53.093  1.00  0.58           C  
ATOM    455  CG  LYS A  62     -12.120 -23.434  54.366  1.00  0.58           C  
ATOM    456  CD  LYS A  62     -11.504 -24.296  55.482  1.00  0.58           C  
ATOM    457  CE  LYS A  62     -11.011 -23.513  56.704  1.00  0.58           C  
ATOM    458  NZ  LYS A  62     -10.462 -24.448  57.720  1.00  0.58           N  
ATOM    459  N   ALA A  63     -12.431 -23.892  49.848  1.00  0.62           N  
ATOM    460  CA  ALA A  63     -12.227 -24.680  48.652  1.00  0.62           C  
ATOM    461  C   ALA A  63     -11.000 -25.565  48.857  1.00  0.62           C  
ATOM    462  O   ALA A  63      -9.936 -25.084  49.229  1.00  0.62           O  
ATOM    463  CB  ALA A  63     -12.036 -23.770  47.422  1.00  0.62           C  
ATOM    464  N   VAL A  64     -11.100 -26.894  48.646  1.00  0.52           N  
ATOM    465  CA  VAL A  64     -10.023 -27.820  49.026  1.00  0.52           C  
ATOM    466  C   VAL A  64      -9.546 -28.612  47.796  1.00  0.52           C  
ATOM    467  O   VAL A  64     -10.426 -29.157  47.126  1.00  0.52           O  
ATOM    468  CB  VAL A  64     -10.506 -28.823  50.041  1.00  0.52           C  
ATOM    469  CG1 VAL A  64      -9.455 -29.912  50.297  1.00  0.52           C  
ATOM    470  CG2 VAL A  64     -10.862 -28.126  51.364  1.00  0.52           C  
ATOM    471  N   PRO A  65      -8.229 -28.640  47.409  1.00  0.39           N  
ATOM    472  CA  PRO A  65      -7.556 -29.533  46.400  1.00  0.39           C  
ATOM    473  C   PRO A  65      -6.987 -30.963  46.718  1.00  0.39           C  
ATOM    474  O   PRO A  65      -6.960 -31.282  47.894  1.00  0.39           O  
ATOM    475  CB  PRO A  65      -6.517 -28.620  45.744  1.00  0.39           C  
ATOM    476  CG  PRO A  65      -7.027 -27.213  46.035  1.00  0.39           C  
ATOM    477  CD  PRO A  65      -7.539 -27.353  47.463  1.00  0.39           C  
ATOM    478  N   PHE A  66      -6.664 -31.846  45.685  1.00  0.35           N  
ATOM    479  CA  PHE A  66      -6.396 -33.310  45.538  1.00  0.35           C  
ATOM    480  C   PHE A  66      -6.691 -33.635  44.053  1.00  0.35           C  
ATOM    481  O   PHE A  66      -7.510 -33.077  43.414  1.00  0.35           O  
ATOM    482  CB  PHE A  66      -7.287 -34.294  46.287  1.00  0.35           C  
ATOM    483  CG  PHE A  66      -7.073 -35.813  46.105  1.00  0.35           C  
ATOM    484  CD1 PHE A  66      -5.845 -36.389  46.428  1.00  0.35           C  
ATOM    485  CD2 PHE A  66      -8.153 -36.709  46.017  1.00  0.35           C  
ATOM    486  CE1 PHE A  66      -5.753 -37.702  46.931  1.00  0.35           C  
ATOM    487  CE2 PHE A  66      -8.096 -37.984  46.596  1.00  0.35           C  
ATOM    488  CZ  PHE A  66      -6.908 -38.460  47.122  1.00  0.35           C  
ATOM    489  N   GLN A  67      -6.037 -34.542  43.381  1.00  0.37           N  
ATOM    490  CA  GLN A  67      -6.320 -35.196  42.107  1.00  0.37           C  
ATOM    491  C   GLN A  67      -7.595 -34.867  41.291  1.00  0.37           C  
ATOM    492  O   GLN A  67      -8.415 -35.737  41.049  1.00  0.37           O  
ATOM    493  CB  GLN A  67      -6.061 -36.762  42.048  1.00  0.37           C  
ATOM    494  CG  GLN A  67      -5.221 -37.446  43.170  1.00  0.37           C  
ATOM    495  CD  GLN A  67      -5.389 -38.992  43.249  1.00  0.37           C  
ATOM    496  OE1 GLN A  67      -5.569 -39.735  42.308  1.00  0.37           O  
ATOM    497  NE2 GLN A  67      -5.356 -39.491  44.513  1.00  0.37           N  
ATOM    498  N   ASN A  68      -7.763 -33.607  40.837  1.00  0.42           N  
ATOM    499  CA  ASN A  68      -8.712 -33.157  39.836  1.00  0.42           C  
ATOM    500  C   ASN A  68      -9.886 -32.185  40.070  1.00  0.42           C  
ATOM    501  O   ASN A  68     -10.024 -31.274  39.265  1.00  0.42           O  
ATOM    502  CB  ASN A  68      -9.054 -34.225  38.749  1.00  0.42           C  
ATOM    503  CG  ASN A  68     -10.305 -35.131  38.816  1.00  0.42           C  
ATOM    504  OD1 ASN A  68     -10.233 -36.262  38.345  1.00  0.42           O  
ATOM    505  ND2 ASN A  68     -11.478 -34.647  39.258  1.00  0.42           N  
ATOM    506  N   ALA A  69     -10.793 -32.330  41.062  1.00  0.42           N  
ATOM    507  CA  ALA A  69     -12.108 -31.675  41.013  1.00  0.42           C  
ATOM    508  C   ALA A  69     -12.276 -30.533  42.025  1.00  0.42           C  
ATOM    509  O   ALA A  69     -12.222 -30.801  43.217  1.00  0.42           O  
ATOM    510  CB  ALA A  69     -13.108 -32.755  41.475  1.00  0.42           C  
ATOM    511  N   ILE A  70     -12.451 -29.223  41.704  1.00  0.47           N  
ATOM    512  CA  ILE A  70     -12.570 -28.237  42.809  1.00  0.47           C  
ATOM    513  C   ILE A  70     -13.824 -28.369  43.639  1.00  0.47           C  
ATOM    514  O   ILE A  70     -14.919 -28.464  43.109  1.00  0.47           O  
ATOM    515  CB  ILE A  70     -12.333 -26.761  42.495  1.00  0.47           C  
ATOM    516  CG1 ILE A  70     -11.122 -26.493  41.572  1.00  0.47           C  
ATOM    517  CG2 ILE A  70     -12.318 -25.843  43.753  1.00  0.47           C  
ATOM    518  CD1 ILE A  70      -9.755 -26.275  42.224  1.00  0.47           C  
ATOM    519  N   LEU A  71     -13.687 -28.387  44.983  1.00  0.54           N  
ATOM    520  CA  LEU A  71     -14.813 -28.603  45.849  1.00  0.54           C  
ATOM    521  C   LEU A  71     -14.990 -27.357  46.640  1.00  0.54           C  
ATOM    522  O   LEU A  71     -14.179 -27.057  47.515  1.00  0.54           O  
ATOM    523  CB  LEU A  71     -14.553 -29.724  46.873  1.00  0.54           C  
ATOM    524  CG  LEU A  71     -14.167 -31.053  46.221  1.00  0.54           C  
ATOM    525  CD1 LEU A  71     -14.012 -32.126  47.271  1.00  0.54           C  
ATOM    526  CD2 LEU A  71     -15.089 -31.511  45.124  1.00  0.54           C  
ATOM    527  N   ASN A  72     -16.057 -26.613  46.361  1.00  0.64           N  
ATOM    528  CA  ASN A  72     -16.419 -25.458  47.135  1.00  0.64           C  
ATOM    529  C   ASN A  72     -17.351 -25.977  48.190  1.00  0.64           C  
ATOM    530  O   ASN A  72     -18.442 -26.432  47.876  1.00  0.64           O  
ATOM    531  CB  ASN A  72     -17.143 -24.434  46.236  1.00  0.64           C  
ATOM    532  CG  ASN A  72     -16.113 -23.812  45.305  1.00  0.64           C  
ATOM    533  OD1 ASN A  72     -15.554 -24.468  44.429  1.00  0.64           O  
ATOM    534  ND2 ASN A  72     -15.817 -22.509  45.508  1.00  0.64           N  
ATOM    535  N   VAL A  73     -16.932 -25.989  49.466  1.00  0.70           N  
ATOM    536  CA  VAL A  73     -17.769 -26.590  50.484  1.00  0.70           C  
ATOM    537  C   VAL A  73     -18.291 -25.528  51.364  1.00  0.70           C  
ATOM    538  O   VAL A  73     -17.555 -24.715  51.918  1.00  0.70           O  
ATOM    539  CB  VAL A  73     -17.117 -27.682  51.290  1.00  0.70           C  
ATOM    540  CG1 VAL A  73     -18.040 -28.230  52.403  1.00  0.70           C  
ATOM    541  CG2 VAL A  73     -16.863 -28.775  50.262  1.00  0.70           C  
ATOM    542  N   LYS A  74     -19.619 -25.531  51.483  1.00  0.69           N  
ATOM    543  CA  LYS A  74     -20.341 -24.661  52.353  1.00  0.69           C  
ATOM    544  C   LYS A  74     -20.802 -25.494  53.520  1.00  0.69           C  
ATOM    545  O   LYS A  74     -21.746 -26.277  53.418  1.00  0.69           O  
ATOM    546  CB  LYS A  74     -21.547 -24.071  51.599  1.00  0.69           C  
ATOM    547  CG  LYS A  74     -21.116 -23.241  50.383  1.00  0.69           C  
ATOM    548  CD  LYS A  74     -22.303 -22.900  49.481  1.00  0.69           C  
ATOM    549  CE  LYS A  74     -21.897 -22.040  48.289  1.00  0.69           C  
ATOM    550  NZ  LYS A  74     -22.985 -22.015  47.305  1.00  0.69           N  
ATOM    551  N   GLU A  75     -20.129 -25.322  54.664  1.00  0.67           N  
ATOM    552  CA  GLU A  75     -20.462 -25.988  55.898  1.00  0.67           C  
ATOM    553  C   GLU A  75     -21.343 -25.069  56.691  1.00  0.67           C  
ATOM    554  O   GLU A  75     -20.884 -24.058  57.221  1.00  0.67           O  
ATOM    555  CB  GLU A  75     -19.213 -26.189  56.772  1.00  0.67           C  
ATOM    556  CG  GLU A  75     -18.208 -27.208  56.218  1.00  0.67           C  
ATOM    557  CD  GLU A  75     -18.677 -28.644  56.298  1.00  0.67           C  
ATOM    558  OE1 GLU A  75     -19.726 -28.876  56.947  1.00  0.67           O  
ATOM    559  OE2 GLU A  75     -18.007 -29.530  55.708  1.00  0.67           O  
ATOM    560  N   LEU A  76     -22.642 -25.365  56.809  1.00  0.70           N  
ATOM    561  CA  LEU A  76     -23.515 -24.501  57.574  1.00  0.70           C  
ATOM    562  C   LEU A  76     -23.694 -25.025  58.993  1.00  0.70           C  
ATOM    563  O   LEU A  76     -23.753 -26.232  59.270  1.00  0.70           O  
ATOM    564  CB  LEU A  76     -24.828 -24.261  56.797  1.00  0.70           C  
ATOM    565  CG  LEU A  76     -25.812 -23.202  57.342  1.00  0.70           C  
ATOM    566  CD1 LEU A  76     -25.224 -21.817  57.622  1.00  0.70           C  
ATOM    567  CD2 LEU A  76     -26.905 -23.018  56.297  1.00  0.70           C  
ATOM    568  N   GLY A  77     -23.730 -24.101  59.984  1.00  0.69           N  
ATOM    569  CA  GLY A  77     -24.125 -24.400  61.352  1.00  0.69           C  
ATOM    570  C   GLY A  77     -25.476 -25.067  61.426  1.00  0.69           C  
ATOM    571  O   GLY A  77     -26.396 -24.753  60.680  1.00  0.69           O  
ATOM    572  N   GLY A  78     -25.627 -26.047  62.333  1.00  0.74           N  
ATOM    573  CA  GLY A  78     -26.820 -26.884  62.369  1.00  0.74           C  
ATOM    574  C   GLY A  78     -27.653 -26.699  63.580  1.00  0.74           C  
ATOM    575  O   GLY A  78     -28.403 -27.593  63.957  1.00  0.74           O  
ATOM    576  N   ALA A  79     -27.513 -25.550  64.265  1.00  0.70           N  
ATOM    577  CA  ALA A  79     -28.334 -25.208  65.409  1.00  0.70           C  
ATOM    578  C   ALA A  79     -29.793 -25.070  65.010  1.00  0.70           C  
ATOM    579  O   ALA A  79     -30.083 -24.762  63.858  1.00  0.70           O  
ATOM    580  CB  ALA A  79     -27.804 -23.933  66.082  1.00  0.70           C  
ATOM    581  N   ASP A  80     -30.752 -25.321  65.926  1.00  0.66           N  
ATOM    582  CA  ASP A  80     -32.158 -25.446  65.576  1.00  0.66           C  
ATOM    583  C   ASP A  80     -32.733 -24.213  64.852  1.00  0.66           C  
ATOM    584  O   ASP A  80     -33.377 -24.295  63.810  1.00  0.66           O  
ATOM    585  CB  ASP A  80     -32.935 -25.830  66.852  1.00  0.66           C  
ATOM    586  CG  ASP A  80     -34.203 -26.606  66.531  1.00  0.66           C  
ATOM    587  OD1 ASP A  80     -34.254 -27.241  65.447  1.00  0.66           O  
ATOM    588  OD2 ASP A  80     -35.087 -26.629  67.417  1.00  0.66           O  
ATOM    589  N   ASN A  81     -32.371 -23.011  65.342  1.00  0.60           N  
ATOM    590  CA  ASN A  81     -32.663 -21.742  64.693  1.00  0.60           C  
ATOM    591  C   ASN A  81     -32.033 -21.566  63.292  1.00  0.60           C  
ATOM    592  O   ASN A  81     -32.633 -21.017  62.371  1.00  0.60           O  
ATOM    593  CB  ASN A  81     -32.196 -20.601  65.638  1.00  0.60           C  
ATOM    594  CG  ASN A  81     -32.922 -19.296  65.326  1.00  0.60           C  
ATOM    595  OD1 ASN A  81     -34.011 -19.270  64.760  1.00  0.60           O  
ATOM    596  ND2 ASN A  81     -32.317 -18.160  65.738  1.00  0.60           N  
ATOM    597  N   ILE A  82     -30.781 -22.035  63.090  1.00  0.66           N  
ATOM    598  CA  ILE A  82     -30.030 -21.865  61.847  1.00  0.66           C  
ATOM    599  C   ILE A  82     -30.606 -22.672  60.674  1.00  0.66           C  
ATOM    600  O   ILE A  82     -30.481 -22.292  59.512  1.00  0.66           O  
ATOM    601  CB  ILE A  82     -28.537 -22.176  62.037  1.00  0.66           C  
ATOM    602  CG1 ILE A  82     -27.900 -21.334  63.174  1.00  0.66           C  
ATOM    603  CG2 ILE A  82     -27.747 -21.958  60.725  1.00  0.66           C  
ATOM    604  CD1 ILE A  82     -27.880 -19.819  62.933  1.00  0.66           C  
ATOM    605  N   ARG A  83     -31.314 -23.789  60.931  1.00  0.63           N  
ATOM    606  CA  ARG A  83     -31.821 -24.704  59.909  1.00  0.63           C  
ATOM    607  C   ARG A  83     -32.761 -24.103  58.873  1.00  0.63           C  
ATOM    608  O   ARG A  83     -32.773 -24.495  57.709  1.00  0.63           O  
ATOM    609  CB  ARG A  83     -32.404 -25.972  60.562  1.00  0.63           C  
ATOM    610  CG  ARG A  83     -31.269 -26.873  61.094  1.00  0.63           C  
ATOM    611  CD  ARG A  83     -31.555 -27.526  62.439  1.00  0.63           C  
ATOM    612  NE  ARG A  83     -32.480 -28.670  62.235  1.00  0.63           N  
ATOM    613  CZ  ARG A  83     -32.867 -29.480  63.229  1.00  0.63           C  
ATOM    614  NH1 ARG A  83     -32.315 -29.425  64.439  1.00  0.63           N  
ATOM    615  NH2 ARG A  83     -33.819 -30.369  62.984  1.00  0.63           N  
ATOM    616  N   LYS A  84     -33.537 -23.061  59.222  1.00  0.64           N  
ATOM    617  CA  LYS A  84     -34.341 -22.347  58.239  1.00  0.64           C  
ATOM    618  C   LYS A  84     -33.526 -21.631  57.157  1.00  0.64           C  
ATOM    619  O   LYS A  84     -33.998 -21.411  56.042  1.00  0.64           O  
ATOM    620  CB  LYS A  84     -35.265 -21.319  58.932  1.00  0.64           C  
ATOM    621  CG  LYS A  84     -36.287 -21.949  59.897  1.00  0.64           C  
ATOM    622  CD  LYS A  84     -37.239 -22.948  59.210  1.00  0.64           C  
ATOM    623  CE  LYS A  84     -38.307 -23.514  60.149  1.00  0.64           C  
ATOM    624  NZ  LYS A  84     -39.119 -24.518  59.425  1.00  0.64           N  
ATOM    625  N   TYR A  85     -32.258 -21.280  57.451  1.00  0.63           N  
ATOM    626  CA  TYR A  85     -31.364 -20.587  56.540  1.00  0.63           C  
ATOM    627  C   TYR A  85     -30.795 -21.494  55.471  1.00  0.63           C  
ATOM    628  O   TYR A  85     -30.271 -21.018  54.464  1.00  0.63           O  
ATOM    629  CB  TYR A  85     -30.147 -19.972  57.282  1.00  0.63           C  
ATOM    630  CG  TYR A  85     -30.571 -18.807  58.122  1.00  0.63           C  
ATOM    631  CD1 TYR A  85     -31.167 -18.997  59.380  1.00  0.63           C  
ATOM    632  CD2 TYR A  85     -30.350 -17.499  57.664  1.00  0.63           C  
ATOM    633  CE1 TYR A  85     -31.550 -17.902  60.161  1.00  0.63           C  
ATOM    634  CE2 TYR A  85     -30.722 -16.398  58.448  1.00  0.63           C  
ATOM    635  CZ  TYR A  85     -31.327 -16.604  59.693  1.00  0.63           C  
ATOM    636  OH  TYR A  85     -31.696 -15.503  60.486  1.00  0.63           O  
ATOM    637  N   TRP A  86     -30.899 -22.824  55.653  1.00  0.65           N  
ATOM    638  CA  TRP A  86     -30.315 -23.836  54.795  1.00  0.65           C  
ATOM    639  C   TRP A  86     -30.827 -23.764  53.358  1.00  0.65           C  
ATOM    640  O   TRP A  86     -30.069 -23.937  52.406  1.00  0.65           O  
ATOM    641  CB  TRP A  86     -30.497 -25.239  55.428  1.00  0.65           C  
ATOM    642  CG  TRP A  86     -29.764 -25.480  56.756  1.00  0.65           C  
ATOM    643  CD1 TRP A  86     -29.153 -24.621  57.633  1.00  0.65           C  
ATOM    644  CD2 TRP A  86     -29.595 -26.789  57.317  1.00  0.65           C  
ATOM    645  NE1 TRP A  86     -28.473 -25.323  58.609  1.00  0.65           N  
ATOM    646  CE2 TRP A  86     -28.749 -26.659  58.440  1.00  0.65           C  
ATOM    647  CE3 TRP A  86     -30.100 -28.026  56.939  1.00  0.65           C  
ATOM    648  CZ2 TRP A  86     -28.368 -27.777  59.169  1.00  0.65           C  
ATOM    649  CZ3 TRP A  86     -29.789 -29.131  57.740  1.00  0.65           C  
ATOM    650  CH2 TRP A  86     -28.930 -29.013  58.836  1.00  0.65           C  
ATOM    651  N   SER A  87     -32.114 -23.394  53.174  1.00  0.70           N  
ATOM    652  CA  SER A  87     -32.775 -23.217  51.887  1.00  0.70           C  
ATOM    653  C   SER A  87     -32.108 -22.240  50.940  1.00  0.70           C  
ATOM    654  O   SER A  87     -32.190 -22.394  49.725  1.00  0.70           O  
ATOM    655  CB  SER A  87     -34.252 -22.793  52.052  1.00  0.70           C  
ATOM    656  OG  SER A  87     -34.970 -23.793  52.772  1.00  0.70           O  
ATOM    657  N   ARG A  88     -31.403 -21.221  51.477  1.00  0.63           N  
ATOM    658  CA  ARG A  88     -30.631 -20.262  50.696  1.00  0.63           C  
ATOM    659  C   ARG A  88     -29.509 -20.902  49.880  1.00  0.63           C  
ATOM    660  O   ARG A  88     -29.215 -20.507  48.756  1.00  0.63           O  
ATOM    661  CB  ARG A  88     -29.925 -19.230  51.616  1.00  0.63           C  
ATOM    662  CG  ARG A  88     -30.851 -18.360  52.484  1.00  0.63           C  
ATOM    663  CD  ARG A  88     -30.051 -17.584  53.536  1.00  0.63           C  
ATOM    664  NE  ARG A  88     -30.976 -16.592  54.183  1.00  0.63           N  
ATOM    665  CZ  ARG A  88     -30.914 -15.265  53.999  1.00  0.63           C  
ATOM    666  NH1 ARG A  88     -30.033 -14.712  53.173  1.00  0.63           N  
ATOM    667  NH2 ARG A  88     -31.753 -14.474  54.665  1.00  0.63           N  
ATOM    668  N   TYR A  89     -28.829 -21.901  50.471  1.00  0.69           N  
ATOM    669  CA  TYR A  89     -27.575 -22.439  49.976  1.00  0.69           C  
ATOM    670  C   TYR A  89     -27.760 -23.517  48.933  1.00  0.69           C  
ATOM    671  O   TYR A  89     -26.809 -23.905  48.261  1.00  0.69           O  
ATOM    672  CB  TYR A  89     -26.759 -23.034  51.151  1.00  0.69           C  
ATOM    673  CG  TYR A  89     -26.352 -21.913  52.064  1.00  0.69           C  
ATOM    674  CD1 TYR A  89     -25.198 -21.161  51.794  1.00  0.69           C  
ATOM    675  CD2 TYR A  89     -27.140 -21.570  53.171  1.00  0.69           C  
ATOM    676  CE1 TYR A  89     -24.821 -20.102  52.631  1.00  0.69           C  
ATOM    677  CE2 TYR A  89     -26.767 -20.511  54.013  1.00  0.69           C  
ATOM    678  CZ  TYR A  89     -25.603 -19.786  53.745  1.00  0.69           C  
ATOM    679  OH  TYR A  89     -25.213 -18.739  54.596  1.00  0.69           O  
ATOM    680  N   TYR A  90     -28.997 -24.016  48.764  1.00  0.70           N  
ATOM    681  CA  TYR A  90     -29.319 -25.088  47.848  1.00  0.70           C  
ATOM    682  C   TYR A  90     -29.114 -24.769  46.372  1.00  0.70           C  
ATOM    683  O   TYR A  90     -28.737 -25.646  45.597  1.00  0.70           O  
ATOM    684  CB  TYR A  90     -30.767 -25.598  48.090  1.00  0.70           C  
ATOM    685  CG  TYR A  90     -30.970 -26.223  49.455  1.00  0.70           C  
ATOM    686  CD1 TYR A  90     -29.964 -26.942  50.134  1.00  0.70           C  
ATOM    687  CD2 TYR A  90     -32.239 -26.142  50.049  1.00  0.70           C  
ATOM    688  CE1 TYR A  90     -30.212 -27.512  51.391  1.00  0.70           C  
ATOM    689  CE2 TYR A  90     -32.485 -26.694  51.318  1.00  0.70           C  
ATOM    690  CZ  TYR A  90     -31.463 -27.366  51.994  1.00  0.70           C  
ATOM    691  OH  TYR A  90     -31.675 -27.898  53.281  1.00  0.70           O  
ATOM    692  N   GLN A  91     -29.369 -23.521  45.917  1.00  0.67           N  
ATOM    693  CA  GLN A  91     -29.227 -23.191  44.506  1.00  0.67           C  
ATOM    694  C   GLN A  91     -27.795 -23.287  43.979  1.00  0.67           C  
ATOM    695  O   GLN A  91     -26.856 -22.715  44.528  1.00  0.67           O  
ATOM    696  CB  GLN A  91     -29.908 -21.852  44.125  1.00  0.67           C  
ATOM    697  CG  GLN A  91     -29.240 -20.577  44.686  1.00  0.67           C  
ATOM    698  CD  GLN A  91     -30.017 -19.338  44.242  1.00  0.67           C  
ATOM    699  OE1 GLN A  91     -31.247 -19.304  44.243  1.00  0.67           O  
ATOM    700  NE2 GLN A  91     -29.285 -18.274  43.842  1.00  0.67           N  
ATOM    701  N   GLY A  92     -27.603 -24.055  42.882  1.00  0.72           N  
ATOM    702  CA  GLY A  92     -26.285 -24.331  42.312  1.00  0.72           C  
ATOM    703  C   GLY A  92     -25.528 -25.473  42.946  1.00  0.72           C  
ATOM    704  O   GLY A  92     -24.385 -25.735  42.579  1.00  0.72           O  
ATOM    705  N   SER A  93     -26.138 -26.197  43.904  1.00  0.73           N  
ATOM    706  CA  SER A  93     -25.480 -27.307  44.585  1.00  0.73           C  
ATOM    707  C   SER A  93     -25.333 -28.556  43.725  1.00  0.73           C  
ATOM    708  O   SER A  93     -26.285 -29.014  43.098  1.00  0.73           O  
ATOM    709  CB  SER A  93     -26.207 -27.688  45.896  1.00  0.73           C  
ATOM    710  OG  SER A  93     -25.441 -28.610  46.670  1.00  0.73           O  
ATOM    711  N   GLN A  94     -24.123 -29.146  43.682  1.00  0.68           N  
ATOM    712  CA  GLN A  94     -23.827 -30.292  42.840  1.00  0.68           C  
ATOM    713  C   GLN A  94     -23.794 -31.570  43.641  1.00  0.68           C  
ATOM    714  O   GLN A  94     -24.068 -32.647  43.130  1.00  0.68           O  
ATOM    715  CB  GLN A  94     -22.412 -30.128  42.246  1.00  0.68           C  
ATOM    716  CG  GLN A  94     -22.291 -28.971  41.228  1.00  0.68           C  
ATOM    717  CD  GLN A  94     -22.632 -29.421  39.807  1.00  0.68           C  
ATOM    718  OE1 GLN A  94     -23.142 -30.507  39.542  1.00  0.68           O  
ATOM    719  NE2 GLN A  94     -22.299 -28.558  38.820  1.00  0.68           N  
ATOM    720  N   GLY A  95     -23.487 -31.493  44.944  1.00  0.74           N  
ATOM    721  CA  GLY A  95     -23.618 -32.637  45.830  1.00  0.74           C  
ATOM    722  C   GLY A  95     -23.945 -32.133  47.196  1.00  0.74           C  
ATOM    723  O   GLY A  95     -23.655 -30.990  47.536  1.00  0.74           O  
ATOM    724  N   VAL A  96     -24.533 -32.972  48.054  1.00  0.77           N  
ATOM    725  CA  VAL A  96     -24.610 -32.632  49.464  1.00  0.77           C  
ATOM    726  C   VAL A  96     -23.871 -33.672  50.220  1.00  0.77           C  
ATOM    727  O   VAL A  96     -23.856 -34.859  49.893  1.00  0.77           O  
ATOM    728  CB  VAL A  96     -25.960 -32.440  50.159  1.00  0.77           C  
ATOM    729  CG1 VAL A  96     -26.757 -31.288  49.524  1.00  0.77           C  
ATOM    730  CG2 VAL A  96     -26.752 -33.747  50.239  1.00  0.77           C  
ATOM    731  N   ILE A  97     -23.247 -33.209  51.296  1.00  0.79           N  
ATOM    732  CA  ILE A  97     -22.687 -34.081  52.281  1.00  0.79           C  
ATOM    733  C   ILE A  97     -23.589 -33.932  53.480  1.00  0.79           C  
ATOM    734  O   ILE A  97     -23.757 -32.851  54.036  1.00  0.79           O  
ATOM    735  CB  ILE A  97     -21.235 -33.766  52.576  1.00  0.79           C  
ATOM    736  CG1 ILE A  97     -20.396 -33.964  51.290  1.00  0.79           C  
ATOM    737  CG2 ILE A  97     -20.748 -34.692  53.709  1.00  0.79           C  
ATOM    738  CD1 ILE A  97     -18.949 -33.481  51.411  1.00  0.79           C  
ATOM    739  N   PHE A  98     -24.248 -35.017  53.904  1.00  0.79           N  
ATOM    740  CA  PHE A  98     -24.973 -34.987  55.152  1.00  0.79           C  
ATOM    741  C   PHE A  98     -24.103 -35.701  56.148  1.00  0.79           C  
ATOM    742  O   PHE A  98     -23.762 -36.868  55.979  1.00  0.79           O  
ATOM    743  CB  PHE A  98     -26.350 -35.670  55.077  1.00  0.79           C  
ATOM    744  CG  PHE A  98     -27.204 -35.308  56.264  1.00  0.79           C  
ATOM    745  CD1 PHE A  98     -28.066 -34.204  56.214  1.00  0.79           C  
ATOM    746  CD2 PHE A  98     -27.175 -36.092  57.424  1.00  0.79           C  
ATOM    747  CE1 PHE A  98     -28.896 -33.883  57.295  1.00  0.79           C  
ATOM    748  CE2 PHE A  98     -27.990 -35.775  58.517  1.00  0.79           C  
ATOM    749  CZ  PHE A  98     -28.858 -34.675  58.450  1.00  0.79           C  
ATOM    750  N   VAL A  99     -23.704 -35.023  57.222  1.00  0.81           N  
ATOM    751  CA  VAL A  99     -22.874 -35.654  58.222  1.00  0.81           C  
ATOM    752  C   VAL A  99     -23.758 -36.003  59.382  1.00  0.81           C  
ATOM    753  O   VAL A  99     -24.617 -35.214  59.789  1.00  0.81           O  
ATOM    754  CB  VAL A  99     -21.721 -34.780  58.692  1.00  0.81           C  
ATOM    755  CG1 VAL A  99     -20.773 -35.578  59.611  1.00  0.81           C  
ATOM    756  CG2 VAL A  99     -20.955 -34.288  57.457  1.00  0.81           C  
ATOM    757  N   LEU A 100     -23.549 -37.189  59.969  1.00  0.79           N  
ATOM    758  CA  LEU A 100     -24.173 -37.572  61.213  1.00  0.79           C  
ATOM    759  C   LEU A 100     -23.153 -37.995  62.258  1.00  0.79           C  
ATOM    760  O   LEU A 100     -22.164 -38.637  61.917  1.00  0.79           O  
ATOM    761  CB  LEU A 100     -25.059 -38.779  60.936  1.00  0.79           C  
ATOM    762  CG  LEU A 100     -25.912 -39.232  62.128  1.00  0.79           C  
ATOM    763  CD1 LEU A 100     -27.220 -38.439  62.247  1.00  0.79           C  
ATOM    764  CD2 LEU A 100     -26.064 -40.747  62.040  1.00  0.79           C  
ATOM    765  N   ASP A 101     -23.400 -37.701  63.561  1.00  0.77           N  
ATOM    766  CA  ASP A 101     -22.768 -38.415  64.663  1.00  0.77           C  
ATOM    767  C   ASP A 101     -23.454 -39.761  64.890  1.00  0.77           C  
ATOM    768  O   ASP A 101     -24.596 -39.852  65.333  1.00  0.77           O  
ATOM    769  CB  ASP A 101     -22.749 -37.560  65.978  1.00  0.77           C  
ATOM    770  CG  ASP A 101     -21.931 -38.157  67.129  1.00  0.77           C  
ATOM    771  OD1 ASP A 101     -21.515 -39.340  67.045  1.00  0.77           O  
ATOM    772  OD2 ASP A 101     -21.656 -37.465  68.144  1.00  0.77           O  
ATOM    773  N   SER A 102     -22.729 -40.861  64.616  1.00  0.76           N  
ATOM    774  CA  SER A 102     -23.185 -42.226  64.806  1.00  0.76           C  
ATOM    775  C   SER A 102     -23.460 -42.584  66.249  1.00  0.76           C  
ATOM    776  O   SER A 102     -24.215 -43.517  66.526  1.00  0.76           O  
ATOM    777  CB  SER A 102     -22.130 -43.244  64.319  1.00  0.76           C  
ATOM    778  OG  SER A 102     -21.927 -43.141  62.913  1.00  0.76           O  
ATOM    779  N   ALA A 103     -22.831 -41.871  67.205  1.00  0.76           N  
ATOM    780  CA  ALA A 103     -23.073 -42.048  68.617  1.00  0.76           C  
ATOM    781  C   ALA A 103     -24.384 -41.432  69.106  1.00  0.76           C  
ATOM    782  O   ALA A 103     -25.088 -42.043  69.901  1.00  0.76           O  
ATOM    783  CB  ALA A 103     -21.886 -41.479  69.408  1.00  0.76           C  
ATOM    784  N   SER A 104     -24.774 -40.231  68.614  1.00  0.75           N  
ATOM    785  CA  SER A 104     -25.974 -39.520  69.085  1.00  0.75           C  
ATOM    786  C   SER A 104     -27.194 -39.902  68.276  1.00  0.75           C  
ATOM    787  O   SER A 104     -28.288 -39.350  68.360  1.00  0.75           O  
ATOM    788  CB  SER A 104     -25.854 -37.974  69.008  1.00  0.75           C  
ATOM    789  OG  SER A 104     -25.764 -37.479  67.669  1.00  0.75           O  
ATOM    790  N   SER A 105     -27.031 -40.914  67.426  1.00  0.57           N  
ATOM    791  CA  SER A 105     -28.096 -41.486  66.658  1.00  0.57           C  
ATOM    792  C   SER A 105     -29.223 -42.085  67.470  1.00  0.57           C  
ATOM    793  O   SER A 105     -30.369 -42.117  67.043  1.00  0.57           O  
ATOM    794  CB  SER A 105     -27.575 -42.635  65.804  1.00  0.57           C  
ATOM    795  OG  SER A 105     -26.677 -42.169  64.811  1.00  0.57           O  
ATOM    796  N   GLU A 106     -28.964 -42.643  68.656  1.00  0.63           N  
ATOM    797  CA  GLU A 106     -30.059 -43.228  69.406  1.00  0.63           C  
ATOM    798  C   GLU A 106     -31.100 -42.232  69.881  1.00  0.63           C  
ATOM    799  O   GLU A 106     -32.300 -42.488  69.818  1.00  0.63           O  
ATOM    800  CB  GLU A 106     -29.536 -44.088  70.555  1.00  0.63           C  
ATOM    801  CG  GLU A 106     -28.749 -43.386  71.675  1.00  0.63           C  
ATOM    802  CD  GLU A 106     -28.343 -44.465  72.669  1.00  0.63           C  
ATOM    803  OE1 GLU A 106     -27.810 -45.505  72.188  1.00  0.63           O  
ATOM    804  OE2 GLU A 106     -28.628 -44.306  73.881  1.00  0.63           O  
ATOM    805  N   ASP A 107     -30.649 -41.060  70.325  1.00  0.72           N  
ATOM    806  CA  ASP A 107     -31.454 -39.950  70.730  1.00  0.72           C  
ATOM    807  C   ASP A 107     -31.914 -39.070  69.562  1.00  0.72           C  
ATOM    808  O   ASP A 107     -33.115 -38.859  69.394  1.00  0.72           O  
ATOM    809  CB  ASP A 107     -30.675 -39.190  71.846  1.00  0.72           C  
ATOM    810  CG  ASP A 107     -29.185 -38.971  71.559  1.00  0.72           C  
ATOM    811  OD1 ASP A 107     -28.472 -39.958  71.230  1.00  0.72           O  
ATOM    812  OD2 ASP A 107     -28.719 -37.819  71.707  1.00  0.72           O  
ATOM    813  N   ASP A 108     -31.005 -38.604  68.679  1.00  0.73           N  
ATOM    814  CA  ASP A 108     -31.354 -37.624  67.664  1.00  0.73           C  
ATOM    815  C   ASP A 108     -31.325 -38.155  66.230  1.00  0.73           C  
ATOM    816  O   ASP A 108     -31.415 -37.376  65.275  1.00  0.73           O  
ATOM    817  CB  ASP A 108     -30.388 -36.412  67.764  1.00  0.73           C  
ATOM    818  CG  ASP A 108     -30.806 -35.428  68.849  1.00  0.73           C  
ATOM    819  OD1 ASP A 108     -31.943 -35.534  69.371  1.00  0.73           O  
ATOM    820  OD2 ASP A 108     -30.015 -34.474  69.068  1.00  0.73           O  
ATOM    821  N   LEU A 109     -31.238 -39.483  65.962  1.00  0.75           N  
ATOM    822  CA  LEU A 109     -31.226 -39.926  64.563  1.00  0.75           C  
ATOM    823  C   LEU A 109     -32.510 -39.636  63.804  1.00  0.75           C  
ATOM    824  O   LEU A 109     -32.499 -39.181  62.663  1.00  0.75           O  
ATOM    825  CB  LEU A 109     -30.831 -41.397  64.301  1.00  0.75           C  
ATOM    826  CG  LEU A 109     -30.528 -41.775  62.843  1.00  0.75           C  
ATOM    827  CD1 LEU A 109     -29.826 -40.680  62.065  1.00  0.75           C  
ATOM    828  CD2 LEU A 109     -29.636 -43.020  62.759  1.00  0.75           C  
ATOM    829  N   GLU A 110     -33.664 -39.808  64.457  1.00  0.72           N  
ATOM    830  CA  GLU A 110     -34.968 -39.506  63.908  1.00  0.72           C  
ATOM    831  C   GLU A 110     -35.089 -38.043  63.471  1.00  0.72           C  
ATOM    832  O   GLU A 110     -35.672 -37.716  62.434  1.00  0.72           O  
ATOM    833  CB  GLU A 110     -36.040 -39.864  64.966  1.00  0.72           C  
ATOM    834  CG  GLU A 110     -35.913 -41.311  65.518  1.00  0.72           C  
ATOM    835  CD  GLU A 110     -36.067 -42.372  64.430  1.00  0.72           C  
ATOM    836  OE1 GLU A 110     -35.072 -42.618  63.701  1.00  0.72           O  
ATOM    837  OE2 GLU A 110     -37.186 -42.929  64.314  1.00  0.72           O  
ATOM    838  N   ALA A 111     -34.466 -37.123  64.242  1.00  0.76           N  
ATOM    839  CA  ALA A 111     -34.319 -35.723  63.897  1.00  0.76           C  
ATOM    840  C   ALA A 111     -33.458 -35.482  62.658  1.00  0.76           C  
ATOM    841  O   ALA A 111     -33.839 -34.744  61.751  1.00  0.76           O  
ATOM    842  CB  ALA A 111     -33.714 -34.972  65.099  1.00  0.76           C  
ATOM    843  N   ALA A 112     -32.288 -36.145  62.567  1.00  0.82           N  
ATOM    844  CA  ALA A 112     -31.415 -36.099  61.410  1.00  0.82           C  
ATOM    845  C   ALA A 112     -32.028 -36.712  60.157  1.00  0.82           C  
ATOM    846  O   ALA A 112     -31.881 -36.170  59.066  1.00  0.82           O  
ATOM    847  CB  ALA A 112     -30.083 -36.780  61.737  1.00  0.82           C  
ATOM    848  N   ARG A 113     -32.772 -37.833  60.283  1.00  0.73           N  
ATOM    849  CA  ARG A 113     -33.533 -38.435  59.199  1.00  0.73           C  
ATOM    850  C   ARG A 113     -34.561 -37.473  58.629  1.00  0.73           C  
ATOM    851  O   ARG A 113     -34.661 -37.287  57.417  1.00  0.73           O  
ATOM    852  CB  ARG A 113     -34.294 -39.692  59.703  1.00  0.73           C  
ATOM    853  CG  ARG A 113     -35.104 -40.428  58.608  1.00  0.73           C  
ATOM    854  CD  ARG A 113     -36.035 -41.545  59.108  1.00  0.73           C  
ATOM    855  NE  ARG A 113     -37.267 -40.881  59.642  1.00  0.73           N  
ATOM    856  CZ  ARG A 113     -38.517 -41.311  59.428  1.00  0.73           C  
ATOM    857  NH1 ARG A 113     -38.815 -42.351  58.663  1.00  0.73           N  
ATOM    858  NH2 ARG A 113     -39.532 -40.685  60.022  1.00  0.73           N  
ATOM    859  N   ASN A 114     -35.317 -36.783  59.510  1.00  0.76           N  
ATOM    860  CA  ASN A 114     -36.288 -35.783  59.105  1.00  0.76           C  
ATOM    861  C   ASN A 114     -35.637 -34.597  58.390  1.00  0.76           C  
ATOM    862  O   ASN A 114     -36.088 -34.160  57.334  1.00  0.76           O  
ATOM    863  CB  ASN A 114     -37.054 -35.286  60.362  1.00  0.76           C  
ATOM    864  CG  ASN A 114     -38.366 -34.616  59.973  1.00  0.76           C  
ATOM    865  OD1 ASN A 114     -38.982 -34.931  58.958  1.00  0.76           O  
ATOM    866  ND2 ASN A 114     -38.845 -33.682  60.824  1.00  0.76           N  
ATOM    867  N   GLU A 115     -34.519 -34.087  58.946  1.00  0.74           N  
ATOM    868  CA  GLU A 115     -33.757 -32.999  58.362  1.00  0.74           C  
ATOM    869  C   GLU A 115     -33.102 -33.341  57.032  1.00  0.74           C  
ATOM    870  O   GLU A 115     -33.054 -32.544  56.097  1.00  0.74           O  
ATOM    871  CB  GLU A 115     -32.683 -32.469  59.338  1.00  0.74           C  
ATOM    872  CG  GLU A 115     -32.354 -30.986  59.064  1.00  0.74           C  
ATOM    873  CD  GLU A 115     -33.496 -30.066  59.484  1.00  0.74           C  
ATOM    874  OE1 GLU A 115     -34.287 -30.450  60.387  1.00  0.74           O  
ATOM    875  OE2 GLU A 115     -33.545 -28.917  58.992  1.00  0.74           O  
ATOM    876  N   LEU A 116     -32.578 -34.577  56.879  1.00  0.74           N  
ATOM    877  CA  LEU A 116     -32.133 -35.036  55.580  1.00  0.74           C  
ATOM    878  C   LEU A 116     -33.274 -35.102  54.591  1.00  0.74           C  
ATOM    879  O   LEU A 116     -33.171 -34.553  53.499  1.00  0.74           O  
ATOM    880  CB  LEU A 116     -31.452 -36.429  55.630  1.00  0.74           C  
ATOM    881  CG  LEU A 116     -30.918 -36.904  54.257  1.00  0.74           C  
ATOM    882  CD1 LEU A 116     -29.820 -35.981  53.722  1.00  0.74           C  
ATOM    883  CD2 LEU A 116     -30.376 -38.327  54.305  1.00  0.74           C  
ATOM    884  N   HIS A 117     -34.419 -35.710  54.971  1.00  0.71           N  
ATOM    885  CA  HIS A 117     -35.568 -35.865  54.093  1.00  0.71           C  
ATOM    886  C   HIS A 117     -36.129 -34.538  53.613  1.00  0.71           C  
ATOM    887  O   HIS A 117     -36.415 -34.364  52.429  1.00  0.71           O  
ATOM    888  CB  HIS A 117     -36.671 -36.722  54.748  1.00  0.71           C  
ATOM    889  CG  HIS A 117     -37.510 -37.483  53.762  1.00  0.71           C  
ATOM    890  ND1 HIS A 117     -38.464 -36.842  52.991  1.00  0.71           N  
ATOM    891  CD2 HIS A 117     -37.516 -38.816  53.503  1.00  0.71           C  
ATOM    892  CE1 HIS A 117     -39.040 -37.802  52.295  1.00  0.71           C  
ATOM    893  NE2 HIS A 117     -38.502 -39.015  52.562  1.00  0.71           N  
ATOM    894  N   SER A 118     -36.205 -33.527  54.504  1.00  0.74           N  
ATOM    895  CA  SER A 118     -36.611 -32.173  54.151  1.00  0.74           C  
ATOM    896  C   SER A 118     -35.716 -31.515  53.102  1.00  0.74           C  
ATOM    897  O   SER A 118     -36.197 -30.913  52.140  1.00  0.74           O  
ATOM    898  CB  SER A 118     -36.734 -31.266  55.411  1.00  0.74           C  
ATOM    899  OG  SER A 118     -35.465 -30.850  55.919  1.00  0.74           O  
ATOM    900  N   ALA A 119     -34.382 -31.676  53.224  1.00  0.74           N  
ATOM    901  CA  ALA A 119     -33.429 -31.292  52.207  1.00  0.74           C  
ATOM    902  C   ALA A 119     -33.600 -32.058  50.898  1.00  0.74           C  
ATOM    903  O   ALA A 119     -33.611 -31.468  49.821  1.00  0.74           O  
ATOM    904  CB  ALA A 119     -31.998 -31.485  52.741  1.00  0.74           C  
ATOM    905  N   LEU A 120     -33.800 -33.397  50.951  1.00  0.71           N  
ATOM    906  CA  LEU A 120     -33.989 -34.229  49.766  1.00  0.71           C  
ATOM    907  C   LEU A 120     -35.225 -33.839  48.980  1.00  0.71           C  
ATOM    908  O   LEU A 120     -35.262 -33.928  47.754  1.00  0.71           O  
ATOM    909  CB  LEU A 120     -34.148 -35.759  50.040  1.00  0.71           C  
ATOM    910  CG  LEU A 120     -33.150 -36.416  51.009  1.00  0.71           C  
ATOM    911  CD1 LEU A 120     -33.129 -37.944  50.881  1.00  0.71           C  
ATOM    912  CD2 LEU A 120     -31.739 -35.890  50.839  1.00  0.71           C  
ATOM    913  N   GLN A 121     -36.288 -33.462  49.706  1.00  0.67           N  
ATOM    914  CA  GLN A 121     -37.563 -33.037  49.183  1.00  0.67           C  
ATOM    915  C   GLN A 121     -37.504 -31.734  48.408  1.00  0.67           C  
ATOM    916  O   GLN A 121     -38.301 -31.494  47.504  1.00  0.67           O  
ATOM    917  CB  GLN A 121     -38.548 -32.879  50.368  1.00  0.67           C  
ATOM    918  CG  GLN A 121     -40.040 -32.993  49.979  1.00  0.67           C  
ATOM    919  CD  GLN A 121     -40.496 -34.409  49.602  1.00  0.67           C  
ATOM    920  OE1 GLN A 121     -41.606 -34.603  49.109  1.00  0.67           O  
ATOM    921  NE2 GLN A 121     -39.651 -35.441  49.831  1.00  0.67           N  
ATOM    922  N   HIS A 122     -36.557 -30.847  48.771  1.00  0.67           N  
ATOM    923  CA  HIS A 122     -36.441 -29.521  48.204  1.00  0.67           C  
ATOM    924  C   HIS A 122     -36.210 -29.518  46.691  1.00  0.67           C  
ATOM    925  O   HIS A 122     -35.301 -30.209  46.225  1.00  0.67           O  
ATOM    926  CB  HIS A 122     -35.299 -28.739  48.893  1.00  0.67           C  
ATOM    927  CG  HIS A 122     -35.402 -27.257  48.722  1.00  0.67           C  
ATOM    928  ND1 HIS A 122     -35.031 -26.656  47.536  1.00  0.67           N  
ATOM    929  CD2 HIS A 122     -35.926 -26.334  49.567  1.00  0.67           C  
ATOM    930  CE1 HIS A 122     -35.333 -25.383  47.683  1.00  0.67           C  
ATOM    931  NE2 HIS A 122     -35.880 -25.133  48.893  1.00  0.67           N  
ATOM    932  N   PRO A 123     -36.953 -28.755  45.878  1.00  0.71           N  
ATOM    933  CA  PRO A 123     -36.957 -28.915  44.425  1.00  0.71           C  
ATOM    934  C   PRO A 123     -35.656 -28.457  43.804  1.00  0.71           C  
ATOM    935  O   PRO A 123     -35.375 -28.787  42.655  1.00  0.71           O  
ATOM    936  CB  PRO A 123     -38.135 -28.032  43.967  1.00  0.71           C  
ATOM    937  CG  PRO A 123     -38.304 -27.000  45.086  1.00  0.71           C  
ATOM    938  CD  PRO A 123     -38.002 -27.835  46.323  1.00  0.71           C  
ATOM    939  N   GLN A 124     -34.849 -27.684  44.546  1.00  0.66           N  
ATOM    940  CA  GLN A 124     -33.560 -27.214  44.105  1.00  0.66           C  
ATOM    941  C   GLN A 124     -32.498 -28.306  44.159  1.00  0.66           C  
ATOM    942  O   GLN A 124     -31.521 -28.286  43.416  1.00  0.66           O  
ATOM    943  CB  GLN A 124     -33.155 -26.058  45.042  1.00  0.66           C  
ATOM    944  CG  GLN A 124     -32.235 -25.002  44.414  1.00  0.66           C  
ATOM    945  CD  GLN A 124     -32.935 -24.117  43.382  1.00  0.66           C  
ATOM    946  OE1 GLN A 124     -32.426 -23.889  42.287  1.00  0.66           O  
ATOM    947  NE2 GLN A 124     -34.113 -23.562  43.751  1.00  0.66           N  
ATOM    948  N   LEU A 125     -32.691 -29.317  45.033  1.00  0.69           N  
ATOM    949  CA  LEU A 125     -31.750 -30.404  45.242  1.00  0.69           C  
ATOM    950  C   LEU A 125     -32.228 -31.704  44.598  1.00  0.69           C  
ATOM    951  O   LEU A 125     -31.898 -32.805  45.037  1.00  0.69           O  
ATOM    952  CB  LEU A 125     -31.498 -30.698  46.745  1.00  0.69           C  
ATOM    953  CG  LEU A 125     -30.835 -29.596  47.598  1.00  0.69           C  
ATOM    954  CD1 LEU A 125     -30.461 -30.202  48.960  1.00  0.69           C  
ATOM    955  CD2 LEU A 125     -29.590 -28.955  46.964  1.00  0.69           C  
ATOM    956  N   CYS A 126     -33.031 -31.641  43.521  1.00  0.67           N  
ATOM    957  CA  CYS A 126     -33.454 -32.838  42.805  1.00  0.67           C  
ATOM    958  C   CYS A 126     -32.333 -33.610  42.120  1.00  0.67           C  
ATOM    959  O   CYS A 126     -32.287 -34.835  42.201  1.00  0.67           O  
ATOM    960  CB  CYS A 126     -34.538 -32.517  41.751  1.00  0.67           C  
ATOM    961  SG  CYS A 126     -36.136 -32.152  42.547  1.00  0.67           S  
ATOM    962  N   THR A 127     -31.388 -32.929  41.439  1.00  0.53           N  
ATOM    963  CA  THR A 127     -30.356 -33.587  40.629  1.00  0.53           C  
ATOM    964  C   THR A 127     -29.032 -33.662  41.344  1.00  0.53           C  
ATOM    965  O   THR A 127     -27.960 -33.678  40.746  1.00  0.53           O  
ATOM    966  CB  THR A 127     -30.125 -32.951  39.272  1.00  0.53           C  
ATOM    967  OG1 THR A 127     -29.890 -31.552  39.379  1.00  0.53           O  
ATOM    968  CG2 THR A 127     -31.405 -33.132  38.451  1.00  0.53           C  
ATOM    969  N   LEU A 128     -29.118 -33.724  42.670  1.00  0.66           N  
ATOM    970  CA  LEU A 128     -28.047 -33.649  43.621  1.00  0.66           C  
ATOM    971  C   LEU A 128     -27.637 -35.062  44.057  1.00  0.66           C  
ATOM    972  O   LEU A 128     -28.460 -35.792  44.605  1.00  0.66           O  
ATOM    973  CB  LEU A 128     -28.710 -32.826  44.762  1.00  0.66           C  
ATOM    974  CG  LEU A 128     -27.877 -32.313  45.930  1.00  0.66           C  
ATOM    975  CD1 LEU A 128     -27.296 -33.476  46.694  1.00  0.66           C  
ATOM    976  CD2 LEU A 128     -26.810 -31.322  45.486  1.00  0.66           C  
ATOM    977  N   PRO A 129     -26.417 -35.539  43.839  1.00  0.69           N  
ATOM    978  CA  PRO A 129     -25.938 -36.746  44.507  1.00  0.69           C  
ATOM    979  C   PRO A 129     -25.664 -36.591  45.996  1.00  0.69           C  
ATOM    980  O   PRO A 129     -25.050 -35.619  46.434  1.00  0.69           O  
ATOM    981  CB  PRO A 129     -24.642 -37.080  43.762  1.00  0.69           C  
ATOM    982  CG  PRO A 129     -24.922 -36.620  42.332  1.00  0.69           C  
ATOM    983  CD  PRO A 129     -25.812 -35.388  42.518  1.00  0.69           C  
ATOM    984  N   PHE A 130     -26.071 -37.573  46.807  1.00  0.74           N  
ATOM    985  CA  PHE A 130     -25.996 -37.453  48.251  1.00  0.74           C  
ATOM    986  C   PHE A 130     -24.867 -38.292  48.804  1.00  0.74           C  
ATOM    987  O   PHE A 130     -24.839 -39.513  48.676  1.00  0.74           O  
ATOM    988  CB  PHE A 130     -27.299 -37.920  48.949  1.00  0.74           C  
ATOM    989  CG  PHE A 130     -28.452 -37.091  48.490  1.00  0.74           C  
ATOM    990  CD1 PHE A 130     -29.140 -37.400  47.310  1.00  0.74           C  
ATOM    991  CD2 PHE A 130     -28.797 -35.938  49.196  1.00  0.74           C  
ATOM    992  CE1 PHE A 130     -30.095 -36.513  46.801  1.00  0.74           C  
ATOM    993  CE2 PHE A 130     -29.697 -35.010  48.655  1.00  0.74           C  
ATOM    994  CZ  PHE A 130     -30.359 -35.305  47.456  1.00  0.74           C  
ATOM    995  N   LEU A 131     -23.909 -37.665  49.497  1.00  0.75           N  
ATOM    996  CA  LEU A 131     -22.935 -38.403  50.269  1.00  0.75           C  
ATOM    997  C   LEU A 131     -23.356 -38.293  51.711  1.00  0.75           C  
ATOM    998  O   LEU A 131     -23.541 -37.204  52.246  1.00  0.75           O  
ATOM    999  CB  LEU A 131     -21.500 -37.847  50.088  1.00  0.75           C  
ATOM   1000  CG  LEU A 131     -20.397 -38.523  50.940  1.00  0.75           C  
ATOM   1001  CD1 LEU A 131     -20.256 -40.016  50.632  1.00  0.75           C  
ATOM   1002  CD2 LEU A 131     -19.047 -37.827  50.723  1.00  0.75           C  
ATOM   1003  N   ILE A 132     -23.539 -39.420  52.404  1.00  0.77           N  
ATOM   1004  CA  ILE A 132     -23.798 -39.363  53.825  1.00  0.77           C  
ATOM   1005  C   ILE A 132     -22.528 -39.805  54.516  1.00  0.77           C  
ATOM   1006  O   ILE A 132     -21.921 -40.820  54.169  1.00  0.77           O  
ATOM   1007  CB  ILE A 132     -24.975 -40.206  54.282  1.00  0.77           C  
ATOM   1008  CG1 ILE A 132     -26.237 -40.036  53.405  1.00  0.77           C  
ATOM   1009  CG2 ILE A 132     -25.262 -39.914  55.779  1.00  0.77           C  
ATOM   1010  CD1 ILE A 132     -26.889 -38.657  53.431  1.00  0.77           C  
ATOM   1011  N   LEU A 133     -22.075 -39.045  55.520  1.00  0.75           N  
ATOM   1012  CA  LEU A 133     -20.953 -39.447  56.331  1.00  0.75           C  
ATOM   1013  C   LEU A 133     -21.450 -39.953  57.659  1.00  0.75           C  
ATOM   1014  O   LEU A 133     -22.003 -39.216  58.476  1.00  0.75           O  
ATOM   1015  CB  LEU A 133     -19.960 -38.301  56.574  1.00  0.75           C  
ATOM   1016  CG  LEU A 133     -19.304 -37.781  55.286  1.00  0.75           C  
ATOM   1017  CD1 LEU A 133     -18.323 -36.692  55.641  1.00  0.75           C  
ATOM   1018  CD2 LEU A 133     -18.574 -38.838  54.469  1.00  0.75           C  
ATOM   1019  N   ALA A 134     -21.233 -41.254  57.906  1.00  0.79           N  
ATOM   1020  CA  ALA A 134     -21.482 -41.878  59.179  1.00  0.79           C  
ATOM   1021  C   ALA A 134     -20.284 -41.636  60.078  1.00  0.79           C  
ATOM   1022  O   ALA A 134     -19.365 -42.456  60.170  1.00  0.79           O  
ATOM   1023  CB  ALA A 134     -21.691 -43.380  58.946  1.00  0.79           C  
ATOM   1024  N   ASN A 135     -20.251 -40.453  60.715  1.00  0.75           N  
ATOM   1025  CA  ASN A 135     -19.090 -39.948  61.401  1.00  0.75           C  
ATOM   1026  C   ASN A 135     -19.101 -40.399  62.843  1.00  0.75           C  
ATOM   1027  O   ASN A 135     -20.126 -40.792  63.390  1.00  0.75           O  
ATOM   1028  CB  ASN A 135     -19.020 -38.398  61.304  1.00  0.75           C  
ATOM   1029  CG  ASN A 135     -17.636 -37.883  61.677  1.00  0.75           C  
ATOM   1030  OD1 ASN A 135     -16.619 -38.503  61.363  1.00  0.75           O  
ATOM   1031  ND2 ASN A 135     -17.583 -36.749  62.402  1.00  0.75           N  
ATOM   1032  N   HIS A 136     -17.919 -40.351  63.478  1.00  0.73           N  
ATOM   1033  CA  HIS A 136     -17.702 -40.775  64.841  1.00  0.73           C  
ATOM   1034  C   HIS A 136     -17.788 -42.287  65.002  1.00  0.73           C  
ATOM   1035  O   HIS A 136     -18.365 -42.814  65.953  1.00  0.73           O  
ATOM   1036  CB  HIS A 136     -18.607 -40.056  65.856  1.00  0.73           C  
ATOM   1037  CG  HIS A 136     -18.521 -38.552  65.822  1.00  0.73           C  
ATOM   1038  ND1 HIS A 136     -17.636 -37.876  66.644  1.00  0.73           N  
ATOM   1039  CD2 HIS A 136     -19.232 -37.662  65.084  1.00  0.73           C  
ATOM   1040  CE1 HIS A 136     -17.829 -36.599  66.389  1.00  0.73           C  
ATOM   1041  NE2 HIS A 136     -18.788 -36.412  65.455  1.00  0.73           N  
ATOM   1042  N   GLN A 137     -17.191 -43.027  64.043  1.00  0.71           N  
ATOM   1043  CA  GLN A 137     -17.173 -44.480  64.016  1.00  0.71           C  
ATOM   1044  C   GLN A 137     -16.184 -45.072  65.010  1.00  0.71           C  
ATOM   1045  O   GLN A 137     -16.227 -46.252  65.347  1.00  0.71           O  
ATOM   1046  CB  GLN A 137     -16.772 -44.944  62.591  1.00  0.71           C  
ATOM   1047  CG  GLN A 137     -17.292 -46.348  62.200  1.00  0.71           C  
ATOM   1048  CD  GLN A 137     -18.802 -46.413  61.942  1.00  0.71           C  
ATOM   1049  OE1 GLN A 137     -19.443 -47.434  62.183  1.00  0.71           O  
ATOM   1050  NE2 GLN A 137     -19.396 -45.337  61.377  1.00  0.71           N  
ATOM   1051  N   ASP A 138     -15.256 -44.236  65.496  1.00  0.74           N  
ATOM   1052  CA  ASP A 138     -14.288 -44.519  66.523  1.00  0.74           C  
ATOM   1053  C   ASP A 138     -14.925 -44.796  67.888  1.00  0.74           C  
ATOM   1054  O   ASP A 138     -14.488 -45.673  68.636  1.00  0.74           O  
ATOM   1055  CB  ASP A 138     -13.309 -43.312  66.587  1.00  0.74           C  
ATOM   1056  CG  ASP A 138     -14.057 -42.015  66.879  1.00  0.74           C  
ATOM   1057  OD1 ASP A 138     -14.877 -41.611  66.011  1.00  0.74           O  
ATOM   1058  OD2 ASP A 138     -13.907 -41.480  68.003  1.00  0.74           O  
ATOM   1059  N   LYS A 139     -15.980 -44.027  68.244  1.00  0.71           N  
ATOM   1060  CA  LYS A 139     -16.643 -44.117  69.523  1.00  0.71           C  
ATOM   1061  C   LYS A 139     -17.286 -45.491  69.788  1.00  0.71           C  
ATOM   1062  O   LYS A 139     -17.935 -46.068  68.913  1.00  0.71           O  
ATOM   1063  CB  LYS A 139     -17.687 -42.976  69.740  1.00  0.71           C  
ATOM   1064  CG  LYS A 139     -17.036 -41.608  70.046  1.00  0.71           C  
ATOM   1065  CD  LYS A 139     -18.019 -40.475  70.459  1.00  0.71           C  
ATOM   1066  CE  LYS A 139     -18.689 -39.812  69.241  1.00  0.71           C  
ATOM   1067  NZ  LYS A 139     -19.630 -38.695  69.511  1.00  0.71           N  
ATOM   1068  N   PRO A 140     -17.170 -46.062  70.986  1.00  0.60           N  
ATOM   1069  CA  PRO A 140     -17.835 -47.309  71.337  1.00  0.60           C  
ATOM   1070  C   PRO A 140     -19.337 -47.135  71.351  1.00  0.60           C  
ATOM   1071  O   PRO A 140     -19.826 -46.085  71.762  1.00  0.60           O  
ATOM   1072  CB  PRO A 140     -17.273 -47.661  72.726  1.00  0.60           C  
ATOM   1073  CG  PRO A 140     -16.787 -46.324  73.294  1.00  0.60           C  
ATOM   1074  CD  PRO A 140     -16.310 -45.574  72.057  1.00  0.60           C  
ATOM   1075  N   ALA A 141     -20.059 -48.145  70.825  1.00  0.64           N  
ATOM   1076  CA  ALA A 141     -21.498 -48.140  70.653  1.00  0.64           C  
ATOM   1077  C   ALA A 141     -21.964 -47.217  69.532  1.00  0.64           C  
ATOM   1078  O   ALA A 141     -23.154 -46.952  69.376  1.00  0.64           O  
ATOM   1079  CB  ALA A 141     -22.259 -47.880  71.969  1.00  0.64           C  
ATOM   1080  N   ALA A 142     -21.035 -46.742  68.673  1.00  0.70           N  
ATOM   1081  CA  ALA A 142     -21.395 -46.104  67.431  1.00  0.70           C  
ATOM   1082  C   ALA A 142     -22.119 -47.049  66.491  1.00  0.70           C  
ATOM   1083  O   ALA A 142     -21.752 -48.211  66.324  1.00  0.70           O  
ATOM   1084  CB  ALA A 142     -20.160 -45.561  66.697  1.00  0.70           C  
ATOM   1085  N   ARG A 143     -23.182 -46.555  65.844  1.00  0.67           N  
ATOM   1086  CA  ARG A 143     -23.921 -47.369  64.914  1.00  0.67           C  
ATOM   1087  C   ARG A 143     -23.237 -47.503  63.585  1.00  0.67           C  
ATOM   1088  O   ARG A 143     -22.683 -46.557  63.024  1.00  0.67           O  
ATOM   1089  CB  ARG A 143     -25.315 -46.800  64.664  1.00  0.67           C  
ATOM   1090  CG  ARG A 143     -26.158 -46.889  65.935  1.00  0.67           C  
ATOM   1091  CD  ARG A 143     -27.354 -45.983  65.822  1.00  0.67           C  
ATOM   1092  NE  ARG A 143     -27.974 -45.914  67.184  1.00  0.67           N  
ATOM   1093  CZ  ARG A 143     -28.960 -46.746  67.541  1.00  0.67           C  
ATOM   1094  NH1 ARG A 143     -29.614 -47.457  66.628  1.00  0.67           N  
ATOM   1095  NH2 ARG A 143     -29.286 -46.870  68.823  1.00  0.67           N  
ATOM   1096  N   SER A 144     -23.310 -48.720  63.040  1.00  0.74           N  
ATOM   1097  CA  SER A 144     -22.696 -49.045  61.775  1.00  0.74           C  
ATOM   1098  C   SER A 144     -23.406 -48.418  60.590  1.00  0.74           C  
ATOM   1099  O   SER A 144     -24.555 -47.983  60.628  1.00  0.74           O  
ATOM   1100  CB  SER A 144     -22.576 -50.584  61.603  1.00  0.74           C  
ATOM   1101  OG  SER A 144     -21.915 -50.978  60.392  1.00  0.74           O  
ATOM   1102  N   VAL A 145     -22.708 -48.394  59.452  1.00  0.75           N  
ATOM   1103  CA  VAL A 145     -23.151 -47.906  58.166  1.00  0.75           C  
ATOM   1104  C   VAL A 145     -24.445 -48.583  57.735  1.00  0.75           C  
ATOM   1105  O   VAL A 145     -25.414 -47.957  57.317  1.00  0.75           O  
ATOM   1106  CB  VAL A 145     -22.046 -48.239  57.168  1.00  0.75           C  
ATOM   1107  CG1 VAL A 145     -22.370 -47.836  55.719  1.00  0.75           C  
ATOM   1108  CG2 VAL A 145     -20.765 -47.534  57.616  1.00  0.75           C  
ATOM   1109  N   GLN A 146     -24.529 -49.913  57.893  1.00  0.68           N  
ATOM   1110  CA  GLN A 146     -25.723 -50.672  57.578  1.00  0.68           C  
ATOM   1111  C   GLN A 146     -26.934 -50.293  58.417  1.00  0.68           C  
ATOM   1112  O   GLN A 146     -28.055 -50.230  57.915  1.00  0.68           O  
ATOM   1113  CB  GLN A 146     -25.444 -52.186  57.680  1.00  0.68           C  
ATOM   1114  CG  GLN A 146     -25.120 -52.698  59.103  1.00  0.68           C  
ATOM   1115  CD  GLN A 146     -24.995 -54.218  59.099  1.00  0.68           C  
ATOM   1116  OE1 GLN A 146     -24.340 -54.805  58.240  1.00  0.68           O  
ATOM   1117  NE2 GLN A 146     -25.648 -54.880  60.080  1.00  0.68           N  
ATOM   1118  N   GLU A 147     -26.727 -49.993  59.717  1.00  0.70           N  
ATOM   1119  CA  GLU A 147     -27.764 -49.500  60.590  1.00  0.70           C  
ATOM   1120  C   GLU A 147     -28.247 -48.139  60.152  1.00  0.70           C  
ATOM   1121  O   GLU A 147     -29.438 -47.897  59.989  1.00  0.70           O  
ATOM   1122  CB  GLU A 147     -27.219 -49.309  62.016  1.00  0.70           C  
ATOM   1123  CG  GLU A 147     -26.994 -50.597  62.823  1.00  0.70           C  
ATOM   1124  CD  GLU A 147     -26.773 -50.168  64.263  1.00  0.70           C  
ATOM   1125  OE1 GLU A 147     -27.760 -49.688  64.891  1.00  0.70           O  
ATOM   1126  OE2 GLU A 147     -25.594 -50.218  64.693  1.00  0.70           O  
ATOM   1127  N   ILE A 148     -27.306 -47.219  59.887  1.00  0.75           N  
ATOM   1128  CA  ILE A 148     -27.578 -45.857  59.475  1.00  0.75           C  
ATOM   1129  C   ILE A 148     -28.395 -45.806  58.191  1.00  0.75           C  
ATOM   1130  O   ILE A 148     -29.356 -45.052  58.093  1.00  0.75           O  
ATOM   1131  CB  ILE A 148     -26.261 -45.096  59.376  1.00  0.75           C  
ATOM   1132  CG1 ILE A 148     -25.757 -44.744  60.799  1.00  0.75           C  
ATOM   1133  CG2 ILE A 148     -26.410 -43.825  58.526  1.00  0.75           C  
ATOM   1134  CD1 ILE A 148     -24.380 -44.084  60.812  1.00  0.75           C  
ATOM   1135  N   LYS A 149     -28.114 -46.668  57.193  1.00  0.71           N  
ATOM   1136  CA  LYS A 149     -28.943 -46.757  55.996  1.00  0.71           C  
ATOM   1137  C   LYS A 149     -30.421 -47.045  56.287  1.00  0.71           C  
ATOM   1138  O   LYS A 149     -31.308 -46.450  55.675  1.00  0.71           O  
ATOM   1139  CB  LYS A 149     -28.434 -47.868  55.044  1.00  0.71           C  
ATOM   1140  CG  LYS A 149     -27.060 -47.598  54.408  1.00  0.71           C  
ATOM   1141  CD  LYS A 149     -26.586 -48.814  53.591  1.00  0.71           C  
ATOM   1142  CE  LYS A 149     -25.251 -48.616  52.869  1.00  0.71           C  
ATOM   1143  NZ  LYS A 149     -24.937 -49.823  52.069  1.00  0.71           N  
ATOM   1144  N   LYS A 150     -30.709 -47.939  57.258  1.00  0.71           N  
ATOM   1145  CA  LYS A 150     -32.059 -48.206  57.728  1.00  0.71           C  
ATOM   1146  C   LYS A 150     -32.720 -47.035  58.438  1.00  0.71           C  
ATOM   1147  O   LYS A 150     -33.834 -46.639  58.107  1.00  0.71           O  
ATOM   1148  CB  LYS A 150     -32.056 -49.377  58.750  1.00  0.71           C  
ATOM   1149  CG  LYS A 150     -31.574 -50.721  58.186  1.00  0.71           C  
ATOM   1150  CD  LYS A 150     -32.475 -51.185  57.038  1.00  0.71           C  
ATOM   1151  CE  LYS A 150     -32.212 -52.589  56.495  1.00  0.71           C  
ATOM   1152  NZ  LYS A 150     -32.693 -53.595  57.454  1.00  0.71           N  
ATOM   1153  N   TYR A 151     -32.028 -46.420  59.417  1.00  0.74           N  
ATOM   1154  CA  TYR A 151     -32.608 -45.375  60.254  1.00  0.74           C  
ATOM   1155  C   TYR A 151     -32.718 -44.045  59.536  1.00  0.74           C  
ATOM   1156  O   TYR A 151     -33.481 -43.171  59.921  1.00  0.74           O  
ATOM   1157  CB  TYR A 151     -31.762 -45.114  61.514  1.00  0.74           C  
ATOM   1158  CG  TYR A 151     -31.756 -46.265  62.473  1.00  0.74           C  
ATOM   1159  CD1 TYR A 151     -32.861 -46.543  63.295  1.00  0.74           C  
ATOM   1160  CD2 TYR A 151     -30.599 -47.040  62.610  1.00  0.74           C  
ATOM   1161  CE1 TYR A 151     -32.819 -47.622  64.196  1.00  0.74           C  
ATOM   1162  CE2 TYR A 151     -30.568 -48.139  63.475  1.00  0.74           C  
ATOM   1163  CZ  TYR A 151     -31.677 -48.432  64.266  1.00  0.74           C  
ATOM   1164  OH  TYR A 151     -31.588 -49.513  65.167  1.00  0.74           O  
ATOM   1165  N   PHE A 152     -31.989 -43.859  58.425  1.00  0.77           N  
ATOM   1166  CA  PHE A 152     -32.139 -42.680  57.600  1.00  0.77           C  
ATOM   1167  C   PHE A 152     -33.198 -42.902  56.546  1.00  0.77           C  
ATOM   1168  O   PHE A 152     -33.473 -41.996  55.767  1.00  0.77           O  
ATOM   1169  CB  PHE A 152     -30.854 -42.403  56.798  1.00  0.77           C  
ATOM   1170  CG  PHE A 152     -29.880 -41.591  57.556  1.00  0.77           C  
ATOM   1171  CD1 PHE A 152     -29.327 -42.042  58.746  1.00  0.77           C  
ATOM   1172  CD2 PHE A 152     -29.476 -40.354  57.043  1.00  0.77           C  
ATOM   1173  CE1 PHE A 152     -28.355 -41.282  59.388  1.00  0.77           C  
ATOM   1174  CE2 PHE A 152     -28.544 -39.561  57.712  1.00  0.77           C  
ATOM   1175  CZ  PHE A 152     -27.978 -40.038  58.892  1.00  0.77           C  
ATOM   1176  N   GLU A 153     -33.768 -44.124  56.489  1.00  0.72           N  
ATOM   1177  CA  GLU A 153     -34.720 -44.604  55.505  1.00  0.72           C  
ATOM   1178  C   GLU A 153     -34.235 -44.468  54.063  1.00  0.72           C  
ATOM   1179  O   GLU A 153     -34.977 -44.247  53.106  1.00  0.72           O  
ATOM   1180  CB  GLU A 153     -36.160 -44.101  55.758  1.00  0.72           C  
ATOM   1181  CG  GLU A 153     -36.460 -42.634  55.365  1.00  0.72           C  
ATOM   1182  CD  GLU A 153     -37.903 -42.278  55.661  1.00  0.72           C  
ATOM   1183  OE1 GLU A 153     -38.657 -43.176  56.117  1.00  0.72           O  
ATOM   1184  OE2 GLU A 153     -38.250 -41.080  55.547  1.00  0.72           O  
ATOM   1185  N   LEU A 154     -32.917 -44.672  53.860  1.00  0.75           N  
ATOM   1186  CA  LEU A 154     -32.287 -44.490  52.569  1.00  0.75           C  
ATOM   1187  C   LEU A 154     -32.637 -45.601  51.593  1.00  0.75           C  
ATOM   1188  O   LEU A 154     -32.634 -45.394  50.381  1.00  0.75           O  
ATOM   1189  CB  LEU A 154     -30.747 -44.404  52.687  1.00  0.75           C  
ATOM   1190  CG  LEU A 154     -30.169 -43.180  53.413  1.00  0.75           C  
ATOM   1191  CD1 LEU A 154     -28.637 -43.258  53.515  1.00  0.75           C  
ATOM   1192  CD2 LEU A 154     -30.575 -41.840  52.780  1.00  0.75           C  
ATOM   1193  N   GLU A 155     -32.990 -46.803  52.095  1.00  0.69           N  
ATOM   1194  CA  GLU A 155     -33.351 -47.945  51.268  1.00  0.69           C  
ATOM   1195  C   GLU A 155     -34.509 -47.719  50.288  1.00  0.69           C  
ATOM   1196  O   GLU A 155     -34.327 -48.056  49.114  1.00  0.69           O  
ATOM   1197  CB  GLU A 155     -33.701 -49.182  52.130  1.00  0.69           C  
ATOM   1198  CG  GLU A 155     -32.531 -49.849  52.870  1.00  0.69           C  
ATOM   1199  CD  GLU A 155     -33.060 -51.093  53.567  1.00  0.69           C  
ATOM   1200  OE1 GLU A 155     -34.003 -50.957  54.390  1.00  0.69           O  
ATOM   1201  OE2 GLU A 155     -32.502 -52.192  53.321  1.00  0.69           O  
ATOM   1202  N   PRO A 156     -35.676 -47.148  50.619  1.00  0.61           N  
ATOM   1203  CA  PRO A 156     -36.686 -46.886  49.600  1.00  0.61           C  
ATOM   1204  C   PRO A 156     -36.340 -45.680  48.739  1.00  0.61           C  
ATOM   1205  O   PRO A 156     -36.725 -45.662  47.574  1.00  0.61           O  
ATOM   1206  CB  PRO A 156     -38.004 -46.717  50.384  1.00  0.61           C  
ATOM   1207  CG  PRO A 156     -37.596 -46.467  51.841  1.00  0.61           C  
ATOM   1208  CD  PRO A 156     -36.260 -47.187  51.965  1.00  0.61           C  
ATOM   1209  N   LEU A 157     -35.627 -44.665  49.270  1.00  0.55           N  
ATOM   1210  CA  LEU A 157     -35.235 -43.469  48.530  1.00  0.55           C  
ATOM   1211  C   LEU A 157     -34.224 -43.741  47.414  1.00  0.55           C  
ATOM   1212  O   LEU A 157     -34.241 -43.109  46.358  1.00  0.55           O  
ATOM   1213  CB  LEU A 157     -34.733 -42.380  49.525  1.00  0.55           C  
ATOM   1214  CG  LEU A 157     -34.656 -40.916  49.012  1.00  0.55           C  
ATOM   1215  CD1 LEU A 157     -33.434 -40.638  48.124  1.00  0.55           C  
ATOM   1216  CD2 LEU A 157     -35.946 -40.447  48.320  1.00  0.55           C  
ATOM   1217  N   ALA A 158     -33.325 -44.723  47.618  1.00  0.50           N  
ATOM   1218  CA  ALA A 158     -32.193 -45.036  46.764  1.00  0.50           C  
ATOM   1219  C   ALA A 158     -32.471 -45.299  45.305  1.00  0.50           C  
ATOM   1220  O   ALA A 158     -31.661 -45.018  44.428  1.00  0.50           O  
ATOM   1221  CB  ALA A 158     -31.525 -46.314  47.307  1.00  0.50           C  
ATOM   1222  N   ARG A 159     -33.621 -45.901  44.994  1.00  0.38           N  
ATOM   1223  CA  ARG A 159     -33.952 -46.258  43.638  1.00  0.38           C  
ATOM   1224  C   ARG A 159     -34.524 -45.067  42.879  1.00  0.38           C  
ATOM   1225  O   ARG A 159     -35.714 -44.990  42.588  1.00  0.38           O  
ATOM   1226  CB  ARG A 159     -34.876 -47.495  43.649  1.00  0.38           C  
ATOM   1227  CG  ARG A 159     -34.246 -48.659  44.450  1.00  0.38           C  
ATOM   1228  CD  ARG A 159     -35.113 -49.917  44.518  1.00  0.38           C  
ATOM   1229  NE  ARG A 159     -34.432 -50.873  45.461  1.00  0.38           N  
ATOM   1230  CZ  ARG A 159     -33.546 -51.811  45.101  1.00  0.38           C  
ATOM   1231  NH1 ARG A 159     -33.181 -51.987  43.836  1.00  0.38           N  
ATOM   1232  NH2 ARG A 159     -33.014 -52.595  46.038  1.00  0.38           N  
ATOM   1233  N   GLY A 160     -33.653 -44.091  42.554  1.00  0.44           N  
ATOM   1234  CA  GLY A 160     -34.048 -42.870  41.875  1.00  0.44           C  
ATOM   1235  C   GLY A 160     -32.950 -41.853  41.927  1.00  0.44           C  
ATOM   1236  O   GLY A 160     -32.385 -41.456  40.911  1.00  0.44           O  
ATOM   1237  N   LYS A 161     -32.594 -41.411  43.143  1.00  0.55           N  
ATOM   1238  CA  LYS A 161     -31.462 -40.530  43.357  1.00  0.55           C  
ATOM   1239  C   LYS A 161     -30.228 -41.355  43.635  1.00  0.55           C  
ATOM   1240  O   LYS A 161     -30.295 -42.551  43.882  1.00  0.55           O  
ATOM   1241  CB  LYS A 161     -31.709 -39.558  44.530  1.00  0.55           C  
ATOM   1242  CG  LYS A 161     -32.802 -38.534  44.201  1.00  0.55           C  
ATOM   1243  CD  LYS A 161     -33.344 -37.841  45.455  1.00  0.55           C  
ATOM   1244  CE  LYS A 161     -34.372 -36.760  45.128  1.00  0.55           C  
ATOM   1245  NZ  LYS A 161     -34.936 -36.242  46.381  1.00  0.55           N  
ATOM   1246  N   ARG A 162     -29.039 -40.739  43.598  1.00  0.56           N  
ATOM   1247  CA  ARG A 162     -27.817 -41.476  43.836  1.00  0.56           C  
ATOM   1248  C   ARG A 162     -27.302 -41.084  45.192  1.00  0.56           C  
ATOM   1249  O   ARG A 162     -27.000 -39.915  45.432  1.00  0.56           O  
ATOM   1250  CB  ARG A 162     -26.741 -41.161  42.771  1.00  0.56           C  
ATOM   1251  CG  ARG A 162     -27.205 -41.512  41.345  1.00  0.56           C  
ATOM   1252  CD  ARG A 162     -26.228 -41.045  40.266  1.00  0.56           C  
ATOM   1253  NE  ARG A 162     -26.921 -41.241  38.951  1.00  0.56           N  
ATOM   1254  CZ  ARG A 162     -26.676 -40.511  37.855  1.00  0.56           C  
ATOM   1255  NH1 ARG A 162     -25.733 -39.574  37.841  1.00  0.56           N  
ATOM   1256  NH2 ARG A 162     -27.392 -40.722  36.754  1.00  0.56           N  
ATOM   1257  N   TRP A 163     -27.191 -42.051  46.115  1.00  0.67           N  
ATOM   1258  CA  TRP A 163     -26.588 -41.786  47.396  1.00  0.67           C  
ATOM   1259  C   TRP A 163     -25.625 -42.878  47.761  1.00  0.67           C  
ATOM   1260  O   TRP A 163     -25.678 -44.000  47.262  1.00  0.67           O  
ATOM   1261  CB  TRP A 163     -27.604 -41.547  48.554  1.00  0.67           C  
ATOM   1262  CG  TRP A 163     -28.536 -42.675  48.927  1.00  0.67           C  
ATOM   1263  CD1 TRP A 163     -29.856 -42.784  48.605  1.00  0.67           C  
ATOM   1264  CD2 TRP A 163     -28.207 -43.858  49.685  1.00  0.67           C  
ATOM   1265  NE1 TRP A 163     -30.344 -43.983  49.053  1.00  0.67           N  
ATOM   1266  CE2 TRP A 163     -29.327 -44.698  49.627  1.00  0.67           C  
ATOM   1267  CE3 TRP A 163     -27.069 -44.243  50.384  1.00  0.67           C  
ATOM   1268  CZ2 TRP A 163     -29.307 -45.967  50.195  1.00  0.67           C  
ATOM   1269  CZ3 TRP A 163     -27.065 -45.495  51.018  1.00  0.67           C  
ATOM   1270  CH2 TRP A 163     -28.166 -46.357  50.907  1.00  0.67           C  
ATOM   1271  N   ILE A 164     -24.713 -42.555  48.682  1.00  0.69           N  
ATOM   1272  CA  ILE A 164     -23.802 -43.521  49.238  1.00  0.69           C  
ATOM   1273  C   ILE A 164     -23.583 -43.111  50.676  1.00  0.69           C  
ATOM   1274  O   ILE A 164     -23.631 -41.933  51.028  1.00  0.69           O  
ATOM   1275  CB  ILE A 164     -22.506 -43.626  48.445  1.00  0.69           C  
ATOM   1276  CG1 ILE A 164     -21.665 -44.864  48.838  1.00  0.69           C  
ATOM   1277  CG2 ILE A 164     -21.712 -42.310  48.550  1.00  0.69           C  
ATOM   1278  CD1 ILE A 164     -20.522 -45.117  47.851  1.00  0.69           C  
ATOM   1279  N   LEU A 165     -23.391 -44.089  51.570  1.00  0.75           N  
ATOM   1280  CA  LEU A 165     -23.093 -43.816  52.956  1.00  0.75           C  
ATOM   1281  C   LEU A 165     -21.713 -44.345  53.189  1.00  0.75           C  
ATOM   1282  O   LEU A 165     -21.456 -45.516  52.903  1.00  0.75           O  
ATOM   1283  CB  LEU A 165     -24.039 -44.569  53.913  1.00  0.75           C  
ATOM   1284  CG  LEU A 165     -23.745 -44.365  55.414  1.00  0.75           C  
ATOM   1285  CD1 LEU A 165     -24.008 -42.953  55.902  1.00  0.75           C  
ATOM   1286  CD2 LEU A 165     -24.613 -45.314  56.212  1.00  0.75           C  
ATOM   1287  N   GLN A 166     -20.797 -43.513  53.713  1.00  0.66           N  
ATOM   1288  CA  GLN A 166     -19.456 -43.971  53.986  1.00  0.66           C  
ATOM   1289  C   GLN A 166     -19.129 -43.802  55.474  1.00  0.66           C  
ATOM   1290  O   GLN A 166     -19.473 -42.770  56.064  1.00  0.66           O  
ATOM   1291  CB  GLN A 166     -18.438 -43.347  53.001  1.00  0.66           C  
ATOM   1292  CG  GLN A 166     -17.868 -41.957  53.353  1.00  0.66           C  
ATOM   1293  CD  GLN A 166     -16.418 -42.047  53.834  1.00  0.66           C  
ATOM   1294  OE1 GLN A 166     -15.647 -42.875  53.351  1.00  0.66           O  
ATOM   1295  NE2 GLN A 166     -16.010 -41.152  54.756  1.00  0.66           N  
ATOM   1296  N   PRO A 167     -18.533 -44.789  56.151  1.00  0.72           N  
ATOM   1297  CA  PRO A 167     -18.129 -44.662  57.545  1.00  0.72           C  
ATOM   1298  C   PRO A 167     -16.951 -43.740  57.690  1.00  0.72           C  
ATOM   1299  O   PRO A 167     -16.065 -43.749  56.844  1.00  0.72           O  
ATOM   1300  CB  PRO A 167     -17.728 -46.080  57.980  1.00  0.72           C  
ATOM   1301  CG  PRO A 167     -17.413 -46.836  56.680  1.00  0.72           C  
ATOM   1302  CD  PRO A 167     -18.215 -46.108  55.599  1.00  0.72           C  
ATOM   1303  N   CYS A 168     -16.920 -42.926  58.755  1.00  0.74           N  
ATOM   1304  CA  CYS A 168     -15.872 -41.944  58.892  1.00  0.74           C  
ATOM   1305  C   CYS A 168     -15.499 -41.731  60.352  1.00  0.74           C  
ATOM   1306  O   CYS A 168     -16.292 -41.941  61.269  1.00  0.74           O  
ATOM   1307  CB  CYS A 168     -16.331 -40.608  58.254  1.00  0.74           C  
ATOM   1308  SG  CYS A 168     -14.944 -39.480  57.892  1.00  0.74           S  
ATOM   1309  N   SER A 169     -14.254 -41.293  60.593  1.00  0.71           N  
ATOM   1310  CA  SER A 169     -13.804 -40.773  61.871  1.00  0.71           C  
ATOM   1311  C   SER A 169     -13.112 -39.483  61.524  1.00  0.71           C  
ATOM   1312  O   SER A 169     -12.611 -39.301  60.416  1.00  0.71           O  
ATOM   1313  CB  SER A 169     -12.794 -41.688  62.645  1.00  0.71           C  
ATOM   1314  OG  SER A 169     -12.248 -41.029  63.794  1.00  0.71           O  
ATOM   1315  N   LEU A 170     -13.012 -38.566  62.495  1.00  0.61           N  
ATOM   1316  CA  LEU A 170     -12.287 -37.327  62.363  1.00  0.61           C  
ATOM   1317  C   LEU A 170     -10.788 -37.536  62.337  1.00  0.61           C  
ATOM   1318  O   LEU A 170     -10.030 -36.617  62.034  1.00  0.61           O  
ATOM   1319  CB  LEU A 170     -12.594 -36.409  63.554  1.00  0.61           C  
ATOM   1320  CG  LEU A 170     -14.068 -35.993  63.670  1.00  0.61           C  
ATOM   1321  CD1 LEU A 170     -14.228 -35.117  64.918  1.00  0.61           C  
ATOM   1322  CD2 LEU A 170     -14.565 -35.275  62.406  1.00  0.61           C  
ATOM   1323  N   ASP A 171     -10.317 -38.761  62.628  1.00  0.52           N  
ATOM   1324  CA  ASP A 171      -8.941 -39.178  62.458  1.00  0.52           C  
ATOM   1325  C   ASP A 171      -8.484 -39.040  61.022  1.00  0.52           C  
ATOM   1326  O   ASP A 171      -7.410 -38.496  60.753  1.00  0.52           O  
ATOM   1327  CB  ASP A 171      -8.781 -40.645  62.896  1.00  0.52           C  
ATOM   1328  CG  ASP A 171      -9.098 -40.727  64.371  1.00  0.52           C  
ATOM   1329  OD1 ASP A 171      -8.655 -39.819  65.113  1.00  0.52           O  
ATOM   1330  OD2 ASP A 171      -9.826 -41.683  64.742  1.00  0.52           O  
ATOM   1331  N   ASP A 172      -9.346 -39.424  60.059  1.00  0.46           N  
ATOM   1332  CA  ASP A 172      -9.079 -39.298  58.644  1.00  0.46           C  
ATOM   1333  C   ASP A 172      -8.781 -37.845  58.227  1.00  0.46           C  
ATOM   1334  O   ASP A 172      -9.539 -36.917  58.517  1.00  0.46           O  
ATOM   1335  CB  ASP A 172     -10.252 -39.924  57.856  1.00  0.46           C  
ATOM   1336  CG  ASP A 172      -9.866 -40.129  56.405  1.00  0.46           C  
ATOM   1337  OD1 ASP A 172      -8.758 -39.666  56.033  1.00  0.46           O  
ATOM   1338  OD2 ASP A 172     -10.671 -40.762  55.685  1.00  0.46           O  
ATOM   1339  N   MET A 173      -7.589 -37.604  57.633  1.00  0.31           N  
ATOM   1340  CA  MET A 173      -7.104 -36.285  57.257  1.00  0.31           C  
ATOM   1341  C   MET A 173      -6.971 -36.158  55.776  1.00  0.31           C  
ATOM   1342  O   MET A 173      -6.552 -35.109  55.294  1.00  0.31           O  
ATOM   1343  CB  MET A 173      -5.726 -35.907  57.876  1.00  0.31           C  
ATOM   1344  CG  MET A 173      -4.505 -36.682  57.330  1.00  0.31           C  
ATOM   1345  SD  MET A 173      -2.902 -36.182  58.034  1.00  0.31           S  
ATOM   1346  CE  MET A 173      -3.191 -36.693  59.748  1.00  0.31           C  
ATOM   1347  N   ASP A 174      -7.367 -37.199  55.024  1.00  0.34           N  
ATOM   1348  CA  ASP A 174      -7.450 -37.133  53.589  1.00  0.34           C  
ATOM   1349  C   ASP A 174      -8.452 -36.053  53.197  1.00  0.34           C  
ATOM   1350  O   ASP A 174      -9.641 -36.236  53.428  1.00  0.34           O  
ATOM   1351  CB  ASP A 174      -7.930 -38.499  53.023  1.00  0.34           C  
ATOM   1352  CG  ASP A 174      -6.831 -39.549  52.973  1.00  0.34           C  
ATOM   1353  OD1 ASP A 174      -5.743 -39.334  53.568  1.00  0.34           O  
ATOM   1354  OD2 ASP A 174      -7.044 -40.574  52.268  1.00  0.34           O  
ATOM   1355  N   ALA A 175      -7.972 -34.911  52.635  1.00  0.40           N  
ATOM   1356  CA  ALA A 175      -8.687 -33.728  52.208  1.00  0.40           C  
ATOM   1357  C   ALA A 175     -10.057 -33.868  51.564  1.00  0.40           C  
ATOM   1358  O   ALA A 175     -10.514 -34.945  51.225  1.00  0.40           O  
ATOM   1359  CB  ALA A 175      -7.820 -32.798  51.380  1.00  0.40           C  
ATOM   1360  N   LEU A 176     -10.842 -32.774  51.358  1.00  0.33           N  
ATOM   1361  CA  LEU A 176     -12.176 -32.911  50.788  1.00  0.33           C  
ATOM   1362  C   LEU A 176     -12.007 -33.464  49.443  1.00  0.33           C  
ATOM   1363  O   LEU A 176     -12.559 -34.506  49.120  1.00  0.33           O  
ATOM   1364  CB  LEU A 176     -12.874 -31.558  50.554  1.00  0.33           C  
ATOM   1365  CG  LEU A 176     -13.835 -30.938  51.552  1.00  0.33           C  
ATOM   1366  CD1 LEU A 176     -14.056 -29.526  51.049  1.00  0.33           C  
ATOM   1367  CD2 LEU A 176     -15.150 -31.748  51.638  1.00  0.33           C  
ATOM   1368  N   LYS A 177     -11.099 -32.846  48.670  1.00  0.39           N  
ATOM   1369  CA  LYS A 177     -10.724 -33.355  47.418  1.00  0.39           C  
ATOM   1370  C   LYS A 177     -10.069 -34.735  47.684  1.00  0.39           C  
ATOM   1371  O   LYS A 177     -10.591 -35.653  47.098  1.00  0.39           O  
ATOM   1372  CB  LYS A 177      -9.964 -32.194  46.748  1.00  0.39           C  
ATOM   1373  CG  LYS A 177     -10.480 -31.707  45.377  1.00  0.39           C  
ATOM   1374  CD  LYS A 177      -9.512 -31.244  44.270  1.00  0.39           C  
ATOM   1375  CE  LYS A 177      -9.382 -29.832  43.635  1.00  0.39           C  
ATOM   1376  NZ  LYS A 177      -9.827 -28.694  44.479  1.00  0.39           N  
ATOM   1377  N   ASP A 178      -9.066 -34.895  48.669  1.00  0.39           N  
ATOM   1378  CA  ASP A 178      -8.409 -36.163  49.104  1.00  0.39           C  
ATOM   1379  C   ASP A 178      -9.340 -37.345  49.407  1.00  0.39           C  
ATOM   1380  O   ASP A 178      -8.897 -38.492  49.481  1.00  0.39           O  
ATOM   1381  CB  ASP A 178      -7.060 -36.271  49.926  1.00  0.39           C  
ATOM   1382  CG  ASP A 178      -5.893 -35.317  49.667  1.00  0.39           C  
ATOM   1383  OD1 ASP A 178      -5.013 -35.638  48.843  1.00  0.39           O  
ATOM   1384  OD2 ASP A 178      -5.798 -34.290  50.354  1.00  0.39           O  
ATOM   1385  N   SER A 179     -10.673 -37.178  49.514  1.00  0.38           N  
ATOM   1386  CA  SER A 179     -11.535 -38.353  49.513  1.00  0.38           C  
ATOM   1387  C   SER A 179     -11.910 -38.811  48.125  1.00  0.38           C  
ATOM   1388  O   SER A 179     -11.705 -39.969  47.755  1.00  0.38           O  
ATOM   1389  CB  SER A 179     -12.793 -38.252  50.401  1.00  0.38           C  
ATOM   1390  OG  SER A 179     -13.758 -37.293  49.972  1.00  0.38           O  
ATOM   1391  N   PHE A 180     -12.409 -37.890  47.284  1.00  0.38           N  
ATOM   1392  CA  PHE A 180     -12.934 -38.104  45.950  1.00  0.38           C  
ATOM   1393  C   PHE A 180     -11.983 -38.738  45.027  1.00  0.38           C  
ATOM   1394  O   PHE A 180     -12.401 -39.527  44.198  1.00  0.38           O  
ATOM   1395  CB  PHE A 180     -13.403 -36.814  45.236  1.00  0.38           C  
ATOM   1396  CG  PHE A 180     -14.642 -36.404  45.909  1.00  0.38           C  
ATOM   1397  CD1 PHE A 180     -14.523 -35.590  47.021  1.00  0.38           C  
ATOM   1398  CD2 PHE A 180     -15.889 -36.909  45.535  1.00  0.38           C  
ATOM   1399  CE1 PHE A 180     -15.618 -35.318  47.836  1.00  0.38           C  
ATOM   1400  CE2 PHE A 180     -17.015 -36.613  46.318  1.00  0.38           C  
ATOM   1401  CZ  PHE A 180     -16.875 -35.831  47.483  1.00  0.38           C  
ATOM   1402  N   SER A 181     -10.683 -38.474  45.104  1.00  0.44           N  
ATOM   1403  CA  SER A 181      -9.852 -39.151  44.123  1.00  0.44           C  
ATOM   1404  C   SER A 181      -9.331 -40.459  44.611  1.00  0.44           C  
ATOM   1405  O   SER A 181      -8.911 -41.274  43.809  1.00  0.44           O  
ATOM   1406  CB  SER A 181      -8.734 -38.313  43.497  1.00  0.44           C  
ATOM   1407  OG  SER A 181      -9.155 -36.958  43.414  1.00  0.44           O  
ATOM   1408  N   GLN A 182      -9.468 -40.788  45.926  1.00  0.45           N  
ATOM   1409  CA  GLN A 182      -9.344 -42.176  46.309  1.00  0.45           C  
ATOM   1410  C   GLN A 182     -10.499 -42.925  45.676  1.00  0.45           C  
ATOM   1411  O   GLN A 182     -10.299 -43.959  45.048  1.00  0.45           O  
ATOM   1412  CB  GLN A 182      -9.388 -42.391  47.836  1.00  0.45           C  
ATOM   1413  CG  GLN A 182      -8.125 -41.970  48.630  1.00  0.45           C  
ATOM   1414  CD  GLN A 182      -6.828 -42.620  48.133  1.00  0.45           C  
ATOM   1415  OE1 GLN A 182      -6.774 -43.783  47.736  1.00  0.45           O  
ATOM   1416  NE2 GLN A 182      -5.722 -41.836  48.141  1.00  0.45           N  
ATOM   1417  N   LEU A 183     -11.719 -42.341  45.701  1.00  0.43           N  
ATOM   1418  CA  LEU A 183     -12.831 -42.873  44.937  1.00  0.43           C  
ATOM   1419  C   LEU A 183     -12.532 -42.984  43.433  1.00  0.43           C  
ATOM   1420  O   LEU A 183     -12.688 -44.075  42.916  1.00  0.43           O  
ATOM   1421  CB  LEU A 183     -14.169 -42.101  45.115  1.00  0.43           C  
ATOM   1422  CG  LEU A 183     -14.932 -42.187  46.464  1.00  0.43           C  
ATOM   1423  CD1 LEU A 183     -14.224 -41.560  47.667  1.00  0.43           C  
ATOM   1424  CD2 LEU A 183     -16.289 -41.488  46.278  1.00  0.43           C  
ATOM   1425  N   ILE A 184     -12.021 -41.974  42.671  1.00  0.41           N  
ATOM   1426  CA  ILE A 184     -11.675 -42.252  41.262  1.00  0.41           C  
ATOM   1427  C   ILE A 184     -10.650 -43.356  41.073  1.00  0.41           C  
ATOM   1428  O   ILE A 184     -10.894 -44.225  40.261  1.00  0.41           O  
ATOM   1429  CB  ILE A 184     -11.278 -41.079  40.344  1.00  0.41           C  
ATOM   1430  CG1 ILE A 184      -9.851 -40.499  40.603  1.00  0.41           C  
ATOM   1431  CG2 ILE A 184     -12.445 -40.061  40.329  1.00  0.41           C  
ATOM   1432  CD1 ILE A 184      -9.417 -39.313  39.741  1.00  0.41           C  
ATOM   1433  N   ASN A 185      -9.534 -43.443  41.827  1.00  0.45           N  
ATOM   1434  CA  ASN A 185      -8.566 -44.527  41.646  1.00  0.45           C  
ATOM   1435  C   ASN A 185      -9.171 -45.918  41.914  1.00  0.45           C  
ATOM   1436  O   ASN A 185      -9.031 -46.848  41.124  1.00  0.45           O  
ATOM   1437  CB  ASN A 185      -7.333 -44.249  42.552  1.00  0.45           C  
ATOM   1438  CG  ASN A 185      -6.081 -44.994  42.095  1.00  0.45           C  
ATOM   1439  OD1 ASN A 185      -6.096 -46.091  41.548  1.00  0.45           O  
ATOM   1440  ND2 ASN A 185      -4.902 -44.375  42.335  1.00  0.45           N  
ATOM   1441  N   LEU A 186      -9.946 -46.048  43.009  1.00  0.43           N  
ATOM   1442  CA  LEU A 186     -10.701 -47.247  43.332  1.00  0.43           C  
ATOM   1443  C   LEU A 186     -11.800 -47.590  42.326  1.00  0.43           C  
ATOM   1444  O   LEU A 186     -12.025 -48.758  42.048  1.00  0.43           O  
ATOM   1445  CB  LEU A 186     -11.339 -47.137  44.738  1.00  0.43           C  
ATOM   1446  CG  LEU A 186     -10.350 -46.936  45.911  1.00  0.43           C  
ATOM   1447  CD1 LEU A 186     -11.143 -46.743  47.212  1.00  0.43           C  
ATOM   1448  CD2 LEU A 186      -9.307 -48.052  46.048  1.00  0.43           C  
ATOM   1449  N   LEU A 187     -12.516 -46.586  41.775  1.00  0.42           N  
ATOM   1450  CA  LEU A 187     -13.531 -46.784  40.750  1.00  0.42           C  
ATOM   1451  C   LEU A 187     -12.967 -46.901  39.316  1.00  0.42           C  
ATOM   1452  O   LEU A 187     -13.662 -47.360  38.413  1.00  0.42           O  
ATOM   1453  CB  LEU A 187     -14.550 -45.600  40.756  1.00  0.42           C  
ATOM   1454  CG  LEU A 187     -15.357 -45.344  42.059  1.00  0.42           C  
ATOM   1455  CD1 LEU A 187     -16.303 -44.142  41.891  1.00  0.42           C  
ATOM   1456  CD2 LEU A 187     -16.136 -46.559  42.561  1.00  0.42           C  
ATOM   1457  N   GLU A 188     -11.712 -46.455  39.055  1.00  0.36           N  
ATOM   1458  CA  GLU A 188     -10.995 -46.535  37.780  1.00  0.36           C  
ATOM   1459  C   GLU A 188     -10.573 -47.947  37.459  1.00  0.36           C  
ATOM   1460  O   GLU A 188     -10.819 -48.476  36.374  1.00  0.36           O  
ATOM   1461  CB  GLU A 188      -9.689 -45.695  37.817  1.00  0.36           C  
ATOM   1462  CG  GLU A 188      -8.923 -45.530  36.472  1.00  0.36           C  
ATOM   1463  CD  GLU A 188      -9.133 -44.168  35.806  1.00  0.36           C  
ATOM   1464  OE1 GLU A 188      -9.253 -43.152  36.538  1.00  0.36           O  
ATOM   1465  OE2 GLU A 188      -9.142 -44.126  34.548  1.00  0.36           O  
ATOM   1466  N   GLU A 189      -9.973 -48.649  38.451  1.00  0.43           N  
ATOM   1467  CA  GLU A 189     -10.056 -50.093  38.454  1.00  0.43           C  
ATOM   1468  C   GLU A 189     -11.517 -50.477  38.651  1.00  0.43           C  
ATOM   1469  O   GLU A 189     -12.234 -49.849  39.413  1.00  0.43           O  
ATOM   1470  CB  GLU A 189      -9.228 -50.793  39.557  1.00  0.43           C  
ATOM   1471  CG  GLU A 189      -7.691 -50.708  39.396  1.00  0.43           C  
ATOM   1472  CD  GLU A 189      -6.978 -51.678  40.341  1.00  0.43           C  
ATOM   1473  OE1 GLU A 189      -7.535 -51.988  41.424  1.00  0.43           O  
ATOM   1474  OE2 GLU A 189      -5.866 -52.134  39.965  1.00  0.43           O  
ATOM   1475  N   LYS A 190     -12.028 -51.501  37.952  1.00  0.42           N  
ATOM   1476  CA  LYS A 190     -13.424 -51.886  38.071  1.00  0.42           C  
ATOM   1477  C   LYS A 190     -13.800 -52.298  39.505  1.00  0.42           C  
ATOM   1478  O   LYS A 190     -13.378 -53.353  39.986  1.00  0.42           O  
ATOM   1479  CB  LYS A 190     -13.667 -52.986  36.997  1.00  0.42           C  
ATOM   1480  CG  LYS A 190     -15.090 -53.533  36.815  1.00  0.42           C  
ATOM   1481  CD  LYS A 190     -15.469 -54.535  37.914  1.00  0.42           C  
ATOM   1482  CE  LYS A 190     -16.744 -55.353  37.757  1.00  0.42           C  
ATOM   1483  NZ  LYS A 190     -16.531 -56.363  36.721  1.00  0.42           N  
ATOM   1484  N   ASP A 191     -14.630 -51.476  40.188  1.00  0.33           N  
ATOM   1485  CA  ASP A 191     -15.016 -51.569  41.591  1.00  0.33           C  
ATOM   1486  C   ASP A 191     -15.668 -52.920  41.949  1.00  0.33           C  
ATOM   1487  O   ASP A 191     -15.367 -53.573  42.940  1.00  0.33           O  
ATOM   1488  CB  ASP A 191     -15.770 -50.247  41.941  1.00  0.33           C  
ATOM   1489  CG  ASP A 191     -16.354 -50.140  43.343  1.00  0.33           C  
ATOM   1490  OD1 ASP A 191     -15.785 -50.737  44.289  1.00  0.33           O  
ATOM   1491  OD2 ASP A 191     -17.359 -49.393  43.488  1.00  0.33           O  
ATOM   1492  N   HIS A 192     -16.420 -53.630  41.111  1.00  0.25           N  
ATOM   1493  CA  HIS A 192     -17.778 -53.501  40.666  1.00  0.25           C  
ATOM   1494  C   HIS A 192     -18.178 -52.506  39.575  1.00  0.25           C  
ATOM   1495  O   HIS A 192     -17.721 -51.378  39.490  1.00  0.25           O  
ATOM   1496  CB  HIS A 192     -18.796 -53.875  41.772  1.00  0.25           C  
ATOM   1497  CG  HIS A 192     -19.930 -52.930  41.919  1.00  0.25           C  
ATOM   1498  ND1 HIS A 192     -19.796 -51.905  42.818  1.00  0.25           N  
ATOM   1499  CD2 HIS A 192     -21.009 -52.729  41.126  1.00  0.25           C  
ATOM   1500  CE1 HIS A 192     -20.775 -51.077  42.553  1.00  0.25           C  
ATOM   1501  NE2 HIS A 192     -21.545 -51.526  41.530  1.00  0.25           N  
ATOM   1502  N   GLU A 193     -19.020 -52.990  38.646  1.00  0.26           N  
ATOM   1503  CA  GLU A 193     -19.505 -52.341  37.459  1.00  0.26           C  
ATOM   1504  C   GLU A 193     -20.867 -53.063  37.307  1.00  0.26           C  
ATOM   1505  O   GLU A 193     -20.951 -54.229  37.815  1.00  0.26           O  
ATOM   1506  CB  GLU A 193     -18.672 -52.716  36.204  1.00  0.26           C  
ATOM   1507  CG  GLU A 193     -18.719 -51.735  35.010  1.00  0.26           C  
ATOM   1508  CD  GLU A 193     -17.802 -50.520  35.163  1.00  0.26           C  
ATOM   1509  OE1 GLU A 193     -16.840 -50.584  35.970  1.00  0.26           O  
ATOM   1510  OE2 GLU A 193     -18.010 -49.552  34.389  1.00  0.26           O  
ATOM   1511  OXT GLU A 193     -21.802 -52.516  36.679  1.00  0.26           O  
TER    1512      GLU A 193                                                      
END   



If you find results from this site helpful for your research, please cite one of our papers:

elNémo is maintained by Yves-Henri Sanejouand.
It was developed by Karsten Suhre.
Between 2003 and 2014, it was hosted by IGS (Marseille).
Last modification: October 18th, 2018.