CNRS Nantes University UFIP UFIP
home |  start a new run |  job status |  references&downloads |  examples |  help  

Should you encounter any unexpected behaviour,
please let us know.


***  nsp14-10 5c8u(300)  ***

elNémo ID: 20081907043723915

Job options:

ID        	=	 20081907043723915
JOBID     	=	 nsp14-10 5c8u(300)
USERID    	=	 unknown
PRIVAT    	=	 0

NMODES    	=	 25
DQMIN     	=	 -300
DQMAX     	=	 300
DQSTEP    	=	 20
DOGRAPHS  	=	 on

DOPROJMODS	=	 0
DORMSD    	=	 0

NRBL      	=	 0
CUTOFF    	=	 0
CAONLY    	=	 0


Input data for this run:

HEADER nsp14-10 5c8u(300)

TITLE     SWISS-MODEL SERVER (https://swissmodel.expasy.org)
TITLE    2 5c8u
EXPDTA    THEORETICAL MODEL (SWISS-MODEL SERVER)
AUTHOR    SWISS-MODEL SERVER (SEE REFERENCE IN JRNL Records)
REVDAT   1   17-AUG-20 1MOD    1       16:48
JRNL        AUTH   A.WATERHOUSE,M.BERTONI,S.BIENERT,G.STUDER,G.TAURIELLO,
JRNL        AUTH 2 R.GUMIENNY,F.T.HEER,T.A.P.DE BEER,C.REMPFER,L.BORDOLI,
JRNL        AUTH 3 R.LEPORE,T.SCHWEDE
JRNL        TITL   SWISS-MODEL: HOMOLOGY MODELLING OF PROTEIN STRUCTURES AND
JRNL        TITL 2 COMPLEXES
JRNL        REF    NUCLEIC.ACIDS.RES..           V.  46 W296  2018
JRNL        PMID   29788355
JRNL        DOI    10.1093/nar/gky427
REMARK   1
REMARK   1 REFERENCE 1
REMARK   1  AUTH   S.BIENERT,A.WATERHOUSE,T.A.P.DE BEER,G.TAURIELLO,G.STUDER,
REMARK   1  AUTH 2 L.BORDOLI,T.SCHWEDE
REMARK   1  TITL   THE SWISS-MODEL REPOSITORY - NEW FEATURES AND FUNCTIONALITY
REMARK   1  REF    NUCLEIC.ACIDS.RES..           V.  22       2017
REMARK   1  REFN                   ISSN 0305-1048
REMARK   1  PMID   27899672
REMARK   1  DOI    10.1093/nar/gkw1132
REMARK   1
REMARK   1 REFERENCE 2
REMARK   1  AUTH   N.GUEX,M.C.PEITSCH,T.SCHWEDE
REMARK   1  TITL   AUTOMATED COMPARATIVE PROTEIN STRUCTURE MODELING WITH
REMARK   1  TITL 2 SWISS-MODEL AND SWISS-PDBVIEWER: A HISTORICAL PERSPECTIVE
REMARK   1  REF    ELECTROPHORESIS               V.  30       2009
REMARK   1  REFN                   ISSN 0173-0835
REMARK   1  PMID   19517507
REMARK   1  DOI    10.1002/elps.200900140
REMARK   1
REMARK   1 REFERENCE 3
REMARK   1  AUTH   P.BENKERT,M.BIASINI,T.SCHWEDE
REMARK   1  TITL   TOWARD THE ESTIMATION OF THE ABSOLUTE QUALITY OF INDIVIDUAL
REMARK   1  TITL 2 PROTEIN STRUCTURE MODELS
REMARK   1  REF    BIOINFORMATICS                V.  27       2011
REMARK   1  REFN                   ISSN 1367-4803
REMARK   1  PMID   21134891
REMARK   1  DOI    10.1093/bioinformatics/btq662
REMARK   1
REMARK   1 REFERENCE 4
REMARK   1  AUTH   M.BERTONI,F.KIEFER,M.BIASINI,L.BORDOLI,T.SCHWEDE
REMARK   1  TITL   MODELING PROTEIN QUATERNARY STRUCTURE OF HOMO- AND
REMARK   1  TITL 2 HETERO-OLIGOMERS BEYOND BINARY INTERACTIONS BY HOMOLOGY
REMARK   1  REF    SCI.REP.                      V.   7       2017
REMARK   1  REFN                   ISSN
REMARK   1  PMID   28874689
REMARK   1  DOI    10.1038/s41598-017-09654-8
REMARK   1
REMARK   1 DISCLAIMER
REMARK   1 The SWISS-MODEL SERVER produces theoretical models for proteins.
REMARK   1 The results of any theoretical modelling procedure is
REMARK   1 NON-EXPERIMENTAL and MUST be considered with care. These models may
REMARK   1 contain significant errors. This is especially true for automated
REMARK   1 modeling since there is no human intervention during model
REMARK   1 building. Please read the header section and the logfile carefully
REMARK   1 to know what templates and alignments were used during the model
REMARK   1 building process. All information by the SWISS-MODEL SERVER is
REMARK   1 provided "AS-IS", without any warranty, expressed or implied.
REMARK   2
REMARK   2 COPYRIGHT NOTICE
REMARK   2 This SWISS-MODEL protein model is copyright. It is produced by the
REMARK   2 SWISS-MODEL server, developed by the Computational Structural
REMARK   2 Biology Group at the SIB Swiss Institute of Bioinformatics at the
REMARK   2 Biozentrum, University of Basel (https://swissmodel.expasy.org). This
REMARK   2 model is licensed under the CC BY-SA 4.0 Creative Commons
REMARK   2 Attribution-ShareAlike 4.0 International License
REMARK   2 (https://creativecommons.org/licenses/by-sa/4.0/legalcode), i.e. you
REMARK   2 can copy and redistribute the model in any medium or format,
REMARK   2 transform and build upon the model for any purpose, even
REMARK   2 commercially, under the following terms:
REMARK   2 Attribution - You must give appropriate credit, provide a link to
REMARK   2 the license, and indicate if changes were made. You may do so in any
REMARK   2 reasonable manner, but not in any way that suggests the licensor
REMARK   2 endorses you or your use. When you publish, patent or distribute
REMARK   2 results that were fully or partially based on the model, please cite
REMARK   2 the corresponding papers mentioned under JRNL.
REMARK   2 ShareAlike - If you remix, transform, or build upon the material,
REMARK   2 you must distribute your contributions under the same license as the
REMARK   2 original.
REMARK   2 No additional restrictions - you may not apply legal terms or
REMARK   2 technological measures that legally restrict others from doing
REMARK   2 anything the license permits.
REMARK   2 Find a human-readable summary of (and not a substitute for) the
REMARK   2 CC BY-SA 4.0 license at this link:
REMARK   2 https://creativecommons.org/licenses/by-sa/4.0/
REMARK   3 
REMARK   3 MODEL INFORMATION
REMARK   3  ENGIN   PROMOD3
REMARK   3  VERSN   3.1.1
REMARK   3  OSTAT   hetero-1-1-mer
REMARK   3  OSRSN   PREDICTION
REMARK   3  QSPRD   0.888
REMARK   3  GMQE    0.99
REMARK   3  QMNV    4.1.0
REMARK   3  QMN4    -2.68
REMARK   3  MODT    FALSE
REMARK   3 
REMARK   3 MODEL LIGAND 1
REMARK   3  NAME    ZN
REMARK   3  BIND    A.74
REMARK   3  BIND 2  A.77
REMARK   3  BIND 3  A.83
REMARK   3  BIND 4  A.90
REMARK   3  BIND 5  _.1
REMARK   3 
REMARK   3 MODEL LIGAND 2
REMARK   3  NAME    ZN
REMARK   3  BIND    A.117
REMARK   3  BIND 2  A.120
REMARK   3  BIND 3  A.128
REMARK   3  BIND 4  A.130
REMARK   3  BIND 5  _.2
REMARK   3 
REMARK   3 MODEL LIGAND 3
REMARK   3  NAME    ZN
REMARK   3  BIND    B.207
REMARK   3  BIND 2  B.210
REMARK   3  BIND 3  B.226
REMARK   3  BIND 4  B.229
REMARK   3  BIND 5  _.3
REMARK   3 
REMARK   3 MODEL LIGAND 4
REMARK   3  NAME    ZN
REMARK   3  BIND    B.257
REMARK   3  BIND 2  B.261
REMARK   3  BIND 3  B.264
REMARK   3  BIND 4  B.279
REMARK   3  BIND 5  _.4
REMARK   3 
REMARK   3 MODEL LIGAND 5
REMARK   3  NAME    MG
REMARK   3  BIND    B.90
REMARK   3  BIND 2  B.187
REMARK   3  BIND 3  B.191
REMARK   3  BIND 4  _.6
REMARK   3 
REMARK   3 TEMPLATE 1
REMARK   3  PDBID   template_upload
REMARK   3  CHAIN   A
REMARK   3  MMCIF   A
REMARK   3  CHAIN   B
REMARK   3  MMCIF   B
REMARK   3  PDBV    2020-08-15
REMARK   3  SMTLE   template_upload.1
REMARK   3  SMTLV   2020-08-15
REMARK   3  MTHD    Unknown
REMARK   3  FOUND   HHblits
REMARK   3  GMQE    0.99
REMARK   3  SIM     0.63
REMARK   3  SID     95.66
REMARK   3  OSTAT   hetero-1-1-mer
REMARK   3  ALN A TRG AGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVT
REMARK   3  ALN A TRG PEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTV
REMARK   3  ALN A TRG CTVCGMWKGYGCSCDQLREPMLQ
REMARK   3  ALN A TPL AGNATEVPANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVT
REMARK   3  ALN A TPL PEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLRNTV
REMARK   3  ALN A TPL CTVCGMWKGYGCSCD--------
REMARK   3  ALN A OFF 2
REMARK   3  ALN B TRG AENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMM
REMARK   3  ALN B TRG GFKMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVN
REMARK   3  ALN B TRG LVAVPTGYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTL
REMARK   3  ALN B TRG KNLSDRVVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIG
REMARK   3  ALN B TRG FDYVYNPFMIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRV
REMARK   3  ALN B TRG DWTIEYPIIGDELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEW
REMARK   3  ALN B TRG KFYDAQPCSDKAYKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVL
REMARK   3  ALN B TRG SNLNLPGCDGGSLYVNKHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDID
REMARK   3  ALN B TRG YVPLKSATCITRCNLGGAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNT
REMARK   3  ALN B TRG FTRLQ
REMARK   3  ALN B TPL AENVTGLFKDCSKIITGLHPTQAPTHLSVDIKFKTEGLCVDIPGIPKDMTYRRLISMM
REMARK   3  ALN B TPL GFKMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATRDAVGTNLPLQLGFSTGVN
REMARK   3  ALN B TPL LVAVPTGYVDTENNTEFTRVNAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTL
REMARK   3  ALN B TPL KGLSDRVVFVLWAHGFELTSMKYFVKIGPERTCCLCDKRATCFSTSSDTYACWNHSVG
REMARK   3  ALN B TPL FDYVYNPFMIDVQQWGFTGNLQSNHDQHCQVHGNAHVASCDAIMTRCLAVHECFVKRV
REMARK   3  ALN B TPL DWSVEYPIIGDELRVNSACRKVQHMVVKSALLADKFPVLHDIGNPKAIKCVPQAEVEW
REMARK   3  ALN B TPL KFYDAQPCSDKAYKIEELFYSYATHHDKFTDGVCLFWNCNVDRYPANAIVCRFDTRVL
REMARK   3  ALN B TPL SNLNLPGCDGGSLYVNKHAFHTPAFDKSAFTNLKQLPFFYYSDSPCE-----------
REMARK   3  ALN B TPL YVPLKSATCITRCNLGGAVCRHHANEYRQYLDAYNMMISAGFSLWIYKQFDTYNLWNT
REMARK   3  ALN B TPL FTR--
REMARK   3  ALN B OFF 0
HELIX    1   1 THR B   31  PHE B   33  1                                   3
HELIX    2   2 ARG B   76  ARG B   81  1                                   6
HELIX    3   3 ASP B  144  LYS B  155  1                                  12
HELIX    4   4 TRP B  159  LEU B  174  1                                  16
HELIX    5   5 HIS B  188  TYR B  197  1                                  10
HELIX    6   6 GLN B  245  TRP B  247  1                                   3
HELIX    7   7 LEU B  253  TYR B  260  1                                   8
HELIX    8   8 ALA B  270  VAL B  287  1                                  18
HELIX    9   9 GLU B  302  ASP B  324  1                                  23
HELIX   10  10 ALA B  360  LYS B  362  1                                   3
HELIX   11  11 TYR B  370  PHE B  377  1                                   8
HELIX   12  12 LYS B  433  PHE B  436  1                                   4
HELIX   13  13 SER B  454  VAL B  460  1                                   7
HELIX   14  14 ARG B  485  SER B  503  1                                  19
HELIX   15  15 TYR B  517  LEU B  519  1                                   3
HELIX   16  16 PRO A    8  PHE A   19  1                                  12
HELIX   17  17 ALA A   23  ALA A   32  1                                  10
HELIX   18  18 LEU A   75  CYS A   79  1                                   5
HELIX   19  19 THR A  101  CYS A  103  1                                   3
HELIX   20  20 PRO A  107  LYS A  113  1                                   7
SHEET    1   1 1 ARG B  53  ILE B  55  0
SHEET    2   2 1 TRP B  86  HIS B  95  0
SHEET    3   3 1 ASN B 104  PHE B 111  0
SHEET    4   4 1 ASN B 116  VAL B 118  0
SHEET    5   5 1 THR B 122  ASP B 126  0
SHEET    6   6 1 THR B 131  ARG B 135  0
SHEET    7   7 1 VAL B 181  LEU B 185  0
SHEET    8   8 1 CYS B 216  SER B 218  0
SHEET    9   9 1 THR B 223  ALA B 225  0
SHEET   10  10 1 PRO B 239  ASP B 243  0
SHEET   11  11 1 VAL B 328  ILE B 332  0
SHEET   12  12 1 GLU B 347  ASP B 352  0
SHEET   13  13 1 ILE B 363  GLU B 365  0
SHEET   14  14 1 VAL B 381  TRP B 385  0
SHEET   15  15 1 SER B 396  PHE B 401  0
SHEET   16  16 1 ASN B 410  PRO B 412  0
SHEET   17  17 1 SER B 418  TYR B 420  0
SHEET   18  18 1 PHE B 426  THR B 428  0
SHEET   19  19 1 PHE B 506  VAL B 510  0
SHEET   20  20 1 GLN A  65  PHE A  68  0
SHEET   21  21 1 VAL A  97  PRO A 100  0
MODEL        1
ATOM      1  N   ALA B   1     -37.374 -29.456 -40.387  1.00  0.31           N
ATOM      2  CA  ALA B   1     -37.943 -28.420 -39.500  1.00  0.31           C
ATOM      3  C   ALA B   1     -39.263 -28.923 -38.910  1.00  0.31           C
ATOM      4  O   ALA B   1     -40.042 -29.514 -39.650  1.00  0.31           O
ATOM      5  CB  ALA B   1     -38.140 -27.171 -40.373  1.00  0.31           C
ATOM      6  N   GLU B   2     -39.547 -28.794 -37.598  1.00  0.54           N
ATOM      7  CA  GLU B   2     -38.663 -28.212 -36.610  1.00  0.54           C
ATOM      8  C   GLU B   2     -38.632 -28.915 -35.288  1.00  0.54           C
ATOM      9  O   GLU B   2     -39.617 -29.495 -34.833  1.00  0.54           O
ATOM     10  CB  GLU B   2     -38.915 -26.702 -36.391  1.00  0.54           C
ATOM     11  CG  GLU B   2     -37.642 -25.926 -35.964  1.00  0.54           C
ATOM     12  CD  GLU B   2     -36.430 -26.353 -36.789  1.00  0.54           C
ATOM     13  OE1 GLU B   2     -35.606 -27.115 -36.218  1.00  0.54           O
ATOM     14  OE2 GLU B   2     -36.403 -26.080 -38.015  1.00  0.54           O
ATOM     15  N   ASN B   3     -37.438 -28.925 -34.673  1.00  0.79           N
ATOM     16  CA  ASN B   3     -37.202 -29.572 -33.406  1.00  0.79           C
ATOM     17  C   ASN B   3     -37.996 -29.005 -32.225  1.00  0.79           C
ATOM     18  O   ASN B   3     -38.137 -27.798 -32.045  1.00  0.79           O
ATOM     19  CB  ASN B   3     -35.695 -29.596 -33.066  1.00  0.79           C
ATOM     20  CG  ASN B   3     -34.979 -30.602 -33.958  1.00  0.79           C
ATOM     21  OD1 ASN B   3     -35.525 -31.631 -34.359  1.00  0.79           O
ATOM     22  ND2 ASN B   3     -33.688 -30.331 -34.244  1.00  0.79           N
ATOM     23  N   VAL B   4     -38.509 -29.900 -31.360  1.00  0.79           N
ATOM     24  CA  VAL B   4     -39.450 -29.562 -30.308  1.00  0.79           C
ATOM     25  C   VAL B   4     -39.084 -30.305 -29.043  1.00  0.79           C
ATOM     26  O   VAL B   4     -38.371 -31.309 -29.069  1.00  0.79           O
ATOM     27  CB  VAL B   4     -40.889 -29.918 -30.668  1.00  0.79           C
ATOM     28  CG1 VAL B   4     -41.461 -28.820 -31.579  1.00  0.79           C
ATOM     29  CG2 VAL B   4     -40.956 -31.290 -31.365  1.00  0.79           C
ATOM     30  N   THR B   5     -39.556 -29.819 -27.881  1.00  0.77           N
ATOM     31  CA  THR B   5     -39.183 -30.386 -26.592  1.00  0.77           C
ATOM     32  C   THR B   5     -40.373 -31.042 -25.932  1.00  0.77           C
ATOM     33  O   THR B   5     -41.511 -30.595 -26.049  1.00  0.77           O
ATOM     34  CB  THR B   5     -38.628 -29.375 -25.588  1.00  0.77           C
ATOM     35  OG1 THR B   5     -37.919 -28.341 -26.248  1.00  0.77           O
ATOM     36  CG2 THR B   5     -37.592 -30.049 -24.678  1.00  0.77           C
ATOM     37  N   GLY B   6     -40.154 -32.134 -25.160  1.00  0.64           N
ATOM     38  CA  GLY B   6     -41.217 -32.663 -24.304  1.00  0.64           C
ATOM     39  C   GLY B   6     -41.421 -31.816 -23.064  1.00  0.64           C
ATOM     40  O   GLY B   6     -42.467 -31.860 -22.414  1.00  0.64           O
ATOM     41  N   LEU B   7     -40.409 -30.983 -22.747  1.00  0.74           N
ATOM     42  CA  LEU B   7     -40.411 -29.987 -21.699  1.00  0.74           C
ATOM     43  C   LEU B   7     -41.371 -28.851 -22.006  1.00  0.74           C
ATOM     44  O   LEU B   7     -41.325 -28.238 -23.071  1.00  0.74           O
ATOM     45  CB  LEU B   7     -38.961 -29.482 -21.475  1.00  0.74           C
ATOM     46  CG  LEU B   7     -38.593 -28.872 -20.102  1.00  0.74           C
ATOM     47  CD1 LEU B   7     -38.918 -27.378 -19.980  1.00  0.74           C
ATOM     48  CD2 LEU B   7     -39.172 -29.669 -18.927  1.00  0.74           C
ATOM     49  N   PHE B   8     -42.315 -28.606 -21.080  1.00  0.70           N
ATOM     50  CA  PHE B   8     -43.381 -27.632 -21.191  1.00  0.70           C
ATOM     51  C   PHE B   8     -44.438 -27.955 -22.239  1.00  0.70           C
ATOM     52  O   PHE B   8     -45.223 -27.094 -22.613  1.00  0.70           O
ATOM     53  CB  PHE B   8     -42.896 -26.160 -21.339  1.00  0.70           C
ATOM     54  CG  PHE B   8     -42.137 -25.588 -20.166  1.00  0.70           C
ATOM     55  CD1 PHE B   8     -42.162 -26.131 -18.867  1.00  0.70           C
ATOM     56  CD2 PHE B   8     -41.410 -24.405 -20.381  1.00  0.70           C
ATOM     57  CE1 PHE B   8     -41.462 -25.511 -17.821  1.00  0.70           C
ATOM     58  CE2 PHE B   8     -40.708 -23.790 -19.340  1.00  0.70           C
ATOM     59  CZ  PHE B   8     -40.727 -24.346 -18.058  1.00  0.70           C
ATOM     60  N   LYS B   9     -44.555 -29.216 -22.711  1.00  0.70           N
ATOM     61  CA  LYS B   9     -45.643 -29.636 -23.594  1.00  0.70           C
ATOM     62  C   LYS B   9     -47.042 -29.247 -23.080  1.00  0.70           C
ATOM     63  O   LYS B   9     -47.391 -29.548 -21.936  1.00  0.70           O
ATOM     64  CB  LYS B   9     -45.589 -31.174 -23.822  1.00  0.70           C
ATOM     65  CG  LYS B   9     -46.602 -31.719 -24.844  1.00  0.70           C
ATOM     66  CD  LYS B   9     -46.557 -33.249 -25.026  1.00  0.70           C
ATOM     67  CE  LYS B   9     -47.104 -34.013 -23.816  1.00  0.70           C
ATOM     68  NZ  LYS B   9     -47.245 -35.460 -24.097  1.00  0.70           N
ATOM     69  N   ASP B  10     -47.863 -28.565 -23.909  1.00  0.85           N
ATOM     70  CA  ASP B  10     -49.242 -28.204 -23.621  1.00  0.85           C
ATOM     71  C   ASP B  10     -50.104 -29.453 -23.714  1.00  0.85           C
ATOM     72  O   ASP B  10     -50.228 -30.083 -24.763  1.00  0.85           O
ATOM     73  CB  ASP B  10     -49.732 -27.110 -24.622  1.00  0.85           C
ATOM     74  CG  ASP B  10     -51.141 -26.578 -24.402  1.00  0.85           C
ATOM     75  OD1 ASP B  10     -51.931 -27.261 -23.709  1.00  0.85           O
ATOM     76  OD2 ASP B  10     -51.461 -25.494 -24.961  1.00  0.85           O
ATOM     77  N   CYS B  11     -50.711 -29.854 -22.587  1.00  0.93           N
ATOM     78  CA  CYS B  11     -51.405 -31.122 -22.504  1.00  0.93           C
ATOM     79  C   CYS B  11     -52.879 -30.910 -22.558  1.00  0.93           C
ATOM     80  O   CYS B  11     -53.683 -31.825 -22.397  1.00  0.93           O
ATOM     81  CB  CYS B  11     -51.052 -31.858 -21.194  1.00  0.93           C
ATOM     82  SG  CYS B  11     -49.371 -32.540 -21.284  1.00  0.93           S
ATOM     83  N   SER B  12     -53.304 -29.675 -22.771  1.00  0.90           N
ATOM     84  CA  SER B  12     -54.697 -29.371 -22.871  1.00  0.90           C
ATOM     85  C   SER B  12     -55.375 -29.962 -24.082  1.00  0.90           C
ATOM     86  O   SER B  12     -54.768 -30.181 -25.126  1.00  0.90           O
ATOM     87  CB  SER B  12     -54.912 -27.871 -22.826  1.00  0.90           C
ATOM     88  OG  SER B  12     -54.407 -27.276 -24.008  1.00  0.90           O
ATOM     89  N   LYS B  13     -56.681 -30.236 -23.961  1.00  0.87           N
ATOM     90  CA  LYS B  13     -57.485 -30.746 -25.052  1.00  0.87           C
ATOM     91  C   LYS B  13     -58.160 -29.604 -25.789  1.00  0.87           C
ATOM     92  O   LYS B  13     -59.132 -29.784 -26.520  1.00  0.87           O
ATOM     93  CB  LYS B  13     -58.544 -31.733 -24.518  1.00  0.87           C
ATOM     94  CG  LYS B  13     -57.939 -33.055 -24.033  1.00  0.87           C
ATOM     95  CD  LYS B  13     -58.993 -33.941 -23.361  1.00  0.87           C
ATOM     96  CE  LYS B  13     -58.707 -35.431 -23.504  1.00  0.87           C
ATOM     97  NZ  LYS B  13     -59.292 -36.155 -22.364  1.00  0.87           N
ATOM     98  N   VAL B  14     -57.645 -28.374 -25.617  1.00  0.85           N
ATOM     99  CA  VAL B  14     -58.065 -27.230 -26.393  1.00  0.85           C
ATOM    100  C   VAL B  14     -57.513 -27.331 -27.807  1.00  0.85           C
ATOM    101  O   VAL B  14     -56.306 -27.339 -28.033  1.00  0.85           O
ATOM    102  CB  VAL B  14     -57.635 -25.908 -25.771  1.00  0.85           C
ATOM    103  CG1 VAL B  14     -58.182 -24.728 -26.599  1.00  0.85           C
ATOM    104  CG2 VAL B  14     -58.125 -25.818 -24.312  1.00  0.85           C
ATOM    105  N   ILE B  15     -58.413 -27.417 -28.807  1.00  0.83           N
ATOM    106  CA  ILE B  15     -58.058 -27.551 -30.211  1.00  0.83           C
ATOM    107  C   ILE B  15     -57.475 -26.270 -30.795  1.00  0.83           C
ATOM    108  O   ILE B  15     -56.691 -26.275 -31.741  1.00  0.83           O
ATOM    109  CB  ILE B  15     -59.273 -28.037 -31.011  1.00  0.83           C
ATOM    110  CG1 ILE B  15     -58.971 -28.365 -32.491  1.00  0.83           C
ATOM    111  CG2 ILE B  15     -60.429 -27.020 -30.924  1.00  0.83           C
ATOM    112  CD1 ILE B  15     -57.824 -29.363 -32.657  1.00  0.83           C
ATOM    113  N   THR B  16     -57.836 -25.118 -30.213  1.00  0.85           N
ATOM    114  CA  THR B  16     -57.353 -23.806 -30.602  1.00  0.85           C
ATOM    115  C   THR B  16     -55.972 -23.546 -30.020  1.00  0.85           C
ATOM    116  O   THR B  16     -55.712 -23.819 -28.845  1.00  0.85           O
ATOM    117  CB  THR B  16     -58.291 -22.681 -30.139  1.00  0.85           C
ATOM    118  OG1 THR B  16     -59.616 -23.165 -29.930  1.00  0.85           O
ATOM    119  CG2 THR B  16     -58.388 -21.591 -31.212  1.00  0.85           C
ATOM    120  N   GLY B  17     -55.031 -22.974 -30.804  1.00  0.74           N
ATOM    121  CA  GLY B  17     -53.810 -22.377 -30.251  1.00  0.74           C
ATOM    122  C   GLY B  17     -54.110 -21.158 -29.399  1.00  0.74           C
ATOM    123  O   GLY B  17     -55.267 -20.777 -29.235  1.00  0.74           O
ATOM    124  N   LEU B  18     -53.095 -20.487 -28.825  1.00  0.85           N
ATOM    125  CA  LEU B  18     -53.365 -19.252 -28.094  1.00  0.85           C
ATOM    126  C   LEU B  18     -53.386 -18.015 -28.983  1.00  0.85           C
ATOM    127  O   LEU B  18     -52.847 -17.966 -30.091  1.00  0.85           O
ATOM    128  CB  LEU B  18     -52.416 -18.968 -26.888  1.00  0.85           C
ATOM    129  CG  LEU B  18     -52.840 -19.503 -25.496  1.00  0.85           C
ATOM    130  CD1 LEU B  18     -54.347 -19.469 -25.204  1.00  0.85           C
ATOM    131  CD2 LEU B  18     -52.293 -20.905 -25.244  1.00  0.85           C
ATOM    132  N   HIS B  19     -54.011 -16.943 -28.458  1.00  0.80           N
ATOM    133  CA  HIS B  19     -53.830 -15.582 -28.921  1.00  0.80           C
ATOM    134  C   HIS B  19     -52.380 -15.127 -28.766  1.00  0.80           C
ATOM    135  O   HIS B  19     -51.730 -15.557 -27.810  1.00  0.80           O
ATOM    136  CB  HIS B  19     -54.763 -14.633 -28.131  1.00  0.80           C
ATOM    137  CG  HIS B  19     -54.905 -13.241 -28.678  1.00  0.80           C
ATOM    138  ND1 HIS B  19     -54.055 -12.240 -28.246  1.00  0.80           N
ATOM    139  CD2 HIS B  19     -55.768 -12.754 -29.607  1.00  0.80           C
ATOM    140  CE1 HIS B  19     -54.417 -11.167 -28.921  1.00  0.80           C
ATOM    141  NE2 HIS B  19     -55.445 -11.422 -29.762  1.00  0.80           N
ATOM    142  N   PRO B  20     -51.802 -14.298 -29.636  1.00  0.84           N
ATOM    143  CA  PRO B  20     -50.428 -13.836 -29.519  1.00  0.84           C
ATOM    144  C   PRO B  20     -50.054 -13.209 -28.210  1.00  0.84           C
ATOM    145  O   PRO B  20     -48.889 -13.324 -27.841  1.00  0.84           O
ATOM    146  CB  PRO B  20     -50.250 -12.840 -30.660  1.00  0.84           C
ATOM    147  CG  PRO B  20     -51.658 -12.516 -31.159  1.00  0.84           C
ATOM    148  CD  PRO B  20     -52.422 -13.795 -30.857  1.00  0.84           C
ATOM    149  N   THR B  21     -50.974 -12.552 -27.489  1.00  0.77           N
ATOM    150  CA  THR B  21     -50.719 -12.243 -26.094  1.00  0.77           C
ATOM    151  C   THR B  21     -51.510 -13.215 -25.275  1.00  0.77           C
ATOM    152  O   THR B  21     -52.662 -13.490 -25.582  1.00  0.77           O
ATOM    153  CB  THR B  21     -50.977 -10.810 -25.658  1.00  0.77           C
ATOM    154  OG1 THR B  21     -52.293 -10.550 -25.193  1.00  0.77           O
ATOM    155  CG2 THR B  21     -50.788  -9.899 -26.852  1.00  0.77           C
ATOM    156  N   GLN B  22     -50.874 -13.788 -24.239  1.00  0.70           N
ATOM    157  CA  GLN B  22     -51.381 -14.868 -23.416  1.00  0.70           C
ATOM    158  C   GLN B  22     -50.911 -16.216 -23.936  1.00  0.70           C
ATOM    159  O   GLN B  22     -50.885 -17.193 -23.188  1.00  0.70           O
ATOM    160  CB  GLN B  22     -52.893 -14.805 -23.039  1.00  0.70           C
ATOM    161  CG  GLN B  22     -53.786 -15.704 -23.930  1.00  0.70           C
ATOM    162  CD  GLN B  22     -55.269 -15.337 -23.976  1.00  0.70           C
ATOM    163  OE1 GLN B  22     -55.920 -15.601 -24.987  1.00  0.70           O
ATOM    164  NE2 GLN B  22     -55.827 -14.760 -22.890  1.00  0.70           N
ATOM    165  N   ALA B  23     -50.429 -16.290 -25.197  1.00  0.79           N
ATOM    166  CA  ALA B  23     -49.510 -17.337 -25.599  1.00  0.79           C
ATOM    167  C   ALA B  23     -48.166 -17.309 -24.865  1.00  0.79           C
ATOM    168  O   ALA B  23     -47.613 -16.232 -24.628  1.00  0.79           O
ATOM    169  CB  ALA B  23     -49.205 -17.337 -27.105  1.00  0.79           C
ATOM    170  N   PRO B  24     -47.569 -18.447 -24.517  1.00  0.72           N
ATOM    171  CA  PRO B  24     -46.272 -18.454 -23.856  1.00  0.72           C
ATOM    172  C   PRO B  24     -45.156 -18.282 -24.858  1.00  0.72           C
ATOM    173  O   PRO B  24     -44.047 -17.953 -24.456  1.00  0.72           O
ATOM    174  CB  PRO B  24     -46.202 -19.845 -23.195  1.00  0.72           C
ATOM    175  CG  PRO B  24     -47.127 -20.719 -24.043  1.00  0.72           C
ATOM    176  CD  PRO B  24     -48.244 -19.743 -24.397  1.00  0.72           C
ATOM    177  N   THR B  25     -45.374 -18.552 -26.153  1.00  0.69           N
ATOM    178  CA  THR B  25     -44.305 -18.561 -27.137  1.00  0.69           C
ATOM    179  C   THR B  25     -44.905 -18.645 -28.530  1.00  0.69           C
ATOM    180  O   THR B  25     -46.096 -18.918 -28.671  1.00  0.69           O
ATOM    181  CB  THR B  25     -43.301 -19.665 -26.892  1.00  0.69           C
ATOM    182  OG1 THR B  25     -42.255 -19.628 -27.837  1.00  0.69           O
ATOM    183  CG2 THR B  25     -43.996 -21.016 -26.894  1.00  0.69           C
ATOM    184  N   HIS B  26     -44.105 -18.420 -29.600  1.00  0.68           N
ATOM    185  CA  HIS B  26     -44.528 -18.496 -30.995  1.00  0.68           C
ATOM    186  C   HIS B  26     -45.005 -19.874 -31.422  1.00  0.68           C
ATOM    187  O   HIS B  26     -45.910 -20.010 -32.239  1.00  0.68           O
ATOM    188  CB  HIS B  26     -43.402 -18.033 -31.947  1.00  0.68           C
ATOM    189  CG  HIS B  26     -43.792 -17.846 -33.386  1.00  0.68           C
ATOM    190  ND1 HIS B  26     -43.866 -18.941 -34.227  1.00  0.68           N
ATOM    191  CD2 HIS B  26     -43.982 -16.702 -34.090  1.00  0.68           C
ATOM    192  CE1 HIS B  26     -44.094 -18.441 -35.421  1.00  0.68           C
ATOM    193  NE2 HIS B  26     -44.172 -17.090 -35.400  1.00  0.68           N
ATOM    194  N   LEU B  27     -44.434 -20.951 -30.855  1.00  0.74           N
ATOM    195  CA  LEU B  27     -44.876 -22.307 -31.133  1.00  0.74           C
ATOM    196  C   LEU B  27     -46.348 -22.539 -30.750  1.00  0.74           C
ATOM    197  O   LEU B  27     -47.114 -23.133 -31.506  1.00  0.74           O
ATOM    198  CB  LEU B  27     -43.913 -23.308 -30.445  1.00  0.74           C
ATOM    199  CG  LEU B  27     -43.148 -24.276 -31.379  1.00  0.74           C
ATOM    200  CD1 LEU B  27     -44.076 -25.308 -32.032  1.00  0.74           C
ATOM    201  CD2 LEU B  27     -42.294 -23.542 -32.425  1.00  0.74           C
ATOM    202  N   SER B  28     -46.763 -21.998 -29.582  1.00  0.78           N
ATOM    203  CA  SER B  28     -48.125 -22.046 -29.041  1.00  0.78           C
ATOM    204  C   SER B  28     -49.175 -21.191 -29.740  1.00  0.78           C
ATOM    205  O   SER B  28     -50.365 -21.513 -29.706  1.00  0.78           O
ATOM    206  CB  SER B  28     -48.126 -21.632 -27.540  1.00  0.78           C
ATOM    207  OG  SER B  28     -49.394 -21.760 -26.889  1.00  0.78           O
ATOM    208  N   VAL B  29     -48.808 -20.056 -30.380  1.00  0.83           N
ATOM    209  CA  VAL B  29     -49.806 -19.193 -31.011  1.00  0.83           C
ATOM    210  C   VAL B  29     -50.586 -19.910 -32.108  1.00  0.83           C
ATOM    211  O   VAL B  29     -50.075 -20.798 -32.793  1.00  0.83           O
ATOM    212  CB  VAL B  29     -49.294 -17.852 -31.548  1.00  0.83           C
ATOM    213  CG1 VAL B  29     -48.468 -17.100 -30.495  1.00  0.83           C
ATOM    214  CG2 VAL B  29     -48.494 -18.046 -32.838  1.00  0.83           C
ATOM    215  N   ASP B  30     -51.875 -19.576 -32.281  1.00  0.89           N
ATOM    216  CA  ASP B  30     -52.699 -20.235 -33.267  1.00  0.89           C
ATOM    217  C   ASP B  30     -52.283 -19.938 -34.707  1.00  0.89           C
ATOM    218  O   ASP B  30     -51.640 -18.938 -35.027  1.00  0.89           O
ATOM    219  CB  ASP B  30     -54.196 -19.926 -33.016  1.00  0.89           C
ATOM    220  CG  ASP B  30     -55.140 -20.987 -33.557  1.00  0.89           C
ATOM    221  OD1 ASP B  30     -54.664 -22.004 -34.119  1.00  0.89           O
ATOM    222  OD2 ASP B  30     -56.369 -20.774 -33.452  1.00  0.89           O
ATOM    223  N   THR B  31     -52.678 -20.837 -35.626  1.00  0.87           N
ATOM    224  CA  THR B  31     -52.413 -20.793 -37.064  1.00  0.87           C
ATOM    225  C   THR B  31     -52.926 -19.512 -37.659  1.00  0.87           C
ATOM    226  O   THR B  31     -52.311 -18.903 -38.525  1.00  0.87           O
ATOM    227  CB  THR B  31     -53.092 -21.952 -37.789  1.00  0.87           C
ATOM    228  OG1 THR B  31     -52.510 -23.182 -37.380  1.00  0.87           O
ATOM    229  CG2 THR B  31     -52.984 -21.902 -39.323  1.00  0.87           C
ATOM    230  N   LYS B  32     -54.075 -19.052 -37.141  1.00  0.86           N
ATOM    231  CA  LYS B  32     -54.842 -17.926 -37.619  1.00  0.86           C
ATOM    232  C   LYS B  32     -54.074 -16.625 -37.543  1.00  0.86           C
ATOM    233  O   LYS B  32     -54.280 -15.719 -38.342  1.00  0.86           O
ATOM    234  CB  LYS B  32     -56.187 -17.820 -36.850  1.00  0.86           C
ATOM    235  CG  LYS B  32     -56.665 -19.159 -36.259  1.00  0.86           C
ATOM    236  CD  LYS B  32     -58.169 -19.441 -36.358  1.00  0.86           C
ATOM    237  CE  LYS B  32     -58.478 -20.877 -35.914  1.00  0.86           C
ATOM    238  NZ  LYS B  32     -59.888 -21.024 -35.504  1.00  0.86           N
ATOM    239  N   PHE B  33     -53.149 -16.522 -36.571  1.00  0.89           N
ATOM    240  CA  PHE B  33     -52.368 -15.329 -36.375  1.00  0.89           C
ATOM    241  C   PHE B  33     -50.979 -15.446 -37.002  1.00  0.89           C
ATOM    242  O   PHE B  33     -50.195 -14.509 -36.936  1.00  0.89           O
ATOM    243  CB  PHE B  33     -52.166 -15.053 -34.864  1.00  0.89           C
ATOM    244  CG  PHE B  33     -53.450 -15.048 -34.077  1.00  0.89           C
ATOM    245  CD1 PHE B  33     -53.924 -16.241 -33.508  1.00  0.89           C
ATOM    246  CD2 PHE B  33     -54.126 -13.850 -33.794  1.00  0.89           C
ATOM    247  CE1 PHE B  33     -55.043 -16.244 -32.667  1.00  0.89           C
ATOM    248  CE2 PHE B  33     -55.236 -13.846 -32.939  1.00  0.89           C
ATOM    249  CZ  PHE B  33     -55.698 -15.043 -32.379  1.00  0.89           C
ATOM    250  N   LYS B  34     -50.610 -16.589 -37.626  1.00  0.83           N
ATOM    251  CA  LYS B  34     -49.264 -16.793 -38.144  1.00  0.83           C
ATOM    252  C   LYS B  34     -49.187 -16.495 -39.627  1.00  0.83           C
ATOM    253  O   LYS B  34     -49.948 -17.011 -40.445  1.00  0.83           O
ATOM    254  CB  LYS B  34     -48.699 -18.219 -37.864  1.00  0.83           C
ATOM    255  CG  LYS B  34     -48.052 -18.348 -36.472  1.00  0.83           C
ATOM    256  CD  LYS B  34     -47.438 -19.734 -36.176  1.00  0.83           C
ATOM    257  CE  LYS B  34     -48.413 -20.632 -35.410  1.00  0.83           C
ATOM    258  NZ  LYS B  34     -47.898 -22.004 -35.210  1.00  0.83           N
ATOM    259  N   THR B  35     -48.226 -15.646 -40.024  1.00  0.89           N
ATOM    260  CA  THR B  35     -48.001 -15.350 -41.428  1.00  0.89           C
ATOM    261  C   THR B  35     -46.543 -15.049 -41.654  1.00  0.89           C
ATOM    262  O   THR B  35     -45.903 -14.359 -40.867  1.00  0.89           O
ATOM    263  CB  THR B  35     -48.875 -14.227 -41.974  1.00  0.89           C
ATOM    264  OG1 THR B  35     -48.697 -14.072 -43.376  1.00  0.89           O
ATOM    265  CG2 THR B  35     -48.589 -12.882 -41.290  1.00  0.89           C
ATOM    266  N   GLU B  36     -45.954 -15.614 -42.724  1.00  0.85           N
ATOM    267  CA  GLU B  36     -44.577 -15.356 -43.125  1.00  0.85           C
ATOM    268  C   GLU B  36     -43.493 -15.687 -42.091  1.00  0.85           C
ATOM    269  O   GLU B  36     -42.370 -15.197 -42.134  1.00  0.85           O
ATOM    270  CB  GLU B  36     -44.450 -13.905 -43.639  1.00  0.85           C
ATOM    271  CG  GLU B  36     -43.842 -13.802 -45.053  1.00  0.85           C
ATOM    272  CD  GLU B  36     -43.996 -12.390 -45.610  1.00  0.85           C
ATOM    273  OE1 GLU B  36     -43.093 -11.552 -45.364  1.00  0.85           O
ATOM    274  OE2 GLU B  36     -45.029 -12.145 -46.287  1.00  0.85           O
ATOM    275  N   GLY B  37     -43.805 -16.562 -41.110  1.00  0.88           N
ATOM    276  CA  GLY B  37     -42.897 -16.934 -40.024  1.00  0.88           C
ATOM    277  C   GLY B  37     -43.034 -16.018 -38.846  1.00  0.88           C
ATOM    278  O   GLY B  37     -42.534 -16.277 -37.757  1.00  0.88           O
ATOM    279  N   LEU B  38     -43.788 -14.936 -39.024  1.00  0.83           N
ATOM    280  CA  LEU B  38     -44.132 -13.981 -38.013  1.00  0.83           C
ATOM    281  C   LEU B  38     -45.468 -14.362 -37.427  1.00  0.83           C
ATOM    282  O   LEU B  38     -46.172 -15.267 -37.886  1.00  0.83           O
ATOM    283  CB  LEU B  38     -44.232 -12.550 -38.602  1.00  0.83           C
ATOM    284  CG  LEU B  38     -42.909 -11.761 -38.711  1.00  0.83           C
ATOM    285  CD1 LEU B  38     -42.405 -11.299 -37.340  1.00  0.83           C
ATOM    286  CD2 LEU B  38     -41.801 -12.504 -39.466  1.00  0.83           C
ATOM    287  N   CYS B  39     -45.839 -13.665 -36.355  1.00  0.80           N
ATOM    288  CA  CYS B  39     -47.174 -13.679 -35.823  1.00  0.80           C
ATOM    289  C   CYS B  39     -47.721 -12.273 -35.962  1.00  0.80           C
ATOM    290  O   CYS B  39     -46.983 -11.315 -36.168  1.00  0.80           O
ATOM    291  CB  CYS B  39     -47.161 -14.167 -34.359  1.00  0.80           C
ATOM    292  SG  CYS B  39     -48.819 -14.530 -33.699  1.00  0.80           S
ATOM    293  N   VAL B  40     -49.046 -12.105 -35.919  1.00  0.80           N
ATOM    294  CA  VAL B  40     -49.646 -10.813 -36.126  1.00  0.80           C
ATOM    295  C   VAL B  40     -50.912 -10.701 -35.314  1.00  0.80           C
ATOM    296  O   VAL B  40     -51.665 -11.662 -35.138  1.00  0.80           O
ATOM    297  CB  VAL B  40     -49.856 -10.500 -37.609  1.00  0.80           C
ATOM    298  CG1 VAL B  40     -50.922 -11.409 -38.250  1.00  0.80           C
ATOM    299  CG2 VAL B  40     -50.182  -9.008 -37.795  1.00  0.80           C
ATOM    300  N   ASP B  41     -51.165  -9.516 -34.730  1.00  0.78           N
ATOM    301  CA  ASP B  41     -52.429  -9.210 -34.103  1.00  0.78           C
ATOM    302  C   ASP B  41     -53.578  -9.139 -35.096  1.00  0.78           C
ATOM    303  O   ASP B  41     -53.464  -8.617 -36.206  1.00  0.78           O
ATOM    304  CB  ASP B  41     -52.348  -7.914 -33.267  1.00  0.78           C
ATOM    305  CG  ASP B  41     -53.614  -7.664 -32.460  1.00  0.78           C
ATOM    306  OD1 ASP B  41     -54.162  -8.675 -31.950  1.00  0.78           O
ATOM    307  OD2 ASP B  41     -54.022  -6.486 -32.339  1.00  0.78           O
ATOM    308  N   ILE B  42     -54.734  -9.658 -34.670  1.00  0.85           N
ATOM    309  CA  ILE B  42     -55.958  -9.541 -35.414  1.00  0.85           C
ATOM    310  C   ILE B  42     -57.032  -9.191 -34.412  1.00  0.85           C
ATOM    311  O   ILE B  42     -57.583 -10.109 -33.805  1.00  0.85           O
ATOM    312  CB  ILE B  42     -56.364 -10.822 -36.133  1.00  0.85           C
ATOM    313  CG1 ILE B  42     -55.321 -11.262 -37.181  1.00  0.85           C
ATOM    314  CG2 ILE B  42     -57.738 -10.596 -36.814  1.00  0.85           C
ATOM    315  CD1 ILE B  42     -55.459 -12.737 -37.562  1.00  0.85           C
ATOM    316  N   PRO B  43     -57.427  -7.927 -34.226  1.00  0.87           N
ATOM    317  CA  PRO B  43     -58.401  -7.541 -33.206  1.00  0.87           C
ATOM    318  C   PRO B  43     -59.723  -8.280 -33.312  1.00  0.87           C
ATOM    319  O   PRO B  43     -60.443  -8.387 -32.327  1.00  0.87           O
ATOM    320  CB  PRO B  43     -58.559  -6.025 -33.407  1.00  0.87           C
ATOM    321  CG  PRO B  43     -57.179  -5.573 -33.896  1.00  0.87           C
ATOM    322  CD  PRO B  43     -56.675  -6.763 -34.718  1.00  0.87           C
ATOM    323  N   GLY B  44     -60.061  -8.786 -34.519  1.00  0.78           N
ATOM    324  CA  GLY B  44     -61.322  -9.458 -34.783  1.00  0.78           C
ATOM    325  C   GLY B  44     -61.438 -10.893 -34.330  1.00  0.78           C
ATOM    326  O   GLY B  44     -62.536 -11.441 -34.322  1.00  0.78           O
ATOM    327  N   ILE B  45     -60.341 -11.554 -33.919  1.00  0.89           N
ATOM    328  CA  ILE B  45     -60.418 -12.906 -33.384  1.00  0.89           C
ATOM    329  C   ILE B  45     -59.970 -12.843 -31.926  1.00  0.89           C
ATOM    330  O   ILE B  45     -58.829 -12.478 -31.639  1.00  0.89           O
ATOM    331  CB  ILE B  45     -59.670 -13.954 -34.210  1.00  0.89           C
ATOM    332  CG1 ILE B  45     -59.645 -15.321 -33.489  1.00  0.89           C
ATOM    333  CG2 ILE B  45     -58.264 -13.458 -34.572  1.00  0.89           C
ATOM    334  CD1 ILE B  45     -59.188 -16.480 -34.372  1.00  0.89           C
ATOM    335  N   PRO B  46     -60.833 -13.116 -30.948  1.00  0.87           N
ATOM    336  CA  PRO B  46     -60.583 -12.702 -29.582  1.00  0.87           C
ATOM    337  C   PRO B  46     -59.686 -13.668 -28.844  1.00  0.87           C
ATOM    338  O   PRO B  46     -59.654 -14.863 -29.127  1.00  0.87           O
ATOM    339  CB  PRO B  46     -61.982 -12.698 -28.952  1.00  0.87           C
ATOM    340  CG  PRO B  46     -62.698 -13.837 -29.677  1.00  0.87           C
ATOM    341  CD  PRO B  46     -62.172 -13.691 -31.104  1.00  0.87           C
ATOM    342  N   LYS B  47     -58.931 -13.134 -27.877  1.00  0.79           N
ATOM    343  CA  LYS B  47     -58.250 -13.885 -26.848  1.00  0.79           C
ATOM    344  C   LYS B  47     -59.210 -14.615 -25.918  1.00  0.79           C
ATOM    345  O   LYS B  47     -60.291 -14.111 -25.612  1.00  0.79           O
ATOM    346  CB  LYS B  47     -57.327 -12.953 -26.013  1.00  0.79           C
ATOM    347  CG  LYS B  47     -57.234 -11.511 -26.534  1.00  0.79           C
ATOM    348  CD  LYS B  47     -56.291 -10.633 -25.699  1.00  0.79           C
ATOM    349  CE  LYS B  47     -56.927 -10.110 -24.411  1.00  0.79           C
ATOM    350  NZ  LYS B  47     -56.059  -9.080 -23.809  1.00  0.79           N
ATOM    351  N   ASP B  48     -58.828 -15.804 -25.416  1.00  0.82           N
ATOM    352  CA  ASP B  48     -59.612 -16.548 -24.456  1.00  0.82           C
ATOM    353  C   ASP B  48     -59.777 -15.788 -23.128  1.00  0.82           C
ATOM    354  O   ASP B  48     -58.810 -15.384 -22.482  1.00  0.82           O
ATOM    355  CB  ASP B  48     -58.925 -17.892 -24.141  1.00  0.82           C
ATOM    356  CG  ASP B  48     -58.703 -18.746 -25.375  1.00  0.82           C
ATOM    357  OD1 ASP B  48     -57.536 -18.801 -25.844  1.00  0.82           O
ATOM    358  OD2 ASP B  48     -59.677 -19.401 -25.820  1.00  0.82           O
ATOM    359  N   MET B  49     -61.026 -15.559 -22.684  1.00  0.81           N
ATOM    360  CA  MET B  49     -61.390 -14.888 -21.442  1.00  0.81           C
ATOM    361  C   MET B  49     -61.078 -15.724 -20.229  1.00  0.81           C
ATOM    362  O   MET B  49     -60.727 -15.231 -19.160  1.00  0.81           O
ATOM    363  CB  MET B  49     -62.905 -14.547 -21.374  1.00  0.81           C
ATOM    364  CG  MET B  49     -63.504 -14.292 -22.763  1.00  0.81           C
ATOM    365  SD  MET B  49     -63.898 -15.862 -23.624  1.00  0.81           S
ATOM    366  CE  MET B  49     -63.953 -15.140 -25.267  1.00  0.81           C
ATOM    367  N   THR B  50     -61.268 -17.037 -20.388  1.00  0.88           N
ATOM    368  CA  THR B  50     -61.086 -18.031 -19.360  1.00  0.88           C
ATOM    369  C   THR B  50     -60.628 -19.270 -20.078  1.00  0.88           C
ATOM    370  O   THR B  50     -61.184 -19.663 -21.100  1.00  0.88           O
ATOM    371  CB  THR B  50     -62.344 -18.308 -18.531  1.00  0.88           C
ATOM    372  OG1 THR B  50     -62.195 -19.448 -17.688  1.00  0.88           O
ATOM    373  CG2 THR B  50     -63.573 -18.511 -19.433  1.00  0.88           C
ATOM    374  N   TYR B  51     -59.569 -19.906 -19.567  1.00  0.89           N
ATOM    375  CA  TYR B  51     -59.070 -21.131 -20.126  1.00  0.89           C
ATOM    376  C   TYR B  51     -58.196 -21.750 -19.077  1.00  0.89           C
ATOM    377  O   TYR B  51     -57.688 -21.051 -18.199  1.00  0.89           O
ATOM    378  CB  TYR B  51     -58.286 -20.973 -21.471  1.00  0.89           C
ATOM    379  CG  TYR B  51     -56.962 -20.230 -21.386  1.00  0.89           C
ATOM    380  CD1 TYR B  51     -56.902 -18.840 -21.488  1.00  0.89           C
ATOM    381  CD2 TYR B  51     -55.754 -20.929 -21.262  1.00  0.89           C
ATOM    382  CE1 TYR B  51     -55.669 -18.170 -21.499  1.00  0.89           C
ATOM    383  CE2 TYR B  51     -54.510 -20.272 -21.296  1.00  0.89           C
ATOM    384  CZ  TYR B  51     -54.465 -18.876 -21.414  1.00  0.89           C
ATOM    385  OH  TYR B  51     -53.232 -18.168 -21.452  1.00  0.89           O
ATOM    386  N   ARG B  52     -57.985 -23.071 -19.149  1.00  0.83           N
ATOM    387  CA  ARG B  52     -57.037 -23.720 -18.283  1.00  0.83           C
ATOM    388  C   ARG B  52     -56.228 -24.679 -19.116  1.00  0.83           C
ATOM    389  O   ARG B  52     -56.780 -25.535 -19.804  1.00  0.83           O
ATOM    390  CB  ARG B  52     -57.711 -24.493 -17.128  1.00  0.83           C
ATOM    391  CG  ARG B  52     -58.375 -23.599 -16.061  1.00  0.83           C
ATOM    392  CD  ARG B  52     -58.076 -24.002 -14.611  1.00  0.83           C
ATOM    393  NE  ARG B  52     -58.505 -25.414 -14.402  1.00  0.83           N
ATOM    394  CZ  ARG B  52     -58.339 -26.116 -13.276  1.00  0.83           C
ATOM    395  NH1 ARG B  52     -57.801 -25.584 -12.189  1.00  0.83           N
ATOM    396  NH2 ARG B  52     -58.677 -27.400 -13.239  1.00  0.83           N
ATOM    397  N   ARG B  53     -54.890 -24.556 -19.105  1.00  0.82           N
ATOM    398  CA  ARG B  53     -54.057 -25.470 -19.864  1.00  0.82           C
ATOM    399  C   ARG B  53     -53.018 -26.105 -18.969  1.00  0.82           C
ATOM    400  O   ARG B  53     -52.212 -25.433 -18.340  1.00  0.82           O
ATOM    401  CB  ARG B  53     -53.369 -24.797 -21.079  1.00  0.82           C
ATOM    402  CG  ARG B  53     -54.353 -24.295 -22.156  1.00  0.82           C
ATOM    403  CD  ARG B  53     -53.664 -23.745 -23.402  1.00  0.82           C
ATOM    404  NE  ARG B  53     -54.688 -23.085 -24.291  1.00  0.82           N
ATOM    405  CZ  ARG B  53     -54.804 -23.344 -25.600  1.00  0.82           C
ATOM    406  NH1 ARG B  53     -54.083 -24.294 -26.189  1.00  0.82           N
ATOM    407  NH2 ARG B  53     -55.665 -22.648 -26.339  1.00  0.82           N
ATOM    408  N   LEU B  54     -53.030 -27.448 -18.871  1.00  0.93           N
ATOM    409  CA  LEU B  54     -52.066 -28.191 -18.086  1.00  0.93           C
ATOM    410  C   LEU B  54     -50.741 -28.245 -18.811  1.00  0.93           C
ATOM    411  O   LEU B  54     -50.668 -28.709 -19.948  1.00  0.93           O
ATOM    412  CB  LEU B  54     -52.562 -29.639 -17.857  1.00  0.93           C
ATOM    413  CG  LEU B  54     -51.643 -30.594 -17.064  1.00  0.93           C
ATOM    414  CD1 LEU B  54     -51.441 -30.111 -15.623  1.00  0.93           C
ATOM    415  CD2 LEU B  54     -52.229 -32.016 -17.093  1.00  0.93           C
ATOM    416  N   ILE B  55     -49.662 -27.782 -18.163  1.00  0.85           N
ATOM    417  CA  ILE B  55     -48.348 -27.835 -18.762  1.00  0.85           C
ATOM    418  C   ILE B  55     -47.501 -28.971 -18.211  1.00  0.85           C
ATOM    419  O   ILE B  55     -47.331 -29.170 -17.006  1.00  0.85           O
ATOM    420  CB  ILE B  55     -47.586 -26.536 -18.631  1.00  0.85           C
ATOM    421  CG1 ILE B  55     -48.307 -25.342 -19.282  1.00  0.85           C
ATOM    422  CG2 ILE B  55     -46.246 -26.706 -19.352  1.00  0.85           C
ATOM    423  CD1 ILE B  55     -48.654 -25.518 -20.765  1.00  0.85           C
ATOM    424  N   SER B  56     -46.932 -29.775 -19.125  1.00  0.86           N
ATOM    425  CA  SER B  56     -46.001 -30.847 -18.840  1.00  0.86           C
ATOM    426  C   SER B  56     -44.666 -30.425 -18.264  1.00  0.86           C
ATOM    427  O   SER B  56     -43.867 -29.750 -18.909  1.00  0.86           O
ATOM    428  CB  SER B  56     -45.683 -31.588 -20.158  1.00  0.86           C
ATOM    429  OG  SER B  56     -44.884 -32.756 -20.013  1.00  0.86           O
ATOM    430  N   MET B  57     -44.342 -30.897 -17.057  1.00  0.81           N
ATOM    431  CA  MET B  57     -43.025 -30.736 -16.492  1.00  0.81           C
ATOM    432  C   MET B  57     -42.288 -32.029 -16.706  1.00  0.81           C
ATOM    433  O   MET B  57     -42.153 -32.755 -15.740  1.00  0.81           O
ATOM    434  CB  MET B  57     -43.140 -30.443 -14.969  1.00  0.81           C
ATOM    435  CG  MET B  57     -43.780 -29.076 -14.640  1.00  0.81           C
ATOM    436  SD  MET B  57     -42.758 -27.630 -15.047  1.00  0.81           S
ATOM    437  CE  MET B  57     -43.915 -26.372 -14.438  1.00  0.81           C
ATOM    438  N   MET B  58     -41.837 -32.404 -17.923  1.00  0.82           N
ATOM    439  CA  MET B  58     -41.202 -33.698 -18.152  1.00  0.82           C
ATOM    440  C   MET B  58     -39.956 -33.559 -18.982  1.00  0.82           C
ATOM    441  O   MET B  58     -39.915 -32.831 -19.968  1.00  0.82           O
ATOM    442  CB  MET B  58     -42.081 -34.766 -18.856  1.00  0.82           C
ATOM    443  CG  MET B  58     -43.324 -35.207 -18.060  1.00  0.82           C
ATOM    444  SD  MET B  58     -43.879 -36.927 -18.327  1.00  0.82           S
ATOM    445  CE  MET B  58     -43.550 -37.100 -20.104  1.00  0.82           C
ATOM    446  N   GLY B  59     -38.885 -34.292 -18.610  1.00  0.77           N
ATOM    447  CA  GLY B  59     -37.659 -34.259 -19.391  1.00  0.77           C
ATOM    448  C   GLY B  59     -36.898 -33.015 -19.096  1.00  0.77           C
ATOM    449  O   GLY B  59     -36.381 -32.370 -19.997  1.00  0.77           O
ATOM    450  N   PHE B  60     -36.835 -32.647 -17.801  1.00  0.82           N
ATOM    451  CA  PHE B  60     -36.317 -31.374 -17.341  1.00  0.82           C
ATOM    452  C   PHE B  60     -34.897 -31.034 -17.804  1.00  0.82           C
ATOM    453  O   PHE B  60     -34.585 -29.868 -18.021  1.00  0.82           O
ATOM    454  CB  PHE B  60     -36.481 -31.276 -15.798  1.00  0.82           C
ATOM    455  CG  PHE B  60     -37.457 -30.207 -15.391  1.00  0.82           C
ATOM    456  CD1 PHE B  60     -37.279 -28.878 -15.797  1.00  0.82           C
ATOM    457  CD2 PHE B  60     -38.547 -30.513 -14.564  1.00  0.82           C
ATOM    458  CE1 PHE B  60     -38.163 -27.871 -15.400  1.00  0.82           C
ATOM    459  CE2 PHE B  60     -39.443 -29.514 -14.167  1.00  0.82           C
ATOM    460  CZ  PHE B  60     -39.251 -28.194 -14.588  1.00  0.82           C
ATOM    461  N   LYS B  61     -34.022 -32.054 -17.993  1.00  0.77           N
ATOM    462  CA  LYS B  61     -32.825 -31.977 -18.835  1.00  0.77           C
ATOM    463  C   LYS B  61     -31.904 -30.794 -18.554  1.00  0.77           C
ATOM    464  O   LYS B  61     -31.552 -30.008 -19.433  1.00  0.77           O
ATOM    465  CB  LYS B  61     -33.155 -32.071 -20.357  1.00  0.77           C
ATOM    466  CG  LYS B  61     -32.041 -32.670 -21.240  1.00  0.77           C
ATOM    467  CD  LYS B  61     -32.322 -32.541 -22.751  1.00  0.77           C
ATOM    468  CE  LYS B  61     -31.497 -33.513 -23.604  1.00  0.77           C
ATOM    469  NZ  LYS B  61     -32.132 -34.854 -23.623  1.00  0.77           N
ATOM    470  N   MET B  62     -31.499 -30.627 -17.287  1.00  0.73           N
ATOM    471  CA  MET B  62     -30.738 -29.475 -16.878  1.00  0.73           C
ATOM    472  C   MET B  62     -29.257 -29.785 -16.740  1.00  0.73           C
ATOM    473  O   MET B  62     -28.775 -30.417 -15.801  1.00  0.73           O
ATOM    474  CB  MET B  62     -31.350 -28.854 -15.608  1.00  0.73           C
ATOM    475  CG  MET B  62     -31.627 -29.862 -14.479  1.00  0.73           C
ATOM    476  SD  MET B  62     -32.686 -29.236 -13.147  1.00  0.73           S
ATOM    477  CE  MET B  62     -32.143 -27.513 -13.042  1.00  0.73           C
ATOM    478  N   ASN B  63     -28.495 -29.300 -17.732  1.00  0.78           N
ATOM    479  CA  ASN B  63     -27.049 -29.321 -17.778  1.00  0.78           C
ATOM    480  C   ASN B  63     -26.599 -27.912 -18.145  1.00  0.78           C
ATOM    481  O   ASN B  63     -26.856 -27.405 -19.235  1.00  0.78           O
ATOM    482  CB  ASN B  63     -26.474 -30.394 -18.754  1.00  0.78           C
ATOM    483  CG  ASN B  63     -27.337 -30.611 -19.997  1.00  0.78           C
ATOM    484  OD1 ASN B  63     -27.870 -31.689 -20.246  1.00  0.78           O
ATOM    485  ND2 ASN B  63     -27.484 -29.543 -20.809  1.00  0.78           N
ATOM    486  N   TYR B  64     -25.934 -27.224 -17.215  1.00  0.73           N
ATOM    487  CA  TYR B  64     -25.591 -25.834 -17.371  1.00  0.73           C
ATOM    488  C   TYR B  64     -24.399 -25.554 -16.478  1.00  0.73           C
ATOM    489  O   TYR B  64     -24.214 -26.213 -15.457  1.00  0.73           O
ATOM    490  CB  TYR B  64     -26.784 -24.866 -17.073  1.00  0.73           C
ATOM    491  CG  TYR B  64     -27.336 -24.999 -15.677  1.00  0.73           C
ATOM    492  CD1 TYR B  64     -28.137 -26.098 -15.333  1.00  0.73           C
ATOM    493  CD2 TYR B  64     -27.063 -24.030 -14.698  1.00  0.73           C
ATOM    494  CE1 TYR B  64     -28.606 -26.258 -14.026  1.00  0.73           C
ATOM    495  CE2 TYR B  64     -27.537 -24.185 -13.389  1.00  0.73           C
ATOM    496  CZ  TYR B  64     -28.304 -25.304 -13.052  1.00  0.73           C
ATOM    497  OH  TYR B  64     -28.770 -25.464 -11.735  1.00  0.73           O
ATOM    498  N   GLN B  65     -23.561 -24.572 -16.849  1.00  0.78           N
ATOM    499  CA  GLN B  65     -22.465 -24.117 -16.022  1.00  0.78           C
ATOM    500  C   GLN B  65     -22.661 -22.633 -15.775  1.00  0.78           C
ATOM    501  O   GLN B  65     -22.834 -21.843 -16.701  1.00  0.78           O
ATOM    502  CB  GLN B  65     -21.080 -24.360 -16.685  1.00  0.78           C
ATOM    503  CG  GLN B  65     -20.478 -25.779 -16.484  1.00  0.78           C
ATOM    504  CD  GLN B  65     -20.183 -26.124 -15.023  1.00  0.78           C
ATOM    505  OE1 GLN B  65     -20.621 -27.149 -14.498  1.00  0.78           O
ATOM    506  NE2 GLN B  65     -19.394 -25.259 -14.351  1.00  0.78           N
ATOM    507  N   VAL B  66     -22.663 -22.217 -14.500  1.00  0.80           N
ATOM    508  CA  VAL B  66     -22.678 -20.822 -14.120  1.00  0.80           C
ATOM    509  C   VAL B  66     -21.725 -20.724 -12.975  1.00  0.80           C
ATOM    510  O   VAL B  66     -21.863 -21.472 -12.014  1.00  0.80           O
ATOM    511  CB  VAL B  66     -24.032 -20.303 -13.638  1.00  0.80           C
ATOM    512  CG1 VAL B  66     -23.930 -18.807 -13.278  1.00  0.80           C
ATOM    513  CG2 VAL B  66     -25.117 -20.501 -14.707  1.00  0.80           C
ATOM    514  N   ASN B  67     -20.740 -19.807 -13.014  1.00  0.68           N
ATOM    515  CA  ASN B  67     -19.660 -19.740 -12.042  1.00  0.68           C
ATOM    516  C   ASN B  67     -20.127 -19.697 -10.588  1.00  0.68           C
ATOM    517  O   ASN B  67     -19.507 -20.287  -9.711  1.00  0.68           O
ATOM    518  CB  ASN B  67     -18.759 -18.505 -12.319  1.00  0.68           C
ATOM    519  CG  ASN B  67     -17.963 -18.691 -13.609  1.00  0.68           C
ATOM    520  OD1 ASN B  67     -18.483 -19.107 -14.644  1.00  0.68           O
ATOM    521  ND2 ASN B  67     -16.652 -18.360 -13.560  1.00  0.68           N
ATOM    522  N   GLY B  68     -21.253 -19.007 -10.310  1.00  0.77           N
ATOM    523  CA  GLY B  68     -21.835 -18.980  -8.975  1.00  0.77           C
ATOM    524  C   GLY B  68     -22.753 -20.119  -8.591  1.00  0.77           C
ATOM    525  O   GLY B  68     -23.137 -20.207  -7.433  1.00  0.77           O
ATOM    526  N   TYR B  69     -23.148 -21.030  -9.500  1.00  0.73           N
ATOM    527  CA  TYR B  69     -24.180 -22.019  -9.201  1.00  0.73           C
ATOM    528  C   TYR B  69     -23.554 -23.404  -9.208  1.00  0.73           C
ATOM    529  O   TYR B  69     -22.897 -23.758 -10.186  1.00  0.73           O
ATOM    530  CB  TYR B  69     -25.379 -22.022 -10.196  1.00  0.73           C
ATOM    531  CG  TYR B  69     -26.194 -20.769 -10.031  1.00  0.73           C
ATOM    532  CD1 TYR B  69     -27.426 -20.731  -9.356  1.00  0.73           C
ATOM    533  CD2 TYR B  69     -25.671 -19.570 -10.510  1.00  0.73           C
ATOM    534  CE1 TYR B  69     -28.081 -19.507  -9.149  1.00  0.73           C
ATOM    535  CE2 TYR B  69     -26.305 -18.351 -10.298  1.00  0.73           C
ATOM    536  CZ  TYR B  69     -27.514 -18.317  -9.606  1.00  0.73           C
ATOM    537  OH  TYR B  69     -28.180 -17.102  -9.400  1.00  0.73           O
ATOM    538  N   PRO B  70     -23.698 -24.220  -8.171  1.00  0.84           N
ATOM    539  CA  PRO B  70     -23.118 -25.553  -8.131  1.00  0.84           C
ATOM    540  C   PRO B  70     -23.871 -26.552  -8.993  1.00  0.84           C
ATOM    541  O   PRO B  70     -25.082 -26.457  -9.182  1.00  0.84           O
ATOM    542  CB  PRO B  70     -23.227 -25.924  -6.647  1.00  0.84           C
ATOM    543  CG  PRO B  70     -24.528 -25.252  -6.215  1.00  0.84           C
ATOM    544  CD  PRO B  70     -24.474 -23.928  -6.964  1.00  0.84           C
ATOM    545  N   ASN B  71     -23.138 -27.523  -9.556  1.00  0.86           N
ATOM    546  CA  ASN B  71     -23.658 -28.620 -10.341  1.00  0.86           C
ATOM    547  C   ASN B  71     -24.630 -29.505  -9.552  1.00  0.86           C
ATOM    548  O   ASN B  71     -24.271 -30.052  -8.515  1.00  0.86           O
ATOM    549  CB  ASN B  71     -22.501 -29.551 -10.824  1.00  0.86           C
ATOM    550  CG  ASN B  71     -21.288 -28.836 -11.431  1.00  0.86           C
ATOM    551  OD1 ASN B  71     -20.954 -27.681 -11.163  1.00  0.86           O
ATOM    552  ND2 ASN B  71     -20.539 -29.599 -12.260  1.00  0.86           N
ATOM    553  N   MET B  72     -25.880 -29.707 -10.030  1.00  0.85           N
ATOM    554  CA  MET B  72     -26.822 -30.607  -9.368  1.00  0.85           C
ATOM    555  C   MET B  72     -26.444 -32.076  -9.466  1.00  0.85           C
ATOM    556  O   MET B  72     -26.711 -32.881  -8.576  1.00  0.85           O
ATOM    557  CB  MET B  72     -28.266 -30.448  -9.893  1.00  0.85           C
ATOM    558  CG  MET B  72     -28.701 -28.981  -9.984  1.00  0.85           C
ATOM    559  SD  MET B  72     -30.455 -28.710 -10.372  1.00  0.85           S
ATOM    560  CE  MET B  72     -31.303 -30.080  -9.535  1.00  0.85           C
ATOM    561  N   PHE B  73     -25.813 -32.467 -10.584  1.00  0.90           N
ATOM    562  CA  PHE B  73     -25.340 -33.821 -10.778  1.00  0.90           C
ATOM    563  C   PHE B  73     -23.863 -33.903 -10.465  1.00  0.90           C
ATOM    564  O   PHE B  73     -23.073 -33.038 -10.842  1.00  0.90           O
ATOM    565  CB  PHE B  73     -25.578 -34.339 -12.217  1.00  0.90           C
ATOM    566  CG  PHE B  73     -26.970 -34.885 -12.350  1.00  0.90           C
ATOM    567  CD1 PHE B  73     -28.066 -34.025 -12.527  1.00  0.90           C
ATOM    568  CD2 PHE B  73     -27.196 -36.270 -12.270  1.00  0.90           C
ATOM    569  CE1 PHE B  73     -29.368 -34.534 -12.581  1.00  0.90           C
ATOM    570  CE2 PHE B  73     -28.495 -36.786 -12.337  1.00  0.90           C
ATOM    571  CZ  PHE B  73     -29.581 -35.914 -12.479  1.00  0.90           C
ATOM    572  N   ILE B  74     -23.471 -34.970  -9.754  1.00  0.92           N
ATOM    573  CA  ILE B  74     -22.121 -35.144  -9.254  1.00  0.92           C
ATOM    574  C   ILE B  74     -21.406 -36.266  -9.991  1.00  0.92           C
ATOM    575  O   ILE B  74     -22.012 -37.146 -10.595  1.00  0.92           O
ATOM    576  CB  ILE B  74     -22.117 -35.394  -7.750  1.00  0.92           C
ATOM    577  CG1 ILE B  74     -22.943 -36.645  -7.379  1.00  0.92           C
ATOM    578  CG2 ILE B  74     -22.653 -34.128  -7.053  1.00  0.92           C
ATOM    579  CD1 ILE B  74     -23.033 -36.888  -5.873  1.00  0.92           C
ATOM    580  N   THR B  75     -20.060 -36.272 -10.001  1.00  0.89           N
ATOM    581  CA  THR B  75     -19.252 -37.350 -10.582  1.00  0.89           C
ATOM    582  C   THR B  75     -19.425 -38.664  -9.822  1.00  0.89           C
ATOM    583  O   THR B  75     -19.737 -38.658  -8.636  1.00  0.89           O
ATOM    584  CB  THR B  75     -17.747 -37.046 -10.636  1.00  0.89           C
ATOM    585  OG1 THR B  75     -17.501 -35.661 -10.449  1.00  0.89           O
ATOM    586  CG2 THR B  75     -17.160 -37.426 -12.004  1.00  0.89           C
ATOM    587  N   ARG B  76     -19.168 -39.847 -10.450  1.00  0.80           N
ATOM    588  CA  ARG B  76     -19.176 -41.147  -9.754  1.00  0.80           C
ATOM    589  C   ARG B  76     -18.265 -41.115  -8.532  1.00  0.80           C
ATOM    590  O   ARG B  76     -18.676 -41.531  -7.455  1.00  0.80           O
ATOM    591  CB  ARG B  76     -18.741 -42.320 -10.710  1.00  0.80           C
ATOM    592  CG  ARG B  76     -18.227 -43.663 -10.087  1.00  0.80           C
ATOM    593  CD  ARG B  76     -19.234 -44.776  -9.681  1.00  0.80           C
ATOM    594  NE  ARG B  76     -19.393 -45.800 -10.794  1.00  0.80           N
ATOM    595  CZ  ARG B  76     -19.541 -47.129 -10.656  1.00  0.80           C
ATOM    596  NH1 ARG B  76     -19.631 -47.910 -11.736  1.00  0.80           N
ATOM    597  NH2 ARG B  76     -19.581 -47.762  -9.489  1.00  0.80           N
ATOM    598  N   GLU B  77     -17.041 -40.559  -8.672  1.00  0.82           N
ATOM    599  CA  GLU B  77     -16.099 -40.325  -7.595  1.00  0.82           C
ATOM    600  C   GLU B  77     -16.620 -39.396  -6.512  1.00  0.82           C
ATOM    601  O   GLU B  77     -16.481 -39.674  -5.328  1.00  0.82           O
ATOM    602  CB  GLU B  77     -14.801 -39.705  -8.146  1.00  0.82           C
ATOM    603  CG  GLU B  77     -13.694 -39.476  -7.084  1.00  0.82           C
ATOM    604  CD  GLU B  77     -12.663 -38.464  -7.565  1.00  0.82           C
ATOM    605  OE1 GLU B  77     -12.186 -38.590  -8.714  1.00  0.82           O
ATOM    606  OE2 GLU B  77     -12.415 -37.506  -6.780  1.00  0.82           O
ATOM    607  N   GLU B  78     -17.264 -38.265  -6.881  1.00  0.85           N
ATOM    608  CA  GLU B  78     -17.779 -37.336  -5.890  1.00  0.85           C
ATOM    609  C   GLU B  78     -18.864 -37.973  -5.042  1.00  0.85           C
ATOM    610  O   GLU B  78     -18.860 -37.868  -3.819  1.00  0.85           O
ATOM    611  CB  GLU B  78     -18.232 -35.992  -6.494  1.00  0.85           C
ATOM    612  CG  GLU B  78     -18.553 -34.957  -5.382  1.00  0.85           C
ATOM    613  CD  GLU B  78     -18.851 -33.541  -5.866  1.00  0.85           C
ATOM    614  OE1 GLU B  78     -19.108 -32.680  -4.972  1.00  0.85           O
ATOM    615  OE2 GLU B  78     -18.798 -33.307  -7.096  1.00  0.85           O
ATOM    616  N   ALA B  79     -19.749 -38.773  -5.662  1.00  0.93           N
ATOM    617  CA  ALA B  79     -20.701 -39.603  -4.955  1.00  0.93           C
ATOM    618  C   ALA B  79     -20.065 -40.576  -3.959  1.00  0.93           C
ATOM    619  O   ALA B  79     -20.598 -40.774  -2.874  1.00  0.93           O
ATOM    620  CB  ALA B  79     -21.615 -40.326  -5.961  1.00  0.93           C
ATOM    621  N   ILE B  80     -18.880 -41.155  -4.259  1.00  0.86           N
ATOM    622  CA  ILE B  80     -18.104 -41.968  -3.315  1.00  0.86           C
ATOM    623  C   ILE B  80     -17.688 -41.181  -2.087  1.00  0.86           C
ATOM    624  O   ILE B  80     -17.671 -41.676  -0.969  1.00  0.86           O
ATOM    625  CB  ILE B  80     -16.826 -42.552  -3.928  1.00  0.86           C
ATOM    626  CG1 ILE B  80     -17.073 -43.202  -5.296  1.00  0.86           C
ATOM    627  CG2 ILE B  80     -16.178 -43.597  -3.002  1.00  0.86           C
ATOM    628  CD1 ILE B  80     -18.258 -44.160  -5.330  1.00  0.86           C
ATOM    629  N   ARG B  81     -17.323 -39.907  -2.287  1.00  0.79           N
ATOM    630  CA  ARG B  81     -16.849 -39.012  -1.259  1.00  0.79           C
ATOM    631  C   ARG B  81     -17.892 -38.705  -0.194  1.00  0.79           C
ATOM    632  O   ARG B  81     -17.594 -38.656   0.996  1.00  0.79           O
ATOM    633  CB  ARG B  81     -16.297 -37.746  -1.952  1.00  0.79           C
ATOM    634  CG  ARG B  81     -15.068 -37.111  -1.281  1.00  0.79           C
ATOM    635  CD  ARG B  81     -14.575 -35.851  -2.009  1.00  0.79           C
ATOM    636  NE  ARG B  81     -14.215 -36.202  -3.430  1.00  0.79           N
ATOM    637  CZ  ARG B  81     -14.511 -35.451  -4.499  1.00  0.79           C
ATOM    638  NH1 ARG B  81     -15.130 -34.281  -4.377  1.00  0.79           N
ATOM    639  NH2 ARG B  81     -14.185 -35.869  -5.719  1.00  0.79           N
ATOM    640  N   HIS B  82     -19.160 -38.524  -0.605  1.00  0.85           N
ATOM    641  CA  HIS B  82     -20.244 -38.256   0.316  1.00  0.85           C
ATOM    642  C   HIS B  82     -21.228 -39.410   0.410  1.00  0.85           C
ATOM    643  O   HIS B  82     -22.258 -39.406  -0.260  1.00  0.85           O
ATOM    644  CB  HIS B  82     -21.039 -37.011  -0.134  1.00  0.85           C
ATOM    645  CG  HIS B  82     -20.215 -35.760  -0.205  1.00  0.85           C
ATOM    646  ND1 HIS B  82     -19.536 -35.459  -1.369  1.00  0.85           N
ATOM    647  CD2 HIS B  82     -20.001 -34.792   0.722  1.00  0.85           C
ATOM    648  CE1 HIS B  82     -18.918 -34.324  -1.131  1.00  0.85           C
ATOM    649  NE2 HIS B  82     -19.165 -33.874   0.122  1.00  0.85           N
ATOM    650  N   VAL B  83     -21.002 -40.411   1.285  1.00  0.86           N
ATOM    651  CA  VAL B  83     -21.925 -41.537   1.413  1.00  0.86           C
ATOM    652  C   VAL B  83     -22.797 -41.393   2.656  1.00  0.86           C
ATOM    653  O   VAL B  83     -22.378 -40.945   3.712  1.00  0.86           O
ATOM    654  CB  VAL B  83     -21.244 -42.893   1.392  1.00  0.86           C
ATOM    655  CG1 VAL B  83     -22.255 -44.039   1.219  1.00  0.86           C
ATOM    656  CG2 VAL B  83     -20.305 -42.992   0.190  1.00  0.86           C
ATOM    657  N   ARG B  84     -24.104 -41.692   2.516  1.00  0.63           N
ATOM    658  CA  ARG B  84     -25.147 -41.324   3.468  1.00  0.63           C
ATOM    659  C   ARG B  84     -25.445 -39.841   3.486  1.00  0.63           C
ATOM    660  O   ARG B  84     -26.244 -39.358   4.285  1.00  0.63           O
ATOM    661  CB  ARG B  84     -25.084 -41.912   4.895  1.00  0.63           C
ATOM    662  CG  ARG B  84     -26.344 -42.719   5.287  1.00  0.63           C
ATOM    663  CD  ARG B  84     -27.685 -42.001   5.069  1.00  0.63           C
ATOM    664  NE  ARG B  84     -28.746 -42.829   5.715  1.00  0.63           N
ATOM    665  CZ  ARG B  84     -29.274 -43.942   5.197  1.00  0.63           C
ATOM    666  NH1 ARG B  84     -29.010 -44.338   3.956  1.00  0.63           N
ATOM    667  NH2 ARG B  84     -30.076 -44.680   5.962  1.00  0.63           N
ATOM    668  N   ALA B  85     -24.936 -39.118   2.478  1.00  0.89           N
ATOM    669  CA  ALA B  85     -25.745 -38.163   1.764  1.00  0.89           C
ATOM    670  C   ALA B  85     -26.729 -38.929   0.881  1.00  0.89           C
ATOM    671  O   ALA B  85     -27.804 -38.442   0.552  1.00  0.89           O
ATOM    672  CB  ALA B  85     -24.842 -37.260   0.914  1.00  0.89           C
ATOM    673  N   TRP B  86     -26.363 -40.185   0.534  1.00  0.89           N
ATOM    674  CA  TRP B  86     -27.115 -41.143  -0.253  1.00  0.89           C
ATOM    675  C   TRP B  86     -28.476 -41.518   0.306  1.00  0.89           C
ATOM    676  O   TRP B  86     -28.598 -42.227   1.316  1.00  0.89           O
ATOM    677  CB  TRP B  86     -26.341 -42.479  -0.485  1.00  0.89           C
ATOM    678  CG  TRP B  86     -25.056 -42.396  -1.308  1.00  0.89           C
ATOM    679  CD1 TRP B  86     -24.256 -41.317  -1.547  1.00  0.89           C
ATOM    680  CD2 TRP B  86     -24.470 -43.492  -2.031  1.00  0.89           C
ATOM    681  NE1 TRP B  86     -23.241 -41.652  -2.397  1.00  0.89           N
ATOM    682  CE2 TRP B  86     -23.349 -42.963  -2.736  1.00  0.89           C
ATOM    683  CE3 TRP B  86     -24.808 -44.833  -2.151  1.00  0.89           C
ATOM    684  CZ2 TRP B  86     -22.591 -43.758  -3.573  1.00  0.89           C
ATOM    685  CZ3 TRP B  86     -23.998 -45.643  -2.951  1.00  0.89           C
ATOM    686  CH2 TRP B  86     -22.921 -45.112  -3.677  1.00  0.89           C
ATOM    687  N   ILE B  87     -29.524 -41.098  -0.421  1.00  0.92           N
ATOM    688  CA  ILE B  87     -30.898 -41.497  -0.214  1.00  0.92           C
ATOM    689  C   ILE B  87     -31.441 -41.950  -1.551  1.00  0.92           C
ATOM    690  O   ILE B  87     -31.215 -41.315  -2.579  1.00  0.92           O
ATOM    691  CB  ILE B  87     -31.784 -40.414   0.389  1.00  0.92           C
ATOM    692  CG1 ILE B  87     -30.927 -39.234   0.894  1.00  0.92           C
ATOM    693  CG2 ILE B  87     -32.597 -41.084   1.516  1.00  0.92           C
ATOM    694  CD1 ILE B  87     -31.706 -38.191   1.681  1.00  0.92           C
ATOM    695  N   GLY B  88     -32.128 -43.102  -1.610  1.00  0.96           N
ATOM    696  CA  GLY B  88     -32.683 -43.610  -2.860  1.00  0.96           C
ATOM    697  C   GLY B  88     -33.933 -42.864  -3.197  1.00  0.96           C
ATOM    698  O   GLY B  88     -34.648 -42.443  -2.300  1.00  0.96           O
ATOM    699  N   PHE B  89     -34.231 -42.692  -4.492  1.00  0.92           N
ATOM    700  CA  PHE B  89     -35.424 -41.981  -4.900  1.00  0.92           C
ATOM    701  C   PHE B  89     -35.986 -42.638  -6.138  1.00  0.92           C
ATOM    702  O   PHE B  89     -35.254 -42.932  -7.089  1.00  0.92           O
ATOM    703  CB  PHE B  89     -35.130 -40.464  -5.109  1.00  0.92           C
ATOM    704  CG  PHE B  89     -36.335 -39.548  -5.142  1.00  0.92           C
ATOM    705  CD1 PHE B  89     -37.488 -39.751  -4.359  1.00  0.92           C
ATOM    706  CD2 PHE B  89     -36.266 -38.385  -5.928  1.00  0.92           C
ATOM    707  CE1 PHE B  89     -38.562 -38.853  -4.419  1.00  0.92           C
ATOM    708  CE2 PHE B  89     -37.340 -37.494  -6.002  1.00  0.92           C
ATOM    709  CZ  PHE B  89     -38.496 -37.736  -5.257  1.00  0.92           C
ATOM    710  N   ASP B  90     -37.291 -42.919  -6.113  1.00  0.93           N
ATOM    711  CA  ASP B  90     -38.061 -43.448  -7.211  1.00  0.93           C
ATOM    712  C   ASP B  90     -39.501 -42.999  -6.962  1.00  0.93           C
ATOM    713  O   ASP B  90     -39.965 -42.985  -5.818  1.00  0.93           O
ATOM    714  CB  ASP B  90     -37.896 -44.980  -7.285  1.00  0.93           C
ATOM    715  CG  ASP B  90     -38.556 -45.530  -8.536  1.00  0.93           C
ATOM    716  OD1 ASP B  90     -37.805 -45.934  -9.457  1.00  0.93           O
ATOM    717  OD2 ASP B  90     -39.810 -45.545  -8.567  1.00  0.93           O
ATOM    718  N   VAL B  91     -40.226 -42.544  -7.997  1.00  0.93           N
ATOM    719  CA  VAL B  91     -41.553 -41.994  -7.828  1.00  0.93           C
ATOM    720  C   VAL B  91     -42.561 -42.589  -8.792  1.00  0.93           C
ATOM    721  O   VAL B  91     -42.600 -42.278  -9.984  1.00  0.93           O
ATOM    722  CB  VAL B  91     -41.549 -40.473  -7.975  1.00  0.93           C
ATOM    723  CG1 VAL B  91     -42.966 -39.907  -7.783  1.00  0.93           C
ATOM    724  CG2 VAL B  91     -40.636 -39.838  -6.911  1.00  0.93           C
ATOM    725  N   GLU B  92     -43.501 -43.396  -8.279  1.00  0.89           N
ATOM    726  CA  GLU B  92     -44.671 -43.825  -9.019  1.00  0.89           C
ATOM    727  C   GLU B  92     -45.549 -42.650  -9.445  1.00  0.89           C
ATOM    728  O   GLU B  92     -45.753 -41.694  -8.693  1.00  0.89           O
ATOM    729  CB  GLU B  92     -45.495 -44.807  -8.176  1.00  0.89           C
ATOM    730  CG  GLU B  92     -44.872 -46.224  -8.127  1.00  0.89           C
ATOM    731  CD  GLU B  92     -45.208 -47.084  -9.351  1.00  0.89           C
ATOM    732  OE1 GLU B  92     -45.965 -48.067  -9.167  1.00  0.89           O
ATOM    733  OE2 GLU B  92     -44.770 -46.758 -10.484  1.00  0.89           O
ATOM    734  N   GLY B  93     -46.085 -42.691 -10.684  1.00  0.95           N
ATOM    735  CA  GLY B  93     -46.807 -41.568 -11.280  1.00  0.95           C
ATOM    736  C   GLY B  93     -48.231 -41.819 -11.695  1.00  0.95           C
ATOM    737  O   GLY B  93     -48.783 -42.913 -11.587  1.00  0.95           O
ATOM    738  N   CYS B  94     -48.874 -40.762 -12.209  1.00  0.93           N
ATOM    739  CA  CYS B  94     -50.226 -40.815 -12.705  1.00  0.93           C
ATOM    740  C   CYS B  94     -50.406 -39.825 -13.834  1.00  0.93           C
ATOM    741  O   CYS B  94     -49.839 -38.735 -13.823  1.00  0.93           O
ATOM    742  CB  CYS B  94     -51.244 -40.532 -11.570  1.00  0.93           C
ATOM    743  SG  CYS B  94     -50.956 -38.973 -10.655  1.00  0.93           S
ATOM    744  N   HIS B  95     -51.214 -40.170 -14.856  1.00  0.88           N
ATOM    745  CA  HIS B  95     -51.353 -39.325 -16.031  1.00  0.88           C
ATOM    746  C   HIS B  95     -52.708 -38.681 -16.045  1.00  0.88           C
ATOM    747  O   HIS B  95     -53.718 -39.362 -15.857  1.00  0.88           O
ATOM    748  CB  HIS B  95     -51.234 -40.071 -17.388  1.00  0.88           C
ATOM    749  CG  HIS B  95     -50.567 -41.392 -17.279  1.00  0.88           C
ATOM    750  ND1 HIS B  95     -49.240 -41.536 -17.610  1.00  0.88           N
ATOM    751  CD2 HIS B  95     -51.067 -42.555 -16.796  1.00  0.88           C
ATOM    752  CE1 HIS B  95     -48.946 -42.780 -17.306  1.00  0.88           C
ATOM    753  NE2 HIS B  95     -50.018 -43.440 -16.812  1.00  0.88           N
ATOM    754  N   ALA B  96     -52.801 -37.376 -16.337  1.00  0.92           N
ATOM    755  CA  ALA B  96     -54.083 -36.735 -16.561  1.00  0.92           C
ATOM    756  C   ALA B  96     -54.968 -37.393 -17.641  1.00  0.92           C
ATOM    757  O   ALA B  96     -54.503 -37.911 -18.660  1.00  0.92           O
ATOM    758  CB  ALA B  96     -53.906 -35.229 -16.819  1.00  0.92           C
ATOM    759  N   THR B  97     -56.295 -37.452 -17.376  1.00  0.84           N
ATOM    760  CA  THR B  97     -57.248 -38.141 -18.255  1.00  0.84           C
ATOM    761  C   THR B  97     -58.264 -37.199 -18.848  1.00  0.84           C
ATOM    762  O   THR B  97     -58.699 -37.372 -19.984  1.00  0.84           O
ATOM    763  CB  THR B  97     -58.102 -39.219 -17.569  1.00  0.84           C
ATOM    764  OG1 THR B  97     -57.335 -39.908 -16.607  1.00  0.84           O
ATOM    765  CG2 THR B  97     -58.593 -40.279 -18.573  1.00  0.84           C
ATOM    766  N   ARG B  98     -58.712 -36.179 -18.089  1.00  0.81           N
ATOM    767  CA  ARG B  98     -59.990 -35.537 -18.365  1.00  0.81           C
ATOM    768  C   ARG B  98     -59.854 -34.150 -18.967  1.00  0.81           C
ATOM    769  O   ARG B  98     -60.027 -34.016 -20.175  1.00  0.81           O
ATOM    770  CB  ARG B  98     -60.893 -35.545 -17.107  1.00  0.81           C
ATOM    771  CG  ARG B  98     -62.360 -35.143 -17.365  1.00  0.81           C
ATOM    772  CD  ARG B  98     -63.286 -35.273 -16.142  1.00  0.81           C
ATOM    773  NE  ARG B  98     -63.607 -36.724 -15.902  1.00  0.81           N
ATOM    774  CZ  ARG B  98     -64.601 -37.388 -16.516  1.00  0.81           C
ATOM    775  NH1 ARG B  98     -65.331 -36.824 -17.472  1.00  0.81           N
ATOM    776  NH2 ARG B  98     -64.870 -38.643 -16.159  1.00  0.81           N
ATOM    777  N   GLU B  99     -59.543 -33.109 -18.154  1.00  0.85           N
ATOM    778  CA  GLU B  99     -59.361 -31.715 -18.563  1.00  0.85           C
ATOM    779  C   GLU B  99     -58.194 -31.566 -19.540  1.00  0.85           C
ATOM    780  O   GLU B  99     -58.195 -30.746 -20.458  1.00  0.85           O
ATOM    781  CB  GLU B  99     -59.184 -30.842 -17.283  1.00  0.85           C
ATOM    782  CG  GLU B  99     -59.155 -29.301 -17.448  1.00  0.85           C
ATOM    783  CD  GLU B  99     -59.087 -28.597 -16.108  1.00  0.85           C
ATOM    784  OE1 GLU B  99     -59.002 -27.344 -16.112  1.00  0.85           O
ATOM    785  OE2 GLU B  99     -59.115 -29.264 -15.043  1.00  0.85           O
ATOM    786  N   ALA B 100     -57.173 -32.430 -19.385  1.00  0.90           N
ATOM    787  CA  ALA B 100     -55.977 -32.413 -20.180  1.00  0.90           C
ATOM    788  C   ALA B 100     -55.379 -33.816 -20.239  1.00  0.90           C
ATOM    789  O   ALA B 100     -55.744 -34.683 -19.436  1.00  0.90           O
ATOM    790  CB  ALA B 100     -55.022 -31.404 -19.527  1.00  0.90           C
ATOM    791  N   VAL B 101     -54.489 -34.104 -21.205  1.00  0.91           N
ATOM    792  CA  VAL B 101     -53.886 -35.407 -21.429  1.00  0.91           C
ATOM    793  C   VAL B 101     -52.449 -35.249 -21.842  1.00  0.91           C
ATOM    794  O   VAL B 101     -52.116 -34.403 -22.708  1.00  0.91           O
ATOM    795  CB  VAL B 101     -54.623 -36.236 -22.496  1.00  0.91           C
ATOM    796  CG1 VAL B 101     -53.761 -37.382 -23.075  1.00  0.91           C
ATOM    797  CG2 VAL B 101     -55.891 -36.846 -21.875  1.00  0.91           C
ATOM    798  N   GLY B 102     -51.527 -36.079 -21.349  1.00  0.92           N
ATOM    799  CA  GLY B 102     -50.209 -36.234 -21.947  1.00  0.92           C
ATOM    800  C   GLY B 102     -49.007 -36.015 -21.081  1.00  0.92           C
ATOM    801  O   GLY B 102     -47.892 -36.203 -21.555  1.00  0.92           O
ATOM    802  N   THR B 103     -49.191 -35.762 -19.774  1.00  0.93           N
ATOM    803  CA  THR B 103     -48.058 -35.617 -18.863  1.00  0.93           C
ATOM    804  C   THR B 103     -48.290 -36.506 -17.664  1.00  0.93           C
ATOM    805  O   THR B 103     -49.397 -37.007 -17.459  1.00  0.93           O
ATOM    806  CB  THR B 103     -47.770 -34.182 -18.411  1.00  0.93           C
ATOM    807  OG1 THR B 103     -46.556 -34.091 -17.675  1.00  0.93           O
ATOM    808  CG2 THR B 103     -48.917 -33.655 -17.539  1.00  0.93           C
ATOM    809  N   ASN B 104     -47.236 -36.712 -16.857  1.00  0.92           N
ATOM    810  CA  ASN B 104     -47.235 -37.514 -15.657  1.00  0.92           C
ATOM    811  C   ASN B 104     -47.068 -36.580 -14.473  1.00  0.92           C
ATOM    812  O   ASN B 104     -46.369 -35.570 -14.525  1.00  0.92           O
ATOM    813  CB  ASN B 104     -46.062 -38.535 -15.617  1.00  0.92           C
ATOM    814  CG  ASN B 104     -46.507 -39.956 -15.920  1.00  0.92           C
ATOM    815  OD1 ASN B 104     -47.223 -40.594 -15.129  1.00  0.92           O
ATOM    816  ND2 ASN B 104     -46.090 -40.486 -17.078  1.00  0.92           N
ATOM    817  N   LEU B 105     -47.739 -36.920 -13.369  1.00  0.94           N
ATOM    818  CA  LEU B 105     -47.757 -36.176 -12.137  1.00  0.94           C
ATOM    819  C   LEU B 105     -47.240 -37.136 -11.067  1.00  0.94           C
ATOM    820  O   LEU B 105     -47.518 -38.333 -11.184  1.00  0.94           O
ATOM    821  CB  LEU B 105     -49.215 -35.758 -11.819  1.00  0.94           C
ATOM    822  CG  LEU B 105     -49.946 -35.047 -12.983  1.00  0.94           C
ATOM    823  CD1 LEU B 105     -51.458 -35.275 -12.886  1.00  0.94           C
ATOM    824  CD2 LEU B 105     -49.654 -33.546 -13.069  1.00  0.94           C
ATOM    825  N   PRO B 106     -46.464 -36.753 -10.057  1.00  0.96           N
ATOM    826  CA  PRO B 106     -46.109 -37.638  -8.944  1.00  0.96           C
ATOM    827  C   PRO B 106     -47.297 -38.182  -8.148  1.00  0.96           C
ATOM    828  O   PRO B 106     -48.118 -37.390  -7.695  1.00  0.96           O
ATOM    829  CB  PRO B 106     -45.201 -36.767  -8.058  1.00  0.96           C
ATOM    830  CG  PRO B 106     -45.638 -35.329  -8.351  1.00  0.96           C
ATOM    831  CD  PRO B 106     -46.014 -35.377  -9.830  1.00  0.96           C
ATOM    832  N   LEU B 107     -47.390 -39.517  -7.933  1.00  0.93           N
ATOM    833  CA  LEU B 107     -48.384 -40.110  -7.045  1.00  0.93           C
ATOM    834  C   LEU B 107     -47.760 -40.603  -5.748  1.00  0.93           C
ATOM    835  O   LEU B 107     -48.084 -40.116  -4.668  1.00  0.93           O
ATOM    836  CB  LEU B 107     -49.135 -41.285  -7.722  1.00  0.93           C
ATOM    837  CG  LEU B 107     -50.212 -41.981  -6.855  1.00  0.93           C
ATOM    838  CD1 LEU B 107     -51.208 -40.980  -6.255  1.00  0.93           C
ATOM    839  CD2 LEU B 107     -50.953 -43.023  -7.696  1.00  0.93           C
ATOM    840  N   GLN B 108     -46.832 -41.585  -5.807  1.00  0.90           N
ATOM    841  CA  GLN B 108     -46.205 -42.143  -4.614  1.00  0.90           C
ATOM    842  C   GLN B 108     -44.707 -41.957  -4.677  1.00  0.90           C
ATOM    843  O   GLN B 108     -44.026 -42.441  -5.572  1.00  0.90           O
ATOM    844  CB  GLN B 108     -46.518 -43.649  -4.376  1.00  0.90           C
ATOM    845  CG  GLN B 108     -45.869 -44.244  -3.094  1.00  0.90           C
ATOM    846  CD  GLN B 108     -46.154 -45.737  -2.925  1.00  0.90           C
ATOM    847  OE1 GLN B 108     -45.674 -46.589  -3.675  1.00  0.90           O
ATOM    848  NE2 GLN B 108     -46.948 -46.092  -1.892  1.00  0.90           N
ATOM    849  N   LEU B 109     -44.152 -41.241  -3.693  1.00  0.93           N
ATOM    850  CA  LEU B 109     -42.755 -40.896  -3.622  1.00  0.93           C
ATOM    851  C   LEU B 109     -42.049 -41.823  -2.651  1.00  0.93           C
ATOM    852  O   LEU B 109     -42.329 -41.836  -1.449  1.00  0.93           O
ATOM    853  CB  LEU B 109     -42.553 -39.428  -3.167  1.00  0.93           C
ATOM    854  CG  LEU B 109     -42.972 -38.352  -4.191  1.00  0.93           C
ATOM    855  CD1 LEU B 109     -44.496 -38.163  -4.253  1.00  0.93           C
ATOM    856  CD2 LEU B 109     -42.313 -37.014  -3.839  1.00  0.93           C
ATOM    857  N   GLY B 110     -41.116 -42.639  -3.180  1.00  0.94           N
ATOM    858  CA  GLY B 110     -40.416 -43.652  -2.419  1.00  0.94           C
ATOM    859  C   GLY B 110     -38.968 -43.364  -2.199  1.00  0.94           C
ATOM    860  O   GLY B 110     -38.283 -42.773  -3.033  1.00  0.94           O
ATOM    861  N   PHE B 111     -38.458 -43.827  -1.050  1.00  0.89           N
ATOM    862  CA  PHE B 111     -37.149 -43.489  -0.550  1.00  0.89           C
ATOM    863  C   PHE B 111     -36.420 -44.732  -0.087  1.00  0.89           C
ATOM    864  O   PHE B 111     -37.015 -45.786   0.090  1.00  0.89           O
ATOM    865  CB  PHE B 111     -37.250 -42.506   0.640  1.00  0.89           C
ATOM    866  CG  PHE B 111     -37.733 -41.166   0.174  1.00  0.89           C
ATOM    867  CD1 PHE B 111     -36.802 -40.184  -0.196  1.00  0.89           C
ATOM    868  CD2 PHE B 111     -39.105 -40.868   0.108  1.00  0.89           C
ATOM    869  CE1 PHE B 111     -37.232 -38.924  -0.625  1.00  0.89           C
ATOM    870  CE2 PHE B 111     -39.537 -39.612  -0.334  1.00  0.89           C
ATOM    871  CZ  PHE B 111     -38.600 -38.639  -0.701  1.00  0.89           C
ATOM    872  N   SER B 112     -35.085 -44.660   0.121  1.00  0.89           N
ATOM    873  CA  SER B 112     -34.323 -45.800   0.628  1.00  0.89           C
ATOM    874  C   SER B 112     -34.612 -46.107   2.083  1.00  0.89           C
ATOM    875  O   SER B 112     -34.387 -47.210   2.573  1.00  0.89           O
ATOM    876  CB  SER B 112     -32.788 -45.616   0.474  1.00  0.89           C
ATOM    877  OG  SER B 112     -32.346 -44.328   0.932  1.00  0.89           O
ATOM    878  N   THR B 113     -35.114 -45.113   2.821  1.00  0.88           N
ATOM    879  CA  THR B 113     -35.807 -45.252   4.088  1.00  0.88           C
ATOM    880  C   THR B 113     -37.159 -45.895   3.860  1.00  0.88           C
ATOM    881  O   THR B 113     -37.753 -45.744   2.804  1.00  0.88           O
ATOM    882  CB  THR B 113     -36.014 -43.904   4.779  1.00  0.88           C
ATOM    883  OG1 THR B 113     -35.146 -42.914   4.234  1.00  0.88           O
ATOM    884  CG2 THR B 113     -35.681 -44.038   6.267  1.00  0.88           C
ATOM    885  N   GLY B 114     -37.751 -46.609   4.841  1.00  0.90           N
ATOM    886  CA  GLY B 114     -38.966 -47.390   4.571  1.00  0.90           C
ATOM    887  C   GLY B 114     -40.228 -46.571   4.439  1.00  0.90           C
ATOM    888  O   GLY B 114     -41.331 -47.095   4.310  1.00  0.90           O
ATOM    889  N   VAL B 115     -40.086 -45.244   4.508  1.00  0.88           N
ATOM    890  CA  VAL B 115     -41.112 -44.262   4.284  1.00  0.88           C
ATOM    891  C   VAL B 115     -41.702 -44.272   2.876  1.00  0.88           C
ATOM    892  O   VAL B 115     -41.027 -44.521   1.878  1.00  0.88           O
ATOM    893  CB  VAL B 115     -40.646 -42.849   4.634  1.00  0.88           C
ATOM    894  CG1 VAL B 115     -39.845 -42.822   5.947  1.00  0.88           C
ATOM    895  CG2 VAL B 115     -39.760 -42.251   3.531  1.00  0.88           C
ATOM    896  N   ASN B 116     -43.003 -43.956   2.765  1.00  0.89           N
ATOM    897  CA  ASN B 116     -43.644 -43.705   1.491  1.00  0.89           C
ATOM    898  C   ASN B 116     -44.539 -42.506   1.682  1.00  0.89           C
ATOM    899  O   ASN B 116     -45.354 -42.462   2.604  1.00  0.89           O
ATOM    900  CB  ASN B 116     -44.503 -44.894   0.979  1.00  0.89           C
ATOM    901  CG  ASN B 116     -43.618 -45.882   0.237  1.00  0.89           C
ATOM    902  OD1 ASN B 116     -43.184 -45.605  -0.887  1.00  0.89           O
ATOM    903  ND2 ASN B 116     -43.326 -47.049   0.845  1.00  0.89           N
ATOM    904  N   LEU B 117     -44.413 -41.496   0.810  1.00  0.93           N
ATOM    905  CA  LEU B 117     -45.285 -40.343   0.852  1.00  0.93           C
ATOM    906  C   LEU B 117     -46.127 -40.385  -0.397  1.00  0.93           C
ATOM    907  O   LEU B 117     -45.638 -40.639  -1.493  1.00  0.93           O
ATOM    908  CB  LEU B 117     -44.534 -38.991   0.943  1.00  0.93           C
ATOM    909  CG  LEU B 117     -43.710 -38.805   2.236  1.00  0.93           C
ATOM    910  CD1 LEU B 117     -42.799 -37.585   2.109  1.00  0.93           C
ATOM    911  CD2 LEU B 117     -44.573 -38.671   3.499  1.00  0.93           C
ATOM    912  N   VAL B 118     -47.440 -40.174  -0.258  1.00  0.94           N
ATOM    913  CA  VAL B 118     -48.365 -40.193  -1.368  1.00  0.94           C
ATOM    914  C   VAL B 118     -48.978 -38.815  -1.466  1.00  0.94           C
ATOM    915  O   VAL B 118     -49.291 -38.181  -0.457  1.00  0.94           O
ATOM    916  CB  VAL B 118     -49.402 -41.314  -1.266  1.00  0.94           C
ATOM    917  CG1 VAL B 118     -49.949 -41.436   0.168  1.00  0.94           C
ATOM    918  CG2 VAL B 118     -50.537 -41.109  -2.288  1.00  0.94           C
ATOM    919  N   ALA B 119     -49.094 -38.291  -2.696  1.00  0.95           N
ATOM    920  CA  ALA B 119     -49.591 -36.970  -2.968  1.00  0.95           C
ATOM    921  C   ALA B 119     -50.834 -37.052  -3.832  1.00  0.95           C
ATOM    922  O   ALA B 119     -50.959 -37.922  -4.692  1.00  0.95           O
ATOM    923  CB  ALA B 119     -48.529 -36.140  -3.702  1.00  0.95           C
ATOM    924  N   VAL B 120     -51.815 -36.142  -3.641  1.00  0.91           N
ATOM    925  CA  VAL B 120     -52.903 -36.021  -4.601  1.00  0.91           C
ATOM    926  C   VAL B 120     -52.394 -35.507  -5.934  1.00  0.91           C
ATOM    927  O   VAL B 120     -51.479 -34.694  -5.896  1.00  0.91           O
ATOM    928  CB  VAL B 120     -54.037 -35.109  -4.159  1.00  0.91           C
ATOM    929  CG1 VAL B 120     -54.848 -35.797  -3.053  1.00  0.91           C
ATOM    930  CG2 VAL B 120     -53.498 -33.742  -3.700  1.00  0.91           C
ATOM    931  N   PRO B 121     -52.892 -35.891  -7.113  1.00  0.94           N
ATOM    932  CA  PRO B 121     -52.395 -35.392  -8.392  1.00  0.94           C
ATOM    933  C   PRO B 121     -52.391 -33.880  -8.477  1.00  0.94           C
ATOM    934  O   PRO B 121     -53.459 -33.266  -8.438  1.00  0.94           O
ATOM    935  CB  PRO B 121     -53.351 -36.004  -9.434  1.00  0.94           C
ATOM    936  CG  PRO B 121     -53.913 -37.253  -8.752  1.00  0.94           C
ATOM    937  CD  PRO B 121     -53.961 -36.865  -7.278  1.00  0.94           C
ATOM    938  N   THR B 122     -51.211 -33.261  -8.630  1.00  0.94           N
ATOM    939  CA  THR B 122     -51.103 -31.814  -8.738  1.00  0.94           C
ATOM    940  C   THR B 122     -50.185 -31.447  -9.880  1.00  0.94           C
ATOM    941  O   THR B 122     -49.172 -32.094 -10.154  1.00  0.94           O
ATOM    942  CB  THR B 122     -50.684 -31.028  -7.485  1.00  0.94           C
ATOM    943  OG1 THR B 122     -49.335 -31.262  -7.128  1.00  0.94           O
ATOM    944  CG2 THR B 122     -51.534 -31.376  -6.254  1.00  0.94           C
ATOM    945  N   GLY B 123     -50.557 -30.386 -10.616  1.00  0.94           N
ATOM    946  CA  GLY B 123     -49.807 -29.935 -11.775  1.00  0.94           C
ATOM    947  C   GLY B 123     -49.812 -28.445 -11.903  1.00  0.94           C
ATOM    948  O   GLY B 123     -50.385 -27.718 -11.096  1.00  0.94           O
ATOM    949  N   TYR B 124     -49.174 -27.945 -12.970  1.00  0.86           N
ATOM    950  CA  TYR B 124     -49.051 -26.527 -13.222  1.00  0.86           C
ATOM    951  C   TYR B 124     -50.011 -26.193 -14.351  1.00  0.86           C
ATOM    952  O   TYR B 124     -49.963 -26.794 -15.424  1.00  0.86           O
ATOM    953  CB  TYR B 124     -47.593 -26.151 -13.607  1.00  0.86           C
ATOM    954  CG  TYR B 124     -46.661 -26.146 -12.414  1.00  0.86           C
ATOM    955  CD1 TYR B 124     -46.196 -27.341 -11.829  1.00  0.86           C
ATOM    956  CD2 TYR B 124     -46.174 -24.924 -11.914  1.00  0.86           C
ATOM    957  CE1 TYR B 124     -45.269 -27.312 -10.774  1.00  0.86           C
ATOM    958  CE2 TYR B 124     -45.259 -24.892 -10.854  1.00  0.86           C
ATOM    959  CZ  TYR B 124     -44.811 -26.084 -10.283  1.00  0.86           C
ATOM    960  OH  TYR B 124     -43.945 -26.023  -9.175  1.00  0.86           O
ATOM    961  N   VAL B 125     -50.955 -25.264 -14.100  1.00  0.87           N
ATOM    962  CA  VAL B 125     -52.030 -24.959 -15.028  1.00  0.87           C
ATOM    963  C   VAL B 125     -52.076 -23.468 -15.379  1.00  0.87           C
ATOM    964  O   VAL B 125     -52.180 -22.602 -14.509  1.00  0.87           O
ATOM    965  CB  VAL B 125     -53.371 -25.436 -14.464  1.00  0.87           C
ATOM    966  CG1 VAL B 125     -54.524 -25.045 -15.403  1.00  0.87           C
ATOM    967  CG2 VAL B 125     -53.346 -26.972 -14.285  1.00  0.87           C
ATOM    968  N   ASP B 126     -52.011 -23.128 -16.685  1.00  0.81           N
ATOM    969  CA  ASP B 126     -51.992 -21.765 -17.195  1.00  0.81           C
ATOM    970  C   ASP B 126     -53.392 -21.173 -17.306  1.00  0.81           C
ATOM    971  O   ASP B 126     -54.297 -21.791 -17.870  1.00  0.81           O
ATOM    972  CB  ASP B 126     -51.417 -21.676 -18.641  1.00  0.81           C
ATOM    973  CG  ASP B 126     -49.924 -21.934 -18.694  1.00  0.81           C
ATOM    974  OD1 ASP B 126     -49.457 -22.844 -17.979  1.00  0.81           O
ATOM    975  OD2 ASP B 126     -49.248 -21.182 -19.450  1.00  0.81           O
ATOM    976  N   THR B 127     -53.582 -19.930 -16.817  1.00  0.77           N
ATOM    977  CA  THR B 127     -54.827 -19.169 -16.897  1.00  0.77           C
ATOM    978  C   THR B 127     -54.544 -17.821 -17.564  1.00  0.77           C
ATOM    979  O   THR B 127     -53.385 -17.549 -17.871  1.00  0.77           O
ATOM    980  CB  THR B 127     -55.448 -18.914 -15.528  1.00  0.77           C
ATOM    981  OG1 THR B 127     -54.518 -18.241 -14.695  1.00  0.77           O
ATOM    982  CG2 THR B 127     -55.818 -20.256 -14.884  1.00  0.77           C
ATOM    983  N   PRO B 128     -55.480 -16.911 -17.873  1.00  0.72           N
ATOM    984  CA  PRO B 128     -55.115 -15.645 -18.504  1.00  0.72           C
ATOM    985  C   PRO B 128     -54.214 -14.765 -17.671  1.00  0.72           C
ATOM    986  O   PRO B 128     -53.471 -13.985 -18.259  1.00  0.72           O
ATOM    987  CB  PRO B 128     -56.436 -14.947 -18.837  1.00  0.72           C
ATOM    988  CG  PRO B 128     -57.433 -16.097 -18.992  1.00  0.72           C
ATOM    989  CD  PRO B 128     -56.875 -17.250 -18.145  1.00  0.72           C
ATOM    990  N   ASN B 129     -54.275 -14.828 -16.336  1.00  0.58           N
ATOM    991  CA  ASN B 129     -53.519 -13.953 -15.458  1.00  0.58           C
ATOM    992  C   ASN B 129     -52.191 -14.530 -15.006  1.00  0.58           C
ATOM    993  O   ASN B 129     -51.220 -13.796 -14.832  1.00  0.58           O
ATOM    994  CB  ASN B 129     -54.350 -13.541 -14.207  1.00  0.58           C
ATOM    995  CG  ASN B 129     -55.508 -14.491 -13.909  1.00  0.58           C
ATOM    996  OD1 ASN B 129     -55.334 -15.665 -13.595  1.00  0.58           O
ATOM    997  ND2 ASN B 129     -56.753 -13.985 -14.031  1.00  0.58           N
ATOM    998  N   ASN B 130     -52.118 -15.851 -14.793  1.00  0.67           N
ATOM    999  CA  ASN B 130     -50.942 -16.468 -14.225  1.00  0.67           C
ATOM   1000  C   ASN B 130     -50.805 -17.935 -14.568  1.00  0.67           C
ATOM   1001  O   ASN B 130     -51.540 -18.516 -15.365  1.00  0.67           O
ATOM   1002  CB  ASN B 130     -50.804 -16.245 -12.693  1.00  0.67           C
ATOM   1003  CG  ASN B 130     -52.037 -16.668 -11.904  1.00  0.67           C
ATOM   1004  OD1 ASN B 130     -52.928 -17.389 -12.350  1.00  0.67           O
ATOM   1005  ND2 ASN B 130     -52.089 -16.201 -10.640  1.00  0.67           N
ATOM   1006  N   THR B 131     -49.762 -18.538 -13.995  1.00  0.72           N
ATOM   1007  CA  THR B 131     -49.536 -19.967 -13.956  1.00  0.72           C
ATOM   1008  C   THR B 131     -49.801 -20.409 -12.546  1.00  0.72           C
ATOM   1009  O   THR B 131     -49.184 -19.907 -11.610  1.00  0.72           O
ATOM   1010  CB  THR B 131     -48.115 -20.390 -14.307  1.00  0.72           C
ATOM   1011  OG1 THR B 131     -47.249 -19.263 -14.418  1.00  0.72           O
ATOM   1012  CG2 THR B 131     -48.165 -21.063 -15.675  1.00  0.72           C
ATOM   1013  N   ASP B 132     -50.741 -21.349 -12.359  1.00  0.83           N
ATOM   1014  CA  ASP B 132     -51.281 -21.657 -11.055  1.00  0.83           C
ATOM   1015  C   ASP B 132     -51.056 -23.130 -10.702  1.00  0.83           C
ATOM   1016  O   ASP B 132     -51.321 -24.048 -11.483  1.00  0.83           O
ATOM   1017  CB  ASP B 132     -52.777 -21.259 -11.059  1.00  0.83           C
ATOM   1018  CG  ASP B 132     -53.405 -21.330  -9.678  1.00  0.83           C
ATOM   1019  OD1 ASP B 132     -52.670 -21.602  -8.696  1.00  0.83           O
ATOM   1020  OD2 ASP B 132     -54.641 -21.117  -9.599  1.00  0.83           O
ATOM   1021  N   PHE B 133     -50.516 -23.398  -9.498  1.00  0.87           N
ATOM   1022  CA  PHE B 133     -50.176 -24.731  -9.048  1.00  0.87           C
ATOM   1023  C   PHE B 133     -51.445 -25.355  -8.479  1.00  0.87           C
ATOM   1024  O   PHE B 133     -51.912 -24.944  -7.421  1.00  0.87           O
ATOM   1025  CB  PHE B 133     -49.053 -24.634  -7.961  1.00  0.87           C
ATOM   1026  CG  PHE B 133     -48.517 -25.951  -7.443  1.00  0.87           C
ATOM   1027  CD1 PHE B 133     -47.235 -26.387  -7.809  1.00  0.87           C
ATOM   1028  CD2 PHE B 133     -49.244 -26.720  -6.517  1.00  0.87           C
ATOM   1029  CE1 PHE B 133     -46.710 -27.590  -7.317  1.00  0.87           C
ATOM   1030  CE2 PHE B 133     -48.730 -27.925  -6.022  1.00  0.87           C
ATOM   1031  CZ  PHE B 133     -47.468 -28.366  -6.432  1.00  0.87           C
ATOM   1032  N   SER B 134     -52.053 -26.377  -9.132  1.00  0.93           N
ATOM   1033  CA  SER B 134     -53.365 -26.838  -8.669  1.00  0.93           C
ATOM   1034  C   SER B 134     -53.629 -28.326  -8.816  1.00  0.93           C
ATOM   1035  O   SER B 134     -52.918 -29.059  -9.506  1.00  0.93           O
ATOM   1036  CB  SER B 134     -54.571 -25.975  -9.163  1.00  0.93           C
ATOM   1037  OG  SER B 134     -54.807 -26.115 -10.556  1.00  0.93           O
ATOM   1038  N   ARG B 135     -54.631 -28.849  -8.065  1.00  0.85           N
ATOM   1039  CA  ARG B 135     -55.053 -30.242  -8.136  1.00  0.85           C
ATOM   1040  C   ARG B 135     -55.659 -30.574  -9.497  1.00  0.85           C
ATOM   1041  O   ARG B 135     -56.422 -29.790 -10.055  1.00  0.85           O
ATOM   1042  CB  ARG B 135     -56.023 -30.623  -6.977  1.00  0.85           C
ATOM   1043  CG  ARG B 135     -56.393 -32.117  -6.897  1.00  0.85           C
ATOM   1044  CD  ARG B 135     -57.325 -32.459  -5.722  1.00  0.85           C
ATOM   1045  NE  ARG B 135     -57.310 -33.933  -5.392  1.00  0.85           N
ATOM   1046  CZ  ARG B 135     -57.501 -34.954  -6.239  1.00  0.85           C
ATOM   1047  NH1 ARG B 135     -57.528 -34.815  -7.559  1.00  0.85           N
ATOM   1048  NH2 ARG B 135     -57.657 -36.179  -5.734  1.00  0.85           N
ATOM   1049  N   VAL B 136     -55.330 -31.758 -10.053  1.00  0.93           N
ATOM   1050  CA  VAL B 136     -55.800 -32.183 -11.362  1.00  0.93           C
ATOM   1051  C   VAL B 136     -56.486 -33.530 -11.223  1.00  0.93           C
ATOM   1052  O   VAL B 136     -56.310 -34.251 -10.234  1.00  0.93           O
ATOM   1053  CB  VAL B 136     -54.669 -32.305 -12.386  1.00  0.93           C
ATOM   1054  CG1 VAL B 136     -55.226 -32.382 -13.826  1.00  0.93           C
ATOM   1055  CG2 VAL B 136     -53.733 -31.088 -12.274  1.00  0.93           C
ATOM   1056  N   SER B 137     -57.331 -33.934 -12.183  1.00  0.89           N
ATOM   1057  CA  SER B 137     -57.756 -35.315 -12.297  1.00  0.89           C
ATOM   1058  C   SER B 137     -56.662 -36.182 -12.900  1.00  0.89           C
ATOM   1059  O   SER B 137     -55.841 -35.720 -13.689  1.00  0.89           O
ATOM   1060  CB  SER B 137     -59.051 -35.499 -13.122  1.00  0.89           C
ATOM   1061  OG  SER B 137     -58.890 -35.089 -14.483  1.00  0.89           O
ATOM   1062  N   ALA B 138     -56.621 -37.479 -12.561  1.00  0.94           N
ATOM   1063  CA  ALA B 138     -55.614 -38.344 -13.125  1.00  0.94           C
ATOM   1064  C   ALA B 138     -56.093 -39.772 -13.098  1.00  0.94           C
ATOM   1065  O   ALA B 138     -57.041 -40.107 -12.390  1.00  0.94           O
ATOM   1066  CB  ALA B 138     -54.277 -38.226 -12.367  1.00  0.94           C
ATOM   1067  N   LYS B 139     -55.456 -40.646 -13.897  1.00  0.87           N
ATOM   1068  CA  LYS B 139     -55.738 -42.064 -13.879  1.00  0.87           C
ATOM   1069  C   LYS B 139     -54.507 -42.854 -13.461  1.00  0.87           C
ATOM   1070  O   LYS B 139     -53.378 -42.379 -13.634  1.00  0.87           O
ATOM   1071  CB  LYS B 139     -56.240 -42.599 -15.244  1.00  0.87           C
ATOM   1072  CG  LYS B 139     -55.272 -42.381 -16.411  1.00  0.87           C
ATOM   1073  CD  LYS B 139     -55.787 -43.013 -17.709  1.00  0.87           C
ATOM   1074  CE  LYS B 139     -54.844 -42.790 -18.891  1.00  0.87           C
ATOM   1075  NZ  LYS B 139     -54.718 -41.341 -19.171  1.00  0.87           N
ATOM   1076  N   PRO B 140     -54.666 -44.055 -12.893  1.00  0.90           N
ATOM   1077  CA  PRO B 140     -53.585 -45.033 -12.763  1.00  0.90           C
ATOM   1078  C   PRO B 140     -52.947 -45.384 -14.109  1.00  0.90           C
ATOM   1079  O   PRO B 140     -53.638 -45.283 -15.127  1.00  0.90           O
ATOM   1080  CB  PRO B 140     -54.261 -46.238 -12.089  1.00  0.90           C
ATOM   1081  CG  PRO B 140     -55.735 -46.105 -12.474  1.00  0.90           C
ATOM   1082  CD  PRO B 140     -55.958 -44.606 -12.462  1.00  0.90           C
ATOM   1083  N   PRO B 141     -51.674 -45.753 -14.200  1.00  0.92           N
ATOM   1084  CA  PRO B 141     -51.096 -46.270 -15.436  1.00  0.92           C
ATOM   1085  C   PRO B 141     -51.757 -47.566 -15.921  1.00  0.92           C
ATOM   1086  O   PRO B 141     -52.383 -48.232 -15.101  1.00  0.92           O
ATOM   1087  CB  PRO B 141     -49.598 -46.416 -15.097  1.00  0.92           C
ATOM   1088  CG  PRO B 141     -49.346 -45.453 -13.934  1.00  0.92           C
ATOM   1089  CD  PRO B 141     -50.663 -45.491 -13.170  1.00  0.92           C
ATOM   1090  N   PRO B 142     -51.676 -47.949 -17.196  1.00  0.91           N
ATOM   1091  CA  PRO B 142     -52.645 -48.873 -17.795  1.00  0.91           C
ATOM   1092  C   PRO B 142     -52.439 -50.335 -17.455  1.00  0.91           C
ATOM   1093  O   PRO B 142     -53.380 -51.111 -17.582  1.00  0.91           O
ATOM   1094  CB  PRO B 142     -52.454 -48.658 -19.313  1.00  0.91           C
ATOM   1095  CG  PRO B 142     -51.045 -48.075 -19.450  1.00  0.91           C
ATOM   1096  CD  PRO B 142     -50.953 -47.190 -18.217  1.00  0.91           C
ATOM   1097  N   GLY B 143     -51.211 -50.763 -17.118  1.00  0.86           N
ATOM   1098  CA  GLY B 143     -50.922 -52.168 -16.846  1.00  0.86           C
ATOM   1099  C   GLY B 143     -51.549 -52.732 -15.595  1.00  0.86           C
ATOM   1100  O   GLY B 143     -51.804 -52.024 -14.627  1.00  0.86           O
ATOM   1101  N   ASP B 144     -51.704 -54.068 -15.555  1.00  0.82           N
ATOM   1102  CA  ASP B 144     -52.183 -54.831 -14.415  1.00  0.82           C
ATOM   1103  C   ASP B 144     -51.306 -54.651 -13.173  1.00  0.82           C
ATOM   1104  O   ASP B 144     -51.768 -54.482 -12.049  1.00  0.82           O
ATOM   1105  CB  ASP B 144     -52.292 -56.310 -14.852  1.00  0.82           C
ATOM   1106  CG  ASP B 144     -53.052 -57.132 -13.824  1.00  0.82           C
ATOM   1107  OD1 ASP B 144     -52.384 -57.684 -12.914  1.00  0.82           O
ATOM   1108  OD2 ASP B 144     -54.300 -57.204 -13.938  1.00  0.82           O
ATOM   1109  N   GLN B 145     -49.980 -54.555 -13.372  1.00  0.82           N
ATOM   1110  CA  GLN B 145     -49.026 -54.250 -12.334  1.00  0.82           C
ATOM   1111  C   GLN B 145     -49.244 -52.893 -11.685  1.00  0.82           C
ATOM   1112  O   GLN B 145     -48.833 -52.677 -10.551  1.00  0.82           O
ATOM   1113  CB  GLN B 145     -47.566 -54.349 -12.849  1.00  0.82           C
ATOM   1114  CG  GLN B 145     -47.117 -53.278 -13.874  1.00  0.82           C
ATOM   1115  CD  GLN B 145     -47.582 -53.550 -15.305  1.00  0.82           C
ATOM   1116  OE1 GLN B 145     -48.459 -54.358 -15.614  1.00  0.82           O
ATOM   1117  NE2 GLN B 145     -46.937 -52.846 -16.258  1.00  0.82           N
ATOM   1118  N   PHE B 146     -49.925 -51.951 -12.368  1.00  0.88           N
ATOM   1119  CA  PHE B 146     -50.183 -50.630 -11.846  1.00  0.88           C
ATOM   1120  C   PHE B 146     -51.567 -50.529 -11.212  1.00  0.88           C
ATOM   1121  O   PHE B 146     -51.994 -49.468 -10.760  1.00  0.88           O
ATOM   1122  CB  PHE B 146     -50.040 -49.556 -12.947  1.00  0.88           C
ATOM   1123  CG  PHE B 146     -48.626 -49.475 -13.465  1.00  0.88           C
ATOM   1124  CD1 PHE B 146     -47.601 -48.915 -12.682  1.00  0.88           C
ATOM   1125  CD2 PHE B 146     -48.331 -49.854 -14.787  1.00  0.88           C
ATOM   1126  CE1 PHE B 146     -46.318 -48.724 -13.208  1.00  0.88           C
ATOM   1127  CE2 PHE B 146     -47.049 -49.663 -15.318  1.00  0.88           C
ATOM   1128  CZ  PHE B 146     -46.042 -49.097 -14.528  1.00  0.88           C
ATOM   1129  N   LYS B 147     -52.294 -51.661 -11.068  1.00  0.84           N
ATOM   1130  CA  LYS B 147     -53.594 -51.680 -10.423  1.00  0.84           C
ATOM   1131  C   LYS B 147     -53.507 -51.445  -8.920  1.00  0.84           C
ATOM   1132  O   LYS B 147     -54.489 -51.108  -8.261  1.00  0.84           O
ATOM   1133  CB  LYS B 147     -54.362 -52.989 -10.752  1.00  0.84           C
ATOM   1134  CG  LYS B 147     -54.058 -54.215  -9.868  1.00  0.84           C
ATOM   1135  CD  LYS B 147     -55.117 -54.412  -8.770  1.00  0.84           C
ATOM   1136  CE  LYS B 147     -54.775 -55.518  -7.776  1.00  0.84           C
ATOM   1137  NZ  LYS B 147     -55.920 -55.710  -6.857  1.00  0.84           N
ATOM   1138  N   HIS B 148     -52.300 -51.574  -8.325  1.00  0.85           N
ATOM   1139  CA  HIS B 148     -52.089 -51.248  -6.926  1.00  0.85           C
ATOM   1140  C   HIS B 148     -52.059 -49.751  -6.662  1.00  0.85           C
ATOM   1141  O   HIS B 148     -52.243 -49.318  -5.531  1.00  0.85           O
ATOM   1142  CB  HIS B 148     -50.848 -51.960  -6.328  1.00  0.85           C
ATOM   1143  CG  HIS B 148     -49.518 -51.362  -6.681  1.00  0.85           C
ATOM   1144  ND1 HIS B 148     -49.128 -50.217  -6.020  1.00  0.85           N
ATOM   1145  CD2 HIS B 148     -48.584 -51.716  -7.599  1.00  0.85           C
ATOM   1146  CE1 HIS B 148     -47.971 -49.884  -6.553  1.00  0.85           C
ATOM   1147  NE2 HIS B 148     -47.597 -50.760  -7.509  1.00  0.85           N
ATOM   1148  N   LEU B 149     -51.898 -48.920  -7.713  1.00  0.90           N
ATOM   1149  CA  LEU B 149     -51.885 -47.480  -7.577  1.00  0.90           C
ATOM   1150  C   LEU B 149     -53.296 -46.900  -7.488  1.00  0.90           C
ATOM   1151  O   LEU B 149     -53.474 -45.751  -7.087  1.00  0.90           O
ATOM   1152  CB  LEU B 149     -51.105 -46.786  -8.723  1.00  0.90           C
ATOM   1153  CG  LEU B 149     -49.576 -46.997  -8.699  1.00  0.90           C
ATOM   1154  CD1 LEU B 149     -49.184 -48.381  -9.205  1.00  0.90           C
ATOM   1155  CD2 LEU B 149     -48.871 -45.957  -9.579  1.00  0.90           C
ATOM   1156  N   ILE B 150     -54.358 -47.681  -7.815  1.00  0.91           N
ATOM   1157  CA  ILE B 150     -55.749 -47.219  -7.770  1.00  0.91           C
ATOM   1158  C   ILE B 150     -56.179 -46.690  -6.400  1.00  0.91           C
ATOM   1159  O   ILE B 150     -56.721 -45.586  -6.358  1.00  0.91           O
ATOM   1160  CB  ILE B 150     -56.765 -48.248  -8.294  1.00  0.91           C
ATOM   1161  CG1 ILE B 150     -56.378 -48.745  -9.700  1.00  0.91           C
ATOM   1162  CG2 ILE B 150     -58.177 -47.622  -8.377  1.00  0.91           C
ATOM   1163  CD1 ILE B 150     -57.082 -50.039 -10.125  1.00  0.91           C
ATOM   1164  N   PRO B 151     -55.930 -47.320  -5.246  1.00  0.90           N
ATOM   1165  CA  PRO B 151     -56.350 -46.763  -3.967  1.00  0.90           C
ATOM   1166  C   PRO B 151     -55.560 -45.537  -3.552  1.00  0.90           C
ATOM   1167  O   PRO B 151     -56.004 -44.830  -2.652  1.00  0.90           O
ATOM   1168  CB  PRO B 151     -56.132 -47.925  -2.975  1.00  0.90           C
ATOM   1169  CG  PRO B 151     -56.233 -49.178  -3.845  1.00  0.90           C
ATOM   1170  CD  PRO B 151     -55.523 -48.721  -5.106  1.00  0.90           C
ATOM   1171  N   LEU B 152     -54.371 -45.286  -4.136  1.00  0.89           N
ATOM   1172  CA  LEU B 152     -53.489 -44.209  -3.715  1.00  0.89           C
ATOM   1173  C   LEU B 152     -53.936 -42.837  -4.207  1.00  0.89           C
ATOM   1174  O   LEU B 152     -53.640 -41.826  -3.580  1.00  0.89           O
ATOM   1175  CB  LEU B 152     -52.029 -44.521  -4.136  1.00  0.89           C
ATOM   1176  CG  LEU B 152     -51.329 -45.515  -3.177  1.00  0.89           C
ATOM   1177  CD1 LEU B 152     -50.603 -46.654  -3.904  1.00  0.89           C
ATOM   1178  CD2 LEU B 152     -50.346 -44.802  -2.239  1.00  0.89           C
ATOM   1179  N   MET B 153     -54.732 -42.783  -5.294  1.00  0.88           N
ATOM   1180  CA  MET B 153     -55.261 -41.569  -5.901  1.00  0.88           C
ATOM   1181  C   MET B 153     -56.131 -40.730  -4.980  1.00  0.88           C
ATOM   1182  O   MET B 153     -56.107 -39.500  -4.999  1.00  0.88           O
ATOM   1183  CB  MET B 153     -56.132 -41.953  -7.121  1.00  0.88           C
ATOM   1184  CG  MET B 153     -55.348 -42.499  -8.324  1.00  0.88           C
ATOM   1185  SD  MET B 153     -54.268 -41.292  -9.147  1.00  0.88           S
ATOM   1186  CE  MET B 153     -53.693 -42.652 -10.183  1.00  0.88           C
ATOM   1187  N   TYR B 154     -56.969 -41.402  -4.175  1.00  0.86           N
ATOM   1188  CA  TYR B 154     -57.855 -40.768  -3.223  1.00  0.86           C
ATOM   1189  C   TYR B 154     -57.141 -40.299  -1.971  1.00  0.86           C
ATOM   1190  O   TYR B 154     -57.491 -39.275  -1.392  1.00  0.86           O
ATOM   1191  CB  TYR B 154     -58.981 -41.739  -2.775  1.00  0.86           C
ATOM   1192  CG  TYR B 154     -59.475 -42.579  -3.920  1.00  0.86           C
ATOM   1193  CD1 TYR B 154     -60.397 -42.076  -4.849  1.00  0.86           C
ATOM   1194  CD2 TYR B 154     -58.999 -43.890  -4.079  1.00  0.86           C
ATOM   1195  CE1 TYR B 154     -60.840 -42.875  -5.913  1.00  0.86           C
ATOM   1196  CE2 TYR B 154     -59.461 -44.700  -5.124  1.00  0.86           C
ATOM   1197  CZ  TYR B 154     -60.376 -44.186  -6.048  1.00  0.86           C
ATOM   1198  OH  TYR B 154     -60.836 -44.976  -7.116  1.00  0.86           O
ATOM   1199  N   LYS B 155     -56.147 -41.089  -1.511  1.00  0.89           N
ATOM   1200  CA  LYS B 155     -55.725 -41.153  -0.124  1.00  0.89           C
ATOM   1201  C   LYS B 155     -55.260 -39.856   0.508  1.00  0.89           C
ATOM   1202  O   LYS B 155     -55.569 -39.573   1.664  1.00  0.89           O
ATOM   1203  CB  LYS B 155     -54.589 -42.202   0.044  1.00  0.89           C
ATOM   1204  CG  LYS B 155     -55.075 -43.625   0.370  1.00  0.89           C
ATOM   1205  CD  LYS B 155     -54.329 -44.214   1.582  1.00  0.89           C
ATOM   1206  CE  LYS B 155     -55.116 -45.290   2.333  1.00  0.89           C
ATOM   1207  NZ  LYS B 155     -55.183 -46.536   1.541  1.00  0.89           N
ATOM   1208  N   GLY B 156     -54.479 -39.055  -0.215  1.00  0.80           N
ATOM   1209  CA  GLY B 156     -53.897 -37.847   0.317  1.00  0.80           C
ATOM   1210  C   GLY B 156     -52.731 -37.581  -0.570  1.00  0.80           C
ATOM   1211  O   GLY B 156     -52.529 -38.308  -1.528  1.00  0.80           O
ATOM   1212  N   LEU B 157     -51.924 -36.541  -0.350  1.00  0.91           N
ATOM   1213  CA  LEU B 157     -51.965 -35.536   0.679  1.00  0.91           C
ATOM   1214  C   LEU B 157     -51.691 -34.229  -0.048  1.00  0.91           C
ATOM   1215  O   LEU B 157     -51.083 -34.273  -1.122  1.00  0.91           O
ATOM   1216  CB  LEU B 157     -50.833 -35.804   1.706  1.00  0.91           C
ATOM   1217  CG  LEU B 157     -51.280 -36.392   3.057  1.00  0.91           C
ATOM   1218  CD1 LEU B 157     -51.168 -37.924   3.041  1.00  0.91           C
ATOM   1219  CD2 LEU B 157     -50.439 -35.783   4.192  1.00  0.91           C
ATOM   1220  N   PRO B 158     -52.112 -33.057   0.437  1.00  0.94           N
ATOM   1221  CA  PRO B 158     -51.700 -31.765  -0.095  1.00  0.94           C
ATOM   1222  C   PRO B 158     -50.226 -31.611  -0.315  1.00  0.94           C
ATOM   1223  O   PRO B 158     -49.442 -31.960   0.562  1.00  0.94           O
ATOM   1224  CB  PRO B 158     -52.162 -30.753   0.951  1.00  0.94           C
ATOM   1225  CG  PRO B 158     -53.386 -31.412   1.573  1.00  0.94           C
ATOM   1226  CD  PRO B 158     -53.002 -32.894   1.589  1.00  0.94           C
ATOM   1227  N   TRP B 159     -49.802 -31.059  -1.458  1.00  0.90           N
ATOM   1228  CA  TRP B 159     -48.388 -30.924  -1.718  1.00  0.90           C
ATOM   1229  C   TRP B 159     -47.657 -29.958  -0.795  1.00  0.90           C
ATOM   1230  O   TRP B 159     -46.486 -30.173  -0.504  1.00  0.90           O
ATOM   1231  CB  TRP B 159     -48.086 -30.638  -3.208  1.00  0.90           C
ATOM   1232  CG  TRP B 159     -47.573 -31.851  -3.980  1.00  0.90           C
ATOM   1233  CD1 TRP B 159     -48.202 -32.710  -4.839  1.00  0.90           C
ATOM   1234  CD2 TRP B 159     -46.215 -32.307  -3.887  1.00  0.90           C
ATOM   1235  NE1 TRP B 159     -47.306 -33.627  -5.337  1.00  0.90           N
ATOM   1236  CE2 TRP B 159     -46.085 -33.405  -4.768  1.00  0.90           C
ATOM   1237  CE3 TRP B 159     -45.136 -31.867  -3.128  1.00  0.90           C
ATOM   1238  CZ2 TRP B 159     -44.875 -34.059  -4.915  1.00  0.90           C
ATOM   1239  CZ3 TRP B 159     -43.920 -32.549  -3.256  1.00  0.90           C
ATOM   1240  CH2 TRP B 159     -43.790 -33.622  -4.148  1.00  0.90           C
ATOM   1241  N   ASN B 160     -48.303 -28.896  -0.266  1.00  0.88           N
ATOM   1242  CA  ASN B 160     -47.696 -28.044   0.751  1.00  0.88           C
ATOM   1243  C   ASN B 160     -47.302 -28.816   2.021  1.00  0.88           C
ATOM   1244  O   ASN B 160     -46.241 -28.595   2.595  1.00  0.88           O
ATOM   1245  CB  ASN B 160     -48.532 -26.764   1.017  1.00  0.88           C
ATOM   1246  CG  ASN B 160     -49.882 -27.079   1.644  1.00  0.88           C
ATOM   1247  OD1 ASN B 160     -50.560 -28.028   1.242  1.00  0.88           O
ATOM   1248  ND2 ASN B 160     -50.295 -26.278   2.646  1.00  0.88           N
ATOM   1249  N   VAL B 161     -48.136 -29.792   2.436  1.00  0.94           N
ATOM   1250  CA  VAL B 161     -47.795 -30.795   3.438  1.00  0.94           C
ATOM   1251  C   VAL B 161     -46.669 -31.753   3.046  1.00  0.94           C
ATOM   1252  O   VAL B 161     -45.766 -32.015   3.838  1.00  0.94           O
ATOM   1253  CB  VAL B 161     -49.019 -31.626   3.810  1.00  0.94           C
ATOM   1254  CG1 VAL B 161     -48.635 -32.785   4.758  1.00  0.94           C
ATOM   1255  CG2 VAL B 161     -50.074 -30.705   4.449  1.00  0.94           C
ATOM   1256  N   VAL B 162     -46.677 -32.325   1.821  1.00  0.94           N
ATOM   1257  CA  VAL B 162     -45.694 -33.327   1.402  1.00  0.94           C
ATOM   1258  C   VAL B 162     -44.267 -32.804   1.387  1.00  0.94           C
ATOM   1259  O   VAL B 162     -43.357 -33.471   1.867  1.00  0.94           O
ATOM   1260  CB  VAL B 162     -46.055 -33.972   0.063  1.00  0.94           C
ATOM   1261  CG1 VAL B 162     -44.961 -34.939  -0.445  1.00  0.94           C
ATOM   1262  CG2 VAL B 162     -47.369 -34.756   0.241  1.00  0.94           C
ATOM   1263  N   ARG B 163     -44.020 -31.576   0.880  1.00  0.84           N
ATOM   1264  CA  ARG B 163     -42.679 -31.004   0.902  1.00  0.84           C
ATOM   1265  C   ARG B 163     -42.107 -30.742   2.301  1.00  0.84           C
ATOM   1266  O   ARG B 163     -40.960 -31.092   2.573  1.00  0.84           O
ATOM   1267  CB  ARG B 163     -42.512 -29.820  -0.090  1.00  0.84           C
ATOM   1268  CG  ARG B 163     -43.428 -28.594   0.087  1.00  0.84           C
ATOM   1269  CD  ARG B 163     -44.309 -28.334  -1.139  1.00  0.84           C
ATOM   1270  NE  ARG B 163     -43.887 -27.199  -2.009  1.00  0.84           N
ATOM   1271  CZ  ARG B 163     -44.655 -26.788  -3.026  1.00  0.84           C
ATOM   1272  NH1 ARG B 163     -45.736 -27.484  -3.394  1.00  0.84           N
ATOM   1273  NH2 ARG B 163     -44.381 -25.717  -3.746  1.00  0.84           N
ATOM   1274  N   ILE B 164     -42.905 -30.219   3.260  1.00  0.89           N
ATOM   1275  CA  ILE B 164     -42.502 -30.145   4.664  1.00  0.89           C
ATOM   1276  C   ILE B 164     -42.287 -31.524   5.304  1.00  0.89           C
ATOM   1277  O   ILE B 164     -41.363 -31.732   6.088  1.00  0.89           O
ATOM   1278  CB  ILE B 164     -43.408 -29.218   5.487  1.00  0.89           C
ATOM   1279  CG1 ILE B 164     -42.612 -28.168   6.305  1.00  0.89           C
ATOM   1280  CG2 ILE B 164     -44.409 -29.975   6.385  1.00  0.89           C
ATOM   1281  CD1 ILE B 164     -41.539 -28.736   7.238  1.00  0.89           C
ATOM   1282  N   LYS B 165     -43.119 -32.538   4.961  1.00  0.88           N
ATOM   1283  CA  LYS B 165     -42.876 -33.915   5.357  1.00  0.88           C
ATOM   1284  C   LYS B 165     -41.586 -34.506   4.801  1.00  0.88           C
ATOM   1285  O   LYS B 165     -40.849 -35.154   5.538  1.00  0.88           O
ATOM   1286  CB  LYS B 165     -44.076 -34.844   5.045  1.00  0.88           C
ATOM   1287  CG  LYS B 165     -45.258 -34.688   6.020  1.00  0.88           C
ATOM   1288  CD  LYS B 165     -46.127 -35.957   6.041  1.00  0.88           C
ATOM   1289  CE  LYS B 165     -47.188 -35.978   7.144  1.00  0.88           C
ATOM   1290  NZ  LYS B 165     -47.830 -37.313   7.183  1.00  0.88           N
ATOM   1291  N   ILE B 166     -41.253 -34.269   3.514  1.00  0.90           N
ATOM   1292  CA  ILE B 166     -39.977 -34.660   2.929  1.00  0.90           C
ATOM   1293  C   ILE B 166     -38.807 -34.010   3.631  1.00  0.90           C
ATOM   1294  O   ILE B 166     -37.840 -34.673   3.991  1.00  0.90           O
ATOM   1295  CB  ILE B 166     -39.936 -34.325   1.433  1.00  0.90           C
ATOM   1296  CG1 ILE B 166     -40.694 -35.430   0.674  1.00  0.90           C
ATOM   1297  CG2 ILE B 166     -38.492 -34.154   0.893  1.00  0.90           C
ATOM   1298  CD1 ILE B 166     -40.752 -35.260  -0.842  1.00  0.90           C
ATOM   1299  N   VAL B 167     -38.876 -32.687   3.868  1.00  0.92           N
ATOM   1300  CA  VAL B 167     -37.806 -31.961   4.521  1.00  0.92           C
ATOM   1301  C   VAL B 167     -37.594 -32.379   5.960  1.00  0.92           C
ATOM   1302  O   VAL B 167     -36.453 -32.576   6.355  1.00  0.92           O
ATOM   1303  CB  VAL B 167     -37.946 -30.455   4.375  1.00  0.92           C
ATOM   1304  CG1 VAL B 167     -36.889 -29.704   5.218  1.00  0.92           C
ATOM   1305  CG2 VAL B 167     -37.805 -30.090   2.884  1.00  0.92           C
ATOM   1306  N   GLN B 168     -38.642 -32.592   6.789  1.00  0.86           N
ATOM   1307  CA  GLN B 168     -38.395 -33.090   8.134  1.00  0.86           C
ATOM   1308  C   GLN B 168     -37.801 -34.499   8.169  1.00  0.86           C
ATOM   1309  O   GLN B 168     -36.800 -34.727   8.834  1.00  0.86           O
ATOM   1310  CB  GLN B 168     -39.592 -32.919   9.108  1.00  0.86           C
ATOM   1311  CG  GLN B 168     -40.858 -33.768   8.845  1.00  0.86           C
ATOM   1312  CD  GLN B 168     -41.583 -34.133  10.144  1.00  0.86           C
ATOM   1313  OE1 GLN B 168     -41.078 -34.027  11.262  1.00  0.86           O
ATOM   1314  NE2 GLN B 168     -42.846 -34.595  10.010  1.00  0.86           N
ATOM   1315  N   MET B 169     -38.336 -35.446   7.375  1.00  0.86           N
ATOM   1316  CA  MET B 169     -37.847 -36.814   7.291  1.00  0.86           C
ATOM   1317  C   MET B 169     -36.444 -36.959   6.706  1.00  0.86           C
ATOM   1318  O   MET B 169     -35.649 -37.808   7.113  1.00  0.86           O
ATOM   1319  CB  MET B 169     -38.906 -37.628   6.514  1.00  0.86           C
ATOM   1320  CG  MET B 169     -38.457 -38.977   5.938  1.00  0.86           C
ATOM   1321  SD  MET B 169     -38.087 -38.832   4.171  1.00  0.86           S
ATOM   1322  CE  MET B 169     -36.861 -40.157   4.123  1.00  0.86           C
ATOM   1323  N   LEU B 170     -36.089 -36.117   5.719  1.00  0.90           N
ATOM   1324  CA  LEU B 170     -34.718 -35.955   5.292  1.00  0.90           C
ATOM   1325  C   LEU B 170     -33.854 -35.307   6.385  1.00  0.90           C
ATOM   1326  O   LEU B 170     -32.732 -35.744   6.640  1.00  0.90           O
ATOM   1327  CB  LEU B 170     -34.647 -35.110   3.999  1.00  0.90           C
ATOM   1328  CG  LEU B 170     -34.989 -35.753   2.629  1.00  0.90           C
ATOM   1329  CD1 LEU B 170     -33.871 -35.452   1.626  1.00  0.90           C
ATOM   1330  CD2 LEU B 170     -35.262 -37.257   2.624  1.00  0.90           C
ATOM   1331  N   SER B 171     -34.360 -34.267   7.086  1.00  0.91           N
ATOM   1332  CA  SER B 171     -33.662 -33.620   8.192  1.00  0.91           C
ATOM   1333  C   SER B 171     -33.312 -34.531   9.349  1.00  0.91           C
ATOM   1334  O   SER B 171     -32.164 -34.543   9.787  1.00  0.91           O
ATOM   1335  CB  SER B 171     -34.420 -32.394   8.799  1.00  0.91           C
ATOM   1336  OG  SER B 171     -34.364 -31.238   7.960  1.00  0.91           O
ATOM   1337  N   ASP B 172     -34.248 -35.341   9.884  1.00  0.89           N
ATOM   1338  CA  ASP B 172     -33.917 -36.263  10.957  1.00  0.89           C
ATOM   1339  C   ASP B 172     -32.986 -37.426  10.545  1.00  0.89           C
ATOM   1340  O   ASP B 172     -31.992 -37.683  11.225  1.00  0.89           O
ATOM   1341  CB  ASP B 172     -35.157 -36.622  11.823  1.00  0.89           C
ATOM   1342  CG  ASP B 172     -36.153 -37.520  11.112  1.00  0.89           C
ATOM   1343  OD1 ASP B 172     -35.789 -38.692  10.850  1.00  0.89           O
ATOM   1344  OD2 ASP B 172     -37.282 -37.051  10.833  1.00  0.89           O
ATOM   1345  N   THR B 173     -33.212 -38.077   9.377  1.00  0.88           N
ATOM   1346  CA  THR B 173     -32.333 -39.112   8.804  1.00  0.88           C
ATOM   1347  C   THR B 173     -30.884 -38.637   8.539  1.00  0.88           C
ATOM   1348  O   THR B 173     -29.923 -39.357   8.816  1.00  0.88           O
ATOM   1349  CB  THR B 173     -32.878 -39.697   7.467  1.00  0.88           C
ATOM   1350  OG1 THR B 173     -34.151 -40.319   7.589  1.00  0.88           O
ATOM   1351  CG2 THR B 173     -31.834 -40.678   6.855  1.00  0.88           C
ATOM   1352  N   LEU B 174     -30.653 -37.425   7.975  1.00  0.89           N
ATOM   1353  CA  LEU B 174     -29.321 -37.013   7.515  1.00  0.89           C
ATOM   1354  C   LEU B 174     -28.565 -36.059   8.452  1.00  0.89           C
ATOM   1355  O   LEU B 174     -27.388 -35.781   8.219  1.00  0.89           O
ATOM   1356  CB  LEU B 174     -29.426 -36.335   6.109  1.00  0.89           C
ATOM   1357  CG  LEU B 174     -28.877 -37.137   4.903  1.00  0.89           C
ATOM   1358  CD1 LEU B 174     -29.556 -38.501   4.749  1.00  0.89           C
ATOM   1359  CD2 LEU B 174     -29.032 -36.327   3.609  1.00  0.89           C
ATOM   1360  N   LYS B 175     -29.165 -35.538   9.551  1.00  0.87           N
ATOM   1361  CA  LYS B 175     -28.580 -34.425  10.301  1.00  0.87           C
ATOM   1362  C   LYS B 175     -27.198 -34.644  10.875  1.00  0.87           C
ATOM   1363  O   LYS B 175     -26.336 -33.771  10.750  1.00  0.87           O
ATOM   1364  CB  LYS B 175     -29.503 -33.912  11.439  1.00  0.87           C
ATOM   1365  CG  LYS B 175     -30.111 -35.002  12.338  1.00  0.87           C
ATOM   1366  CD  LYS B 175     -30.823 -34.447  13.584  1.00  0.87           C
ATOM   1367  CE  LYS B 175     -31.847 -33.353  13.271  1.00  0.87           C
ATOM   1368  NZ  LYS B 175     -32.311 -32.718  14.521  1.00  0.87           N
ATOM   1369  N   ASN B 176     -26.976 -35.818  11.487  1.00  0.84           N
ATOM   1370  CA  ASN B 176     -25.717 -36.179  12.095  1.00  0.84           C
ATOM   1371  C   ASN B 176     -24.683 -36.571  11.055  1.00  0.84           C
ATOM   1372  O   ASN B 176     -23.503 -36.287  11.206  1.00  0.84           O
ATOM   1373  CB  ASN B 176     -25.929 -37.360  13.075  1.00  0.84           C
ATOM   1374  CG  ASN B 176     -26.811 -36.930  14.244  1.00  0.84           C
ATOM   1375  OD1 ASN B 176     -27.061 -35.755  14.509  1.00  0.84           O
ATOM   1376  ND2 ASN B 176     -27.332 -37.930  14.990  1.00  0.84           N
ATOM   1377  N   LEU B 177     -25.122 -37.268   9.990  1.00  0.87           N
ATOM   1378  CA  LEU B 177     -24.245 -37.942   9.050  1.00  0.87           C
ATOM   1379  C   LEU B 177     -23.636 -37.047   7.979  1.00  0.87           C
ATOM   1380  O   LEU B 177     -22.526 -37.294   7.518  1.00  0.87           O
ATOM   1381  CB  LEU B 177     -24.980 -39.117   8.346  1.00  0.87           C
ATOM   1382  CG  LEU B 177     -25.798 -40.049   9.270  1.00  0.87           C
ATOM   1383  CD1 LEU B 177     -26.281 -41.285   8.500  1.00  0.87           C
ATOM   1384  CD2 LEU B 177     -25.017 -40.504  10.508  1.00  0.87           C
ATOM   1385  N   SER B 178     -24.341 -35.990   7.523  1.00  0.90           N
ATOM   1386  CA  SER B 178     -23.863 -35.213   6.385  1.00  0.90           C
ATOM   1387  C   SER B 178     -24.313 -33.762   6.431  1.00  0.90           C
ATOM   1388  O   SER B 178     -25.169 -33.366   7.225  1.00  0.90           O
ATOM   1389  CB  SER B 178     -24.325 -35.869   5.050  1.00  0.90           C
ATOM   1390  OG  SER B 178     -23.810 -35.227   3.881  1.00  0.90           O
ATOM   1391  N   ASP B 179     -23.711 -32.903   5.581  1.00  0.91           N
ATOM   1392  CA  ASP B 179     -24.037 -31.506   5.414  1.00  0.91           C
ATOM   1393  C   ASP B 179     -24.870 -31.279   4.154  1.00  0.91           C
ATOM   1394  O   ASP B 179     -25.238 -30.159   3.792  1.00  0.91           O
ATOM   1395  CB  ASP B 179     -22.700 -30.721   5.331  1.00  0.91           C
ATOM   1396  CG  ASP B 179     -21.975 -30.991   4.012  1.00  0.91           C
ATOM   1397  OD1 ASP B 179     -21.690 -32.180   3.726  1.00  0.91           O
ATOM   1398  OD2 ASP B 179     -21.771 -30.021   3.240  1.00  0.91           O
ATOM   1399  N   ARG B 180     -25.170 -32.366   3.429  1.00  0.86           N
ATOM   1400  CA  ARG B 180     -25.772 -32.265   2.133  1.00  0.86           C
ATOM   1401  C   ARG B 180     -26.579 -33.501   1.795  1.00  0.86           C
ATOM   1402  O   ARG B 180     -26.606 -34.478   2.539  1.00  0.86           O
ATOM   1403  CB  ARG B 180     -24.697 -32.020   1.037  1.00  0.86           C
ATOM   1404  CG  ARG B 180     -23.667 -33.156   0.859  1.00  0.86           C
ATOM   1405  CD  ARG B 180     -22.917 -33.112  -0.484  1.00  0.86           C
ATOM   1406  NE  ARG B 180     -21.958 -31.967  -0.474  1.00  0.86           N
ATOM   1407  CZ  ARG B 180     -21.147 -31.660  -1.503  1.00  0.86           C
ATOM   1408  NH1 ARG B 180     -21.194 -32.286  -2.678  1.00  0.86           N
ATOM   1409  NH2 ARG B 180     -20.256 -30.685  -1.335  1.00  0.86           N
ATOM   1410  N   VAL B 181     -27.274 -33.475   0.642  1.00  0.94           N
ATOM   1411  CA  VAL B 181     -28.068 -34.578   0.128  1.00  0.94           C
ATOM   1412  C   VAL B 181     -27.452 -35.091  -1.161  1.00  0.94           C
ATOM   1413  O   VAL B 181     -26.980 -34.289  -1.965  1.00  0.94           O
ATOM   1414  CB  VAL B 181     -29.502 -34.164  -0.253  1.00  0.94           C
ATOM   1415  CG1 VAL B 181     -30.517 -35.181   0.294  1.00  0.94           C
ATOM   1416  CG2 VAL B 181     -29.834 -32.725   0.186  1.00  0.94           C
ATOM   1417  N   VAL B 182     -27.490 -36.414  -1.431  1.00  0.95           N
ATOM   1418  CA  VAL B 182     -27.397 -36.917  -2.799  1.00  0.95           C
ATOM   1419  C   VAL B 182     -28.502 -37.935  -3.049  1.00  0.95           C
ATOM   1420  O   VAL B 182     -28.674 -38.911  -2.314  1.00  0.95           O
ATOM   1421  CB  VAL B 182     -26.043 -37.441  -3.311  1.00  0.95           C
ATOM   1422  CG1 VAL B 182     -24.876 -36.601  -2.764  1.00  0.95           C
ATOM   1423  CG2 VAL B 182     -25.817 -38.924  -2.993  1.00  0.95           C
ATOM   1424  N   PHE B 183     -29.308 -37.743  -4.104  1.00  0.92           N
ATOM   1425  CA  PHE B 183     -30.320 -38.712  -4.479  1.00  0.92           C
ATOM   1426  C   PHE B 183     -29.760 -39.730  -5.462  1.00  0.92           C
ATOM   1427  O   PHE B 183     -29.217 -39.380  -6.509  1.00  0.92           O
ATOM   1428  CB  PHE B 183     -31.585 -38.058  -5.080  1.00  0.92           C
ATOM   1429  CG  PHE B 183     -32.260 -37.191  -4.056  1.00  0.92           C
ATOM   1430  CD1 PHE B 183     -33.117 -37.777  -3.112  1.00  0.92           C
ATOM   1431  CD2 PHE B 183     -32.054 -35.801  -4.017  1.00  0.92           C
ATOM   1432  CE1 PHE B 183     -33.766 -36.993  -2.152  1.00  0.92           C
ATOM   1433  CE2 PHE B 183     -32.721 -35.013  -3.068  1.00  0.92           C
ATOM   1434  CZ  PHE B 183     -33.574 -35.608  -2.135  1.00  0.92           C
ATOM   1435  N   VAL B 184     -29.888 -41.032  -5.143  1.00  0.95           N
ATOM   1436  CA  VAL B 184     -29.494 -42.114  -6.033  1.00  0.95           C
ATOM   1437  C   VAL B 184     -30.737 -42.710  -6.672  1.00  0.95           C
ATOM   1438  O   VAL B 184     -31.586 -43.312  -6.010  1.00  0.95           O
ATOM   1439  CB  VAL B 184     -28.627 -43.209  -5.401  1.00  0.95           C
ATOM   1440  CG1 VAL B 184     -27.146 -42.899  -5.681  1.00  0.95           C
ATOM   1441  CG2 VAL B 184     -28.858 -43.334  -3.888  1.00  0.95           C
ATOM   1442  N   LEU B 185     -30.871 -42.541  -7.999  1.00  0.92           N
ATOM   1443  CA  LEU B 185     -32.067 -42.871  -8.766  1.00  0.92           C
ATOM   1444  C   LEU B 185     -31.752 -43.721 -10.001  1.00  0.92           C
ATOM   1445  O   LEU B 185     -30.592 -43.850 -10.376  1.00  0.92           O
ATOM   1446  CB  LEU B 185     -33.006 -41.652  -9.035  1.00  0.92           C
ATOM   1447  CG  LEU B 185     -32.486 -40.291  -9.582  1.00  0.92           C
ATOM   1448  CD1 LEU B 185     -32.823 -39.160  -8.591  1.00  0.92           C
ATOM   1449  CD2 LEU B 185     -31.000 -40.217  -9.945  1.00  0.92           C
ATOM   1450  N   TRP B 186     -32.763 -44.437 -10.572  1.00  0.90           N
ATOM   1451  CA  TRP B 186     -32.517 -45.441 -11.613  1.00  0.90           C
ATOM   1452  C   TRP B 186     -32.979 -44.962 -12.966  1.00  0.90           C
ATOM   1453  O   TRP B 186     -32.499 -45.388 -14.014  1.00  0.90           O
ATOM   1454  CB  TRP B 186     -33.273 -46.763 -11.293  1.00  0.90           C
ATOM   1455  CG  TRP B 186     -33.190 -47.830 -12.390  1.00  0.90           C
ATOM   1456  CD1 TRP B 186     -34.156 -48.185 -13.292  1.00  0.90           C
ATOM   1457  CD2 TRP B 186     -31.989 -48.503 -12.775  1.00  0.90           C
ATOM   1458  NE1 TRP B 186     -33.626 -49.036 -14.233  1.00  0.90           N
ATOM   1459  CE2 TRP B 186     -32.308 -49.270 -13.939  1.00  0.90           C
ATOM   1460  CE3 TRP B 186     -30.714 -48.541 -12.230  1.00  0.90           C
ATOM   1461  CZ2 TRP B 186     -31.342 -50.033 -14.558  1.00  0.90           C
ATOM   1462  CZ3 TRP B 186     -29.760 -49.363 -12.837  1.00  0.90           C
ATOM   1463  CH2 TRP B 186     -30.067 -50.105 -13.990  1.00  0.90           C
ATOM   1464  N   ALA B 187     -33.952 -44.061 -12.963  1.00  0.89           N
ATOM   1465  CA  ALA B 187     -34.311 -43.310 -14.112  1.00  0.89           C
ATOM   1466  C   ALA B 187     -34.103 -41.871 -13.731  1.00  0.89           C
ATOM   1467  O   ALA B 187     -34.811 -41.309 -12.909  1.00  0.89           O
ATOM   1468  CB  ALA B 187     -35.781 -43.597 -14.459  1.00  0.89           C
ATOM   1469  N   HIS B 188     -33.109 -41.204 -14.339  1.00  0.76           N
ATOM   1470  CA  HIS B 188     -32.827 -39.806 -14.092  1.00  0.76           C
ATOM   1471  C   HIS B 188     -34.049 -38.934 -14.299  1.00  0.76           C
ATOM   1472  O   HIS B 188     -34.327 -38.027 -13.524  1.00  0.76           O
ATOM   1473  CB  HIS B 188     -31.674 -39.358 -15.039  1.00  0.76           C
ATOM   1474  CG  HIS B 188     -31.508 -37.890 -15.320  1.00  0.76           C
ATOM   1475  ND1 HIS B 188     -30.832 -37.511 -16.462  1.00  0.76           N
ATOM   1476  CD2 HIS B 188     -31.839 -36.792 -14.595  1.00  0.76           C
ATOM   1477  CE1 HIS B 188     -30.759 -36.201 -16.411  1.00  0.76           C
ATOM   1478  NE2 HIS B 188     -31.347 -35.715 -15.298  1.00  0.76           N
ATOM   1479  N   GLY B 189     -34.827 -39.199 -15.363  1.00  0.89           N
ATOM   1480  CA  GLY B 189     -35.808 -38.230 -15.813  1.00  0.89           C
ATOM   1481  C   GLY B 189     -37.062 -37.985 -15.001  1.00  0.89           C
ATOM   1482  O   GLY B 189     -37.488 -36.834 -14.914  1.00  0.89           O
ATOM   1483  N   PHE B 190     -37.735 -38.996 -14.410  1.00  0.90           N
ATOM   1484  CA  PHE B 190     -39.015 -38.737 -13.762  1.00  0.90           C
ATOM   1485  C   PHE B 190     -38.860 -38.099 -12.387  1.00  0.90           C
ATOM   1486  O   PHE B 190     -39.544 -37.147 -12.030  1.00  0.90           O
ATOM   1487  CB  PHE B 190     -39.897 -40.011 -13.694  1.00  0.90           C
ATOM   1488  CG  PHE B 190     -41.338 -39.752 -13.295  1.00  0.90           C
ATOM   1489  CD1 PHE B 190     -41.971 -38.498 -13.433  1.00  0.90           C
ATOM   1490  CD2 PHE B 190     -42.091 -40.815 -12.775  1.00  0.90           C
ATOM   1491  CE1 PHE B 190     -43.292 -38.304 -13.013  1.00  0.90           C
ATOM   1492  CE2 PHE B 190     -43.417 -40.627 -12.371  1.00  0.90           C
ATOM   1493  CZ  PHE B 190     -44.015 -39.368 -12.469  1.00  0.90           C
ATOM   1494  N   GLU B 191     -37.913 -38.582 -11.583  1.00  0.90           N
ATOM   1495  CA  GLU B 191     -37.672 -38.109 -10.243  1.00  0.90           C
ATOM   1496  C   GLU B 191     -37.096 -36.712 -10.216  1.00  0.90           C
ATOM   1497  O   GLU B 191     -37.393 -35.942  -9.304  1.00  0.90           O
ATOM   1498  CB  GLU B 191     -36.802 -39.110  -9.464  1.00  0.90           C
ATOM   1499  CG  GLU B 191     -37.532 -40.436  -9.138  1.00  0.90           C
ATOM   1500  CD  GLU B 191     -37.918 -41.287 -10.356  1.00  0.90           C
ATOM   1501  OE1 GLU B 191     -38.977 -41.949 -10.292  1.00  0.90           O
ATOM   1502  OE2 GLU B 191     -37.218 -41.203 -11.393  1.00  0.90           O
ATOM   1503  N   LEU B 192     -36.343 -36.296 -11.250  1.00  0.91           N
ATOM   1504  CA  LEU B 192     -35.993 -34.908 -11.500  1.00  0.91           C
ATOM   1505  C   LEU B 192     -37.246 -34.039 -11.681  1.00  0.91           C
ATOM   1506  O   LEU B 192     -37.384 -32.969 -11.103  1.00  0.91           O
ATOM   1507  CB  LEU B 192     -35.142 -34.855 -12.792  1.00  0.91           C
ATOM   1508  CG  LEU B 192     -34.136 -33.697 -12.967  1.00  0.91           C
ATOM   1509  CD1 LEU B 192     -33.760 -33.563 -14.451  1.00  0.91           C
ATOM   1510  CD2 LEU B 192     -34.604 -32.349 -12.414  1.00  0.91           C
ATOM   1511  N   THR B 193     -38.237 -34.541 -12.452  1.00  0.91           N
ATOM   1512  CA  THR B 193     -39.562 -33.931 -12.577  1.00  0.91           C
ATOM   1513  C   THR B 193     -40.282 -33.829 -11.250  1.00  0.91           C
ATOM   1514  O   THR B 193     -40.779 -32.767 -10.885  1.00  0.91           O
ATOM   1515  CB  THR B 193     -40.397 -34.617 -13.655  1.00  0.91           C
ATOM   1516  OG1 THR B 193     -40.121 -33.983 -14.886  1.00  0.91           O
ATOM   1517  CG2 THR B 193     -41.920 -34.630 -13.421  1.00  0.91           C
ATOM   1518  N   SER B 194     -40.271 -34.896 -10.433  1.00  0.93           N
ATOM   1519  CA  SER B 194     -40.848 -34.909  -9.094  1.00  0.93           C
ATOM   1520  C   SER B 194     -40.190 -33.945  -8.124  1.00  0.93           C
ATOM   1521  O   SER B 194     -40.834 -33.397  -7.232  1.00  0.93           O
ATOM   1522  CB  SER B 194     -40.847 -36.329  -8.491  1.00  0.93           C
ATOM   1523  OG  SER B 194     -41.680 -37.171  -9.289  1.00  0.93           O
ATOM   1524  N   MET B 195     -38.885 -33.670  -8.299  1.00  0.91           N
ATOM   1525  CA  MET B 195     -38.153 -32.680  -7.532  1.00  0.91           C
ATOM   1526  C   MET B 195     -38.685 -31.259  -7.649  1.00  0.91           C
ATOM   1527  O   MET B 195     -38.584 -30.486  -6.704  1.00  0.91           O
ATOM   1528  CB  MET B 195     -36.648 -32.701  -7.863  1.00  0.91           C
ATOM   1529  CG  MET B 195     -35.929 -33.919  -7.274  1.00  0.91           C
ATOM   1530  SD  MET B 195     -34.150 -33.876  -7.577  1.00  0.91           S
ATOM   1531  CE  MET B 195     -33.928 -35.663  -7.394  1.00  0.91           C
ATOM   1532  N   LYS B 196     -39.325 -30.881  -8.778  1.00  0.84           N
ATOM   1533  CA  LYS B 196     -39.851 -29.547  -9.049  1.00  0.84           C
ATOM   1534  C   LYS B 196     -40.725 -28.992  -7.936  1.00  0.84           C
ATOM   1535  O   LYS B 196     -40.753 -27.800  -7.634  1.00  0.84           O
ATOM   1536  CB  LYS B 196     -40.667 -29.608 -10.368  1.00  0.84           C
ATOM   1537  CG  LYS B 196     -41.387 -28.319 -10.806  1.00  0.84           C
ATOM   1538  CD  LYS B 196     -40.424 -27.139 -10.997  1.00  0.84           C
ATOM   1539  CE  LYS B 196     -41.126 -25.787 -11.104  1.00  0.84           C
ATOM   1540  NZ  LYS B 196     -40.119 -24.732 -11.257  1.00  0.84           N
ATOM   1541  N   TYR B 197     -41.459 -29.909  -7.310  1.00  0.90           N
ATOM   1542  CA  TYR B 197     -42.401 -29.699  -6.260  1.00  0.90           C
ATOM   1543  C   TYR B 197     -41.762 -29.320  -4.914  1.00  0.90           C
ATOM   1544  O   TYR B 197     -42.295 -28.451  -4.233  1.00  0.90           O
ATOM   1545  CB  TYR B 197     -43.316 -30.955  -6.167  1.00  0.90           C
ATOM   1546  CG  TYR B 197     -44.116 -31.264  -7.433  1.00  0.90           C
ATOM   1547  CD1 TYR B 197     -43.511 -31.594  -8.664  1.00  0.90           C
ATOM   1548  CD2 TYR B 197     -45.519 -31.317  -7.380  1.00  0.90           C
ATOM   1549  CE1 TYR B 197     -44.267 -31.907  -9.800  1.00  0.90           C
ATOM   1550  CE2 TYR B 197     -46.282 -31.587  -8.524  1.00  0.90           C
ATOM   1551  CZ  TYR B 197     -45.660 -31.877  -9.737  1.00  0.90           C
ATOM   1552  OH  TYR B 197     -46.441 -32.170 -10.874  1.00  0.90           O
ATOM   1553  N   PHE B 198     -40.628 -29.935  -4.483  1.00  0.91           N
ATOM   1554  CA  PHE B 198     -39.997 -29.637  -3.193  1.00  0.91           C
ATOM   1555  C   PHE B 198     -38.576 -29.098  -3.250  1.00  0.91           C
ATOM   1556  O   PHE B 198     -37.974 -28.781  -2.222  1.00  0.91           O
ATOM   1557  CB  PHE B 198     -39.979 -30.892  -2.275  1.00  0.91           C
ATOM   1558  CG  PHE B 198     -39.325 -32.095  -2.897  1.00  0.91           C
ATOM   1559  CD1 PHE B 198     -37.930 -32.229  -2.939  1.00  0.91           C
ATOM   1560  CD2 PHE B 198     -40.116 -33.124  -3.421  1.00  0.91           C
ATOM   1561  CE1 PHE B 198     -37.341 -33.363  -3.507  1.00  0.91           C
ATOM   1562  CE2 PHE B 198     -39.537 -34.270  -3.974  1.00  0.91           C
ATOM   1563  CZ  PHE B 198     -38.144 -34.383  -4.020  1.00  0.91           C
ATOM   1564  N   VAL B 199     -37.972 -28.983  -4.426  1.00  0.94           N
ATOM   1565  CA  VAL B 199     -36.614 -28.529  -4.584  1.00  0.94           C
ATOM   1566  C   VAL B 199     -36.605 -27.097  -5.044  1.00  0.94           C
ATOM   1567  O   VAL B 199     -37.426 -26.659  -5.847  1.00  0.94           O
ATOM   1568  CB  VAL B 199     -35.853 -29.380  -5.587  1.00  0.94           C
ATOM   1569  CG1 VAL B 199     -34.503 -28.769  -5.990  1.00  0.94           C
ATOM   1570  CG2 VAL B 199     -35.638 -30.773  -4.986  1.00  0.94           C
ATOM   1571  N   LYS B 200     -35.634 -26.318  -4.553  1.00  0.84           N
ATOM   1572  CA  LYS B 200     -35.267 -25.079  -5.183  1.00  0.84           C
ATOM   1573  C   LYS B 200     -33.781 -25.182  -5.436  1.00  0.84           C
ATOM   1574  O   LYS B 200     -33.125 -26.121  -4.988  1.00  0.84           O
ATOM   1575  CB  LYS B 200     -35.654 -23.841  -4.321  1.00  0.84           C
ATOM   1576  CG  LYS B 200     -36.468 -22.779  -5.088  1.00  0.84           C
ATOM   1577  CD  LYS B 200     -37.791 -22.314  -4.457  1.00  0.84           C
ATOM   1578  CE  LYS B 200     -38.791 -21.776  -5.503  1.00  0.84           C
ATOM   1579  NZ  LYS B 200     -38.503 -20.386  -5.950  1.00  0.84           N
ATOM   1580  N   ILE B 201     -33.220 -24.247  -6.206  1.00  0.87           N
ATOM   1581  CA  ILE B 201     -31.804 -24.237  -6.492  1.00  0.87           C
ATOM   1582  C   ILE B 201     -31.310 -22.804  -6.378  1.00  0.87           C
ATOM   1583  O   ILE B 201     -32.078 -21.842  -6.464  1.00  0.87           O
ATOM   1584  CB  ILE B 201     -31.512 -24.914  -7.839  1.00  0.87           C
ATOM   1585  CG1 ILE B 201     -30.160 -25.658  -7.882  1.00  0.87           C
ATOM   1586  CG2 ILE B 201     -31.656 -23.929  -9.013  1.00  0.87           C
ATOM   1587  CD1 ILE B 201     -30.124 -26.868  -6.942  1.00  0.87           C
ATOM   1588  N   GLY B 202     -30.002 -22.615  -6.135  1.00  0.89           N
ATOM   1589  CA  GLY B 202     -29.368 -21.314  -6.021  1.00  0.89           C
ATOM   1590  C   GLY B 202     -27.883 -21.518  -5.829  1.00  0.89           C
ATOM   1591  O   GLY B 202     -27.426 -22.658  -5.851  1.00  0.89           O
ATOM   1592  N   PRO B 203     -27.094 -20.472  -5.658  1.00  0.87           N
ATOM   1593  CA  PRO B 203     -25.681 -20.569  -5.304  1.00  0.87           C
ATOM   1594  C   PRO B 203     -25.489 -20.982  -3.856  1.00  0.87           C
ATOM   1595  O   PRO B 203     -26.313 -20.611  -3.021  1.00  0.87           O
ATOM   1596  CB  PRO B 203     -25.202 -19.130  -5.541  1.00  0.87           C
ATOM   1597  CG  PRO B 203     -26.390 -18.264  -5.135  1.00  0.87           C
ATOM   1598  CD  PRO B 203     -27.584 -19.095  -5.604  1.00  0.87           C
ATOM   1599  N   GLU B 204     -24.425 -21.758  -3.534  1.00  0.85           N
ATOM   1600  CA  GLU B 204     -24.154 -22.256  -2.187  1.00  0.85           C
ATOM   1601  C   GLU B 204     -24.238 -21.175  -1.114  1.00  0.85           C
ATOM   1602  O   GLU B 204     -23.747 -20.060  -1.279  1.00  0.85           O
ATOM   1603  CB  GLU B 204     -22.791 -23.001  -2.076  1.00  0.85           C
ATOM   1604  CG  GLU B 204     -22.841 -24.499  -2.486  1.00  0.85           C
ATOM   1605  CD  GLU B 204     -23.536 -25.409  -1.475  1.00  0.85           C
ATOM   1606  OE1 GLU B 204     -23.549 -26.643  -1.705  1.00  0.85           O
ATOM   1607  OE2 GLU B 204     -24.068 -24.917  -0.442  1.00  0.85           O
ATOM   1608  N   ARG B 205     -24.912 -21.485   0.009  1.00  0.79           N
ATOM   1609  CA  ARG B 205     -25.148 -20.527   1.066  1.00  0.79           C
ATOM   1610  C   ARG B 205     -25.069 -21.204   2.408  1.00  0.79           C
ATOM   1611  O   ARG B 205     -25.083 -22.426   2.511  1.00  0.79           O
ATOM   1612  CB  ARG B 205     -26.504 -19.796   0.913  1.00  0.79           C
ATOM   1613  CG  ARG B 205     -26.406 -18.678  -0.139  1.00  0.79           C
ATOM   1614  CD  ARG B 205     -26.970 -17.348   0.342  1.00  0.79           C
ATOM   1615  NE  ARG B 205     -26.591 -16.279  -0.630  1.00  0.79           N
ATOM   1616  CZ  ARG B 205     -27.167 -16.097  -1.821  1.00  0.79           C
ATOM   1617  NH1 ARG B 205     -28.062 -16.942  -2.322  1.00  0.79           N
ATOM   1618  NH2 ARG B 205     -26.840 -15.023  -2.531  1.00  0.79           N
ATOM   1619  N   THR B 206     -24.944 -20.408   3.483  1.00  0.89           N
ATOM   1620  CA  THR B 206     -24.785 -20.876   4.848  1.00  0.89           C
ATOM   1621  C   THR B 206     -26.117 -20.898   5.575  1.00  0.89           C
ATOM   1622  O   THR B 206     -27.060 -20.194   5.216  1.00  0.89           O
ATOM   1623  CB  THR B 206     -23.787 -20.032   5.633  1.00  0.89           C
ATOM   1624  OG1 THR B 206     -24.282 -18.725   5.907  1.00  0.89           O
ATOM   1625  CG2 THR B 206     -22.533 -19.836   4.765  1.00  0.89           C
ATOM   1626  N   CYS B 207     -26.261 -21.747   6.610  1.00  0.93           N
ATOM   1627  CA  CYS B 207     -27.503 -21.847   7.347  1.00  0.93           C
ATOM   1628  C   CYS B 207     -27.774 -20.703   8.306  1.00  0.93           C
ATOM   1629  O   CYS B 207     -26.962 -20.351   9.153  1.00  0.93           O
ATOM   1630  CB  CYS B 207     -27.709 -23.243   8.000  1.00  0.93           C
ATOM   1631  SG  CYS B 207     -26.286 -24.133   8.699  1.00  0.93           S
ATOM   1632  N   CYS B 208     -28.947 -20.055   8.197  1.00  0.91           N
ATOM   1633  CA  CYS B 208     -29.318 -18.956   9.065  1.00  0.91           C
ATOM   1634  C   CYS B 208     -29.480 -19.335  10.544  1.00  0.91           C
ATOM   1635  O   CYS B 208     -30.205 -20.257  10.910  1.00  0.91           O
ATOM   1636  CB  CYS B 208     -30.462 -18.114   8.422  1.00  0.91           C
ATOM   1637  SG  CYS B 208     -31.513 -17.098   9.506  1.00  0.91           S
ATOM   1638  N   LEU B 209     -28.715 -18.594  11.383  1.00  0.80           N
ATOM   1639  CA  LEU B 209     -28.525 -18.702  12.827  1.00  0.80           C
ATOM   1640  C   LEU B 209     -27.384 -19.658  13.158  1.00  0.80           C
ATOM   1641  O   LEU B 209     -27.029 -19.889  14.313  1.00  0.80           O
ATOM   1642  CB  LEU B 209     -29.845 -18.910  13.637  1.00  0.80           C
ATOM   1643  CG  LEU B 209     -30.062 -20.290  14.293  1.00  0.80           C
ATOM   1644  CD1 LEU B 209     -29.738 -20.264  15.794  1.00  0.80           C
ATOM   1645  CD2 LEU B 209     -31.496 -20.789  14.098  1.00  0.80           C
ATOM   1646  N   CYS B 210     -26.709 -20.198  12.137  1.00  0.91           N
ATOM   1647  CA  CYS B 210     -25.871 -21.362  12.273  1.00  0.91           C
ATOM   1648  C   CYS B 210     -24.548 -21.158  11.538  1.00  0.91           C
ATOM   1649  O   CYS B 210     -24.313 -20.136  10.902  1.00  0.91           O
ATOM   1650  CB  CYS B 210     -26.561 -22.587  11.635  1.00  0.91           C
ATOM   1651  SG  CYS B 210     -28.365 -22.748  11.903  1.00  0.91           S
ATOM   1652  N   ASP B 211     -23.654 -22.162  11.645  1.00  0.86           N
ATOM   1653  CA  ASP B 211     -22.329 -22.191  11.057  1.00  0.86           C
ATOM   1654  C   ASP B 211     -22.271 -22.771   9.621  1.00  0.86           C
ATOM   1655  O   ASP B 211     -21.919 -22.087   8.664  1.00  0.86           O
ATOM   1656  CB  ASP B 211     -21.534 -23.078  12.052  1.00  0.86           C
ATOM   1657  CG  ASP B 211     -20.046 -23.115  11.758  1.00  0.86           C
ATOM   1658  OD1 ASP B 211     -19.442 -22.028  11.614  1.00  0.86           O
ATOM   1659  OD2 ASP B 211     -19.521 -24.254  11.677  1.00  0.86           O
ATOM   1660  N   ARG B 212     -22.612 -24.073   9.445  1.00  0.76           N
ATOM   1661  CA  ARG B 212     -22.425 -24.811   8.181  1.00  0.76           C
ATOM   1662  C   ARG B 212     -23.257 -24.394   6.953  1.00  0.76           C
ATOM   1663  O   ARG B 212     -23.990 -23.414   6.939  1.00  0.76           O
ATOM   1664  CB  ARG B 212     -22.431 -26.355   8.397  1.00  0.76           C
ATOM   1665  CG  ARG B 212     -23.814 -27.008   8.636  1.00  0.76           C
ATOM   1666  CD  ARG B 212     -23.776 -28.538   8.824  1.00  0.76           C
ATOM   1667  NE  ARG B 212     -25.197 -29.021   8.942  1.00  0.76           N
ATOM   1668  CZ  ARG B 212     -25.558 -30.267   9.292  1.00  0.76           C
ATOM   1669  NH1 ARG B 212     -26.844 -30.546   9.508  1.00  0.76           N
ATOM   1670  NH2 ARG B 212     -24.682 -31.243   9.482  1.00  0.76           N
ATOM   1671  N   ARG B 213     -23.129 -25.131   5.822  1.00  0.79           N
ATOM   1672  CA  ARG B 213     -23.866 -24.872   4.588  1.00  0.79           C
ATOM   1673  C   ARG B 213     -25.353 -25.160   4.701  1.00  0.79           C
ATOM   1674  O   ARG B 213     -25.792 -25.991   5.495  1.00  0.79           O
ATOM   1675  CB  ARG B 213     -23.309 -25.581   3.320  1.00  0.79           C
ATOM   1676  CG  ARG B 213     -23.828 -27.015   3.094  1.00  0.79           C
ATOM   1677  CD  ARG B 213     -23.474 -27.589   1.719  1.00  0.79           C
ATOM   1678  NE  ARG B 213     -24.601 -28.502   1.345  1.00  0.79           N
ATOM   1679  CZ  ARG B 213     -25.688 -28.091   0.672  1.00  0.79           C
ATOM   1680  NH1 ARG B 213     -25.839 -26.851   0.214  1.00  0.79           N
ATOM   1681  NH2 ARG B 213     -26.660 -28.969   0.472  1.00  0.79           N
ATOM   1682  N   ALA B 214     -26.171 -24.492   3.872  1.00  0.94           N
ATOM   1683  CA  ALA B 214     -27.603 -24.627   3.890  1.00  0.94           C
ATOM   1684  C   ALA B 214     -28.155 -25.692   2.940  1.00  0.94           C
ATOM   1685  O   ALA B 214     -28.072 -25.623   1.715  1.00  0.94           O
ATOM   1686  CB  ALA B 214     -28.270 -23.274   3.608  1.00  0.94           C
ATOM   1687  N   THR B 215     -28.764 -26.730   3.538  1.00  0.92           N
ATOM   1688  CA  THR B 215     -29.629 -27.703   2.884  1.00  0.92           C
ATOM   1689  C   THR B 215     -31.001 -27.206   2.483  1.00  0.92           C
ATOM   1690  O   THR B 215     -31.509 -27.555   1.423  1.00  0.92           O
ATOM   1691  CB  THR B 215     -29.894 -28.891   3.781  1.00  0.92           C
ATOM   1692  OG1 THR B 215     -28.673 -29.550   4.085  1.00  0.92           O
ATOM   1693  CG2 THR B 215     -30.810 -29.906   3.108  1.00  0.92           C
ATOM   1694  N   CYS B 216     -31.676 -26.428   3.335  1.00  0.93           N
ATOM   1695  CA  CYS B 216     -33.102 -26.180   3.280  1.00  0.93           C
ATOM   1696  C   CYS B 216     -33.468 -24.727   3.017  1.00  0.93           C
ATOM   1697  O   CYS B 216     -32.698 -23.801   3.287  1.00  0.93           O
ATOM   1698  CB  CYS B 216     -33.812 -26.580   4.600  1.00  0.93           C
ATOM   1699  SG  CYS B 216     -33.438 -28.268   5.160  1.00  0.93           S
ATOM   1700  N   PHE B 217     -34.693 -24.513   2.497  1.00  0.90           N
ATOM   1701  CA  PHE B 217     -35.314 -23.211   2.297  1.00  0.90           C
ATOM   1702  C   PHE B 217     -36.726 -23.222   2.885  1.00  0.90           C
ATOM   1703  O   PHE B 217     -37.366 -24.266   2.973  1.00  0.90           O
ATOM   1704  CB  PHE B 217     -35.401 -22.888   0.781  1.00  0.90           C
ATOM   1705  CG  PHE B 217     -35.903 -21.505   0.470  1.00  0.90           C
ATOM   1706  CD1 PHE B 217     -37.209 -21.329  -0.018  1.00  0.90           C
ATOM   1707  CD2 PHE B 217     -35.103 -20.373   0.677  1.00  0.90           C
ATOM   1708  CE1 PHE B 217     -37.699 -20.048  -0.290  1.00  0.90           C
ATOM   1709  CE2 PHE B 217     -35.591 -19.089   0.408  1.00  0.90           C
ATOM   1710  CZ  PHE B 217     -36.891 -18.929  -0.075  1.00  0.90           C
ATOM   1711  N   SER B 218     -37.222 -22.046   3.317  1.00  0.88           N
ATOM   1712  CA  SER B 218     -38.577 -21.867   3.826  1.00  0.88           C
ATOM   1713  C   SER B 218     -39.268 -20.827   2.984  1.00  0.88           C
ATOM   1714  O   SER B 218     -38.738 -19.743   2.762  1.00  0.88           O
ATOM   1715  CB  SER B 218     -38.625 -21.328   5.281  1.00  0.88           C
ATOM   1716  OG  SER B 218     -39.966 -21.082   5.731  1.00  0.88           O
ATOM   1717  N   THR B 219     -40.476 -21.095   2.488  1.00  0.84           N
ATOM   1718  CA  THR B 219     -41.154 -20.121   1.645  1.00  0.84           C
ATOM   1719  C   THR B 219     -41.974 -19.130   2.467  1.00  0.84           C
ATOM   1720  O   THR B 219     -42.343 -18.065   1.980  1.00  0.84           O
ATOM   1721  CB  THR B 219     -42.040 -20.737   0.585  1.00  0.84           C
ATOM   1722  OG1 THR B 219     -42.944 -21.608   1.210  1.00  0.84           O
ATOM   1723  CG2 THR B 219     -41.271 -21.461  -0.542  1.00  0.84           C
ATOM   1724  N   ALA B 220     -42.241 -19.430   3.758  1.00  0.89           N
ATOM   1725  CA  ALA B 220     -43.009 -18.603   4.669  1.00  0.89           C
ATOM   1726  C   ALA B 220     -42.318 -17.298   5.049  1.00  0.89           C
ATOM   1727  O   ALA B 220     -42.940 -16.246   5.196  1.00  0.89           O
ATOM   1728  CB  ALA B 220     -43.334 -19.447   5.918  1.00  0.89           C
ATOM   1729  N   SER B 221     -40.992 -17.350   5.223  1.00  0.89           N
ATOM   1730  CA  SER B 221     -40.150 -16.194   5.448  1.00  0.89           C
ATOM   1731  C   SER B 221     -38.817 -16.511   4.846  1.00  0.89           C
ATOM   1732  O   SER B 221     -38.288 -17.601   5.056  1.00  0.89           O
ATOM   1733  CB  SER B 221     -39.906 -15.856   6.946  1.00  0.89           C
ATOM   1734  OG  SER B 221     -39.377 -16.968   7.676  1.00  0.89           O
ATOM   1735  N   ASP B 222     -38.223 -15.574   4.080  1.00  0.87           N
ATOM   1736  CA  ASP B 222     -37.009 -15.861   3.348  1.00  0.87           C
ATOM   1737  C   ASP B 222     -35.862 -16.214   4.296  1.00  0.87           C
ATOM   1738  O   ASP B 222     -35.391 -15.397   5.091  1.00  0.87           O
ATOM   1739  CB  ASP B 222     -36.689 -14.702   2.373  1.00  0.87           C
ATOM   1740  CG  ASP B 222     -35.762 -15.155   1.252  1.00  0.87           C
ATOM   1741  OD1 ASP B 222     -34.568 -15.428   1.533  1.00  0.87           O
ATOM   1742  OD2 ASP B 222     -36.255 -15.251   0.099  1.00  0.87           O
ATOM   1743  N   THR B 223     -35.473 -17.501   4.286  1.00  0.89           N
ATOM   1744  CA  THR B 223     -34.461 -18.034   5.176  1.00  0.89           C
ATOM   1745  C   THR B 223     -33.825 -19.259   4.545  1.00  0.89           C
ATOM   1746  O   THR B 223     -34.376 -19.935   3.679  1.00  0.89           O
ATOM   1747  CB  THR B 223     -34.919 -18.394   6.592  1.00  0.89           C
ATOM   1748  OG1 THR B 223     -36.176 -19.018   6.503  1.00  0.89           O
ATOM   1749  CG2 THR B 223     -35.132 -17.222   7.533  1.00  0.89           C
ATOM   1750  N   TYR B 224     -32.589 -19.560   4.988  1.00  0.90           N
ATOM   1751  CA  TYR B 224     -31.826 -20.734   4.612  1.00  0.90           C
ATOM   1752  C   TYR B 224     -31.468 -21.509   5.856  1.00  0.90           C
ATOM   1753  O   TYR B 224     -31.188 -20.921   6.894  1.00  0.90           O
ATOM   1754  CB  TYR B 224     -30.502 -20.354   3.914  1.00  0.90           C
ATOM   1755  CG  TYR B 224     -30.765 -19.605   2.649  1.00  0.90           C
ATOM   1756  CD1 TYR B 224     -31.491 -20.234   1.633  1.00  0.90           C
ATOM   1757  CD2 TYR B 224     -30.287 -18.301   2.431  1.00  0.90           C
ATOM   1758  CE1 TYR B 224     -31.721 -19.580   0.417  1.00  0.90           C
ATOM   1759  CE2 TYR B 224     -30.454 -17.691   1.179  1.00  0.90           C
ATOM   1760  CZ  TYR B 224     -31.164 -18.327   0.163  1.00  0.90           C
ATOM   1761  OH  TYR B 224     -31.355 -17.669  -1.075  1.00  0.90           O
ATOM   1762  N   ALA B 225     -31.450 -22.845   5.816  1.00  0.93           N
ATOM   1763  CA  ALA B 225     -31.154 -23.616   6.997  1.00  0.93           C
ATOM   1764  C   ALA B 225     -30.590 -24.944   6.590  1.00  0.93           C
ATOM   1765  O   ALA B 225     -30.508 -25.254   5.412  1.00  0.93           O
ATOM   1766  CB  ALA B 225     -32.369 -23.784   7.915  1.00  0.93           C
ATOM   1767  N   CYS B 226     -30.108 -25.747   7.546  1.00  0.87           N
ATOM   1768  CA  CYS B 226     -29.553 -27.052   7.269  1.00  0.87           C
ATOM   1769  C   CYS B 226     -30.431 -28.117   7.851  1.00  0.87           C
ATOM   1770  O   CYS B 226     -31.585 -27.883   8.194  1.00  0.87           O
ATOM   1771  CB  CYS B 226     -28.087 -27.202   7.743  1.00  0.87           C
ATOM   1772  SG  CYS B 226     -27.830 -27.053   9.527  1.00  0.87           S
ATOM   1773  N   TRP B 227     -29.927 -29.338   7.997  1.00  0.86           N
ATOM   1774  CA  TRP B 227     -30.706 -30.431   8.506  1.00  0.86           C
ATOM   1775  C   TRP B 227     -30.884 -30.374  10.004  1.00  0.86           C
ATOM   1776  O   TRP B 227     -31.654 -31.138  10.566  1.00  0.86           O
ATOM   1777  CB  TRP B 227     -30.002 -31.777   8.232  1.00  0.86           C
ATOM   1778  CG  TRP B 227     -29.624 -32.114   6.803  1.00  0.86           C
ATOM   1779  CD1 TRP B 227     -28.402 -32.468   6.296  1.00  0.86           C
ATOM   1780  CD2 TRP B 227     -30.570 -32.325   5.754  1.00  0.86           C
ATOM   1781  NE1 TRP B 227     -28.535 -32.910   5.004  1.00  0.86           N
ATOM   1782  CE2 TRP B 227     -29.857 -32.867   4.665  1.00  0.86           C
ATOM   1783  CE3 TRP B 227     -31.939 -32.131   5.681  1.00  0.86           C
ATOM   1784  CZ2 TRP B 227     -30.516 -33.243   3.518  1.00  0.86           C
ATOM   1785  CZ3 TRP B 227     -32.597 -32.457   4.494  1.00  0.86           C
ATOM   1786  CH2 TRP B 227     -31.889 -32.994   3.409  1.00  0.86           C
ATOM   1787  N   HIS B 228     -30.114 -29.534  10.726  1.00  0.84           N
ATOM   1788  CA  HIS B 228     -30.076 -29.699  12.171  1.00  0.84           C
ATOM   1789  C   HIS B 228     -31.087 -28.834  12.870  1.00  0.84           C
ATOM   1790  O   HIS B 228     -31.912 -29.316  13.641  1.00  0.84           O
ATOM   1791  CB  HIS B 228     -28.671 -29.432  12.734  1.00  0.84           C
ATOM   1792  CG  HIS B 228     -28.573 -29.483  14.229  1.00  0.84           C
ATOM   1793  ND1 HIS B 228     -28.550 -30.702  14.872  1.00  0.84           N
ATOM   1794  CD2 HIS B 228     -28.417 -28.473  15.122  1.00  0.84           C
ATOM   1795  CE1 HIS B 228     -28.359 -30.408  16.147  1.00  0.84           C
ATOM   1796  NE2 HIS B 228     -28.278 -29.072  16.352  1.00  0.84           N
ATOM   1797  N   HIS B 229     -31.028 -27.528  12.580  1.00  0.74           N
ATOM   1798  CA  HIS B 229     -31.750 -26.488  13.272  1.00  0.74           C
ATOM   1799  C   HIS B 229     -32.987 -26.063  12.505  1.00  0.74           C
ATOM   1800  O   HIS B 229     -33.560 -25.017  12.796  1.00  0.74           O
ATOM   1801  CB  HIS B 229     -30.872 -25.214  13.440  1.00  0.74           C
ATOM   1802  CG  HIS B 229     -29.383 -25.403  13.415  1.00  0.74           C
ATOM   1803  ND1 HIS B 229     -28.707 -25.920  12.322  1.00  0.74           N
ATOM   1804  CD2 HIS B 229     -28.496 -25.010  14.358  1.00  0.74           C
ATOM   1805  CE1 HIS B 229     -27.428 -25.835  12.634  1.00  0.74           C
ATOM   1806  NE2 HIS B 229     -27.246 -25.293  13.858  1.00  0.74           N
ATOM   1807  N   SER B 230     -33.421 -26.828  11.482  1.00  0.80           N
ATOM   1808  CA  SER B 230     -34.522 -26.413  10.621  1.00  0.80           C
ATOM   1809  C   SER B 230     -35.783 -27.235  10.819  1.00  0.80           C
ATOM   1810  O   SER B 230     -35.787 -28.456  10.759  1.00  0.80           O
ATOM   1811  CB  SER B 230     -34.155 -26.361   9.103  1.00  0.80           C
ATOM   1812  OG  SER B 230     -34.535 -27.498   8.317  1.00  0.80           O
ATOM   1813  N   ILE B 231     -36.920 -26.549  11.032  1.00  0.90           N
ATOM   1814  CA  ILE B 231     -38.233 -27.163  11.026  1.00  0.90           C
ATOM   1815  C   ILE B 231     -39.125 -26.087  10.455  1.00  0.90           C
ATOM   1816  O   ILE B 231     -38.806 -24.905  10.557  1.00  0.90           O
ATOM   1817  CB  ILE B 231     -38.823 -27.599  12.378  1.00  0.90           C
ATOM   1818  CG1 ILE B 231     -38.902 -26.479  13.447  1.00  0.90           C
ATOM   1819  CG2 ILE B 231     -38.066 -28.829  12.913  1.00  0.90           C
ATOM   1820  CD1 ILE B 231     -39.797 -26.842  14.642  1.00  0.90           C
ATOM   1821  N   GLY B 232     -40.244 -26.419   9.781  1.00  0.88           N
ATOM   1822  CA  GLY B 232     -41.070 -25.390   9.135  1.00  0.88           C
ATOM   1823  C   GLY B 232     -40.510 -24.918   7.824  1.00  0.88           C
ATOM   1824  O   GLY B 232     -41.091 -24.081   7.148  1.00  0.88           O
ATOM   1825  N   PHE B 233     -39.369 -25.492   7.428  1.00  0.87           N
ATOM   1826  CA  PHE B 233     -38.744 -25.288   6.147  1.00  0.87           C
ATOM   1827  C   PHE B 233     -39.328 -26.300   5.186  1.00  0.87           C
ATOM   1828  O   PHE B 233     -39.227 -27.507   5.396  1.00  0.87           O
ATOM   1829  CB  PHE B 233     -37.202 -25.458   6.239  1.00  0.87           C
ATOM   1830  CG  PHE B 233     -36.535 -24.236   6.815  1.00  0.87           C
ATOM   1831  CD1 PHE B 233     -36.813 -23.745   8.104  1.00  0.87           C
ATOM   1832  CD2 PHE B 233     -35.591 -23.550   6.040  1.00  0.87           C
ATOM   1833  CE1 PHE B 233     -36.209 -22.577   8.580  1.00  0.87           C
ATOM   1834  CE2 PHE B 233     -35.002 -22.370   6.496  1.00  0.87           C
ATOM   1835  CZ  PHE B 233     -35.315 -21.881   7.766  1.00  0.87           C
ATOM   1836  N   ASP B 234     -39.989 -25.822   4.118  1.00  0.89           N
ATOM   1837  CA  ASP B 234     -40.771 -26.634   3.224  1.00  0.89           C
ATOM   1838  C   ASP B 234     -39.983 -27.080   2.008  1.00  0.89           C
ATOM   1839  O   ASP B 234     -40.433 -27.918   1.237  1.00  0.89           O
ATOM   1840  CB  ASP B 234     -42.075 -25.875   2.839  1.00  0.89           C
ATOM   1841  CG  ASP B 234     -41.890 -24.511   2.212  1.00  0.89           C
ATOM   1842  OD1 ASP B 234     -41.069 -23.690   2.681  1.00  0.89           O
ATOM   1843  OD2 ASP B 234     -42.606 -24.266   1.217  1.00  0.89           O
ATOM   1844  N   TYR B 235     -38.754 -26.578   1.823  1.00  0.91           N
ATOM   1845  CA  TYR B 235     -38.020 -26.807   0.598  1.00  0.91           C
ATOM   1846  C   TYR B 235     -36.588 -27.268   0.800  1.00  0.91           C
ATOM   1847  O   TYR B 235     -35.940 -27.029   1.818  1.00  0.91           O
ATOM   1848  CB  TYR B 235     -37.971 -25.487  -0.200  1.00  0.91           C
ATOM   1849  CG  TYR B 235     -38.995 -25.470  -1.283  1.00  0.91           C
ATOM   1850  CD1 TYR B 235     -40.331 -25.250  -0.961  1.00  0.91           C
ATOM   1851  CD2 TYR B 235     -38.655 -25.592  -2.632  1.00  0.91           C
ATOM   1852  CE1 TYR B 235     -41.309 -25.126  -1.952  1.00  0.91           C
ATOM   1853  CE2 TYR B 235     -39.596 -25.354  -3.634  1.00  0.91           C
ATOM   1854  CZ  TYR B 235     -40.925 -25.140  -3.296  1.00  0.91           C
ATOM   1855  OH  TYR B 235     -41.860 -24.941  -4.323  1.00  0.91           O
ATOM   1856  N   VAL B 236     -36.039 -27.922  -0.242  1.00  0.93           N
ATOM   1857  CA  VAL B 236     -34.654 -28.368  -0.300  1.00  0.93           C
ATOM   1858  C   VAL B 236     -33.856 -27.443  -1.225  1.00  0.93           C
ATOM   1859  O   VAL B 236     -34.130 -27.345  -2.412  1.00  0.93           O
ATOM   1860  CB  VAL B 236     -34.550 -29.800  -0.819  1.00  0.93           C
ATOM   1861  CG1 VAL B 236     -33.129 -30.357  -0.603  1.00  0.93           C
ATOM   1862  CG2 VAL B 236     -35.571 -30.702  -0.099  1.00  0.93           C
ATOM   1863  N   TYR B 237     -32.863 -26.709  -0.681  1.00  0.91           N
ATOM   1864  CA  TYR B 237     -32.159 -25.594  -1.301  1.00  0.91           C
ATOM   1865  C   TYR B 237     -31.078 -25.952  -2.294  1.00  0.91           C
ATOM   1866  O   TYR B 237     -30.901 -25.299  -3.317  1.00  0.91           O
ATOM   1867  CB  TYR B 237     -31.453 -24.753  -0.193  1.00  0.91           C
ATOM   1868  CG  TYR B 237     -30.835 -23.510  -0.783  1.00  0.91           C
ATOM   1869  CD1 TYR B 237     -29.444 -23.347  -0.927  1.00  0.91           C
ATOM   1870  CD2 TYR B 237     -31.692 -22.589  -1.384  1.00  0.91           C
ATOM   1871  CE1 TYR B 237     -28.930 -22.229  -1.605  1.00  0.91           C
ATOM   1872  CE2 TYR B 237     -31.177 -21.511  -2.103  1.00  0.91           C
ATOM   1873  CZ  TYR B 237     -29.800 -21.290  -2.168  1.00  0.91           C
ATOM   1874  OH  TYR B 237     -29.333 -20.089  -2.735  1.00  0.91           O
ATOM   1875  N   ASN B 238     -30.260 -26.945  -1.959  1.00  0.91           N
ATOM   1876  CA  ASN B 238     -29.297 -27.466  -2.890  1.00  0.91           C
ATOM   1877  C   ASN B 238     -29.152 -28.951  -2.610  1.00  0.91           C
ATOM   1878  O   ASN B 238     -28.350 -29.362  -1.762  1.00  0.91           O
ATOM   1879  CB  ASN B 238     -27.935 -26.738  -2.808  1.00  0.91           C
ATOM   1880  CG  ASN B 238     -27.764 -25.790  -3.990  1.00  0.91           C
ATOM   1881  OD1 ASN B 238     -27.290 -26.210  -5.043  1.00  0.91           O
ATOM   1882  ND2 ASN B 238     -28.152 -24.506  -3.850  1.00  0.91           N
ATOM   1883  N   PRO B 239     -29.961 -29.776  -3.267  1.00  0.97           N
ATOM   1884  CA  PRO B 239     -29.726 -31.199  -3.356  1.00  0.97           C
ATOM   1885  C   PRO B 239     -28.774 -31.518  -4.481  1.00  0.97           C
ATOM   1886  O   PRO B 239     -28.638 -30.757  -5.435  1.00  0.97           O
ATOM   1887  CB  PRO B 239     -31.116 -31.765  -3.662  1.00  0.97           C
ATOM   1888  CG  PRO B 239     -31.788 -30.681  -4.499  1.00  0.97           C
ATOM   1889  CD  PRO B 239     -31.221 -29.387  -3.918  1.00  0.97           C
ATOM   1890  N   PHE B 240     -28.121 -32.679  -4.366  1.00  0.93           N
ATOM   1891  CA  PHE B 240     -27.286 -33.241  -5.393  1.00  0.93           C
ATOM   1892  C   PHE B 240     -27.894 -34.584  -5.744  1.00  0.93           C
ATOM   1893  O   PHE B 240     -28.783 -35.086  -5.054  1.00  0.93           O
ATOM   1894  CB  PHE B 240     -25.828 -33.451  -4.918  1.00  0.93           C
ATOM   1895  CG  PHE B 240     -25.140 -32.157  -4.593  1.00  0.93           C
ATOM   1896  CD1 PHE B 240     -25.265 -31.576  -3.320  1.00  0.93           C
ATOM   1897  CD2 PHE B 240     -24.329 -31.527  -5.548  1.00  0.93           C
ATOM   1898  CE1 PHE B 240     -24.592 -30.388  -3.007  1.00  0.93           C
ATOM   1899  CE2 PHE B 240     -23.662 -30.334  -5.243  1.00  0.93           C
ATOM   1900  CZ  PHE B 240     -23.795 -29.764  -3.972  1.00  0.93           C
ATOM   1901  N   MET B 241     -27.468 -35.199  -6.852  1.00  0.92           N
ATOM   1902  CA  MET B 241     -28.018 -36.468  -7.266  1.00  0.92           C
ATOM   1903  C   MET B 241     -27.105 -37.169  -8.239  1.00  0.92           C
ATOM   1904  O   MET B 241     -26.258 -36.557  -8.891  1.00  0.92           O
ATOM   1905  CB  MET B 241     -29.425 -36.296  -7.893  1.00  0.92           C
ATOM   1906  CG  MET B 241     -29.455 -35.315  -9.078  1.00  0.92           C
ATOM   1907  SD  MET B 241     -30.916 -34.241  -9.177  1.00  0.92           S
ATOM   1908  CE  MET B 241     -30.479 -33.186  -7.761  1.00  0.92           C
ATOM   1909  N   ILE B 242     -27.249 -38.499  -8.355  1.00  0.92           N
ATOM   1910  CA  ILE B 242     -26.537 -39.257  -9.359  1.00  0.92           C
ATOM   1911  C   ILE B 242     -27.388 -40.420  -9.809  1.00  0.92           C
ATOM   1912  O   ILE B 242     -28.051 -41.090  -9.016  1.00  0.92           O
ATOM   1913  CB  ILE B 242     -25.132 -39.685  -8.916  1.00  0.92           C
ATOM   1914  CG1 ILE B 242     -24.224 -40.154 -10.079  1.00  0.92           C
ATOM   1915  CG2 ILE B 242     -25.184 -40.751  -7.803  1.00  0.92           C
ATOM   1916  CD1 ILE B 242     -24.174 -39.180 -11.260  1.00  0.92           C
ATOM   1917  N   ASP B 243     -27.416 -40.666 -11.131  1.00  0.91           N
ATOM   1918  CA  ASP B 243     -28.087 -41.800 -11.713  1.00  0.91           C
ATOM   1919  C   ASP B 243     -27.131 -42.976 -11.797  1.00  0.91           C
ATOM   1920  O   ASP B 243     -26.008 -42.893 -12.290  1.00  0.91           O
ATOM   1921  CB  ASP B 243     -28.707 -41.423 -13.081  1.00  0.91           C
ATOM   1922  CG  ASP B 243     -29.655 -42.483 -13.637  1.00  0.91           C
ATOM   1923  OD1 ASP B 243     -29.620 -43.642 -13.161  1.00  0.91           O
ATOM   1924  OD2 ASP B 243     -30.426 -42.136 -14.561  1.00  0.91           O
ATOM   1925  N   VAL B 244     -27.604 -44.107 -11.255  1.00  0.93           N
ATOM   1926  CA  VAL B 244     -26.951 -45.388 -11.279  1.00  0.93           C
ATOM   1927  C   VAL B 244     -26.967 -45.983 -12.681  1.00  0.93           C
ATOM   1928  O   VAL B 244     -25.955 -46.469 -13.172  1.00  0.93           O
ATOM   1929  CB  VAL B 244     -27.625 -46.274 -10.242  1.00  0.93           C
ATOM   1930  CG1 VAL B 244     -27.210 -47.746 -10.363  1.00  0.93           C
ATOM   1931  CG2 VAL B 244     -27.246 -45.742  -8.842  1.00  0.93           C
ATOM   1932  N   GLN B 245     -28.100 -45.907 -13.411  1.00  0.87           N
ATOM   1933  CA  GLN B 245     -28.294 -46.498 -14.734  1.00  0.87           C
ATOM   1934  C   GLN B 245     -27.322 -45.935 -15.749  1.00  0.87           C
ATOM   1935  O   GLN B 245     -26.751 -46.654 -16.572  1.00  0.87           O
ATOM   1936  CB  GLN B 245     -29.761 -46.291 -15.170  1.00  0.87           C
ATOM   1937  CG  GLN B 245     -30.161 -46.807 -16.574  1.00  0.87           C
ATOM   1938  CD  GLN B 245     -30.218 -45.707 -17.638  1.00  0.87           C
ATOM   1939  OE1 GLN B 245     -30.802 -44.637 -17.469  1.00  0.87           O
ATOM   1940  NE2 GLN B 245     -29.635 -45.983 -18.826  1.00  0.87           N
ATOM   1941  N   GLN B 246     -27.036 -44.630 -15.608  1.00  0.86           N
ATOM   1942  CA  GLN B 246     -26.022 -43.865 -16.303  1.00  0.86           C
ATOM   1943  C   GLN B 246     -24.589 -44.415 -16.205  1.00  0.86           C
ATOM   1944  O   GLN B 246     -23.689 -43.983 -16.923  1.00  0.86           O
ATOM   1945  CB  GLN B 246     -26.100 -42.417 -15.764  1.00  0.86           C
ATOM   1946  CG  GLN B 246     -25.646 -41.332 -16.770  1.00  0.86           C
ATOM   1947  CD  GLN B 246     -26.750 -40.302 -17.008  1.00  0.86           C
ATOM   1948  OE1 GLN B 246     -27.702 -40.555 -17.748  1.00  0.86           O
ATOM   1949  NE2 GLN B 246     -26.638 -39.115 -16.372  1.00  0.86           N
ATOM   1950  N   TRP B 247     -24.345 -45.443 -15.361  1.00  0.86           N
ATOM   1951  CA  TRP B 247     -23.059 -46.106 -15.252  1.00  0.86           C
ATOM   1952  C   TRP B 247     -22.917 -47.327 -16.157  1.00  0.86           C
ATOM   1953  O   TRP B 247     -21.935 -48.058 -16.060  1.00  0.86           O
ATOM   1954  CB  TRP B 247     -22.715 -46.484 -13.787  1.00  0.86           C
ATOM   1955  CG  TRP B 247     -22.609 -45.285 -12.858  1.00  0.86           C
ATOM   1956  CD1 TRP B 247     -22.368 -43.975 -13.172  1.00  0.86           C
ATOM   1957  CD2 TRP B 247     -22.777 -45.357 -11.446  1.00  0.86           C
ATOM   1958  NE1 TRP B 247     -22.401 -43.212 -12.034  1.00  0.86           N
ATOM   1959  CE2 TRP B 247     -22.659 -44.011 -10.957  1.00  0.86           C
ATOM   1960  CE3 TRP B 247     -23.007 -46.410 -10.575  1.00  0.86           C
ATOM   1961  CZ2 TRP B 247     -22.801 -43.749  -9.614  1.00  0.86           C
ATOM   1962  CZ3 TRP B 247     -23.169 -46.126  -9.218  1.00  0.86           C
ATOM   1963  CH2 TRP B 247     -23.073 -44.806  -8.742  1.00  0.86           C
ATOM   1964  N   GLY B 248     -23.858 -47.547 -17.104  1.00  0.89           N
ATOM   1965  CA  GLY B 248     -23.694 -48.515 -18.195  1.00  0.89           C
ATOM   1966  C   GLY B 248     -24.122 -49.932 -17.940  1.00  0.89           C
ATOM   1967  O   GLY B 248     -23.703 -50.857 -18.626  1.00  0.89           O
ATOM   1968  N   PHE B 249     -24.994 -50.152 -16.958  1.00  0.91           N
ATOM   1969  CA  PHE B 249     -25.651 -51.424 -16.721  1.00  0.91           C
ATOM   1970  C   PHE B 249     -26.528 -51.953 -17.873  1.00  0.91           C
ATOM   1971  O   PHE B 249     -27.179 -51.197 -18.586  1.00  0.91           O
ATOM   1972  CB  PHE B 249     -26.568 -51.256 -15.510  1.00  0.91           C
ATOM   1973  CG  PHE B 249     -25.803 -50.950 -14.261  1.00  0.91           C
ATOM   1974  CD1 PHE B 249     -25.623 -49.621 -13.853  1.00  0.91           C
ATOM   1975  CD2 PHE B 249     -25.370 -51.986 -13.422  1.00  0.91           C
ATOM   1976  CE1 PHE B 249     -25.096 -49.338 -12.592  1.00  0.91           C
ATOM   1977  CE2 PHE B 249     -24.893 -51.694 -12.138  1.00  0.91           C
ATOM   1978  CZ  PHE B 249     -24.770 -50.366 -11.721  1.00  0.91           C
ATOM   1979  N   THR B 250     -26.571 -53.290 -18.071  1.00  0.88           N
ATOM   1980  CA  THR B 250     -27.315 -53.921 -19.165  1.00  0.88           C
ATOM   1981  C   THR B 250     -28.829 -53.991 -19.030  1.00  0.88           C
ATOM   1982  O   THR B 250     -29.548 -53.702 -19.981  1.00  0.88           O
ATOM   1983  CB  THR B 250     -26.872 -55.364 -19.409  1.00  0.88           C
ATOM   1984  OG1 THR B 250     -26.857 -56.117 -18.198  1.00  0.88           O
ATOM   1985  CG2 THR B 250     -25.445 -55.384 -19.968  1.00  0.88           C
ATOM   1986  N   GLY B 251     -29.358 -54.436 -17.869  1.00  0.94           N
ATOM   1987  CA  GLY B 251     -30.781 -54.737 -17.722  1.00  0.94           C
ATOM   1988  C   GLY B 251     -31.561 -53.672 -17.002  1.00  0.94           C
ATOM   1989  O   GLY B 251     -31.164 -52.517 -16.900  1.00  0.94           O
ATOM   1990  N   ASN B 252     -32.725 -54.054 -16.445  1.00  0.90           N
ATOM   1991  CA  ASN B 252     -33.500 -53.206 -15.568  1.00  0.90           C
ATOM   1992  C   ASN B 252     -32.972 -53.310 -14.142  1.00  0.90           C
ATOM   1993  O   ASN B 252     -32.175 -54.181 -13.817  1.00  0.90           O
ATOM   1994  CB  ASN B 252     -35.020 -53.527 -15.669  1.00  0.90           C
ATOM   1995  CG  ASN B 252     -35.350 -54.972 -15.297  1.00  0.90           C
ATOM   1996  OD1 ASN B 252     -34.838 -55.929 -15.877  1.00  0.90           O
ATOM   1997  ND2 ASN B 252     -36.258 -55.159 -14.314  1.00  0.90           N
ATOM   1998  N   LEU B 253     -33.392 -52.407 -13.231  1.00  0.91           N
ATOM   1999  CA  LEU B 253     -32.846 -52.372 -11.882  1.00  0.91           C
ATOM   2000  C   LEU B 253     -33.017 -53.662 -11.095  1.00  0.91           C
ATOM   2001  O   LEU B 253     -32.067 -54.166 -10.504  1.00  0.91           O
ATOM   2002  CB  LEU B 253     -33.461 -51.164 -11.145  1.00  0.91           C
ATOM   2003  CG  LEU B 253     -33.258 -51.060  -9.627  1.00  0.91           C
ATOM   2004  CD1 LEU B 253     -32.978 -49.612  -9.215  1.00  0.91           C
ATOM   2005  CD2 LEU B 253     -34.518 -51.557  -8.918  1.00  0.91           C
ATOM   2006  N   GLN B 254     -34.215 -54.268 -11.144  1.00  0.89           N
ATOM   2007  CA  GLN B 254     -34.540 -55.486 -10.428  1.00  0.89           C
ATOM   2008  C   GLN B 254     -33.650 -56.683 -10.758  1.00  0.89           C
ATOM   2009  O   GLN B 254     -33.131 -57.348  -9.874  1.00  0.89           O
ATOM   2010  CB  GLN B 254     -36.003 -55.826 -10.782  1.00  0.89           C
ATOM   2011  CG  GLN B 254     -36.580 -57.065 -10.057  1.00  0.89           C
ATOM   2012  CD  GLN B 254     -37.622 -56.818  -8.958  1.00  0.89           C
ATOM   2013  OE1 GLN B 254     -37.918 -57.725  -8.181  1.00  0.89           O
ATOM   2014  NE2 GLN B 254     -38.265 -55.633  -8.911  1.00  0.89           N
ATOM   2015  N   SER B 255     -33.378 -56.960 -12.051  1.00  0.91           N
ATOM   2016  CA  SER B 255     -32.541 -58.088 -12.440  1.00  0.91           C
ATOM   2017  C   SER B 255     -31.111 -57.986 -11.962  1.00  0.91           C
ATOM   2018  O   SER B 255     -30.497 -58.965 -11.546  1.00  0.91           O
ATOM   2019  CB  SER B 255     -32.489 -58.282 -13.977  1.00  0.91           C
ATOM   2020  OG  SER B 255     -32.116 -57.086 -14.663  1.00  0.91           O
ATOM   2021  N   ASN B 256     -30.544 -56.774 -12.033  1.00  0.89           N
ATOM   2022  CA  ASN B 256     -29.218 -56.469 -11.544  1.00  0.89           C
ATOM   2023  C   ASN B 256     -29.157 -56.497 -10.018  1.00  0.89           C
ATOM   2024  O   ASN B 256     -28.209 -57.012  -9.433  1.00  0.89           O
ATOM   2025  CB  ASN B 256     -28.774 -55.080 -12.067  1.00  0.89           C
ATOM   2026  CG  ASN B 256     -28.629 -55.053 -13.586  1.00  0.89           C
ATOM   2027  OD1 ASN B 256     -28.858 -56.011 -14.312  1.00  0.89           O
ATOM   2028  ND2 ASN B 256     -28.220 -53.869 -14.100  1.00  0.89           N
ATOM   2029  N   HIS B 257     -30.177 -55.937  -9.328  1.00  0.89           N
ATOM   2030  CA  HIS B 257     -30.228 -55.881  -7.871  1.00  0.89           C
ATOM   2031  C   HIS B 257     -30.276 -57.271  -7.247  1.00  0.89           C
ATOM   2032  O   HIS B 257     -29.494 -57.589  -6.352  1.00  0.89           O
ATOM   2033  CB  HIS B 257     -31.428 -55.028  -7.384  1.00  0.89           C
ATOM   2034  CG  HIS B 257     -31.606 -55.062  -5.897  1.00  0.89           C
ATOM   2035  ND1 HIS B 257     -30.772 -54.362  -5.039  1.00  0.89           N
ATOM   2036  CD2 HIS B 257     -32.355 -55.953  -5.205  1.00  0.89           C
ATOM   2037  CE1 HIS B 257     -31.042 -54.851  -3.846  1.00  0.89           C
ATOM   2038  NE2 HIS B 257     -31.983 -55.820  -3.891  1.00  0.89           N
ATOM   2039  N   ASP B 258     -31.143 -58.146  -7.787  1.00  0.90           N
ATOM   2040  CA  ASP B 258     -31.395 -59.492  -7.313  1.00  0.90           C
ATOM   2041  C   ASP B 258     -30.198 -60.436  -7.394  1.00  0.90           C
ATOM   2042  O   ASP B 258     -30.107 -61.409  -6.650  1.00  0.90           O
ATOM   2043  CB  ASP B 258     -32.575 -60.090  -8.115  1.00  0.90           C
ATOM   2044  CG  ASP B 258     -33.912 -59.436  -7.770  1.00  0.90           C
ATOM   2045  OD1 ASP B 258     -33.927 -58.386  -7.081  1.00  0.90           O
ATOM   2046  OD2 ASP B 258     -34.942 -59.997  -8.225  1.00  0.90           O
ATOM   2047  N   LEU B 259     -29.218 -60.180  -8.289  1.00  0.89           N
ATOM   2048  CA  LEU B 259     -27.979 -60.942  -8.320  1.00  0.89           C
ATOM   2049  C   LEU B 259     -27.161 -60.758  -7.057  1.00  0.89           C
ATOM   2050  O   LEU B 259     -26.582 -61.697  -6.516  1.00  0.89           O
ATOM   2051  CB  LEU B 259     -27.097 -60.548  -9.534  1.00  0.89           C
ATOM   2052  CG  LEU B 259     -25.756 -61.314  -9.658  1.00  0.89           C
ATOM   2053  CD1 LEU B 259     -25.964 -62.821  -9.873  1.00  0.89           C
ATOM   2054  CD2 LEU B 259     -24.888 -60.731 -10.782  1.00  0.89           C
ATOM   2055  N   TYR B 260     -27.084 -59.513  -6.559  1.00  0.88           N
ATOM   2056  CA  TYR B 260     -26.191 -59.196  -5.471  1.00  0.88           C
ATOM   2057  C   TYR B 260     -26.916 -59.188  -4.153  1.00  0.88           C
ATOM   2058  O   TYR B 260     -26.296 -59.278  -3.096  1.00  0.88           O
ATOM   2059  CB  TYR B 260     -25.635 -57.762  -5.645  1.00  0.88           C
ATOM   2060  CG  TYR B 260     -24.949 -57.551  -6.968  1.00  0.88           C
ATOM   2061  CD1 TYR B 260     -24.049 -58.497  -7.490  1.00  0.88           C
ATOM   2062  CD2 TYR B 260     -25.165 -56.358  -7.682  1.00  0.88           C
ATOM   2063  CE1 TYR B 260     -23.344 -58.232  -8.671  1.00  0.88           C
ATOM   2064  CE2 TYR B 260     -24.455 -56.090  -8.862  1.00  0.88           C
ATOM   2065  CZ  TYR B 260     -23.523 -57.018  -9.340  1.00  0.88           C
ATOM   2066  OH  TYR B 260     -22.714 -56.732 -10.459  1.00  0.88           O
ATOM   2067  N   CYS B 261     -28.251 -59.053  -4.170  1.00  0.93           N
ATOM   2068  CA  CYS B 261     -28.987 -58.981  -2.935  1.00  0.93           C
ATOM   2069  C   CYS B 261     -30.275 -59.761  -2.941  1.00  0.93           C
ATOM   2070  O   CYS B 261     -31.240 -59.395  -3.601  1.00  0.93           O
ATOM   2071  CB  CYS B 261     -29.253 -57.495  -2.593  1.00  0.93           C
ATOM   2072  SG  CYS B 261     -30.193 -57.206  -1.049  1.00  0.93           S
ATOM   2073  N   GLN B 262     -30.350 -60.811  -2.100  1.00  0.86           N
ATOM   2074  CA  GLN B 262     -31.555 -61.616  -2.002  1.00  0.86           C
ATOM   2075  C   GLN B 262     -32.390 -61.222  -0.790  1.00  0.86           C
ATOM   2076  O   GLN B 262     -33.488 -61.731  -0.581  1.00  0.86           O
ATOM   2077  CB  GLN B 262     -31.259 -63.146  -1.977  1.00  0.86           C
ATOM   2078  CG  GLN B 262     -29.790 -63.564  -1.725  1.00  0.86           C
ATOM   2079  CD  GLN B 262     -28.915 -63.597  -2.980  1.00  0.86           C
ATOM   2080  OE1 GLN B 262     -29.358 -63.973  -4.067  1.00  0.86           O
ATOM   2081  NE2 GLN B 262     -27.618 -63.256  -2.816  1.00  0.86           N
ATOM   2082  N   VAL B 263     -31.893 -60.284   0.039  1.00  0.90           N
ATOM   2083  CA  VAL B 263     -32.606 -59.739   1.187  1.00  0.90           C
ATOM   2084  C   VAL B 263     -33.799 -58.868   0.825  1.00  0.90           C
ATOM   2085  O   VAL B 263     -34.848 -58.916   1.467  1.00  0.90           O
ATOM   2086  CB  VAL B 263     -31.644 -58.992   2.100  1.00  0.90           C
ATOM   2087  CG1 VAL B 263     -32.370 -58.084   3.113  1.00  0.90           C
ATOM   2088  CG2 VAL B 263     -30.814 -60.045   2.854  1.00  0.90           C
ATOM   2089  N   HIS B 264     -33.673 -58.032  -0.219  1.00  0.84           N
ATOM   2090  CA  HIS B 264     -34.739 -57.121  -0.598  1.00  0.84           C
ATOM   2091  C   HIS B 264     -35.647 -57.805  -1.600  1.00  0.84           C
ATOM   2092  O   HIS B 264     -35.305 -57.915  -2.772  1.00  0.84           O
ATOM   2093  CB  HIS B 264     -34.254 -55.791  -1.249  1.00  0.84           C
ATOM   2094  CG  HIS B 264     -33.245 -54.964  -0.492  1.00  0.84           C
ATOM   2095  ND1 HIS B 264     -32.701 -55.392   0.703  1.00  0.84           N
ATOM   2096  CD2 HIS B 264     -32.688 -53.777  -0.844  1.00  0.84           C
ATOM   2097  CE1 HIS B 264     -31.838 -54.473   1.058  1.00  0.84           C
ATOM   2098  NE2 HIS B 264     -31.784 -53.475   0.155  1.00  0.84           N
ATOM   2099  N   GLY B 265     -36.832 -58.290  -1.173  1.00  0.83           N
ATOM   2100  CA  GLY B 265     -37.832 -58.815  -2.100  1.00  0.83           C
ATOM   2101  C   GLY B 265     -38.544 -57.748  -2.891  1.00  0.83           C
ATOM   2102  O   GLY B 265     -38.291 -56.558  -2.733  1.00  0.83           O
ATOM   2103  N   ASN B 266     -39.512 -58.144  -3.736  1.00  0.72           N
ATOM   2104  CA  ASN B 266     -40.250 -57.199  -4.544  1.00  0.72           C
ATOM   2105  C   ASN B 266     -41.666 -56.992  -4.051  1.00  0.72           C
ATOM   2106  O   ASN B 266     -42.524 -57.872  -4.092  1.00  0.72           O
ATOM   2107  CB  ASN B 266     -40.296 -57.644  -6.023  1.00  0.72           C
ATOM   2108  CG  ASN B 266     -40.791 -56.505  -6.907  1.00  0.72           C
ATOM   2109  OD1 ASN B 266     -40.294 -55.382  -6.843  1.00  0.72           O
ATOM   2110  ND2 ASN B 266     -41.835 -56.767  -7.722  1.00  0.72           N
ATOM   2111  N   ALA B 267     -41.947 -55.758  -3.637  1.00  0.91           N
ATOM   2112  CA  ALA B 267     -43.279 -55.237  -3.578  1.00  0.91           C
ATOM   2113  C   ALA B 267     -43.195 -53.965  -4.365  1.00  0.91           C
ATOM   2114  O   ALA B 267     -42.243 -53.213  -4.189  1.00  0.91           O
ATOM   2115  CB  ALA B 267     -43.684 -54.967  -2.122  1.00  0.91           C
ATOM   2116  N   HIS B 268     -44.154 -53.662  -5.258  1.00  0.80           N
ATOM   2117  CA  HIS B 268     -43.959 -52.570  -6.207  1.00  0.80           C
ATOM   2118  C   HIS B 268     -44.366 -51.232  -5.595  1.00  0.80           C
ATOM   2119  O   HIS B 268     -44.810 -50.302  -6.254  1.00  0.80           O
ATOM   2120  CB  HIS B 268     -44.677 -52.850  -7.563  1.00  0.80           C
ATOM   2121  CG  HIS B 268     -43.859 -52.628  -8.808  1.00  0.80           C
ATOM   2122  ND1 HIS B 268     -42.622 -52.047  -8.718  1.00  0.80           N
ATOM   2123  CD2 HIS B 268     -44.186 -52.812 -10.114  1.00  0.80           C
ATOM   2124  CE1 HIS B 268     -42.208 -51.866  -9.950  1.00  0.80           C
ATOM   2125  NE2 HIS B 268     -43.124 -52.317 -10.844  1.00  0.80           N
ATOM   2126  N   VAL B 269     -44.242 -51.126  -4.261  1.00  0.89           N
ATOM   2127  CA  VAL B 269     -44.331 -49.917  -3.483  1.00  0.89           C
ATOM   2128  C   VAL B 269     -43.070 -49.111  -3.741  1.00  0.89           C
ATOM   2129  O   VAL B 269     -41.975 -49.657  -3.661  1.00  0.89           O
ATOM   2130  CB  VAL B 269     -44.429 -50.225  -1.982  1.00  0.89           C
ATOM   2131  CG1 VAL B 269     -45.063 -49.051  -1.215  1.00  0.89           C
ATOM   2132  CG2 VAL B 269     -45.244 -51.514  -1.741  1.00  0.89           C
ATOM   2133  N   ALA B 270     -43.174 -47.800  -4.021  1.00  0.96           N
ATOM   2134  CA  ALA B 270     -42.068 -46.967  -4.466  1.00  0.96           C
ATOM   2135  C   ALA B 270     -40.810 -46.974  -3.603  1.00  0.96           C
ATOM   2136  O   ALA B 270     -39.698 -46.881  -4.112  1.00  0.96           O
ATOM   2137  CB  ALA B 270     -42.554 -45.518  -4.637  1.00  0.96           C
ATOM   2138  N   SER B 271     -40.921 -47.101  -2.258  1.00  0.94           N
ATOM   2139  CA  SER B 271     -39.741 -47.272  -1.415  1.00  0.94           C
ATOM   2140  C   SER B 271     -38.889 -48.457  -1.784  1.00  0.94           C
ATOM   2141  O   SER B 271     -37.665 -48.373  -1.761  1.00  0.94           O
ATOM   2142  CB  SER B 271     -40.046 -47.370   0.101  1.00  0.94           C
ATOM   2143  OG  SER B 271     -40.906 -48.476   0.404  1.00  0.94           O
ATOM   2144  N   CYS B 272     -39.489 -49.582  -2.189  1.00  0.93           N
ATOM   2145  CA  CYS B 272     -38.752 -50.780  -2.520  1.00  0.93           C
ATOM   2146  C   CYS B 272     -37.758 -50.594  -3.673  1.00  0.93           C
ATOM   2147  O   CYS B 272     -36.577 -50.902  -3.523  1.00  0.93           O
ATOM   2148  CB  CYS B 272     -39.774 -51.891  -2.833  1.00  0.93           C
ATOM   2149  SG  CYS B 272     -39.052 -53.546  -3.029  1.00  0.93           S
ATOM   2150  N   ASP B 273     -38.195 -49.990  -4.804  1.00  0.91           N
ATOM   2151  CA  ASP B 273     -37.345 -49.673  -5.941  1.00  0.91           C
ATOM   2152  C   ASP B 273     -36.248 -48.670  -5.550  1.00  0.91           C
ATOM   2153  O   ASP B 273     -35.064 -48.880  -5.811  1.00  0.91           O
ATOM   2154  CB  ASP B 273     -38.213 -49.187  -7.141  1.00  0.91           C
ATOM   2155  CG  ASP B 273     -38.418 -50.292  -8.177  1.00  0.91           C
ATOM   2156  OD1 ASP B 273     -37.669 -50.320  -9.189  1.00  0.91           O
ATOM   2157  OD2 ASP B 273     -39.298 -51.159  -7.951  1.00  0.91           O
ATOM   2158  N   ALA B 274     -36.605 -47.606  -4.791  1.00  0.95           N
ATOM   2159  CA  ALA B 274     -35.660 -46.669  -4.200  1.00  0.95           C
ATOM   2160  C   ALA B 274     -34.603 -47.304  -3.263  1.00  0.95           C
ATOM   2161  O   ALA B 274     -33.421 -46.963  -3.333  1.00  0.95           O
ATOM   2162  CB  ALA B 274     -36.435 -45.547  -3.482  1.00  0.95           C
ATOM   2163  N   ILE B 275     -34.973 -48.277  -2.381  1.00  0.91           N
ATOM   2164  CA  ILE B 275     -34.044 -49.076  -1.569  1.00  0.91           C
ATOM   2165  C   ILE B 275     -33.083 -49.867  -2.441  1.00  0.91           C
ATOM   2166  O   ILE B 275     -31.868 -49.851  -2.217  1.00  0.91           O
ATOM   2167  CB  ILE B 275     -34.726 -50.090  -0.626  1.00  0.91           C
ATOM   2168  CG1 ILE B 275     -35.663 -49.461   0.421  1.00  0.91           C
ATOM   2169  CG2 ILE B 275     -33.691 -50.875   0.207  1.00  0.91           C
ATOM   2170  CD1 ILE B 275     -36.654 -50.469   1.023  1.00  0.91           C
ATOM   2171  N   MET B 276     -33.600 -50.549  -3.486  1.00  0.90           N
ATOM   2172  CA  MET B 276     -32.785 -51.327  -4.401  1.00  0.90           C
ATOM   2173  C   MET B 276     -31.727 -50.492  -5.098  1.00  0.90           C
ATOM   2174  O   MET B 276     -30.555 -50.868  -5.115  1.00  0.90           O
ATOM   2175  CB  MET B 276     -33.640 -52.009  -5.480  1.00  0.90           C
ATOM   2176  CG  MET B 276     -34.475 -53.199  -4.986  1.00  0.90           C
ATOM   2177  SD  MET B 276     -35.291 -54.075  -6.357  1.00  0.90           S
ATOM   2178  CE  MET B 276     -36.117 -55.357  -5.374  1.00  0.90           C
ATOM   2179  N   THR B 277     -32.076 -49.285  -5.598  1.00  0.91           N
ATOM   2180  CA  THR B 277     -31.125 -48.374  -6.239  1.00  0.91           C
ATOM   2181  C   THR B 277     -29.945 -48.048  -5.360  1.00  0.91           C
ATOM   2182  O   THR B 277     -28.793 -48.051  -5.783  1.00  0.91           O
ATOM   2183  CB  THR B 277     -31.715 -47.022  -6.639  1.00  0.91           C
ATOM   2184  OG1 THR B 277     -33.058 -47.154  -7.054  1.00  0.91           O
ATOM   2185  CG2 THR B 277     -30.957 -46.461  -7.842  1.00  0.91           C
ATOM   2186  N   ARG B 278     -30.209 -47.784  -4.066  1.00  0.85           N
ATOM   2187  CA  ARG B 278     -29.150 -47.564  -3.116  1.00  0.85           C
ATOM   2188  C   ARG B 278     -28.298 -48.791  -2.817  1.00  0.85           C
ATOM   2189  O   ARG B 278     -27.075 -48.722  -2.758  1.00  0.85           O
ATOM   2190  CB  ARG B 278     -29.709 -46.996  -1.796  1.00  0.85           C
ATOM   2191  CG  ARG B 278     -28.720 -45.972  -1.221  1.00  0.85           C
ATOM   2192  CD  ARG B 278     -29.015 -45.486   0.193  1.00  0.85           C
ATOM   2193  NE  ARG B 278     -27.918 -45.947   1.097  1.00  0.85           N
ATOM   2194  CZ  ARG B 278     -27.876 -47.130   1.715  1.00  0.85           C
ATOM   2195  NH1 ARG B 278     -28.852 -48.022   1.636  1.00  0.85           N
ATOM   2196  NH2 ARG B 278     -26.818 -47.398   2.479  1.00  0.85           N
ATOM   2197  N   CYS B 279     -28.941 -49.954  -2.617  1.00  0.91           N
ATOM   2198  CA  CYS B 279     -28.292 -51.206  -2.274  1.00  0.91           C
ATOM   2199  C   CYS B 279     -27.330 -51.708  -3.350  1.00  0.91           C
ATOM   2200  O   CYS B 279     -26.198 -52.103  -3.082  1.00  0.91           O
ATOM   2201  CB  CYS B 279     -29.388 -52.264  -2.039  1.00  0.91           C
ATOM   2202  SG  CYS B 279     -28.770 -53.797  -1.285  1.00  0.91           S
ATOM   2203  N   LEU B 280     -27.787 -51.644  -4.616  1.00  0.90           N
ATOM   2204  CA  LEU B 280     -27.000 -51.905  -5.804  1.00  0.90           C
ATOM   2205  C   LEU B 280     -25.877 -50.905  -5.994  1.00  0.90           C
ATOM   2206  O   LEU B 280     -24.751 -51.270  -6.327  1.00  0.90           O
ATOM   2207  CB  LEU B 280     -27.917 -51.922  -7.050  1.00  0.90           C
ATOM   2208  CG  LEU B 280     -27.213 -52.222  -8.389  1.00  0.90           C
ATOM   2209  CD1 LEU B 280     -28.108 -53.046  -9.316  1.00  0.90           C
ATOM   2210  CD2 LEU B 280     -26.831 -50.923  -9.094  1.00  0.90           C
ATOM   2211  N   ALA B 281     -26.129 -49.600  -5.757  1.00  0.94           N
ATOM   2212  CA  ALA B 281     -25.088 -48.596  -5.807  1.00  0.94           C
ATOM   2213  C   ALA B 281     -23.992 -48.811  -4.770  1.00  0.94           C
ATOM   2214  O   ALA B 281     -22.808 -48.655  -5.045  1.00  0.94           O
ATOM   2215  CB  ALA B 281     -25.696 -47.193  -5.671  1.00  0.94           C
ATOM   2216  N   VAL B 282     -24.380 -49.237  -3.546  1.00  0.92           N
ATOM   2217  CA  VAL B 282     -23.456 -49.669  -2.511  1.00  0.92           C
ATOM   2218  C   VAL B 282     -22.613 -50.843  -2.983  1.00  0.92           C
ATOM   2219  O   VAL B 282     -21.399 -50.846  -2.806  1.00  0.92           O
ATOM   2220  CB  VAL B 282     -24.208 -49.982  -1.213  1.00  0.92           C
ATOM   2221  CG1 VAL B 282     -23.393 -50.862  -0.243  1.00  0.92           C
ATOM   2222  CG2 VAL B 282     -24.600 -48.656  -0.525  1.00  0.92           C
ATOM   2223  N   HIS B 283     -23.202 -51.844  -3.666  1.00  0.88           N
ATOM   2224  CA  HIS B 283     -22.428 -52.960  -4.186  1.00  0.88           C
ATOM   2225  C   HIS B 283     -21.353 -52.551  -5.197  1.00  0.88           C
ATOM   2226  O   HIS B 283     -20.174 -52.853  -5.049  1.00  0.88           O
ATOM   2227  CB  HIS B 283     -23.373 -53.977  -4.862  1.00  0.88           C
ATOM   2228  CG  HIS B 283     -22.692 -55.228  -5.312  1.00  0.88           C
ATOM   2229  ND1 HIS B 283     -22.105 -55.238  -6.557  1.00  0.88           N
ATOM   2230  CD2 HIS B 283     -22.501 -56.418  -4.690  1.00  0.88           C
ATOM   2231  CE1 HIS B 283     -21.568 -56.431  -6.678  1.00  0.88           C
ATOM   2232  NE2 HIS B 283     -21.776 -57.187  -5.573  1.00  0.88           N
ATOM   2233  N   GLU B 284     -21.746 -51.757  -6.207  1.00  0.88           N
ATOM   2234  CA  GLU B 284     -20.898 -51.371  -7.318  1.00  0.88           C
ATOM   2235  C   GLU B 284     -19.655 -50.599  -6.944  1.00  0.88           C
ATOM   2236  O   GLU B 284     -18.622 -50.640  -7.612  1.00  0.88           O
ATOM   2237  CB  GLU B 284     -21.712 -50.507  -8.297  1.00  0.88           C
ATOM   2238  CG  GLU B 284     -21.973 -51.251  -9.619  1.00  0.88           C
ATOM   2239  CD  GLU B 284     -20.684 -51.575 -10.378  1.00  0.88           C
ATOM   2240  OE1 GLU B 284     -20.542 -52.738 -10.817  1.00  0.88           O
ATOM   2241  OE2 GLU B 284     -19.802 -50.664 -10.517  1.00  0.88           O
ATOM   2242  N   CYS B 285     -19.763 -49.794  -5.887  1.00  0.89           N
ATOM   2243  CA  CYS B 285     -18.667 -49.013  -5.380  1.00  0.89           C
ATOM   2244  C   CYS B 285     -17.944 -49.718  -4.259  1.00  0.89           C
ATOM   2245  O   CYS B 285     -16.722 -49.672  -4.196  1.00  0.89           O
ATOM   2246  CB  CYS B 285     -19.185 -47.642  -4.900  1.00  0.89           C
ATOM   2247  SG  CYS B 285     -20.125 -46.813  -6.243  1.00  0.89           S
ATOM   2248  N   PHE B 286     -18.676 -50.386  -3.343  1.00  0.87           N
ATOM   2249  CA  PHE B 286     -18.099 -50.785  -2.071  1.00  0.87           C
ATOM   2250  C   PHE B 286     -18.095 -52.272  -1.765  1.00  0.87           C
ATOM   2251  O   PHE B 286     -17.548 -52.687  -0.748  1.00  0.87           O
ATOM   2252  CB  PHE B 286     -18.804 -50.054  -0.903  1.00  0.87           C
ATOM   2253  CG  PHE B 286     -18.695 -48.558  -1.014  1.00  0.87           C
ATOM   2254  CD1 PHE B 286     -17.467 -47.941  -1.300  1.00  0.87           C
ATOM   2255  CD2 PHE B 286     -19.824 -47.750  -0.798  1.00  0.87           C
ATOM   2256  CE1 PHE B 286     -17.370 -46.548  -1.354  1.00  0.87           C
ATOM   2257  CE2 PHE B 286     -19.739 -46.359  -0.896  1.00  0.87           C
ATOM   2258  CZ  PHE B 286     -18.507 -45.758  -1.163  1.00  0.87           C
ATOM   2259  N   VAL B 287     -18.608 -53.141  -2.664  1.00  0.85           N
ATOM   2260  CA  VAL B 287     -18.208 -54.545  -2.647  1.00  0.85           C
ATOM   2261  C   VAL B 287     -16.846 -54.655  -3.305  1.00  0.85           C
ATOM   2262  O   VAL B 287     -16.095 -55.622  -3.065  1.00  0.85           O
ATOM   2263  CB  VAL B 287     -19.258 -55.463  -3.273  1.00  0.85           C
ATOM   2264  CG1 VAL B 287     -18.644 -56.710  -3.940  1.00  0.85           C
ATOM   2265  CG2 VAL B 287     -20.250 -55.866  -2.169  1.00  0.85           C
ATOM   2266  N   LYS B 288     -16.403 -53.652  -4.066  1.00  0.72           N
ATOM   2267  CA  LYS B 288     -15.013 -53.450  -4.422  1.00  0.72           C
ATOM   2268  C   LYS B 288     -14.237 -53.088  -3.166  1.00  0.72           C
ATOM   2269  O   LYS B 288     -14.607 -52.181  -2.420  1.00  0.72           O
ATOM   2270  CB  LYS B 288     -14.841 -52.402  -5.548  1.00  0.72           C
ATOM   2271  CG  LYS B 288     -15.602 -52.824  -6.819  1.00  0.72           C
ATOM   2272  CD  LYS B 288     -15.633 -51.779  -7.952  1.00  0.72           C
ATOM   2273  CE  LYS B 288     -16.532 -52.249  -9.118  1.00  0.72           C
ATOM   2274  NZ  LYS B 288     -17.075 -51.131  -9.927  1.00  0.72           N
ATOM   2275  N   ARG B 289     -13.196 -53.870  -2.832  1.00  0.65           N
ATOM   2276  CA  ARG B 289     -12.767 -53.965  -1.451  1.00  0.65           C
ATOM   2277  C   ARG B 289     -11.887 -52.827  -0.988  1.00  0.65           C
ATOM   2278  O   ARG B 289     -10.757 -52.670  -1.435  1.00  0.65           O
ATOM   2279  CB  ARG B 289     -12.034 -55.294  -1.105  1.00  0.65           C
ATOM   2280  CG  ARG B 289     -12.976 -56.475  -0.806  1.00  0.65           C
ATOM   2281  CD  ARG B 289     -13.466 -57.203  -2.057  1.00  0.65           C
ATOM   2282  NE  ARG B 289     -14.884 -57.588  -1.816  1.00  0.65           N
ATOM   2283  CZ  ARG B 289     -15.348 -58.814  -1.555  1.00  0.65           C
ATOM   2284  NH1 ARG B 289     -14.534 -59.844  -1.372  1.00  0.65           N
ATOM   2285  NH2 ARG B 289     -16.664 -58.995  -1.460  1.00  0.65           N
ATOM   2286  N   VAL B 290     -12.415 -52.071  -0.006  1.00  0.72           N
ATOM   2287  CA  VAL B 290     -11.679 -51.226   0.916  1.00  0.72           C
ATOM   2288  C   VAL B 290     -10.667 -50.285   0.281  1.00  0.72           C
ATOM   2289  O   VAL B 290      -9.468 -50.367   0.526  1.00  0.72           O
ATOM   2290  CB  VAL B 290     -11.080 -51.990   2.099  1.00  0.72           C
ATOM   2291  CG1 VAL B 290     -10.813 -51.009   3.260  1.00  0.72           C
ATOM   2292  CG2 VAL B 290     -12.025 -53.122   2.560  1.00  0.72           C
ATOM   2293  N   ASP B 291     -11.118 -49.343  -0.580  1.00  0.75           N
ATOM   2294  CA  ASP B 291     -10.232 -48.297  -1.063  1.00  0.75           C
ATOM   2295  C   ASP B 291      -9.698 -47.440   0.089  1.00  0.75           C
ATOM   2296  O   ASP B 291     -10.409 -47.000   0.995  1.00  0.75           O
ATOM   2297  CB  ASP B 291     -10.875 -47.439  -2.198  1.00  0.75           C
ATOM   2298  CG  ASP B 291      -9.940 -46.363  -2.742  1.00  0.75           C
ATOM   2299  OD1 ASP B 291      -9.821 -45.294  -2.085  1.00  0.75           O
ATOM   2300  OD2 ASP B 291      -9.294 -46.592  -3.786  1.00  0.75           O
ATOM   2301  N   TRP B 292      -8.378 -47.212   0.051  1.00  0.60           N
ATOM   2302  CA  TRP B 292      -7.667 -46.478   1.061  1.00  0.60           C
ATOM   2303  C   TRP B 292      -7.237 -45.106   0.553  1.00  0.60           C
ATOM   2304  O   TRP B 292      -6.482 -44.418   1.230  1.00  0.60           O
ATOM   2305  CB  TRP B 292      -6.458 -47.318   1.576  1.00  0.60           C
ATOM   2306  CG  TRP B 292      -6.722 -48.177   2.825  1.00  0.60           C
ATOM   2307  CD1 TRP B 292      -6.824 -47.729   4.114  1.00  0.60           C
ATOM   2308  CD2 TRP B 292      -6.869 -49.610   2.888  1.00  0.60           C
ATOM   2309  NE1 TRP B 292      -7.077 -48.775   4.971  1.00  0.60           N
ATOM   2310  CE2 TRP B 292      -7.111 -49.939   4.255  1.00  0.60           C
ATOM   2311  CE3 TRP B 292      -6.827 -50.609   1.922  1.00  0.60           C
ATOM   2312  CZ2 TRP B 292      -7.324 -51.248   4.646  1.00  0.60           C
ATOM   2313  CZ3 TRP B 292      -7.066 -51.931   2.324  1.00  0.60           C
ATOM   2314  CH2 TRP B 292      -7.311 -52.248   3.669  1.00  0.60           C
ATOM   2315  N   THR B 293      -7.715 -44.639  -0.617  1.00  0.83           N
ATOM   2316  CA  THR B 293      -7.356 -43.317  -1.129  1.00  0.83           C
ATOM   2317  C   THR B 293      -8.425 -42.284  -0.794  1.00  0.83           C
ATOM   2318  O   THR B 293      -8.138 -41.102  -0.618  1.00  0.83           O
ATOM   2319  CB  THR B 293      -7.085 -43.276  -2.620  1.00  0.83           C
ATOM   2320  OG1 THR B 293      -8.275 -43.531  -3.322  1.00  0.83           O
ATOM   2321  CG2 THR B 293      -6.014 -44.257  -3.095  1.00  0.83           C
ATOM   2322  N   ILE B 294      -9.690 -42.720  -0.621  1.00  0.87           N
ATOM   2323  CA  ILE B 294     -10.801 -41.920  -0.137  1.00  0.87           C
ATOM   2324  C   ILE B 294     -10.539 -41.290   1.215  1.00  0.87           C
ATOM   2325  O   ILE B 294      -9.963 -41.928   2.094  1.00  0.87           O
ATOM   2326  CB  ILE B 294     -12.085 -42.759  -0.059  1.00  0.87           C
ATOM   2327  CG1 ILE B 294     -11.835 -44.150   0.591  1.00  0.87           C
ATOM   2328  CG2 ILE B 294     -12.589 -42.885  -1.507  1.00  0.87           C
ATOM   2329  CD1 ILE B 294     -13.073 -44.920   1.071  1.00  0.87           C
ATOM   2330  N   GLU B 295     -11.027 -40.056   1.465  1.00  0.73           N
ATOM   2331  CA  GLU B 295     -10.987 -39.467   2.796  1.00  0.73           C
ATOM   2332  C   GLU B 295     -12.369 -38.991   3.197  1.00  0.73           C
ATOM   2333  O   GLU B 295     -13.151 -38.538   2.368  1.00  0.73           O
ATOM   2334  CB  GLU B 295      -9.949 -38.347   3.009  1.00  0.73           C
ATOM   2335  CG  GLU B 295      -9.150 -38.533   4.329  1.00  0.73           C
ATOM   2336  CD  GLU B 295      -7.963 -39.502   4.205  1.00  0.73           C
ATOM   2337  OE1 GLU B 295      -8.066 -40.643   4.726  1.00  0.73           O
ATOM   2338  OE2 GLU B 295      -6.939 -39.095   3.609  1.00  0.73           O
ATOM   2339  N   TYR B 296     -12.722 -39.137   4.484  1.00  0.79           N
ATOM   2340  CA  TYR B 296     -14.067 -38.961   5.005  1.00  0.79           C
ATOM   2341  C   TYR B 296     -13.940 -38.237   6.340  1.00  0.79           C
ATOM   2342  O   TYR B 296     -13.165 -38.707   7.168  1.00  0.79           O
ATOM   2343  CB  TYR B 296     -14.810 -40.312   5.327  1.00  0.79           C
ATOM   2344  CG  TYR B 296     -15.204 -41.202   4.154  1.00  0.79           C
ATOM   2345  CD1 TYR B 296     -15.465 -40.706   2.864  1.00  0.79           C
ATOM   2346  CD2 TYR B 296     -15.349 -42.589   4.364  1.00  0.79           C
ATOM   2347  CE1 TYR B 296     -15.764 -41.575   1.801  1.00  0.79           C
ATOM   2348  CE2 TYR B 296     -15.654 -43.457   3.309  1.00  0.79           C
ATOM   2349  CZ  TYR B 296     -15.853 -42.953   2.029  1.00  0.79           C
ATOM   2350  OH  TYR B 296     -16.118 -43.854   0.988  1.00  0.79           O
ATOM   2351  N   PRO B 297     -14.609 -37.123   6.638  1.00  0.87           N
ATOM   2352  CA  PRO B 297     -14.468 -36.501   7.943  1.00  0.87           C
ATOM   2353  C   PRO B 297     -15.267 -37.245   8.994  1.00  0.87           C
ATOM   2354  O   PRO B 297     -16.375 -37.684   8.707  1.00  0.87           O
ATOM   2355  CB  PRO B 297     -14.990 -35.064   7.755  1.00  0.87           C
ATOM   2356  CG  PRO B 297     -15.930 -35.153   6.552  1.00  0.87           C
ATOM   2357  CD  PRO B 297     -15.253 -36.221   5.687  1.00  0.87           C
ATOM   2358  N   ILE B 298     -14.743 -37.402  10.226  1.00  0.87           N
ATOM   2359  CA  ILE B 298     -15.468 -38.109  11.270  1.00  0.87           C
ATOM   2360  C   ILE B 298     -16.184 -37.185  12.249  1.00  0.87           C
ATOM   2361  O   ILE B 298     -15.596 -36.421  13.012  1.00  0.87           O
ATOM   2362  CB  ILE B 298     -14.592 -39.113  12.026  1.00  0.87           C
ATOM   2363  CG1 ILE B 298     -15.322 -39.830  13.188  1.00  0.87           C
ATOM   2364  CG2 ILE B 298     -13.320 -38.429  12.570  1.00  0.87           C
ATOM   2365  CD1 ILE B 298     -16.521 -40.685  12.776  1.00  0.87           C
ATOM   2366  N   ILE B 299     -17.523 -37.284  12.289  1.00  0.71           N
ATOM   2367  CA  ILE B 299     -18.312 -36.903  13.447  1.00  0.71           C
ATOM   2368  C   ILE B 299     -19.287 -38.039  13.736  1.00  0.71           C
ATOM   2369  O   ILE B 299     -20.108 -38.379  12.896  1.00  0.71           O
ATOM   2370  CB  ILE B 299     -19.056 -35.570  13.336  1.00  0.71           C
ATOM   2371  CG1 ILE B 299     -19.168 -35.020  11.897  1.00  0.71           C
ATOM   2372  CG2 ILE B 299     -18.296 -34.546  14.207  1.00  0.71           C
ATOM   2373  CD1 ILE B 299     -20.195 -35.725  11.009  1.00  0.71           C
ATOM   2374  N   GLY B 300     -19.256 -38.695  14.920  1.00  0.79           N
ATOM   2375  CA  GLY B 300     -18.292 -38.522  16.007  1.00  0.79           C
ATOM   2376  C   GLY B 300     -18.184 -39.734  16.907  1.00  0.79           C
ATOM   2377  O   GLY B 300     -18.561 -40.832  16.508  1.00  0.79           O
ATOM   2378  N   ASP B 301     -17.605 -39.572  18.127  1.00  0.74           N
ATOM   2379  CA  ASP B 301     -17.432 -40.606  19.161  1.00  0.74           C
ATOM   2380  C   ASP B 301     -16.319 -41.619  18.817  1.00  0.74           C
ATOM   2381  O   ASP B 301     -15.508 -42.028  19.645  1.00  0.74           O
ATOM   2382  CB  ASP B 301     -18.790 -41.255  19.543  1.00  0.74           C
ATOM   2383  CG  ASP B 301     -18.633 -42.309  20.626  1.00  0.74           C
ATOM   2384  OD1 ASP B 301     -19.107 -43.448  20.402  1.00  0.74           O
ATOM   2385  OD2 ASP B 301     -18.012 -41.973  21.669  1.00  0.74           O
ATOM   2386  N   GLU B 302     -16.189 -41.945  17.533  1.00  0.73           N
ATOM   2387  CA  GLU B 302     -15.324 -42.928  16.923  1.00  0.73           C
ATOM   2388  C   GLU B 302     -13.847 -43.004  17.276  1.00  0.73           C
ATOM   2389  O   GLU B 302     -13.306 -44.084  17.430  1.00  0.73           O
ATOM   2390  CB  GLU B 302     -15.440 -42.730  15.417  1.00  0.73           C
ATOM   2391  CG  GLU B 302     -15.345 -44.028  14.612  1.00  0.73           C
ATOM   2392  CD  GLU B 302     -13.944 -44.629  14.606  1.00  0.73           C
ATOM   2393  OE1 GLU B 302     -12.946 -43.887  14.428  1.00  0.73           O
ATOM   2394  OE2 GLU B 302     -13.867 -45.876  14.734  1.00  0.73           O
ATOM   2395  N   LEU B 303     -13.107 -41.894  17.442  1.00  0.87           N
ATOM   2396  CA  LEU B 303     -11.664 -41.946  17.669  1.00  0.87           C
ATOM   2397  C   LEU B 303     -11.298 -42.693  18.958  1.00  0.87           C
ATOM   2398  O   LEU B 303     -10.281 -43.378  19.070  1.00  0.87           O
ATOM   2399  CB  LEU B 303     -11.130 -40.487  17.601  1.00  0.87           C
ATOM   2400  CG  LEU B 303      -9.746 -40.203  16.961  1.00  0.87           C
ATOM   2401  CD1 LEU B 303      -9.332 -41.238  15.906  1.00  0.87           C
ATOM   2402  CD2 LEU B 303      -9.767 -38.804  16.311  1.00  0.87           C
ATOM   2403  N   LYS B 304     -12.208 -42.630  19.952  1.00  0.86           N
ATOM   2404  CA  LYS B 304     -12.180 -43.479  21.117  1.00  0.86           C
ATOM   2405  C   LYS B 304     -12.459 -44.961  20.810  1.00  0.86           C
ATOM   2406  O   LYS B 304     -11.752 -45.832  21.311  1.00  0.86           O
ATOM   2407  CB  LYS B 304     -13.145 -42.921  22.182  1.00  0.86           C
ATOM   2408  CG  LYS B 304     -12.817 -41.513  22.700  1.00  0.86           C
ATOM   2409  CD  LYS B 304     -13.889 -41.034  23.696  1.00  0.86           C
ATOM   2410  CE  LYS B 304     -13.563 -39.709  24.385  1.00  0.86           C
ATOM   2411  NZ  LYS B 304     -14.679 -39.347  25.285  1.00  0.86           N
ATOM   2412  N   ILE B 305     -13.446 -45.281  19.931  1.00  0.89           N
ATOM   2413  CA  ILE B 305     -13.726 -46.628  19.421  1.00  0.89           C
ATOM   2414  C   ILE B 305     -12.502 -47.219  18.736  1.00  0.89           C
ATOM   2415  O   ILE B 305     -12.100 -48.345  19.022  1.00  0.89           O
ATOM   2416  CB  ILE B 305     -14.913 -46.651  18.432  1.00  0.89           C
ATOM   2417  CG1 ILE B 305     -16.242 -46.243  19.116  1.00  0.89           C
ATOM   2418  CG2 ILE B 305     -15.060 -48.029  17.735  1.00  0.89           C
ATOM   2419  CD1 ILE B 305     -17.403 -45.942  18.151  1.00  0.89           C
ATOM   2420  N   ASN B 306     -11.837 -46.437  17.868  1.00  0.86           N
ATOM   2421  CA  ASN B 306     -10.661 -46.819  17.115  1.00  0.86           C
ATOM   2422  C   ASN B 306      -9.469 -47.205  17.984  1.00  0.86           C
ATOM   2423  O   ASN B 306      -8.825 -48.237  17.786  1.00  0.86           O
ATOM   2424  CB  ASN B 306     -10.289 -45.621  16.209  1.00  0.86           C
ATOM   2425  CG  ASN B 306      -9.845 -46.041  14.822  1.00  0.86           C
ATOM   2426  OD1 ASN B 306      -9.829 -47.221  14.433  1.00  0.86           O
ATOM   2427  ND2 ASN B 306      -9.503 -45.026  14.007  1.00  0.86           N
ATOM   2428  N   ALA B 307      -9.173 -46.392  19.019  1.00  0.92           N
ATOM   2429  CA  ALA B 307      -8.182 -46.724  20.015  1.00  0.92           C
ATOM   2430  C   ALA B 307      -8.571 -47.922  20.881  1.00  0.92           C
ATOM   2431  O   ALA B 307      -7.759 -48.812  21.129  1.00  0.92           O
ATOM   2432  CB  ALA B 307      -7.888 -45.476  20.864  1.00  0.92           C
ATOM   2433  N   ALA B 308      -9.845 -48.004  21.323  1.00  0.91           N
ATOM   2434  CA  ALA B 308     -10.373 -49.103  22.113  1.00  0.91           C
ATOM   2435  C   ALA B 308     -10.251 -50.435  21.397  1.00  0.91           C
ATOM   2436  O   ALA B 308      -9.871 -51.450  21.975  1.00  0.91           O
ATOM   2437  CB  ALA B 308     -11.841 -48.812  22.467  1.00  0.91           C
ATOM   2438  N   CYS B 309     -10.481 -50.408  20.079  1.00  0.91           N
ATOM   2439  CA  CYS B 309     -10.351 -51.511  19.162  1.00  0.91           C
ATOM   2440  C   CYS B 309      -8.983 -52.171  19.173  1.00  0.91           C
ATOM   2441  O   CYS B 309      -8.873 -53.391  19.141  1.00  0.91           O
ATOM   2442  CB  CYS B 309     -10.699 -50.999  17.740  1.00  0.91           C
ATOM   2443  SG  CYS B 309     -11.284 -52.299  16.611  1.00  0.91           S
ATOM   2444  N   ARG B 310      -7.900 -51.371  19.245  1.00  0.81           N
ATOM   2445  CA  ARG B 310      -6.554 -51.881  19.427  1.00  0.81           C
ATOM   2446  C   ARG B 310      -6.279 -52.348  20.857  1.00  0.81           C
ATOM   2447  O   ARG B 310      -5.666 -53.386  21.084  1.00  0.81           O
ATOM   2448  CB  ARG B 310      -5.504 -50.834  18.985  1.00  0.81           C
ATOM   2449  CG  ARG B 310      -5.712 -50.265  17.559  1.00  0.81           C
ATOM   2450  CD  ARG B 310      -5.751 -51.309  16.426  1.00  0.81           C
ATOM   2451  NE  ARG B 310      -7.161 -51.411  15.919  1.00  0.81           N
ATOM   2452  CZ  ARG B 310      -7.541 -52.214  14.916  1.00  0.81           C
ATOM   2453  NH1 ARG B 310      -6.712 -53.095  14.364  1.00  0.81           N
ATOM   2454  NH2 ARG B 310      -8.786 -52.125  14.455  1.00  0.81           N
ATOM   2455  N   LYS B 311      -6.745 -51.599  21.879  1.00  0.86           N
ATOM   2456  CA  LYS B 311      -6.531 -51.948  23.278  1.00  0.86           C
ATOM   2457  C   LYS B 311      -7.191 -53.252  23.700  1.00  0.86           C
ATOM   2458  O   LYS B 311      -6.581 -54.099  24.350  1.00  0.86           O
ATOM   2459  CB  LYS B 311      -6.985 -50.790  24.200  1.00  0.86           C
ATOM   2460  CG  LYS B 311      -6.099 -49.546  24.031  1.00  0.86           C
ATOM   2461  CD  LYS B 311      -6.603 -48.337  24.831  1.00  0.86           C
ATOM   2462  CE  LYS B 311      -5.747 -47.091  24.588  1.00  0.86           C
ATOM   2463  NZ  LYS B 311      -6.261 -45.948  25.374  1.00  0.86           N
ATOM   2464  N   VAL B 312      -8.455 -53.476  23.294  1.00  0.93           N
ATOM   2465  CA  VAL B 312      -9.122 -54.750  23.485  1.00  0.93           C
ATOM   2466  C   VAL B 312      -8.452 -55.884  22.705  1.00  0.93           C
ATOM   2467  O   VAL B 312      -8.227 -56.964  23.252  1.00  0.93           O
ATOM   2468  CB  VAL B 312     -10.618 -54.656  23.219  1.00  0.93           C
ATOM   2469  CG1 VAL B 312     -11.288 -56.024  23.455  1.00  0.93           C
ATOM   2470  CG2 VAL B 312     -11.253 -53.610  24.163  1.00  0.93           C
ATOM   2471  N   GLN B 313      -8.048 -55.639  21.433  1.00  0.88           N
ATOM   2472  CA  GLN B 313      -7.306 -56.584  20.606  1.00  0.88           C
ATOM   2473  C   GLN B 313      -6.011 -57.076  21.221  1.00  0.88           C
ATOM   2474  O   GLN B 313      -5.768 -58.280  21.271  1.00  0.88           O
ATOM   2475  CB  GLN B 313      -6.911 -55.920  19.260  1.00  0.88           C
ATOM   2476  CG  GLN B 313      -6.239 -56.872  18.242  1.00  0.88           C
ATOM   2477  CD  GLN B 313      -5.666 -56.163  17.011  1.00  0.88           C
ATOM   2478  OE1 GLN B 313      -5.226 -55.010  17.011  1.00  0.88           O
ATOM   2479  NE2 GLN B 313      -5.607 -56.930  15.896  1.00  0.88           N
ATOM   2480  N   HIS B 314      -5.165 -56.153  21.725  1.00  0.88           N
ATOM   2481  CA  HIS B 314      -3.855 -56.442  22.287  1.00  0.88           C
ATOM   2482  C   HIS B 314      -3.956 -57.353  23.488  1.00  0.88           C
ATOM   2483  O   HIS B 314      -3.265 -58.362  23.603  1.00  0.88           O
ATOM   2484  CB  HIS B 314      -3.131 -55.130  22.709  1.00  0.88           C
ATOM   2485  CG  HIS B 314      -1.830 -55.326  23.451  1.00  0.88           C
ATOM   2486  ND1 HIS B 314      -1.544 -54.571  24.575  1.00  0.88           N
ATOM   2487  CD2 HIS B 314      -0.792 -56.155  23.176  1.00  0.88           C
ATOM   2488  CE1 HIS B 314      -0.339 -54.946  24.948  1.00  0.88           C
ATOM   2489  NE2 HIS B 314       0.163 -55.907  24.138  1.00  0.88           N
ATOM   2490  N   MET B 315      -4.877 -57.023  24.403  1.00  0.86           N
ATOM   2491  CA  MET B 315      -5.111 -57.794  25.596  1.00  0.86           C
ATOM   2492  C   MET B 315      -5.696 -59.182  25.385  1.00  0.86           C
ATOM   2493  O   MET B 315      -5.220 -60.144  25.990  1.00  0.86           O
ATOM   2494  CB  MET B 315      -5.992 -56.938  26.525  1.00  0.86           C
ATOM   2495  CG  MET B 315      -6.605 -57.666  27.733  1.00  0.86           C
ATOM   2496  SD  MET B 315      -6.299 -56.946  29.361  1.00  0.86           S
ATOM   2497  CE  MET B 315      -6.009 -55.178  29.129  1.00  0.86           C
ATOM   2498  N   VAL B 316      -6.733 -59.343  24.532  1.00  0.94           N
ATOM   2499  CA  VAL B 316      -7.404 -60.631  24.400  1.00  0.94           C
ATOM   2500  C   VAL B 316      -6.494 -61.709  23.825  1.00  0.94           C
ATOM   2501  O   VAL B 316      -6.389 -62.811  24.357  1.00  0.94           O
ATOM   2502  CB  VAL B 316      -8.742 -60.534  23.659  1.00  0.94           C
ATOM   2503  CG1 VAL B 316      -8.561 -60.094  22.195  1.00  0.94           C
ATOM   2504  CG2 VAL B 316      -9.509 -61.871  23.745  1.00  0.94           C
ATOM   2505  N   VAL B 317      -5.735 -61.390  22.760  1.00  0.93           N
ATOM   2506  CA  VAL B 317      -4.811 -62.321  22.148  1.00  0.93           C
ATOM   2507  C   VAL B 317      -3.536 -62.550  22.958  1.00  0.93           C
ATOM   2508  O   VAL B 317      -2.978 -63.644  22.936  1.00  0.93           O
ATOM   2509  CB  VAL B 317      -4.570 -61.911  20.711  1.00  0.93           C
ATOM   2510  CG1 VAL B 317      -3.869 -60.557  20.643  1.00  0.93           C
ATOM   2511  CG2 VAL B 317      -3.773 -62.975  19.940  1.00  0.93           C
ATOM   2512  N   LYS B 318      -3.072 -61.566  23.773  1.00  0.88           N
ATOM   2513  CA  LYS B 318      -2.013 -61.795  24.754  1.00  0.88           C
ATOM   2514  C   LYS B 318      -2.435 -62.804  25.806  1.00  0.88           C
ATOM   2515  O   LYS B 318      -1.735 -63.775  26.081  1.00  0.88           O
ATOM   2516  CB  LYS B 318      -1.609 -60.471  25.472  1.00  0.88           C
ATOM   2517  CG  LYS B 318      -0.591 -60.625  26.627  1.00  0.88           C
ATOM   2518  CD  LYS B 318      -0.177 -59.305  27.317  1.00  0.88           C
ATOM   2519  CE  LYS B 318      -1.330 -58.557  28.007  1.00  0.88           C
ATOM   2520  NZ  LYS B 318      -0.830 -57.381  28.763  1.00  0.88           N
ATOM   2521  N   ALA B 319      -3.637 -62.627  26.386  1.00  0.93           N
ATOM   2522  CA  ALA B 319      -4.168 -63.541  27.367  1.00  0.93           C
ATOM   2523  C   ALA B 319      -4.404 -64.938  26.802  1.00  0.93           C
ATOM   2524  O   ALA B 319      -4.013 -65.930  27.407  1.00  0.93           O
ATOM   2525  CB  ALA B 319      -5.420 -62.920  28.009  1.00  0.93           C
ATOM   2526  N   ALA B 320      -4.959 -65.050  25.580  1.00  0.95           N
ATOM   2527  CA  ALA B 320      -5.136 -66.318  24.902  1.00  0.95           C
ATOM   2528  C   ALA B 320      -3.841 -67.098  24.677  1.00  0.95           C
ATOM   2529  O   ALA B 320      -3.743 -68.289  24.978  1.00  0.95           O
ATOM   2530  CB  ALA B 320      -5.800 -66.017  23.550  1.00  0.95           C
ATOM   2531  N   LEU B 321      -2.771 -66.425  24.206  1.00  0.92           N
ATOM   2532  CA  LEU B 321      -1.460 -67.037  24.108  1.00  0.92           C
ATOM   2533  C   LEU B 321      -0.879 -67.476  25.458  1.00  0.92           C
ATOM   2534  O   LEU B 321      -0.316 -68.559  25.575  1.00  0.92           O
ATOM   2535  CB  LEU B 321      -0.449 -66.131  23.361  1.00  0.92           C
ATOM   2536  CG  LEU B 321      -0.740 -65.887  21.861  1.00  0.92           C
ATOM   2537  CD1 LEU B 321       0.375 -65.036  21.236  1.00  0.92           C
ATOM   2538  CD2 LEU B 321      -0.908 -67.199  21.082  1.00  0.92           C
ATOM   2539  N   LEU B 322      -1.027 -66.670  26.532  1.00  0.89           N
ATOM   2540  CA  LEU B 322      -0.612 -67.059  27.875  1.00  0.89           C
ATOM   2541  C   LEU B 322      -1.355 -68.285  28.417  1.00  0.89           C
ATOM   2542  O   LEU B 322      -0.731 -69.169  29.007  1.00  0.89           O
ATOM   2543  CB  LEU B 322      -0.761 -65.874  28.876  1.00  0.89           C
ATOM   2544  CG  LEU B 322       0.445 -64.909  29.023  1.00  0.89           C
ATOM   2545  CD1 LEU B 322       1.084 -64.435  27.708  1.00  0.89           C
ATOM   2546  CD2 LEU B 322       0.003 -63.700  29.862  1.00  0.89           C
ATOM   2547  N   ALA B 323      -2.691 -68.358  28.238  1.00  0.93           N
ATOM   2548  CA  ALA B 323      -3.527 -69.417  28.769  1.00  0.93           C
ATOM   2549  C   ALA B 323      -3.295 -70.800  28.176  1.00  0.93           C
ATOM   2550  O   ALA B 323      -3.065 -71.767  28.901  1.00  0.93           O
ATOM   2551  CB  ALA B 323      -4.993 -69.026  28.505  1.00  0.93           C
ATOM   2552  N   ASP B 324      -3.312 -70.892  26.832  1.00  0.92           N
ATOM   2553  CA  ASP B 324      -3.335 -72.161  26.130  1.00  0.92           C
ATOM   2554  C   ASP B 324      -2.023 -72.437  25.411  1.00  0.92           C
ATOM   2555  O   ASP B 324      -1.800 -73.518  24.869  1.00  0.92           O
ATOM   2556  CB  ASP B 324      -4.496 -72.114  25.117  1.00  0.92           C
ATOM   2557  CG  ASP B 324      -5.786 -72.071  25.941  1.00  0.92           C
ATOM   2558  OD1 ASP B 324      -6.378 -70.980  26.096  1.00  0.92           O
ATOM   2559  OD2 ASP B 324      -6.199 -73.106  26.497  1.00  0.92           O
ATOM   2560  N   LYS B 325      -1.084 -71.467  25.446  1.00  0.88           N
ATOM   2561  CA  LYS B 325       0.319 -71.652  25.103  1.00  0.88           C
ATOM   2562  C   LYS B 325       0.579 -72.093  23.663  1.00  0.88           C
ATOM   2563  O   LYS B 325       1.430 -72.941  23.404  1.00  0.88           O
ATOM   2564  CB  LYS B 325       1.016 -72.662  26.060  1.00  0.88           C
ATOM   2565  CG  LYS B 325       0.719 -72.512  27.563  1.00  0.88           C
ATOM   2566  CD  LYS B 325       1.713 -71.636  28.340  1.00  0.88           C
ATOM   2567  CE  LYS B 325       1.368 -71.628  29.834  1.00  0.88           C
ATOM   2568  NZ  LYS B 325       2.314 -70.799  30.613  1.00  0.88           N
ATOM   2569  N   PHE B 326      -0.152 -71.535  22.680  1.00  0.90           N
ATOM   2570  CA  PHE B 326      -0.113 -72.007  21.304  1.00  0.90           C
ATOM   2571  C   PHE B 326       1.264 -71.959  20.611  1.00  0.90           C
ATOM   2572  O   PHE B 326       1.963 -70.956  20.750  1.00  0.90           O
ATOM   2573  CB  PHE B 326      -1.087 -71.198  20.416  1.00  0.90           C
ATOM   2574  CG  PHE B 326      -2.504 -71.342  20.884  1.00  0.90           C
ATOM   2575  CD1 PHE B 326      -3.111 -70.349  21.670  1.00  0.90           C
ATOM   2576  CD2 PHE B 326      -3.269 -72.448  20.479  1.00  0.90           C
ATOM   2577  CE1 PHE B 326      -4.462 -70.442  22.015  1.00  0.90           C
ATOM   2578  CE2 PHE B 326      -4.623 -72.543  20.821  1.00  0.90           C
ATOM   2579  CZ  PHE B 326      -5.218 -71.540  21.593  1.00  0.90           C
ATOM   2580  N   PRO B 327       1.691 -72.965  19.825  1.00  0.91           N
ATOM   2581  CA  PRO B 327       2.995 -72.949  19.154  1.00  0.91           C
ATOM   2582  C   PRO B 327       3.099 -71.875  18.093  1.00  0.91           C
ATOM   2583  O   PRO B 327       4.158 -71.276  17.914  1.00  0.91           O
ATOM   2584  CB  PRO B 327       3.115 -74.344  18.505  1.00  0.91           C
ATOM   2585  CG  PRO B 327       2.190 -75.242  19.332  1.00  0.91           C
ATOM   2586  CD  PRO B 327       1.085 -74.299  19.806  1.00  0.91           C
ATOM   2587  N   VAL B 328       1.993 -71.643  17.376  1.00  0.91           N
ATOM   2588  CA  VAL B 328       1.937 -70.770  16.229  1.00  0.91           C
ATOM   2589  C   VAL B 328       0.618 -70.026  16.287  1.00  0.91           C
ATOM   2590  O   VAL B 328      -0.385 -70.533  16.797  1.00  0.91           O
ATOM   2591  CB  VAL B 328       2.092 -71.528  14.911  1.00  0.91           C
ATOM   2592  CG1 VAL B 328       0.956 -72.547  14.732  1.00  0.91           C
ATOM   2593  CG2 VAL B 328       2.170 -70.564  13.709  1.00  0.91           C
ATOM   2594  N   LEU B 329       0.590 -68.778  15.793  1.00  0.92           N
ATOM   2595  CA  LEU B 329      -0.611 -67.997  15.628  1.00  0.92           C
ATOM   2596  C   LEU B 329      -0.735 -67.640  14.164  1.00  0.92           C
ATOM   2597  O   LEU B 329       0.172 -67.082  13.548  1.00  0.92           O
ATOM   2598  CB  LEU B 329      -0.588 -66.731  16.523  1.00  0.92           C
ATOM   2599  CG  LEU B 329      -1.822 -65.801  16.441  1.00  0.92           C
ATOM   2600  CD1 LEU B 329      -2.000 -65.023  17.752  1.00  0.92           C
ATOM   2601  CD2 LEU B 329      -1.711 -64.788  15.294  1.00  0.92           C
ATOM   2602  N   HIS B 330      -1.891 -67.965  13.565  1.00  0.90           N
ATOM   2603  CA  HIS B 330      -2.161 -67.715  12.168  1.00  0.90           C
ATOM   2604  C   HIS B 330      -3.088 -66.514  12.056  1.00  0.90           C
ATOM   2605  O   HIS B 330      -4.263 -66.577  12.408  1.00  0.90           O
ATOM   2606  CB  HIS B 330      -2.851 -68.939  11.521  1.00  0.90           C
ATOM   2607  CG  HIS B 330      -2.036 -70.211  11.508  1.00  0.90           C
ATOM   2608  ND1 HIS B 330      -1.399 -70.602  10.340  1.00  0.90           N
ATOM   2609  CD2 HIS B 330      -1.922 -71.185  12.452  1.00  0.90           C
ATOM   2610  CE1 HIS B 330      -0.925 -71.814  10.602  1.00  0.90           C
ATOM   2611  NE2 HIS B 330      -1.207 -72.205  11.863  1.00  0.90           N
ATOM   2612  N   ASP B 331      -2.572 -65.375  11.579  1.00  0.93           N
ATOM   2613  CA  ASP B 331      -3.253 -64.101  11.580  1.00  0.93           C
ATOM   2614  C   ASP B 331      -3.865 -63.875  10.202  1.00  0.93           C
ATOM   2615  O   ASP B 331      -3.159 -63.811   9.195  1.00  0.93           O
ATOM   2616  CB  ASP B 331      -2.171 -63.057  11.941  1.00  0.93           C
ATOM   2617  CG  ASP B 331      -2.683 -61.666  12.258  1.00  0.93           C
ATOM   2618  OD1 ASP B 331      -3.917 -61.448  12.288  1.00  0.93           O
ATOM   2619  OD2 ASP B 331      -1.805 -60.797  12.502  1.00  0.93           O
ATOM   2620  N   ILE B 332      -5.210 -63.826  10.102  1.00  0.93           N
ATOM   2621  CA  ILE B 332      -5.892 -63.829   8.819  1.00  0.93           C
ATOM   2622  C   ILE B 332      -6.682 -62.552   8.614  1.00  0.93           C
ATOM   2623  O   ILE B 332      -7.598 -62.226   9.367  1.00  0.93           O
ATOM   2624  CB  ILE B 332      -6.805 -65.040   8.626  1.00  0.93           C
ATOM   2625  CG1 ILE B 332      -6.130 -66.310   9.207  1.00  0.93           C
ATOM   2626  CG2 ILE B 332      -7.142 -65.197   7.125  1.00  0.93           C
ATOM   2627  CD1 ILE B 332      -6.649 -67.638   8.648  1.00  0.93           C
ATOM   2628  N   GLY B 333      -6.365 -61.806   7.539  1.00  0.94           N
ATOM   2629  CA  GLY B 333      -6.938 -60.500   7.252  1.00  0.94           C
ATOM   2630  C   GLY B 333      -6.040 -59.381   7.695  1.00  0.94           C
ATOM   2631  O   GLY B 333      -6.512 -58.306   8.058  1.00  0.94           O
ATOM   2632  N   ASN B 334      -4.709 -59.603   7.674  1.00  0.87           N
ATOM   2633  CA  ASN B 334      -3.723 -58.599   8.025  1.00  0.87           C
ATOM   2634  C   ASN B 334      -2.932 -58.188   6.771  1.00  0.87           C
ATOM   2635  O   ASN B 334      -2.075 -58.946   6.315  1.00  0.87           O
ATOM   2636  CB  ASN B 334      -2.777 -59.142   9.137  1.00  0.87           C
ATOM   2637  CG  ASN B 334      -2.170 -58.011   9.967  1.00  0.87           C
ATOM   2638  OD1 ASN B 334      -2.274 -56.828   9.613  1.00  0.87           O
ATOM   2639  ND2 ASN B 334      -1.561 -58.376  11.117  1.00  0.87           N
ATOM   2640  N   PRO B 335      -3.152 -57.004   6.175  1.00  0.86           N
ATOM   2641  CA  PRO B 335      -2.504 -56.650   4.909  1.00  0.86           C
ATOM   2642  C   PRO B 335      -1.056 -56.266   5.089  1.00  0.86           C
ATOM   2643  O   PRO B 335      -0.347 -56.061   4.108  1.00  0.86           O
ATOM   2644  CB  PRO B 335      -3.286 -55.419   4.415  1.00  0.86           C
ATOM   2645  CG  PRO B 335      -4.676 -55.581   5.022  1.00  0.86           C
ATOM   2646  CD  PRO B 335      -4.403 -56.263   6.359  1.00  0.86           C
ATOM   2647  N   LYS B 336      -0.615 -56.094   6.337  1.00  0.80           N
ATOM   2648  CA  LYS B 336       0.680 -55.574   6.682  1.00  0.80           C
ATOM   2649  C   LYS B 336       1.079 -56.315   7.935  1.00  0.80           C
ATOM   2650  O   LYS B 336       0.236 -56.871   8.607  1.00  0.80           O
ATOM   2651  CB  LYS B 336       0.634 -54.031   6.893  1.00  0.80           C
ATOM   2652  CG  LYS B 336      -0.702 -53.493   7.450  1.00  0.80           C
ATOM   2653  CD  LYS B 336      -0.692 -51.968   7.677  1.00  0.80           C
ATOM   2654  CE  LYS B 336      -1.429 -51.129   6.619  1.00  0.80           C
ATOM   2655  NZ  LYS B 336      -2.890 -51.384   6.657  1.00  0.80           N
ATOM   2656  N   ALA B 337       2.377 -56.412   8.283  1.00  0.85           N
ATOM   2657  CA  ALA B 337       2.785 -57.327   9.338  1.00  0.85           C
ATOM   2658  C   ALA B 337       2.177 -57.102  10.730  1.00  0.85           C
ATOM   2659  O   ALA B 337       1.622 -58.009  11.321  1.00  0.85           O
ATOM   2660  CB  ALA B 337       4.322 -57.258   9.444  1.00  0.85           C
ATOM   2661  N   ILE B 338       2.248 -55.870  11.264  1.00  0.77           N
ATOM   2662  CA  ILE B 338       1.562 -55.374  12.461  1.00  0.77           C
ATOM   2663  C   ILE B 338       1.117 -56.392  13.528  1.00  0.77           C
ATOM   2664  O   ILE B 338      -0.064 -56.676  13.711  1.00  0.77           O
ATOM   2665  CB  ILE B 338       0.424 -54.441  12.049  1.00  0.77           C
ATOM   2666  CG1 ILE B 338       0.857 -53.478  10.910  1.00  0.77           C
ATOM   2667  CG2 ILE B 338      -0.136 -53.645  13.251  1.00  0.77           C
ATOM   2668  CD1 ILE B 338       2.043 -52.567  11.253  1.00  0.77           C
ATOM   2669  N   LYS B 339       2.085 -56.980  14.270  1.00  0.83           N
ATOM   2670  CA  LYS B 339       1.798 -57.904  15.357  1.00  0.83           C
ATOM   2671  C   LYS B 339       1.065 -57.245  16.522  1.00  0.83           C
ATOM   2672  O   LYS B 339       1.619 -56.401  17.225  1.00  0.83           O
ATOM   2673  CB  LYS B 339       3.086 -58.567  15.923  1.00  0.83           C
ATOM   2674  CG  LYS B 339       3.815 -59.519  14.961  1.00  0.83           C
ATOM   2675  CD  LYS B 339       5.135 -60.045  15.564  1.00  0.83           C
ATOM   2676  CE  LYS B 339       5.461 -61.485  15.157  1.00  0.83           C
ATOM   2677  NZ  LYS B 339       6.696 -61.969  15.819  1.00  0.83           N
ATOM   2678  N   CYS B 340      -0.202 -57.642  16.777  1.00  0.92           N
ATOM   2679  CA  CYS B 340      -1.044 -57.055  17.811  1.00  0.92           C
ATOM   2680  C   CYS B 340      -0.495 -57.216  19.216  1.00  0.92           C
ATOM   2681  O   CYS B 340      -0.712 -56.362  20.071  1.00  0.92           O
ATOM   2682  CB  CYS B 340      -2.503 -57.564  17.741  1.00  0.92           C
ATOM   2683  SG  CYS B 340      -2.623 -59.377  17.770  1.00  0.92           S
ATOM   2684  N   VAL B 341       0.268 -58.295  19.474  1.00  0.89           N
ATOM   2685  CA  VAL B 341       1.149 -58.372  20.624  1.00  0.89           C
ATOM   2686  C   VAL B 341       2.582 -58.335  20.116  1.00  0.89           C
ATOM   2687  O   VAL B 341       2.959 -59.241  19.373  1.00  0.89           O
ATOM   2688  CB  VAL B 341       0.997 -59.634  21.461  1.00  0.89           C
ATOM   2689  CG1 VAL B 341       1.260 -59.302  22.937  1.00  0.89           C
ATOM   2690  CG2 VAL B 341      -0.419 -60.196  21.349  1.00  0.89           C
ATOM   2691  N   PRO B 342       3.434 -57.360  20.440  1.00  0.85           N
ATOM   2692  CA  PRO B 342       4.629 -57.141  19.634  1.00  0.85           C
ATOM   2693  C   PRO B 342       5.677 -58.183  19.920  1.00  0.85           C
ATOM   2694  O   PRO B 342       6.413 -58.588  19.021  1.00  0.85           O
ATOM   2695  CB  PRO B 342       5.122 -55.741  20.055  1.00  0.85           C
ATOM   2696  CG  PRO B 342       4.407 -55.438  21.377  1.00  0.85           C
ATOM   2697  CD  PRO B 342       3.079 -56.161  21.196  1.00  0.85           C
ATOM   2698  N   GLN B 343       5.757 -58.604  21.186  1.00  0.84           N
ATOM   2699  CA  GLN B 343       6.753 -59.516  21.677  1.00  0.84           C
ATOM   2700  C   GLN B 343       6.070 -60.720  22.284  1.00  0.84           C
ATOM   2701  O   GLN B 343       5.345 -60.635  23.276  1.00  0.84           O
ATOM   2702  CB  GLN B 343       7.697 -58.831  22.699  1.00  0.84           C
ATOM   2703  CG  GLN B 343       6.992 -57.764  23.572  1.00  0.84           C
ATOM   2704  CD  GLN B 343       7.942 -57.082  24.556  1.00  0.84           C
ATOM   2705  OE1 GLN B 343       9.007 -57.581  24.920  1.00  0.84           O
ATOM   2706  NE2 GLN B 343       7.536 -55.882  25.030  1.00  0.84           N
ATOM   2707  N   ALA B 344       6.292 -61.883  21.660  1.00  0.84           N
ATOM   2708  CA  ALA B 344       5.890 -63.164  22.163  1.00  0.84           C
ATOM   2709  C   ALA B 344       6.711 -64.162  21.391  1.00  0.84           C
ATOM   2710  O   ALA B 344       7.009 -63.938  20.218  1.00  0.84           O
ATOM   2711  CB  ALA B 344       4.390 -63.454  21.926  1.00  0.84           C
ATOM   2712  N   ASP B 345       7.056 -65.299  22.018  1.00  0.83           N
ATOM   2713  CA  ASP B 345       7.936 -66.290  21.430  1.00  0.83           C
ATOM   2714  C   ASP B 345       7.241 -67.086  20.336  1.00  0.83           C
ATOM   2715  O   ASP B 345       7.865 -67.788  19.545  1.00  0.83           O
ATOM   2716  CB  ASP B 345       8.428 -67.255  22.535  1.00  0.83           C
ATOM   2717  CG  ASP B 345       9.259 -66.532  23.588  1.00  0.83           C
ATOM   2718  OD1 ASP B 345       9.625 -65.350  23.372  1.00  0.83           O
ATOM   2719  OD2 ASP B 345       9.499 -67.164  24.646  1.00  0.83           O
ATOM   2720  N   VAL B 346       5.901 -66.970  20.275  1.00  0.90           N
ATOM   2721  CA  VAL B 346       5.039 -67.653  19.335  1.00  0.90           C
ATOM   2722  C   VAL B 346       5.420 -67.447  17.866  1.00  0.90           C
ATOM   2723  O   VAL B 346       5.724 -66.333  17.421  1.00  0.90           O
ATOM   2724  CB  VAL B 346       3.587 -67.242  19.589  1.00  0.90           C
ATOM   2725  CG1 VAL B 346       3.330 -65.786  19.149  1.00  0.90           C
ATOM   2726  CG2 VAL B 346       2.625 -68.201  18.876  1.00  0.90           C
ATOM   2727  N   GLU B 347       5.412 -68.522  17.040  1.00  0.84           N
ATOM   2728  CA  GLU B 347       5.550 -68.355  15.599  1.00  0.84           C
ATOM   2729  C   GLU B 347       4.337 -67.620  15.040  1.00  0.84           C
ATOM   2730  O   GLU B 347       3.196 -67.925  15.371  1.00  0.84           O
ATOM   2731  CB  GLU B 347       5.793 -69.684  14.839  1.00  0.84           C
ATOM   2732  CG  GLU B 347       6.275 -69.499  13.370  1.00  0.84           C
ATOM   2733  CD  GLU B 347       6.346 -70.797  12.557  1.00  0.84           C
ATOM   2734  OE1 GLU B 347       5.809 -71.834  13.007  1.00  0.84           O
ATOM   2735  OE2 GLU B 347       6.887 -70.733  11.416  1.00  0.84           O
ATOM   2736  N   TRP B 348       4.527 -66.590  14.201  1.00  0.86           N
ATOM   2737  CA  TRP B 348       3.415 -65.760  13.782  1.00  0.86           C
ATOM   2738  C   TRP B 348       3.387 -65.725  12.281  1.00  0.86           C
ATOM   2739  O   TRP B 348       4.354 -65.328  11.629  1.00  0.86           O
ATOM   2740  CB  TRP B 348       3.536 -64.334  14.367  1.00  0.86           C
ATOM   2741  CG  TRP B 348       2.265 -63.486  14.436  1.00  0.86           C
ATOM   2742  CD1 TRP B 348       1.363 -63.173  13.455  1.00  0.86           C
ATOM   2743  CD2 TRP B 348       1.834 -62.776  15.614  1.00  0.86           C
ATOM   2744  NE1 TRP B 348       0.417 -62.294  13.939  1.00  0.86           N
ATOM   2745  CE2 TRP B 348       0.669 -62.058  15.260  1.00  0.86           C
ATOM   2746  CE3 TRP B 348       2.352 -62.705  16.905  1.00  0.86           C
ATOM   2747  CZ2 TRP B 348      -0.008 -61.291  16.188  1.00  0.86           C
ATOM   2748  CZ3 TRP B 348       1.664 -61.927  17.846  1.00  0.86           C
ATOM   2749  CH2 TRP B 348       0.490 -61.245  17.495  1.00  0.86           C
ATOM   2750  N   LYS B 349       2.269 -66.175  11.701  1.00  0.84           N
ATOM   2751  CA  LYS B 349       2.132 -66.313  10.275  1.00  0.84           C
ATOM   2752  C   LYS B 349       1.007 -65.442   9.778  1.00  0.84           C
ATOM   2753  O   LYS B 349      -0.060 -65.365  10.380  1.00  0.84           O
ATOM   2754  CB  LYS B 349       1.875 -67.787   9.902  1.00  0.84           C
ATOM   2755  CG  LYS B 349       3.083 -68.682  10.203  1.00  0.84           C
ATOM   2756  CD  LYS B 349       3.662 -69.373   8.960  1.00  0.84           C
ATOM   2757  CE  LYS B 349       4.929 -70.127   9.355  1.00  0.84           C
ATOM   2758  NZ  LYS B 349       5.494 -70.943   8.265  1.00  0.84           N
ATOM   2759  N   PHE B 350       1.237 -64.747   8.654  1.00  0.86           N
ATOM   2760  CA  PHE B 350       0.347 -63.717   8.171  1.00  0.86           C
ATOM   2761  C   PHE B 350      -0.325 -64.176   6.900  1.00  0.86           C
ATOM   2762  O   PHE B 350       0.312 -64.718   5.996  1.00  0.86           O
ATOM   2763  CB  PHE B 350       1.120 -62.423   7.815  1.00  0.86           C
ATOM   2764  CG  PHE B 350       1.810 -61.803   8.994  1.00  0.86           C
ATOM   2765  CD1 PHE B 350       1.095 -61.476  10.152  1.00  0.86           C
ATOM   2766  CD2 PHE B 350       3.176 -61.476   8.932  1.00  0.86           C
ATOM   2767  CE1 PHE B 350       1.745 -60.877  11.233  1.00  0.86           C
ATOM   2768  CE2 PHE B 350       3.823 -60.845   9.999  1.00  0.86           C
ATOM   2769  CZ  PHE B 350       3.107 -60.564  11.162  1.00  0.86           C
ATOM   2770  N   TYR B 351      -1.643 -63.951   6.801  1.00  0.87           N
ATOM   2771  CA  TYR B 351      -2.413 -64.329   5.639  1.00  0.87           C
ATOM   2772  C   TYR B 351      -3.385 -63.219   5.299  1.00  0.87           C
ATOM   2773  O   TYR B 351      -4.078 -62.696   6.172  1.00  0.87           O
ATOM   2774  CB  TYR B 351      -3.248 -65.613   5.887  1.00  0.87           C
ATOM   2775  CG  TYR B 351      -2.391 -66.735   6.393  1.00  0.87           C
ATOM   2776  CD1 TYR B 351      -1.763 -67.617   5.505  1.00  0.87           C
ATOM   2777  CD2 TYR B 351      -2.199 -66.906   7.773  1.00  0.87           C
ATOM   2778  CE1 TYR B 351      -0.968 -68.669   5.988  1.00  0.87           C
ATOM   2779  CE2 TYR B 351      -1.423 -67.962   8.256  1.00  0.87           C
ATOM   2780  CZ  TYR B 351      -0.819 -68.853   7.367  1.00  0.87           C
ATOM   2781  OH  TYR B 351      -0.077 -69.929   7.888  1.00  0.87           O
ATOM   2782  N   ASP B 352      -3.490 -62.849   4.012  1.00  0.87           N
ATOM   2783  CA  ASP B 352      -4.592 -62.026   3.560  1.00  0.87           C
ATOM   2784  C   ASP B 352      -4.771 -62.204   2.067  1.00  0.87           C
ATOM   2785  O   ASP B 352      -3.908 -62.735   1.370  1.00  0.87           O
ATOM   2786  CB  ASP B 352      -4.418 -60.518   3.902  1.00  0.87           C
ATOM   2787  CG  ASP B 352      -5.721 -59.748   3.730  1.00  0.87           C
ATOM   2788  OD1 ASP B 352      -6.802 -60.387   3.838  1.00  0.87           O
ATOM   2789  OD2 ASP B 352      -5.652 -58.544   3.405  1.00  0.87           O
ATOM   2790  N   ALA B 353      -5.938 -61.787   1.553  1.00  0.87           N
ATOM   2791  CA  ALA B 353      -6.265 -61.836   0.152  1.00  0.87           C
ATOM   2792  C   ALA B 353      -5.470 -60.847  -0.678  1.00  0.87           C
ATOM   2793  O   ALA B 353      -5.073 -61.138  -1.802  1.00  0.87           O
ATOM   2794  CB  ALA B 353      -7.776 -61.642  -0.050  1.00  0.87           C
ATOM   2795  N   GLN B 354      -5.213 -59.644  -0.141  1.00  0.78           N
ATOM   2796  CA  GLN B 354      -4.374 -58.682  -0.809  1.00  0.78           C
ATOM   2797  C   GLN B 354      -3.268 -58.253   0.142  1.00  0.78           C
ATOM   2798  O   GLN B 354      -3.512 -57.456   1.045  1.00  0.78           O
ATOM   2799  CB  GLN B 354      -5.229 -57.478  -1.278  1.00  0.78           C
ATOM   2800  CG  GLN B 354      -5.849 -57.728  -2.677  1.00  0.78           C
ATOM   2801  CD  GLN B 354      -7.370 -57.590  -2.758  1.00  0.78           C
ATOM   2802  OE1 GLN B 354      -8.082 -57.030  -1.925  1.00  0.78           O
ATOM   2803  NE2 GLN B 354      -7.913 -58.124  -3.880  1.00  0.78           N
ATOM   2804  N   PRO B 355      -2.029 -58.718  -0.008  1.00  0.83           N
ATOM   2805  CA  PRO B 355      -0.921 -58.223   0.792  1.00  0.83           C
ATOM   2806  C   PRO B 355      -0.497 -56.848   0.311  1.00  0.83           C
ATOM   2807  O   PRO B 355      -0.530 -56.580  -0.891  1.00  0.83           O
ATOM   2808  CB  PRO B 355       0.187 -59.264   0.549  1.00  0.83           C
ATOM   2809  CG  PRO B 355      -0.091 -59.785  -0.864  1.00  0.83           C
ATOM   2810  CD  PRO B 355      -1.618 -59.798  -0.917  1.00  0.83           C
ATOM   2811  N   CYS B 356      -0.098 -55.941   1.224  1.00  0.79           N
ATOM   2812  CA  CYS B 356       0.592 -54.716   0.855  1.00  0.79           C
ATOM   2813  C   CYS B 356       1.894 -54.976   0.125  1.00  0.79           C
ATOM   2814  O   CYS B 356       2.566 -55.984   0.324  1.00  0.79           O
ATOM   2815  CB  CYS B 356       0.927 -53.795   2.051  1.00  0.79           C
ATOM   2816  SG  CYS B 356      -0.531 -53.005   2.807  1.00  0.79           S
ATOM   2817  N   SER B 357       2.274 -54.049  -0.778  1.00  0.78           N
ATOM   2818  CA  SER B 357       3.501 -54.168  -1.546  1.00  0.78           C
ATOM   2819  C   SER B 357       4.730 -54.174  -0.673  1.00  0.78           C
ATOM   2820  O   SER B 357       5.603 -55.037  -0.791  1.00  0.78           O
ATOM   2821  CB  SER B 357       3.649 -53.020  -2.573  1.00  0.78           C
ATOM   2822  OG  SER B 357       2.460 -52.902  -3.356  1.00  0.78           O
ATOM   2823  N   ASP B 358       4.817 -53.248   0.293  1.00  0.81           N
ATOM   2824  CA  ASP B 358       5.684 -53.411   1.420  1.00  0.81           C
ATOM   2825  C   ASP B 358       5.169 -54.526   2.330  1.00  0.81           C
ATOM   2826  O   ASP B 358       3.974 -54.675   2.542  1.00  0.81           O
ATOM   2827  CB  ASP B 358       5.843 -52.054   2.130  1.00  0.81           C
ATOM   2828  CG  ASP B 358       4.503 -51.617   2.698  1.00  0.81           C
ATOM   2829  OD1 ASP B 358       3.657 -51.150   1.900  1.00  0.81           O
ATOM   2830  OD2 ASP B 358       4.307 -51.792   3.929  1.00  0.81           O
ATOM   2831  N   LYS B 359       6.080 -55.372   2.841  1.00  0.72           N
ATOM   2832  CA  LYS B 359       5.768 -56.476   3.732  1.00  0.72           C
ATOM   2833  C   LYS B 359       5.267 -57.706   2.992  1.00  0.72           C
ATOM   2834  O   LYS B 359       5.128 -58.757   3.618  1.00  0.72           O
ATOM   2835  CB  LYS B 359       4.854 -56.084   4.938  1.00  0.72           C
ATOM   2836  CG  LYS B 359       5.443 -54.972   5.832  1.00  0.72           C
ATOM   2837  CD  LYS B 359       4.369 -54.081   6.486  1.00  0.72           C
ATOM   2838  CE  LYS B 359       4.673 -53.617   7.914  1.00  0.72           C
ATOM   2839  NZ  LYS B 359       5.955 -52.881   7.963  1.00  0.72           N
ATOM   2840  N   ALA B 360       5.091 -57.668   1.657  1.00  0.82           N
ATOM   2841  CA  ALA B 360       4.563 -58.725   0.799  1.00  0.82           C
ATOM   2842  C   ALA B 360       5.197 -60.080   1.045  1.00  0.82           C
ATOM   2843  O   ALA B 360       4.531 -61.096   1.150  1.00  0.82           O
ATOM   2844  CB  ALA B 360       4.740 -58.355  -0.694  1.00  0.82           C
ATOM   2845  N   TYR B 361       6.518 -60.108   1.261  1.00  0.78           N
ATOM   2846  CA  TYR B 361       7.293 -61.294   1.537  1.00  0.78           C
ATOM   2847  C   TYR B 361       7.015 -61.971   2.882  1.00  0.78           C
ATOM   2848  O   TYR B 361       7.474 -63.082   3.130  1.00  0.78           O
ATOM   2849  CB  TYR B 361       8.800 -60.935   1.415  1.00  0.78           C
ATOM   2850  CG  TYR B 361       9.286 -60.053   2.544  1.00  0.78           C
ATOM   2851  CD1 TYR B 361       8.892 -58.707   2.653  1.00  0.78           C
ATOM   2852  CD2 TYR B 361      10.143 -60.585   3.521  1.00  0.78           C
ATOM   2853  CE1 TYR B 361       9.365 -57.906   3.698  1.00  0.78           C
ATOM   2854  CE2 TYR B 361      10.619 -59.782   4.567  1.00  0.78           C
ATOM   2855  CZ  TYR B 361      10.226 -58.442   4.658  1.00  0.78           C
ATOM   2856  OH  TYR B 361      10.715 -57.626   5.700  1.00  0.78           O
ATOM   2857  N   LYS B 362       6.293 -61.303   3.803  1.00  0.79           N
ATOM   2858  CA  LYS B 362       6.006 -61.836   5.114  1.00  0.79           C
ATOM   2859  C   LYS B 362       4.618 -62.440   5.158  1.00  0.79           C
ATOM   2860  O   LYS B 362       4.231 -63.021   6.170  1.00  0.79           O
ATOM   2861  CB  LYS B 362       5.990 -60.696   6.164  1.00  0.79           C
ATOM   2862  CG  LYS B 362       7.349 -60.121   6.577  1.00  0.79           C
ATOM   2863  CD  LYS B 362       7.125 -58.955   7.554  1.00  0.79           C
ATOM   2864  CE  LYS B 362       8.149 -58.853   8.686  1.00  0.79           C
ATOM   2865  NZ  LYS B 362       9.496 -58.528   8.177  1.00  0.79           N
ATOM   2866  N   ILE B 363       3.830 -62.312   4.081  1.00  0.83           N
ATOM   2867  CA  ILE B 363       2.416 -62.625   4.097  1.00  0.83           C
ATOM   2868  C   ILE B 363       2.121 -63.622   3.004  1.00  0.83           C
ATOM   2869  O   ILE B 363       2.525 -63.444   1.859  1.00  0.83           O
ATOM   2870  CB  ILE B 363       1.543 -61.386   3.877  1.00  0.83           C
ATOM   2871  CG1 ILE B 363       1.960 -60.221   4.805  1.00  0.83           C
ATOM   2872  CG2 ILE B 363       0.052 -61.745   4.076  1.00  0.83           C
ATOM   2873  CD1 ILE B 363       1.142 -58.952   4.569  1.00  0.83           C
ATOM   2874  N   GLU B 364       1.395 -64.705   3.321  1.00  0.82           N
ATOM   2875  CA  GLU B 364       0.944 -65.639   2.310  1.00  0.82           C
ATOM   2876  C   GLU B 364      -0.381 -65.174   1.709  1.00  0.82           C
ATOM   2877  O   GLU B 364      -1.238 -64.612   2.399  1.00  0.82           O
ATOM   2878  CB  GLU B 364       0.818 -67.051   2.920  1.00  0.82           C
ATOM   2879  CG  GLU B 364       0.355 -68.161   1.945  1.00  0.82           C
ATOM   2880  CD  GLU B 364       1.312 -68.333   0.767  1.00  0.82           C
ATOM   2881  OE1 GLU B 364       1.199 -67.536  -0.199  1.00  0.82           O
ATOM   2882  OE2 GLU B 364       2.160 -69.259   0.836  1.00  0.82           O
ATOM   2883  N   GLU B 365      -0.583 -65.379   0.392  1.00  0.82           N
ATOM   2884  CA  GLU B 365      -1.778 -64.929  -0.303  1.00  0.82           C
ATOM   2885  C   GLU B 365      -2.904 -65.933  -0.118  1.00  0.82           C
ATOM   2886  O   GLU B 365      -2.844 -67.066  -0.589  1.00  0.82           O
ATOM   2887  CB  GLU B 365      -1.527 -64.734  -1.822  1.00  0.82           C
ATOM   2888  CG  GLU B 365      -2.718 -64.123  -2.611  1.00  0.82           C
ATOM   2889  CD  GLU B 365      -2.574 -64.297  -4.125  1.00  0.82           C
ATOM   2890  OE1 GLU B 365      -2.183 -63.310  -4.801  1.00  0.82           O
ATOM   2891  OE2 GLU B 365      -2.892 -65.410  -4.621  1.00  0.82           O
ATOM   2892  N   LEU B 366      -3.985 -65.557   0.597  1.00  0.88           N
ATOM   2893  CA  LEU B 366      -5.114 -66.457   0.723  1.00  0.88           C
ATOM   2894  C   LEU B 366      -6.445 -65.767   0.927  1.00  0.88           C
ATOM   2895  O   LEU B 366      -6.602 -64.889   1.769  1.00  0.88           O
ATOM   2896  CB  LEU B 366      -4.947 -67.470   1.895  1.00  0.88           C
ATOM   2897  CG  LEU B 366      -4.525 -68.902   1.498  1.00  0.88           C
ATOM   2898  CD1 LEU B 366      -4.711 -69.843   2.698  1.00  0.88           C
ATOM   2899  CD2 LEU B 366      -5.306 -69.436   0.287  1.00  0.88           C
ATOM   2900  N   PHE B 367      -7.490 -66.247   0.225  1.00  0.84           N
ATOM   2901  CA  PHE B 367      -8.863 -65.960   0.577  1.00  0.84           C
ATOM   2902  C   PHE B 367      -9.369 -67.141   1.386  1.00  0.84           C
ATOM   2903  O   PHE B 367      -9.496 -68.251   0.869  1.00  0.84           O
ATOM   2904  CB  PHE B 367      -9.724 -65.788  -0.702  1.00  0.84           C
ATOM   2905  CG  PHE B 367     -11.059 -65.097  -0.509  1.00  0.84           C
ATOM   2906  CD1 PHE B 367     -11.762 -65.018   0.709  1.00  0.84           C
ATOM   2907  CD2 PHE B 367     -11.653 -64.530  -1.647  1.00  0.84           C
ATOM   2908  CE1 PHE B 367     -13.008 -64.384   0.791  1.00  0.84           C
ATOM   2909  CE2 PHE B 367     -12.898 -63.896  -1.575  1.00  0.84           C
ATOM   2910  CZ  PHE B 367     -13.575 -63.819  -0.354  1.00  0.84           C
ATOM   2911  N   TYR B 368      -9.641 -66.940   2.690  1.00  0.89           N
ATOM   2912  CA  TYR B 368     -10.228 -67.960   3.533  1.00  0.89           C
ATOM   2913  C   TYR B 368     -11.623 -68.403   3.085  1.00  0.89           C
ATOM   2914  O   TYR B 368     -12.464 -67.595   2.700  1.00  0.89           O
ATOM   2915  CB  TYR B 368     -10.205 -67.506   5.020  1.00  0.89           C
ATOM   2916  CG  TYR B 368     -10.371 -68.654   5.998  1.00  0.89           C
ATOM   2917  CD1 TYR B 368      -9.245 -69.343   6.475  1.00  0.89           C
ATOM   2918  CD2 TYR B 368     -11.638 -69.071   6.445  1.00  0.89           C
ATOM   2919  CE1 TYR B 368      -9.389 -70.424   7.357  1.00  0.89           C
ATOM   2920  CE2 TYR B 368     -11.792 -70.186   7.277  1.00  0.89           C
ATOM   2921  CZ  TYR B 368     -10.661 -70.866   7.731  1.00  0.89           C
ATOM   2922  OH  TYR B 368     -10.812 -71.996   8.555  1.00  0.89           O
ATOM   2923  N   SER B 369     -11.876 -69.717   3.133  1.00  0.89           N
ATOM   2924  CA  SER B 369     -13.203 -70.295   3.029  1.00  0.89           C
ATOM   2925  C   SER B 369     -13.169 -71.509   3.913  1.00  0.89           C
ATOM   2926  O   SER B 369     -12.220 -72.292   3.861  1.00  0.89           O
ATOM   2927  CB  SER B 369     -13.560 -70.732   1.577  1.00  0.89           C
ATOM   2928  OG  SER B 369     -14.658 -71.653   1.495  1.00  0.89           O
ATOM   2929  N   TYR B 370     -14.199 -71.733   4.752  1.00  0.89           N
ATOM   2930  CA  TYR B 370     -14.225 -72.857   5.670  1.00  0.89           C
ATOM   2931  C   TYR B 370     -14.173 -74.181   4.941  1.00  0.89           C
ATOM   2932  O   TYR B 370     -13.493 -75.112   5.364  1.00  0.89           O
ATOM   2933  CB  TYR B 370     -15.470 -72.786   6.587  1.00  0.89           C
ATOM   2934  CG  TYR B 370     -15.505 -73.883   7.624  1.00  0.89           C
ATOM   2935  CD1 TYR B 370     -14.856 -73.723   8.857  1.00  0.89           C
ATOM   2936  CD2 TYR B 370     -16.199 -75.079   7.371  1.00  0.89           C
ATOM   2937  CE1 TYR B 370     -14.934 -74.717   9.839  1.00  0.89           C
ATOM   2938  CE2 TYR B 370     -16.265 -76.083   8.347  1.00  0.89           C
ATOM   2939  CZ  TYR B 370     -15.633 -75.898   9.580  1.00  0.89           C
ATOM   2940  OH  TYR B 370     -15.696 -76.897  10.565  1.00  0.89           O
ATOM   2941  N   ALA B 371     -14.864 -74.253   3.790  1.00  0.91           N
ATOM   2942  CA  ALA B 371     -14.909 -75.419   2.945  1.00  0.91           C
ATOM   2943  C   ALA B 371     -13.544 -75.863   2.439  1.00  0.91           C
ATOM   2944  O   ALA B 371     -13.262 -77.051   2.331  1.00  0.91           O
ATOM   2945  CB  ALA B 371     -15.856 -75.134   1.768  1.00  0.91           C
ATOM   2946  N   THR B 372     -12.648 -74.914   2.121  1.00  0.91           N
ATOM   2947  CA  THR B 372     -11.344 -75.256   1.578  1.00  0.91           C
ATOM   2948  C   THR B 372     -10.267 -75.297   2.642  1.00  0.91           C
ATOM   2949  O   THR B 372      -9.195 -75.880   2.434  1.00  0.91           O
ATOM   2950  CB  THR B 372     -10.863 -74.243   0.533  1.00  0.91           C
ATOM   2951  OG1 THR B 372     -11.943 -73.497  -0.015  1.00  0.91           O
ATOM   2952  CG2 THR B 372     -10.206 -75.004  -0.626  1.00  0.91           C
ATOM   2953  N   HIS B 373     -10.484 -74.650   3.807  1.00  0.86           N
ATOM   2954  CA  HIS B 373      -9.389 -74.372   4.722  1.00  0.86           C
ATOM   2955  C   HIS B 373      -9.539 -74.839   6.155  1.00  0.86           C
ATOM   2956  O   HIS B 373      -8.603 -74.670   6.931  1.00  0.86           O
ATOM   2957  CB  HIS B 373      -9.045 -72.867   4.715  1.00  0.86           C
ATOM   2958  CG  HIS B 373      -8.538 -72.395   3.383  1.00  0.86           C
ATOM   2959  ND1 HIS B 373      -8.810 -71.108   2.981  1.00  0.86           N
ATOM   2960  CD2 HIS B 373      -7.742 -73.010   2.467  1.00  0.86           C
ATOM   2961  CE1 HIS B 373      -8.185 -70.957   1.830  1.00  0.86           C
ATOM   2962  NE2 HIS B 373      -7.520 -72.081   1.471  1.00  0.86           N
ATOM   2963  N   SER B 374     -10.636 -75.514   6.548  1.00  0.86           N
ATOM   2964  CA  SER B 374     -10.791 -76.063   7.896  1.00  0.86           C
ATOM   2965  C   SER B 374      -9.724 -77.087   8.258  1.00  0.86           C
ATOM   2966  O   SER B 374      -9.118 -77.033   9.325  1.00  0.86           O
ATOM   2967  CB  SER B 374     -12.187 -76.710   8.067  1.00  0.86           C
ATOM   2968  OG  SER B 374     -12.401 -77.709   7.069  1.00  0.86           O
ATOM   2969  N   ASP B 375      -9.413 -77.978   7.304  1.00  0.86           N
ATOM   2970  CA  ASP B 375      -8.328 -78.929   7.343  1.00  0.86           C
ATOM   2971  C   ASP B 375      -6.948 -78.348   7.647  1.00  0.86           C
ATOM   2972  O   ASP B 375      -6.126 -78.977   8.300  1.00  0.86           O
ATOM   2973  CB  ASP B 375      -8.149 -79.507   5.924  1.00  0.86           C
ATOM   2974  CG  ASP B 375      -9.288 -80.375   5.431  1.00  0.86           C
ATOM   2975  OD1 ASP B 375     -10.090 -80.870   6.254  1.00  0.86           O
ATOM   2976  OD2 ASP B 375      -9.328 -80.532   4.181  1.00  0.86           O
ATOM   2977  N   LYS B 376      -6.620 -77.158   7.097  1.00  0.83           N
ATOM   2978  CA  LYS B 376      -5.233 -76.798   6.851  1.00  0.83           C
ATOM   2979  C   LYS B 376      -4.639 -75.937   7.945  1.00  0.83           C
ATOM   2980  O   LYS B 376      -3.440 -75.680   7.953  1.00  0.83           O
ATOM   2981  CB  LYS B 376      -5.115 -75.969   5.537  1.00  0.83           C
ATOM   2982  CG  LYS B 376      -5.949 -76.449   4.331  1.00  0.83           C
ATOM   2983  CD  LYS B 376      -5.499 -77.781   3.715  1.00  0.83           C
ATOM   2984  CE  LYS B 376      -6.548 -78.480   2.827  1.00  0.83           C
ATOM   2985  NZ  LYS B 376      -7.140 -77.593   1.801  1.00  0.83           N
ATOM   2986  N   PHE B 377      -5.480 -75.477   8.882  1.00  0.86           N
ATOM   2987  CA  PHE B 377      -5.103 -74.552   9.934  1.00  0.86           C
ATOM   2988  C   PHE B 377      -5.404 -75.202  11.279  1.00  0.86           C
ATOM   2989  O   PHE B 377      -5.931 -74.587  12.208  1.00  0.86           O
ATOM   2990  CB  PHE B 377      -5.845 -73.189   9.809  1.00  0.86           C
ATOM   2991  CG  PHE B 377      -5.360 -72.358   8.647  1.00  0.86           C
ATOM   2992  CD1 PHE B 377      -5.725 -72.668   7.327  1.00  0.86           C
ATOM   2993  CD2 PHE B 377      -4.582 -71.211   8.875  1.00  0.86           C
ATOM   2994  CE1 PHE B 377      -5.311 -71.864   6.257  1.00  0.86           C
ATOM   2995  CE2 PHE B 377      -4.156 -70.411   7.808  1.00  0.86           C
ATOM   2996  CZ  PHE B 377      -4.516 -70.740   6.499  1.00  0.86           C
ATOM   2997  N   THR B 378      -5.117 -76.510  11.398  1.00  0.86           N
ATOM   2998  CA  THR B 378      -5.315 -77.286  12.609  1.00  0.86           C
ATOM   2999  C   THR B 378      -4.332 -76.938  13.706  1.00  0.86           C
ATOM   3000  O   THR B 378      -4.683 -76.936  14.883  1.00  0.86           O
ATOM   3001  CB  THR B 378      -5.267 -78.794  12.377  1.00  0.86           C
ATOM   3002  OG1 THR B 378      -4.108 -79.156  11.637  1.00  0.86           O
ATOM   3003  CG2 THR B 378      -6.493 -79.228  11.558  1.00  0.86           C
ATOM   3004  N   ASP B 379      -3.059 -76.674  13.365  1.00  0.89           N
ATOM   3005  CA  ASP B 379      -2.033 -76.327  14.317  1.00  0.89           C
ATOM   3006  C   ASP B 379      -2.156 -74.910  14.898  1.00  0.89           C
ATOM   3007  O   ASP B 379      -2.489 -73.934  14.235  1.00  0.89           O
ATOM   3008  CB  ASP B 379      -0.642 -76.592  13.693  1.00  0.89           C
ATOM   3009  CG  ASP B 379      -0.537 -75.808  12.395  1.00  0.89           C
ATOM   3010  OD1 ASP B 379      -0.013 -74.668  12.426  1.00  0.89           O
ATOM   3011  OD2 ASP B 379      -1.047 -76.327  11.373  1.00  0.89           O
ATOM   3012  N   GLY B 380      -1.850 -74.769  16.207  1.00  0.94           N
ATOM   3013  CA  GLY B 380      -1.919 -73.487  16.904  1.00  0.94           C
ATOM   3014  C   GLY B 380      -3.278 -72.833  17.025  1.00  0.94           C
ATOM   3015  O   GLY B 380      -4.277 -73.470  17.351  1.00  0.94           O
ATOM   3016  N   VAL B 381      -3.323 -71.499  16.850  1.00  0.95           N
ATOM   3017  CA  VAL B 381      -4.553 -70.730  16.942  1.00  0.95           C
ATOM   3018  C   VAL B 381      -4.690 -69.838  15.729  1.00  0.95           C
ATOM   3019  O   VAL B 381      -3.702 -69.415  15.125  1.00  0.95           O
ATOM   3020  CB  VAL B 381      -4.632 -69.891  18.221  1.00  0.95           C
ATOM   3021  CG1 VAL B 381      -3.809 -68.591  18.127  1.00  0.95           C
ATOM   3022  CG2 VAL B 381      -6.092 -69.581  18.607  1.00  0.95           C
ATOM   3023  N   CYS B 382      -5.929 -69.494  15.347  1.00  0.94           N
ATOM   3024  CA  CYS B 382      -6.190 -68.579  14.261  1.00  0.94           C
ATOM   3025  C   CYS B 382      -6.739 -67.286  14.817  1.00  0.94           C
ATOM   3026  O   CYS B 382      -7.543 -67.268  15.748  1.00  0.94           O
ATOM   3027  CB  CYS B 382      -7.181 -69.163  13.229  1.00  0.94           C
ATOM   3028  SG  CYS B 382      -6.479 -70.651  12.453  1.00  0.94           S
ATOM   3029  N   LEU B 383      -6.300 -66.152  14.268  1.00  0.94           N
ATOM   3030  CA  LEU B 383      -6.790 -64.851  14.651  1.00  0.94           C
ATOM   3031  C   LEU B 383      -7.436 -64.221  13.441  1.00  0.94           C
ATOM   3032  O   LEU B 383      -6.860 -64.188  12.357  1.00  0.94           O
ATOM   3033  CB  LEU B 383      -5.632 -63.958  15.151  1.00  0.94           C
ATOM   3034  CG  LEU B 383      -5.987 -62.486  15.454  1.00  0.94           C
ATOM   3035  CD1 LEU B 383      -6.891 -62.327  16.682  1.00  0.94           C
ATOM   3036  CD2 LEU B 383      -4.704 -61.677  15.662  1.00  0.94           C
ATOM   3037  N   PHE B 384      -8.667 -63.703  13.592  1.00  0.93           N
ATOM   3038  CA  PHE B 384      -9.300 -62.951  12.527  1.00  0.93           C
ATOM   3039  C   PHE B 384      -9.738 -61.623  13.117  1.00  0.93           C
ATOM   3040  O   PHE B 384     -10.740 -61.553  13.825  1.00  0.93           O
ATOM   3041  CB  PHE B 384     -10.567 -63.666  11.962  1.00  0.93           C
ATOM   3042  CG  PHE B 384     -10.320 -65.057  11.448  1.00  0.93           C
ATOM   3043  CD1 PHE B 384     -10.266 -66.116  12.363  1.00  0.93           C
ATOM   3044  CD2 PHE B 384     -10.244 -65.350  10.074  1.00  0.93           C
ATOM   3045  CE1 PHE B 384     -10.106 -67.435  11.930  1.00  0.93           C
ATOM   3046  CE2 PHE B 384     -10.076 -66.672   9.635  1.00  0.93           C
ATOM   3047  CZ  PHE B 384      -9.997 -67.715  10.565  1.00  0.93           C
ATOM   3048  N   TRP B 385      -9.035 -60.501  12.875  1.00  0.90           N
ATOM   3049  CA  TRP B 385      -9.448 -59.252  13.501  1.00  0.90           C
ATOM   3050  C   TRP B 385     -10.056 -58.307  12.489  1.00  0.90           C
ATOM   3051  O   TRP B 385      -9.375 -57.619  11.736  1.00  0.90           O
ATOM   3052  CB  TRP B 385      -8.305 -58.605  14.313  1.00  0.90           C
ATOM   3053  CG  TRP B 385      -8.788 -57.576  15.329  1.00  0.90           C
ATOM   3054  CD1 TRP B 385      -8.874 -56.217  15.211  1.00  0.90           C
ATOM   3055  CD2 TRP B 385      -9.283 -57.907  16.634  1.00  0.90           C
ATOM   3056  NE1 TRP B 385      -9.404 -55.676  16.360  1.00  0.90           N
ATOM   3057  CE2 TRP B 385      -9.675 -56.685  17.245  1.00  0.90           C
ATOM   3058  CE3 TRP B 385      -9.408 -59.117  17.309  1.00  0.90           C
ATOM   3059  CZ2 TRP B 385     -10.210 -56.670  18.521  1.00  0.90           C
ATOM   3060  CZ3 TRP B 385      -9.920 -59.091  18.612  1.00  0.90           C
ATOM   3061  CH2 TRP B 385     -10.321 -57.884  19.208  1.00  0.90           C
ATOM   3062  N   ASN B 386     -11.406 -58.293  12.465  1.00  0.91           N
ATOM   3063  CA  ASN B 386     -12.235 -57.616  11.485  1.00  0.91           C
ATOM   3064  C   ASN B 386     -12.067 -58.229  10.115  1.00  0.91           C
ATOM   3065  O   ASN B 386     -12.272 -57.594   9.084  1.00  0.91           O
ATOM   3066  CB  ASN B 386     -12.041 -56.082  11.426  1.00  0.91           C
ATOM   3067  CG  ASN B 386     -12.501 -55.437  12.718  1.00  0.91           C
ATOM   3068  OD1 ASN B 386     -12.948 -56.073  13.676  1.00  0.91           O
ATOM   3069  ND2 ASN B 386     -12.423 -54.088  12.766  1.00  0.91           N
ATOM   3070  N   CYS B 387     -11.743 -59.526  10.088  1.00  0.94           N
ATOM   3071  CA  CYS B 387     -11.747 -60.316   8.890  1.00  0.94           C
ATOM   3072  C   CYS B 387     -13.034 -61.123   8.872  1.00  0.94           C
ATOM   3073  O   CYS B 387     -13.313 -61.936   9.760  1.00  0.94           O
ATOM   3074  CB  CYS B 387     -10.489 -61.193   8.859  1.00  0.94           C
ATOM   3075  SG  CYS B 387     -10.378 -62.284   7.402  1.00  0.94           S
ATOM   3076  N   ASN B 388     -13.901 -60.868   7.876  1.00  0.86           N
ATOM   3077  CA  ASN B 388     -15.299 -61.229   7.972  1.00  0.86           C
ATOM   3078  C   ASN B 388     -15.603 -62.371   7.018  1.00  0.86           C
ATOM   3079  O   ASN B 388     -15.708 -62.166   5.809  1.00  0.86           O
ATOM   3080  CB  ASN B 388     -16.212 -60.023   7.615  1.00  0.86           C
ATOM   3081  CG  ASN B 388     -15.773 -58.723   8.290  1.00  0.86           C
ATOM   3082  OD1 ASN B 388     -15.992 -58.500   9.483  1.00  0.86           O
ATOM   3083  ND2 ASN B 388     -15.164 -57.812   7.495  1.00  0.86           N
ATOM   3084  N   VAL B 389     -15.763 -63.602   7.536  1.00  0.87           N
ATOM   3085  CA  VAL B 389     -15.724 -64.793   6.705  1.00  0.87           C
ATOM   3086  C   VAL B 389     -16.965 -65.620   6.987  1.00  0.87           C
ATOM   3087  O   VAL B 389     -17.734 -65.302   7.901  1.00  0.87           O
ATOM   3088  CB  VAL B 389     -14.446 -65.610   6.924  1.00  0.87           C
ATOM   3089  CG1 VAL B 389     -14.138 -66.424   5.658  1.00  0.87           C
ATOM   3090  CG2 VAL B 389     -13.270 -64.670   7.263  1.00  0.87           C
ATOM   3091  N   ASP B 390     -17.227 -66.671   6.188  1.00  0.81           N
ATOM   3092  CA  ASP B 390     -18.064 -67.802   6.523  1.00  0.81           C
ATOM   3093  C   ASP B 390     -17.575 -68.550   7.779  1.00  0.81           C
ATOM   3094  O   ASP B 390     -16.710 -68.070   8.507  1.00  0.81           O
ATOM   3095  CB  ASP B 390     -18.247 -68.718   5.288  1.00  0.81           C
ATOM   3096  CG  ASP B 390     -16.908 -69.142   4.711  1.00  0.81           C
ATOM   3097  OD1 ASP B 390     -16.591 -70.353   4.789  1.00  0.81           O
ATOM   3098  OD2 ASP B 390     -16.187 -68.260   4.186  1.00  0.81           O
ATOM   3099  N   ARG B 391     -18.167 -69.720   8.130  1.00  0.76           N
ATOM   3100  CA  ARG B 391     -18.038 -70.247   9.485  1.00  0.76           C
ATOM   3101  C   ARG B 391     -16.624 -70.461  10.006  1.00  0.76           C
ATOM   3102  O   ARG B 391     -15.731 -70.928   9.313  1.00  0.76           O
ATOM   3103  CB  ARG B 391     -19.010 -71.433   9.792  1.00  0.76           C
ATOM   3104  CG  ARG B 391     -18.423 -72.858   9.842  1.00  0.76           C
ATOM   3105  CD  ARG B 391     -19.465 -73.924  10.226  1.00  0.76           C
ATOM   3106  NE  ARG B 391     -20.008 -74.540   8.970  1.00  0.76           N
ATOM   3107  CZ  ARG B 391     -21.304 -74.645   8.644  1.00  0.76           C
ATOM   3108  NH1 ARG B 391     -22.265 -74.014   9.312  1.00  0.76           N
ATOM   3109  NH2 ARG B 391     -21.640 -75.417   7.608  1.00  0.76           N
ATOM   3110  N   TYR B 392     -16.362 -70.058  11.262  1.00  0.89           N
ATOM   3111  CA  TYR B 392     -15.004 -69.963  11.755  1.00  0.89           C
ATOM   3112  C   TYR B 392     -14.449 -71.313  12.246  1.00  0.89           C
ATOM   3113  O   TYR B 392     -15.199 -72.110  12.817  1.00  0.89           O
ATOM   3114  CB  TYR B 392     -14.908 -68.882  12.873  1.00  0.89           C
ATOM   3115  CG  TYR B 392     -15.113 -67.466  12.340  1.00  0.89           C
ATOM   3116  CD1 TYR B 392     -14.335 -66.991  11.269  1.00  0.89           C
ATOM   3117  CD2 TYR B 392     -16.083 -66.596  12.877  1.00  0.89           C
ATOM   3118  CE1 TYR B 392     -14.515 -65.698  10.749  1.00  0.89           C
ATOM   3119  CE2 TYR B 392     -16.270 -65.310  12.341  1.00  0.89           C
ATOM   3120  CZ  TYR B 392     -15.472 -64.835  11.298  1.00  0.89           C
ATOM   3121  OH  TYR B 392     -15.627 -63.496  10.845  1.00  0.89           O
ATOM   3122  N   PRO B 393     -13.154 -71.626  12.030  1.00  0.92           N
ATOM   3123  CA  PRO B 393     -12.465 -72.770  12.637  1.00  0.92           C
ATOM   3124  C   PRO B 393     -12.560 -72.803  14.144  1.00  0.92           C
ATOM   3125  O   PRO B 393     -12.675 -71.759  14.774  1.00  0.92           O
ATOM   3126  CB  PRO B 393     -11.014 -72.636  12.152  1.00  0.92           C
ATOM   3127  CG  PRO B 393     -10.816 -71.134  11.968  1.00  0.92           C
ATOM   3128  CD  PRO B 393     -12.187 -70.663  11.493  1.00  0.92           C
ATOM   3129  N   ALA B 394     -12.522 -74.007  14.741  1.00  0.91           N
ATOM   3130  CA  ALA B 394     -12.769 -74.228  16.147  1.00  0.91           C
ATOM   3131  C   ALA B 394     -11.787 -73.506  17.066  1.00  0.91           C
ATOM   3132  O   ALA B 394     -12.148 -72.932  18.091  1.00  0.91           O
ATOM   3133  CB  ALA B 394     -12.768 -75.753  16.387  1.00  0.91           C
ATOM   3134  N   ASN B 395     -10.508 -73.505  16.674  1.00  0.89           N
ATOM   3135  CA  ASN B 395      -9.395 -72.860  17.338  1.00  0.89           C
ATOM   3136  C   ASN B 395      -9.160 -71.415  16.904  1.00  0.89           C
ATOM   3137  O   ASN B 395      -8.181 -71.091  16.238  1.00  0.89           O
ATOM   3138  CB  ASN B 395      -8.107 -73.685  17.095  1.00  0.89           C
ATOM   3139  CG  ASN B 395      -7.978 -74.113  15.628  1.00  0.89           C
ATOM   3140  OD1 ASN B 395      -8.683 -75.033  15.190  1.00  0.89           O
ATOM   3141  ND2 ASN B 395      -7.121 -73.430  14.842  1.00  0.89           N
ATOM   3142  N   SER B 396     -10.041 -70.488  17.308  1.00  0.93           N
ATOM   3143  CA  SER B 396     -10.028 -69.137  16.777  1.00  0.93           C
ATOM   3144  C   SER B 396     -10.240 -68.055  17.822  1.00  0.93           C
ATOM   3145  O   SER B 396     -10.904 -68.257  18.833  1.00  0.93           O
ATOM   3146  CB  SER B 396     -11.109 -68.972  15.685  1.00  0.93           C
ATOM   3147  OG  SER B 396     -10.999 -67.718  15.018  1.00  0.93           O
ATOM   3148  N   ILE B 397      -9.670 -66.862  17.582  1.00  0.94           N
ATOM   3149  CA  ILE B 397      -9.921 -65.621  18.303  1.00  0.94           C
ATOM   3150  C   ILE B 397     -10.404 -64.630  17.251  1.00  0.94           C
ATOM   3151  O   ILE B 397      -9.690 -64.334  16.294  1.00  0.94           O
ATOM   3152  CB  ILE B 397      -8.649 -65.060  18.953  1.00  0.94           C
ATOM   3153  CG1 ILE B 397      -8.002 -66.087  19.906  1.00  0.94           C
ATOM   3154  CG2 ILE B 397      -8.912 -63.732  19.708  1.00  0.94           C
ATOM   3155  CD1 ILE B 397      -6.485 -65.904  20.021  1.00  0.94           C
ATOM   3156  N   VAL B 398     -11.631 -64.084  17.358  1.00  0.94           N
ATOM   3157  CA  VAL B 398     -12.160 -63.261  16.278  1.00  0.94           C
ATOM   3158  C   VAL B 398     -13.003 -62.111  16.770  1.00  0.94           C
ATOM   3159  O   VAL B 398     -13.808 -62.220  17.697  1.00  0.94           O
ATOM   3160  CB  VAL B 398     -12.881 -64.066  15.186  1.00  0.94           C
ATOM   3161  CG1 VAL B 398     -13.953 -64.987  15.773  1.00  0.94           C
ATOM   3162  CG2 VAL B 398     -13.538 -63.179  14.106  1.00  0.94           C
ATOM   3163  N   CYS B 399     -12.809 -60.947  16.121  1.00  0.95           N
ATOM   3164  CA  CYS B 399     -13.660 -59.791  16.252  1.00  0.95           C
ATOM   3165  C   CYS B 399     -14.410 -59.618  14.946  1.00  0.95           C
ATOM   3166  O   CYS B 399     -13.817 -59.571  13.867  1.00  0.95           O
ATOM   3167  CB  CYS B 399     -12.836 -58.522  16.548  1.00  0.95           C
ATOM   3168  SG  CYS B 399     -13.866 -57.056  16.881  1.00  0.95           S
ATOM   3169  N   ARG B 400     -15.750 -59.554  15.021  1.00  0.86           N
ATOM   3170  CA  ARG B 400     -16.612 -59.373  13.873  1.00  0.86           C
ATOM   3171  C   ARG B 400     -17.586 -58.267  14.208  1.00  0.86           C
ATOM   3172  O   ARG B 400     -18.124 -58.204  15.311  1.00  0.86           O
ATOM   3173  CB  ARG B 400     -17.409 -60.669  13.545  1.00  0.86           C
ATOM   3174  CG  ARG B 400     -18.495 -60.566  12.439  1.00  0.86           C
ATOM   3175  CD  ARG B 400     -18.007 -60.404  10.990  1.00  0.86           C
ATOM   3176  NE  ARG B 400     -18.183 -61.703  10.240  1.00  0.86           N
ATOM   3177  CZ  ARG B 400     -19.308 -62.062   9.598  1.00  0.86           C
ATOM   3178  NH1 ARG B 400     -20.375 -61.268   9.548  1.00  0.86           N
ATOM   3179  NH2 ARG B 400     -19.362 -63.249   8.998  1.00  0.86           N
ATOM   3180  N   PHE B 401     -17.842 -57.355  13.260  1.00  0.92           N
ATOM   3181  CA  PHE B 401     -18.887 -56.355  13.368  1.00  0.92           C
ATOM   3182  C   PHE B 401     -20.313 -56.965  13.362  1.00  0.92           C
ATOM   3183  O   PHE B 401     -20.626 -57.757  12.470  1.00  0.92           O
ATOM   3184  CB  PHE B 401     -18.698 -55.393  12.162  1.00  0.92           C
ATOM   3185  CG  PHE B 401     -19.290 -54.055  12.455  1.00  0.92           C
ATOM   3186  CD1 PHE B 401     -20.651 -53.814  12.238  1.00  0.92           C
ATOM   3187  CD2 PHE B 401     -18.495 -53.044  13.015  1.00  0.92           C
ATOM   3188  CE1 PHE B 401     -21.221 -52.598  12.626  1.00  0.92           C
ATOM   3189  CE2 PHE B 401     -19.066 -51.837  13.427  1.00  0.92           C
ATOM   3190  CZ  PHE B 401     -20.434 -51.616  13.238  1.00  0.92           C
ATOM   3191  N   ASP B 402     -21.220 -56.625  14.316  1.00  0.91           N
ATOM   3192  CA  ASP B 402     -22.636 -56.984  14.209  1.00  0.91           C
ATOM   3193  C   ASP B 402     -23.359 -55.954  13.336  1.00  0.91           C
ATOM   3194  O   ASP B 402     -23.458 -54.776  13.664  1.00  0.91           O
ATOM   3195  CB  ASP B 402     -23.337 -57.221  15.596  1.00  0.91           C
ATOM   3196  CG  ASP B 402     -24.716 -57.870  15.510  1.00  0.91           C
ATOM   3197  OD1 ASP B 402     -25.363 -57.803  14.441  1.00  0.91           O
ATOM   3198  OD2 ASP B 402     -25.194 -58.448  16.518  1.00  0.91           O
ATOM   3199  N   THR B 403     -23.897 -56.401  12.177  1.00  0.89           N
ATOM   3200  CA  THR B 403     -24.595 -55.549  11.219  1.00  0.89           C
ATOM   3201  C   THR B 403     -25.949 -55.129  11.726  1.00  0.89           C
ATOM   3202  O   THR B 403     -26.569 -54.210  11.194  1.00  0.89           O
ATOM   3203  CB  THR B 403     -24.817 -56.174   9.832  1.00  0.89           C
ATOM   3204  OG1 THR B 403     -25.531 -57.412   9.853  1.00  0.89           O
ATOM   3205  CG2 THR B 403     -23.457 -56.430   9.169  1.00  0.89           C
ATOM   3206  N   ARG B 404     -26.467 -55.797  12.768  1.00  0.79           N
ATOM   3207  CA  ARG B 404     -27.780 -55.530  13.289  1.00  0.79           C
ATOM   3208  C   ARG B 404     -27.862 -54.279  14.138  1.00  0.79           C
ATOM   3209  O   ARG B 404     -28.891 -53.610  14.179  1.00  0.79           O
ATOM   3210  CB  ARG B 404     -28.245 -56.747  14.101  1.00  0.79           C
ATOM   3211  CG  ARG B 404     -28.203 -58.038  13.259  1.00  0.79           C
ATOM   3212  CD  ARG B 404     -28.608 -59.280  14.041  1.00  0.79           C
ATOM   3213  NE  ARG B 404     -27.650 -59.426  15.175  1.00  0.79           N
ATOM   3214  CZ  ARG B 404     -27.879 -60.151  16.274  1.00  0.79           C
ATOM   3215  NH1 ARG B 404     -28.901 -61.002  16.331  1.00  0.79           N
ATOM   3216  NH2 ARG B 404     -27.059 -60.006  17.303  1.00  0.79           N
ATOM   3217  N   VAL B 405     -26.782 -53.946  14.874  1.00  0.90           N
ATOM   3218  CA  VAL B 405     -26.775 -52.786  15.744  1.00  0.90           C
ATOM   3219  C   VAL B 405     -26.744 -51.480  14.967  1.00  0.90           C
ATOM   3220  O   VAL B 405     -26.267 -51.404  13.835  1.00  0.90           O
ATOM   3221  CB  VAL B 405     -25.698 -52.781  16.826  1.00  0.90           C
ATOM   3222  CG1 VAL B 405     -25.589 -54.174  17.477  1.00  0.90           C
ATOM   3223  CG2 VAL B 405     -24.335 -52.329  16.275  1.00  0.90           C
ATOM   3224  N   LEU B 406     -27.240 -50.382  15.565  1.00  0.83           N
ATOM   3225  CA  LEU B 406     -27.280 -49.115  14.870  1.00  0.83           C
ATOM   3226  C   LEU B 406     -26.443 -48.073  15.584  1.00  0.83           C
ATOM   3227  O   LEU B 406     -26.601 -47.789  16.770  1.00  0.83           O
ATOM   3228  CB  LEU B 406     -28.734 -48.632  14.657  1.00  0.83           C
ATOM   3229  CG  LEU B 406     -29.052 -48.097  13.238  1.00  0.83           C
ATOM   3230  CD1 LEU B 406     -28.157 -46.921  12.821  1.00  0.83           C
ATOM   3231  CD2 LEU B 406     -29.024 -49.213  12.180  1.00  0.83           C
ATOM   3232  N   SER B 407     -25.508 -47.467  14.843  1.00  0.81           N
ATOM   3233  CA  SER B 407     -24.662 -46.389  15.295  1.00  0.81           C
ATOM   3234  C   SER B 407     -24.629 -45.416  14.154  1.00  0.81           C
ATOM   3235  O   SER B 407     -24.982 -45.769  13.031  1.00  0.81           O
ATOM   3236  CB  SER B 407     -23.203 -46.818  15.652  1.00  0.81           C
ATOM   3237  OG  SER B 407     -22.460 -47.319  14.534  1.00  0.81           O
ATOM   3238  N   ASN B 408     -24.193 -44.160  14.390  1.00  0.81           N
ATOM   3239  CA  ASN B 408     -24.094 -43.175  13.322  1.00  0.81           C
ATOM   3240  C   ASN B 408     -23.109 -43.594  12.226  1.00  0.81           C
ATOM   3241  O   ASN B 408     -23.300 -43.304  11.052  1.00  0.81           O
ATOM   3242  CB  ASN B 408     -23.869 -41.736  13.878  1.00  0.81           C
ATOM   3243  CG  ASN B 408     -22.417 -41.432  14.226  1.00  0.81           C
ATOM   3244  OD1 ASN B 408     -21.634 -41.015  13.378  1.00  0.81           O
ATOM   3245  ND2 ASN B 408     -22.023 -41.648  15.496  1.00  0.81           N
ATOM   3246  N   LEU B 409     -22.054 -44.332  12.627  1.00  0.86           N
ATOM   3247  CA  LEU B 409     -21.043 -44.883  11.756  1.00  0.86           C
ATOM   3248  C   LEU B 409     -21.531 -45.883  10.704  1.00  0.86           C
ATOM   3249  O   LEU B 409     -20.955 -45.944   9.622  1.00  0.86           O
ATOM   3250  CB  LEU B 409     -19.917 -45.586  12.561  1.00  0.86           C
ATOM   3251  CG  LEU B 409     -19.046 -44.751  13.538  1.00  0.86           C
ATOM   3252  CD1 LEU B 409     -18.960 -43.254  13.216  1.00  0.86           C
ATOM   3253  CD2 LEU B 409     -19.397 -44.984  15.016  1.00  0.86           C
ATOM   3254  N   ASN B 410     -22.552 -46.740  10.972  1.00  0.88           N
ATOM   3255  CA  ASN B 410     -22.882 -47.817  10.035  1.00  0.88           C
ATOM   3256  C   ASN B 410     -24.185 -47.620   9.274  1.00  0.88           C
ATOM   3257  O   ASN B 410     -25.172 -47.095   9.787  1.00  0.88           O
ATOM   3258  CB  ASN B 410     -22.661 -49.262  10.581  1.00  0.88           C
ATOM   3259  CG  ASN B 410     -23.825 -49.960  11.277  1.00  0.88           C
ATOM   3260  OD1 ASN B 410     -23.956 -51.177  11.120  1.00  0.88           O
ATOM   3261  ND2 ASN B 410     -24.662 -49.228  12.029  1.00  0.88           N
ATOM   3262  N   LEU B 411     -24.175 -48.010   7.985  1.00  0.89           N
ATOM   3263  CA  LEU B 411     -25.183 -47.674   7.003  1.00  0.89           C
ATOM   3264  C   LEU B 411     -25.704 -48.956   6.342  1.00  0.89           C
ATOM   3265  O   LEU B 411     -24.918 -49.893   6.213  1.00  0.89           O
ATOM   3266  CB  LEU B 411     -24.543 -46.789   5.902  1.00  0.89           C
ATOM   3267  CG  LEU B 411     -23.594 -45.683   6.425  1.00  0.89           C
ATOM   3268  CD1 LEU B 411     -22.971 -44.908   5.259  1.00  0.89           C
ATOM   3269  CD2 LEU B 411     -24.248 -44.706   7.408  1.00  0.89           C
ATOM   3270  N   PRO B 412     -26.956 -49.104   5.886  1.00  0.92           N
ATOM   3271  CA  PRO B 412     -27.452 -50.360   5.296  1.00  0.92           C
ATOM   3272  C   PRO B 412     -26.745 -50.787   4.011  1.00  0.92           C
ATOM   3273  O   PRO B 412     -26.391 -49.903   3.230  1.00  0.92           O
ATOM   3274  CB  PRO B 412     -28.932 -50.053   4.982  1.00  0.92           C
ATOM   3275  CG  PRO B 412     -29.320 -48.934   5.954  1.00  0.92           C
ATOM   3276  CD  PRO B 412     -28.029 -48.132   6.109  1.00  0.92           C
ATOM   3277  N   GLY B 413     -26.552 -52.092   3.725  1.00  0.89           N
ATOM   3278  CA  GLY B 413     -25.955 -52.523   2.459  1.00  0.89           C
ATOM   3279  C   GLY B 413     -26.509 -53.815   1.907  1.00  0.89           C
ATOM   3280  O   GLY B 413     -27.605 -54.262   2.239  1.00  0.89           O
ATOM   3281  N   CYS B 414     -25.742 -54.458   1.012  1.00  0.90           N
ATOM   3282  CA  CYS B 414     -26.088 -55.734   0.419  1.00  0.90           C
ATOM   3283  C   CYS B 414     -25.371 -56.886   1.132  1.00  0.90           C
ATOM   3284  O   CYS B 414     -24.187 -56.807   1.424  1.00  0.90           O
ATOM   3285  CB  CYS B 414     -25.749 -55.747  -1.099  1.00  0.90           C
ATOM   3286  SG  CYS B 414     -24.118 -54.995  -1.455  1.00  0.90           S
ATOM   3287  N   ASP B 415     -26.034 -58.005   1.459  1.00  0.87           N
ATOM   3288  CA  ASP B 415     -27.447 -58.199   1.616  1.00  0.87           C
ATOM   3289  C   ASP B 415     -27.745 -58.580   3.056  1.00  0.87           C
ATOM   3290  O   ASP B 415     -27.434 -59.647   3.570  1.00  0.87           O
ATOM   3291  CB  ASP B 415     -27.930 -59.176   0.541  1.00  0.87           C
ATOM   3292  CG  ASP B 415     -27.291 -60.552   0.552  1.00  0.87           C
ATOM   3293  OD1 ASP B 415     -26.068 -60.688   0.788  1.00  0.87           O
ATOM   3294  OD2 ASP B 415     -28.063 -61.485   0.225  1.00  0.87           O
ATOM   3295  N   GLY B 416     -28.287 -57.598   3.808  1.00  0.88           N
ATOM   3296  CA  GLY B 416     -28.310 -57.635   5.272  1.00  0.88           C
ATOM   3297  C   GLY B 416     -26.965 -57.297   5.869  1.00  0.88           C
ATOM   3298  O   GLY B 416     -26.791 -57.210   7.085  1.00  0.88           O
ATOM   3299  N   GLY B 417     -25.973 -57.064   4.989  1.00  0.94           N
ATOM   3300  CA  GLY B 417     -24.712 -56.433   5.305  1.00  0.94           C
ATOM   3301  C   GLY B 417     -24.900 -55.007   5.729  1.00  0.94           C
ATOM   3302  O   GLY B 417     -25.883 -54.352   5.382  1.00  0.94           O
ATOM   3303  N   SER B 418     -23.918 -54.458   6.447  1.00  0.92           N
ATOM   3304  CA  SER B 418     -23.871 -53.035   6.714  1.00  0.92           C
ATOM   3305  C   SER B 418     -22.539 -52.501   6.252  1.00  0.92           C
ATOM   3306  O   SER B 418     -21.562 -53.225   6.062  1.00  0.92           O
ATOM   3307  CB  SER B 418     -24.216 -52.588   8.171  1.00  0.92           C
ATOM   3308  OG  SER B 418     -23.227 -52.925   9.146  1.00  0.92           O
ATOM   3309  N   LEU B 419     -22.482 -51.195   5.971  1.00  0.90           N
ATOM   3310  CA  LEU B 419     -21.280 -50.542   5.521  1.00  0.90           C
ATOM   3311  C   LEU B 419     -20.864 -49.609   6.625  1.00  0.90           C
ATOM   3312  O   LEU B 419     -21.575 -48.668   6.967  1.00  0.90           O
ATOM   3313  CB  LEU B 419     -21.551 -49.802   4.195  1.00  0.90           C
ATOM   3314  CG  LEU B 419     -20.356 -49.021   3.629  1.00  0.90           C
ATOM   3315  CD1 LEU B 419     -20.170 -49.310   2.141  1.00  0.90           C
ATOM   3316  CD2 LEU B 419     -20.561 -47.521   3.855  1.00  0.90           C
ATOM   3317  N   TYR B 420     -19.714 -49.893   7.258  1.00  0.88           N
ATOM   3318  CA  TYR B 420     -19.293 -49.201   8.455  1.00  0.88           C
ATOM   3319  C   TYR B 420     -18.293 -48.140   8.058  1.00  0.88           C
ATOM   3320  O   TYR B 420     -17.294 -48.404   7.388  1.00  0.88           O
ATOM   3321  CB  TYR B 420     -18.738 -50.223   9.489  1.00  0.88           C
ATOM   3322  CG  TYR B 420     -18.054 -49.626  10.701  1.00  0.88           C
ATOM   3323  CD1 TYR B 420     -16.673 -49.803  10.876  1.00  0.88           C
ATOM   3324  CD2 TYR B 420     -18.770 -48.939  11.694  1.00  0.88           C
ATOM   3325  CE1 TYR B 420     -16.025 -49.324  12.021  1.00  0.88           C
ATOM   3326  CE2 TYR B 420     -18.132 -48.504  12.869  1.00  0.88           C
ATOM   3327  CZ  TYR B 420     -16.755 -48.696  13.030  1.00  0.88           C
ATOM   3328  OH  TYR B 420     -16.087 -48.342  14.221  1.00  0.88           O
ATOM   3329  N   VAL B 421     -18.581 -46.889   8.446  1.00  0.88           N
ATOM   3330  CA  VAL B 421     -17.787 -45.745   8.089  1.00  0.88           C
ATOM   3331  C   VAL B 421     -17.198 -45.131   9.326  1.00  0.88           C
ATOM   3332  O   VAL B 421     -17.882 -44.694  10.244  1.00  0.88           O
ATOM   3333  CB  VAL B 421     -18.595 -44.655   7.397  1.00  0.88           C
ATOM   3334  CG1 VAL B 421     -17.658 -43.574   6.823  1.00  0.88           C
ATOM   3335  CG2 VAL B 421     -19.429 -45.290   6.280  1.00  0.88           C
ATOM   3336  N   ASN B 422     -15.872 -45.045   9.345  1.00  0.83           N
ATOM   3337  CA  ASN B 422     -15.145 -44.229  10.276  1.00  0.83           C
ATOM   3338  C   ASN B 422     -14.060 -43.549   9.475  1.00  0.83           C
ATOM   3339  O   ASN B 422     -14.162 -42.378   9.126  1.00  0.83           O
ATOM   3340  CB  ASN B 422     -14.616 -45.024  11.498  1.00  0.83           C
ATOM   3341  CG  ASN B 422     -13.996 -46.404  11.238  1.00  0.83           C
ATOM   3342  OD1 ASN B 422     -13.951 -46.904  10.134  1.00  0.83           O
ATOM   3343  ND2 ASN B 422     -13.518 -47.038  12.341  1.00  0.83           N
ATOM   3344  N   LYS B 423     -13.042 -44.308   9.044  1.00  0.80           N
ATOM   3345  CA  LYS B 423     -12.305 -43.972   7.853  1.00  0.80           C
ATOM   3346  C   LYS B 423     -12.162 -45.266   7.069  1.00  0.80           C
ATOM   3347  O   LYS B 423     -12.540 -46.323   7.544  1.00  0.80           O
ATOM   3348  CB  LYS B 423     -10.975 -43.224   8.101  1.00  0.80           C
ATOM   3349  CG  LYS B 423     -10.686 -42.026   7.162  1.00  0.80           C
ATOM   3350  CD  LYS B 423     -10.590 -42.344   5.658  1.00  0.80           C
ATOM   3351  CE  LYS B 423     -11.902 -42.340   4.878  1.00  0.80           C
ATOM   3352  NZ  LYS B 423     -11.790 -42.997   3.576  1.00  0.80           N
ATOM   3353  N   HIS B 424     -11.710 -45.217   5.806  1.00  0.70           N
ATOM   3354  CA  HIS B 424     -11.564 -46.333   4.886  1.00  0.70           C
ATOM   3355  C   HIS B 424     -12.698 -47.344   4.859  1.00  0.70           C
ATOM   3356  O   HIS B 424     -12.449 -48.536   4.977  1.00  0.70           O
ATOM   3357  CB  HIS B 424     -10.190 -46.963   5.151  1.00  0.70           C
ATOM   3358  CG  HIS B 424      -9.133 -45.884   5.152  1.00  0.70           C
ATOM   3359  ND1 HIS B 424      -8.500 -45.522   6.324  1.00  0.70           N
ATOM   3360  CD2 HIS B 424      -8.765 -45.040   4.149  1.00  0.70           C
ATOM   3361  CE1 HIS B 424      -7.751 -44.477   6.012  1.00  0.70           C
ATOM   3362  NE2 HIS B 424      -7.881 -44.143   4.709  1.00  0.70           N
ATOM   3363  N   ALA B 425     -13.965 -46.886   4.721  1.00  0.83           N
ATOM   3364  CA  ALA B 425     -15.153 -47.700   4.927  1.00  0.83           C
ATOM   3365  C   ALA B 425     -15.202 -49.092   4.298  1.00  0.83           C
ATOM   3366  O   ALA B 425     -15.134 -49.270   3.081  1.00  0.83           O
ATOM   3367  CB  ALA B 425     -16.449 -46.955   4.549  1.00  0.83           C
ATOM   3368  N   PHE B 426     -15.370 -50.117   5.152  1.00  0.83           N
ATOM   3369  CA  PHE B 426     -15.474 -51.495   4.730  1.00  0.83           C
ATOM   3370  C   PHE B 426     -16.924 -51.937   4.756  1.00  0.83           C
ATOM   3371  O   PHE B 426     -17.588 -51.974   5.793  1.00  0.83           O
ATOM   3372  CB  PHE B 426     -14.586 -52.518   5.518  1.00  0.83           C
ATOM   3373  CG  PHE B 426     -13.918 -51.959   6.744  1.00  0.83           C
ATOM   3374  CD1 PHE B 426     -12.776 -51.159   6.605  1.00  0.83           C
ATOM   3375  CD2 PHE B 426     -14.382 -52.258   8.037  1.00  0.83           C
ATOM   3376  CE1 PHE B 426     -12.139 -50.615   7.724  1.00  0.83           C
ATOM   3377  CE2 PHE B 426     -13.736 -51.730   9.165  1.00  0.83           C
ATOM   3378  CZ  PHE B 426     -12.624 -50.893   9.006  1.00  0.83           C
ATOM   3379  N   HIS B 427     -17.464 -52.305   3.577  1.00  0.86           N
ATOM   3380  CA  HIS B 427     -18.693 -53.067   3.483  1.00  0.86           C
ATOM   3381  C   HIS B 427     -18.484 -54.445   4.100  1.00  0.86           C
ATOM   3382  O   HIS B 427     -17.438 -55.061   3.883  1.00  0.86           O
ATOM   3383  CB  HIS B 427     -19.138 -53.213   2.012  1.00  0.86           C
ATOM   3384  CG  HIS B 427     -20.477 -53.856   1.863  1.00  0.86           C
ATOM   3385  ND1 HIS B 427     -20.670 -54.790   0.870  1.00  0.86           N
ATOM   3386  CD2 HIS B 427     -21.582 -53.757   2.643  1.00  0.86           C
ATOM   3387  CE1 HIS B 427     -21.884 -55.252   1.068  1.00  0.86           C
ATOM   3388  NE2 HIS B 427     -22.481 -54.660   2.131  1.00  0.86           N
ATOM   3389  N   THR B 428     -19.424 -54.954   4.920  1.00  0.90           N
ATOM   3390  CA  THR B 428     -19.217 -56.209   5.634  1.00  0.90           C
ATOM   3391  C   THR B 428     -20.351 -57.185   5.360  1.00  0.90           C
ATOM   3392  O   THR B 428     -21.500 -56.747   5.287  1.00  0.90           O
ATOM   3393  CB  THR B 428     -18.991 -56.037   7.152  1.00  0.90           C
ATOM   3394  OG1 THR B 428     -20.170 -56.182   7.936  1.00  0.90           O
ATOM   3395  CG2 THR B 428     -18.436 -54.639   7.458  1.00  0.90           C
ATOM   3396  N   PRO B 429     -20.128 -58.500   5.198  1.00  0.91           N
ATOM   3397  CA  PRO B 429     -21.181 -59.511   5.281  1.00  0.91           C
ATOM   3398  C   PRO B 429     -22.121 -59.379   6.461  1.00  0.91           C
ATOM   3399  O   PRO B 429     -21.688 -58.966   7.534  1.00  0.91           O
ATOM   3400  CB  PRO B 429     -20.431 -60.855   5.362  1.00  0.91           C
ATOM   3401  CG  PRO B 429     -19.076 -60.565   4.721  1.00  0.91           C
ATOM   3402  CD  PRO B 429     -18.806 -59.126   5.156  1.00  0.91           C
ATOM   3403  N   ALA B 430     -23.396 -59.779   6.319  1.00  0.92           N
ATOM   3404  CA  ALA B 430     -24.310 -59.827   7.441  1.00  0.92           C
ATOM   3405  C   ALA B 430     -23.830 -60.592   8.682  1.00  0.92           C
ATOM   3406  O   ALA B 430     -23.020 -61.524   8.622  1.00  0.92           O
ATOM   3407  CB  ALA B 430     -25.655 -60.425   7.011  1.00  0.92           C
ATOM   3408  N   PHE B 431     -24.312 -60.187   9.872  1.00  0.86           N
ATOM   3409  CA  PHE B 431     -24.051 -60.921  11.095  1.00  0.86           C
ATOM   3410  C   PHE B 431     -24.840 -62.233  11.127  1.00  0.86           C
ATOM   3411  O   PHE B 431     -26.070 -62.238  11.085  1.00  0.86           O
ATOM   3412  CB  PHE B 431     -24.327 -60.039  12.338  1.00  0.86           C
ATOM   3413  CG  PHE B 431     -24.005 -60.723  13.643  1.00  0.86           C
ATOM   3414  CD1 PHE B 431     -22.718 -60.664  14.203  1.00  0.86           C
ATOM   3415  CD2 PHE B 431     -25.019 -61.400  14.341  1.00  0.86           C
ATOM   3416  CE1 PHE B 431     -22.460 -61.249  15.451  1.00  0.86           C
ATOM   3417  CE2 PHE B 431     -24.761 -61.998  15.579  1.00  0.86           C
ATOM   3418  CZ  PHE B 431     -23.481 -61.917  16.137  1.00  0.86           C
ATOM   3419  N   ASP B 432     -24.126 -63.373  11.203  1.00  0.85           N
ATOM   3420  CA  ASP B 432     -24.708 -64.698  11.179  1.00  0.85           C
ATOM   3421  C   ASP B 432     -24.245 -65.498  12.390  1.00  0.85           C
ATOM   3422  O   ASP B 432     -23.058 -65.619  12.671  1.00  0.85           O
ATOM   3423  CB  ASP B 432     -24.313 -65.427   9.862  1.00  0.85           C
ATOM   3424  CG  ASP B 432     -24.809 -66.863   9.805  1.00  0.85           C
ATOM   3425  OD1 ASP B 432     -25.806 -67.172  10.513  1.00  0.85           O
ATOM   3426  OD2 ASP B 432     -24.124 -67.694   9.154  1.00  0.85           O
ATOM   3427  N   LYS B 433     -25.197 -66.129  13.109  1.00  0.83           N
ATOM   3428  CA  LYS B 433     -24.902 -67.040  14.195  1.00  0.83           C
ATOM   3429  C   LYS B 433     -24.273 -68.335  13.712  1.00  0.83           C
ATOM   3430  O   LYS B 433     -23.494 -68.965  14.422  1.00  0.83           O
ATOM   3431  CB  LYS B 433     -26.165 -67.374  15.017  1.00  0.83           C
ATOM   3432  CG  LYS B 433     -26.644 -66.223  15.916  1.00  0.83           C
ATOM   3433  CD  LYS B 433     -27.904 -66.638  16.695  1.00  0.83           C
ATOM   3434  CE  LYS B 433     -28.491 -65.549  17.598  1.00  0.83           C
ATOM   3435  NZ  LYS B 433     -29.677 -66.075  18.319  1.00  0.83           N
ATOM   3436  N   SER B 434     -24.566 -68.742  12.460  1.00  0.89           N
ATOM   3437  CA  SER B 434     -24.017 -69.941  11.847  1.00  0.89           C
ATOM   3438  C   SER B 434     -22.504 -69.876  11.663  1.00  0.89           C
ATOM   3439  O   SER B 434     -21.817 -70.900  11.674  1.00  0.89           O
ATOM   3440  CB  SER B 434     -24.772 -70.322  10.534  1.00  0.89           C
ATOM   3441  OG  SER B 434     -23.921 -70.590   9.409  1.00  0.89           O
ATOM   3442  N   ALA B 435     -21.937 -68.660  11.528  1.00  0.89           N
ATOM   3443  CA  ALA B 435     -20.510 -68.469  11.475  1.00  0.89           C
ATOM   3444  C   ALA B 435     -19.777 -68.723  12.795  1.00  0.89           C
ATOM   3445  O   ALA B 435     -18.579 -69.006  12.802  1.00  0.89           O
ATOM   3446  CB  ALA B 435     -20.143 -67.072  10.936  1.00  0.89           C
ATOM   3447  N   PHE B 436     -20.479 -68.663  13.946  1.00  0.88           N
ATOM   3448  CA  PHE B 436     -19.844 -68.720  15.258  1.00  0.88           C
ATOM   3449  C   PHE B 436     -20.083 -70.019  16.008  1.00  0.88           C
ATOM   3450  O   PHE B 436     -19.728 -70.136  17.175  1.00  0.88           O
ATOM   3451  CB  PHE B 436     -20.297 -67.567  16.180  1.00  0.88           C
ATOM   3452  CG  PHE B 436     -20.046 -66.242  15.533  1.00  0.88           C
ATOM   3453  CD1 PHE B 436     -18.752 -65.714  15.395  1.00  0.88           C
ATOM   3454  CD2 PHE B 436     -21.132 -65.498  15.065  1.00  0.88           C
ATOM   3455  CE1 PHE B 436     -18.562 -64.455  14.808  1.00  0.88           C
ATOM   3456  CE2 PHE B 436     -20.952 -64.234  14.503  1.00  0.88           C
ATOM   3457  CZ  PHE B 436     -19.665 -63.711  14.375  1.00  0.88           C
ATOM   3458  N   VAL B 437     -20.644 -71.049  15.349  1.00  0.91           N
ATOM   3459  CA  VAL B 437     -21.062 -72.318  15.946  1.00  0.91           C
ATOM   3460  C   VAL B 437     -19.960 -73.082  16.665  1.00  0.91           C
ATOM   3461  O   VAL B 437     -20.143 -73.678  17.730  1.00  0.91           O
ATOM   3462  CB  VAL B 437     -21.614 -73.204  14.830  1.00  0.91           C
ATOM   3463  CG1 VAL B 437     -21.819 -74.673  15.258  1.00  0.91           C
ATOM   3464  CG2 VAL B 437     -22.937 -72.606  14.320  1.00  0.91           C
ATOM   3465  N   ASN B 438     -18.755 -73.111  16.074  1.00  0.87           N
ATOM   3466  CA  ASN B 438     -17.624 -73.771  16.682  1.00  0.87           C
ATOM   3467  C   ASN B 438     -17.121 -73.045  17.913  1.00  0.87           C
ATOM   3468  O   ASN B 438     -16.719 -73.686  18.882  1.00  0.87           O
ATOM   3469  CB  ASN B 438     -16.480 -73.963  15.675  1.00  0.87           C
ATOM   3470  CG  ASN B 438     -17.033 -74.760  14.507  1.00  0.87           C
ATOM   3471  OD1 ASN B 438     -17.537 -75.868  14.682  1.00  0.87           O
ATOM   3472  ND2 ASN B 438     -16.984 -74.183  13.292  1.00  0.87           N
ATOM   3473  N   LEU B 439     -17.158 -71.706  17.877  1.00  0.88           N
ATOM   3474  CA  LEU B 439     -16.677 -70.794  18.886  1.00  0.88           C
ATOM   3475  C   LEU B 439     -17.648 -70.624  20.042  1.00  0.88           C
ATOM   3476  O   LEU B 439     -18.720 -71.226  20.098  1.00  0.88           O
ATOM   3477  CB  LEU B 439     -16.343 -69.417  18.250  1.00  0.88           C
ATOM   3478  CG  LEU B 439     -15.357 -69.495  17.064  1.00  0.88           C
ATOM   3479  CD1 LEU B 439     -14.863 -68.104  16.648  1.00  0.88           C
ATOM   3480  CD2 LEU B 439     -14.144 -70.382  17.367  1.00  0.88           C
ATOM   3481  N   LYS B 440     -17.263 -69.822  21.046  1.00  0.85           N
ATOM   3482  CA  LYS B 440     -18.168 -69.354  22.069  1.00  0.85           C
ATOM   3483  C   LYS B 440     -17.912 -67.879  22.314  1.00  0.85           C
ATOM   3484  O   LYS B 440     -16.838 -67.347  22.030  1.00  0.85           O
ATOM   3485  CB  LYS B 440     -18.041 -70.149  23.394  1.00  0.85           C
ATOM   3486  CG  LYS B 440     -18.780 -71.494  23.338  1.00  0.85           C
ATOM   3487  CD  LYS B 440     -18.835 -72.220  24.686  1.00  0.85           C
ATOM   3488  CE  LYS B 440     -19.805 -73.400  24.656  1.00  0.85           C
ATOM   3489  NZ  LYS B 440     -19.820 -74.071  25.970  1.00  0.85           N
ATOM   3490  N   GLN B 441     -18.941 -67.154  22.796  1.00  0.85           N
ATOM   3491  CA  GLN B 441     -18.852 -65.735  23.083  1.00  0.85           C
ATOM   3492  C   GLN B 441     -17.849 -65.409  24.183  1.00  0.85           C
ATOM   3493  O   GLN B 441     -17.738 -66.138  25.164  1.00  0.85           O
ATOM   3494  CB  GLN B 441     -20.253 -65.163  23.409  1.00  0.85           C
ATOM   3495  CG  GLN B 441     -20.649 -64.001  22.474  1.00  0.85           C
ATOM   3496  CD  GLN B 441     -22.055 -63.491  22.776  1.00  0.85           C
ATOM   3497  OE1 GLN B 441     -22.874 -64.132  23.436  1.00  0.85           O
ATOM   3498  NE2 GLN B 441     -22.361 -62.280  22.257  1.00  0.85           N
ATOM   3499  N   LEU B 442     -17.080 -64.313  24.043  1.00  0.89           N
ATOM   3500  CA  LEU B 442     -15.999 -64.001  24.963  1.00  0.89           C
ATOM   3501  C   LEU B 442     -16.508 -63.244  26.192  1.00  0.89           C
ATOM   3502  O   LEU B 442     -17.071 -62.155  26.045  1.00  0.89           O
ATOM   3503  CB  LEU B 442     -14.926 -63.211  24.171  1.00  0.89           C
ATOM   3504  CG  LEU B 442     -13.502 -63.044  24.757  1.00  0.89           C
ATOM   3505  CD1 LEU B 442     -13.413 -61.777  25.610  1.00  0.89           C
ATOM   3506  CD2 LEU B 442     -12.942 -64.283  25.468  1.00  0.89           C
ATOM   3507  N   PRO B 443     -16.376 -63.735  27.427  1.00  0.90           N
ATOM   3508  CA  PRO B 443     -16.762 -62.959  28.592  1.00  0.90           C
ATOM   3509  C   PRO B 443     -15.723 -61.902  28.863  1.00  0.90           C
ATOM   3510  O   PRO B 443     -14.534 -62.192  28.774  1.00  0.90           O
ATOM   3511  CB  PRO B 443     -16.810 -63.983  29.747  1.00  0.90           C
ATOM   3512  CG  PRO B 443     -16.858 -65.349  29.055  1.00  0.90           C
ATOM   3513  CD  PRO B 443     -16.040 -65.111  27.790  1.00  0.90           C
ATOM   3514  N   PHE B 444     -16.138 -60.674  29.225  1.00  0.91           N
ATOM   3515  CA  PHE B 444     -15.215 -59.643  29.657  1.00  0.91           C
ATOM   3516  C   PHE B 444     -14.302 -60.112  30.794  1.00  0.91           C
ATOM   3517  O   PHE B 444     -14.756 -60.690  31.784  1.00  0.91           O
ATOM   3518  CB  PHE B 444     -15.983 -58.347  30.076  1.00  0.91           C
ATOM   3519  CG  PHE B 444     -15.067 -57.302  30.672  1.00  0.91           C
ATOM   3520  CD1 PHE B 444     -14.305 -56.447  29.865  1.00  0.91           C
ATOM   3521  CD2 PHE B 444     -14.858 -57.282  32.060  1.00  0.91           C
ATOM   3522  CE1 PHE B 444     -13.366 -55.574  30.427  1.00  0.91           C
ATOM   3523  CE2 PHE B 444     -13.898 -56.437  32.620  1.00  0.91           C
ATOM   3524  CZ  PHE B 444     -13.155 -55.573  31.810  1.00  0.91           C
ATOM   3525  N   PHE B 445     -13.005 -59.790  30.656  1.00  0.91           N
ATOM   3526  CA  PHE B 445     -12.017 -59.889  31.700  1.00  0.91           C
ATOM   3527  C   PHE B 445     -10.963 -58.829  31.440  1.00  0.91           C
ATOM   3528  O   PHE B 445     -10.885 -58.253  30.358  1.00  0.91           O
ATOM   3529  CB  PHE B 445     -11.345 -61.289  31.833  1.00  0.91           C
ATOM   3530  CG  PHE B 445     -10.629 -61.727  30.586  1.00  0.91           C
ATOM   3531  CD1 PHE B 445      -9.304 -61.317  30.367  1.00  0.91           C
ATOM   3532  CD2 PHE B 445     -11.248 -62.558  29.643  1.00  0.91           C
ATOM   3533  CE1 PHE B 445      -8.625 -61.682  29.202  1.00  0.91           C
ATOM   3534  CE2 PHE B 445     -10.550 -62.972  28.502  1.00  0.91           C
ATOM   3535  CZ  PHE B 445      -9.245 -62.519  28.269  1.00  0.91           C
ATOM   3536  N   TYR B 446     -10.106 -58.563  32.438  1.00  0.91           N
ATOM   3537  CA  TYR B 446      -8.976 -57.667  32.305  1.00  0.91           C
ATOM   3538  C   TYR B 446      -7.747 -58.401  32.836  1.00  0.91           C
ATOM   3539  O   TYR B 446      -7.820 -59.041  33.882  1.00  0.91           O
ATOM   3540  CB  TYR B 446      -9.301 -56.329  33.034  1.00  0.91           C
ATOM   3541  CG  TYR B 446      -8.103 -55.496  33.412  1.00  0.91           C
ATOM   3542  CD1 TYR B 446      -7.540 -54.613  32.480  1.00  0.91           C
ATOM   3543  CD2 TYR B 446      -7.479 -55.656  34.662  1.00  0.91           C
ATOM   3544  CE1 TYR B 446      -6.349 -53.924  32.774  1.00  0.91           C
ATOM   3545  CE2 TYR B 446      -6.282 -54.996  34.944  1.00  0.91           C
ATOM   3546  CZ  TYR B 446      -5.713 -54.133  34.013  1.00  0.91           C
ATOM   3547  OH  TYR B 446      -4.479 -53.566  34.386  1.00  0.91           O
ATOM   3548  N   TYR B 447      -6.613 -58.351  32.102  1.00  0.88           N
ATOM   3549  CA  TYR B 447      -5.366 -59.038  32.402  1.00  0.88           C
ATOM   3550  C   TYR B 447      -4.200 -58.074  32.306  1.00  0.88           C
ATOM   3551  O   TYR B 447      -3.905 -57.487  31.264  1.00  0.88           O
ATOM   3552  CB  TYR B 447      -5.071 -60.272  31.461  1.00  0.88           C
ATOM   3553  CG  TYR B 447      -3.807 -61.063  31.827  1.00  0.88           C
ATOM   3554  CD1 TYR B 447      -2.530 -60.518  31.591  1.00  0.88           C
ATOM   3555  CD2 TYR B 447      -3.857 -62.333  32.430  1.00  0.88           C
ATOM   3556  CE1 TYR B 447      -1.368 -61.133  32.071  1.00  0.88           C
ATOM   3557  CE2 TYR B 447      -2.698 -62.961  32.908  1.00  0.88           C
ATOM   3558  CZ  TYR B 447      -1.461 -62.344  32.758  1.00  0.88           C
ATOM   3559  OH  TYR B 447      -0.330 -62.968  33.307  1.00  0.88           O
ATOM   3560  N   SER B 448      -3.403 -57.977  33.371  1.00  0.85           N
ATOM   3561  CA  SER B 448      -2.151 -57.271  33.285  1.00  0.85           C
ATOM   3562  C   SER B 448      -1.203 -58.015  34.166  1.00  0.85           C
ATOM   3563  O   SER B 448      -1.602 -58.607  35.164  1.00  0.85           O
ATOM   3564  CB  SER B 448      -2.294 -55.772  33.653  1.00  0.85           C
ATOM   3565  OG  SER B 448      -1.074 -55.039  33.539  1.00  0.85           O
ATOM   3566  N   ASP B 449       0.066 -58.064  33.770  1.00  0.86           N
ATOM   3567  CA  ASP B 449       1.117 -58.662  34.531  1.00  0.86           C
ATOM   3568  C   ASP B 449       1.958 -57.424  34.768  1.00  0.86           C
ATOM   3569  O   ASP B 449       2.392 -56.750  33.833  1.00  0.86           O
ATOM   3570  CB  ASP B 449       1.756 -59.830  33.737  1.00  0.86           C
ATOM   3571  CG  ASP B 449       3.110 -60.204  34.303  1.00  0.86           C
ATOM   3572  OD1 ASP B 449       3.225 -60.247  35.553  1.00  0.86           O
ATOM   3573  OD2 ASP B 449       4.037 -60.404  33.482  1.00  0.86           O
ATOM   3574  N   SER B 450       2.048 -56.995  36.032  1.00  0.79           N
ATOM   3575  CA  SER B 450       2.746 -55.797  36.417  1.00  0.79           C
ATOM   3576  C   SER B 450       2.925 -55.860  37.902  1.00  0.79           C
ATOM   3577  O   SER B 450       2.150 -56.547  38.558  1.00  0.79           O
ATOM   3578  CB  SER B 450       1.934 -54.501  36.251  1.00  0.79           C
ATOM   3579  OG  SER B 450       1.829 -54.165  34.904  1.00  0.79           O
ATOM   3580  N   PRO B 451       3.870 -55.165  38.509  1.00  0.77           N
ATOM   3581  CA  PRO B 451       3.873 -54.877  39.945  1.00  0.77           C
ATOM   3582  C   PRO B 451       2.760 -53.927  40.363  1.00  0.77           C
ATOM   3583  O   PRO B 451       2.345 -53.106  39.554  1.00  0.77           O
ATOM   3584  CB  PRO B 451       5.232 -54.180  40.159  1.00  0.77           C
ATOM   3585  CG  PRO B 451       5.577 -53.600  38.787  1.00  0.77           C
ATOM   3586  CD  PRO B 451       5.075 -54.678  37.850  1.00  0.77           C
ATOM   3587  N   CYS B 452       2.260 -53.961  41.619  1.00  0.77           N
ATOM   3588  CA  CYS B 452       1.339 -52.934  42.093  1.00  0.77           C
ATOM   3589  C   CYS B 452       1.911 -51.517  42.217  1.00  0.77           C
ATOM   3590  O   CYS B 452       1.223 -50.544  41.910  1.00  0.77           O
ATOM   3591  CB  CYS B 452       0.750 -53.315  43.485  1.00  0.77           C
ATOM   3592  SG  CYS B 452      -0.612 -54.522  43.611  1.00  0.77           S
ATOM   3593  N   GLU B 453       3.152 -51.354  42.711  1.00  0.54           N
ATOM   3594  CA  GLU B 453       3.619 -50.075  43.213  1.00  0.54           C
ATOM   3595  C   GLU B 453       4.539 -49.312  42.285  1.00  0.54           C
ATOM   3596  O   GLU B 453       4.830 -48.142  42.518  1.00  0.54           O
ATOM   3597  CB  GLU B 453       4.397 -50.362  44.504  1.00  0.54           C
ATOM   3598  CG  GLU B 453       3.499 -50.915  45.636  1.00  0.54           C
ATOM   3599  CD  GLU B 453       4.309 -51.388  46.842  1.00  0.54           C
ATOM   3600  OE1 GLU B 453       5.562 -51.375  46.760  1.00  0.54           O
ATOM   3601  OE2 GLU B 453       3.659 -51.800  47.835  1.00  0.54           O
ATOM   3602  N   SER B 454       4.967 -49.924  41.160  1.00  0.55           N
ATOM   3603  CA  SER B 454       5.815 -49.266  40.157  1.00  0.55           C
ATOM   3604  C   SER B 454       5.116 -48.048  39.589  1.00  0.55           C
ATOM   3605  O   SER B 454       5.658 -46.946  39.455  1.00  0.55           O
ATOM   3606  CB  SER B 454       6.137 -50.236  38.993  1.00  0.55           C
ATOM   3607  OG  SER B 454       7.046 -49.682  38.044  1.00  0.55           O
ATOM   3608  N   HIS B 455       3.816 -48.202  39.329  1.00  0.56           N
ATOM   3609  CA  HIS B 455       2.952 -47.215  38.768  1.00  0.56           C
ATOM   3610  C   HIS B 455       2.409 -46.230  39.794  1.00  0.56           C
ATOM   3611  O   HIS B 455       1.388 -45.586  39.564  1.00  0.56           O
ATOM   3612  CB  HIS B 455       1.748 -47.929  38.137  1.00  0.56           C
ATOM   3613  CG  HIS B 455       2.006 -48.846  36.954  1.00  0.56           C
ATOM   3614  ND1 HIS B 455       2.467 -50.114  37.251  1.00  0.56           N
ATOM   3615  CD2 HIS B 455       1.832 -48.723  35.604  1.00  0.56           C
ATOM   3616  CE1 HIS B 455       2.576 -50.718  36.094  1.00  0.56           C
ATOM   3617  NE2 HIS B 455       2.208 -49.931  35.060  1.00  0.56           N
ATOM   3618  N   GLY B 456       3.091 -46.030  40.940  1.00  0.54           N
ATOM   3619  CA  GLY B 456       2.684 -45.118  42.009  1.00  0.54           C
ATOM   3620  C   GLY B 456       2.565 -43.683  41.562  1.00  0.54           C
ATOM   3621  O   GLY B 456       1.815 -42.904  42.127  1.00  0.54           O
ATOM   3622  N   LYS B 457       3.273 -43.314  40.476  1.00  0.45           N
ATOM   3623  CA  LYS B 457       3.086 -42.060  39.767  1.00  0.45           C
ATOM   3624  C   LYS B 457       1.700 -41.902  39.159  1.00  0.45           C
ATOM   3625  O   LYS B 457       1.161 -40.804  39.095  1.00  0.45           O
ATOM   3626  CB  LYS B 457       4.146 -41.879  38.643  1.00  0.45           C
ATOM   3627  CG  LYS B 457       4.079 -40.517  37.916  1.00  0.45           C
ATOM   3628  CD  LYS B 457       5.173 -40.315  36.854  1.00  0.45           C
ATOM   3629  CE  LYS B 457       5.056 -38.962  36.140  1.00  0.45           C
ATOM   3630  NZ  LYS B 457       6.145 -38.822  35.150  1.00  0.45           N
ATOM   3631  N   GLN B 458       1.051 -42.980  38.690  1.00  0.46           N
ATOM   3632  CA  GLN B 458      -0.187 -42.853  37.949  1.00  0.46           C
ATOM   3633  C   GLN B 458      -1.371 -42.578  38.873  1.00  0.46           C
ATOM   3634  O   GLN B 458      -2.440 -42.200  38.427  1.00  0.46           O
ATOM   3635  CB  GLN B 458      -0.451 -44.083  37.053  1.00  0.46           C
ATOM   3636  CG  GLN B 458       0.506 -44.265  35.844  1.00  0.46           C
ATOM   3637  CD  GLN B 458       0.308 -43.255  34.711  1.00  0.46           C
ATOM   3638  OE1 GLN B 458      -0.632 -42.457  34.645  1.00  0.46           O
ATOM   3639  NE2 GLN B 458       1.246 -43.283  33.735  1.00  0.46           N
ATOM   3640  N   VAL B 459      -1.167 -42.653  40.206  1.00  0.49           N
ATOM   3641  CA  VAL B 459      -2.106 -42.270  41.259  1.00  0.49           C
ATOM   3642  C   VAL B 459      -2.717 -40.892  41.054  1.00  0.49           C
ATOM   3643  O   VAL B 459      -3.868 -40.651  41.401  1.00  0.49           O
ATOM   3644  CB  VAL B 459      -1.380 -42.310  42.607  1.00  0.49           C
ATOM   3645  CG1 VAL B 459      -2.151 -41.623  43.756  1.00  0.49           C
ATOM   3646  CG2 VAL B 459      -1.099 -43.776  42.989  1.00  0.49           C
ATOM   3647  N   VAL B 460      -1.961 -39.941  40.464  1.00  0.38           N
ATOM   3648  CA  VAL B 460      -2.458 -38.598  40.229  1.00  0.38           C
ATOM   3649  C   VAL B 460      -3.101 -38.411  38.868  1.00  0.38           C
ATOM   3650  O   VAL B 460      -3.563 -37.319  38.541  1.00  0.38           O
ATOM   3651  CB  VAL B 460      -1.363 -37.548  40.367  1.00  0.38           C
ATOM   3652  CG1 VAL B 460      -0.718 -37.633  41.762  1.00  0.38           C
ATOM   3653  CG2 VAL B 460      -0.299 -37.660  39.254  1.00  0.38           C
ATOM   3654  N   SER B 461      -3.163 -39.468  38.037  1.00  0.44           N
ATOM   3655  CA  SER B 461      -3.927 -39.463  36.805  1.00  0.44           C
ATOM   3656  C   SER B 461      -5.236 -40.209  36.947  1.00  0.44           C
ATOM   3657  O   SER B 461      -6.073 -40.183  36.042  1.00  0.44           O
ATOM   3658  CB  SER B 461      -3.107 -40.048  35.624  1.00  0.44           C
ATOM   3659  OG  SER B 461      -2.938 -41.463  35.706  1.00  0.44           O
ATOM   3660  N   ASP B 462      -5.478 -40.839  38.116  1.00  0.52           N
ATOM   3661  CA  ASP B 462      -6.740 -41.450  38.446  1.00  0.52           C
ATOM   3662  C   ASP B 462      -7.920 -40.485  38.390  1.00  0.52           C
ATOM   3663  O   ASP B 462      -7.879 -39.376  38.914  1.00  0.52           O
ATOM   3664  CB  ASP B 462      -6.735 -42.061  39.870  1.00  0.52           C
ATOM   3665  CG  ASP B 462      -5.877 -43.306  40.015  1.00  0.52           C
ATOM   3666  OD1 ASP B 462      -5.241 -43.743  39.031  1.00  0.52           O
ATOM   3667  OD2 ASP B 462      -5.934 -43.908  41.120  1.00  0.52           O
ATOM   3668  N   ILE B 463      -9.025 -40.911  37.745  1.00  0.47           N
ATOM   3669  CA  ILE B 463     -10.217 -40.088  37.609  1.00  0.47           C
ATOM   3670  C   ILE B 463     -11.151 -40.280  38.795  1.00  0.47           C
ATOM   3671  O   ILE B 463     -11.502 -39.332  39.493  1.00  0.47           O
ATOM   3672  CB  ILE B 463     -10.914 -40.428  36.290  1.00  0.47           C
ATOM   3673  CG1 ILE B 463     -10.007 -40.040  35.091  1.00  0.47           C
ATOM   3674  CG2 ILE B 463     -12.303 -39.756  36.192  1.00  0.47           C
ATOM   3675  CD1 ILE B 463     -10.483 -40.562  33.728  1.00  0.47           C
ATOM   3676  N   ASP B 464     -11.549 -41.531  39.090  1.00  0.49           N
ATOM   3677  CA  ASP B 464     -12.298 -41.842  40.289  1.00  0.49           C
ATOM   3678  C   ASP B 464     -11.415 -42.042  41.506  1.00  0.49           C
ATOM   3679  O   ASP B 464     -10.324 -42.604  41.422  1.00  0.49           O
ATOM   3680  CB  ASP B 464     -13.021 -43.187  40.160  1.00  0.49           C
ATOM   3681  CG  ASP B 464     -14.136 -43.187  39.141  1.00  0.49           C
ATOM   3682  OD1 ASP B 464     -14.619 -42.101  38.754  1.00  0.49           O
ATOM   3683  OD2 ASP B 464     -14.536 -44.329  38.798  1.00  0.49           O
ATOM   3684  N   TYR B 465     -11.902 -41.667  42.703  1.00  0.52           N
ATOM   3685  CA  TYR B 465     -11.170 -41.881  43.933  1.00  0.52           C
ATOM   3686  C   TYR B 465     -11.389 -43.257  44.570  1.00  0.52           C
ATOM   3687  O   TYR B 465     -10.444 -43.986  44.882  1.00  0.52           O
ATOM   3688  CB  TYR B 465     -11.596 -40.777  44.940  1.00  0.52           C
ATOM   3689  CG  TYR B 465     -10.775 -40.840  46.198  1.00  0.52           C
ATOM   3690  CD1 TYR B 465     -11.314 -41.357  47.390  1.00  0.52           C
ATOM   3691  CD2 TYR B 465      -9.421 -40.482  46.157  1.00  0.52           C
ATOM   3692  CE1 TYR B 465     -10.495 -41.543  48.514  1.00  0.52           C
ATOM   3693  CE2 TYR B 465      -8.608 -40.649  47.284  1.00  0.52           C
ATOM   3694  CZ  TYR B 465      -9.143 -41.185  48.458  1.00  0.52           C
ATOM   3695  OH  TYR B 465      -8.301 -41.359  49.569  1.00  0.52           O
ATOM   3696  N   VAL B 466     -12.659 -43.620  44.823  1.00  0.64           N
ATOM   3697  CA  VAL B 466     -13.036 -44.798  45.589  1.00  0.64           C
ATOM   3698  C   VAL B 466     -12.646 -46.125  44.948  1.00  0.64           C
ATOM   3699  O   VAL B 466     -12.612 -46.237  43.713  1.00  0.64           O
ATOM   3700  CB  VAL B 466     -14.515 -44.828  45.958  1.00  0.64           C
ATOM   3701  CG1 VAL B 466     -14.844 -43.597  46.821  1.00  0.64           C
ATOM   3702  CG2 VAL B 466     -15.400 -44.900  44.701  1.00  0.64           C
ATOM   3703  N   PRO B 467     -12.334 -47.155  45.736  1.00  0.76           N
ATOM   3704  CA  PRO B 467     -11.991 -48.455  45.195  1.00  0.76           C
ATOM   3705  C   PRO B 467     -13.191 -49.149  44.588  1.00  0.76           C
ATOM   3706  O   PRO B 467     -14.282 -49.112  45.150  1.00  0.76           O
ATOM   3707  CB  PRO B 467     -11.458 -49.224  46.412  1.00  0.76           C
ATOM   3708  CG  PRO B 467     -12.114 -48.578  47.629  1.00  0.76           C
ATOM   3709  CD  PRO B 467     -12.218 -47.119  47.203  1.00  0.76           C
ATOM   3710  N   LEU B 468     -12.997 -49.795  43.428  1.00  0.72           N
ATOM   3711  CA  LEU B 468     -14.009 -50.616  42.804  1.00  0.72           C
ATOM   3712  C   LEU B 468     -13.396 -51.997  42.705  1.00  0.72           C
ATOM   3713  O   LEU B 468     -12.421 -52.213  41.986  1.00  0.72           O
ATOM   3714  CB  LEU B 468     -14.396 -50.068  41.401  1.00  0.72           C
ATOM   3715  CG  LEU B 468     -15.900 -50.100  41.041  1.00  0.72           C
ATOM   3716  CD1 LEU B 468     -16.178 -49.227  39.802  1.00  0.72           C
ATOM   3717  CD2 LEU B 468     -16.432 -51.523  40.815  1.00  0.72           C
ATOM   3718  N   LYS B 469     -13.921 -52.969  43.471  1.00  0.68           N
ATOM   3719  CA  LYS B 469     -13.463 -54.339  43.393  1.00  0.68           C
ATOM   3720  C   LYS B 469     -14.296 -55.107  42.386  1.00  0.68           C
ATOM   3721  O   LYS B 469     -15.526 -55.135  42.455  1.00  0.68           O
ATOM   3722  CB  LYS B 469     -13.459 -55.015  44.790  1.00  0.68           C
ATOM   3723  CG  LYS B 469     -13.157 -56.526  44.817  1.00  0.68           C
ATOM   3724  CD  LYS B 469     -14.425 -57.383  44.635  1.00  0.68           C
ATOM   3725  CE  LYS B 469     -14.277 -58.811  45.152  1.00  0.68           C
ATOM   3726  NZ  LYS B 469     -15.607 -59.457  45.228  1.00  0.68           N
ATOM   3727  N   SER B 470     -13.632 -55.795  41.439  1.00  0.74           N
ATOM   3728  CA  SER B 470     -14.302 -56.627  40.453  1.00  0.74           C
ATOM   3729  C   SER B 470     -13.958 -58.072  40.698  1.00  0.74           C
ATOM   3730  O   SER B 470     -12.826 -58.438  41.000  1.00  0.74           O
ATOM   3731  CB  SER B 470     -13.952 -56.321  38.974  1.00  0.74           C
ATOM   3732  OG  SER B 470     -14.602 -57.238  38.079  1.00  0.74           O
ATOM   3733  N   ALA B 471     -14.969 -58.945  40.573  1.00  0.69           N
ATOM   3734  CA  ALA B 471     -14.772 -60.369  40.544  1.00  0.69           C
ATOM   3735  C   ALA B 471     -14.169 -60.816  39.234  1.00  0.69           C
ATOM   3736  O   ALA B 471     -13.261 -61.636  39.190  1.00  0.69           O
ATOM   3737  CB  ALA B 471     -16.109 -61.079  40.807  1.00  0.69           C
ATOM   3738  N   THR B 472     -14.640 -60.238  38.116  1.00  0.75           N
ATOM   3739  CA  THR B 472     -14.022 -60.520  36.842  1.00  0.75           C
ATOM   3740  C   THR B 472     -12.952 -59.498  36.563  1.00  0.75           C
ATOM   3741  O   THR B 472     -13.141 -58.462  35.914  1.00  0.75           O
ATOM   3742  CB  THR B 472     -14.975 -60.709  35.672  1.00  0.75           C
ATOM   3743  OG1 THR B 472     -14.239 -60.846  34.459  1.00  0.75           O
ATOM   3744  CG2 THR B 472     -15.988 -59.554  35.594  1.00  0.75           C
ATOM   3745  N   CYS B 473     -11.753 -59.823  37.036  1.00  0.69           N
ATOM   3746  CA  CYS B 473     -10.541 -59.426  36.396  1.00  0.69           C
ATOM   3747  C   CYS B 473      -9.477 -60.353  36.927  1.00  0.69           C
ATOM   3748  O   CYS B 473      -9.730 -61.080  37.886  1.00  0.69           O
ATOM   3749  CB  CYS B 473     -10.213 -57.924  36.620  1.00  0.69           C
ATOM   3750  SG  CYS B 473      -9.354 -57.464  38.149  1.00  0.69           S
ATOM   3751  N   ILE B 474      -8.259 -60.369  36.364  1.00  0.85           N
ATOM   3752  CA  ILE B 474      -7.150 -60.924  37.117  1.00  0.85           C
ATOM   3753  C   ILE B 474      -6.408 -59.717  37.675  1.00  0.85           C
ATOM   3754  O   ILE B 474      -5.779 -58.935  36.970  1.00  0.85           O
ATOM   3755  CB  ILE B 474      -6.306 -61.954  36.363  1.00  0.85           C
ATOM   3756  CG1 ILE B 474      -5.597 -61.395  35.133  1.00  0.85           C
ATOM   3757  CG2 ILE B 474      -7.198 -63.137  35.935  1.00  0.85           C
ATOM   3758  CD1 ILE B 474      -4.150 -61.036  35.433  1.00  0.85           C
ATOM   3759  N   THR B 475      -6.551 -59.434  38.992  1.00  0.61           N
ATOM   3760  CA  THR B 475      -5.879 -58.294  39.629  1.00  0.61           C
ATOM   3761  C   THR B 475      -4.419 -58.627  39.642  1.00  0.61           C
ATOM   3762  O   THR B 475      -4.095 -59.795  39.744  1.00  0.61           O
ATOM   3763  CB  THR B 475      -6.355 -57.890  41.041  1.00  0.61           C
ATOM   3764  OG1 THR B 475      -5.750 -58.570  42.118  1.00  0.61           O
ATOM   3765  CG2 THR B 475      -7.847 -58.173  41.178  1.00  0.61           C
ATOM   3766  N   ARG B 476      -3.464 -57.686  39.580  1.00  0.58           N
ATOM   3767  CA  ARG B 476      -2.079 -58.100  39.466  1.00  0.58           C
ATOM   3768  C   ARG B 476      -1.555 -58.486  40.837  1.00  0.58           C
ATOM   3769  O   ARG B 476      -0.431 -58.972  40.990  1.00  0.58           O
ATOM   3770  CB  ARG B 476      -1.126 -57.063  38.804  1.00  0.58           C
ATOM   3771  CG  ARG B 476      -1.479 -56.461  37.417  1.00  0.58           C
ATOM   3772  CD  ARG B 476      -2.058 -55.037  37.453  1.00  0.58           C
ATOM   3773  NE  ARG B 476      -1.396 -54.127  36.446  1.00  0.58           N
ATOM   3774  CZ  ARG B 476      -1.282 -52.804  36.539  1.00  0.58           C
ATOM   3775  NH1 ARG B 476      -2.025 -52.054  37.324  1.00  0.58           N
ATOM   3776  NH2 ARG B 476      -0.362 -52.179  35.806  1.00  0.58           N
ATOM   3777  N   CYS B 477      -2.376 -58.316  41.884  1.00  0.71           N
ATOM   3778  CA  CYS B 477      -2.020 -58.694  43.230  1.00  0.71           C
ATOM   3779  C   CYS B 477      -3.230 -59.241  43.991  1.00  0.71           C
ATOM   3780  O   CYS B 477      -3.763 -58.581  44.890  1.00  0.71           O
ATOM   3781  CB  CYS B 477      -1.382 -57.501  44.026  1.00  0.71           C
ATOM   3782  SG  CYS B 477      -0.127 -56.455  43.129  1.00  0.71           S
ATOM   3783  N   ASN B 478      -3.733 -60.458  43.681  1.00  0.62           N
ATOM   3784  CA  ASN B 478      -5.053 -60.896  44.143  1.00  0.62           C
ATOM   3785  C   ASN B 478      -5.068 -61.550  45.524  1.00  0.62           C
ATOM   3786  O   ASN B 478      -5.924 -62.359  45.852  1.00  0.62           O
ATOM   3787  CB  ASN B 478      -5.767 -61.790  43.085  1.00  0.62           C
ATOM   3788  CG  ASN B 478      -7.286 -61.697  43.252  1.00  0.62           C
ATOM   3789  OD1 ASN B 478      -7.841 -60.596  43.314  1.00  0.62           O
ATOM   3790  ND2 ASN B 478      -7.979 -62.854  43.308  1.00  0.62           N
ATOM   3791  N   LEU B 479      -4.097 -61.208  46.381  1.00  0.55           N
ATOM   3792  CA  LEU B 479      -4.052 -61.602  47.770  1.00  0.55           C
ATOM   3793  C   LEU B 479      -5.169 -60.960  48.583  1.00  0.55           C
ATOM   3794  O   LEU B 479      -5.818 -61.607  49.396  1.00  0.55           O
ATOM   3795  CB  LEU B 479      -2.622 -61.226  48.253  1.00  0.55           C
ATOM   3796  CG  LEU B 479      -2.224 -61.328  49.744  1.00  0.55           C
ATOM   3797  CD1 LEU B 479      -2.671 -60.112  50.572  1.00  0.55           C
ATOM   3798  CD2 LEU B 479      -2.629 -62.652  50.399  1.00  0.55           C
ATOM   3799  N   GLY B 480      -5.415 -59.650  48.372  1.00  0.60           N
ATOM   3800  CA  GLY B 480      -6.299 -58.878  49.237  1.00  0.60           C
ATOM   3801  C   GLY B 480      -7.706 -58.779  48.721  1.00  0.60           C
ATOM   3802  O   GLY B 480      -8.268 -59.714  48.169  1.00  0.60           O
ATOM   3803  N   GLY B 481      -8.329 -57.591  48.879  1.00  0.73           N
ATOM   3804  CA  GLY B 481      -9.640 -57.295  48.291  1.00  0.73           C
ATOM   3805  C   GLY B 481      -9.876 -57.664  46.827  1.00  0.73           C
ATOM   3806  O   GLY B 481     -10.896 -58.266  46.509  1.00  0.73           O
ATOM   3807  N   ALA B 482      -8.993 -57.315  45.866  1.00  0.67           N
ATOM   3808  CA  ALA B 482      -7.827 -56.464  45.998  1.00  0.67           C
ATOM   3809  C   ALA B 482      -7.933 -55.257  45.102  1.00  0.67           C
ATOM   3810  O   ALA B 482      -7.813 -55.321  43.881  1.00  0.67           O
ATOM   3811  CB  ALA B 482      -6.522 -57.218  45.690  1.00  0.67           C
ATOM   3812  N   VAL B 483      -8.148 -54.088  45.721  1.00  0.72           N
ATOM   3813  CA  VAL B 483      -8.202 -52.823  45.028  1.00  0.72           C
ATOM   3814  C   VAL B 483      -6.872 -52.131  45.141  1.00  0.72           C
ATOM   3815  O   VAL B 483      -6.619 -51.285  46.002  1.00  0.72           O
ATOM   3816  CB  VAL B 483      -9.336 -51.949  45.519  1.00  0.72           C
ATOM   3817  CG1 VAL B 483     -10.603 -52.402  44.777  1.00  0.72           C
ATOM   3818  CG2 VAL B 483      -9.491 -52.099  47.046  1.00  0.72           C
ATOM   3819  N   CYS B 484      -5.956 -52.485  44.240  1.00  0.75           N
ATOM   3820  CA  CYS B 484      -4.617 -51.952  44.219  1.00  0.75           C
ATOM   3821  C   CYS B 484      -4.657 -50.748  43.331  1.00  0.75           C
ATOM   3822  O   CYS B 484      -5.027 -50.906  42.171  1.00  0.75           O
ATOM   3823  CB  CYS B 484      -3.664 -52.980  43.601  1.00  0.75           C
ATOM   3824  SG  CYS B 484      -3.923 -54.615  44.377  1.00  0.75           S
ATOM   3825  N   ARG B 485      -4.329 -49.524  43.808  1.00  0.66           N
ATOM   3826  CA  ARG B 485      -4.905 -48.320  43.208  1.00  0.66           C
ATOM   3827  C   ARG B 485      -4.734 -48.227  41.684  1.00  0.66           C
ATOM   3828  O   ARG B 485      -5.704 -48.034  40.955  1.00  0.66           O
ATOM   3829  CB  ARG B 485      -4.326 -47.038  43.864  1.00  0.66           C
ATOM   3830  CG  ARG B 485      -5.158 -45.761  43.606  1.00  0.66           C
ATOM   3831  CD  ARG B 485      -6.406 -45.561  44.483  1.00  0.66           C
ATOM   3832  NE  ARG B 485      -5.941 -44.952  45.775  1.00  0.66           N
ATOM   3833  CZ  ARG B 485      -6.666 -44.119  46.535  1.00  0.66           C
ATOM   3834  NH1 ARG B 485      -7.942 -43.843  46.294  1.00  0.66           N
ATOM   3835  NH2 ARG B 485      -6.090 -43.549  47.596  1.00  0.66           N
ATOM   3836  N   HIS B 486      -3.503 -48.514  41.187  1.00  0.70           N
ATOM   3837  CA  HIS B 486      -3.133 -48.581  39.775  1.00  0.70           C
ATOM   3838  C   HIS B 486      -3.897 -49.611  38.976  1.00  0.70           C
ATOM   3839  O   HIS B 486      -4.284 -49.372  37.848  1.00  0.70           O
ATOM   3840  CB  HIS B 486      -1.627 -48.912  39.533  1.00  0.70           C
ATOM   3841  CG  HIS B 486      -1.179 -48.527  38.160  1.00  0.70           C
ATOM   3842  ND1 HIS B 486      -0.934 -49.467  37.151  1.00  0.70           N
ATOM   3843  CD2 HIS B 486      -1.421 -47.340  37.614  1.00  0.70           C
ATOM   3844  CE1 HIS B 486      -1.045 -48.814  36.043  1.00  0.70           C
ATOM   3845  NE2 HIS B 486      -1.332 -47.530  36.290  1.00  0.70           N
ATOM   3846  N   HIS B 487      -4.138 -50.827  39.514  1.00  0.74           N
ATOM   3847  CA  HIS B 487      -4.953 -51.785  38.776  1.00  0.74           C
ATOM   3848  C   HIS B 487      -6.406 -51.412  38.785  1.00  0.74           C
ATOM   3849  O   HIS B 487      -7.090 -51.533  37.777  1.00  0.74           O
ATOM   3850  CB  HIS B 487      -4.863 -53.260  39.220  1.00  0.74           C
ATOM   3851  CG  HIS B 487      -3.599 -53.694  39.883  1.00  0.74           C
ATOM   3852  ND1 HIS B 487      -3.634 -54.930  40.465  1.00  0.74           N
ATOM   3853  CD2 HIS B 487      -2.371 -53.111  40.082  1.00  0.74           C
ATOM   3854  CE1 HIS B 487      -2.441 -55.097  41.012  1.00  0.74           C
ATOM   3855  NE2 HIS B 487      -1.666 -54.026  40.802  1.00  0.74           N
ATOM   3856  N   ALA B 488      -6.915 -50.943  39.929  1.00  0.76           N
ATOM   3857  CA  ALA B 488      -8.275 -50.517  40.112  1.00  0.76           C
ATOM   3858  C   ALA B 488      -8.637 -49.350  39.186  1.00  0.76           C
ATOM   3859  O   ALA B 488      -9.716 -49.307  38.609  1.00  0.76           O
ATOM   3860  CB  ALA B 488      -8.435 -50.233  41.616  1.00  0.76           C
ATOM   3861  N   ASN B 489      -7.695 -48.407  38.962  1.00  0.74           N
ATOM   3862  CA  ASN B 489      -7.752 -47.494  37.837  1.00  0.74           C
ATOM   3863  C   ASN B 489      -7.632 -48.133  36.445  1.00  0.74           C
ATOM   3864  O   ASN B 489      -8.510 -47.926  35.611  1.00  0.74           O
ATOM   3865  CB  ASN B 489      -6.660 -46.410  38.006  1.00  0.74           C
ATOM   3866  CG  ASN B 489      -6.704 -45.416  36.852  1.00  0.74           C
ATOM   3867  OD1 ASN B 489      -6.068 -45.606  35.815  1.00  0.74           O
ATOM   3868  ND2 ASN B 489      -7.564 -44.393  36.983  1.00  0.74           N
ATOM   3869  N   GLU B 490      -6.577 -48.924  36.148  1.00  0.78           N
ATOM   3870  CA  GLU B 490      -6.375 -49.437  34.797  1.00  0.78           C
ATOM   3871  C   GLU B 490      -7.487 -50.352  34.310  1.00  0.78           C
ATOM   3872  O   GLU B 490      -7.878 -50.329  33.149  1.00  0.78           O
ATOM   3873  CB  GLU B 490      -5.022 -50.145  34.607  1.00  0.78           C
ATOM   3874  CG  GLU B 490      -3.946 -49.282  33.915  1.00  0.78           C
ATOM   3875  CD  GLU B 490      -2.712 -50.113  33.590  1.00  0.78           C
ATOM   3876  OE1 GLU B 490      -2.709 -51.338  33.891  1.00  0.78           O
ATOM   3877  OE2 GLU B 490      -1.734 -49.544  33.066  1.00  0.78           O
ATOM   3878  N   TYR B 491      -8.055 -51.163  35.224  1.00  0.86           N
ATOM   3879  CA  TYR B 491      -9.256 -51.930  34.988  1.00  0.86           C
ATOM   3880  C   TYR B 491     -10.434 -51.056  34.585  1.00  0.86           C
ATOM   3881  O   TYR B 491     -11.140 -51.363  33.631  1.00  0.86           O
ATOM   3882  CB  TYR B 491      -9.611 -52.675  36.308  1.00  0.86           C
ATOM   3883  CG  TYR B 491     -10.931 -53.384  36.251  1.00  0.86           C
ATOM   3884  CD1 TYR B 491     -12.099 -52.714  36.644  1.00  0.86           C
ATOM   3885  CD2 TYR B 491     -11.028 -54.673  35.735  1.00  0.86           C
ATOM   3886  CE1 TYR B 491     -13.348 -53.333  36.530  1.00  0.86           C
ATOM   3887  CE2 TYR B 491     -12.271 -55.298  35.622  1.00  0.86           C
ATOM   3888  CZ  TYR B 491     -13.428 -54.630  36.015  1.00  0.86           C
ATOM   3889  OH  TYR B 491     -14.655 -55.294  35.881  1.00  0.86           O
ATOM   3890  N   ARG B 492     -10.667 -49.950  35.316  1.00  0.77           N
ATOM   3891  CA  ARG B 492     -11.801 -49.072  35.123  1.00  0.77           C
ATOM   3892  C   ARG B 492     -11.729 -48.416  33.746  1.00  0.77           C
ATOM   3893  O   ARG B 492     -12.666 -48.480  32.957  1.00  0.77           O
ATOM   3894  CB  ARG B 492     -11.794 -48.112  36.349  1.00  0.77           C
ATOM   3895  CG  ARG B 492     -13.061 -47.291  36.654  1.00  0.77           C
ATOM   3896  CD  ARG B 492     -13.446 -47.229  38.151  1.00  0.77           C
ATOM   3897  NE  ARG B 492     -12.298 -46.697  38.972  1.00  0.77           N
ATOM   3898  CZ  ARG B 492     -12.366 -46.525  40.301  1.00  0.77           C
ATOM   3899  NH1 ARG B 492     -13.512 -46.612  40.965  1.00  0.77           N
ATOM   3900  NH2 ARG B 492     -11.276 -46.162  40.984  1.00  0.77           N
ATOM   3901  N   LEU B 493     -10.535 -47.912  33.371  1.00  0.83           N
ATOM   3902  CA  LEU B 493     -10.259 -47.376  32.049  1.00  0.83           C
ATOM   3903  C   LEU B 493     -10.392 -48.384  30.912  1.00  0.83           C
ATOM   3904  O   LEU B 493     -10.956 -48.087  29.860  1.00  0.83           O
ATOM   3905  CB  LEU B 493      -8.828 -46.789  31.998  1.00  0.83           C
ATOM   3906  CG  LEU B 493      -8.576 -45.582  32.923  1.00  0.83           C
ATOM   3907  CD1 LEU B 493      -7.090 -45.200  32.890  1.00  0.83           C
ATOM   3908  CD2 LEU B 493      -9.429 -44.362  32.549  1.00  0.83           C
ATOM   3909  N   TYR B 494      -9.869 -49.619  31.083  1.00  0.88           N
ATOM   3910  CA  TYR B 494     -10.061 -50.678  30.111  1.00  0.88           C
ATOM   3911  C   TYR B 494     -11.519 -51.115  29.972  1.00  0.88           C
ATOM   3912  O   TYR B 494     -12.008 -51.264  28.857  1.00  0.88           O
ATOM   3913  CB  TYR B 494      -9.130 -51.879  30.431  1.00  0.88           C
ATOM   3914  CG  TYR B 494      -9.282 -53.008  29.442  1.00  0.88           C
ATOM   3915  CD1 TYR B 494     -10.059 -54.130  29.773  1.00  0.88           C
ATOM   3916  CD2 TYR B 494      -8.682 -52.950  28.174  1.00  0.88           C
ATOM   3917  CE1 TYR B 494     -10.223 -55.179  28.861  1.00  0.88           C
ATOM   3918  CE2 TYR B 494      -8.840 -54.006  27.263  1.00  0.88           C
ATOM   3919  CZ  TYR B 494      -9.612 -55.120  27.609  1.00  0.88           C
ATOM   3920  OH  TYR B 494      -9.750 -56.198  26.717  1.00  0.88           O
ATOM   3921  N   LEU B 495     -12.261 -51.310  31.082  1.00  0.89           N
ATOM   3922  CA  LEU B 495     -13.665 -51.688  31.026  1.00  0.89           C
ATOM   3923  C   LEU B 495     -14.537 -50.649  30.343  1.00  0.89           C
ATOM   3924  O   LEU B 495     -15.364 -50.993  29.499  1.00  0.89           O
ATOM   3925  CB  LEU B 495     -14.212 -52.040  32.430  1.00  0.89           C
ATOM   3926  CG  LEU B 495     -15.737 -52.275  32.508  1.00  0.89           C
ATOM   3927  CD1 LEU B 495     -16.067 -53.560  33.269  1.00  0.89           C
ATOM   3928  CD2 LEU B 495     -16.440 -51.093  33.191  1.00  0.89           C
ATOM   3929  N   ASP B 496     -14.339 -49.352  30.631  1.00  0.83           N
ATOM   3930  CA  ASP B 496     -15.031 -48.271  29.962  1.00  0.83           C
ATOM   3931  C   ASP B 496     -14.783 -48.236  28.449  1.00  0.83           C
ATOM   3932  O   ASP B 496     -15.709 -48.148  27.641  1.00  0.83           O
ATOM   3933  CB  ASP B 496     -14.566 -46.945  30.602  1.00  0.83           C
ATOM   3934  CG  ASP B 496     -15.232 -46.684  31.951  1.00  0.83           C
ATOM   3935  OD1 ASP B 496     -16.084 -47.499  32.386  1.00  0.83           O
ATOM   3936  OD2 ASP B 496     -14.901 -45.623  32.538  1.00  0.83           O
ATOM   3937  N   ALA B 497     -13.511 -48.374  28.019  1.00  0.85           N
ATOM   3938  CA  ALA B 497     -13.156 -48.509  26.619  1.00  0.85           C
ATOM   3939  C   ALA B 497     -13.655 -49.792  25.947  1.00  0.85           C
ATOM   3940  O   ALA B 497     -14.100 -49.777  24.803  1.00  0.85           O
ATOM   3941  CB  ALA B 497     -11.642 -48.333  26.406  1.00  0.85           C
ATOM   3942  N   TYR B 498     -13.631 -50.947  26.640  1.00  0.89           N
ATOM   3943  CA  TYR B 498     -14.278 -52.169  26.189  1.00  0.89           C
ATOM   3944  C   TYR B 498     -15.789 -52.021  26.002  1.00  0.89           C
ATOM   3945  O   TYR B 498     -16.347 -52.422  24.982  1.00  0.89           O
ATOM   3946  CB  TYR B 498     -13.985 -53.289  27.225  1.00  0.89           C
ATOM   3947  CG  TYR B 498     -14.571 -54.626  26.848  1.00  0.89           C
ATOM   3948  CD1 TYR B 498     -13.805 -55.559  26.135  1.00  0.89           C
ATOM   3949  CD2 TYR B 498     -15.885 -54.969  27.222  1.00  0.89           C
ATOM   3950  CE1 TYR B 498     -14.350 -56.796  25.767  1.00  0.89           C
ATOM   3951  CE2 TYR B 498     -16.431 -56.207  26.857  1.00  0.89           C
ATOM   3952  CZ  TYR B 498     -15.665 -57.115  26.119  1.00  0.89           C
ATOM   3953  OH  TYR B 498     -16.204 -58.360  25.747  1.00  0.89           O
ATOM   3954  N   ASN B 499     -16.486 -51.398  26.973  1.00  0.87           N
ATOM   3955  CA  ASN B 499     -17.921 -51.193  26.905  1.00  0.87           C
ATOM   3956  C   ASN B 499     -18.305 -50.190  25.822  1.00  0.87           C
ATOM   3957  O   ASN B 499     -19.388 -50.243  25.247  1.00  0.87           O
ATOM   3958  CB  ASN B 499     -18.488 -50.794  28.288  1.00  0.87           C
ATOM   3959  CG  ASN B 499     -18.645 -52.035  29.165  1.00  0.87           C
ATOM   3960  OD1 ASN B 499     -18.737 -53.174  28.701  1.00  0.87           O
ATOM   3961  ND2 ASN B 499     -18.729 -51.817  30.495  1.00  0.87           N
ATOM   3962  N   MET B 500     -17.396 -49.278  25.456  1.00  0.84           N
ATOM   3963  CA  MET B 500     -17.500 -48.515  24.234  1.00  0.84           C
ATOM   3964  C   MET B 500     -17.389 -49.336  22.943  1.00  0.84           C
ATOM   3965  O   MET B 500     -18.171 -49.159  22.013  1.00  0.84           O
ATOM   3966  CB  MET B 500     -16.436 -47.415  24.270  1.00  0.84           C
ATOM   3967  CG  MET B 500     -16.165 -46.783  22.907  1.00  0.84           C
ATOM   3968  SD  MET B 500     -15.286 -45.234  23.039  1.00  0.84           S
ATOM   3969  CE  MET B 500     -16.622 -44.278  23.806  1.00  0.84           C
ATOM   3970  N   MET B 501     -16.425 -50.278  22.851  1.00  0.87           N
ATOM   3971  CA  MET B 501     -16.248 -51.145  21.690  1.00  0.87           C
ATOM   3972  C   MET B 501     -17.457 -52.030  21.393  1.00  0.87           C
ATOM   3973  O   MET B 501     -17.896 -52.136  20.250  1.00  0.87           O
ATOM   3974  CB  MET B 501     -14.929 -51.967  21.819  1.00  0.87           C
ATOM   3975  CG  MET B 501     -14.978 -53.434  21.342  1.00  0.87           C
ATOM   3976  SD  MET B 501     -13.377 -54.135  20.870  1.00  0.87           S
ATOM   3977  CE  MET B 501     -13.426 -53.394  19.221  1.00  0.87           C
ATOM   3978  N   ILE B 502     -18.049 -52.657  22.427  1.00  0.89           N
ATOM   3979  CA  ILE B 502     -19.281 -53.423  22.308  1.00  0.89           C
ATOM   3980  C   ILE B 502     -20.495 -52.555  21.968  1.00  0.89           C
ATOM   3981  O   ILE B 502     -21.331 -52.931  21.150  1.00  0.89           O
ATOM   3982  CB  ILE B 502     -19.470 -54.328  23.521  1.00  0.89           C
ATOM   3983  CG1 ILE B 502     -20.433 -55.503  23.252  1.00  0.89           C
ATOM   3984  CG2 ILE B 502     -19.887 -53.506  24.748  1.00  0.89           C
ATOM   3985  CD1 ILE B 502     -20.554 -56.456  24.450  1.00  0.89           C
ATOM   3986  N   SER B 503     -20.590 -51.317  22.513  1.00  0.85           N
ATOM   3987  CA  SER B 503     -21.622 -50.339  22.158  1.00  0.85           C
ATOM   3988  C   SER B 503     -21.552 -49.868  20.717  1.00  0.85           C
ATOM   3989  O   SER B 503     -22.546 -49.431  20.146  1.00  0.85           O
ATOM   3990  CB  SER B 503     -21.579 -49.074  23.052  1.00  0.85           C
ATOM   3991  OG  SER B 503     -22.175 -49.343  24.322  1.00  0.85           O
ATOM   3992  N   ALA B 504     -20.381 -49.988  20.063  1.00  0.88           N
ATOM   3993  CA  ALA B 504     -20.239 -49.673  18.659  1.00  0.88           C
ATOM   3994  C   ALA B 504     -20.511 -50.883  17.769  1.00  0.88           C
ATOM   3995  O   ALA B 504     -20.484 -50.780  16.544  1.00  0.88           O
ATOM   3996  CB  ALA B 504     -18.813 -49.158  18.404  1.00  0.88           C
ATOM   3997  N   GLY B 505     -20.844 -52.042  18.377  1.00  0.92           N
ATOM   3998  CA  GLY B 505     -21.336 -53.228  17.687  1.00  0.92           C
ATOM   3999  C   GLY B 505     -20.332 -54.285  17.363  1.00  0.92           C
ATOM   4000  O   GLY B 505     -20.645 -55.268  16.697  1.00  0.92           O
ATOM   4001  N   PHE B 506     -19.081 -54.153  17.814  1.00  0.92           N
ATOM   4002  CA  PHE B 506     -18.114 -55.227  17.665  1.00  0.92           C
ATOM   4003  C   PHE B 506     -18.389 -56.414  18.591  1.00  0.92           C
ATOM   4004  O   PHE B 506     -18.651 -56.252  19.783  1.00  0.92           O
ATOM   4005  CB  PHE B 506     -16.677 -54.729  17.898  1.00  0.92           C
ATOM   4006  CG  PHE B 506     -16.266 -53.738  16.844  1.00  0.92           C
ATOM   4007  CD1 PHE B 506     -16.402 -52.359  17.072  1.00  0.92           C
ATOM   4008  CD2 PHE B 506     -15.709 -54.172  15.630  1.00  0.92           C
ATOM   4009  CE1 PHE B 506     -16.023 -51.433  16.095  1.00  0.92           C
ATOM   4010  CE2 PHE B 506     -15.301 -53.247  14.662  1.00  0.92           C
ATOM   4011  CZ  PHE B 506     -15.473 -51.876  14.887  1.00  0.92           C
ATOM   4012  N   SER B 507     -18.317 -57.653  18.066  1.00  0.93           N
ATOM   4013  CA  SER B 507     -18.623 -58.861  18.822  1.00  0.93           C
ATOM   4014  C   SER B 507     -17.366 -59.689  18.954  1.00  0.93           C
ATOM   4015  O   SER B 507     -16.659 -59.924  17.973  1.00  0.93           O
ATOM   4016  CB  SER B 507     -19.718 -59.735  18.142  1.00  0.93           C
ATOM   4017  OG  SER B 507     -20.254 -60.735  19.020  1.00  0.93           O
ATOM   4018  N   LEU B 508     -17.049 -60.147  20.181  1.00  0.92           N
ATOM   4019  CA  LEU B 508     -15.835 -60.890  20.453  1.00  0.92           C
ATOM   4020  C   LEU B 508     -16.144 -62.356  20.672  1.00  0.92           C
ATOM   4021  O   LEU B 508     -16.988 -62.738  21.486  1.00  0.92           O
ATOM   4022  CB  LEU B 508     -15.062 -60.380  21.701  1.00  0.92           C
ATOM   4023  CG  LEU B 508     -14.262 -59.062  21.553  1.00  0.92           C
ATOM   4024  CD1 LEU B 508     -13.688 -58.855  20.146  1.00  0.92           C
ATOM   4025  CD2 LEU B 508     -15.032 -57.815  22.012  1.00  0.92           C
ATOM   4026  N   TRP B 509     -15.433 -63.225  19.937  1.00  0.90           N
ATOM   4027  CA  TRP B 509     -15.664 -64.649  19.975  1.00  0.90           C
ATOM   4028  C   TRP B 509     -14.348 -65.386  20.117  1.00  0.90           C
ATOM   4029  O   TRP B 509     -13.326 -64.976  19.564  1.00  0.90           O
ATOM   4030  CB  TRP B 509     -16.348 -65.116  18.676  1.00  0.90           C
ATOM   4031  CG  TRP B 509     -17.710 -64.491  18.426  1.00  0.90           C
ATOM   4032  CD1 TRP B 509     -18.046 -63.333  17.781  1.00  0.90           C
ATOM   4033  CD2 TRP B 509     -18.922 -65.125  18.816  1.00  0.90           C
ATOM   4034  NE1 TRP B 509     -19.416 -63.244  17.686  1.00  0.90           N
ATOM   4035  CE2 TRP B 509     -19.985 -64.284  18.361  1.00  0.90           C
ATOM   4036  CE3 TRP B 509     -19.188 -66.319  19.464  1.00  0.90           C
ATOM   4037  CZ2 TRP B 509     -21.296 -64.651  18.563  1.00  0.90           C
ATOM   4038  CZ3 TRP B 509     -20.520 -66.680  19.669  1.00  0.90           C
ATOM   4039  CH2 TRP B 509     -21.564 -65.852  19.226  1.00  0.90           C
ATOM   4040  N   VAL B 510     -14.335 -66.501  20.872  1.00  0.93           N
ATOM   4041  CA  VAL B 510     -13.127 -67.284  21.058  1.00  0.93           C
ATOM   4042  C   VAL B 510     -13.410 -68.772  20.965  1.00  0.93           C
ATOM   4043  O   VAL B 510     -14.542 -69.243  20.977  1.00  0.93           O
ATOM   4044  CB  VAL B 510     -12.390 -67.035  22.376  1.00  0.93           C
ATOM   4045  CG1 VAL B 510     -11.866 -65.595  22.498  1.00  0.93           C
ATOM   4046  CG2 VAL B 510     -13.289 -67.343  23.581  1.00  0.93           C
ATOM   4047  N   TYR B 511     -12.342 -69.574  20.864  1.00  0.89           N
ATOM   4048  CA  TYR B 511     -12.345 -71.009  21.002  1.00  0.89           C
ATOM   4049  C   TYR B 511     -12.960 -71.525  22.306  1.00  0.89           C
ATOM   4050  O   TYR B 511     -12.784 -70.961  23.382  1.00  0.89           O
ATOM   4051  CB  TYR B 511     -10.907 -71.550  20.785  1.00  0.89           C
ATOM   4052  CG  TYR B 511      -9.886 -70.951  21.707  1.00  0.89           C
ATOM   4053  CD1 TYR B 511      -9.313 -69.682  21.486  1.00  0.89           C
ATOM   4054  CD2 TYR B 511      -9.436 -71.720  22.786  1.00  0.89           C
ATOM   4055  CE1 TYR B 511      -8.302 -69.205  22.311  1.00  0.89           C
ATOM   4056  CE2 TYR B 511      -8.432 -71.242  23.630  1.00  0.89           C
ATOM   4057  CZ  TYR B 511      -7.885 -69.974  23.369  1.00  0.89           C
ATOM   4058  OH  TYR B 511      -6.908 -69.356  24.125  1.00  0.89           O
ATOM   4059  N   LYS B 512     -13.704 -72.655  22.226  1.00  0.84           N
ATOM   4060  CA  LYS B 512     -14.460 -73.226  23.338  1.00  0.84           C
ATOM   4061  C   LYS B 512     -13.633 -73.605  24.546  1.00  0.84           C
ATOM   4062  O   LYS B 512     -14.155 -73.706  25.651  1.00  0.84           O
ATOM   4063  CB  LYS B 512     -15.235 -74.510  22.930  1.00  0.84           C
ATOM   4064  CG  LYS B 512     -16.290 -74.293  21.839  1.00  0.84           C
ATOM   4065  CD  LYS B 512     -17.578 -75.114  22.049  1.00  0.84           C
ATOM   4066  CE  LYS B 512     -17.738 -76.293  21.080  1.00  0.84           C
ATOM   4067  NZ  LYS B 512     -18.159 -75.836  19.736  1.00  0.84           N
ATOM   4068  N   GLN B 513     -12.334 -73.866  24.342  1.00  0.84           N
ATOM   4069  CA  GLN B 513     -11.453 -74.330  25.379  1.00  0.84           C
ATOM   4070  C   GLN B 513     -10.982 -73.230  26.322  1.00  0.84           C
ATOM   4071  O   GLN B 513     -10.473 -73.517  27.402  1.00  0.84           O
ATOM   4072  CB  GLN B 513     -10.224 -74.980  24.706  1.00  0.84           C
ATOM   4073  CG  GLN B 513      -9.629 -76.139  25.530  1.00  0.84           C
ATOM   4074  CD  GLN B 513      -8.197 -76.438  25.096  1.00  0.84           C
ATOM   4075  OE1 GLN B 513      -7.923 -76.671  23.915  1.00  0.84           O
ATOM   4076  NE2 GLN B 513      -7.253 -76.423  26.061  1.00  0.84           N
ATOM   4077  N   PHE B 514     -11.126 -71.943  25.922  1.00  0.87           N
ATOM   4078  CA  PHE B 514     -10.626 -70.818  26.692  1.00  0.87           C
ATOM   4079  C   PHE B 514     -11.222 -70.718  28.098  1.00  0.87           C
ATOM   4080  O   PHE B 514     -12.438 -70.745  28.289  1.00  0.87           O
ATOM   4081  CB  PHE B 514     -10.829 -69.480  25.909  1.00  0.87           C
ATOM   4082  CG  PHE B 514     -10.305 -68.275  26.657  1.00  0.87           C
ATOM   4083  CD1 PHE B 514     -11.149 -67.558  27.523  1.00  0.87           C
ATOM   4084  CD2 PHE B 514      -8.957 -67.899  26.565  1.00  0.87           C
ATOM   4085  CE1 PHE B 514     -10.654 -66.498  28.292  1.00  0.87           C
ATOM   4086  CE2 PHE B 514      -8.452 -66.846  27.338  1.00  0.87           C
ATOM   4087  CZ  PHE B 514      -9.303 -66.145  28.199  1.00  0.87           C
ATOM   4088  N   ASP B 515     -10.341 -70.531  29.098  1.00  0.86           N
ATOM   4089  CA  ASP B 515     -10.721 -70.340  30.478  1.00  0.86           C
ATOM   4090  C   ASP B 515      -9.852 -69.257  31.107  1.00  0.86           C
ATOM   4091  O   ASP B 515      -8.638 -69.172  30.918  1.00  0.86           O
ATOM   4092  CB  ASP B 515     -10.612 -71.681  31.259  1.00  0.86           C
ATOM   4093  CG  ASP B 515     -11.086 -71.643  32.711  1.00  0.86           C
ATOM   4094  OD1 ASP B 515     -11.487 -70.561  33.218  1.00  0.86           O
ATOM   4095  OD2 ASP B 515     -10.999 -72.709  33.363  1.00  0.86           O
ATOM   4096  N   THR B 516     -10.493 -68.413  31.933  1.00  0.86           N
ATOM   4097  CA  THR B 516      -9.880 -67.415  32.790  1.00  0.86           C
ATOM   4098  C   THR B 516      -8.938 -68.047  33.797  1.00  0.86           C
ATOM   4099  O   THR B 516      -7.889 -67.491  34.116  1.00  0.86           O
ATOM   4100  CB  THR B 516     -10.922 -66.577  33.526  1.00  0.86           C
ATOM   4101  OG1 THR B 516     -11.690 -65.844  32.579  1.00  0.86           O
ATOM   4102  CG2 THR B 516     -10.282 -65.541  34.463  1.00  0.86           C
ATOM   4103  N   TYR B 517      -9.265 -69.252  34.317  1.00  0.82           N
ATOM   4104  CA  TYR B 517      -8.504 -69.914  35.362  1.00  0.82           C
ATOM   4105  C   TYR B 517      -7.049 -70.173  34.984  1.00  0.82           C
ATOM   4106  O   TYR B 517      -6.141 -69.960  35.788  1.00  0.82           O
ATOM   4107  CB  TYR B 517      -9.222 -71.204  35.849  1.00  0.82           C
ATOM   4108  CG  TYR B 517      -8.464 -71.867  36.969  1.00  0.82           C
ATOM   4109  CD1 TYR B 517      -7.548 -72.888  36.667  1.00  0.82           C
ATOM   4110  CD2 TYR B 517      -8.573 -71.413  38.292  1.00  0.82           C
ATOM   4111  CE1 TYR B 517      -6.715 -73.410  37.664  1.00  0.82           C
ATOM   4112  CE2 TYR B 517      -7.756 -71.955  39.296  1.00  0.82           C
ATOM   4113  CZ  TYR B 517      -6.814 -72.941  38.976  1.00  0.82           C
ATOM   4114  OH  TYR B 517      -5.956 -73.455  39.967  1.00  0.82           O
ATOM   4115  N   ASN B 518      -6.773 -70.556  33.723  1.00  0.83           N
ATOM   4116  CA  ASN B 518      -5.420 -70.835  33.271  1.00  0.83           C
ATOM   4117  C   ASN B 518      -4.498 -69.612  33.336  1.00  0.83           C
ATOM   4118  O   ASN B 518      -3.273 -69.743  33.353  1.00  0.83           O
ATOM   4119  CB  ASN B 518      -5.449 -71.431  31.840  1.00  0.83           C
ATOM   4120  CG  ASN B 518      -5.897 -72.890  31.891  1.00  0.83           C
ATOM   4121  OD1 ASN B 518      -6.075 -73.487  32.955  1.00  0.83           O
ATOM   4122  ND2 ASN B 518      -6.060 -73.515  30.704  1.00  0.83           N
ATOM   4123  N   LEU B 519      -5.063 -68.391  33.449  1.00  0.85           N
ATOM   4124  CA  LEU B 519      -4.310 -67.164  33.612  1.00  0.85           C
ATOM   4125  C   LEU B 519      -3.805 -66.937  35.030  1.00  0.85           C
ATOM   4126  O   LEU B 519      -2.946 -66.092  35.260  1.00  0.85           O
ATOM   4127  CB  LEU B 519      -5.122 -65.923  33.165  1.00  0.85           C
ATOM   4128  CG  LEU B 519      -5.574 -65.951  31.691  1.00  0.85           C
ATOM   4129  CD1 LEU B 519      -6.431 -64.722  31.325  1.00  0.85           C
ATOM   4130  CD2 LEU B 519      -4.383 -66.137  30.739  1.00  0.85           C
ATOM   4131  N   TRP B 520      -4.289 -67.690  36.040  1.00  0.65           N
ATOM   4132  CA  TRP B 520      -3.768 -67.561  37.388  1.00  0.65           C
ATOM   4133  C   TRP B 520      -2.450 -68.311  37.524  1.00  0.65           C
ATOM   4134  O   TRP B 520      -1.603 -67.995  38.356  1.00  0.65           O
ATOM   4135  CB  TRP B 520      -4.767 -68.081  38.455  1.00  0.65           C
ATOM   4136  CG  TRP B 520      -6.123 -67.377  38.516  1.00  0.65           C
ATOM   4137  CD1 TRP B 520      -7.363 -67.928  38.348  1.00  0.65           C
ATOM   4138  CD2 TRP B 520      -6.338 -66.008  38.899  1.00  0.65           C
ATOM   4139  NE1 TRP B 520      -8.339 -66.987  38.583  1.00  0.65           N
ATOM   4140  CE2 TRP B 520      -7.747 -65.807  38.939  1.00  0.65           C
ATOM   4141  CE3 TRP B 520      -5.468 -64.976  39.221  1.00  0.65           C
ATOM   4142  CZ2 TRP B 520      -8.279 -64.583  39.306  1.00  0.65           C
ATOM   4143  CZ3 TRP B 520      -6.011 -63.738  39.588  1.00  0.65           C
ATOM   4144  CH2 TRP B 520      -7.400 -63.546  39.635  1.00  0.65           C
ATOM   4145  N   ASN B 521      -2.211 -69.290  36.628  1.00  0.76           N
ATOM   4146  CA  ASN B 521      -1.034 -70.138  36.659  1.00  0.76           C
ATOM   4147  C   ASN B 521       0.195 -69.423  36.125  1.00  0.76           C
ATOM   4148  O   ASN B 521       1.314 -69.908  36.263  1.00  0.76           O
ATOM   4149  CB  ASN B 521      -1.218 -71.439  35.834  1.00  0.76           C
ATOM   4150  CG  ASN B 521      -2.311 -72.335  36.411  1.00  0.76           C
ATOM   4151  OD1 ASN B 521      -3.063 -71.988  37.319  1.00  0.76           O
ATOM   4152  ND2 ASN B 521      -2.401 -73.567  35.858  1.00  0.76           N
ATOM   4153  N   THR B 522       0.021 -68.255  35.474  1.00  0.83           N
ATOM   4154  CA  THR B 522       1.135 -67.436  35.020  1.00  0.83           C
ATOM   4155  C   THR B 522       1.620 -66.479  36.093  1.00  0.83           C
ATOM   4156  O   THR B 522       2.753 -66.015  36.041  1.00  0.83           O
ATOM   4157  CB  THR B 522       0.834 -66.635  33.756  1.00  0.83           C
ATOM   4158  OG1 THR B 522      -0.318 -65.815  33.880  1.00  0.83           O
ATOM   4159  CG2 THR B 522       0.571 -67.620  32.607  1.00  0.83           C
ATOM   4160  N   PHE B 523       0.766 -66.201  37.101  1.00  0.78           N
ATOM   4161  CA  PHE B 523       1.070 -65.416  38.283  1.00  0.78           C
ATOM   4162  C   PHE B 523       1.791 -66.194  39.364  1.00  0.78           C
ATOM   4163  O   PHE B 523       2.695 -65.674  40.012  1.00  0.78           O
ATOM   4164  CB  PHE B 523      -0.238 -64.854  38.912  1.00  0.78           C
ATOM   4165  CG  PHE B 523      -0.761 -63.599  38.273  1.00  0.78           C
ATOM   4166  CD1 PHE B 523      -0.016 -62.796  37.388  1.00  0.78           C
ATOM   4167  CD2 PHE B 523      -2.028 -63.147  38.666  1.00  0.78           C
ATOM   4168  CE1 PHE B 523      -0.493 -61.556  36.957  1.00  0.78           C
ATOM   4169  CE2 PHE B 523      -2.487 -61.895  38.262  1.00  0.78           C
ATOM   4170  CZ  PHE B 523      -1.711 -61.086  37.431  1.00  0.78           C
ATOM   4171  N   THR B 524       1.376 -67.454  39.624  1.00  0.65           N
ATOM   4172  CA  THR B 524       1.985 -68.275  40.680  1.00  0.65           C
ATOM   4173  C   THR B 524       3.459 -68.576  40.386  1.00  0.65           C
ATOM   4174  O   THR B 524       3.817 -69.003  39.286  1.00  0.65           O
ATOM   4175  CB  THR B 524       1.163 -69.525  41.044  1.00  0.65           C
ATOM   4176  OG1 THR B 524       1.269 -69.839  42.427  1.00  0.65           O
ATOM   4177  CG2 THR B 524       1.586 -70.766  40.248  1.00  0.65           C
ATOM   4178  N   ARG B 525       4.357 -68.287  41.345  1.00  0.39           N
ATOM   4179  CA  ARG B 525       5.782 -68.207  41.130  1.00  0.39           C
ATOM   4180  C   ARG B 525       6.453 -68.141  42.520  1.00  0.39           C
ATOM   4181  O   ARG B 525       5.803 -67.735  43.521  1.00  0.39           O
ATOM   4182  CB  ARG B 525       6.152 -66.998  40.203  1.00  0.39           C
ATOM   4183  CG  ARG B 525       7.362 -67.194  39.253  1.00  0.39           C
ATOM   4184  CD  ARG B 525       8.773 -67.146  39.881  1.00  0.39           C
ATOM   4185  NE  ARG B 525       9.107 -65.726  40.304  1.00  0.39           N
ATOM   4186  CZ  ARG B 525       8.940 -65.179  41.522  1.00  0.39           C
ATOM   4187  NH1 ARG B 525       9.187 -63.895  41.711  1.00  0.39           N
ATOM   4188  NH2 ARG B 525       8.576 -65.846  42.617  1.00  0.39           N
ATOM   4189  OXT ARG B 525       7.666 -68.504  42.570  1.00  0.39           O
TER    4190      ARG B 525
ATOM   4191  N   ALA A   1     -49.072 -37.724 -28.615  1.00  0.70           N
ATOM   4192  CA  ALA A   1     -50.186 -37.249 -27.730  1.00  0.70           C
ATOM   4193  C   ALA A   1     -49.914 -36.015 -26.876  1.00  0.70           C
ATOM   4194  O   ALA A   1     -49.395 -36.101 -25.762  1.00  0.70           O
ATOM   4195  CB  ALA A   1     -50.682 -38.439 -26.881  1.00  0.70           C
ATOM   4196  N   GLY A   2     -50.233 -34.821 -27.420  1.00  0.78           N
ATOM   4197  CA  GLY A   2     -50.053 -33.545 -26.737  1.00  0.78           C
ATOM   4198  C   GLY A   2     -49.326 -32.579 -27.622  1.00  0.78           C
ATOM   4199  O   GLY A   2     -48.702 -32.991 -28.600  1.00  0.78           O
ATOM   4200  N   ASN A   3     -49.369 -31.279 -27.291  1.00  0.67           N
ATOM   4201  CA  ASN A   3     -48.937 -30.222 -28.189  1.00  0.67           C
ATOM   4202  C   ASN A   3     -47.639 -29.592 -27.707  1.00  0.67           C
ATOM   4203  O   ASN A   3     -47.518 -29.079 -26.598  1.00  0.67           O
ATOM   4204  CB  ASN A   3     -50.022 -29.112 -28.326  1.00  0.67           C
ATOM   4205  CG  ASN A   3     -50.900 -29.334 -29.556  1.00  0.67           C
ATOM   4206  OD1 ASN A   3     -51.027 -30.439 -30.086  1.00  0.67           O
ATOM   4207  ND2 ASN A   3     -51.507 -28.231 -30.056  1.00  0.67           N
ATOM   4208  N   ALA A   4     -46.589 -29.618 -28.542  1.00  0.72           N
ATOM   4209  CA  ALA A   4     -45.311 -29.047 -28.179  1.00  0.72           C
ATOM   4210  C   ALA A   4     -45.296 -27.524 -28.158  1.00  0.72           C
ATOM   4211  O   ALA A   4     -45.625 -26.870 -29.142  1.00  0.72           O
ATOM   4212  CB  ALA A   4     -44.207 -29.548 -29.118  1.00  0.72           C
ATOM   4213  N   THR A   5     -44.897 -26.921 -27.015  1.00  0.66           N
ATOM   4214  CA  THR A   5     -44.857 -25.464 -26.913  1.00  0.66           C
ATOM   4215  C   THR A   5     -43.447 -24.921 -27.075  1.00  0.66           C
ATOM   4216  O   THR A   5     -43.270 -23.753 -27.374  1.00  0.66           O
ATOM   4217  CB  THR A   5     -45.449 -24.945 -25.597  1.00  0.66           C
ATOM   4218  OG1 THR A   5     -45.891 -23.597 -25.690  1.00  0.66           O
ATOM   4219  CG2 THR A   5     -44.434 -24.996 -24.457  1.00  0.66           C
ATOM   4220  N   GLU A   6     -42.383 -25.728 -26.923  1.00  0.69           N
ATOM   4221  CA  GLU A   6     -41.023 -25.204 -26.846  1.00  0.69           C
ATOM   4222  C   GLU A   6     -40.018 -25.970 -27.684  1.00  0.69           C
ATOM   4223  O   GLU A   6     -40.301 -27.057 -28.195  1.00  0.69           O
ATOM   4224  CB  GLU A   6     -40.528 -25.198 -25.378  1.00  0.69           C
ATOM   4225  CG  GLU A   6     -40.742 -23.840 -24.672  1.00  0.69           C
ATOM   4226  CD  GLU A   6     -39.754 -22.768 -25.122  1.00  0.69           C
ATOM   4227  OE1 GLU A   6     -39.887 -21.621 -24.619  1.00  0.69           O
ATOM   4228  OE2 GLU A   6     -38.854 -23.021 -25.963  1.00  0.69           O
ATOM   4229  N   VAL A   7     -38.812 -25.385 -27.860  1.00  0.75           N
ATOM   4230  CA  VAL A   7     -37.780 -25.876 -28.770  1.00  0.75           C
ATOM   4231  C   VAL A   7     -36.469 -26.158 -28.019  1.00  0.75           C
ATOM   4232  O   VAL A   7     -36.176 -25.453 -27.048  1.00  0.75           O
ATOM   4233  CB  VAL A   7     -37.576 -24.969 -30.005  1.00  0.75           C
ATOM   4234  CG1 VAL A   7     -38.564 -23.785 -29.979  1.00  0.75           C
ATOM   4235  CG2 VAL A   7     -36.135 -24.434 -30.158  1.00  0.75           C
ATOM   4236  N   PRO A   8     -35.623 -27.148 -28.397  1.00  0.78           N
ATOM   4237  CA  PRO A   8     -34.523 -27.633 -27.565  1.00  0.78           C
ATOM   4238  C   PRO A   8     -33.496 -26.618 -27.142  1.00  0.78           C
ATOM   4239  O   PRO A   8     -32.835 -26.822 -26.130  1.00  0.78           O
ATOM   4240  CB  PRO A   8     -33.866 -28.732 -28.409  1.00  0.78           C
ATOM   4241  CG  PRO A   8     -35.046 -29.344 -29.152  1.00  0.78           C
ATOM   4242  CD  PRO A   8     -35.963 -28.146 -29.415  1.00  0.78           C
ATOM   4243  N   ALA A   9     -33.322 -25.537 -27.919  1.00  0.70           N
ATOM   4244  CA  ALA A   9     -32.332 -24.516 -27.675  1.00  0.70           C
ATOM   4245  C   ALA A   9     -32.513 -23.806 -26.328  1.00  0.70           C
ATOM   4246  O   ALA A   9     -31.545 -23.460 -25.656  1.00  0.70           O
ATOM   4247  CB  ALA A   9     -32.351 -23.541 -28.870  1.00  0.70           C
ATOM   4248  N   ASN A  10     -33.778 -23.617 -25.893  1.00  0.78           N
ATOM   4249  CA  ASN A  10     -34.105 -22.975 -24.635  1.00  0.78           C
ATOM   4250  C   ASN A  10     -34.076 -23.903 -23.427  1.00  0.78           C
ATOM   4251  O   ASN A  10     -34.039 -23.426 -22.299  1.00  0.78           O
ATOM   4252  CB  ASN A  10     -35.535 -22.385 -24.685  1.00  0.78           C
ATOM   4253  CG  ASN A  10     -35.593 -21.070 -25.440  1.00  0.78           C
ATOM   4254  OD1 ASN A  10     -34.604 -20.380 -25.697  1.00  0.78           O
ATOM   4255  ND2 ASN A  10     -36.833 -20.653 -25.773  1.00  0.78           N
ATOM   4256  N   SER A  11     -34.074 -25.239 -23.599  1.00  0.74           N
ATOM   4257  CA  SER A  11     -34.382 -26.212 -22.550  1.00  0.74           C
ATOM   4258  C   SER A  11     -33.618 -26.061 -21.258  1.00  0.74           C
ATOM   4259  O   SER A  11     -34.175 -26.130 -20.173  1.00  0.74           O
ATOM   4260  CB  SER A  11     -34.057 -27.643 -23.030  1.00  0.74           C
ATOM   4261  OG  SER A  11     -34.915 -28.016 -24.105  1.00  0.74           O
ATOM   4262  N   THR A  12     -32.301 -25.818 -21.363  1.00  0.76           N
ATOM   4263  CA  THR A  12     -31.422 -25.644 -20.230  1.00  0.76           C
ATOM   4264  C   THR A  12     -31.775 -24.408 -19.432  1.00  0.76           C
ATOM   4265  O   THR A  12     -31.776 -24.406 -18.206  1.00  0.76           O
ATOM   4266  CB  THR A  12     -29.966 -25.581 -20.675  1.00  0.76           C
ATOM   4267  OG1 THR A  12     -29.776 -24.562 -21.650  1.00  0.76           O
ATOM   4268  CG2 THR A  12     -29.609 -26.920 -21.346  1.00  0.76           C
ATOM   4269  N   VAL A  13     -32.100 -23.302 -20.123  1.00  0.86           N
ATOM   4270  CA  VAL A  13     -32.261 -22.011 -19.494  1.00  0.86           C
ATOM   4271  C   VAL A  13     -33.500 -21.955 -18.649  1.00  0.86           C
ATOM   4272  O   VAL A  13     -33.498 -21.538 -17.498  1.00  0.86           O
ATOM   4273  CB  VAL A  13     -32.366 -20.882 -20.507  1.00  0.86           C
ATOM   4274  CG1 VAL A  13     -31.976 -19.574 -19.803  1.00  0.86           C
ATOM   4275  CG2 VAL A  13     -31.442 -21.162 -21.703  1.00  0.86           C
ATOM   4276  N   LEU A  14     -34.610 -22.439 -19.240  1.00  0.83           N
ATOM   4277  CA  LEU A  14     -35.910 -22.421 -18.617  1.00  0.83           C
ATOM   4278  C   LEU A  14     -35.941 -23.279 -17.378  1.00  0.83           C
ATOM   4279  O   LEU A  14     -36.446 -22.873 -16.340  1.00  0.83           O
ATOM   4280  CB  LEU A  14     -37.032 -22.924 -19.556  1.00  0.83           C
ATOM   4281  CG  LEU A  14     -36.917 -22.510 -21.032  1.00  0.83           C
ATOM   4282  CD1 LEU A  14     -37.751 -23.442 -21.913  1.00  0.83           C
ATOM   4283  CD2 LEU A  14     -37.341 -21.069 -21.308  1.00  0.83           C
ATOM   4284  N   SER A  15     -35.356 -24.490 -17.449  1.00  0.79           N
ATOM   4285  CA  SER A  15     -35.284 -25.407 -16.334  1.00  0.79           C
ATOM   4286  C   SER A  15     -34.508 -24.863 -15.151  1.00  0.79           C
ATOM   4287  O   SER A  15     -34.970 -24.924 -14.014  1.00  0.79           O
ATOM   4288  CB  SER A  15     -34.707 -26.761 -16.802  1.00  0.79           C
ATOM   4289  OG  SER A  15     -33.432 -26.629 -17.417  1.00  0.79           O
ATOM   4290  N   PHE A  16     -33.346 -24.231 -15.414  1.00  0.79           N
ATOM   4291  CA  PHE A  16     -32.574 -23.516 -14.418  1.00  0.79           C
ATOM   4292  C   PHE A  16     -33.361 -22.389 -13.753  1.00  0.79           C
ATOM   4293  O   PHE A  16     -33.519 -22.368 -12.534  1.00  0.79           O
ATOM   4294  CB  PHE A  16     -31.261 -22.985 -15.077  1.00  0.79           C
ATOM   4295  CG  PHE A  16     -30.397 -22.127 -14.181  1.00  0.79           C
ATOM   4296  CD1 PHE A  16     -30.215 -22.434 -12.821  1.00  0.79           C
ATOM   4297  CD2 PHE A  16     -29.774 -20.979 -14.703  1.00  0.79           C
ATOM   4298  CE1 PHE A  16     -29.460 -21.594 -11.996  1.00  0.79           C
ATOM   4299  CE2 PHE A  16     -29.019 -20.140 -13.876  1.00  0.79           C
ATOM   4300  CZ  PHE A  16     -28.870 -20.442 -12.523  1.00  0.79           C
ATOM   4301  N   CYS A  17     -33.953 -21.468 -14.538  1.00  0.85           N
ATOM   4302  CA  CYS A  17     -34.727 -20.361 -13.996  1.00  0.85           C
ATOM   4303  C   CYS A  17     -35.957 -20.816 -13.245  1.00  0.85           C
ATOM   4304  O   CYS A  17     -36.347 -20.244 -12.230  1.00  0.85           O
ATOM   4305  CB  CYS A  17     -35.135 -19.385 -15.113  1.00  0.85           C
ATOM   4306  SG  CYS A  17     -33.638 -18.707 -15.902  1.00  0.85           S
ATOM   4307  N   ALA A  18     -36.589 -21.899 -13.726  1.00  0.80           N
ATOM   4308  CA  ALA A  18     -37.713 -22.520 -13.087  1.00  0.80           C
ATOM   4309  C   ALA A  18     -37.396 -23.052 -11.698  1.00  0.80           C
ATOM   4310  O   ALA A  18     -38.195 -22.898 -10.774  1.00  0.80           O
ATOM   4311  CB  ALA A  18     -38.238 -23.683 -13.953  1.00  0.80           C
ATOM   4312  N   PHE A  19     -36.242 -23.719 -11.509  1.00  0.72           N
ATOM   4313  CA  PHE A  19     -35.874 -24.269 -10.213  1.00  0.72           C
ATOM   4314  C   PHE A  19     -35.354 -23.233  -9.225  1.00  0.72           C
ATOM   4315  O   PHE A  19     -35.307 -23.486  -8.027  1.00  0.72           O
ATOM   4316  CB  PHE A  19     -34.804 -25.387 -10.347  1.00  0.72           C
ATOM   4317  CG  PHE A  19     -35.433 -26.747 -10.457  1.00  0.72           C
ATOM   4318  CD1 PHE A  19     -35.986 -27.357  -9.318  1.00  0.72           C
ATOM   4319  CD2 PHE A  19     -35.420 -27.461 -11.665  1.00  0.72           C
ATOM   4320  CE1 PHE A  19     -36.483 -28.663  -9.384  1.00  0.72           C
ATOM   4321  CE2 PHE A  19     -35.915 -28.770 -11.730  1.00  0.72           C
ATOM   4322  CZ  PHE A  19     -36.442 -29.376 -10.586  1.00  0.72           C
ATOM   4323  N   ALA A  20     -34.935 -22.043  -9.671  1.00  0.81           N
ATOM   4324  CA  ALA A  20     -34.305 -21.055  -8.828  1.00  0.81           C
ATOM   4325  C   ALA A  20     -35.142 -20.466  -7.691  1.00  0.81           C
ATOM   4326  O   ALA A  20     -36.365 -20.312  -7.752  1.00  0.81           O
ATOM   4327  CB  ALA A  20     -33.734 -19.943  -9.712  1.00  0.81           C
ATOM   4328  N   VAL A  21     -34.492 -20.105  -6.561  1.00  0.78           N
ATOM   4329  CA  VAL A  21     -35.138 -19.254  -5.563  1.00  0.78           C
ATOM   4330  C   VAL A  21     -35.430 -17.890  -6.122  1.00  0.78           C
ATOM   4331  O   VAL A  21     -36.576 -17.436  -6.095  1.00  0.78           O
ATOM   4332  CB  VAL A  21     -34.363 -19.074  -4.268  1.00  0.78           C
ATOM   4333  CG1 VAL A  21     -35.065 -19.946  -3.217  1.00  0.78           C
ATOM   4334  CG2 VAL A  21     -32.874 -19.406  -4.457  1.00  0.78           C
ATOM   4335  N   ASP A  22     -34.404 -17.278  -6.717  1.00  0.83           N
ATOM   4336  CA  ASP A  22     -34.484 -16.040  -7.436  1.00  0.83           C
ATOM   4337  C   ASP A  22     -34.425 -16.332  -8.930  1.00  0.83           C
ATOM   4338  O   ASP A  22     -33.370 -16.593  -9.507  1.00  0.83           O
ATOM   4339  CB  ASP A  22     -33.294 -15.162  -6.992  1.00  0.83           C
ATOM   4340  CG  ASP A  22     -33.415 -13.727  -7.473  1.00  0.83           C
ATOM   4341  OD1 ASP A  22     -33.918 -13.523  -8.607  1.00  0.83           O
ATOM   4342  OD2 ASP A  22     -32.956 -12.823  -6.735  1.00  0.83           O
ATOM   4343  N   ALA A  23     -35.585 -16.283  -9.608  1.00  0.89           N
ATOM   4344  CA  ALA A  23     -35.666 -16.514 -11.031  1.00  0.89           C
ATOM   4345  C   ALA A  23     -35.027 -15.398 -11.837  1.00  0.89           C
ATOM   4346  O   ALA A  23     -34.466 -15.610 -12.912  1.00  0.89           O
ATOM   4347  CB  ALA A  23     -37.148 -16.663 -11.405  1.00  0.89           C
ATOM   4348  N   ALA A  24     -35.108 -14.161 -11.312  1.00  0.90           N
ATOM   4349  CA  ALA A  24     -34.551 -13.004 -11.959  1.00  0.90           C
ATOM   4350  C   ALA A  24     -33.033 -13.005 -11.979  1.00  0.90           C
ATOM   4351  O   ALA A  24     -32.406 -12.785 -13.016  1.00  0.90           O
ATOM   4352  CB  ALA A  24     -35.010 -11.730 -11.230  1.00  0.90           C
ATOM   4353  N   LYS A  25     -32.401 -13.277 -10.823  1.00  0.84           N
ATOM   4354  CA  LYS A  25     -30.968 -13.394 -10.700  1.00  0.84           C
ATOM   4355  C   LYS A  25     -30.413 -14.568 -11.479  1.00  0.84           C
ATOM   4356  O   LYS A  25     -29.414 -14.423 -12.179  1.00  0.84           O
ATOM   4357  CB  LYS A  25     -30.474 -13.380  -9.232  1.00  0.84           C
ATOM   4358  CG  LYS A  25     -29.003 -13.767  -9.117  1.00  0.84           C
ATOM   4359  CD  LYS A  25     -28.326 -13.364  -7.811  1.00  0.84           C
ATOM   4360  CE  LYS A  25     -26.809 -13.587  -7.860  1.00  0.84           C
ATOM   4361  NZ  LYS A  25     -26.222 -12.942  -9.055  1.00  0.84           N
ATOM   4362  N   ALA A  26     -31.083 -15.737 -11.449  1.00  0.90           N
ATOM   4363  CA  ALA A  26     -30.640 -16.906 -12.175  1.00  0.90           C
ATOM   4364  C   ALA A  26     -30.478 -16.670 -13.674  1.00  0.90           C
ATOM   4365  O   ALA A  26     -29.464 -17.022 -14.269  1.00  0.90           O
ATOM   4366  CB  ALA A  26     -31.660 -18.029 -11.931  1.00  0.90           C
ATOM   4367  N   TYR A  27     -31.455 -15.988 -14.310  1.00  0.87           N
ATOM   4368  CA  TYR A  27     -31.368 -15.626 -15.712  1.00  0.87           C
ATOM   4369  C   TYR A  27     -30.218 -14.664 -16.002  1.00  0.87           C
ATOM   4370  O   TYR A  27     -29.445 -14.866 -16.935  1.00  0.87           O
ATOM   4371  CB  TYR A  27     -32.749 -15.077 -16.188  1.00  0.87           C
ATOM   4372  CG  TYR A  27     -32.886 -14.982 -17.693  1.00  0.87           C
ATOM   4373  CD1 TYR A  27     -32.601 -16.087 -18.512  1.00  0.87           C
ATOM   4374  CD2 TYR A  27     -33.296 -13.785 -18.306  1.00  0.87           C
ATOM   4375  CE1 TYR A  27     -32.610 -15.960 -19.911  1.00  0.87           C
ATOM   4376  CE2 TYR A  27     -33.304 -13.660 -19.703  1.00  0.87           C
ATOM   4377  CZ  TYR A  27     -32.944 -14.737 -20.507  1.00  0.87           C
ATOM   4378  OH  TYR A  27     -32.956 -14.595 -21.910  1.00  0.87           O
ATOM   4379  N   LYS A  28     -30.027 -13.630 -15.153  1.00  0.82           N
ATOM   4380  CA  LYS A  28     -28.956 -12.667 -15.311  1.00  0.82           C
ATOM   4381  C   LYS A  28     -27.587 -13.321 -15.239  1.00  0.82           C
ATOM   4382  O   LYS A  28     -26.735 -13.107 -16.096  1.00  0.82           O
ATOM   4383  CB  LYS A  28     -29.095 -11.558 -14.241  1.00  0.82           C
ATOM   4384  CG  LYS A  28     -30.351 -10.692 -14.441  1.00  0.82           C
ATOM   4385  CD  LYS A  28     -30.599  -9.721 -13.272  1.00  0.82           C
ATOM   4386  CE  LYS A  28     -31.291  -8.425 -13.712  1.00  0.82           C
ATOM   4387  NZ  LYS A  28     -31.570  -7.535 -12.559  1.00  0.82           N
ATOM   4388  N   ASP A  29     -27.387 -14.213 -14.252  1.00  0.83           N
ATOM   4389  CA  ASP A  29     -26.155 -14.953 -14.110  1.00  0.83           C
ATOM   4390  C   ASP A  29     -25.902 -15.884 -15.290  1.00  0.83           C
ATOM   4391  O   ASP A  29     -24.785 -15.986 -15.783  1.00  0.83           O
ATOM   4392  CB  ASP A  29     -26.113 -15.730 -12.782  1.00  0.83           C
ATOM   4393  CG  ASP A  29     -26.249 -14.801 -11.593  1.00  0.83           C
ATOM   4394  OD1 ASP A  29     -25.891 -13.599 -11.648  1.00  0.83           O
ATOM   4395  OD2 ASP A  29     -26.677 -15.277 -10.511  1.00  0.83           O
ATOM   4396  N   TYR A  30     -26.957 -16.549 -15.811  1.00  0.83           N
ATOM   4397  CA  TYR A  30     -26.866 -17.429 -16.964  1.00  0.83           C
ATOM   4398  C   TYR A  30     -26.362 -16.727 -18.223  1.00  0.83           C
ATOM   4399  O   TYR A  30     -25.526 -17.268 -18.944  1.00  0.83           O
ATOM   4400  CB  TYR A  30     -28.228 -18.129 -17.229  1.00  0.83           C
ATOM   4401  CG  TYR A  30     -28.139 -19.165 -18.322  1.00  0.83           C
ATOM   4402  CD1 TYR A  30     -27.648 -20.458 -18.068  1.00  0.83           C
ATOM   4403  CD2 TYR A  30     -28.528 -18.831 -19.629  1.00  0.83           C
ATOM   4404  CE1 TYR A  30     -27.547 -21.396 -19.108  1.00  0.83           C
ATOM   4405  CE2 TYR A  30     -28.436 -19.771 -20.662  1.00  0.83           C
ATOM   4406  CZ  TYR A  30     -27.940 -21.052 -20.404  1.00  0.83           C
ATOM   4407  OH  TYR A  30     -27.860 -21.993 -21.450  1.00  0.83           O
ATOM   4408  N   LEU A  31     -26.819 -15.484 -18.487  1.00  0.80           N
ATOM   4409  CA  LEU A  31     -26.286 -14.669 -19.568  1.00  0.80           C
ATOM   4410  C   LEU A  31     -24.789 -14.404 -19.437  1.00  0.80           C
ATOM   4411  O   LEU A  31     -24.039 -14.474 -20.410  1.00  0.80           O
ATOM   4412  CB  LEU A  31     -27.038 -13.318 -19.672  1.00  0.80           C
ATOM   4413  CG  LEU A  31     -28.450 -13.394 -20.292  1.00  0.80           C
ATOM   4414  CD1 LEU A  31     -29.095 -11.999 -20.309  1.00  0.80           C
ATOM   4415  CD2 LEU A  31     -28.424 -13.954 -21.721  1.00  0.80           C
ATOM   4416  N   ALA A  32     -24.303 -14.143 -18.208  1.00  0.78           N
ATOM   4417  CA  ALA A  32     -22.897 -13.939 -17.922  1.00  0.78           C
ATOM   4418  C   ALA A  32     -22.008 -15.147 -18.222  1.00  0.78           C
ATOM   4419  O   ALA A  32     -20.847 -15.008 -18.593  1.00  0.78           O
ATOM   4420  CB  ALA A  32     -22.734 -13.473 -16.465  1.00  0.78           C
ATOM   4421  N   SER A  33     -22.559 -16.369 -18.118  1.00  0.77           N
ATOM   4422  CA  SER A  33     -21.846 -17.622 -18.315  1.00  0.77           C
ATOM   4423  C   SER A  33     -21.566 -17.994 -19.753  1.00  0.77           C
ATOM   4424  O   SER A  33     -21.049 -19.075 -20.022  1.00  0.77           O
ATOM   4425  CB  SER A  33     -22.695 -18.810 -17.821  1.00  0.77           C
ATOM   4426  OG  SER A  33     -23.071 -18.606 -16.472  1.00  0.77           O
ATOM   4427  N   GLY A  34     -21.923 -17.149 -20.741  1.00  0.77           N
ATOM   4428  CA  GLY A  34     -21.846 -17.564 -22.138  1.00  0.77           C
ATOM   4429  C   GLY A  34     -23.062 -18.328 -22.588  1.00  0.77           C
ATOM   4430  O   GLY A  34     -23.083 -18.903 -23.673  1.00  0.77           O
ATOM   4431  N   GLY A  35     -24.122 -18.374 -21.757  1.00  0.81           N
ATOM   4432  CA  GLY A  35     -25.388 -18.978 -22.138  1.00  0.81           C
ATOM   4433  C   GLY A  35     -26.182 -18.130 -23.102  1.00  0.81           C
ATOM   4434  O   GLY A  35     -26.259 -16.913 -22.973  1.00  0.81           O
ATOM   4435  N   GLN A  36     -26.831 -18.761 -24.101  1.00  0.80           N
ATOM   4436  CA  GLN A  36     -27.709 -18.062 -25.027  1.00  0.80           C
ATOM   4437  C   GLN A  36     -28.961 -17.457 -24.362  1.00  0.80           C
ATOM   4438  O   GLN A  36     -29.530 -18.103 -23.478  1.00  0.80           O
ATOM   4439  CB  GLN A  36     -28.148 -18.996 -26.188  1.00  0.80           C
ATOM   4440  CG  GLN A  36     -27.014 -19.412 -27.160  1.00  0.80           C
ATOM   4441  CD  GLN A  36     -26.643 -18.295 -28.140  1.00  0.80           C
ATOM   4442  OE1 GLN A  36     -26.855 -17.104 -27.916  1.00  0.80           O
ATOM   4443  NE2 GLN A  36     -26.064 -18.686 -29.299  1.00  0.80           N
ATOM   4444  N   PRO A  37     -29.437 -16.257 -24.718  1.00  0.89           N
ATOM   4445  CA  PRO A  37     -30.736 -15.746 -24.287  1.00  0.89           C
ATOM   4446  C   PRO A  37     -31.914 -16.546 -24.823  1.00  0.89           C
ATOM   4447  O   PRO A  37     -31.776 -17.317 -25.772  1.00  0.89           O
ATOM   4448  CB  PRO A  37     -30.770 -14.297 -24.808  1.00  0.89           C
ATOM   4449  CG  PRO A  37     -29.812 -14.286 -26.000  1.00  0.89           C
ATOM   4450  CD  PRO A  37     -28.762 -15.334 -25.632  1.00  0.89           C
ATOM   4451  N   ILE A  38     -33.100 -16.373 -24.208  1.00  0.87           N
ATOM   4452  CA  ILE A  38     -34.338 -17.015 -24.624  1.00  0.87           C
ATOM   4453  C   ILE A  38     -34.775 -16.699 -26.051  1.00  0.87           C
ATOM   4454  O   ILE A  38     -35.025 -15.549 -26.414  1.00  0.87           O
ATOM   4455  CB  ILE A  38     -35.484 -16.708 -23.658  1.00  0.87           C
ATOM   4456  CG1 ILE A  38     -35.292 -17.524 -22.361  1.00  0.87           C
ATOM   4457  CG2 ILE A  38     -36.863 -17.015 -24.287  1.00  0.87           C
ATOM   4458  CD1 ILE A  38     -36.390 -17.296 -21.317  1.00  0.87           C
ATOM   4459  N   THR A  39     -34.964 -17.745 -26.884  1.00  0.81           N
ATOM   4460  CA  THR A  39     -35.468 -17.612 -28.249  1.00  0.81           C
ATOM   4461  C   THR A  39     -36.943 -17.981 -28.337  1.00  0.81           C
ATOM   4462  O   THR A  39     -37.599 -18.292 -27.343  1.00  0.81           O
ATOM   4463  CB  THR A  39     -34.640 -18.382 -29.282  1.00  0.81           C
ATOM   4464  OG1 THR A  39     -34.942 -18.001 -30.627  1.00  0.81           O
ATOM   4465  CG2 THR A  39     -34.870 -19.894 -29.126  1.00  0.81           C
ATOM   4466  N   ASN A  40     -37.526 -17.916 -29.550  1.00  0.69           N
ATOM   4467  CA  ASN A  40     -38.860 -18.380 -29.893  1.00  0.69           C
ATOM   4468  C   ASN A  40     -40.007 -17.513 -29.379  1.00  0.69           C
ATOM   4469  O   ASN A  40     -41.169 -17.761 -29.681  1.00  0.69           O
ATOM   4470  CB  ASN A  40     -39.002 -19.892 -29.533  1.00  0.69           C
ATOM   4471  CG  ASN A  40     -40.233 -20.597 -30.089  1.00  0.69           C
ATOM   4472  OD1 ASN A  40     -40.939 -21.324 -29.383  1.00  0.69           O
ATOM   4473  ND2 ASN A  40     -40.470 -20.452 -31.403  1.00  0.69           N
ATOM   4474  N   CYS A  41     -39.739 -16.418 -28.650  1.00  0.76           N
ATOM   4475  CA  CYS A  41     -40.767 -15.485 -28.222  1.00  0.76           C
ATOM   4476  C   CYS A  41     -41.552 -14.842 -29.362  1.00  0.76           C
ATOM   4477  O   CYS A  41     -40.990 -14.430 -30.372  1.00  0.76           O
ATOM   4478  CB  CYS A  41     -40.172 -14.381 -27.303  1.00  0.76           C
ATOM   4479  SG  CYS A  41     -38.438 -13.993 -27.737  1.00  0.76           S
ATOM   4480  N   VAL A  42     -42.895 -14.755 -29.211  1.00  0.79           N
ATOM   4481  CA  VAL A  42     -43.828 -14.308 -30.240  1.00  0.79           C
ATOM   4482  C   VAL A  42     -43.534 -12.928 -30.826  1.00  0.79           C
ATOM   4483  O   VAL A  42     -43.581 -11.908 -30.138  1.00  0.79           O
ATOM   4484  CB  VAL A  42     -45.288 -14.432 -29.780  1.00  0.79           C
ATOM   4485  CG1 VAL A  42     -45.439 -13.966 -28.327  1.00  0.79           C
ATOM   4486  CG2 VAL A  42     -46.256 -13.640 -30.681  1.00  0.79           C
ATOM   4487  N   LYS A  43     -43.243 -12.895 -32.145  1.00  0.69           N
ATOM   4488  CA  LYS A  43     -42.690 -11.752 -32.837  1.00  0.69           C
ATOM   4489  C   LYS A  43     -43.644 -11.231 -33.894  1.00  0.69           C
ATOM   4490  O   LYS A  43     -44.252 -12.011 -34.630  1.00  0.69           O
ATOM   4491  CB  LYS A  43     -41.354 -12.120 -33.537  1.00  0.69           C
ATOM   4492  CG  LYS A  43     -40.458 -10.891 -33.702  1.00  0.69           C
ATOM   4493  CD  LYS A  43     -39.369 -10.950 -34.782  1.00  0.69           C
ATOM   4494  CE  LYS A  43     -38.578  -9.648 -34.628  1.00  0.69           C
ATOM   4495  NZ  LYS A  43     -37.668  -9.301 -35.735  1.00  0.69           N
ATOM   4496  N   MET A  44     -43.807  -9.894 -33.986  1.00  0.68           N
ATOM   4497  CA  MET A  44     -44.917  -9.298 -34.701  1.00  0.68           C
ATOM   4498  C   MET A  44     -44.558  -8.697 -36.038  1.00  0.68           C
ATOM   4499  O   MET A  44     -43.612  -7.927 -36.181  1.00  0.68           O
ATOM   4500  CB  MET A  44     -45.687  -8.221 -33.880  1.00  0.68           C
ATOM   4501  CG  MET A  44     -46.521  -8.744 -32.691  1.00  0.68           C
ATOM   4502  SD  MET A  44     -46.856 -10.531 -32.760  1.00  0.68           S
ATOM   4503  CE  MET A  44     -48.525 -10.348 -32.181  1.00  0.68           C
ATOM   4504  N   LEU A  45     -45.363  -9.024 -37.070  1.00  0.72           N
ATOM   4505  CA  LEU A  45     -45.464  -8.226 -38.276  1.00  0.72           C
ATOM   4506  C   LEU A  45     -46.295  -6.991 -37.946  1.00  0.72           C
ATOM   4507  O   LEU A  45     -47.436  -7.088 -37.502  1.00  0.72           O
ATOM   4508  CB  LEU A  45     -46.129  -9.053 -39.408  1.00  0.72           C
ATOM   4509  CG  LEU A  45     -45.915  -8.628 -40.884  1.00  0.72           C
ATOM   4510  CD1 LEU A  45     -45.192  -7.289 -41.088  1.00  0.72           C
ATOM   4511  CD2 LEU A  45     -45.195  -9.753 -41.648  1.00  0.72           C
ATOM   4512  N   CYS A  46     -45.726  -5.787 -38.100  1.00  0.78           N
ATOM   4513  CA  CYS A  46     -46.355  -4.568 -37.657  1.00  0.78           C
ATOM   4514  C   CYS A  46     -46.087  -3.522 -38.715  1.00  0.78           C
ATOM   4515  O   CYS A  46     -45.258  -3.707 -39.601  1.00  0.78           O
ATOM   4516  CB  CYS A  46     -45.816  -4.107 -36.270  1.00  0.78           C
ATOM   4517  SG  CYS A  46     -46.762  -2.720 -35.525  1.00  0.78           S
ATOM   4518  N   THR A  47     -46.817  -2.396 -38.665  1.00  0.79           N
ATOM   4519  CA  THR A  47     -46.633  -1.252 -39.544  1.00  0.79           C
ATOM   4520  C   THR A  47     -45.402  -0.441 -39.159  1.00  0.79           C
ATOM   4521  O   THR A  47     -44.832   0.293 -39.960  1.00  0.79           O
ATOM   4522  CB  THR A  47     -47.908  -0.392 -39.540  1.00  0.79           C
ATOM   4523  OG1 THR A  47     -47.793   0.829 -40.255  1.00  0.79           O
ATOM   4524  CG2 THR A  47     -48.352  -0.076 -38.106  1.00  0.79           C
ATOM   4525  N   HIS A  48     -44.955  -0.580 -37.892  1.00  0.73           N
ATOM   4526  CA  HIS A  48     -43.844   0.148 -37.296  1.00  0.73           C
ATOM   4527  C   HIS A  48     -44.062   1.655 -37.302  1.00  0.73           C
ATOM   4528  O   HIS A  48     -43.141   2.468 -37.339  1.00  0.73           O
ATOM   4529  CB  HIS A  48     -42.454  -0.288 -37.822  1.00  0.73           C
ATOM   4530  CG  HIS A  48     -41.928  -1.598 -37.288  1.00  0.73           C
ATOM   4531  ND1 HIS A  48     -42.683  -2.758 -37.351  1.00  0.73           N
ATOM   4532  CD2 HIS A  48     -40.675  -1.886 -36.844  1.00  0.73           C
ATOM   4533  CE1 HIS A  48     -41.871  -3.720 -36.956  1.00  0.73           C
ATOM   4534  NE2 HIS A  48     -40.644  -3.249 -36.638  1.00  0.73           N
ATOM   4535  N   THR A  49     -45.336   2.039 -37.147  1.00  0.83           N
ATOM   4536  CA  THR A  49     -45.771   3.342 -36.690  1.00  0.83           C
ATOM   4537  C   THR A  49     -46.828   3.042 -35.658  1.00  0.83           C
ATOM   4538  O   THR A  49     -47.432   1.967 -35.674  1.00  0.83           O
ATOM   4539  CB  THR A  49     -46.321   4.280 -37.769  1.00  0.83           C
ATOM   4540  OG1 THR A  49     -46.559   5.588 -37.256  1.00  0.83           O
ATOM   4541  CG2 THR A  49     -47.640   3.766 -38.367  1.00  0.83           C
ATOM   4542  N   GLY A  50     -47.062   3.967 -34.721  1.00  0.73           N
ATOM   4543  CA  GLY A  50     -47.929   3.729 -33.585  1.00  0.73           C
ATOM   4544  C   GLY A  50     -47.376   4.442 -32.393  1.00  0.73           C
ATOM   4545  O   GLY A  50     -46.390   5.176 -32.468  1.00  0.73           O
ATOM   4546  N   THR A  51     -48.018   4.269 -31.234  1.00  0.81           N
ATOM   4547  CA  THR A  51     -47.491   4.682 -29.945  1.00  0.81           C
ATOM   4548  C   THR A  51     -46.207   3.946 -29.575  1.00  0.81           C
ATOM   4549  O   THR A  51     -46.105   2.734 -29.699  1.00  0.81           O
ATOM   4550  CB  THR A  51     -48.492   4.502 -28.791  1.00  0.81           C
ATOM   4551  OG1 THR A  51     -49.789   4.174 -29.264  1.00  0.81           O
ATOM   4552  CG2 THR A  51     -48.680   5.839 -28.062  1.00  0.81           C
ATOM   4553  N   GLY A  52     -45.188   4.638 -29.027  1.00  0.86           N
ATOM   4554  CA  GLY A  52     -43.948   3.982 -28.598  1.00  0.86           C
ATOM   4555  C   GLY A  52     -44.028   3.257 -27.282  1.00  0.86           C
ATOM   4556  O   GLY A  52     -43.035   2.721 -26.799  1.00  0.86           O
ATOM   4557  N   GLN A  53     -45.197   3.269 -26.620  1.00  0.80           N
ATOM   4558  CA  GLN A  53     -45.359   2.772 -25.270  1.00  0.80           C
ATOM   4559  C   GLN A  53     -45.028   1.299 -25.124  1.00  0.80           C
ATOM   4560  O   GLN A  53     -45.357   0.475 -25.967  1.00  0.80           O
ATOM   4561  CB  GLN A  53     -46.763   3.076 -24.707  1.00  0.80           C
ATOM   4562  CG  GLN A  53     -47.116   4.569 -24.870  1.00  0.80           C
ATOM   4563  CD  GLN A  53     -48.299   5.008 -24.008  1.00  0.80           C
ATOM   4564  OE1 GLN A  53     -48.984   4.233 -23.343  1.00  0.80           O
ATOM   4565  NE2 GLN A  53     -48.547   6.336 -24.017  1.00  0.80           N
ATOM   4566  N   ALA A  54     -44.322   0.937 -24.038  1.00  0.88           N
ATOM   4567  CA  ALA A  54     -43.942  -0.433 -23.794  1.00  0.88           C
ATOM   4568  C   ALA A  54     -45.115  -1.350 -23.517  1.00  0.88           C
ATOM   4569  O   ALA A  54     -45.146  -2.456 -24.027  1.00  0.88           O
ATOM   4570  CB  ALA A  54     -42.976  -0.485 -22.612  1.00  0.88           C
ATOM   4571  N   ILE A  55     -46.109  -0.914 -22.723  1.00  0.76           N
ATOM   4572  CA  ILE A  55     -47.350  -1.641 -22.509  1.00  0.76           C
ATOM   4573  C   ILE A  55     -48.411  -1.144 -23.481  1.00  0.76           C
ATOM   4574  O   ILE A  55     -48.778   0.030 -23.497  1.00  0.76           O
ATOM   4575  CB  ILE A  55     -47.843  -1.571 -21.052  1.00  0.76           C
ATOM   4576  CG1 ILE A  55     -49.176  -2.344 -20.820  1.00  0.76           C
ATOM   4577  CG2 ILE A  55     -47.889  -0.118 -20.523  1.00  0.76           C
ATOM   4578  CD1 ILE A  55     -50.456  -1.495 -20.884  1.00  0.76           C
ATOM   4579  N   THR A  56     -48.952  -2.034 -24.338  1.00  0.82           N
ATOM   4580  CA  THR A  56     -49.993  -1.669 -25.295  1.00  0.82           C
ATOM   4581  C   THR A  56     -51.036  -2.772 -25.364  1.00  0.82           C
ATOM   4582  O   THR A  56     -50.760  -3.947 -25.135  1.00  0.82           O
ATOM   4583  CB  THR A  56     -49.523  -1.341 -26.719  1.00  0.82           C
ATOM   4584  OG1 THR A  56     -48.759  -2.368 -27.334  1.00  0.82           O
ATOM   4585  CG2 THR A  56     -48.666  -0.071 -26.711  1.00  0.82           C
ATOM   4586  N   VAL A  57     -52.317  -2.425 -25.631  1.00  0.75           N
ATOM   4587  CA  VAL A  57     -53.390  -3.408 -25.756  1.00  0.75           C
ATOM   4588  C   VAL A  57     -53.461  -4.041 -27.137  1.00  0.75           C
ATOM   4589  O   VAL A  57     -53.907  -5.177 -27.280  1.00  0.75           O
ATOM   4590  CB  VAL A  57     -54.734  -2.817 -25.335  1.00  0.75           C
ATOM   4591  CG1 VAL A  57     -55.207  -1.718 -26.308  1.00  0.75           C
ATOM   4592  CG2 VAL A  57     -55.786  -3.931 -25.146  1.00  0.75           C
ATOM   4593  N   THR A  58     -52.959  -3.338 -28.168  1.00  0.74           N
ATOM   4594  CA  THR A  58     -52.752  -3.831 -29.523  1.00  0.74           C
ATOM   4595  C   THR A  58     -51.313  -3.490 -29.911  1.00  0.74           C
ATOM   4596  O   THR A  58     -50.769  -2.551 -29.327  1.00  0.74           O
ATOM   4597  CB  THR A  58     -53.721  -3.234 -30.527  1.00  0.74           C
ATOM   4598  OG1 THR A  58     -53.696  -1.814 -30.468  1.00  0.74           O
ATOM   4599  CG2 THR A  58     -55.145  -3.678 -30.167  1.00  0.74           C
ATOM   4600  N   PRO A  59     -50.573  -4.203 -30.771  1.00  0.79           N
ATOM   4601  CA  PRO A  59     -49.189  -3.854 -31.072  1.00  0.79           C
ATOM   4602  C   PRO A  59     -48.995  -2.471 -31.679  1.00  0.79           C
ATOM   4603  O   PRO A  59     -49.509  -2.204 -32.763  1.00  0.79           O
ATOM   4604  CB  PRO A  59     -48.726  -4.969 -32.017  1.00  0.79           C
ATOM   4605  CG  PRO A  59     -49.993  -5.346 -32.775  1.00  0.79           C
ATOM   4606  CD  PRO A  59     -51.070  -5.231 -31.690  1.00  0.79           C
ATOM   4607  N   GLU A  60     -48.191  -1.618 -31.024  1.00  0.75           N
ATOM   4608  CA  GLU A  60     -47.866  -0.288 -31.493  1.00  0.75           C
ATOM   4609  C   GLU A  60     -46.358  -0.126 -31.464  1.00  0.75           C
ATOM   4610  O   GLU A  60     -45.751  -0.197 -30.400  1.00  0.75           O
ATOM   4611  CB  GLU A  60     -48.430   0.781 -30.535  1.00  0.75           C
ATOM   4612  CG  GLU A  60     -49.950   0.720 -30.275  1.00  0.75           C
ATOM   4613  CD  GLU A  60     -50.745   1.611 -31.220  1.00  0.75           C
ATOM   4614  OE1 GLU A  60     -50.287   1.858 -32.364  1.00  0.75           O
ATOM   4615  OE2 GLU A  60     -51.806   2.099 -30.756  1.00  0.75           O
ATOM   4616  N   ALA A  61     -45.686   0.078 -32.609  1.00  0.78           N
ATOM   4617  CA  ALA A  61     -44.236   0.097 -32.635  1.00  0.78           C
ATOM   4618  C   ALA A  61     -43.692   1.321 -33.318  1.00  0.78           C
ATOM   4619  O   ALA A  61     -44.224   1.772 -34.325  1.00  0.78           O
ATOM   4620  CB  ALA A  61     -43.679  -1.145 -33.355  1.00  0.78           C
ATOM   4621  N   ASN A  62     -42.575   1.877 -32.815  1.00  0.79           N
ATOM   4622  CA  ASN A  62     -41.825   2.875 -33.555  1.00  0.79           C
ATOM   4623  C   ASN A  62     -41.003   2.181 -34.633  1.00  0.79           C
ATOM   4624  O   ASN A  62     -40.877   0.961 -34.634  1.00  0.79           O
ATOM   4625  CB  ASN A  62     -40.840   3.678 -32.670  1.00  0.79           C
ATOM   4626  CG  ASN A  62     -41.532   4.511 -31.602  1.00  0.79           C
ATOM   4627  OD1 ASN A  62     -42.752   4.605 -31.468  1.00  0.79           O
ATOM   4628  ND2 ASN A  62     -40.683   5.170 -30.785  1.00  0.79           N
ATOM   4629  N   MET A  63     -40.378   2.927 -35.563  1.00  0.77           N
ATOM   4630  CA  MET A  63     -39.459   2.337 -36.527  1.00  0.77           C
ATOM   4631  C   MET A  63     -38.252   1.659 -35.867  1.00  0.77           C
ATOM   4632  O   MET A  63     -37.791   0.608 -36.300  1.00  0.77           O
ATOM   4633  CB  MET A  63     -39.065   3.375 -37.611  1.00  0.77           C
ATOM   4634  CG  MET A  63     -40.171   3.575 -38.677  1.00  0.77           C
ATOM   4635  SD  MET A  63     -40.416   2.135 -39.772  1.00  0.77           S
ATOM   4636  CE  MET A  63     -41.684   2.841 -40.866  1.00  0.77           C
ATOM   4637  N   ASP A  64     -37.754   2.229 -34.760  1.00  0.76           N
ATOM   4638  CA  ASP A  64     -36.609   1.802 -33.990  1.00  0.76           C
ATOM   4639  C   ASP A  64     -36.926   0.644 -33.041  1.00  0.76           C
ATOM   4640  O   ASP A  64     -36.037   0.064 -32.413  1.00  0.76           O
ATOM   4641  CB  ASP A  64     -36.087   3.005 -33.139  1.00  0.76           C
ATOM   4642  CG  ASP A  64     -36.418   4.361 -33.755  1.00  0.76           C
ATOM   4643  OD1 ASP A  64     -35.490   5.048 -34.238  1.00  0.76           O
ATOM   4644  OD2 ASP A  64     -37.633   4.709 -33.739  1.00  0.76           O
ATOM   4645  N   GLN A  65     -38.212   0.293 -32.868  1.00  0.79           N
ATOM   4646  CA  GLN A  65     -38.658  -0.680 -31.901  1.00  0.79           C
ATOM   4647  C   GLN A  65     -39.278  -1.816 -32.657  1.00  0.79           C
ATOM   4648  O   GLN A  65     -39.873  -1.624 -33.713  1.00  0.79           O
ATOM   4649  CB  GLN A  65     -39.737  -0.141 -30.917  1.00  0.79           C
ATOM   4650  CG  GLN A  65     -39.254   1.064 -30.079  1.00  0.79           C
ATOM   4651  CD  GLN A  65     -40.335   1.774 -29.257  1.00  0.79           C
ATOM   4652  OE1 GLN A  65     -40.075   2.833 -28.687  1.00  0.79           O
ATOM   4653  NE2 GLN A  65     -41.563   1.222 -29.179  1.00  0.79           N
ATOM   4654  N   GLU A  66     -39.188  -3.041 -32.129  1.00  0.78           N
ATOM   4655  CA  GLU A  66     -39.939  -4.133 -32.697  1.00  0.78           C
ATOM   4656  C   GLU A  66     -40.941  -4.621 -31.693  1.00  0.78           C
ATOM   4657  O   GLU A  66     -40.841  -4.372 -30.490  1.00  0.78           O
ATOM   4658  CB  GLU A  66     -39.068  -5.266 -33.255  1.00  0.78           C
ATOM   4659  CG  GLU A  66     -38.040  -4.721 -34.268  1.00  0.78           C
ATOM   4660  CD  GLU A  66     -37.468  -5.818 -35.141  1.00  0.78           C
ATOM   4661  OE1 GLU A  66     -37.293  -6.964 -34.650  1.00  0.78           O
ATOM   4662  OE2 GLU A  66     -37.242  -5.570 -36.347  1.00  0.78           O
ATOM   4663  N   SER A  67     -41.986  -5.283 -32.196  1.00  0.81           N
ATOM   4664  CA  SER A  67     -43.163  -5.586 -31.420  1.00  0.81           C
ATOM   4665  C   SER A  67     -43.284  -7.059 -31.110  1.00  0.81           C
ATOM   4666  O   SER A  67     -43.114  -7.924 -31.969  1.00  0.81           O
ATOM   4667  CB  SER A  67     -44.392  -5.061 -32.178  1.00  0.81           C
ATOM   4668  OG  SER A  67     -45.624  -5.304 -31.516  1.00  0.81           O
ATOM   4669  N   PHE A  68     -43.550  -7.372 -29.829  1.00  0.80           N
ATOM   4670  CA  PHE A  68     -43.609  -8.728 -29.334  1.00  0.80           C
ATOM   4671  C   PHE A  68     -44.920  -8.991 -28.610  1.00  0.80           C
ATOM   4672  O   PHE A  68     -45.522  -8.114 -27.992  1.00  0.80           O
ATOM   4673  CB  PHE A  68     -42.445  -9.016 -28.345  1.00  0.80           C
ATOM   4674  CG  PHE A  68     -41.152  -9.273 -29.072  1.00  0.80           C
ATOM   4675  CD1 PHE A  68     -40.707 -10.592 -29.264  1.00  0.80           C
ATOM   4676  CD2 PHE A  68     -40.359  -8.215 -29.549  1.00  0.80           C
ATOM   4677  CE1 PHE A  68     -39.501 -10.852 -29.925  1.00  0.80           C
ATOM   4678  CE2 PHE A  68     -39.166  -8.472 -30.238  1.00  0.80           C
ATOM   4679  CZ  PHE A  68     -38.735  -9.791 -30.424  1.00  0.80           C
ATOM   4680  N   GLY A  69     -45.388 -10.262 -28.629  1.00  0.81           N
ATOM   4681  CA  GLY A  69     -46.652 -10.634 -27.986  1.00  0.81           C
ATOM   4682  C   GLY A  69     -46.529 -10.718 -26.490  1.00  0.81           C
ATOM   4683  O   GLY A  69     -47.517 -10.803 -25.768  1.00  0.81           O
ATOM   4684  N   GLY A  70     -45.286 -10.623 -25.981  1.00  0.67           N
ATOM   4685  CA  GLY A  70     -44.949 -10.125 -24.652  1.00  0.67           C
ATOM   4686  C   GLY A  70     -45.152 -11.059 -23.507  1.00  0.67           C
ATOM   4687  O   GLY A  70     -44.333 -11.117 -22.598  1.00  0.67           O
ATOM   4688  N   ALA A  71     -46.208 -11.878 -23.526  1.00  0.83           N
ATOM   4689  CA  ALA A  71     -46.480 -12.896 -22.532  1.00  0.83           C
ATOM   4690  C   ALA A  71     -45.372 -13.943 -22.512  1.00  0.83           C
ATOM   4691  O   ALA A  71     -45.041 -14.532 -21.485  1.00  0.83           O
ATOM   4692  CB  ALA A  71     -47.849 -13.518 -22.845  1.00  0.83           C
ATOM   4693  N   SER A  72     -44.725 -14.108 -23.678  1.00  0.79           N
ATOM   4694  CA  SER A  72     -43.545 -14.905 -23.917  1.00  0.79           C
ATOM   4695  C   SER A  72     -42.256 -14.280 -23.442  1.00  0.79           C
ATOM   4696  O   SER A  72     -41.237 -14.966 -23.327  1.00  0.79           O
ATOM   4697  CB  SER A  72     -43.322 -15.083 -25.437  1.00  0.79           C
ATOM   4698  OG  SER A  72     -43.310 -13.813 -26.101  1.00  0.79           O
ATOM   4699  N   CYS A  73     -42.272 -12.954 -23.219  1.00  0.88           N
ATOM   4700  CA  CYS A  73     -41.117 -12.167 -22.839  1.00  0.88           C
ATOM   4701  C   CYS A  73     -41.180 -11.803 -21.378  1.00  0.88           C
ATOM   4702  O   CYS A  73     -40.241 -11.251 -20.813  1.00  0.88           O
ATOM   4703  CB  CYS A  73     -41.003 -10.855 -23.651  1.00  0.88           C
ATOM   4704  SG  CYS A  73     -40.990 -11.188 -25.443  1.00  0.88           S
ATOM   4705  N   CYS A  74     -42.277 -12.157 -20.698  1.00  0.88           N
ATOM   4706  CA  CYS A  74     -42.331 -12.239 -19.257  1.00  0.88           C
ATOM   4707  C   CYS A  74     -41.745 -13.574 -18.849  1.00  0.88           C
ATOM   4708  O   CYS A  74     -42.302 -14.630 -19.137  1.00  0.88           O
ATOM   4709  CB  CYS A  74     -43.792 -12.164 -18.729  1.00  0.88           C
ATOM   4710  SG  CYS A  74     -43.944 -12.493 -16.916  1.00  0.88           S
ATOM   4711  N   LEU A  75     -40.618 -13.556 -18.117  1.00  0.91           N
ATOM   4712  CA  LEU A  75     -39.911 -14.748 -17.697  1.00  0.91           C
ATOM   4713  C   LEU A  75     -40.748 -15.697 -16.863  1.00  0.91           C
ATOM   4714  O   LEU A  75     -40.736 -16.908 -17.043  1.00  0.91           O
ATOM   4715  CB  LEU A  75     -38.709 -14.310 -16.838  1.00  0.91           C
ATOM   4716  CG  LEU A  75     -37.775 -15.452 -16.400  1.00  0.91           C
ATOM   4717  CD1 LEU A  75     -37.053 -16.073 -17.602  1.00  0.91           C
ATOM   4718  CD2 LEU A  75     -36.755 -14.929 -15.386  1.00  0.91           C
ATOM   4719  N   TYR A  76     -41.524 -15.141 -15.925  1.00  0.85           N
ATOM   4720  CA  TYR A  76     -42.350 -15.881 -14.992  1.00  0.85           C
ATOM   4721  C   TYR A  76     -43.485 -16.651 -15.682  1.00  0.85           C
ATOM   4722  O   TYR A  76     -43.725 -17.820 -15.397  1.00  0.85           O
ATOM   4723  CB  TYR A  76     -42.849 -14.962 -13.842  1.00  0.85           C
ATOM   4724  CG  TYR A  76     -41.682 -14.255 -13.170  1.00  0.85           C
ATOM   4725  CD1 TYR A  76     -41.119 -13.110 -13.759  1.00  0.85           C
ATOM   4726  CD2 TYR A  76     -41.139 -14.701 -11.950  1.00  0.85           C
ATOM   4727  CE1 TYR A  76     -40.045 -12.444 -13.164  1.00  0.85           C
ATOM   4728  CE2 TYR A  76     -40.034 -14.059 -11.368  1.00  0.85           C
ATOM   4729  CZ  TYR A  76     -39.498 -12.921 -11.974  1.00  0.85           C
ATOM   4730  OH  TYR A  76     -38.463 -12.197 -11.361  1.00  0.85           O
ATOM   4731  N   CYS A  77     -44.163 -16.026 -16.674  1.00  0.79           N
ATOM   4732  CA  CYS A  77     -45.103 -16.690 -17.575  1.00  0.79           C
ATOM   4733  C   CYS A  77     -44.467 -17.695 -18.505  1.00  0.79           C
ATOM   4734  O   CYS A  77     -45.087 -18.665 -18.910  1.00  0.79           O
ATOM   4735  CB  CYS A  77     -45.832 -15.680 -18.488  1.00  0.79           C
ATOM   4736  SG  CYS A  77     -47.108 -14.794 -17.558  1.00  0.79           S
ATOM   4737  N   ARG A  78     -43.224 -17.427 -18.928  1.00  0.71           N
ATOM   4738  CA  ARG A  78     -42.491 -18.290 -19.821  1.00  0.71           C
ATOM   4739  C   ARG A  78     -42.007 -19.575 -19.160  1.00  0.71           C
ATOM   4740  O   ARG A  78     -42.046 -20.647 -19.756  1.00  0.71           O
ATOM   4741  CB  ARG A  78     -41.317 -17.503 -20.459  1.00  0.71           C
ATOM   4742  CG  ARG A  78     -40.624 -18.241 -21.621  1.00  0.71           C
ATOM   4743  CD  ARG A  78     -41.595 -18.571 -22.758  1.00  0.71           C
ATOM   4744  NE  ARG A  78     -40.843 -19.183 -23.884  1.00  0.71           N
ATOM   4745  CZ  ARG A  78     -40.205 -18.517 -24.848  1.00  0.71           C
ATOM   4746  NH1 ARG A  78     -40.113 -17.198 -24.881  1.00  0.71           N
ATOM   4747  NH2 ARG A  78     -39.610 -19.241 -25.789  1.00  0.71           N
ATOM   4748  N   CYS A  79     -41.539 -19.480 -17.898  1.00  0.78           N
ATOM   4749  CA  CYS A  79     -40.958 -20.583 -17.143  1.00  0.78           C
ATOM   4750  C   CYS A  79     -41.949 -21.265 -16.226  1.00  0.78           C
ATOM   4751  O   CYS A  79     -41.606 -22.202 -15.501  1.00  0.78           O
ATOM   4752  CB  CYS A  79     -39.804 -20.079 -16.238  1.00  0.78           C
ATOM   4753  SG  CYS A  79     -38.394 -19.493 -17.232  1.00  0.78           S
ATOM   4754  N   HIS A  80     -43.205 -20.810 -16.244  1.00  0.72           N
ATOM   4755  CA  HIS A  80     -44.306 -21.386 -15.505  1.00  0.72           C
ATOM   4756  C   HIS A  80     -44.127 -21.369 -14.001  1.00  0.72           C
ATOM   4757  O   HIS A  80     -44.192 -22.398 -13.328  1.00  0.72           O
ATOM   4758  CB  HIS A  80     -44.751 -22.770 -16.045  1.00  0.72           C
ATOM   4759  CG  HIS A  80     -44.957 -22.763 -17.534  1.00  0.72           C
ATOM   4760  ND1 HIS A  80     -45.438 -21.602 -18.091  1.00  0.72           N
ATOM   4761  CD2 HIS A  80     -44.846 -23.725 -18.487  1.00  0.72           C
ATOM   4762  CE1 HIS A  80     -45.615 -21.865 -19.363  1.00  0.72           C
ATOM   4763  NE2 HIS A  80     -45.272 -23.139 -19.662  1.00  0.72           N
ATOM   4764  N   ILE A  81     -43.870 -20.173 -13.437  1.00  0.75           N
ATOM   4765  CA  ILE A  81     -43.578 -19.996 -12.023  1.00  0.75           C
ATOM   4766  C   ILE A  81     -44.285 -18.767 -11.491  1.00  0.75           C
ATOM   4767  O   ILE A  81     -44.647 -17.877 -12.260  1.00  0.75           O
ATOM   4768  CB  ILE A  81     -42.081 -19.818 -11.772  1.00  0.75           C
ATOM   4769  CG1 ILE A  81     -41.568 -18.527 -12.455  1.00  0.75           C
ATOM   4770  CG2 ILE A  81     -41.343 -21.073 -12.282  1.00  0.75           C
ATOM   4771  CD1 ILE A  81     -40.053 -18.448 -12.607  1.00  0.75           C
ATOM   4772  N   ASP A  82     -44.480 -18.684 -10.158  1.00  0.75           N
ATOM   4773  CA  ASP A  82     -45.154 -17.583  -9.494  1.00  0.75           C
ATOM   4774  C   ASP A  82     -44.597 -16.184  -9.825  1.00  0.75           C
ATOM   4775  O   ASP A  82     -43.392 -15.975  -9.977  1.00  0.75           O
ATOM   4776  CB  ASP A  82     -45.185 -17.806  -7.952  1.00  0.75           C
ATOM   4777  CG  ASP A  82     -45.600 -19.237  -7.630  1.00  0.75           C
ATOM   4778  OD1 ASP A  82     -46.634 -19.680  -8.179  1.00  0.75           O
ATOM   4779  OD2 ASP A  82     -44.844 -19.929  -6.895  1.00  0.75           O
ATOM   4780  N   HIS A  83     -45.484 -15.185 -10.000  1.00  0.75           N
ATOM   4781  CA  HIS A  83     -45.137 -13.830 -10.402  1.00  0.75           C
ATOM   4782  C   HIS A  83     -44.531 -12.946  -9.314  1.00  0.75           C
ATOM   4783  O   HIS A  83     -44.746 -13.192  -8.133  1.00  0.75           O
ATOM   4784  CB  HIS A  83     -46.348 -13.122 -11.053  1.00  0.75           C
ATOM   4785  CG  HIS A  83     -46.611 -13.734 -12.387  1.00  0.75           C
ATOM   4786  ND1 HIS A  83     -47.386 -14.871 -12.479  1.00  0.75           N
ATOM   4787  CD2 HIS A  83     -45.969 -13.504 -13.560  1.00  0.75           C
ATOM   4788  CE1 HIS A  83     -47.197 -15.320 -13.699  1.00  0.75           C
ATOM   4789  NE2 HIS A  83     -46.347 -14.530 -14.397  1.00  0.75           N
ATOM   4790  N   PRO A  84     -43.765 -11.884  -9.640  1.00  0.78           N
ATOM   4791  CA  PRO A  84     -43.195 -10.992  -8.629  1.00  0.78           C
ATOM   4792  C   PRO A  84     -44.239 -10.242  -7.833  1.00  0.78           C
ATOM   4793  O   PRO A  84     -43.983  -9.855  -6.697  1.00  0.78           O
ATOM   4794  CB  PRO A  84     -42.304 -10.022  -9.427  1.00  0.78           C
ATOM   4795  CG  PRO A  84     -41.921 -10.814 -10.674  1.00  0.78           C
ATOM   4796  CD  PRO A  84     -43.177 -11.635 -10.960  1.00  0.78           C
ATOM   4797  N   ASN A  85     -45.410  -9.970  -8.435  1.00  0.72           N
ATOM   4798  CA  ASN A  85     -46.541  -9.396  -7.746  1.00  0.72           C
ATOM   4799  C   ASN A  85     -47.070 -10.324  -6.638  1.00  0.72           C
ATOM   4800  O   ASN A  85     -47.186 -11.524  -6.882  1.00  0.72           O
ATOM   4801  CB  ASN A  85     -47.623  -9.073  -8.807  1.00  0.72           C
ATOM   4802  CG  ASN A  85     -48.865  -8.435  -8.207  1.00  0.72           C
ATOM   4803  OD1 ASN A  85     -49.692  -9.101  -7.579  1.00  0.72           O
ATOM   4804  ND2 ASN A  85     -48.990  -7.102  -8.370  1.00  0.72           N
ATOM   4805  N   PRO A  86     -47.432  -9.853  -5.435  1.00  0.75           N
ATOM   4806  CA  PRO A  86     -47.655 -10.750  -4.308  1.00  0.75           C
ATOM   4807  C   PRO A  86     -48.922 -11.562  -4.423  1.00  0.75           C
ATOM   4808  O   PRO A  86     -49.043 -12.575  -3.736  1.00  0.75           O
ATOM   4809  CB  PRO A  86     -47.737  -9.814  -3.088  1.00  0.75           C
ATOM   4810  CG  PRO A  86     -48.107  -8.455  -3.683  1.00  0.75           C
ATOM   4811  CD  PRO A  86     -47.307  -8.465  -4.981  1.00  0.75           C
ATOM   4812  N   LYS A  87     -49.895 -11.139  -5.241  1.00  0.73           N
ATOM   4813  CA  LYS A  87     -51.115 -11.892  -5.400  1.00  0.73           C
ATOM   4814  C   LYS A  87     -51.856 -11.468  -6.653  1.00  0.73           C
ATOM   4815  O   LYS A  87     -52.569 -10.469  -6.685  1.00  0.73           O
ATOM   4816  CB  LYS A  87     -52.076 -11.715  -4.193  1.00  0.73           C
ATOM   4817  CG  LYS A  87     -53.503 -12.278  -4.377  1.00  0.73           C
ATOM   4818  CD  LYS A  87     -53.589 -13.781  -4.696  1.00  0.73           C
ATOM   4819  CE  LYS A  87     -54.823 -14.170  -5.525  1.00  0.73           C
ATOM   4820  NZ  LYS A  87     -56.052 -13.512  -5.020  1.00  0.73           N
ATOM   4821  N   GLY A  88     -51.786 -12.227  -7.748  1.00  0.69           N
ATOM   4822  CA  GLY A  88     -50.762 -13.226  -8.058  1.00  0.69           C
ATOM   4823  C   GLY A  88     -50.548 -13.142  -9.530  1.00  0.69           C
ATOM   4824  O   GLY A  88     -50.270 -14.132 -10.199  1.00  0.69           O
ATOM   4825  N   PHE A  89     -50.816 -11.948 -10.079  1.00  0.64           N
ATOM   4826  CA  PHE A  89     -51.134 -11.736 -11.476  1.00  0.64           C
ATOM   4827  C   PHE A  89     -49.999 -11.061 -12.210  1.00  0.64           C
ATOM   4828  O   PHE A  89     -49.074 -10.514 -11.614  1.00  0.64           O
ATOM   4829  CB  PHE A  89     -52.433 -10.890 -11.677  1.00  0.64           C
ATOM   4830  CG  PHE A  89     -53.689 -11.465 -11.058  1.00  0.64           C
ATOM   4831  CD1 PHE A  89     -53.804 -12.796 -10.613  1.00  0.64           C
ATOM   4832  CD2 PHE A  89     -54.824 -10.638 -10.975  1.00  0.64           C
ATOM   4833  CE1 PHE A  89     -55.003 -13.279 -10.077  1.00  0.64           C
ATOM   4834  CE2 PHE A  89     -56.025 -11.114 -10.434  1.00  0.64           C
ATOM   4835  CZ  PHE A  89     -56.115 -12.436  -9.984  1.00  0.64           C
ATOM   4836  N   CYS A  90     -50.054 -11.122 -13.552  1.00  0.74           N
ATOM   4837  CA  CYS A  90     -48.980 -10.696 -14.424  1.00  0.74           C
ATOM   4838  C   CYS A  90     -49.350  -9.532 -15.324  1.00  0.74           C
ATOM   4839  O   CYS A  90     -50.368  -9.555 -16.015  1.00  0.74           O
ATOM   4840  CB  CYS A  90     -48.599 -11.872 -15.355  1.00  0.74           C
ATOM   4841  SG  CYS A  90     -47.245 -11.488 -16.529  1.00  0.74           S
ATOM   4842  N   ASP A  91     -48.465  -8.524 -15.397  1.00  0.77           N
ATOM   4843  CA  ASP A  91     -48.585  -7.332 -16.215  1.00  0.77           C
ATOM   4844  C   ASP A  91     -48.662  -7.578 -17.720  1.00  0.77           C
ATOM   4845  O   ASP A  91     -49.453  -6.966 -18.439  1.00  0.77           O
ATOM   4846  CB  ASP A  91     -47.350  -6.430 -15.967  1.00  0.77           C
ATOM   4847  CG  ASP A  91     -47.035  -6.422 -14.482  1.00  0.77           C
ATOM   4848  OD1 ASP A  91     -47.794  -5.796 -13.709  1.00  0.77           O
ATOM   4849  OD2 ASP A  91     -46.079  -7.150 -14.108  1.00  0.77           O
ATOM   4850  N   LEU A  92     -47.813  -8.496 -18.234  1.00  0.80           N
ATOM   4851  CA  LEU A  92     -47.594  -8.670 -19.663  1.00  0.80           C
ATOM   4852  C   LEU A  92     -48.441  -9.764 -20.276  1.00  0.80           C
ATOM   4853  O   LEU A  92     -48.321 -10.077 -21.459  1.00  0.80           O
ATOM   4854  CB  LEU A  92     -46.126  -9.052 -19.996  1.00  0.80           C
ATOM   4855  CG  LEU A  92     -45.035  -8.006 -19.697  1.00  0.80           C
ATOM   4856  CD1 LEU A  92     -43.866  -8.226 -20.673  1.00  0.80           C
ATOM   4857  CD2 LEU A  92     -45.546  -6.560 -19.784  1.00  0.80           C
ATOM   4858  N   LYS A  93     -49.346 -10.390 -19.511  1.00  0.67           N
ATOM   4859  CA  LYS A  93     -50.256 -11.349 -20.095  1.00  0.67           C
ATOM   4860  C   LYS A  93     -51.538 -10.627 -20.472  1.00  0.67           C
ATOM   4861  O   LYS A  93     -52.199  -9.987 -19.659  1.00  0.67           O
ATOM   4862  CB  LYS A  93     -50.512 -12.580 -19.185  1.00  0.67           C
ATOM   4863  CG  LYS A  93     -49.975 -13.904 -19.769  1.00  0.67           C
ATOM   4864  CD  LYS A  93     -50.465 -15.175 -19.034  1.00  0.67           C
ATOM   4865  CE  LYS A  93     -50.511 -16.426 -19.927  1.00  0.67           C
ATOM   4866  NZ  LYS A  93     -51.197 -17.600 -19.338  1.00  0.67           N
ATOM   4867  N   GLY A  94     -51.918 -10.691 -21.763  1.00  0.74           N
ATOM   4868  CA  GLY A  94     -53.059  -9.946 -22.258  1.00  0.74           C
ATOM   4869  C   GLY A  94     -52.710  -8.597 -22.842  1.00  0.74           C
ATOM   4870  O   GLY A  94     -53.629  -7.838 -23.160  1.00  0.74           O
ATOM   4871  N   LYS A  95     -51.408  -8.282 -23.010  1.00  0.69           N
ATOM   4872  CA  LYS A  95     -50.899  -7.029 -23.550  1.00  0.69           C
ATOM   4873  C   LYS A  95     -49.685  -7.297 -24.438  1.00  0.69           C
ATOM   4874  O   LYS A  95     -49.068  -8.355 -24.349  1.00  0.69           O
ATOM   4875  CB  LYS A  95     -50.437  -6.050 -22.433  1.00  0.69           C
ATOM   4876  CG  LYS A  95     -51.376  -5.933 -21.218  1.00  0.69           C
ATOM   4877  CD  LYS A  95     -52.700  -5.187 -21.458  1.00  0.69           C
ATOM   4878  CE  LYS A  95     -53.679  -5.418 -20.296  1.00  0.69           C
ATOM   4879  NZ  LYS A  95     -54.168  -4.144 -19.719  1.00  0.69           N
ATOM   4880  N   TYR A  96     -49.305  -6.349 -25.314  1.00  0.76           N
ATOM   4881  CA  TYR A  96     -48.120  -6.443 -26.158  1.00  0.76           C
ATOM   4882  C   TYR A  96     -46.963  -5.663 -25.543  1.00  0.76           C
ATOM   4883  O   TYR A  96     -47.177  -4.798 -24.691  1.00  0.76           O
ATOM   4884  CB  TYR A  96     -48.373  -5.880 -27.586  1.00  0.76           C
ATOM   4885  CG  TYR A  96     -49.419  -6.683 -28.307  1.00  0.76           C
ATOM   4886  CD1 TYR A  96     -50.778  -6.358 -28.166  1.00  0.76           C
ATOM   4887  CD2 TYR A  96     -49.075  -7.805 -29.077  1.00  0.76           C
ATOM   4888  CE1 TYR A  96     -51.780  -7.156 -28.741  1.00  0.76           C
ATOM   4889  CE2 TYR A  96     -50.087  -8.565 -29.679  1.00  0.76           C
ATOM   4890  CZ  TYR A  96     -51.429  -8.262 -29.511  1.00  0.76           C
ATOM   4891  OH  TYR A  96     -52.385  -9.194 -29.961  1.00  0.76           O
ATOM   4892  N   VAL A  97     -45.703  -5.950 -25.963  1.00  0.88           N
ATOM   4893  CA  VAL A  97     -44.533  -5.223 -25.475  1.00  0.88           C
ATOM   4894  C   VAL A  97     -43.545  -4.900 -26.581  1.00  0.88           C
ATOM   4895  O   VAL A  97     -43.283  -5.701 -27.476  1.00  0.88           O
ATOM   4896  CB  VAL A  97     -43.841  -5.879 -24.269  1.00  0.88           C
ATOM   4897  CG1 VAL A  97     -42.439  -5.300 -23.974  1.00  0.88           C
ATOM   4898  CG2 VAL A  97     -44.722  -5.649 -23.031  1.00  0.88           C
ATOM   4899  N   GLN A  98     -42.967  -3.678 -26.556  1.00  0.80           N
ATOM   4900  CA  GLN A  98     -42.036  -3.233 -27.570  1.00  0.80           C
ATOM   4901  C   GLN A  98     -40.628  -3.169 -27.013  1.00  0.80           C
ATOM   4902  O   GLN A  98     -40.426  -2.839 -25.845  1.00  0.80           O
ATOM   4903  CB  GLN A  98     -42.402  -1.844 -28.146  1.00  0.80           C
ATOM   4904  CG  GLN A  98     -43.907  -1.478 -28.111  1.00  0.80           C
ATOM   4905  CD  GLN A  98     -44.842  -2.439 -28.849  1.00  0.80           C
ATOM   4906  OE1 GLN A  98     -44.616  -2.902 -29.976  1.00  0.80           O
ATOM   4907  NE2 GLN A  98     -45.956  -2.793 -28.178  1.00  0.80           N
ATOM   4908  N   ILE A  99     -39.608  -3.483 -27.833  1.00  0.86           N
ATOM   4909  CA  ILE A  99     -38.217  -3.386 -27.418  1.00  0.86           C
ATOM   4910  C   ILE A  99     -37.425  -2.773 -28.570  1.00  0.86           C
ATOM   4911  O   ILE A  99     -37.669  -3.169 -29.712  1.00  0.86           O
ATOM   4912  CB  ILE A  99     -37.621  -4.743 -27.027  1.00  0.86           C
ATOM   4913  CG1 ILE A  99     -38.267  -5.300 -25.738  1.00  0.86           C
ATOM   4914  CG2 ILE A  99     -36.093  -4.650 -26.829  1.00  0.86           C
ATOM   4915  CD1 ILE A  99     -39.452  -6.234 -26.005  1.00  0.86           C
ATOM   4916  N   PRO A 100     -36.500  -1.811 -28.380  1.00  0.82           N
ATOM   4917  CA  PRO A 100     -35.495  -1.426 -29.378  1.00  0.82           C
ATOM   4918  C   PRO A 100     -34.843  -2.572 -30.135  1.00  0.82           C
ATOM   4919  O   PRO A 100     -34.390  -3.516 -29.500  1.00  0.82           O
ATOM   4920  CB  PRO A 100     -34.449  -0.646 -28.568  1.00  0.82           C
ATOM   4921  CG  PRO A 100     -35.242  -0.023 -27.418  1.00  0.82           C
ATOM   4922  CD  PRO A 100     -36.353  -1.037 -27.140  1.00  0.82           C
ATOM   4923  N   THR A 101     -34.725  -2.503 -31.476  1.00  0.80           N
ATOM   4924  CA  THR A 101     -34.321  -3.643 -32.314  1.00  0.80           C
ATOM   4925  C   THR A 101     -32.991  -4.285 -31.933  1.00  0.80           C
ATOM   4926  O   THR A 101     -32.833  -5.502 -31.922  1.00  0.80           O
ATOM   4927  CB  THR A 101     -34.229  -3.273 -33.792  1.00  0.80           C
ATOM   4928  OG1 THR A 101     -35.408  -2.622 -34.221  1.00  0.80           O
ATOM   4929  CG2 THR A 101     -34.084  -4.518 -34.674  1.00  0.80           C
ATOM   4930  N   THR A 102     -31.990  -3.471 -31.552  1.00  0.76           N
ATOM   4931  CA  THR A 102     -30.680  -3.911 -31.074  1.00  0.76           C
ATOM   4932  C   THR A 102     -30.720  -4.758 -29.815  1.00  0.76           C
ATOM   4933  O   THR A 102     -29.933  -5.685 -29.644  1.00  0.76           O
ATOM   4934  CB  THR A 102     -29.757  -2.737 -30.766  1.00  0.76           C
ATOM   4935  OG1 THR A 102     -30.449  -1.727 -30.038  1.00  0.76           O
ATOM   4936  CG2 THR A 102     -29.272  -2.097 -32.073  1.00  0.76           C
ATOM   4937  N   CYS A 103     -31.643  -4.441 -28.888  1.00  0.86           N
ATOM   4938  CA  CYS A 103     -31.726  -5.072 -27.588  1.00  0.86           C
ATOM   4939  C   CYS A 103     -32.820  -6.122 -27.569  1.00  0.86           C
ATOM   4940  O   CYS A 103     -33.077  -6.774 -26.564  1.00  0.86           O
ATOM   4941  CB  CYS A 103     -31.935  -4.001 -26.488  1.00  0.86           C
ATOM   4942  SG  CYS A 103     -31.051  -4.424 -24.939  1.00  0.86           S
ATOM   4943  N   ALA A 104     -33.441  -6.373 -28.739  1.00  0.89           N
ATOM   4944  CA  ALA A 104     -34.523  -7.318 -28.905  1.00  0.89           C
ATOM   4945  C   ALA A 104     -34.000  -8.707 -29.248  1.00  0.89           C
ATOM   4946  O   ALA A 104     -34.753  -9.632 -29.535  1.00  0.89           O
ATOM   4947  CB  ALA A 104     -35.477  -6.801 -29.999  1.00  0.89           C
ATOM   4948  N   ASN A 105     -32.665  -8.883 -29.149  1.00  0.83           N
ATOM   4949  CA  ASN A 105     -31.984 -10.163 -29.107  1.00  0.83           C
ATOM   4950  C   ASN A 105     -32.365 -10.935 -27.839  1.00  0.83           C
ATOM   4951  O   ASN A 105     -32.622 -12.133 -27.872  1.00  0.83           O
ATOM   4952  CB  ASN A 105     -30.454  -9.913 -29.163  1.00  0.83           C
ATOM   4953  CG  ASN A 105     -29.684 -11.179 -29.521  1.00  0.83           C
ATOM   4954  OD1 ASN A 105     -30.192 -12.121 -30.126  1.00  0.83           O
ATOM   4955  ND2 ASN A 105     -28.383 -11.198 -29.153  1.00  0.83           N
ATOM   4956  N   ASP A 106     -32.456 -10.220 -26.693  1.00  0.88           N
ATOM   4957  CA  ASP A 106     -33.011 -10.749 -25.460  1.00  0.88           C
ATOM   4958  C   ASP A 106     -34.190  -9.885 -25.001  1.00  0.88           C
ATOM   4959  O   ASP A 106     -34.007  -8.924 -24.251  1.00  0.88           O
ATOM   4960  CB  ASP A 106     -31.938 -10.745 -24.344  1.00  0.88           C
ATOM   4961  CG  ASP A 106     -32.504 -11.292 -23.036  1.00  0.88           C
ATOM   4962  OD1 ASP A 106     -32.142 -10.743 -21.973  1.00  0.88           O
ATOM   4963  OD2 ASP A 106     -33.368 -12.213 -23.053  1.00  0.88           O
ATOM   4964  N   PRO A 107     -35.432 -10.200 -25.348  1.00  0.92           N
ATOM   4965  CA  PRO A 107     -36.536  -9.357 -24.918  1.00  0.92           C
ATOM   4966  C   PRO A 107     -36.920  -9.716 -23.517  1.00  0.92           C
ATOM   4967  O   PRO A 107     -37.579  -8.931 -22.841  1.00  0.92           O
ATOM   4968  CB  PRO A 107     -37.679  -9.707 -25.881  1.00  0.92           C
ATOM   4969  CG  PRO A 107     -36.979 -10.265 -27.116  1.00  0.92           C
ATOM   4970  CD  PRO A 107     -35.777 -10.996 -26.528  1.00  0.92           C
ATOM   4971  N   VAL A 108     -36.580 -10.934 -23.082  1.00  0.93           N
ATOM   4972  CA  VAL A 108     -36.985 -11.444 -21.799  1.00  0.93           C
ATOM   4973  C   VAL A 108     -36.254 -10.745 -20.668  1.00  0.93           C
ATOM   4974  O   VAL A 108     -36.866 -10.304 -19.701  1.00  0.93           O
ATOM   4975  CB  VAL A 108     -36.851 -12.955 -21.723  1.00  0.93           C
ATOM   4976  CG1 VAL A 108     -37.775 -13.495 -20.616  1.00  0.93           C
ATOM   4977  CG2 VAL A 108     -37.271 -13.563 -23.077  1.00  0.93           C
ATOM   4978  N   GLY A 109     -34.924 -10.534 -20.764  1.00  0.90           N
ATOM   4979  CA  GLY A 109     -34.214  -9.776 -19.740  1.00  0.90           C
ATOM   4980  C   GLY A 109     -34.471  -8.303 -19.803  1.00  0.90           C
ATOM   4981  O   GLY A 109     -34.319  -7.604 -18.813  1.00  0.90           O
ATOM   4982  N   PHE A 110     -34.920  -7.791 -20.963  1.00  0.87           N
ATOM   4983  CA  PHE A 110     -35.366  -6.421 -21.111  1.00  0.87           C
ATOM   4984  C   PHE A 110     -36.608  -6.121 -20.284  1.00  0.87           C
ATOM   4985  O   PHE A 110     -36.701  -5.077 -19.644  1.00  0.87           O
ATOM   4986  CB  PHE A 110     -35.596  -6.117 -22.612  1.00  0.87           C
ATOM   4987  CG  PHE A 110     -35.493  -4.645 -22.915  1.00  0.87           C
ATOM   4988  CD1 PHE A 110     -36.486  -3.743 -22.500  1.00  0.87           C
ATOM   4989  CD2 PHE A 110     -34.408  -4.152 -23.656  1.00  0.87           C
ATOM   4990  CE1 PHE A 110     -36.407  -2.387 -22.833  1.00  0.87           C
ATOM   4991  CE2 PHE A 110     -34.323  -2.794 -23.988  1.00  0.87           C
ATOM   4992  CZ  PHE A 110     -35.331  -1.913 -23.586  1.00  0.87           C
ATOM   4993  N   THR A 111     -37.589  -7.052 -20.247  1.00  0.87           N
ATOM   4994  CA  THR A 111     -38.787  -6.892 -19.427  1.00  0.87           C
ATOM   4995  C   THR A 111     -38.493  -6.820 -17.936  1.00  0.87           C
ATOM   4996  O   THR A 111     -39.106  -6.055 -17.203  1.00  0.87           O
ATOM   4997  CB  THR A 111     -39.876  -7.946 -19.641  1.00  0.87           C
ATOM   4998  OG1 THR A 111     -39.498  -9.228 -19.157  1.00  0.87           O
ATOM   4999  CG2 THR A 111     -40.299  -8.067 -21.114  1.00  0.87           C
ATOM   5000  N   LEU A 112     -37.547  -7.652 -17.463  1.00  0.87           N
ATOM   5001  CA  LEU A 112     -37.025  -7.639 -16.112  1.00  0.87           C
ATOM   5002  C   LEU A 112     -36.100  -6.479 -15.752  1.00  0.87           C
ATOM   5003  O   LEU A 112     -36.082  -6.009 -14.620  1.00  0.87           O
ATOM   5004  CB  LEU A 112     -36.295  -8.977 -15.839  1.00  0.87           C
ATOM   5005  CG  LEU A 112     -37.114  -9.989 -15.018  1.00  0.87           C
ATOM   5006  CD1 LEU A 112     -36.385 -11.338 -15.016  1.00  0.87           C
ATOM   5007  CD2 LEU A 112     -37.345  -9.499 -13.579  1.00  0.87           C
ATOM   5008  N   LYS A 113     -35.228  -6.041 -16.677  1.00  0.85           N
ATOM   5009  CA  LYS A 113     -34.233  -5.019 -16.414  1.00  0.85           C
ATOM   5010  C   LYS A 113     -34.789  -3.623 -16.205  1.00  0.85           C
ATOM   5011  O   LYS A 113     -34.282  -2.857 -15.387  1.00  0.85           O
ATOM   5012  CB  LYS A 113     -33.201  -5.017 -17.565  1.00  0.85           C
ATOM   5013  CG  LYS A 113     -32.026  -4.051 -17.396  1.00  0.85           C
ATOM   5014  CD  LYS A 113     -31.061  -4.123 -18.584  1.00  0.85           C
ATOM   5015  CE  LYS A 113     -29.978  -3.056 -18.467  1.00  0.85           C
ATOM   5016  NZ  LYS A 113     -29.077  -3.113 -19.633  1.00  0.85           N
ATOM   5017  N   ASN A 114     -35.826  -3.255 -16.968  1.00  0.85           N
ATOM   5018  CA  ASN A 114     -36.308  -1.900 -17.038  1.00  0.85           C
ATOM   5019  C   ASN A 114     -37.751  -1.884 -16.576  1.00  0.85           C
ATOM   5020  O   ASN A 114     -38.509  -2.810 -16.845  1.00  0.85           O
ATOM   5021  CB  ASN A 114     -36.212  -1.363 -18.494  1.00  0.85           C
ATOM   5022  CG  ASN A 114     -34.760  -1.264 -18.957  1.00  0.85           C
ATOM   5023  OD1 ASN A 114     -34.106  -2.216 -19.389  1.00  0.85           O
ATOM   5024  ND2 ASN A 114     -34.198  -0.034 -18.897  1.00  0.85           N
ATOM   5025  N   THR A 115     -38.188  -0.817 -15.878  1.00  0.80           N
ATOM   5026  CA  THR A 115     -39.579  -0.676 -15.452  1.00  0.80           C
ATOM   5027  C   THR A 115     -40.160   0.566 -16.100  1.00  0.80           C
ATOM   5028  O   THR A 115     -39.520   1.617 -16.165  1.00  0.80           O
ATOM   5029  CB  THR A 115     -39.765  -0.583 -13.940  1.00  0.80           C
ATOM   5030  OG1 THR A 115     -39.056  -1.637 -13.309  1.00  0.80           O
ATOM   5031  CG2 THR A 115     -41.237  -0.757 -13.541  1.00  0.80           C
ATOM   5032  N   VAL A 116     -41.384   0.482 -16.663  1.00  0.86           N
ATOM   5033  CA  VAL A 116     -42.078   1.625 -17.246  1.00  0.86           C
ATOM   5034  C   VAL A 116     -42.458   2.684 -16.229  1.00  0.86           C
ATOM   5035  O   VAL A 116     -42.673   2.382 -15.057  1.00  0.86           O
ATOM   5036  CB  VAL A 116     -43.320   1.253 -18.038  1.00  0.86           C
ATOM   5037  CG1 VAL A 116     -42.927   0.237 -19.117  1.00  0.86           C
ATOM   5038  CG2 VAL A 116     -44.428   0.700 -17.119  1.00  0.86           C
ATOM   5039  N   CYS A 117     -42.542   3.971 -16.637  1.00  0.80           N
ATOM   5040  CA  CYS A 117     -42.932   5.012 -15.702  1.00  0.80           C
ATOM   5041  C   CYS A 117     -44.408   5.314 -15.788  1.00  0.80           C
ATOM   5042  O   CYS A 117     -45.023   5.234 -16.848  1.00  0.80           O
ATOM   5043  CB  CYS A 117     -42.117   6.335 -15.845  1.00  0.80           C
ATOM   5044  SG  CYS A 117     -42.663   7.448 -17.206  1.00  0.80           S
ATOM   5045  N   THR A 118     -45.003   5.781 -14.679  1.00  0.80           N
ATOM   5046  CA  THR A 118     -46.444   6.006 -14.616  1.00  0.80           C
ATOM   5047  C   THR A 118     -46.812   7.386 -15.143  1.00  0.80           C
ATOM   5048  O   THR A 118     -47.967   7.792 -15.135  1.00  0.80           O
ATOM   5049  CB  THR A 118     -46.983   5.882 -13.185  1.00  0.80           C
ATOM   5050  OG1 THR A 118     -46.299   4.850 -12.487  1.00  0.80           O
ATOM   5051  CG2 THR A 118     -48.468   5.493 -13.171  1.00  0.80           C
ATOM   5052  N   VAL A 119     -45.820   8.161 -15.629  1.00  0.84           N
ATOM   5053  CA  VAL A 119     -46.032   9.513 -16.124  1.00  0.84           C
ATOM   5054  C   VAL A 119     -46.432   9.548 -17.586  1.00  0.84           C
ATOM   5055  O   VAL A 119     -47.408  10.193 -17.959  1.00  0.84           O
ATOM   5056  CB  VAL A 119     -44.774  10.363 -15.976  1.00  0.84           C
ATOM   5057  CG1 VAL A 119     -45.058  11.829 -16.360  1.00  0.84           C
ATOM   5058  CG2 VAL A 119     -44.264  10.314 -14.525  1.00  0.84           C
ATOM   5059  N   CYS A 120     -45.677   8.861 -18.469  1.00  0.83           N
ATOM   5060  CA  CYS A 120     -45.980   8.828 -19.891  1.00  0.83           C
ATOM   5061  C   CYS A 120     -46.285   7.426 -20.376  1.00  0.83           C
ATOM   5062  O   CYS A 120     -46.522   7.204 -21.562  1.00  0.83           O
ATOM   5063  CB  CYS A 120     -44.830   9.433 -20.748  1.00  0.83           C
ATOM   5064  SG  CYS A 120     -43.199   8.637 -20.508  1.00  0.83           S
ATOM   5065  N   GLY A 121     -46.290   6.434 -19.461  1.00  0.78           N
ATOM   5066  CA  GLY A 121     -46.664   5.058 -19.778  1.00  0.78           C
ATOM   5067  C   GLY A 121     -45.657   4.312 -20.624  1.00  0.78           C
ATOM   5068  O   GLY A 121     -45.966   3.301 -21.249  1.00  0.78           O
ATOM   5069  N   MET A 122     -44.409   4.801 -20.689  1.00  0.76           N
ATOM   5070  CA  MET A 122     -43.429   4.380 -21.669  1.00  0.76           C
ATOM   5071  C   MET A 122     -42.145   3.917 -20.986  1.00  0.76           C
ATOM   5072  O   MET A 122     -41.971   4.075 -19.775  1.00  0.76           O
ATOM   5073  CB  MET A 122     -43.191   5.564 -22.634  1.00  0.76           C
ATOM   5074  CG  MET A 122     -42.379   5.281 -23.907  1.00  0.76           C
ATOM   5075  SD  MET A 122     -42.306   6.709 -25.031  1.00  0.76           S
ATOM   5076  CE  MET A 122     -44.030   6.709 -25.596  1.00  0.76           C
ATOM   5077  N   TRP A 123     -41.217   3.260 -21.724  1.00  0.78           N
ATOM   5078  CA  TRP A 123     -39.968   2.776 -21.163  1.00  0.78           C
ATOM   5079  C   TRP A 123     -39.097   3.868 -20.549  1.00  0.78           C
ATOM   5080  O   TRP A 123     -38.865   4.916 -21.137  1.00  0.78           O
ATOM   5081  CB  TRP A 123     -39.095   2.029 -22.215  1.00  0.78           C
ATOM   5082  CG  TRP A 123     -39.416   0.564 -22.473  1.00  0.78           C
ATOM   5083  CD1 TRP A 123     -39.537  -0.073 -23.678  1.00  0.78           C
ATOM   5084  CD2 TRP A 123     -39.586  -0.452 -21.466  1.00  0.78           C
ATOM   5085  NE1 TRP A 123     -39.799  -1.409 -23.491  1.00  0.78           N
ATOM   5086  CE2 TRP A 123     -39.830  -1.671 -22.145  1.00  0.78           C
ATOM   5087  CE3 TRP A 123     -39.547  -0.407 -20.077  1.00  0.78           C
ATOM   5088  CZ2 TRP A 123     -40.043  -2.850 -21.447  1.00  0.78           C
ATOM   5089  CZ3 TRP A 123     -39.815  -1.586 -19.382  1.00  0.78           C
ATOM   5090  CH2 TRP A 123     -40.035  -2.796 -20.048  1.00  0.78           C
ATOM   5091  N   LYS A 124     -38.543   3.629 -19.344  1.00  0.82           N
ATOM   5092  CA  LYS A 124     -37.615   4.556 -18.729  1.00  0.82           C
ATOM   5093  C   LYS A 124     -36.192   4.348 -19.246  1.00  0.82           C
ATOM   5094  O   LYS A 124     -35.629   3.257 -19.169  1.00  0.82           O
ATOM   5095  CB  LYS A 124     -37.688   4.393 -17.192  1.00  0.82           C
ATOM   5096  CG  LYS A 124     -37.081   5.523 -16.341  1.00  0.82           C
ATOM   5097  CD  LYS A 124     -38.038   6.708 -16.144  1.00  0.82           C
ATOM   5098  CE  LYS A 124     -37.413   7.837 -15.313  1.00  0.82           C
ATOM   5099  NZ  LYS A 124     -38.333   8.980 -15.274  1.00  0.82           N
ATOM   5100  N   GLY A 125     -35.582   5.403 -19.833  1.00  0.84           N
ATOM   5101  CA  GLY A 125     -34.203   5.390 -20.330  1.00  0.84           C
ATOM   5102  C   GLY A 125     -34.064   5.014 -21.783  1.00  0.84           C
ATOM   5103  O   GLY A 125     -33.093   5.388 -22.426  1.00  0.84           O
ATOM   5104  N   TYR A 126     -35.070   4.331 -22.357  1.00  0.78           N
ATOM   5105  CA  TYR A 126     -35.128   4.030 -23.783  1.00  0.78           C
ATOM   5106  C   TYR A 126     -36.201   4.732 -24.664  1.00  0.78           C
ATOM   5107  O   TYR A 126     -36.458   4.279 -25.774  1.00  0.78           O
ATOM   5108  CB  TYR A 126     -35.301   2.495 -23.948  1.00  0.78           C
ATOM   5109  CG  TYR A 126     -33.990   1.767 -23.834  1.00  0.78           C
ATOM   5110  CD1 TYR A 126     -33.615   1.120 -22.645  1.00  0.78           C
ATOM   5111  CD2 TYR A 126     -33.160   1.647 -24.961  1.00  0.78           C
ATOM   5112  CE1 TYR A 126     -32.445   0.348 -22.593  1.00  0.78           C
ATOM   5113  CE2 TYR A 126     -31.987   0.880 -24.910  1.00  0.78           C
ATOM   5114  CZ  TYR A 126     -31.629   0.232 -23.723  1.00  0.78           C
ATOM   5115  OH  TYR A 126     -30.464  -0.559 -23.680  1.00  0.78           O
ATOM   5116  N   GLY A 127     -36.874   5.847 -24.295  1.00  0.60           N
ATOM   5117  CA  GLY A 127     -36.721   6.651 -23.102  1.00  0.60           C
ATOM   5118  C   GLY A 127     -37.854   7.578 -22.885  1.00  0.60           C
ATOM   5119  O   GLY A 127     -38.924   7.447 -23.473  1.00  0.60           O
ATOM   5120  N   CYS A 128     -37.648   8.538 -21.980  1.00  0.66           N
ATOM   5121  CA  CYS A 128     -38.721   9.330 -21.439  1.00  0.66           C
ATOM   5122  C   CYS A 128     -38.551  10.801 -21.714  1.00  0.66           C
ATOM   5123  O   CYS A 128     -37.451  11.327 -21.767  1.00  0.66           O
ATOM   5124  CB  CYS A 128     -38.809   9.155 -19.908  1.00  0.66           C
ATOM   5125  SG  CYS A 128     -39.697   7.636 -19.464  1.00  0.66           S
ATOM   5126  N   SER A 129     -39.691  11.498 -21.883  1.00  0.75           N
ATOM   5127  CA  SER A 129     -39.753  12.952 -21.955  1.00  0.75           C
ATOM   5128  C   SER A 129     -39.667  13.558 -20.565  1.00  0.75           C
ATOM   5129  O   SER A 129     -39.307  14.711 -20.363  1.00  0.75           O
ATOM   5130  CB  SER A 129     -41.096  13.323 -22.635  1.00  0.75           C
ATOM   5131  OG  SER A 129     -41.208  14.703 -22.969  1.00  0.75           O
ATOM   5132  N   CYS A 130     -39.987  12.747 -19.543  1.00  0.76           N
ATOM   5133  CA  CYS A 130     -39.579  12.975 -18.175  1.00  0.76           C
ATOM   5134  C   CYS A 130     -38.092  12.727 -17.956  1.00  0.76           C
ATOM   5135  O   CYS A 130     -37.570  11.719 -18.434  1.00  0.76           O
ATOM   5136  CB  CYS A 130     -40.422  12.139 -17.160  1.00  0.76           C
ATOM   5137  SG  CYS A 130     -41.671  11.039 -17.936  1.00  0.76           S
ATOM   5138  N   ASP A 131     -37.478  13.630 -17.165  1.00  0.62           N
ATOM   5139  CA  ASP A 131     -36.088  13.648 -16.754  1.00  0.62           C
ATOM   5140  C   ASP A 131     -35.197  14.379 -17.803  1.00  0.62           C
ATOM   5141  O   ASP A 131     -35.764  15.066 -18.695  1.00  0.62           O
ATOM   5142  CB  ASP A 131     -35.516  12.273 -16.310  1.00  0.62           C
ATOM   5143  CG  ASP A 131     -36.269  11.652 -15.144  1.00  0.62           C
ATOM   5144  OD1 ASP A 131     -37.503  11.395 -15.227  1.00  0.62           O
ATOM   5145  OD2 ASP A 131     -35.620  11.284 -14.136  1.00  0.62           O
ATOM   5146  OXT ASP A 131     -33.943  14.312 -17.680  1.00  0.62           O
TER    5147      ASP A 131
ATOM 5148 ZN   ZN  _   1     -46.320 -13.552 -16.506  1.00215.38          Zn
ATOM 5149 ZN   ZN  _   2     -41.779   8.811 -18.675  1.00261.86          Zn
ATOM 5150 ZN   ZN  _   3     -27.444 -24.739  10.948  1.00225.21          Zn
ATOM 5151 ZN   ZN  _   4     -30.795 -55.503  -1.590  1.00160.42          Zn
ATOM 5152 MG   MG  _   6     -37.552 -44.263 -11.357  1.00132.39          Mg
ENDMDL
MODEL        2
ATOM    1 ZN   ZN  B 603      -2.543 -54.752  42.131  1.00147.18          Zn
ATOM    1 ZN   ZN  B 603    19671  16819  19432   2120  -3078  -1992      Zn
ENDMDL
MODEL        3
ATOM      1  N   ALA B   1     -37.374 -29.456 -40.387  1.00  0.31           N
ATOM      2  CA  ALA B   1     -37.943 -28.420 -39.500  1.00  0.31           C
ATOM      3  C   ALA B   1     -39.263 -28.923 -38.910  1.00  0.31           C
ATOM      4  O   ALA B   1     -40.042 -29.514 -39.650  1.00  0.31           O
ATOM      5  CB  ALA B   1     -38.140 -27.171 -40.373  1.00  0.31           C
ATOM      6  N   GLU B   2     -39.547 -28.794 -37.598  1.00  0.54           N
ATOM      7  CA  GLU B   2     -38.663 -28.212 -36.610  1.00  0.54           C
ATOM      8  C   GLU B   2     -38.632 -28.915 -35.288  1.00  0.54           C
ATOM      9  O   GLU B   2     -39.617 -29.495 -34.833  1.00  0.54           O
ATOM     10  CB  GLU B   2     -38.915 -26.702 -36.391  1.00  0.54           C
ATOM     11  CG  GLU B   2     -37.642 -25.926 -35.964  1.00  0.54           C
ATOM     12  CD  GLU B   2     -36.430 -26.353 -36.789  1.00  0.54           C
ATOM     13  OE1 GLU B   2     -35.606 -27.115 -36.218  1.00  0.54           O
ATOM     14  OE2 GLU B   2     -36.403 -26.080 -38.015  1.00  0.54           O
ATOM     15  N   ASN B   3     -37.438 -28.925 -34.673  1.00  0.79           N
ATOM     16  CA  ASN B   3     -37.202 -29.572 -33.406  1.00  0.79           C
ATOM     17  C   ASN B   3     -37.996 -29.005 -32.225  1.00  0.79           C
ATOM     18  O   ASN B   3     -38.137 -27.798 -32.045  1.00  0.79           O
ATOM     19  CB  ASN B   3     -35.695 -29.596 -33.066  1.00  0.79           C
ATOM     20  CG  ASN B   3     -34.979 -30.602 -33.958  1.00  0.79           C
ATOM     21  OD1 ASN B   3     -35.525 -31.631 -34.359  1.00  0.79           O
ATOM     22  ND2 ASN B   3     -33.688 -30.331 -34.244  1.00  0.79           N
ATOM     23  N   VAL B   4     -38.509 -29.900 -31.360  1.00  0.79           N
ATOM     24  CA  VAL B   4     -39.450 -29.562 -30.308  1.00  0.79           C
ATOM     25  C   VAL B   4     -39.084 -30.305 -29.043  1.00  0.79           C
ATOM     26  O   VAL B   4     -38.371 -31.309 -29.069  1.00  0.79           O
ATOM     27  CB  VAL B   4     -40.889 -29.918 -30.668  1.00  0.79           C
ATOM     28  CG1 VAL B   4     -41.461 -28.820 -31.579  1.00  0.79           C
ATOM     29  CG2 VAL B   4     -40.956 -31.290 -31.365  1.00  0.79           C
ATOM     30  N   THR B   5     -39.556 -29.819 -27.881  1.00  0.77           N
ATOM     31  CA  THR B   5     -39.183 -30.386 -26.592  1.00  0.77           C
ATOM     32  C   THR B   5     -40.373 -31.042 -25.932  1.00  0.77           C
ATOM     33  O   THR B   5     -41.511 -30.595 -26.049  1.00  0.77           O
ATOM     34  CB  THR B   5     -38.628 -29.375 -25.588  1.00  0.77           C
ATOM     35  OG1 THR B   5     -37.919 -28.341 -26.248  1.00  0.77           O
ATOM     36  CG2 THR B   5     -37.592 -30.049 -24.678  1.00  0.77           C
ATOM     37  N   GLY B   6     -40.154 -32.134 -25.160  1.00  0.64           N
ATOM     38  CA  GLY B   6     -41.217 -32.663 -24.304  1.00  0.64           C
ATOM     39  C   GLY B   6     -41.421 -31.816 -23.064  1.00  0.64           C
ATOM     40  O   GLY B   6     -42.467 -31.860 -22.414  1.00  0.64           O
ATOM     41  N   LEU B   7     -40.409 -30.983 -22.747  1.00  0.74           N
ATOM     42  CA  LEU B   7     -40.411 -29.987 -21.699  1.00  0.74           C
ATOM     43  C   LEU B   7     -41.371 -28.851 -22.006  1.00  0.74           C
ATOM     44  O   LEU B   7     -41.325 -28.238 -23.071  1.00  0.74           O
ATOM     45  CB  LEU B   7     -38.961 -29.482 -21.475  1.00  0.74           C
ATOM     46  CG  LEU B   7     -38.593 -28.872 -20.102  1.00  0.74           C
ATOM     47  CD1 LEU B   7     -38.918 -27.378 -19.980  1.00  0.74           C
ATOM     48  CD2 LEU B   7     -39.172 -29.669 -18.927  1.00  0.74           C
ATOM     49  N   PHE B   8     -42.315 -28.606 -21.080  1.00  0.70           N
ATOM     50  CA  PHE B   8     -43.381 -27.632 -21.191  1.00  0.70           C
ATOM     51  C   PHE B   8     -44.438 -27.955 -22.239  1.00  0.70           C
ATOM     52  O   PHE B   8     -45.223 -27.094 -22.613  1.00  0.70           O
ATOM     53  CB  PHE B   8     -42.896 -26.160 -21.339  1.00  0.70           C
ATOM     54  CG  PHE B   8     -42.137 -25.588 -20.166  1.00  0.70           C
ATOM     55  CD1 PHE B   8     -42.162 -26.131 -18.867  1.00  0.70           C
ATOM     56  CD2 PHE B   8     -41.410 -24.405 -20.381  1.00  0.70           C
ATOM     57  CE1 PHE B   8     -41.462 -25.511 -17.821  1.00  0.70           C
ATOM     58  CE2 PHE B   8     -40.708 -23.790 -19.340  1.00  0.70           C
ATOM     59  CZ  PHE B   8     -40.727 -24.346 -18.058  1.00  0.70           C
ATOM     60  N   LYS B   9     -44.555 -29.216 -22.711  1.00  0.70           N
ATOM     61  CA  LYS B   9     -45.643 -29.636 -23.594  1.00  0.70           C
ATOM     62  C   LYS B   9     -47.042 -29.247 -23.080  1.00  0.70           C
ATOM     63  O   LYS B   9     -47.391 -29.548 -21.936  1.00  0.70           O
ATOM     64  CB  LYS B   9     -45.589 -31.174 -23.822  1.00  0.70           C
ATOM     65  CG  LYS B   9     -46.602 -31.719 -24.844  1.00  0.70           C
ATOM     66  CD  LYS B   9     -46.557 -33.249 -25.026  1.00  0.70           C
ATOM     67  CE  LYS B   9     -47.104 -34.013 -23.816  1.00  0.70           C
ATOM     68  NZ  LYS B   9     -47.245 -35.460 -24.097  1.00  0.70           N
ATOM     69  N   ASP B  10     -47.863 -28.565 -23.909  1.00  0.85           N
ATOM     70  CA  ASP B  10     -49.242 -28.204 -23.621  1.00  0.85           C
ATOM     71  C   ASP B  10     -50.104 -29.453 -23.714  1.00  0.85           C
ATOM     72  O   ASP B  10     -50.228 -30.083 -24.763  1.00  0.85           O
ATOM     73  CB  ASP B  10     -49.732 -27.110 -24.622  1.00  0.85           C
ATOM     74  CG  ASP B  10     -51.141 -26.578 -24.402  1.00  0.85           C
ATOM     75  OD1 ASP B  10     -51.931 -27.261 -23.709  1.00  0.85           O
ATOM     76  OD2 ASP B  10     -51.461 -25.494 -24.961  1.00  0.85           O
ATOM     77  N   CYS B  11     -50.711 -29.854 -22.587  1.00  0.93           N
ATOM     78  CA  CYS B  11     -51.405 -31.122 -22.504  1.00  0.93           C
ATOM     79  C   CYS B  11     -52.879 -30.910 -22.558  1.00  0.93           C
ATOM     80  O   CYS B  11     -53.683 -31.825 -22.397  1.00  0.93           O
ATOM     81  CB  CYS B  11     -51.052 -31.858 -21.194  1.00  0.93           C
ATOM     82  SG  CYS B  11     -49.371 -32.540 -21.284  1.00  0.93           S
ATOM     83  N   SER B  12     -53.304 -29.675 -22.771  1.00  0.90           N
ATOM     84  CA  SER B  12     -54.697 -29.371 -22.871  1.00  0.90           C
ATOM     85  C   SER B  12     -55.375 -29.962 -24.082  1.00  0.90           C
ATOM     86  O   SER B  12     -54.768 -30.181 -25.126  1.00  0.90           O
ATOM     87  CB  SER B  12     -54.912 -27.871 -22.826  1.00  0.90           C
ATOM     88  OG  SER B  12     -54.407 -27.276 -24.008  1.00  0.90           O
ATOM     89  N   LYS B  13     -56.681 -30.236 -23.961  1.00  0.87           N
ATOM     90  CA  LYS B  13     -57.485 -30.746 -25.052  1.00  0.87           C
ATOM     91  C   LYS B  13     -58.160 -29.604 -25.789  1.00  0.87           C
ATOM     92  O   LYS B  13     -59.132 -29.784 -26.520  1.00  0.87           O
ATOM     93  CB  LYS B  13     -58.544 -31.733 -24.518  1.00  0.87           C
ATOM     94  CG  LYS B  13     -57.939 -33.055 -24.033  1.00  0.87           C
ATOM     95  CD  LYS B  13     -58.993 -33.941 -23.361  1.00  0.87           C
ATOM     96  CE  LYS B  13     -58.707 -35.431 -23.504  1.00  0.87           C
ATOM     97  NZ  LYS B  13     -59.292 -36.155 -22.364  1.00  0.87           N
ATOM     98  N   VAL B  14     -57.645 -28.374 -25.617  1.00  0.85           N
ATOM     99  CA  VAL B  14     -58.065 -27.230 -26.393  1.00  0.85           C
ATOM    100  C   VAL B  14     -57.513 -27.331 -27.807  1.00  0.85           C
ATOM    101  O   VAL B  14     -56.306 -27.339 -28.033  1.00  0.85           O
ATOM    102  CB  VAL B  14     -57.635 -25.908 -25.771  1.00  0.85           C
ATOM    103  CG1 VAL B  14     -58.182 -24.728 -26.599  1.00  0.85           C
ATOM    104  CG2 VAL B  14     -58.125 -25.818 -24.312  1.00  0.85           C
ATOM    105  N   ILE B  15     -58.413 -27.417 -28.807  1.00  0.83           N
ATOM    106  CA  ILE B  15     -58.058 -27.551 -30.211  1.00  0.83           C
ATOM    107  C   ILE B  15     -57.475 -26.270 -30.795  1.00  0.83           C
ATOM    108  O   ILE B  15     -56.691 -26.275 -31.741  1.00  0.83           O
ATOM    109  CB  ILE B  15     -59.273 -28.037 -31.011  1.00  0.83           C
ATOM    110  CG1 ILE B  15     -58.971 -28.365 -32.491  1.00  0.83           C
ATOM    111  CG2 ILE B  15     -60.429 -27.020 -30.924  1.00  0.83           C
ATOM    112  CD1 ILE B  15     -57.824 -29.363 -32.657  1.00  0.83           C
ATOM    113  N   THR B  16     -57.836 -25.118 -30.213  1.00  0.85           N
ATOM    114  CA  THR B  16     -57.353 -23.806 -30.602  1.00  0.85           C
ATOM    115  C   THR B  16     -55.972 -23.546 -30.020  1.00  0.85           C
ATOM    116  O   THR B  16     -55.712 -23.819 -28.845  1.00  0.85           O
ATOM    117  CB  THR B  16     -58.291 -22.681 -30.139  1.00  0.85           C
ATOM    118  OG1 THR B  16     -59.616 -23.165 -29.930  1.00  0.85           O
ATOM    119  CG2 THR B  16     -58.388 -21.591 -31.212  1.00  0.85           C
ATOM    120  N   GLY B  17     -55.031 -22.974 -30.804  1.00  0.74           N
ATOM    121  CA  GLY B  17     -53.810 -22.377 -30.251  1.00  0.74           C
ATOM    122  C   GLY B  17     -54.110 -21.158 -29.399  1.00  0.74           C
ATOM    123  O   GLY B  17     -55.267 -20.777 -29.235  1.00  0.74           O
ATOM    124  N   LEU B  18     -53.095 -20.487 -28.825  1.00  0.85           N
ATOM    125  CA  LEU B  18     -53.365 -19.252 -28.094  1.00  0.85           C
ATOM    126  C   LEU B  18     -53.386 -18.015 -28.983  1.00  0.85           C
ATOM    127  O   LEU B  18     -52.847 -17.966 -30.091  1.00  0.85           O
ATOM    128  CB  LEU B  18     -52.416 -18.968 -26.888  1.00  0.85           C
ATOM    129  CG  LEU B  18     -52.840 -19.503 -25.496  1.00  0.85           C
ATOM    130  CD1 LEU B  18     -54.347 -19.469 -25.204  1.00  0.85           C
ATOM    131  CD2 LEU B  18     -52.293 -20.905 -25.244  1.00  0.85           C
ATOM    132  N   HIS B  19     -54.011 -16.943 -28.458  1.00  0.80           N
ATOM    133  CA  HIS B  19     -53.830 -15.582 -28.921  1.00  0.80           C
ATOM    134  C   HIS B  19     -52.380 -15.127 -28.766  1.00  0.80           C
ATOM    135  O   HIS B  19     -51.730 -15.557 -27.810  1.00  0.80           O
ATOM    136  CB  HIS B  19     -54.763 -14.633 -28.131  1.00  0.80           C
ATOM    137  CG  HIS B  19     -54.905 -13.241 -28.678  1.00  0.80           C
ATOM    138  ND1 HIS B  19     -54.055 -12.240 -28.246  1.00  0.80           N
ATOM    139  CD2 HIS B  19     -55.768 -12.754 -29.607  1.00  0.80           C
ATOM    140  CE1 HIS B  19     -54.417 -11.167 -28.921  1.00  0.80           C
ATOM    141  NE2 HIS B  19     -55.445 -11.422 -29.762  1.00  0.80           N
ATOM    142  N   PRO B  20     -51.802 -14.298 -29.636  1.00  0.84           N
ATOM    143  CA  PRO B  20     -50.428 -13.836 -29.519  1.00  0.84           C
ATOM    144  C   PRO B  20     -50.054 -13.209 -28.210  1.00  0.84           C
ATOM    145  O   PRO B  20     -48.889 -13.324 -27.841  1.00  0.84           O
ATOM    146  CB  PRO B  20     -50.250 -12.840 -30.660  1.00  0.84           C
ATOM    147  CG  PRO B  20     -51.658 -12.516 -31.159  1.00  0.84           C
ATOM    148  CD  PRO B  20     -52.422 -13.795 -30.857  1.00  0.84           C
ATOM    149  N   THR B  21     -50.974 -12.552 -27.489  1.00  0.77           N
ATOM    150  CA  THR B  21     -50.719 -12.243 -26.094  1.00  0.77           C
ATOM    151  C   THR B  21     -51.510 -13.215 -25.275  1.00  0.77           C
ATOM    152  O   THR B  21     -52.662 -13.490 -25.582  1.00  0.77           O
ATOM    153  CB  THR B  21     -50.977 -10.810 -25.658  1.00  0.77           C
ATOM    154  OG1 THR B  21     -52.293 -10.550 -25.193  1.00  0.77           O
ATOM    155  CG2 THR B  21     -50.788  -9.899 -26.852  1.00  0.77           C
ATOM    156  N   GLN B  22     -50.874 -13.788 -24.239  1.00  0.70           N
ATOM    157  CA  GLN B  22     -51.381 -14.868 -23.416  1.00  0.70           C
ATOM    158  C   GLN B  22     -50.911 -16.216 -23.936  1.00  0.70           C
ATOM    159  O   GLN B  22     -50.885 -17.193 -23.188  1.00  0.70           O
ATOM    160  CB  GLN B  22     -52.893 -14.805 -23.039  1.00  0.70           C
ATOM    161  CG  GLN B  22     -53.786 -15.704 -23.930  1.00  0.70           C
ATOM    162  CD  GLN B  22     -55.269 -15.337 -23.976  1.00  0.70           C
ATOM    163  OE1 GLN B  22     -55.920 -15.601 -24.987  1.00  0.70           O
ATOM    164  NE2 GLN B  22     -55.827 -14.760 -22.890  1.00  0.70           N
ATOM    165  N   ALA B  23     -50.429 -16.290 -25.197  1.00  0.79           N
ATOM    166  CA  ALA B  23     -49.510 -17.337 -25.599  1.00  0.79           C
ATOM    167  C   ALA B  23     -48.166 -17.309 -24.865  1.00  0.79           C
ATOM    168  O   ALA B  23     -47.613 -16.232 -24.628  1.00  0.79           O
ATOM    169  CB  ALA B  23     -49.205 -17.337 -27.105  1.00  0.79           C
ATOM    170  N   PRO B  24     -47.569 -18.447 -24.517  1.00  0.72           N
ATOM    171  CA  PRO B  24     -46.272 -18.454 -23.856  1.00  0.72           C
ATOM    172  C   PRO B  24     -45.156 -18.282 -24.858  1.00  0.72           C
ATOM    173  O   PRO B  24     -44.047 -17.953 -24.456  1.00  0.72           O
ATOM    174  CB  PRO B  24     -46.202 -19.845 -23.195  1.00  0.72           C
ATOM    175  CG  PRO B  24     -47.127 -20.719 -24.043  1.00  0.72           C
ATOM    176  CD  PRO B  24     -48.244 -19.743 -24.397  1.00  0.72           C
ATOM    177  N   THR B  25     -45.374 -18.552 -26.153  1.00  0.69           N
ATOM    178  CA  THR B  25     -44.305 -18.561 -27.137  1.00  0.69           C
ATOM    179  C   THR B  25     -44.905 -18.645 -28.530  1.00  0.69           C
ATOM    180  O   THR B  25     -46.096 -18.918 -28.671  1.00  0.69           O
ATOM    181  CB  THR B  25     -43.301 -19.665 -26.892  1.00  0.69           C
ATOM    182  OG1 THR B  25     -42.255 -19.628 -27.837  1.00  0.69           O
ATOM    183  CG2 THR B  25     -43.996 -21.016 -26.894  1.00  0.69           C
ATOM    184  N   HIS B  26     -44.105 -18.420 -29.600  1.00  0.68           N
ATOM    185  CA  HIS B  26     -44.528 -18.496 -30.995  1.00  0.68           C
ATOM    186  C   HIS B  26     -45.005 -19.874 -31.422  1.00  0.68           C
ATOM    187  O   HIS B  26     -45.910 -20.010 -32.239  1.00  0.68           O
ATOM    188  CB  HIS B  26     -43.402 -18.033 -31.947  1.00  0.68           C
ATOM    189  CG  HIS B  26     -43.792 -17.846 -33.386  1.00  0.68           C
ATOM    190  ND1 HIS B  26     -43.866 -18.941 -34.227  1.00  0.68           N
ATOM    191  CD2 HIS B  26     -43.982 -16.702 -34.090  1.00  0.68           C
ATOM    192  CE1 HIS B  26     -44.094 -18.441 -35.421  1.00  0.68           C
ATOM    193  NE2 HIS B  26     -44.172 -17.090 -35.400  1.00  0.68           N
ATOM    194  N   LEU B  27     -44.434 -20.951 -30.855  1.00  0.74           N
ATOM    195  CA  LEU B  27     -44.876 -22.307 -31.133  1.00  0.74           C
ATOM    196  C   LEU B  27     -46.348 -22.539 -30.750  1.00  0.74           C
ATOM    197  O   LEU B  27     -47.114 -23.133 -31.506  1.00  0.74           O
ATOM    198  CB  LEU B  27     -43.913 -23.308 -30.445  1.00  0.74           C
ATOM    199  CG  LEU B  27     -43.148 -24.276 -31.379  1.00  0.74           C
ATOM    200  CD1 LEU B  27     -44.076 -25.308 -32.032  1.00  0.74           C
ATOM    201  CD2 LEU B  27     -42.294 -23.542 -32.425  1.00  0.74           C
ATOM    202  N   SER B  28     -46.763 -21.998 -29.582  1.00  0.78           N
ATOM    203  CA  SER B  28     -48.125 -22.046 -29.041  1.00  0.78           C
ATOM    204  C   SER B  28     -49.175 -21.191 -29.740  1.00  0.78           C
ATOM    205  O   SER B  28     -50.365 -21.513 -29.706  1.00  0.78           O
ATOM    206  CB  SER B  28     -48.126 -21.632 -27.540  1.00  0.78           C
ATOM    207  OG  SER B  28     -49.394 -21.760 -26.889  1.00  0.78           O
ATOM    208  N   VAL B  29     -48.808 -20.056 -30.380  1.00  0.83           N
ATOM    209  CA  VAL B  29     -49.806 -19.193 -31.011  1.00  0.83           C
ATOM    210  C   VAL B  29     -50.586 -19.910 -32.108  1.00  0.83           C
ATOM    211  O   VAL B  29     -50.075 -20.798 -32.793  1.00  0.83           O
ATOM    212  CB  VAL B  29     -49.294 -17.852 -31.548  1.00  0.83           C
ATOM    213  CG1 VAL B  29     -48.468 -17.100 -30.495  1.00  0.83           C
ATOM    214  CG2 VAL B  29     -48.494 -18.046 -32.838  1.00  0.83           C
ATOM    215  N   ASP B  30     -51.875 -19.576 -32.281  1.00  0.89           N
ATOM    216  CA  ASP B  30     -52.699 -20.235 -33.267  1.00  0.89           C
ATOM    217  C   ASP B  30     -52.283 -19.938 -34.707  1.00  0.89           C
ATOM    218  O   ASP B  30     -51.640 -18.938 -35.027  1.00  0.89           O
ATOM    219  CB  ASP B  30     -54.196 -19.926 -33.016  1.00  0.89           C
ATOM    220  CG  ASP B  30     -55.140 -20.987 -33.557  1.00  0.89           C
ATOM    221  OD1 ASP B  30     -54.664 -22.004 -34.119  1.00  0.89           O
ATOM    222  OD2 ASP B  30     -56.369 -20.774 -33.452  1.00  0.89           O
ATOM    223  N   THR B  31     -52.678 -20.837 -35.626  1.00  0.87           N
ATOM    224  CA  THR B  31     -52.413 -20.793 -37.064  1.00  0.87           C
ATOM    225  C   THR B  31     -52.926 -19.512 -37.659  1.00  0.87           C
ATOM    226  O   THR B  31     -52.311 -18.903 -38.525  1.00  0.87           O
ATOM    227  CB  THR B  31     -53.092 -21.952 -37.789  1.00  0.87           C
ATOM    228  OG1 THR B  31     -52.510 -23.182 -37.380  1.00  0.87           O
ATOM    229  CG2 THR B  31     -52.984 -21.902 -39.323  1.00  0.87           C
ATOM    230  N   LYS B  32     -54.075 -19.052 -37.141  1.00  0.86           N
ATOM    231  CA  LYS B  32     -54.842 -17.926 -37.619  1.00  0.86           C
ATOM    232  C   LYS B  32     -54.074 -16.625 -37.543  1.00  0.86           C
ATOM    233  O   LYS B  32     -54.280 -15.719 -38.342  1.00  0.86           O
ATOM    234  CB  LYS B  32     -56.187 -17.820 -36.850  1.00  0.86           C
ATOM    235  CG  LYS B  32     -56.665 -19.159 -36.259  1.00  0.86           C
ATOM    236  CD  LYS B  32     -58.169 -19.441 -36.358  1.00  0.86           C
ATOM    237  CE  LYS B  32     -58.478 -20.877 -35.914  1.00  0.86           C
ATOM    238  NZ  LYS B  32     -59.888 -21.024 -35.504  1.00  0.86           N
ATOM    239  N   PHE B  33     -53.149 -16.522 -36.571  1.00  0.89           N
ATOM    240  CA  PHE B  33     -52.368 -15.329 -36.375  1.00  0.89           C
ATOM    241  C   PHE B  33     -50.979 -15.446 -37.002  1.00  0.89           C
ATOM    242  O   PHE B  33     -50.195 -14.509 -36.936  1.00  0.89           O
ATOM    243  CB  PHE B  33     -52.166 -15.053 -34.864  1.00  0.89           C
ATOM    244  CG  PHE B  33     -53.450 -15.048 -34.077  1.00  0.89           C
ATOM    245  CD1 PHE B  33     -53.924 -16.241 -33.508  1.00  0.89           C
ATOM    246  CD2 PHE B  33     -54.126 -13.850 -33.794  1.00  0.89           C
ATOM    247  CE1 PHE B  33     -55.043 -16.244 -32.667  1.00  0.89           C
ATOM    248  CE2 PHE B  33     -55.236 -13.846 -32.939  1.00  0.89           C
ATOM    249  CZ  PHE B  33     -55.698 -15.043 -32.379  1.00  0.89           C
ATOM    250  N   LYS B  34     -50.610 -16.589 -37.626  1.00  0.83           N
ATOM    251  CA  LYS B  34     -49.264 -16.793 -38.144  1.00  0.83           C
ATOM    252  C   LYS B  34     -49.187 -16.495 -39.627  1.00  0.83           C
ATOM    253  O   LYS B  34     -49.948 -17.011 -40.445  1.00  0.83           O
ATOM    254  CB  LYS B  34     -48.699 -18.219 -37.864  1.00  0.83           C
ATOM    255  CG  LYS B  34     -48.052 -18.348 -36.472  1.00  0.83           C
ATOM    256  CD  LYS B  34     -47.438 -19.734 -36.176  1.00  0.83           C
ATOM    257  CE  LYS B  34     -48.413 -20.632 -35.410  1.00  0.83           C
ATOM    258  NZ  LYS B  34     -47.898 -22.004 -35.210  1.00  0.83           N
ATOM    259  N   THR B  35     -48.226 -15.646 -40.024  1.00  0.89           N
ATOM    260  CA  THR B  35     -48.001 -15.350 -41.428  1.00  0.89           C
ATOM    261  C   THR B  35     -46.543 -15.049 -41.654  1.00  0.89           C
ATOM    262  O   THR B  35     -45.903 -14.359 -40.867  1.00  0.89           O
ATOM    263  CB  THR B  35     -48.875 -14.227 -41.974  1.00  0.89           C
ATOM    264  OG1 THR B  35     -48.697 -14.072 -43.376  1.00  0.89           O
ATOM    265  CG2 THR B  35     -48.589 -12.882 -41.290  1.00  0.89           C
ATOM    266  N   GLU B  36     -45.954 -15.614 -42.724  1.00  0.85           N
ATOM    267  CA  GLU B  36     -44.577 -15.356 -43.125  1.00  0.85           C
ATOM    268  C   GLU B  36     -43.493 -15.687 -42.091  1.00  0.85           C
ATOM    269  O   GLU B  36     -42.370 -15.197 -42.134  1.00  0.85           O
ATOM    270  CB  GLU B  36     -44.450 -13.905 -43.639  1.00  0.85           C
ATOM    271  CG  GLU B  36     -43.842 -13.802 -45.053  1.00  0.85           C
ATOM    272  CD  GLU B  36     -43.996 -12.390 -45.610  1.00  0.85           C
ATOM    273  OE1 GLU B  36     -43.093 -11.552 -45.364  1.00  0.85           O
ATOM    274  OE2 GLU B  36     -45.029 -12.145 -46.287  1.00  0.85           O
ATOM    275  N   GLY B  37     -43.805 -16.562 -41.110  1.00  0.88           N
ATOM    276  CA  GLY B  37     -42.897 -16.934 -40.024  1.00  0.88           C
ATOM    277  C   GLY B  37     -43.034 -16.018 -38.846  1.00  0.88           C
ATOM    278  O   GLY B  37     -42.534 -16.277 -37.757  1.00  0.88           O
ATOM    279  N   LEU B  38     -43.788 -14.936 -39.024  1.00  0.83           N
ATOM    280  CA  LEU B  38     -44.132 -13.981 -38.013  1.00  0.83           C
ATOM    281  C   LEU B  38     -45.468 -14.362 -37.427  1.00  0.83           C
ATOM    282  O   LEU B  38     -46.172 -15.267 -37.886  1.00  0.83           O
ATOM    283  CB  LEU B  38     -44.232 -12.550 -38.602  1.00  0.83           C
ATOM    284  CG  LEU B  38     -42.909 -11.761 -38.711  1.00  0.83           C
ATOM    285  CD1 LEU B  38     -42.405 -11.299 -37.340  1.00  0.83           C
ATOM    286  CD2 LEU B  38     -41.801 -12.504 -39.466  1.00  0.83           C
ATOM    287  N   CYS B  39     -45.839 -13.665 -36.355  1.00  0.80           N
ATOM    288  CA  CYS B  39     -47.174 -13.679 -35.823  1.00  0.80           C
ATOM    289  C   CYS B  39     -47.721 -12.273 -35.962  1.00  0.80           C
ATOM    290  O   CYS B  39     -46.983 -11.315 -36.168  1.00  0.80           O
ATOM    291  CB  CYS B  39     -47.161 -14.167 -34.359  1.00  0.80           C
ATOM    292  SG  CYS B  39     -48.819 -14.530 -33.699  1.00  0.80           S
ATOM    293  N   VAL B  40     -49.046 -12.105 -35.919  1.00  0.80           N
ATOM    294  CA  VAL B  40     -49.646 -10.813 -36.126  1.00  0.80           C
ATOM    295  C   VAL B  40     -50.912 -10.701 -35.314  1.00  0.80           C
ATOM    296  O   VAL B  40     -51.665 -11.662 -35.138  1.00  0.80           O
ATOM    297  CB  VAL B  40     -49.856 -10.500 -37.609  1.00  0.80           C
ATOM    298  CG1 VAL B  40     -50.922 -11.409 -38.250  1.00  0.80           C
ATOM    299  CG2 VAL B  40     -50.182  -9.008 -37.795  1.00  0.80           C
ATOM    300  N   ASP B  41     -51.165  -9.516 -34.730  1.00  0.78           N
ATOM    301  CA  ASP B  41     -52.429  -9.210 -34.103  1.00  0.78           C
ATOM    302  C   ASP B  41     -53.578  -9.139 -35.096  1.00  0.78           C
ATOM    303  O   ASP B  41     -53.464  -8.617 -36.206  1.00  0.78           O
ATOM    304  CB  ASP B  41     -52.348  -7.914 -33.267  1.00  0.78           C
ATOM    305  CG  ASP B  41     -53.614  -7.664 -32.460  1.00  0.78           C
ATOM    306  OD1 ASP B  41     -54.162  -8.675 -31.950  1.00  0.78           O
ATOM    307  OD2 ASP B  41     -54.022  -6.486 -32.339  1.00  0.78           O
ATOM    308  N   ILE B  42     -54.734  -9.658 -34.670  1.00  0.85           N
ATOM    309  CA  ILE B  42     -55.958  -9.541 -35.414  1.00  0.85           C
ATOM    310  C   ILE B  42     -57.032  -9.191 -34.412  1.00  0.85           C
ATOM    311  O   ILE B  42     -57.583 -10.109 -33.805  1.00  0.85           O
ATOM    312  CB  ILE B  42     -56.364 -10.822 -36.133  1.00  0.85           C
ATOM    313  CG1 ILE B  42     -55.321 -11.262 -37.181  1.00  0.85           C
ATOM    314  CG2 ILE B  42     -57.738 -10.596 -36.814  1.00  0.85           C
ATOM    315  CD1 ILE B  42     -55.459 -12.737 -37.562  1.00  0.85           C
ATOM    316  N   PRO B  43     -57.427  -7.927 -34.226  1.00  0.87           N
ATOM    317  CA  PRO B  43     -58.401  -7.541 -33.206  1.00  0.87           C
ATOM    318  C   PRO B  43     -59.723  -8.280 -33.312  1.00  0.87           C
ATOM    319  O   PRO B  43     -60.443  -8.387 -32.327  1.00  0.87           O
ATOM    320  CB  PRO B  43     -58.559  -6.025 -33.407  1.00  0.87           C
ATOM    321  CG  PRO B  43     -57.179  -5.573 -33.896  1.00  0.87           C
ATOM    322  CD  PRO B  43     -56.675  -6.763 -34.718  1.00  0.87           C
ATOM    323  N   GLY B  44     -60.061  -8.786 -34.519  1.00  0.78           N
ATOM    324  CA  GLY B  44     -61.322  -9.458 -34.783  1.00  0.78           C
ATOM    325  C   GLY B  44     -61.438 -10.893 -34.330  1.00  0.78           C
ATOM    326  O   GLY B  44     -62.536 -11.441 -34.322  1.00  0.78           O
ATOM    327  N   ILE B  45     -60.341 -11.554 -33.919  1.00  0.89           N
ATOM    328  CA  ILE B  45     -60.418 -12.906 -33.384  1.00  0.89           C
ATOM    329  C   ILE B  45     -59.970 -12.843 -31.926  1.00  0.89           C
ATOM    330  O   ILE B  45     -58.829 -12.478 -31.639  1.00  0.89           O
ATOM    331  CB  ILE B  45     -59.670 -13.954 -34.210  1.00  0.89           C
ATOM    332  CG1 ILE B  45     -59.645 -15.321 -33.489  1.00  0.89           C
ATOM    333  CG2 ILE B  45     -58.264 -13.458 -34.572  1.00  0.89           C
ATOM    334  CD1 ILE B  45     -59.188 -16.480 -34.372  1.00  0.89           C
ATOM    335  N   PRO B  46     -60.833 -13.116 -30.948  1.00  0.87           N
ATOM    336  CA  PRO B  46     -60.583 -12.702 -29.582  1.00  0.87           C
ATOM    337  C   PRO B  46     -59.686 -13.668 -28.844  1.00  0.87           C
ATOM    338  O   PRO B  46     -59.654 -14.863 -29.127  1.00  0.87           O
ATOM    339  CB  PRO B  46     -61.982 -12.698 -28.952  1.00  0.87           C
ATOM    340  CG  PRO B  46     -62.698 -13.837 -29.677  1.00  0.87           C
ATOM    341  CD  PRO B  46     -62.172 -13.691 -31.104  1.00  0.87           C
ATOM    342  N   LYS B  47     -58.931 -13.134 -27.877  1.00  0.79           N
ATOM    343  CA  LYS B  47     -58.250 -13.885 -26.848  1.00  0.79           C
ATOM    344  C   LYS B  47     -59.210 -14.615 -25.918  1.00  0.79           C
ATOM    345  O   LYS B  47     -60.291 -14.111 -25.612  1.00  0.79           O
ATOM    346  CB  LYS B  47     -57.327 -12.953 -26.013  1.00  0.79           C
ATOM    347  CG  LYS B  47     -57.234 -11.511 -26.534  1.00  0.79           C
ATOM    348  CD  LYS B  47     -56.291 -10.633 -25.699  1.00  0.79           C
ATOM    349  CE  LYS B  47     -56.927 -10.110 -24.411  1.00  0.79           C
ATOM    350  NZ  LYS B  47     -56.059  -9.080 -23.809  1.00  0.79           N
ATOM    351  N   ASP B  48     -58.828 -15.804 -25.416  1.00  0.82           N
ATOM    352  CA  ASP B  48     -59.612 -16.548 -24.456  1.00  0.82           C
ATOM    353  C   ASP B  48     -59.777 -15.788 -23.128  1.00  0.82           C
ATOM    354  O   ASP B  48     -58.810 -15.384 -22.482  1.00  0.82           O
ATOM    355  CB  ASP B  48     -58.925 -17.892 -24.141  1.00  0.82           C
ATOM    356  CG  ASP B  48     -58.703 -18.746 -25.375  1.00  0.82           C
ATOM    357  OD1 ASP B  48     -57.536 -18.801 -25.844  1.00  0.82           O
ATOM    358  OD2 ASP B  48     -59.677 -19.401 -25.820  1.00  0.82           O
ATOM    359  N   MET B  49     -61.026 -15.559 -22.684  1.00  0.81           N
ATOM    360  CA  MET B  49     -61.390 -14.888 -21.442  1.00  0.81           C
ATOM    361  C   MET B  49     -61.078 -15.724 -20.229  1.00  0.81           C
ATOM    362  O   MET B  49     -60.727 -15.231 -19.160  1.00  0.81           O
ATOM    363  CB  MET B  49     -62.905 -14.547 -21.374  1.00  0.81           C
ATOM    364  CG  MET B  49     -63.504 -14.292 -22.763  1.00  0.81           C
ATOM    365  SD  MET B  49     -63.898 -15.862 -23.624  1.00  0.81           S
ATOM    366  CE  MET B  49     -63.953 -15.140 -25.267  1.00  0.81           C
ATOM    367  N   THR B  50     -61.268 -17.037 -20.388  1.00  0.88           N
ATOM    368  CA  THR B  50     -61.086 -18.031 -19.360  1.00  0.88           C
ATOM    369  C   THR B  50     -60.628 -19.270 -20.078  1.00  0.88           C
ATOM    370  O   THR B  50     -61.184 -19.663 -21.100  1.00  0.88           O
ATOM    371  CB  THR B  50     -62.344 -18.308 -18.531  1.00  0.88           C
ATOM    372  OG1 THR B  50     -62.195 -19.448 -17.688  1.00  0.88           O
ATOM    373  CG2 THR B  50     -63.573 -18.511 -19.433  1.00  0.88           C
ATOM    374  N   TYR B  51     -59.569 -19.906 -19.567  1.00  0.89           N
ATOM    375  CA  TYR B  51     -59.070 -21.131 -20.126  1.00  0.89           C
ATOM    376  C   TYR B  51     -58.196 -21.750 -19.077  1.00  0.89           C
ATOM    377  O   TYR B  51     -57.688 -21.051 -18.199  1.00  0.89           O
ATOM    378  CB  TYR B  51     -58.286 -20.973 -21.471  1.00  0.89           C
ATOM    379  CG  TYR B  51     -56.962 -20.230 -21.386  1.00  0.89           C
ATOM    380  CD1 TYR B  51     -56.902 -18.840 -21.488  1.00  0.89           C
ATOM    381  CD2 TYR B  51     -55.754 -20.929 -21.262  1.00  0.89           C
ATOM    382  CE1 TYR B  51     -55.669 -18.170 -21.499  1.00  0.89           C
ATOM    383  CE2 TYR B  51     -54.510 -20.272 -21.296  1.00  0.89           C
ATOM    384  CZ  TYR B  51     -54.465 -18.876 -21.414  1.00  0.89           C
ATOM    385  OH  TYR B  51     -53.232 -18.168 -21.452  1.00  0.89           O
ATOM    386  N   ARG B  52     -57.985 -23.071 -19.149  1.00  0.83           N
ATOM    387  CA  ARG B  52     -57.037 -23.720 -18.283  1.00  0.83           C
ATOM    388  C   ARG B  52     -56.228 -24.679 -19.116  1.00  0.83           C
ATOM    389  O   ARG B  52     -56.780 -25.535 -19.804  1.00  0.83           O
ATOM    390  CB  ARG B  52     -57.711 -24.493 -17.128  1.00  0.83           C
ATOM    391  CG  ARG B  52     -58.375 -23.599 -16.061  1.00  0.83           C
ATOM    392  CD  ARG B  52     -58.076 -24.002 -14.611  1.00  0.83           C
ATOM    393  NE  ARG B  52     -58.505 -25.414 -14.402  1.00  0.83           N
ATOM    394  CZ  ARG B  52     -58.339 -26.116 -13.276  1.00  0.83           C
ATOM    395  NH1 ARG B  52     -57.801 -25.584 -12.189  1.00  0.83           N
ATOM    396  NH2 ARG B  52     -58.677 -27.400 -13.239  1.00  0.83           N
ATOM    397  N   ARG B  53     -54.890 -24.556 -19.105  1.00  0.82           N
ATOM    398  CA  ARG B  53     -54.057 -25.470 -19.864  1.00  0.82           C
ATOM    399  C   ARG B  53     -53.018 -26.105 -18.969  1.00  0.82           C
ATOM    400  O   ARG B  53     -52.212 -25.433 -18.340  1.00  0.82           O
ATOM    401  CB  ARG B  53     -53.369 -24.797 -21.079  1.00  0.82           C
ATOM    402  CG  ARG B  53     -54.353 -24.295 -22.156  1.00  0.82           C
ATOM    403  CD  ARG B  53     -53.664 -23.745 -23.402  1.00  0.82           C
ATOM    404  NE  ARG B  53     -54.688 -23.085 -24.291  1.00  0.82           N
ATOM    405  CZ  ARG B  53     -54.804 -23.344 -25.600  1.00  0.82           C
ATOM    406  NH1 ARG B  53     -54.083 -24.294 -26.189  1.00  0.82           N
ATOM    407  NH2 ARG B  53     -55.665 -22.648 -26.339  1.00  0.82           N
ATOM    408  N   LEU B  54     -53.030 -27.448 -18.871  1.00  0.93           N
ATOM    409  CA  LEU B  54     -52.066 -28.191 -18.086  1.00  0.93           C
ATOM    410  C   LEU B  54     -50.741 -28.245 -18.811  1.00  0.93           C
ATOM    411  O   LEU B  54     -50.668 -28.709 -19.948  1.00  0.93           O
ATOM    412  CB  LEU B  54     -52.562 -29.639 -17.857  1.00  0.93           C
ATOM    413  CG  LEU B  54     -51.643 -30.594 -17.064  1.00  0.93           C
ATOM    414  CD1 LEU B  54     -51.441 -30.111 -15.623  1.00  0.93           C
ATOM    415  CD2 LEU B  54     -52.229 -32.016 -17.093  1.00  0.93           C
ATOM    416  N   ILE B  55     -49.662 -27.782 -18.163  1.00  0.85           N
ATOM    417  CA  ILE B  55     -48.348 -27.835 -18.762  1.00  0.85           C
ATOM    418  C   ILE B  55     -47.501 -28.971 -18.211  1.00  0.85           C
ATOM    419  O   ILE B  55     -47.331 -29.170 -17.006  1.00  0.85           O
ATOM    420  CB  ILE B  55     -47.586 -26.536 -18.631  1.00  0.85           C
ATOM    421  CG1 ILE B  55     -48.307 -25.342 -19.282  1.00  0.85           C
ATOM    422  CG2 ILE B  55     -46.246 -26.706 -19.352  1.00  0.85           C
ATOM    423  CD1 ILE B  55     -48.654 -25.518 -20.765  1.00  0.85           C
ATOM    424  N   SER B  56     -46.932 -29.775 -19.125  1.00  0.86           N
ATOM    425  CA  SER B  56     -46.001 -30.847 -18.840  1.00  0.86           C
ATOM    426  C   SER B  56     -44.666 -30.425 -18.264  1.00  0.86           C
ATOM    427  O   SER B  56     -43.867 -29.750 -18.909  1.00  0.86           O
ATOM    428  CB  SER B  56     -45.683 -31.588 -20.158  1.00  0.86           C
ATOM    429  OG  SER B  56     -44.884 -32.756 -20.013  1.00  0.86           O
ATOM    430  N   MET B  57     -44.342 -30.897 -17.057  1.00  0.81           N
ATOM    431  CA  MET B  57     -43.025 -30.736 -16.492  1.00  0.81           C
ATOM    432  C   MET B  57     -42.288 -32.029 -16.706  1.00  0.81           C
ATOM    433  O   MET B  57     -42.153 -32.755 -15.740  1.00  0.81           O
ATOM    434  CB  MET B  57     -43.140 -30.443 -14.969  1.00  0.81           C
ATOM    435  CG  MET B  57     -43.780 -29.076 -14.640  1.00  0.81           C
ATOM    436  SD  MET B  57     -42.758 -27.630 -15.047  1.00  0.81           S
ATOM    437  CE  MET B  57     -43.915 -26.372 -14.438  1.00  0.81           C
ATOM    438  N   MET B  58     -41.837 -32.404 -17.923  1.00  0.82           N
ATOM    439  CA  MET B  58     -41.202 -33.698 -18.152  1.00  0.82           C
ATOM    440  C   MET B  58     -39.956 -33.559 -18.982  1.00  0.82           C
ATOM    441  O   MET B  58     -39.915 -32.831 -19.968  1.00  0.82           O
ATOM    442  CB  MET B  58     -42.081 -34.766 -18.856  1.00  0.82           C
ATOM    443  CG  MET B  58     -43.324 -35.207 -18.060  1.00  0.82           C
ATOM    444  SD  MET B  58     -43.879 -36.927 -18.327  1.00  0.82           S
ATOM    445  CE  MET B  58     -43.550 -37.100 -20.104  1.00  0.82           C
ATOM    446  N   GLY B  59     -38.885 -34.292 -18.610  1.00  0.77           N
ATOM    447  CA  GLY B  59     -37.659 -34.259 -19.391  1.00  0.77           C
ATOM    448  C   GLY B  59     -36.898 -33.015 -19.096  1.00  0.77           C
ATOM    449  O   GLY B  59     -36.381 -32.370 -19.997  1.00  0.77           O
ATOM    450  N   PHE B  60     -36.835 -32.647 -17.801  1.00  0.82           N
ATOM    451  CA  PHE B  60     -36.317 -31.374 -17.341  1.00  0.82           C
ATOM    452  C   PHE B  60     -34.897 -31.034 -17.804  1.00  0.82           C
ATOM    453  O   PHE B  60     -34.585 -29.868 -18.021  1.00  0.82           O
ATOM    454  CB  PHE B  60     -36.481 -31.276 -15.798  1.00  0.82           C
ATOM    455  CG  PHE B  60     -37.457 -30.207 -15.391  1.00  0.82           C
ATOM    456  CD1 PHE B  60     -37.279 -28.878 -15.797  1.00  0.82           C
ATOM    457  CD2 PHE B  60     -38.547 -30.513 -14.564  1.00  0.82           C
ATOM    458  CE1 PHE B  60     -38.163 -27.871 -15.400  1.00  0.82           C
ATOM    459  CE2 PHE B  60     -39.443 -29.514 -14.167  1.00  0.82           C
ATOM    460  CZ  PHE B  60     -39.251 -28.194 -14.588  1.00  0.82           C
ATOM    461  N   LYS B  61     -34.022 -32.054 -17.993  1.00  0.77           N
ATOM    462  CA  LYS B  61     -32.825 -31.977 -18.835  1.00  0.77           C
ATOM    463  C   LYS B  61     -31.904 -30.794 -18.554  1.00  0.77           C
ATOM    464  O   LYS B  61     -31.552 -30.008 -19.433  1.00  0.77           O
ATOM    465  CB  LYS B  61     -33.155 -32.071 -20.357  1.00  0.77           C
ATOM    466  CG  LYS B  61     -32.041 -32.670 -21.240  1.00  0.77           C
ATOM    467  CD  LYS B  61     -32.322 -32.541 -22.751  1.00  0.77           C
ATOM    468  CE  LYS B  61     -31.497 -33.513 -23.604  1.00  0.77           C
ATOM    469  NZ  LYS B  61     -32.132 -34.854 -23.623  1.00  0.77           N
ATOM    470  N   MET B  62     -31.499 -30.627 -17.287  1.00  0.73           N
ATOM    471  CA  MET B  62     -30.738 -29.475 -16.878  1.00  0.73           C
ATOM    472  C   MET B  62     -29.257 -29.785 -16.740  1.00  0.73           C
ATOM    473  O   MET B  62     -28.775 -30.417 -15.801  1.00  0.73           O
ATOM    474  CB  MET B  62     -31.350 -28.854 -15.608  1.00  0.73           C
ATOM    475  CG  MET B  62     -31.627 -29.862 -14.479  1.00  0.73           C
ATOM    476  SD  MET B  62     -32.686 -29.236 -13.147  1.00  0.73           S
ATOM    477  CE  MET B  62     -32.143 -27.513 -13.042  1.00  0.73           C
ATOM    478  N   ASN B  63     -28.495 -29.300 -17.732  1.00  0.78           N
ATOM    479  CA  ASN B  63     -27.049 -29.321 -17.778  1.00  0.78           C
ATOM    480  C   ASN B  63     -26.599 -27.912 -18.145  1.00  0.78           C
ATOM    481  O   ASN B  63     -26.856 -27.405 -19.235  1.00  0.78           O
ATOM    482  CB  ASN B  63     -26.474 -30.394 -18.754  1.00  0.78           C
ATOM    483  CG  ASN B  63     -27.337 -30.611 -19.997  1.00  0.78           C
ATOM    484  OD1 ASN B  63     -27.870 -31.689 -20.246  1.00  0.78           O
ATOM    485  ND2 ASN B  63     -27.484 -29.543 -20.809  1.00  0.78           N
ATOM    486  N   TYR B  64     -25.934 -27.224 -17.215  1.00  0.73           N
ATOM    487  CA  TYR B  64     -25.591 -25.834 -17.371  1.00  0.73           C
ATOM    488  C   TYR B  64     -24.399 -25.554 -16.478  1.00  0.73           C
ATOM    489  O   TYR B  64     -24.214 -26.213 -15.457  1.00  0.73           O
ATOM    490  CB  TYR B  64     -26.784 -24.866 -17.073  1.00  0.73           C
ATOM    491  CG  TYR B  64     -27.336 -24.999 -15.677  1.00  0.73           C
ATOM    492  CD1 TYR B  64     -28.137 -26.098 -15.333  1.00  0.73           C
ATOM    493  CD2 TYR B  64     -27.063 -24.030 -14.698  1.00  0.73           C
ATOM    494  CE1 TYR B  64     -28.606 -26.258 -14.026  1.00  0.73           C
ATOM    495  CE2 TYR B  64     -27.537 -24.185 -13.389  1.00  0.73           C
ATOM    496  CZ  TYR B  64     -28.304 -25.304 -13.052  1.00  0.73           C
ATOM    497  OH  TYR B  64     -28.770 -25.464 -11.735  1.00  0.73           O
ATOM    498  N   GLN B  65     -23.561 -24.572 -16.849  1.00  0.78           N
ATOM    499  CA  GLN B  65     -22.465 -24.117 -16.022  1.00  0.78           C
ATOM    500  C   GLN B  65     -22.661 -22.633 -15.775  1.00  0.78           C
ATOM    501  O   GLN B  65     -22.834 -21.843 -16.701  1.00  0.78           O
ATOM    502  CB  GLN B  65     -21.080 -24.360 -16.685  1.00  0.78           C
ATOM    503  CG  GLN B  65     -20.478 -25.779 -16.484  1.00  0.78           C
ATOM    504  CD  GLN B  65     -20.183 -26.124 -15.023  1.00  0.78           C
ATOM    505  OE1 GLN B  65     -20.621 -27.149 -14.498  1.00  0.78           O
ATOM    506  NE2 GLN B  65     -19.394 -25.259 -14.351  1.00  0.78           N
ATOM    507  N   VAL B  66     -22.663 -22.217 -14.500  1.00  0.80           N
ATOM    508  CA  VAL B  66     -22.678 -20.822 -14.120  1.00  0.80           C
ATOM    509  C   VAL B  66     -21.725 -20.724 -12.975  1.00  0.80           C
ATOM    510  O   VAL B  66     -21.863 -21.472 -12.014  1.00  0.80           O
ATOM    511  CB  VAL B  66     -24.032 -20.303 -13.638  1.00  0.80           C
ATOM    512  CG1 VAL B  66     -23.930 -18.807 -13.278  1.00  0.80           C
ATOM    513  CG2 VAL B  66     -25.117 -20.501 -14.707  1.00  0.80           C
ATOM    514  N   ASN B  67     -20.740 -19.807 -13.014  1.00  0.68           N
ATOM    515  CA  ASN B  67     -19.660 -19.740 -12.042  1.00  0.68           C
ATOM    516  C   ASN B  67     -20.127 -19.697 -10.588  1.00  0.68           C
ATOM    517  O   ASN B  67     -19.507 -20.287  -9.711  1.00  0.68           O
ATOM    518  CB  ASN B  67     -18.759 -18.505 -12.319  1.00  0.68           C
ATOM    519  CG  ASN B  67     -17.963 -18.691 -13.609  1.00  0.68           C
ATOM    520  OD1 ASN B  67     -18.483 -19.107 -14.644  1.00  0.68           O
ATOM    521  ND2 ASN B  67     -16.652 -18.360 -13.560  1.00  0.68           N
ATOM    522  N   GLY B  68     -21.253 -19.007 -10.310  1.00  0.77           N
ATOM    523  CA  GLY B  68     -21.835 -18.980  -8.975  1.00  0.77           C
ATOM    524  C   GLY B  68     -22.753 -20.119  -8.591  1.00  0.77           C
ATOM    525  O   GLY B  68     -23.137 -20.207  -7.433  1.00  0.77           O
ATOM    526  N   TYR B  69     -23.148 -21.030  -9.500  1.00  0.73           N
ATOM    527  CA  TYR B  69     -24.180 -22.019  -9.201  1.00  0.73           C
ATOM    528  C   TYR B  69     -23.554 -23.404  -9.208  1.00  0.73           C
ATOM    529  O   TYR B  69     -22.897 -23.758 -10.186  1.00  0.73           O
ATOM    530  CB  TYR B  69     -25.379 -22.022 -10.196  1.00  0.73           C
ATOM    531  CG  TYR B  69     -26.194 -20.769 -10.031  1.00  0.73           C
ATOM    532  CD1 TYR B  69     -27.426 -20.731  -9.356  1.00  0.73           C
ATOM    533  CD2 TYR B  69     -25.671 -19.570 -10.510  1.00  0.73           C
ATOM    534  CE1 TYR B  69     -28.081 -19.507  -9.149  1.00  0.73           C
ATOM    535  CE2 TYR B  69     -26.305 -18.351 -10.298  1.00  0.73           C
ATOM    536  CZ  TYR B  69     -27.514 -18.317  -9.606  1.00  0.73           C
ATOM    537  OH  TYR B  69     -28.180 -17.102  -9.400  1.00  0.73           O
ATOM    538  N   PRO B  70     -23.698 -24.220  -8.171  1.00  0.84           N
ATOM    539  CA  PRO B  70     -23.118 -25.553  -8.131  1.00  0.84           C
ATOM    540  C   PRO B  70     -23.871 -26.552  -8.993  1.00  0.84           C
ATOM    541  O   PRO B  70     -25.082 -26.457  -9.182  1.00  0.84           O
ATOM    542  CB  PRO B  70     -23.227 -25.924  -6.647  1.00  0.84           C
ATOM    543  CG  PRO B  70     -24.528 -25.252  -6.215  1.00  0.84           C
ATOM    544  CD  PRO B  70     -24.474 -23.928  -6.964  1.00  0.84           C
ATOM    545  N   ASN B  71     -23.138 -27.523  -9.556  1.00  0.86           N
ATOM    546  CA  ASN B  71     -23.658 -28.620 -10.341  1.00  0.86           C
ATOM    547  C   ASN B  71     -24.630 -29.505  -9.552  1.00  0.86           C
ATOM    548  O   ASN B  71     -24.271 -30.052  -8.515  1.00  0.86           O
ATOM    549  CB  ASN B  71     -22.501 -29.551 -10.824  1.00  0.86           C
ATOM    550  CG  ASN B  71     -21.288 -28.836 -11.431  1.00  0.86           C
ATOM    551  OD1 ASN B  71     -20.954 -27.681 -11.163  1.00  0.86           O
ATOM    552  ND2 ASN B  71     -20.539 -29.599 -12.260  1.00  0.86           N
ATOM    553  N   MET B  72     -25.880 -29.707 -10.030  1.00  0.85           N
ATOM    554  CA  MET B  72     -26.822 -30.607  -9.368  1.00  0.85           C
ATOM    555  C   MET B  72     -26.444 -32.076  -9.466  1.00  0.85           C
ATOM    556  O   MET B  72     -26.711 -32.881  -8.576  1.00  0.85           O
ATOM    557  CB  MET B  72     -28.266 -30.448  -9.893  1.00  0.85           C
ATOM    558  CG  MET B  72     -28.701 -28.981  -9.984  1.00  0.85           C
ATOM    559  SD  MET B  72     -30.455 -28.710 -10.372  1.00  0.85           S
ATOM    560  CE  MET B  72     -31.303 -30.080  -9.535  1.00  0.85           C
ATOM    561  N   PHE B  73     -25.813 -32.467 -10.584  1.00  0.90           N
ATOM    562  CA  PHE B  73     -25.340 -33.821 -10.778  1.00  0.90           C
ATOM    563  C   PHE B  73     -23.863 -33.903 -10.465  1.00  0.90           C
ATOM    564  O   PHE B  73     -23.073 -33.038 -10.842  1.00  0.90           O
ATOM    565  CB  PHE B  73     -25.578 -34.339 -12.217  1.00  0.90           C
ATOM    566  CG  PHE B  73     -26.970 -34.885 -12.350  1.00  0.90           C
ATOM    567  CD1 PHE B  73     -28.066 -34.025 -12.527  1.00  0.90           C
ATOM    568  CD2 PHE B  73     -27.196 -36.270 -12.270  1.00  0.90           C
ATOM    569  CE1 PHE B  73     -29.368 -34.534 -12.581  1.00  0.90           C
ATOM    570  CE2 PHE B  73     -28.495 -36.786 -12.337  1.00  0.90           C
ATOM    571  CZ  PHE B  73     -29.581 -35.914 -12.479  1.00  0.90           C
ATOM    572  N   ILE B  74     -23.471 -34.970  -9.754  1.00  0.92           N
ATOM    573  CA  ILE B  74     -22.121 -35.144  -9.254  1.00  0.92           C
ATOM    574  C   ILE B  74     -21.406 -36.266  -9.991  1.00  0.92           C
ATOM    575  O   ILE B  74     -22.012 -37.146 -10.595  1.00  0.92           O
ATOM    576  CB  ILE B  74     -22.117 -35.394  -7.750  1.00  0.92           C
ATOM    577  CG1 ILE B  74     -22.943 -36.645  -7.379  1.00  0.92           C
ATOM    578  CG2 ILE B  74     -22.653 -34.128  -7.053  1.00  0.92           C
ATOM    579  CD1 ILE B  74     -23.033 -36.888  -5.873  1.00  0.92           C
ATOM    580  N   THR B  75     -20.060 -36.272 -10.001  1.00  0.89           N
ATOM    581  CA  THR B  75     -19.252 -37.350 -10.582  1.00  0.89           C
ATOM    582  C   THR B  75     -19.425 -38.664  -9.822  1.00  0.89           C
ATOM    583  O   THR B  75     -19.737 -38.658  -8.636  1.00  0.89           O
ATOM    584  CB  THR B  75     -17.747 -37.046 -10.636  1.00  0.89           C
ATOM    585  OG1 THR B  75     -17.501 -35.661 -10.449  1.00  0.89           O
ATOM    586  CG2 THR B  75     -17.160 -37.426 -12.004  1.00  0.89           C
ATOM    587  N   ARG B  76     -19.168 -39.847 -10.450  1.00  0.80           N
ATOM    588  CA  ARG B  76     -19.176 -41.147  -9.754  1.00  0.80           C
ATOM    589  C   ARG B  76     -18.265 -41.115  -8.532  1.00  0.80           C
ATOM    590  O   ARG B  76     -18.676 -41.531  -7.455  1.00  0.80           O
ATOM    591  CB  ARG B  76     -18.741 -42.320 -10.710  1.00  0.80           C
ATOM    592  CG  ARG B  76     -18.227 -43.663 -10.087  1.00  0.80           C
ATOM    593  CD  ARG B  76     -19.234 -44.776  -9.681  1.00  0.80           C
ATOM    594  NE  ARG B  76     -19.393 -45.800 -10.794  1.00  0.80           N
ATOM    595  CZ  ARG B  76     -19.541 -47.129 -10.656  1.00  0.80           C
ATOM    596  NH1 ARG B  76     -19.631 -47.910 -11.736  1.00  0.80           N
ATOM    597  NH2 ARG B  76     -19.581 -47.762  -9.489  1.00  0.80           N
ATOM    598  N   GLU B  77     -17.041 -40.559  -8.672  1.00  0.82           N
ATOM    599  CA  GLU B  77     -16.099 -40.325  -7.595  1.00  0.82           C
ATOM    600  C   GLU B  77     -16.620 -39.396  -6.512  1.00  0.82           C
ATOM    601  O   GLU B  77     -16.481 -39.674  -5.328  1.00  0.82           O
ATOM    602  CB  GLU B  77     -14.801 -39.705  -8.146  1.00  0.82           C
ATOM    603  CG  GLU B  77     -13.694 -39.476  -7.084  1.00  0.82           C
ATOM    604  CD  GLU B  77     -12.663 -38.464  -7.565  1.00  0.82           C
ATOM    605  OE1 GLU B  77     -12.186 -38.590  -8.714  1.00  0.82           O
ATOM    606  OE2 GLU B  77     -12.415 -37.506  -6.780  1.00  0.82           O
ATOM    607  N   GLU B  78     -17.264 -38.265  -6.881  1.00  0.85           N
ATOM    608  CA  GLU B  78     -17.779 -37.336  -5.890  1.00  0.85           C
ATOM    609  C   GLU B  78     -18.864 -37.973  -5.042  1.00  0.85           C
ATOM    610  O   GLU B  78     -18.860 -37.868  -3.819  1.00  0.85           O
ATOM    611  CB  GLU B  78     -18.232 -35.992  -6.494  1.00  0.85           C
ATOM    612  CG  GLU B  78     -18.553 -34.957  -5.382  1.00  0.85           C
ATOM    613  CD  GLU B  78     -18.851 -33.541  -5.866  1.00  0.85           C
ATOM    614  OE1 GLU B  78     -19.108 -32.680  -4.972  1.00  0.85           O
ATOM    615  OE2 GLU B  78     -18.798 -33.307  -7.096  1.00  0.85           O
ATOM    616  N   ALA B  79     -19.749 -38.773  -5.662  1.00  0.93           N
ATOM    617  CA  ALA B  79     -20.701 -39.603  -4.955  1.00  0.93           C
ATOM    618  C   ALA B  79     -20.065 -40.576  -3.959  1.00  0.93           C
ATOM    619  O   ALA B  79     -20.598 -40.774  -2.874  1.00  0.93           O
ATOM    620  CB  ALA B  79     -21.615 -40.326  -5.961  1.00  0.93           C
ATOM    621  N   ILE B  80     -18.880 -41.155  -4.259  1.00  0.86           N
ATOM    622  CA  ILE B  80     -18.104 -41.968  -3.315  1.00  0.86           C
ATOM    623  C   ILE B  80     -17.688 -41.181  -2.087  1.00  0.86           C
ATOM    624  O   ILE B  80     -17.671 -41.676  -0.969  1.00  0.86           O
ATOM    625  CB  ILE B  80     -16.826 -42.552  -3.928  1.00  0.86           C
ATOM    626  CG1 ILE B  80     -17.073 -43.202  -5.296  1.00  0.86           C
ATOM    627  CG2 ILE B  80     -16.178 -43.597  -3.002  1.00  0.86           C
ATOM    628  CD1 ILE B  80     -18.258 -44.160  -5.330  1.00  0.86           C
ATOM    629  N   ARG B  81     -17.323 -39.907  -2.287  1.00  0.79           N
ATOM    630  CA  ARG B  81     -16.849 -39.012  -1.259  1.00  0.79           C
ATOM    631  C   ARG B  81     -17.892 -38.705  -0.194  1.00  0.79           C
ATOM    632  O   ARG B  81     -17.594 -38.656   0.996  1.00  0.79           O
ATOM    633  CB  ARG B  81     -16.297 -37.746  -1.952  1.00  0.79           C
ATOM    634  CG  ARG B  81     -15.068 -37.111  -1.281  1.00  0.79           C
ATOM    635  CD  ARG B  81     -14.575 -35.851  -2.009  1.00  0.79           C
ATOM    636  NE  ARG B  81     -14.215 -36.202  -3.430  1.00  0.79           N
ATOM    637  CZ  ARG B  81     -14.511 -35.451  -4.499  1.00  0.79           C
ATOM    638  NH1 ARG B  81     -15.130 -34.281  -4.377  1.00  0.79           N
ATOM    639  NH2 ARG B  81     -14.185 -35.869  -5.719  1.00  0.79           N
ATOM    640  N   HIS B  82     -19.160 -38.524  -0.605  1.00  0.85           N
ATOM    641  CA  HIS B  82     -20.244 -38.256   0.316  1.00  0.85           C
ATOM    642  C   HIS B  82     -21.228 -39.410   0.410  1.00  0.85           C
ATOM    643  O   HIS B  82     -22.258 -39.406  -0.260  1.00  0.85           O
ATOM    644  CB  HIS B  82     -21.039 -37.011  -0.134  1.00  0.85           C
ATOM    645  CG  HIS B  82     -20.215 -35.760  -0.205  1.00  0.85           C
ATOM    646  ND1 HIS B  82     -19.536 -35.459  -1.369  1.00  0.85           N
ATOM    647  CD2 HIS B  82     -20.001 -34.792   0.722  1.00  0.85           C
ATOM    648  CE1 HIS B  82     -18.918 -34.324  -1.131  1.00  0.85           C
ATOM    649  NE2 HIS B  82     -19.165 -33.874   0.122  1.00  0.85           N
ATOM    650  N   VAL B  83     -21.002 -40.411   1.285  1.00  0.86           N
ATOM    651  CA  VAL B  83     -21.925 -41.537   1.413  1.00  0.86           C
ATOM    652  C   VAL B  83     -22.797 -41.393   2.656  1.00  0.86           C
ATOM    653  O   VAL B  83     -22.378 -40.945   3.712  1.00  0.86           O
ATOM    654  CB  VAL B  83     -21.244 -42.893   1.392  1.00  0.86           C
ATOM    655  CG1 VAL B  83     -22.255 -44.039   1.219  1.00  0.86           C
ATOM    656  CG2 VAL B  83     -20.305 -42.992   0.190  1.00  0.86           C
ATOM    657  N   ARG B  84     -24.104 -41.692   2.516  1.00  0.63           N
ATOM    658  CA  ARG B  84     -25.147 -41.324   3.468  1.00  0.63           C
ATOM    659  C   ARG B  84     -25.445 -39.841   3.486  1.00  0.63           C
ATOM    660  O   ARG B  84     -26.244 -39.358   4.285  1.00  0.63           O
ATOM    661  CB  ARG B  84     -25.084 -41.912   4.895  1.00  0.63           C
ATOM    662  CG  ARG B  84     -26.344 -42.719   5.287  1.00  0.63           C
ATOM    663  CD  ARG B  84     -27.685 -42.001   5.069  1.00  0.63           C
ATOM    664  NE  ARG B  84     -28.746 -42.829   5.715  1.00  0.63           N
ATOM    665  CZ  ARG B  84     -29.274 -43.942   5.197  1.00  0.63           C
ATOM    666  NH1 ARG B  84     -29.010 -44.338   3.956  1.00  0.63           N
ATOM    667  NH2 ARG B  84     -30.076 -44.680   5.962  1.00  0.63           N
ATOM    668  N   ALA B  85     -24.936 -39.118   2.478  1.00  0.89           N
ATOM    669  CA  ALA B  85     -25.745 -38.163   1.764  1.00  0.89           C
ATOM    670  C   ALA B  85     -26.729 -38.929   0.881  1.00  0.89           C
ATOM    671  O   ALA B  85     -27.804 -38.442   0.552  1.00  0.89           O
ATOM    672  CB  ALA B  85     -24.842 -37.260   0.914  1.00  0.89           C
ATOM    673  N   TRP B  86     -26.363 -40.185   0.534  1.00  0.89           N
ATOM    674  CA  TRP B  86     -27.115 -41.143  -0.253  1.00  0.89           C
ATOM    675  C   TRP B  86     -28.476 -41.518   0.306  1.00  0.89           C
ATOM    676  O   TRP B  86     -28.598 -42.227   1.316  1.00  0.89           O
ATOM    677  CB  TRP B  86     -26.341 -42.479  -0.485  1.00  0.89           C
ATOM    678  CG  TRP B  86     -25.056 -42.396  -1.308  1.00  0.89           C
ATOM    679  CD1 TRP B  86     -24.256 -41.317  -1.547  1.00  0.89           C
ATOM    680  CD2 TRP B  86     -24.470 -43.492  -2.031  1.00  0.89           C
ATOM    681  NE1 TRP B  86     -23.241 -41.652  -2.397  1.00  0.89           N
ATOM    682  CE2 TRP B  86     -23.349 -42.963  -2.736  1.00  0.89           C
ATOM    683  CE3 TRP B  86     -24.808 -44.833  -2.151  1.00  0.89           C
ATOM    684  CZ2 TRP B  86     -22.591 -43.758  -3.573  1.00  0.89           C
ATOM    685  CZ3 TRP B  86     -23.998 -45.643  -2.951  1.00  0.89           C
ATOM    686  CH2 TRP B  86     -22.921 -45.112  -3.677  1.00  0.89           C
ATOM    687  N   ILE B  87     -29.524 -41.098  -0.421  1.00  0.92           N
ATOM    688  CA  ILE B  87     -30.898 -41.497  -0.214  1.00  0.92           C
ATOM    689  C   ILE B  87     -31.441 -41.950  -1.551  1.00  0.92           C
ATOM    690  O   ILE B  87     -31.215 -41.315  -2.579  1.00  0.92           O
ATOM    691  CB  ILE B  87     -31.784 -40.414   0.389  1.00  0.92           C
ATOM    692  CG1 ILE B  87     -30.927 -39.234   0.894  1.00  0.92           C
ATOM    693  CG2 ILE B  87     -32.597 -41.084   1.516  1.00  0.92           C
ATOM    694  CD1 ILE B  87     -31.706 -38.191   1.681  1.00  0.92           C
ATOM    695  N   GLY B  88     -32.128 -43.102  -1.610  1.00  0.96           N
ATOM    696  CA  GLY B  88     -32.683 -43.610  -2.860  1.00  0.96           C
ATOM    697  C   GLY B  88     -33.933 -42.864  -3.197  1.00  0.96           C
ATOM    698  O   GLY B  88     -34.648 -42.443  -2.300  1.00  0.96           O
ATOM    699  N   PHE B  89     -34.231 -42.692  -4.492  1.00  0.92           N
ATOM    700  CA  PHE B  89     -35.424 -41.981  -4.900  1.00  0.92           C
ATOM    701  C   PHE B  89     -35.986 -42.638  -6.138  1.00  0.92           C
ATOM    702  O   PHE B  89     -35.254 -42.932  -7.089  1.00  0.92           O
ATOM    703  CB  PHE B  89     -35.130 -40.464  -5.109  1.00  0.92           C
ATOM    704  CG  PHE B  89     -36.335 -39.548  -5.142  1.00  0.92           C
ATOM    705  CD1 PHE B  89     -37.488 -39.751  -4.359  1.00  0.92           C
ATOM    706  CD2 PHE B  89     -36.266 -38.385  -5.928  1.00  0.92           C
ATOM    707  CE1 PHE B  89     -38.562 -38.853  -4.419  1.00  0.92           C
ATOM    708  CE2 PHE B  89     -37.340 -37.494  -6.002  1.00  0.92           C
ATOM    709  CZ  PHE B  89     -38.496 -37.736  -5.257  1.00  0.92           C
ATOM    710  N   ASP B  90     -37.291 -42.919  -6.113  1.00  0.93           N
ATOM    711  CA  ASP B  90     -38.061 -43.448  -7.211  1.00  0.93           C
ATOM    712  C   ASP B  90     -39.501 -42.999  -6.962  1.00  0.93           C
ATOM    713  O   ASP B  90     -39.965 -42.985  -5.818  1.00  0.93           O
ATOM    714  CB  ASP B  90     -37.896 -44.980  -7.285  1.00  0.93           C
ATOM    715  CG  ASP B  90     -38.556 -45.530  -8.536  1.00  0.93           C
ATOM    716  OD1 ASP B  90     -37.805 -45.934  -9.457  1.00  0.93           O
ATOM    717  OD2 ASP B  90     -39.810 -45.545  -8.567  1.00  0.93           O
ATOM    718  N   VAL B  91     -40.226 -42.544  -7.997  1.00  0.93           N
ATOM    719  CA  VAL B  91     -41.553 -41.994  -7.828  1.00  0.93           C
ATOM    720  C   VAL B  91     -42.561 -42.589  -8.792  1.00  0.93           C
ATOM    721  O   VAL B  91     -42.600 -42.278  -9.984  1.00  0.93           O
ATOM    722  CB  VAL B  91     -41.549 -40.473  -7.975  1.00  0.93           C
ATOM    723  CG1 VAL B  91     -42.966 -39.907  -7.783  1.00  0.93           C
ATOM    724  CG2 VAL B  91     -40.636 -39.838  -6.911  1.00  0.93           C
ATOM    725  N   GLU B  92     -43.501 -43.396  -8.279  1.00  0.89           N
ATOM    726  CA  GLU B  92     -44.671 -43.825  -9.019  1.00  0.89           C
ATOM    727  C   GLU B  92     -45.549 -42.650  -9.445  1.00  0.89           C
ATOM    728  O   GLU B  92     -45.753 -41.694  -8.693  1.00  0.89           O
ATOM    729  CB  GLU B  92     -45.495 -44.807  -8.176  1.00  0.89           C
ATOM    730  CG  GLU B  92     -44.872 -46.224  -8.127  1.00  0.89           C
ATOM    731  CD  GLU B  92     -45.208 -47.084  -9.351  1.00  0.89           C
ATOM    732  OE1 GLU B  92     -45.965 -48.067  -9.167  1.00  0.89           O
ATOM    733  OE2 GLU B  92     -44.770 -46.758 -10.484  1.00  0.89           O
ATOM    734  N   GLY B  93     -46.085 -42.691 -10.684  1.00  0.95           N
ATOM    735  CA  GLY B  93     -46.807 -41.568 -11.280  1.00  0.95           C
ATOM    736  C   GLY B  93     -48.231 -41.819 -11.695  1.00  0.95           C
ATOM    737  O   GLY B  93     -48.783 -42.913 -11.587  1.00  0.95           O
ATOM    738  N   CYS B  94     -48.874 -40.762 -12.209  1.00  0.93           N
ATOM    739  CA  CYS B  94     -50.226 -40.815 -12.705  1.00  0.93           C
ATOM    740  C   CYS B  94     -50.406 -39.825 -13.834  1.00  0.93           C
ATOM    741  O   CYS B  94     -49.839 -38.735 -13.823  1.00  0.93           O
ATOM    742  CB  CYS B  94     -51.244 -40.532 -11.570  1.00  0.93           C
ATOM    743  SG  CYS B  94     -50.956 -38.973 -10.655  1.00  0.93           S
ATOM    744  N   HIS B  95     -51.214 -40.170 -14.856  1.00  0.88           N
ATOM    745  CA  HIS B  95     -51.353 -39.325 -16.031  1.00  0.88           C
ATOM    746  C   HIS B  95     -52.708 -38.681 -16.045  1.00  0.88           C
ATOM    747  O   HIS B  95     -53.718 -39.362 -15.857  1.00  0.88           O
ATOM    748  CB  HIS B  95     -51.234 -40.071 -17.388  1.00  0.88           C
ATOM    749  CG  HIS B  95     -50.567 -41.392 -17.279  1.00  0.88           C
ATOM    750  ND1 HIS B  95     -49.240 -41.536 -17.610  1.00  0.88           N
ATOM    751  CD2 HIS B  95     -51.067 -42.555 -16.796  1.00  0.88           C
ATOM    752  CE1 HIS B  95     -48.946 -42.780 -17.306  1.00  0.88           C
ATOM    753  NE2 HIS B  95     -50.018 -43.440 -16.812  1.00  0.88           N
ATOM    754  N   ALA B  96     -52.801 -37.376 -16.337  1.00  0.92           N
ATOM    755  CA  ALA B  96     -54.083 -36.735 -16.561  1.00  0.92           C
ATOM    756  C   ALA B  96     -54.968 -37.393 -17.641  1.00  0.92           C
ATOM    757  O   ALA B  96     -54.503 -37.911 -18.660  1.00  0.92           O
ATOM    758  CB  ALA B  96     -53.906 -35.229 -16.819  1.00  0.92           C
ATOM    759  N   THR B  97     -56.295 -37.452 -17.376  1.00  0.84           N
ATOM    760  CA  THR B  97     -57.248 -38.141 -18.255  1.00  0.84           C
ATOM    761  C   THR B  97     -58.264 -37.199 -18.848  1.00  0.84           C
ATOM    762  O   THR B  97     -58.699 -37.372 -19.984  1.00  0.84           O
ATOM    763  CB  THR B  97     -58.102 -39.219 -17.569  1.00  0.84           C
ATOM    764  OG1 THR B  97     -57.335 -39.908 -16.607  1.00  0.84           O
ATOM    765  CG2 THR B  97     -58.593 -40.279 -18.573  1.00  0.84           C
ATOM    766  N   ARG B  98     -58.712 -36.179 -18.089  1.00  0.81           N
ATOM    767  CA  ARG B  98     -59.990 -35.537 -18.365  1.00  0.81           C
ATOM    768  C   ARG B  98     -59.854 -34.150 -18.967  1.00  0.81           C
ATOM    769  O   ARG B  98     -60.027 -34.016 -20.175  1.00  0.81           O
ATOM    770  CB  ARG B  98     -60.893 -35.545 -17.107  1.00  0.81           C
ATOM    771  CG  ARG B  98     -62.360 -35.143 -17.365  1.00  0.81           C
ATOM    772  CD  ARG B  98     -63.286 -35.273 -16.142  1.00  0.81           C
ATOM    773  NE  ARG B  98     -63.607 -36.724 -15.902  1.00  0.81           N
ATOM    774  CZ  ARG B  98     -64.601 -37.388 -16.516  1.00  0.81           C
ATOM    775  NH1 ARG B  98     -65.331 -36.824 -17.472  1.00  0.81           N
ATOM    776  NH2 ARG B  98     -64.870 -38.643 -16.159  1.00  0.81           N
ATOM    777  N   GLU B  99     -59.543 -33.109 -18.154  1.00  0.85           N
ATOM    778  CA  GLU B  99     -59.361 -31.715 -18.563  1.00  0.85           C
ATOM    779  C   GLU B  99     -58.194 -31.566 -19.540  1.00  0.85           C
ATOM    780  O   GLU B  99     -58.195 -30.746 -20.458  1.00  0.85           O
ATOM    781  CB  GLU B  99     -59.184 -30.842 -17.283  1.00  0.85           C
ATOM    782  CG  GLU B  99     -59.155 -29.301 -17.448  1.00  0.85           C
ATOM    783  CD  GLU B  99     -59.087 -28.597 -16.108  1.00  0.85           C
ATOM    784  OE1 GLU B  99     -59.002 -27.344 -16.112  1.00  0.85           O
ATOM    785  OE2 GLU B  99     -59.115 -29.264 -15.043  1.00  0.85           O
ATOM    786  N   ALA B 100     -57.173 -32.430 -19.385  1.00  0.90           N
ATOM    787  CA  ALA B 100     -55.977 -32.413 -20.180  1.00  0.90           C
ATOM    788  C   ALA B 100     -55.379 -33.816 -20.239  1.00  0.90           C
ATOM    789  O   ALA B 100     -55.744 -34.683 -19.436  1.00  0.90           O
ATOM    790  CB  ALA B 100     -55.022 -31.404 -19.527  1.00  0.90           C
ATOM    791  N   VAL B 101     -54.489 -34.104 -21.205  1.00  0.91           N
ATOM    792  CA  VAL B 101     -53.886 -35.407 -21.429  1.00  0.91           C
ATOM    793  C   VAL B 101     -52.449 -35.249 -21.842  1.00  0.91           C
ATOM    794  O   VAL B 101     -52.116 -34.403 -22.708  1.00  0.91           O
ATOM    795  CB  VAL B 101     -54.623 -36.236 -22.496  1.00  0.91           C
ATOM    796  CG1 VAL B 101     -53.761 -37.382 -23.075  1.00  0.91           C
ATOM    797  CG2 VAL B 101     -55.891 -36.846 -21.875  1.00  0.91           C
ATOM    798  N   GLY B 102     -51.527 -36.079 -21.349  1.00  0.92           N
ATOM    799  CA  GLY B 102     -50.209 -36.234 -21.947  1.00  0.92           C
ATOM    800  C   GLY B 102     -49.007 -36.015 -21.081  1.00  0.92           C
ATOM    801  O   GLY B 102     -47.892 -36.203 -21.555  1.00  0.92           O
ATOM    802  N   THR B 103     -49.191 -35.762 -19.774  1.00  0.93           N
ATOM    803  CA  THR B 103     -48.058 -35.617 -18.863  1.00  0.93           C
ATOM    804  C   THR B 103     -48.290 -36.506 -17.664  1.00  0.93           C
ATOM    805  O   THR B 103     -49.397 -37.007 -17.459  1.00  0.93           O
ATOM    806  CB  THR B 103     -47.770 -34.182 -18.411  1.00  0.93           C
ATOM    807  OG1 THR B 103     -46.556 -34.091 -17.675  1.00  0.93           O
ATOM    808  CG2 THR B 103     -48.917 -33.655 -17.539  1.00  0.93           C
ATOM    809  N   ASN B 104     -47.236 -36.712 -16.857  1.00  0.92           N
ATOM    810  CA  ASN B 104     -47.235 -37.514 -15.657  1.00  0.92           C
ATOM    811  C   ASN B 104     -47.068 -36.580 -14.473  1.00  0.92           C
ATOM    812  O   ASN B 104     -46.369 -35.570 -14.525  1.00  0.92           O
ATOM    813  CB  ASN B 104     -46.062 -38.535 -15.617  1.00  0.92           C
ATOM    814  CG  ASN B 104     -46.507 -39.956 -15.920  1.00  0.92           C
ATOM    815  OD1 ASN B 104     -47.223 -40.594 -15.129  1.00  0.92           O
ATOM    816  ND2 ASN B 104     -46.090 -40.486 -17.078  1.00  0.92           N
ATOM    817  N   LEU B 105     -47.739 -36.920 -13.369  1.00  0.94           N
ATOM    818  CA  LEU B 105     -47.757 -36.176 -12.137  1.00  0.94           C
ATOM    819  C   LEU B 105     -47.240 -37.136 -11.067  1.00  0.94           C
ATOM    820  O   LEU B 105     -47.518 -38.333 -11.184  1.00  0.94           O
ATOM    821  CB  LEU B 105     -49.215 -35.758 -11.819  1.00  0.94           C
ATOM    822  CG  LEU B 105     -49.946 -35.047 -12.983  1.00  0.94           C
ATOM    823  CD1 LEU B 105     -51.458 -35.275 -12.886  1.00  0.94           C
ATOM    824  CD2 LEU B 105     -49.654 -33.546 -13.069  1.00  0.94           C
ATOM    825  N   PRO B 106     -46.464 -36.753 -10.057  1.00  0.96           N
ATOM    826  CA  PRO B 106     -46.109 -37.638  -8.944  1.00  0.96           C
ATOM    827  C   PRO B 106     -47.297 -38.182  -8.148  1.00  0.96           C
ATOM    828  O   PRO B 106     -48.118 -37.390  -7.695  1.00  0.96           O
ATOM    829  CB  PRO B 106     -45.201 -36.767  -8.058  1.00  0.96           C
ATOM    830  CG  PRO B 106     -45.638 -35.329  -8.351  1.00  0.96           C
ATOM    831  CD  PRO B 106     -46.014 -35.377  -9.830  1.00  0.96           C
ATOM    832  N   LEU B 107     -47.390 -39.517  -7.933  1.00  0.93           N
ATOM    833  CA  LEU B 107     -48.384 -40.110  -7.045  1.00  0.93           C
ATOM    834  C   LEU B 107     -47.760 -40.603  -5.748  1.00  0.93           C
ATOM    835  O   LEU B 107     -48.084 -40.116  -4.668  1.00  0.93           O
ATOM    836  CB  LEU B 107     -49.135 -41.285  -7.722  1.00  0.93           C
ATOM    837  CG  LEU B 107     -50.212 -41.981  -6.855  1.00  0.93           C
ATOM    838  CD1 LEU B 107     -51.208 -40.980  -6.255  1.00  0.93           C
ATOM    839  CD2 LEU B 107     -50.953 -43.023  -7.696  1.00  0.93           C
ATOM    840  N   GLN B 108     -46.832 -41.585  -5.807  1.00  0.90           N
ATOM    841  CA  GLN B 108     -46.205 -42.143  -4.614  1.00  0.90           C
ATOM    842  C   GLN B 108     -44.707 -41.957  -4.677  1.00  0.90           C
ATOM    843  O   GLN B 108     -44.026 -42.441  -5.572  1.00  0.90           O
ATOM    844  CB  GLN B 108     -46.518 -43.649  -4.376  1.00  0.90           C
ATOM    845  CG  GLN B 108     -45.869 -44.244  -3.094  1.00  0.90           C
ATOM    846  CD  GLN B 108     -46.154 -45.737  -2.925  1.00  0.90           C
ATOM    847  OE1 GLN B 108     -45.674 -46.589  -3.675  1.00  0.90           O
ATOM    848  NE2 GLN B 108     -46.948 -46.092  -1.892  1.00  0.90           N
ATOM    849  N   LEU B 109     -44.152 -41.241  -3.693  1.00  0.93           N
ATOM    850  CA  LEU B 109     -42.755 -40.896  -3.622  1.00  0.93           C
ATOM    851  C   LEU B 109     -42.049 -41.823  -2.651  1.00  0.93           C
ATOM    852  O   LEU B 109     -42.329 -41.836  -1.449  1.00  0.93           O
ATOM    853  CB  LEU B 109     -42.553 -39.428  -3.167  1.00  0.93           C
ATOM    854  CG  LEU B 109     -42.972 -38.352  -4.191  1.00  0.93           C
ATOM    855  CD1 LEU B 109     -44.496 -38.163  -4.253  1.00  0.93           C
ATOM    856  CD2 LEU B 109     -42.313 -37.014  -3.839  1.00  0.93           C
ATOM    857  N   GLY B 110     -41.116 -42.639  -3.180  1.00  0.94           N
ATOM    858  CA  GLY B 110     -40.416 -43.652  -2.419  1.00  0.94           C
ATOM    859  C   GLY B 110     -38.968 -43.364  -2.199  1.00  0.94           C
ATOM    860  O   GLY B 110     -38.283 -42.773  -3.033  1.00  0.94           O
ATOM    861  N   PHE B 111     -38.458 -43.827  -1.050  1.00  0.89           N
ATOM    862  CA  PHE B 111     -37.149 -43.489  -0.550  1.00  0.89           C
ATOM    863  C   PHE B 111     -36.420 -44.732  -0.087  1.00  0.89           C
ATOM    864  O   PHE B 111     -37.015 -45.786   0.090  1.00  0.89           O
ATOM    865  CB  PHE B 111     -37.250 -42.506   0.640  1.00  0.89           C
ATOM    866  CG  PHE B 111     -37.733 -41.166   0.174  1.00  0.89           C
ATOM    867  CD1 PHE B 111     -36.802 -40.184  -0.196  1.00  0.89           C
ATOM    868  CD2 PHE B 111     -39.105 -40.868   0.108  1.00  0.89           C
ATOM    869  CE1 PHE B 111     -37.232 -38.924  -0.625  1.00  0.89           C
ATOM    870  CE2 PHE B 111     -39.537 -39.612  -0.334  1.00  0.89           C
ATOM    871  CZ  PHE B 111     -38.600 -38.639  -0.701  1.00  0.89           C
ATOM    872  N   SER B 112     -35.085 -44.660   0.121  1.00  0.89           N
ATOM    873  CA  SER B 112     -34.323 -45.800   0.628  1.00  0.89           C
ATOM    874  C   SER B 112     -34.612 -46.107   2.083  1.00  0.89           C
ATOM    875  O   SER B 112     -34.387 -47.210   2.573  1.00  0.89           O
ATOM    876  CB  SER B 112     -32.788 -45.616   0.474  1.00  0.89           C
ATOM    877  OG  SER B 112     -32.346 -44.328   0.932  1.00  0.89           O
ATOM    878  N   THR B 113     -35.114 -45.113   2.821  1.00  0.88           N
ATOM    879  CA  THR B 113     -35.807 -45.252   4.088  1.00  0.88           C
ATOM    880  C   THR B 113     -37.159 -45.895   3.860  1.00  0.88           C
ATOM    881  O   THR B 113     -37.753 -45.744   2.804  1.00  0.88           O
ATOM    882  CB  THR B 113     -36.014 -43.904   4.779  1.00  0.88           C
ATOM    883  OG1 THR B 113     -35.146 -42.914   4.234  1.00  0.88           O
ATOM    884  CG2 THR B 113     -35.681 -44.038   6.267  1.00  0.88           C
ATOM    885  N   GLY B 114     -37.751 -46.609   4.841  1.00  0.90           N
ATOM    886  CA  GLY B 114     -38.966 -47.390   4.571  1.00  0.90           C
ATOM    887  C   GLY B 114     -40.228 -46.571   4.439  1.00  0.90           C
ATOM    888  O   GLY B 114     -41.331 -47.095   4.310  1.00  0.90           O
ATOM    889  N   VAL B 115     -40.086 -45.244   4.508  1.00  0.88           N
ATOM    890  CA  VAL B 115     -41.112 -44.262   4.284  1.00  0.88           C
ATOM    891  C   VAL B 115     -41.702 -44.272   2.876  1.00  0.88           C
ATOM    892  O   VAL B 115     -41.027 -44.521   1.878  1.00  0.88           O
ATOM    893  CB  VAL B 115     -40.646 -42.849   4.634  1.00  0.88           C
ATOM    894  CG1 VAL B 115     -39.845 -42.822   5.947  1.00  0.88           C
ATOM    895  CG2 VAL B 115     -39.760 -42.251   3.531  1.00  0.88           C
ATOM    896  N   ASN B 116     -43.003 -43.956   2.765  1.00  0.89           N
ATOM    897  CA  ASN B 116     -43.644 -43.705   1.491  1.00  0.89           C
ATOM    898  C   ASN B 116     -44.539 -42.506   1.682  1.00  0.89           C
ATOM    899  O   ASN B 116     -45.354 -42.462   2.604  1.00  0.89           O
ATOM    900  CB  ASN B 116     -44.503 -44.894   0.979  1.00  0.89           C
ATOM    901  CG  ASN B 116     -43.618 -45.882   0.237  1.00  0.89           C
ATOM    902  OD1 ASN B 116     -43.184 -45.605  -0.887  1.00  0.89           O
ATOM    903  ND2 ASN B 116     -43.326 -47.049   0.845  1.00  0.89           N
ATOM    904  N   LEU B 117     -44.413 -41.496   0.810  1.00  0.93           N
ATOM    905  CA  LEU B 117     -45.285 -40.343   0.852  1.00  0.93           C
ATOM    906  C   LEU B 117     -46.127 -40.385  -0.397  1.00  0.93           C
ATOM    907  O   LEU B 117     -45.638 -40.639  -1.493  1.00  0.93           O
ATOM    908  CB  LEU B 117     -44.534 -38.991   0.943  1.00  0.93           C
ATOM    909  CG  LEU B 117     -43.710 -38.805   2.236  1.00  0.93           C
ATOM    910  CD1 LEU B 117     -42.799 -37.585   2.109  1.00  0.93           C
ATOM    911  CD2 LEU B 117     -44.573 -38.671   3.499  1.00  0.93           C
ATOM    912  N   VAL B 118     -47.440 -40.174  -0.258  1.00  0.94           N
ATOM    913  CA  VAL B 118     -48.365 -40.193  -1.368  1.00  0.94           C
ATOM    914  C   VAL B 118     -48.978 -38.815  -1.466  1.00  0.94           C
ATOM    915  O   VAL B 118     -49.291 -38.181  -0.457  1.00  0.94           O
ATOM    916  CB  VAL B 118     -49.402 -41.314  -1.266  1.00  0.94           C
ATOM    917  CG1 VAL B 118     -49.949 -41.436   0.168  1.00  0.94           C
ATOM    918  CG2 VAL B 118     -50.537 -41.109  -2.288  1.00  0.94           C
ATOM    919  N   ALA B 119     -49.094 -38.291  -2.696  1.00  0.95           N
ATOM    920  CA  ALA B 119     -49.591 -36.970  -2.968  1.00  0.95           C
ATOM    921  C   ALA B 119     -50.834 -37.052  -3.832  1.00  0.95           C
ATOM    922  O   ALA B 119     -50.959 -37.922  -4.692  1.00  0.95           O
ATOM    923  CB  ALA B 119     -48.529 -36.140  -3.702  1.00  0.95           C
ATOM    924  N   VAL B 120     -51.815 -36.142  -3.641  1.00  0.91           N
ATOM    925  CA  VAL B 120     -52.903 -36.021  -4.601  1.00  0.91           C
ATOM    926  C   VAL B 120     -52.394 -35.507  -5.934  1.00  0.91           C
ATOM    927  O   VAL B 120     -51.479 -34.694  -5.896  1.00  0.91           O
ATOM    928  CB  VAL B 120     -54.037 -35.109  -4.159  1.00  0.91           C
ATOM    929  CG1 VAL B 120     -54.848 -35.797  -3.053  1.00  0.91           C
ATOM    930  CG2 VAL B 120     -53.498 -33.742  -3.700  1.00  0.91           C
ATOM    931  N   PRO B 121     -52.892 -35.891  -7.113  1.00  0.94           N
ATOM    932  CA  PRO B 121     -52.395 -35.392  -8.392  1.00  0.94           C
ATOM    933  C   PRO B 121     -52.391 -33.880  -8.477  1.00  0.94           C
ATOM    934  O   PRO B 121     -53.459 -33.266  -8.438  1.00  0.94           O
ATOM    935  CB  PRO B 121     -53.351 -36.004  -9.434  1.00  0.94           C
ATOM    936  CG  PRO B 121     -53.913 -37.253  -8.752  1.00  0.94           C
ATOM    937  CD  PRO B 121     -53.961 -36.865  -7.278  1.00  0.94           C
ATOM    938  N   THR B 122     -51.211 -33.261  -8.630  1.00  0.94           N
ATOM    939  CA  THR B 122     -51.103 -31.814  -8.738  1.00  0.94           C
ATOM    940  C   THR B 122     -50.185 -31.447  -9.880  1.00  0.94           C
ATOM    941  O   THR B 122     -49.172 -32.094 -10.154  1.00  0.94           O
ATOM    942  CB  THR B 122     -50.684 -31.028  -7.485  1.00  0.94           C
ATOM    943  OG1 THR B 122     -49.335 -31.262  -7.128  1.00  0.94           O
ATOM    944  CG2 THR B 122     -51.534 -31.376  -6.254  1.00  0.94           C
ATOM    945  N   GLY B 123     -50.557 -30.386 -10.616  1.00  0.94           N
ATOM    946  CA  GLY B 123     -49.807 -29.935 -11.775  1.00  0.94           C
ATOM    947  C   GLY B 123     -49.812 -28.445 -11.903  1.00  0.94           C
ATOM    948  O   GLY B 123     -50.385 -27.718 -11.096  1.00  0.94           O
ATOM    949  N   TYR B 124     -49.174 -27.945 -12.970  1.00  0.86           N
ATOM    950  CA  TYR B 124     -49.051 -26.527 -13.222  1.00  0.86           C
ATOM    951  C   TYR B 124     -50.011 -26.193 -14.351  1.00  0.86           C
ATOM    952  O   TYR B 124     -49.963 -26.794 -15.424  1.00  0.86           O
ATOM    953  CB  TYR B 124     -47.593 -26.151 -13.607  1.00  0.86           C
ATOM    954  CG  TYR B 124     -46.661 -26.146 -12.414  1.00  0.86           C
ATOM    955  CD1 TYR B 124     -46.196 -27.341 -11.829  1.00  0.86           C
ATOM    956  CD2 TYR B 124     -46.174 -24.924 -11.914  1.00  0.86           C
ATOM    957  CE1 TYR B 124     -45.269 -27.312 -10.774  1.00  0.86           C
ATOM    958  CE2 TYR B 124     -45.259 -24.892 -10.854  1.00  0.86           C
ATOM    959  CZ  TYR B 124     -44.811 -26.084 -10.283  1.00  0.86           C
ATOM    960  OH  TYR B 124     -43.945 -26.023  -9.175  1.00  0.86           O
ATOM    961  N   VAL B 125     -50.955 -25.264 -14.100  1.00  0.87           N
ATOM    962  CA  VAL B 125     -52.030 -24.959 -15.028  1.00  0.87           C
ATOM    963  C   VAL B 125     -52.076 -23.468 -15.379  1.00  0.87           C
ATOM    964  O   VAL B 125     -52.180 -22.602 -14.509  1.00  0.87           O
ATOM    965  CB  VAL B 125     -53.371 -25.436 -14.464  1.00  0.87           C
ATOM    966  CG1 VAL B 125     -54.524 -25.045 -15.403  1.00  0.87           C
ATOM    967  CG2 VAL B 125     -53.346 -26.972 -14.285  1.00  0.87           C
ATOM    968  N   ASP B 126     -52.011 -23.128 -16.685  1.00  0.81           N
ATOM    969  CA  ASP B 126     -51.992 -21.765 -17.195  1.00  0.81           C
ATOM    970  C   ASP B 126     -53.392 -21.173 -17.306  1.00  0.81           C
ATOM    971  O   ASP B 126     -54.297 -21.791 -17.870  1.00  0.81           O
ATOM    972  CB  ASP B 126     -51.417 -21.676 -18.641  1.00  0.81           C
ATOM    973  CG  ASP B 126     -49.924 -21.934 -18.694  1.00  0.81           C
ATOM    974  OD1 ASP B 126     -49.457 -22.844 -17.979  1.00  0.81           O
ATOM    975  OD2 ASP B 126     -49.248 -21.182 -19.450  1.00  0.81           O
ATOM    976  N   THR B 127     -53.582 -19.930 -16.817  1.00  0.77           N
ATOM    977  CA  THR B 127     -54.827 -19.169 -16.897  1.00  0.77           C
ATOM    978  C   THR B 127     -54.544 -17.821 -17.564  1.00  0.77           C
ATOM    979  O   THR B 127     -53.385 -17.549 -17.871  1.00  0.77           O
ATOM    980  CB  THR B 127     -55.448 -18.914 -15.528  1.00  0.77           C
ATOM    981  OG1 THR B 127     -54.518 -18.241 -14.695  1.00  0.77           O
ATOM    982  CG2 THR B 127     -55.818 -20.256 -14.884  1.00  0.77           C
ATOM    983  N   PRO B 128     -55.480 -16.911 -17.873  1.00  0.72           N
ATOM    984  CA  PRO B 128     -55.115 -15.645 -18.504  1.00  0.72           C
ATOM    985  C   PRO B 128     -54.214 -14.765 -17.671  1.00  0.72           C
ATOM    986  O   PRO B 128     -53.471 -13.985 -18.259  1.00  0.72           O
ATOM    987  CB  PRO B 128     -56.436 -14.947 -18.837  1.00  0.72           C
ATOM    988  CG  PRO B 128     -57.433 -16.097 -18.992  1.00  0.72           C
ATOM    989  CD  PRO B 128     -56.875 -17.250 -18.145  1.00  0.72           C
ATOM    990  N   ASN B 129     -54.275 -14.828 -16.336  1.00  0.58           N
ATOM    991  CA  ASN B 129     -53.519 -13.953 -15.458  1.00  0.58           C
ATOM    992  C   ASN B 129     -52.191 -14.530 -15.006  1.00  0.58           C
ATOM    993  O   ASN B 129     -51.220 -13.796 -14.832  1.00  0.58           O
ATOM    994  CB  ASN B 129     -54.350 -13.541 -14.207  1.00  0.58           C
ATOM    995  CG  ASN B 129     -55.508 -14.491 -13.909  1.00  0.58           C
ATOM    996  OD1 ASN B 129     -55.334 -15.665 -13.595  1.00  0.58           O
ATOM    997  ND2 ASN B 129     -56.753 -13.985 -14.031  1.00  0.58           N
ATOM    998  N   ASN B 130     -52.118 -15.851 -14.793  1.00  0.67           N
ATOM    999  CA  ASN B 130     -50.942 -16.468 -14.225  1.00  0.67           C
ATOM   1000  C   ASN B 130     -50.805 -17.935 -14.568  1.00  0.67           C
ATOM   1001  O   ASN B 130     -51.540 -18.516 -15.365  1.00  0.67           O
ATOM   1002  CB  ASN B 130     -50.804 -16.245 -12.693  1.00  0.67           C
ATOM   1003  CG  ASN B 130     -52.037 -16.668 -11.904  1.00  0.67           C
ATOM   1004  OD1 ASN B 130     -52.928 -17.389 -12.350  1.00  0.67           O
ATOM   1005  ND2 ASN B 130     -52.089 -16.201 -10.640  1.00  0.67           N
ATOM   1006  N   THR B 131     -49.762 -18.538 -13.995  1.00  0.72           N
ATOM   1007  CA  THR B 131     -49.536 -19.967 -13.956  1.00  0.72           C
ATOM   1008  C   THR B 131     -49.801 -20.409 -12.546  1.00  0.72           C
ATOM   1009  O   THR B 131     -49.184 -19.907 -11.610  1.00  0.72           O
ATOM   1010  CB  THR B 131     -48.115 -20.390 -14.307  1.00  0.72           C
ATOM   1011  OG1 THR B 131     -47.249 -19.263 -14.418  1.00  0.72           O
ATOM   1012  CG2 THR B 131     -48.165 -21.063 -15.675  1.00  0.72           C
ATOM   1013  N   ASP B 132     -50.741 -21.349 -12.359  1.00  0.83           N
ATOM   1014  CA  ASP B 132     -51.281 -21.657 -11.055  1.00  0.83           C
ATOM   1015  C   ASP B 132     -51.056 -23.130 -10.702  1.00  0.83           C
ATOM   1016  O   ASP B 132     -51.321 -24.048 -11.483  1.00  0.83           O
ATOM   1017  CB  ASP B 132     -52.777 -21.259 -11.059  1.00  0.83           C
ATOM   1018  CG  ASP B 132     -53.405 -21.330  -9.678  1.00  0.83           C
ATOM   1019  OD1 ASP B 132     -52.670 -21.602  -8.696  1.00  0.83           O
ATOM   1020  OD2 ASP B 132     -54.641 -21.117  -9.599  1.00  0.83           O
ATOM   1021  N   PHE B 133     -50.516 -23.398  -9.498  1.00  0.87           N
ATOM   1022  CA  PHE B 133     -50.176 -24.731  -9.048  1.00  0.87           C
ATOM   1023  C   PHE B 133     -51.445 -25.355  -8.479  1.00  0.87           C
ATOM   1024  O   PHE B 133     -51.912 -24.944  -7.421  1.00  0.87           O
ATOM   1025  CB  PHE B 133     -49.053 -24.634  -7.961  1.00  0.87           C
ATOM   1026  CG  PHE B 133     -48.517 -25.951  -7.443  1.00  0.87           C
ATOM   1027  CD1 PHE B 133     -47.235 -26.387  -7.809  1.00  0.87           C
ATOM   1028  CD2 PHE B 133     -49.244 -26.720  -6.517  1.00  0.87           C
ATOM   1029  CE1 PHE B 133     -46.710 -27.590  -7.317  1.00  0.87           C
ATOM   1030  CE2 PHE B 133     -48.730 -27.925  -6.022  1.00  0.87           C
ATOM   1031  CZ  PHE B 133     -47.468 -28.366  -6.432  1.00  0.87           C
ATOM   1032  N   SER B 134     -52.053 -26.377  -9.132  1.00  0.93           N
ATOM   1033  CA  SER B 134     -53.365 -26.838  -8.669  1.00  0.93           C
ATOM   1034  C   SER B 134     -53.629 -28.326  -8.816  1.00  0.93           C
ATOM   1035  O   SER B 134     -52.918 -29.059  -9.506  1.00  0.93           O
ATOM   1036  CB  SER B 134     -54.571 -25.975  -9.163  1.00  0.93           C
ATOM   1037  OG  SER B 134     -54.807 -26.115 -10.556  1.00  0.93           O
ATOM   1038  N   ARG B 135     -54.631 -28.849  -8.065  1.00  0.85           N
ATOM   1039  CA  ARG B 135     -55.053 -30.242  -8.136  1.00  0.85           C
ATOM   1040  C   ARG B 135     -55.659 -30.574  -9.497  1.00  0.85           C
ATOM   1041  O   ARG B 135     -56.422 -29.790 -10.055  1.00  0.85           O
ATOM   1042  CB  ARG B 135     -56.023 -30.623  -6.977  1.00  0.85           C
ATOM   1043  CG  ARG B 135     -56.393 -32.117  -6.897  1.00  0.85           C
ATOM   1044  CD  ARG B 135     -57.325 -32.459  -5.722  1.00  0.85           C
ATOM   1045  NE  ARG B 135     -57.310 -33.933  -5.392  1.00  0.85           N
ATOM   1046  CZ  ARG B 135     -57.501 -34.954  -6.239  1.00  0.85           C
ATOM   1047  NH1 ARG B 135     -57.528 -34.815  -7.559  1.00  0.85           N
ATOM   1048  NH2 ARG B 135     -57.657 -36.179  -5.734  1.00  0.85           N
ATOM   1049  N   VAL B 136     -55.330 -31.758 -10.053  1.00  0.93           N
ATOM   1050  CA  VAL B 136     -55.800 -32.183 -11.362  1.00  0.93           C
ATOM   1051  C   VAL B 136     -56.486 -33.530 -11.223  1.00  0.93           C
ATOM   1052  O   VAL B 136     -56.310 -34.251 -10.234  1.00  0.93           O
ATOM   1053  CB  VAL B 136     -54.669 -32.305 -12.386  1.00  0.93           C
ATOM   1054  CG1 VAL B 136     -55.226 -32.382 -13.826  1.00  0.93           C
ATOM   1055  CG2 VAL B 136     -53.733 -31.088 -12.274  1.00  0.93           C
ATOM   1056  N   SER B 137     -57.331 -33.934 -12.183  1.00  0.89           N
ATOM   1057  CA  SER B 137     -57.756 -35.315 -12.297  1.00  0.89           C
ATOM   1058  C   SER B 137     -56.662 -36.182 -12.900  1.00  0.89           C
ATOM   1059  O   SER B 137     -55.841 -35.720 -13.689  1.00  0.89           O
ATOM   1060  CB  SER B 137     -59.051 -35.499 -13.122  1.00  0.89           C
ATOM   1061  OG  SER B 137     -58.890 -35.089 -14.483  1.00  0.89           O
ATOM   1062  N   ALA B 138     -56.621 -37.479 -12.561  1.00  0.94           N
ATOM   1063  CA  ALA B 138     -55.614 -38.344 -13.125  1.00  0.94           C
ATOM   1064  C   ALA B 138     -56.093 -39.772 -13.098  1.00  0.94           C
ATOM   1065  O   ALA B 138     -57.041 -40.107 -12.390  1.00  0.94           O
ATOM   1066  CB  ALA B 138     -54.277 -38.226 -12.367  1.00  0.94           C
ATOM   1067  N   LYS B 139     -55.456 -40.646 -13.897  1.00  0.87           N
ATOM   1068  CA  LYS B 139     -55.738 -42.064 -13.879  1.00  0.87           C
ATOM   1069  C   LYS B 139     -54.507 -42.854 -13.461  1.00  0.87           C
ATOM   1070  O   LYS B 139     -53.378 -42.379 -13.634  1.00  0.87           O
ATOM   1071  CB  LYS B 139     -56.240 -42.599 -15.244  1.00  0.87           C
ATOM   1072  CG  LYS B 139     -55.272 -42.381 -16.411  1.00  0.87           C
ATOM   1073  CD  LYS B 139     -55.787 -43.013 -17.709  1.00  0.87           C
ATOM   1074  CE  LYS B 139     -54.844 -42.790 -18.891  1.00  0.87           C
ATOM   1075  NZ  LYS B 139     -54.718 -41.341 -19.171  1.00  0.87           N
ATOM   1076  N   PRO B 140     -54.666 -44.055 -12.893  1.00  0.90           N
ATOM   1077  CA  PRO B 140     -53.585 -45.033 -12.763  1.00  0.90           C
ATOM   1078  C   PRO B 140     -52.947 -45.384 -14.109  1.00  0.90           C
ATOM   1079  O   PRO B 140     -53.638 -45.283 -15.127  1.00  0.90           O
ATOM   1080  CB  PRO B 140     -54.261 -46.238 -12.089  1.00  0.90           C
ATOM   1081  CG  PRO B 140     -55.735 -46.105 -12.474  1.00  0.90           C
ATOM   1082  CD  PRO B 140     -55.958 -44.606 -12.462  1.00  0.90           C
ATOM   1083  N   PRO B 141     -51.674 -45.753 -14.200  1.00  0.92           N
ATOM   1084  CA  PRO B 141     -51.096 -46.270 -15.436  1.00  0.92           C
ATOM   1085  C   PRO B 141     -51.757 -47.566 -15.921  1.00  0.92           C
ATOM   1086  O   PRO B 141     -52.383 -48.232 -15.101  1.00  0.92           O
ATOM   1087  CB  PRO B 141     -49.598 -46.416 -15.097  1.00  0.92           C
ATOM   1088  CG  PRO B 141     -49.346 -45.453 -13.934  1.00  0.92           C
ATOM   1089  CD  PRO B 141     -50.663 -45.491 -13.170  1.00  0.92           C
ATOM   1090  N   PRO B 142     -51.676 -47.949 -17.196  1.00  0.91           N
ATOM   1091  CA  PRO B 142     -52.645 -48.873 -17.795  1.00  0.91           C
ATOM   1092  C   PRO B 142     -52.439 -50.335 -17.455  1.00  0.91           C
ATOM   1093  O   PRO B 142     -53.380 -51.111 -17.582  1.00  0.91           O
ATOM   1094  CB  PRO B 142     -52.454 -48.658 -19.313  1.00  0.91           C
ATOM   1095  CG  PRO B 142     -51.045 -48.075 -19.450  1.00  0.91           C
ATOM   1096  CD  PRO B 142     -50.953 -47.190 -18.217  1.00  0.91           C
ATOM   1097  N   GLY B 143     -51.211 -50.763 -17.118  1.00  0.86           N
ATOM   1098  CA  GLY B 143     -50.922 -52.168 -16.846  1.00  0.86           C
ATOM   1099  C   GLY B 143     -51.549 -52.732 -15.595  1.00  0.86           C
ATOM   1100  O   GLY B 143     -51.804 -52.024 -14.627  1.00  0.86           O
ATOM   1101  N   ASP B 144     -51.704 -54.068 -15.555  1.00  0.82           N
ATOM   1102  CA  ASP B 144     -52.183 -54.831 -14.415  1.00  0.82           C
ATOM   1103  C   ASP B 144     -51.306 -54.651 -13.173  1.00  0.82           C
ATOM   1104  O   ASP B 144     -51.768 -54.482 -12.049  1.00  0.82           O
ATOM   1105  CB  ASP B 144     -52.292 -56.310 -14.852  1.00  0.82           C
ATOM   1106  CG  ASP B 144     -53.052 -57.132 -13.824  1.00  0.82           C
ATOM   1107  OD1 ASP B 144     -52.384 -57.684 -12.914  1.00  0.82           O
ATOM   1108  OD2 ASP B 144     -54.300 -57.204 -13.938  1.00  0.82           O
ATOM   1109  N   GLN B 145     -49.980 -54.555 -13.372  1.00  0.82           N
ATOM   1110  CA  GLN B 145     -49.026 -54.250 -12.334  1.00  0.82           C
ATOM   1111  C   GLN B 145     -49.244 -52.893 -11.685  1.00  0.82           C
ATOM   1112  O   GLN B 145     -48.833 -52.677 -10.551  1.00  0.82           O
ATOM   1113  CB  GLN B 145     -47.566 -54.349 -12.849  1.00  0.82           C
ATOM   1114  CG  GLN B 145     -47.117 -53.278 -13.874  1.00  0.82           C
ATOM   1115  CD  GLN B 145     -47.582 -53.550 -15.305  1.00  0.82           C
ATOM   1116  OE1 GLN B 145     -48.459 -54.358 -15.614  1.00  0.82           O
ATOM   1117  NE2 GLN B 145     -46.937 -52.846 -16.258  1.00  0.82           N
ATOM   1118  N   PHE B 146     -49.925 -51.951 -12.368  1.00  0.88           N
ATOM   1119  CA  PHE B 146     -50.183 -50.630 -11.846  1.00  0.88           C
ATOM   1120  C   PHE B 146     -51.567 -50.529 -11.212  1.00  0.88           C
ATOM   1121  O   PHE B 146     -51.994 -49.468 -10.760  1.00  0.88           O
ATOM   1122  CB  PHE B 146     -50.040 -49.556 -12.947  1.00  0.88           C
ATOM   1123  CG  PHE B 146     -48.626 -49.475 -13.465  1.00  0.88           C
ATOM   1124  CD1 PHE B 146     -47.601 -48.915 -12.682  1.00  0.88           C
ATOM   1125  CD2 PHE B 146     -48.331 -49.854 -14.787  1.00  0.88           C
ATOM   1126  CE1 PHE B 146     -46.318 -48.724 -13.208  1.00  0.88           C
ATOM   1127  CE2 PHE B 146     -47.049 -49.663 -15.318  1.00  0.88           C
ATOM   1128  CZ  PHE B 146     -46.042 -49.097 -14.528  1.00  0.88           C
ATOM   1129  N   LYS B 147     -52.294 -51.661 -11.068  1.00  0.84           N
ATOM   1130  CA  LYS B 147     -53.594 -51.680 -10.423  1.00  0.84           C
ATOM   1131  C   LYS B 147     -53.507 -51.445  -8.920  1.00  0.84           C
ATOM   1132  O   LYS B 147     -54.489 -51.108  -8.261  1.00  0.84           O
ATOM   1133  CB  LYS B 147     -54.362 -52.989 -10.752  1.00  0.84           C
ATOM   1134  CG  LYS B 147     -54.058 -54.215  -9.868  1.00  0.84           C
ATOM   1135  CD  LYS B 147     -55.117 -54.412  -8.770  1.00  0.84           C
ATOM   1136  CE  LYS B 147     -54.775 -55.518  -7.776  1.00  0.84           C
ATOM   1137  NZ  LYS B 147     -55.920 -55.710  -6.857  1.00  0.84           N
ATOM   1138  N   HIS B 148     -52.300 -51.574  -8.325  1.00  0.85           N
ATOM   1139  CA  HIS B 148     -52.089 -51.248  -6.926  1.00  0.85           C
ATOM   1140  C   HIS B 148     -52.059 -49.751  -6.662  1.00  0.85           C
ATOM   1141  O   HIS B 148     -52.243 -49.318  -5.531  1.00  0.85           O
ATOM   1142  CB  HIS B 148     -50.848 -51.960  -6.328  1.00  0.85           C
ATOM   1143  CG  HIS B 148     -49.518 -51.362  -6.681  1.00  0.85           C
ATOM   1144  ND1 HIS B 148     -49.128 -50.217  -6.020  1.00  0.85           N
ATOM   1145  CD2 HIS B 148     -48.584 -51.716  -7.599  1.00  0.85           C
ATOM   1146  CE1 HIS B 148     -47.971 -49.884  -6.553  1.00  0.85           C
ATOM   1147  NE2 HIS B 148     -47.597 -50.760  -7.509  1.00  0.85           N
ATOM   1148  N   LEU B 149     -51.898 -48.920  -7.713  1.00  0.90           N
ATOM   1149  CA  LEU B 149     -51.885 -47.480  -7.577  1.00  0.90           C
ATOM   1150  C   LEU B 149     -53.296 -46.900  -7.488  1.00  0.90           C
ATOM   1151  O   LEU B 149     -53.474 -45.751  -7.087  1.00  0.90           O
ATOM   1152  CB  LEU B 149     -51.105 -46.786  -8.723  1.00  0.90           C
ATOM   1153  CG  LEU B 149     -49.576 -46.997  -8.699  1.00  0.90           C
ATOM   1154  CD1 LEU B 149     -49.184 -48.381  -9.205  1.00  0.90           C
ATOM   1155  CD2 LEU B 149     -48.871 -45.957  -9.579  1.00  0.90           C
ATOM   1156  N   ILE B 150     -54.358 -47.681  -7.815  1.00  0.91           N
ATOM   1157  CA  ILE B 150     -55.749 -47.219  -7.770  1.00  0.91           C
ATOM   1158  C   ILE B 150     -56.179 -46.690  -6.400  1.00  0.91           C
ATOM   1159  O   ILE B 150     -56.721 -45.586  -6.358  1.00  0.91           O
ATOM   1160  CB  ILE B 150     -56.765 -48.248  -8.294  1.00  0.91           C
ATOM   1161  CG1 ILE B 150     -56.378 -48.745  -9.700  1.00  0.91           C
ATOM   1162  CG2 ILE B 150     -58.177 -47.622  -8.377  1.00  0.91           C
ATOM   1163  CD1 ILE B 150     -57.082 -50.039 -10.125  1.00  0.91           C
ATOM   1164  N   PRO B 151     -55.930 -47.320  -5.246  1.00  0.90           N
ATOM   1165  CA  PRO B 151     -56.350 -46.763  -3.967  1.00  0.90           C
ATOM   1166  C   PRO B 151     -55.560 -45.537  -3.552  1.00  0.90           C
ATOM   1167  O   PRO B 151     -56.004 -44.830  -2.652  1.00  0.90           O
ATOM   1168  CB  PRO B 151     -56.132 -47.925  -2.975  1.00  0.90           C
ATOM   1169  CG  PRO B 151     -56.233 -49.178  -3.845  1.00  0.90           C
ATOM   1170  CD  PRO B 151     -55.523 -48.721  -5.106  1.00  0.90           C
ATOM   1171  N   LEU B 152     -54.371 -45.286  -4.136  1.00  0.89           N
ATOM   1172  CA  LEU B 152     -53.489 -44.209  -3.715  1.00  0.89           C
ATOM   1173  C   LEU B 152     -53.936 -42.837  -4.207  1.00  0.89           C
ATOM   1174  O   LEU B 152     -53.640 -41.826  -3.580  1.00  0.89           O
ATOM   1175  CB  LEU B 152     -52.029 -44.521  -4.136  1.00  0.89           C
ATOM   1176  CG  LEU B 152     -51.329 -45.515  -3.177  1.00  0.89           C
ATOM   1177  CD1 LEU B 152     -50.603 -46.654  -3.904  1.00  0.89           C
ATOM   1178  CD2 LEU B 152     -50.346 -44.802  -2.239  1.00  0.89           C
ATOM   1179  N   MET B 153     -54.732 -42.783  -5.294  1.00  0.88           N
ATOM   1180  CA  MET B 153     -55.261 -41.569  -5.901  1.00  0.88           C
ATOM   1181  C   MET B 153     -56.131 -40.730  -4.980  1.00  0.88           C
ATOM   1182  O   MET B 153     -56.107 -39.500  -4.999  1.00  0.88           O
ATOM   1183  CB  MET B 153     -56.132 -41.953  -7.121  1.00  0.88           C
ATOM   1184  CG  MET B 153     -55.348 -42.499  -8.324  1.00  0.88           C
ATOM   1185  SD  MET B 153     -54.268 -41.292  -9.147  1.00  0.88           S
ATOM   1186  CE  MET B 153     -53.693 -42.652 -10.183  1.00  0.88           C
ATOM   1187  N   TYR B 154     -56.969 -41.402  -4.175  1.00  0.86           N
ATOM   1188  CA  TYR B 154     -57.855 -40.768  -3.223  1.00  0.86           C
ATOM   1189  C   TYR B 154     -57.141 -40.299  -1.971  1.00  0.86           C
ATOM   1190  O   TYR B 154     -57.491 -39.275  -1.392  1.00  0.86           O
ATOM   1191  CB  TYR B 154     -58.981 -41.739  -2.775  1.00  0.86           C
ATOM   1192  CG  TYR B 154     -59.475 -42.579  -3.920  1.00  0.86           C
ATOM   1193  CD1 TYR B 154     -60.397 -42.076  -4.849  1.00  0.86           C
ATOM   1194  CD2 TYR B 154     -58.999 -43.890  -4.079  1.00  0.86           C
ATOM   1195  CE1 TYR B 154     -60.840 -42.875  -5.913  1.00  0.86           C
ATOM   1196  CE2 TYR B 154     -59.461 -44.700  -5.124  1.00  0.86           C
ATOM   1197  CZ  TYR B 154     -60.376 -44.186  -6.048  1.00  0.86           C
ATOM   1198  OH  TYR B 154     -60.836 -44.976  -7.116  1.00  0.86           O
ATOM   1199  N   LYS B 155     -56.147 -41.089  -1.511  1.00  0.89           N
ATOM   1200  CA  LYS B 155     -55.725 -41.153  -0.124  1.00  0.89           C
ATOM   1201  C   LYS B 155     -55.260 -39.856   0.508  1.00  0.89           C
ATOM   1202  O   LYS B 155     -55.569 -39.573   1.664  1.00  0.89           O
ATOM   1203  CB  LYS B 155     -54.589 -42.202   0.044  1.00  0.89           C
ATOM   1204  CG  LYS B 155     -55.075 -43.625   0.370  1.00  0.89           C
ATOM   1205  CD  LYS B 155     -54.329 -44.214   1.582  1.00  0.89           C
ATOM   1206  CE  LYS B 155     -55.116 -45.290   2.333  1.00  0.89           C
ATOM   1207  NZ  LYS B 155     -55.183 -46.536   1.541  1.00  0.89           N
ATOM   1208  N   GLY B 156     -54.479 -39.055  -0.215  1.00  0.80           N
ATOM   1209  CA  GLY B 156     -53.897 -37.847   0.317  1.00  0.80           C
ATOM   1210  C   GLY B 156     -52.731 -37.581  -0.570  1.00  0.80           C
ATOM   1211  O   GLY B 156     -52.529 -38.308  -1.528  1.00  0.80           O
ATOM   1212  N   LEU B 157     -51.924 -36.541  -0.350  1.00  0.91           N
ATOM   1213  CA  LEU B 157     -51.965 -35.536   0.679  1.00  0.91           C
ATOM   1214  C   LEU B 157     -51.691 -34.229  -0.048  1.00  0.91           C
ATOM   1215  O   LEU B 157     -51.083 -34.273  -1.122  1.00  0.91           O
ATOM   1216  CB  LEU B 157     -50.833 -35.804   1.706  1.00  0.91           C
ATOM   1217  CG  LEU B 157     -51.280 -36.392   3.057  1.00  0.91           C
ATOM   1218  CD1 LEU B 157     -51.168 -37.924   3.041  1.00  0.91           C
ATOM   1219  CD2 LEU B 157     -50.439 -35.783   4.192  1.00  0.91           C
ATOM   1220  N   PRO B 158     -52.112 -33.057   0.437  1.00  0.94           N
ATOM   1221  CA  PRO B 158     -51.700 -31.765  -0.095  1.00  0.94           C
ATOM   1222  C   PRO B 158     -50.226 -31.611  -0.315  1.00  0.94           C
ATOM   1223  O   PRO B 158     -49.442 -31.960   0.562  1.00  0.94           O
ATOM   1224  CB  PRO B 158     -52.162 -30.753   0.951  1.00  0.94           C
ATOM   1225  CG  PRO B 158     -53.386 -31.412   1.573  1.00  0.94           C
ATOM   1226  CD  PRO B 158     -53.002 -32.894   1.589  1.00  0.94           C
ATOM   1227  N   TRP B 159     -49.802 -31.059  -1.458  1.00  0.90           N
ATOM   1228  CA  TRP B 159     -48.388 -30.924  -1.718  1.00  0.90           C
ATOM   1229  C   TRP B 159     -47.657 -29.958  -0.795  1.00  0.90           C
ATOM   1230  O   TRP B 159     -46.486 -30.173  -0.504  1.00  0.90           O
ATOM   1231  CB  TRP B 159     -48.086 -30.638  -3.208  1.00  0.90           C
ATOM   1232  CG  TRP B 159     -47.573 -31.851  -3.980  1.00  0.90           C
ATOM   1233  CD1 TRP B 159     -48.202 -32.710  -4.839  1.00  0.90           C
ATOM   1234  CD2 TRP B 159     -46.215 -32.307  -3.887  1.00  0.90           C
ATOM   1235  NE1 TRP B 159     -47.306 -33.627  -5.337  1.00  0.90           N
ATOM   1236  CE2 TRP B 159     -46.085 -33.405  -4.768  1.00  0.90           C
ATOM   1237  CE3 TRP B 159     -45.136 -31.867  -3.128  1.00  0.90           C
ATOM   1238  CZ2 TRP B 159     -44.875 -34.059  -4.915  1.00  0.90           C
ATOM   1239  CZ3 TRP B 159     -43.920 -32.549  -3.256  1.00  0.90           C
ATOM   1240  CH2 TRP B 159     -43.790 -33.622  -4.148  1.00  0.90           C
ATOM   1241  N   ASN B 160     -48.303 -28.896  -0.266  1.00  0.88           N
ATOM   1242  CA  ASN B 160     -47.696 -28.044   0.751  1.00  0.88           C
ATOM   1243  C   ASN B 160     -47.302 -28.816   2.021  1.00  0.88           C
ATOM   1244  O   ASN B 160     -46.241 -28.595   2.595  1.00  0.88           O
ATOM   1245  CB  ASN B 160     -48.532 -26.764   1.017  1.00  0.88           C
ATOM   1246  CG  ASN B 160     -49.882 -27.079   1.644  1.00  0.88           C
ATOM   1247  OD1 ASN B 160     -50.560 -28.028   1.242  1.00  0.88           O
ATOM   1248  ND2 ASN B 160     -50.295 -26.278   2.646  1.00  0.88           N
ATOM   1249  N   VAL B 161     -48.136 -29.792   2.436  1.00  0.94           N
ATOM   1250  CA  VAL B 161     -47.795 -30.795   3.438  1.00  0.94           C
ATOM   1251  C   VAL B 161     -46.669 -31.753   3.046  1.00  0.94           C
ATOM   1252  O   VAL B 161     -45.766 -32.015   3.838  1.00  0.94           O
ATOM   1253  CB  VAL B 161     -49.019 -31.626   3.810  1.00  0.94           C
ATOM   1254  CG1 VAL B 161     -48.635 -32.785   4.758  1.00  0.94           C
ATOM   1255  CG2 VAL B 161     -50.074 -30.705   4.449  1.00  0.94           C
ATOM   1256  N   VAL B 162     -46.677 -32.325   1.821  1.00  0.94           N
ATOM   1257  CA  VAL B 162     -45.694 -33.327   1.402  1.00  0.94           C
ATOM   1258  C   VAL B 162     -44.267 -32.804   1.387  1.00  0.94           C
ATOM   1259  O   VAL B 162     -43.357 -33.471   1.867  1.00  0.94           O
ATOM   1260  CB  VAL B 162     -46.055 -33.972   0.063  1.00  0.94           C
ATOM   1261  CG1 VAL B 162     -44.961 -34.939  -0.445  1.00  0.94           C
ATOM   1262  CG2 VAL B 162     -47.369 -34.756   0.241  1.00  0.94           C
ATOM   1263  N   ARG B 163     -44.020 -31.576   0.880  1.00  0.84           N
ATOM   1264  CA  ARG B 163     -42.679 -31.004   0.902  1.00  0.84           C
ATOM   1265  C   ARG B 163     -42.107 -30.742   2.301  1.00  0.84           C
ATOM   1266  O   ARG B 163     -40.960 -31.092   2.573  1.00  0.84           O
ATOM   1267  CB  ARG B 163     -42.512 -29.820  -0.090  1.00  0.84           C
ATOM   1268  CG  ARG B 163     -43.428 -28.594   0.087  1.00  0.84           C
ATOM   1269  CD  ARG B 163     -44.309 -28.334  -1.139  1.00  0.84           C
ATOM   1270  NE  ARG B 163     -43.887 -27.199  -2.009  1.00  0.84           N
ATOM   1271  CZ  ARG B 163     -44.655 -26.788  -3.026  1.00  0.84           C
ATOM   1272  NH1 ARG B 163     -45.736 -27.484  -3.394  1.00  0.84           N
ATOM   1273  NH2 ARG B 163     -44.381 -25.717  -3.746  1.00  0.84           N
ATOM   1274  N   ILE B 164     -42.905 -30.219   3.260  1.00  0.89           N
ATOM   1275  CA  ILE B 164     -42.502 -30.145   4.664  1.00  0.89           C
ATOM   1276  C   ILE B 164     -42.287 -31.524   5.304  1.00  0.89           C
ATOM   1277  O   ILE B 164     -41.363 -31.732   6.088  1.00  0.89           O
ATOM   1278  CB  ILE B 164     -43.408 -29.218   5.487  1.00  0.89           C
ATOM   1279  CG1 ILE B 164     -42.612 -28.168   6.305  1.00  0.89           C
ATOM   1280  CG2 ILE B 164     -44.409 -29.975   6.385  1.00  0.89           C
ATOM   1281  CD1 ILE B 164     -41.539 -28.736   7.238  1.00  0.89           C
ATOM   1282  N   LYS B 165     -43.119 -32.538   4.961  1.00  0.88           N
ATOM   1283  CA  LYS B 165     -42.876 -33.915   5.357  1.00  0.88           C
ATOM   1284  C   LYS B 165     -41.586 -34.506   4.801  1.00  0.88           C
ATOM   1285  O   LYS B 165     -40.849 -35.154   5.538  1.00  0.88           O
ATOM   1286  CB  LYS B 165     -44.076 -34.844   5.045  1.00  0.88           C
ATOM   1287  CG  LYS B 165     -45.258 -34.688   6.020  1.00  0.88           C
ATOM   1288  CD  LYS B 165     -46.127 -35.957   6.041  1.00  0.88           C
ATOM   1289  CE  LYS B 165     -47.188 -35.978   7.144  1.00  0.88           C
ATOM   1290  NZ  LYS B 165     -47.830 -37.313   7.183  1.00  0.88           N
ATOM   1291  N   ILE B 166     -41.253 -34.269   3.514  1.00  0.90           N
ATOM   1292  CA  ILE B 166     -39.977 -34.660   2.929  1.00  0.90           C
ATOM   1293  C   ILE B 166     -38.807 -34.010   3.631  1.00  0.90           C
ATOM   1294  O   ILE B 166     -37.840 -34.673   3.991  1.00  0.90           O
ATOM   1295  CB  ILE B 166     -39.936 -34.325   1.433  1.00  0.90           C
ATOM   1296  CG1 ILE B 166     -40.694 -35.430   0.674  1.00  0.90           C
ATOM   1297  CG2 ILE B 166     -38.492 -34.154   0.893  1.00  0.90           C
ATOM   1298  CD1 ILE B 166     -40.752 -35.260  -0.842  1.00  0.90           C
ATOM   1299  N   VAL B 167     -38.876 -32.687   3.868  1.00  0.92           N
ATOM   1300  CA  VAL B 167     -37.806 -31.961   4.521  1.00  0.92           C
ATOM   1301  C   VAL B 167     -37.594 -32.379   5.960  1.00  0.92           C
ATOM   1302  O   VAL B 167     -36.453 -32.576   6.355  1.00  0.92           O
ATOM   1303  CB  VAL B 167     -37.946 -30.455   4.375  1.00  0.92           C
ATOM   1304  CG1 VAL B 167     -36.889 -29.704   5.218  1.00  0.92           C
ATOM   1305  CG2 VAL B 167     -37.805 -30.090   2.884  1.00  0.92           C
ATOM   1306  N   GLN B 168     -38.642 -32.592   6.789  1.00  0.86           N
ATOM   1307  CA  GLN B 168     -38.395 -33.090   8.134  1.00  0.86           C
ATOM   1308  C   GLN B 168     -37.801 -34.499   8.169  1.00  0.86           C
ATOM   1309  O   GLN B 168     -36.800 -34.727   8.834  1.00  0.86           O
ATOM   1310  CB  GLN B 168     -39.592 -32.919   9.108  1.00  0.86           C
ATOM   1311  CG  GLN B 168     -40.858 -33.768   8.845  1.00  0.86           C
ATOM   1312  CD  GLN B 168     -41.583 -34.133  10.144  1.00  0.86           C
ATOM   1313  OE1 GLN B 168     -41.078 -34.027  11.262  1.00  0.86           O
ATOM   1314  NE2 GLN B 168     -42.846 -34.595  10.010  1.00  0.86           N
ATOM   1315  N   MET B 169     -38.336 -35.446   7.375  1.00  0.86           N
ATOM   1316  CA  MET B 169     -37.847 -36.814   7.291  1.00  0.86           C
ATOM   1317  C   MET B 169     -36.444 -36.959   6.706  1.00  0.86           C
ATOM   1318  O   MET B 169     -35.649 -37.808   7.113  1.00  0.86           O
ATOM   1319  CB  MET B 169     -38.906 -37.628   6.514  1.00  0.86           C
ATOM   1320  CG  MET B 169     -38.457 -38.977   5.938  1.00  0.86           C
ATOM   1321  SD  MET B 169     -38.087 -38.832   4.171  1.00  0.86           S
ATOM   1322  CE  MET B 169     -36.861 -40.157   4.123  1.00  0.86           C
ATOM   1323  N   LEU B 170     -36.089 -36.117   5.719  1.00  0.90           N
ATOM   1324  CA  LEU B 170     -34.718 -35.955   5.292  1.00  0.90           C
ATOM   1325  C   LEU B 170     -33.854 -35.307   6.385  1.00  0.90           C
ATOM   1326  O   LEU B 170     -32.732 -35.744   6.640  1.00  0.90           O
ATOM   1327  CB  LEU B 170     -34.647 -35.110   3.999  1.00  0.90           C
ATOM   1328  CG  LEU B 170     -34.989 -35.753   2.629  1.00  0.90           C
ATOM   1329  CD1 LEU B 170     -33.871 -35.452   1.626  1.00  0.90           C
ATOM   1330  CD2 LEU B 170     -35.262 -37.257   2.624  1.00  0.90           C
ATOM   1331  N   SER B 171     -34.360 -34.267   7.086  1.00  0.91           N
ATOM   1332  CA  SER B 171     -33.662 -33.620   8.192  1.00  0.91           C
ATOM   1333  C   SER B 171     -33.312 -34.531   9.349  1.00  0.91           C
ATOM   1334  O   SER B 171     -32.164 -34.543   9.787  1.00  0.91           O
ATOM   1335  CB  SER B 171     -34.420 -32.394   8.799  1.00  0.91           C
ATOM   1336  OG  SER B 171     -34.364 -31.238   7.960  1.00  0.91           O
ATOM   1337  N   ASP B 172     -34.248 -35.341   9.884  1.00  0.89           N
ATOM   1338  CA  ASP B 172     -33.917 -36.263  10.957  1.00  0.89           C
ATOM   1339  C   ASP B 172     -32.986 -37.426  10.545  1.00  0.89           C
ATOM   1340  O   ASP B 172     -31.992 -37.683  11.225  1.00  0.89           O
ATOM   1341  CB  ASP B 172     -35.157 -36.622  11.823  1.00  0.89           C
ATOM   1342  CG  ASP B 172     -36.153 -37.520  11.112  1.00  0.89           C
ATOM   1343  OD1 ASP B 172     -35.789 -38.692  10.850  1.00  0.89           O
ATOM   1344  OD2 ASP B 172     -37.282 -37.051  10.833  1.00  0.89           O
ATOM   1345  N   THR B 173     -33.212 -38.077   9.377  1.00  0.88           N
ATOM   1346  CA  THR B 173     -32.333 -39.112   8.804  1.00  0.88           C
ATOM   1347  C   THR B 173     -30.884 -38.637   8.539  1.00  0.88           C
ATOM   1348  O   THR B 173     -29.923 -39.357   8.816  1.00  0.88           O
ATOM   1349  CB  THR B 173     -32.878 -39.697   7.467  1.00  0.88           C
ATOM   1350  OG1 THR B 173     -34.151 -40.319   7.589  1.00  0.88           O
ATOM   1351  CG2 THR B 173     -31.834 -40.678   6.855  1.00  0.88           C
ATOM   1352  N   LEU B 174     -30.653 -37.425   7.975  1.00  0.89           N
ATOM   1353  CA  LEU B 174     -29.321 -37.013   7.515  1.00  0.89           C
ATOM   1354  C   LEU B 174     -28.565 -36.059   8.452  1.00  0.89           C
ATOM   1355  O   LEU B 174     -27.388 -35.781   8.219  1.00  0.89           O
ATOM   1356  CB  LEU B 174     -29.426 -36.335   6.109  1.00  0.89           C
ATOM   1357  CG  LEU B 174     -28.877 -37.137   4.903  1.00  0.89           C
ATOM   1358  CD1 LEU B 174     -29.556 -38.501   4.749  1.00  0.89           C
ATOM   1359  CD2 LEU B 174     -29.032 -36.327   3.609  1.00  0.89           C
ATOM   1360  N   LYS B 175     -29.165 -35.538   9.551  1.00  0.87           N
ATOM   1361  CA  LYS B 175     -28.580 -34.425  10.301  1.00  0.87           C
ATOM   1362  C   LYS B 175     -27.198 -34.644  10.875  1.00  0.87           C
ATOM   1363  O   LYS B 175     -26.336 -33.771  10.750  1.00  0.87           O
ATOM   1364  CB  LYS B 175     -29.503 -33.912  11.439  1.00  0.87           C
ATOM   1365  CG  LYS B 175     -30.111 -35.002  12.338  1.00  0.87           C
ATOM   1366  CD  LYS B 175     -30.823 -34.447  13.584  1.00  0.87           C
ATOM   1367  CE  LYS B 175     -31.847 -33.353  13.271  1.00  0.87           C
ATOM   1368  NZ  LYS B 175     -32.311 -32.718  14.521  1.00  0.87           N
ATOM   1369  N   ASN B 176     -26.976 -35.818  11.487  1.00  0.84           N
ATOM   1370  CA  ASN B 176     -25.717 -36.179  12.095  1.00  0.84           C
ATOM   1371  C   ASN B 176     -24.683 -36.571  11.055  1.00  0.84           C
ATOM   1372  O   ASN B 176     -23.503 -36.287  11.206  1.00  0.84           O
ATOM   1373  CB  ASN B 176     -25.929 -37.360  13.075  1.00  0.84           C
ATOM   1374  CG  ASN B 176     -26.811 -36.930  14.244  1.00  0.84           C
ATOM   1375  OD1 ASN B 176     -27.061 -35.755  14.509  1.00  0.84           O
ATOM   1376  ND2 ASN B 176     -27.332 -37.930  14.990  1.00  0.84           N
ATOM   1377  N   LEU B 177     -25.122 -37.268   9.990  1.00  0.87           N
ATOM   1378  CA  LEU B 177     -24.245 -37.942   9.050  1.00  0.87           C
ATOM   1379  C   LEU B 177     -23.636 -37.047   7.979  1.00  0.87           C
ATOM   1380  O   LEU B 177     -22.526 -37.294   7.518  1.00  0.87           O
ATOM   1381  CB  LEU B 177     -24.980 -39.117   8.346  1.00  0.87           C
ATOM   1382  CG  LEU B 177     -25.798 -40.049   9.270  1.00  0.87           C
ATOM   1383  CD1 LEU B 177     -26.281 -41.285   8.500  1.00  0.87           C
ATOM   1384  CD2 LEU B 177     -25.017 -40.504  10.508  1.00  0.87           C
ATOM   1385  N   SER B 178     -24.341 -35.990   7.523  1.00  0.90           N
ATOM   1386  CA  SER B 178     -23.863 -35.213   6.385  1.00  0.90           C
ATOM   1387  C   SER B 178     -24.313 -33.762   6.431  1.00  0.90           C
ATOM   1388  O   SER B 178     -25.169 -33.366   7.225  1.00  0.90           O
ATOM   1389  CB  SER B 178     -24.325 -35.869   5.050  1.00  0.90           C
ATOM   1390  OG  SER B 178     -23.810 -35.227   3.881  1.00  0.90           O
ATOM   1391  N   ASP B 179     -23.711 -32.903   5.581  1.00  0.91           N
ATOM   1392  CA  ASP B 179     -24.037 -31.506   5.414  1.00  0.91           C
ATOM   1393  C   ASP B 179     -24.870 -31.279   4.154  1.00  0.91           C
ATOM   1394  O   ASP B 179     -25.238 -30.159   3.792  1.00  0.91           O
ATOM   1395  CB  ASP B 179     -22.700 -30.721   5.331  1.00  0.91           C
ATOM   1396  CG  ASP B 179     -21.975 -30.991   4.012  1.00  0.91           C
ATOM   1397  OD1 ASP B 179     -21.690 -32.180   3.726  1.00  0.91           O
ATOM   1398  OD2 ASP B 179     -21.771 -30.021   3.240  1.00  0.91           O
ATOM   1399  N   ARG B 180     -25.170 -32.366   3.429  1.00  0.86           N
ATOM   1400  CA  ARG B 180     -25.772 -32.265   2.133  1.00  0.86           C
ATOM   1401  C   ARG B 180     -26.579 -33.501   1.795  1.00  0.86           C
ATOM   1402  O   ARG B 180     -26.606 -34.478   2.539  1.00  0.86           O
ATOM   1403  CB  ARG B 180     -24.697 -32.020   1.037  1.00  0.86           C
ATOM   1404  CG  ARG B 180     -23.667 -33.156   0.859  1.00  0.86           C
ATOM   1405  CD  ARG B 180     -22.917 -33.112  -0.484  1.00  0.86           C
ATOM   1406  NE  ARG B 180     -21.958 -31.967  -0.474  1.00  0.86           N
ATOM   1407  CZ  ARG B 180     -21.147 -31.660  -1.503  1.00  0.86           C
ATOM   1408  NH1 ARG B 180     -21.194 -32.286  -2.678  1.00  0.86           N
ATOM   1409  NH2 ARG B 180     -20.256 -30.685  -1.335  1.00  0.86           N
ATOM   1410  N   VAL B 181     -27.274 -33.475   0.642  1.00  0.94           N
ATOM   1411  CA  VAL B 181     -28.068 -34.578   0.128  1.00  0.94           C
ATOM   1412  C   VAL B 181     -27.452 -35.091  -1.161  1.00  0.94           C
ATOM   1413  O   VAL B 181     -26.980 -34.289  -1.965  1.00  0.94           O
ATOM   1414  CB  VAL B 181     -29.502 -34.164  -0.253  1.00  0.94           C
ATOM   1415  CG1 VAL B 181     -30.517 -35.181   0.294  1.00  0.94           C
ATOM   1416  CG2 VAL B 181     -29.834 -32.725   0.186  1.00  0.94           C
ATOM   1417  N   VAL B 182     -27.490 -36.414  -1.431  1.00  0.95           N
ATOM   1418  CA  VAL B 182     -27.397 -36.917  -2.799  1.00  0.95           C
ATOM   1419  C   VAL B 182     -28.502 -37.935  -3.049  1.00  0.95           C
ATOM   1420  O   VAL B 182     -28.674 -38.911  -2.314  1.00  0.95           O
ATOM   1421  CB  VAL B 182     -26.043 -37.441  -3.311  1.00  0.95           C
ATOM   1422  CG1 VAL B 182     -24.876 -36.601  -2.764  1.00  0.95           C
ATOM   1423  CG2 VAL B 182     -25.817 -38.924  -2.993  1.00  0.95           C
ATOM   1424  N   PHE B 183     -29.308 -37.743  -4.104  1.00  0.92           N
ATOM   1425  CA  PHE B 183     -30.320 -38.712  -4.479  1.00  0.92           C
ATOM   1426  C   PHE B 183     -29.760 -39.730  -5.462  1.00  0.92           C
ATOM   1427  O   PHE B 183     -29.217 -39.380  -6.509  1.00  0.92           O
ATOM   1428  CB  PHE B 183     -31.585 -38.058  -5.080  1.00  0.92           C
ATOM   1429  CG  PHE B 183     -32.260 -37.191  -4.056  1.00  0.92           C
ATOM   1430  CD1 PHE B 183     -33.117 -37.777  -3.112  1.00  0.92           C
ATOM   1431  CD2 PHE B 183     -32.054 -35.801  -4.017  1.00  0.92           C
ATOM   1432  CE1 PHE B 183     -33.766 -36.993  -2.152  1.00  0.92           C
ATOM   1433  CE2 PHE B 183     -32.721 -35.013  -3.068  1.00  0.92           C
ATOM   1434  CZ  PHE B 183     -33.574 -35.608  -2.135  1.00  0.92           C
ATOM   1435  N   VAL B 184     -29.888 -41.032  -5.143  1.00  0.95           N
ATOM   1436  CA  VAL B 184     -29.494 -42.114  -6.033  1.00  0.95           C
ATOM   1437  C   VAL B 184     -30.737 -42.710  -6.672  1.00  0.95           C
ATOM   1438  O   VAL B 184     -31.586 -43.312  -6.010  1.00  0.95           O
ATOM   1439  CB  VAL B 184     -28.627 -43.209  -5.401  1.00  0.95           C
ATOM   1440  CG1 VAL B 184     -27.146 -42.899  -5.681  1.00  0.95           C
ATOM   1441  CG2 VAL B 184     -28.858 -43.334  -3.888  1.00  0.95           C
ATOM   1442  N   LEU B 185     -30.871 -42.541  -7.999  1.00  0.92           N
ATOM   1443  CA  LEU B 185     -32.067 -42.871  -8.766  1.00  0.92           C
ATOM   1444  C   LEU B 185     -31.752 -43.721 -10.001  1.00  0.92           C
ATOM   1445  O   LEU B 185     -30.592 -43.850 -10.376  1.00  0.92           O
ATOM   1446  CB  LEU B 185     -33.006 -41.652  -9.035  1.00  0.92           C
ATOM   1447  CG  LEU B 185     -32.486 -40.291  -9.582  1.00  0.92           C
ATOM   1448  CD1 LEU B 185     -32.823 -39.160  -8.591  1.00  0.92           C
ATOM   1449  CD2 LEU B 185     -31.000 -40.217  -9.945  1.00  0.92           C
ATOM   1450  N   TRP B 186     -32.763 -44.437 -10.572  1.00  0.90           N
ATOM   1451  CA  TRP B 186     -32.517 -45.441 -11.613  1.00  0.90           C
ATOM   1452  C   TRP B 186     -32.979 -44.962 -12.966  1.00  0.90           C
ATOM   1453  O   TRP B 186     -32.499 -45.388 -14.014  1.00  0.90           O
ATOM   1454  CB  TRP B 186     -33.273 -46.763 -11.293  1.00  0.90           C
ATOM   1455  CG  TRP B 186     -33.190 -47.830 -12.390  1.00  0.90           C
ATOM   1456  CD1 TRP B 186     -34.156 -48.185 -13.292  1.00  0.90           C
ATOM   1457  CD2 TRP B 186     -31.989 -48.503 -12.775  1.00  0.90           C
ATOM   1458  NE1 TRP B 186     -33.626 -49.036 -14.233  1.00  0.90           N
ATOM   1459  CE2 TRP B 186     -32.308 -49.270 -13.939  1.00  0.90           C
ATOM   1460  CE3 TRP B 186     -30.714 -48.541 -12.230  1.00  0.90           C
ATOM   1461  CZ2 TRP B 186     -31.342 -50.033 -14.558  1.00  0.90           C
ATOM   1462  CZ3 TRP B 186     -29.760 -49.363 -12.837  1.00  0.90           C
ATOM   1463  CH2 TRP B 186     -30.067 -50.105 -13.990  1.00  0.90           C
ATOM   1464  N   ALA B 187     -33.952 -44.061 -12.963  1.00  0.89           N
ATOM   1465  CA  ALA B 187     -34.311 -43.310 -14.112  1.00  0.89           C
ATOM   1466  C   ALA B 187     -34.103 -41.871 -13.731  1.00  0.89           C
ATOM   1467  O   ALA B 187     -34.811 -41.309 -12.909  1.00  0.89           O
ATOM   1468  CB  ALA B 187     -35.781 -43.597 -14.459  1.00  0.89           C
ATOM   1469  N   HIS B 188     -33.109 -41.204 -14.339  1.00  0.76           N
ATOM   1470  CA  HIS B 188     -32.827 -39.806 -14.092  1.00  0.76           C
ATOM   1471  C   HIS B 188     -34.049 -38.934 -14.299  1.00  0.76           C
ATOM   1472  O   HIS B 188     -34.327 -38.027 -13.524  1.00  0.76           O
ATOM   1473  CB  HIS B 188     -31.674 -39.358 -15.039  1.00  0.76           C
ATOM   1474  CG  HIS B 188     -31.508 -37.890 -15.320  1.00  0.76           C
ATOM   1475  ND1 HIS B 188     -30.832 -37.511 -16.462  1.00  0.76           N
ATOM   1476  CD2 HIS B 188     -31.839 -36.792 -14.595  1.00  0.76           C
ATOM   1477  CE1 HIS B 188     -30.759 -36.201 -16.411  1.00  0.76           C
ATOM   1478  NE2 HIS B 188     -31.347 -35.715 -15.298  1.00  0.76           N
ATOM   1479  N   GLY B 189     -34.827 -39.199 -15.363  1.00  0.89           N
ATOM   1480  CA  GLY B 189     -35.808 -38.230 -15.813  1.00  0.89           C
ATOM   1481  C   GLY B 189     -37.062 -37.985 -15.001  1.00  0.89           C
ATOM   1482  O   GLY B 189     -37.488 -36.834 -14.914  1.00  0.89           O
ATOM   1483  N   PHE B 190     -37.735 -38.996 -14.410  1.00  0.90           N
ATOM   1484  CA  PHE B 190     -39.015 -38.737 -13.762  1.00  0.90           C
ATOM   1485  C   PHE B 190     -38.860 -38.099 -12.387  1.00  0.90           C
ATOM   1486  O   PHE B 190     -39.544 -37.147 -12.030  1.00  0.90           O
ATOM   1487  CB  PHE B 190     -39.897 -40.011 -13.694  1.00  0.90           C
ATOM   1488  CG  PHE B 190     -41.338 -39.752 -13.295  1.00  0.90           C
ATOM   1489  CD1 PHE B 190     -41.971 -38.498 -13.433  1.00  0.90           C
ATOM   1490  CD2 PHE B 190     -42.091 -40.815 -12.775  1.00  0.90           C
ATOM   1491  CE1 PHE B 190     -43.292 -38.304 -13.013  1.00  0.90           C
ATOM   1492  CE2 PHE B 190     -43.417 -40.627 -12.371  1.00  0.90           C
ATOM   1493  CZ  PHE B 190     -44.015 -39.368 -12.469  1.00  0.90           C
ATOM   1494  N   GLU B 191     -37.913 -38.582 -11.583  1.00  0.90           N
ATOM   1495  CA  GLU B 191     -37.672 -38.109 -10.243  1.00  0.90           C
ATOM   1496  C   GLU B 191     -37.096 -36.712 -10.216  1.00  0.90           C
ATOM   1497  O   GLU B 191     -37.393 -35.942  -9.304  1.00  0.90           O
ATOM   1498  CB  GLU B 191     -36.802 -39.110  -9.464  1.00  0.90           C
ATOM   1499  CG  GLU B 191     -37.532 -40.436  -9.138  1.00  0.90           C
ATOM   1500  CD  GLU B 191     -37.918 -41.287 -10.356  1.00  0.90           C
ATOM   1501  OE1 GLU B 191     -38.977 -41.949 -10.292  1.00  0.90           O
ATOM   1502  OE2 GLU B 191     -37.218 -41.203 -11.393  1.00  0.90           O
ATOM   1503  N   LEU B 192     -36.343 -36.296 -11.250  1.00  0.91           N
ATOM   1504  CA  LEU B 192     -35.993 -34.908 -11.500  1.00  0.91           C
ATOM   1505  C   LEU B 192     -37.246 -34.039 -11.681  1.00  0.91           C
ATOM   1506  O   LEU B 192     -37.384 -32.969 -11.103  1.00  0.91           O
ATOM   1507  CB  LEU B 192     -35.142 -34.855 -12.792  1.00  0.91           C
ATOM   1508  CG  LEU B 192     -34.136 -33.697 -12.967  1.00  0.91           C
ATOM   1509  CD1 LEU B 192     -33.760 -33.563 -14.451  1.00  0.91           C
ATOM   1510  CD2 LEU B 192     -34.604 -32.349 -12.414  1.00  0.91           C
ATOM   1511  N   THR B 193     -38.237 -34.541 -12.452  1.00  0.91           N
ATOM   1512  CA  THR B 193     -39.562 -33.931 -12.577  1.00  0.91           C
ATOM   1513  C   THR B 193     -40.282 -33.829 -11.250  1.00  0.91           C
ATOM   1514  O   THR B 193     -40.779 -32.767 -10.885  1.00  0.91           O
ATOM   1515  CB  THR B 193     -40.397 -34.617 -13.655  1.00  0.91           C
ATOM   1516  OG1 THR B 193     -40.121 -33.983 -14.886  1.00  0.91           O
ATOM   1517  CG2 THR B 193     -41.920 -34.630 -13.421  1.00  0.91           C
ATOM   1518  N   SER B 194     -40.271 -34.896 -10.433  1.00  0.93           N
ATOM   1519  CA  SER B 194     -40.848 -34.909  -9.094  1.00  0.93           C
ATOM   1520  C   SER B 194     -40.190 -33.945  -8.124  1.00  0.93           C
ATOM   1521  O   SER B 194     -40.834 -33.397  -7.232  1.00  0.93           O
ATOM   1522  CB  SER B 194     -40.847 -36.329  -8.491  1.00  0.93           C
ATOM   1523  OG  SER B 194     -41.680 -37.171  -9.289  1.00  0.93           O
ATOM   1524  N   MET B 195     -38.885 -33.670  -8.299  1.00  0.91           N
ATOM   1525  CA  MET B 195     -38.153 -32.680  -7.532  1.00  0.91           C
ATOM   1526  C   MET B 195     -38.685 -31.259  -7.649  1.00  0.91           C
ATOM   1527  O   MET B 195     -38.584 -30.486  -6.704  1.00  0.91           O
ATOM   1528  CB  MET B 195     -36.648 -32.701  -7.863  1.00  0.91           C
ATOM   1529  CG  MET B 195     -35.929 -33.919  -7.274  1.00  0.91           C
ATOM   1530  SD  MET B 195     -34.150 -33.876  -7.577  1.00  0.91           S
ATOM   1531  CE  MET B 195     -33.928 -35.663  -7.394  1.00  0.91           C
ATOM   1532  N   LYS B 196     -39.325 -30.881  -8.778  1.00  0.84           N
ATOM   1533  CA  LYS B 196     -39.851 -29.547  -9.049  1.00  0.84           C
ATOM   1534  C   LYS B 196     -40.725 -28.992  -7.936  1.00  0.84           C
ATOM   1535  O   LYS B 196     -40.753 -27.800  -7.634  1.00  0.84           O
ATOM   1536  CB  LYS B 196     -40.667 -29.608 -10.368  1.00  0.84           C
ATOM   1537  CG  LYS B 196     -41.387 -28.319 -10.806  1.00  0.84           C
ATOM   1538  CD  LYS B 196     -40.424 -27.139 -10.997  1.00  0.84           C
ATOM   1539  CE  LYS B 196     -41.126 -25.787 -11.104  1.00  0.84           C
ATOM   1540  NZ  LYS B 196     -40.119 -24.732 -11.257  1.00  0.84           N
ATOM   1541  N   TYR B 197     -41.459 -29.909  -7.310  1.00  0.90           N
ATOM   1542  CA  TYR B 197     -42.401 -29.699  -6.260  1.00  0.90           C
ATOM   1543  C   TYR B 197     -41.762 -29.320  -4.914  1.00  0.90           C
ATOM   1544  O   TYR B 197     -42.295 -28.451  -4.233  1.00  0.90           O
ATOM   1545  CB  TYR B 197     -43.316 -30.955  -6.167  1.00  0.90           C
ATOM   1546  CG  TYR B 197     -44.116 -31.264  -7.433  1.00  0.90           C
ATOM   1547  CD1 TYR B 197     -43.511 -31.594  -8.664  1.00  0.90           C
ATOM   1548  CD2 TYR B 197     -45.519 -31.317  -7.380  1.00  0.90           C
ATOM   1549  CE1 TYR B 197     -44.267 -31.907  -9.800  1.00  0.90           C
ATOM   1550  CE2 TYR B 197     -46.282 -31.587  -8.524  1.00  0.90           C
ATOM   1551  CZ  TYR B 197     -45.660 -31.877  -9.737  1.00  0.90           C
ATOM   1552  OH  TYR B 197     -46.441 -32.170 -10.874  1.00  0.90           O
ATOM   1553  N   PHE B 198     -40.628 -29.935  -4.483  1.00  0.91           N
ATOM   1554  CA  PHE B 198     -39.997 -29.637  -3.193  1.00  0.91           C
ATOM   1555  C   PHE B 198     -38.576 -29.098  -3.250  1.00  0.91           C
ATOM   1556  O   PHE B 198     -37.974 -28.781  -2.222  1.00  0.91           O
ATOM   1557  CB  PHE B 198     -39.979 -30.892  -2.275  1.00  0.91           C
ATOM   1558  CG  PHE B 198     -39.325 -32.095  -2.897  1.00  0.91           C
ATOM   1559  CD1 PHE B 198     -37.930 -32.229  -2.939  1.00  0.91           C
ATOM   1560  CD2 PHE B 198     -40.116 -33.124  -3.421  1.00  0.91           C
ATOM   1561  CE1 PHE B 198     -37.341 -33.363  -3.507  1.00  0.91           C
ATOM   1562  CE2 PHE B 198     -39.537 -34.270  -3.974  1.00  0.91           C
ATOM   1563  CZ  PHE B 198     -38.144 -34.383  -4.020  1.00  0.91           C
ATOM   1564  N   VAL B 199     -37.972 -28.983  -4.426  1.00  0.94           N
ATOM   1565  CA  VAL B 199     -36.614 -28.529  -4.584  1.00  0.94           C
ATOM   1566  C   VAL B 199     -36.605 -27.097  -5.044  1.00  0.94           C
ATOM   1567  O   VAL B 199     -37.426 -26.659  -5.847  1.00  0.94           O
ATOM   1568  CB  VAL B 199     -35.853 -29.380  -5.587  1.00  0.94           C
ATOM   1569  CG1 VAL B 199     -34.503 -28.769  -5.990  1.00  0.94           C
ATOM   1570  CG2 VAL B 199     -35.638 -30.773  -4.986  1.00  0.94           C
ATOM   1571  N   LYS B 200     -35.634 -26.318  -4.553  1.00  0.84           N
ATOM   1572  CA  LYS B 200     -35.267 -25.079  -5.183  1.00  0.84           C
ATOM   1573  C   LYS B 200     -33.781 -25.182  -5.436  1.00  0.84           C
ATOM   1574  O   LYS B 200     -33.125 -26.121  -4.988  1.00  0.84           O
ATOM   1575  CB  LYS B 200     -35.654 -23.841  -4.321  1.00  0.84           C
ATOM   1576  CG  LYS B 200     -36.468 -22.779  -5.088  1.00  0.84           C
ATOM   1577  CD  LYS B 200     -37.791 -22.314  -4.457  1.00  0.84           C
ATOM   1578  CE  LYS B 200     -38.791 -21.776  -5.503  1.00  0.84           C
ATOM   1579  NZ  LYS B 200     -38.503 -20.386  -5.950  1.00  0.84           N
ATOM   1580  N   ILE B 201     -33.220 -24.247  -6.206  1.00  0.87           N
ATOM   1581  CA  ILE B 201     -31.804 -24.237  -6.492  1.00  0.87           C
ATOM   1582  C   ILE B 201     -31.310 -22.804  -6.378  1.00  0.87           C
ATOM   1583  O   ILE B 201     -32.078 -21.842  -6.464  1.00  0.87           O
ATOM   1584  CB  ILE B 201     -31.512 -24.914  -7.839  1.00  0.87           C
ATOM   1585  CG1 ILE B 201     -30.160 -25.658  -7.882  1.00  0.87           C
ATOM   1586  CG2 ILE B 201     -31.656 -23.929  -9.013  1.00  0.87           C
ATOM   1587  CD1 ILE B 201     -30.124 -26.868  -6.942  1.00  0.87           C
ATOM   1588  N   GLY B 202     -30.002 -22.615  -6.135  1.00  0.89           N
ATOM   1589  CA  GLY B 202     -29.368 -21.314  -6.021  1.00  0.89           C
ATOM   1590  C   GLY B 202     -27.883 -21.518  -5.829  1.00  0.89           C
ATOM   1591  O   GLY B 202     -27.426 -22.658  -5.851  1.00  0.89           O
ATOM   1592  N   PRO B 203     -27.094 -20.472  -5.658  1.00  0.87           N
ATOM   1593  CA  PRO B 203     -25.681 -20.569  -5.304  1.00  0.87           C
ATOM   1594  C   PRO B 203     -25.489 -20.982  -3.856  1.00  0.87           C
ATOM   1595  O   PRO B 203     -26.313 -20.611  -3.021  1.00  0.87           O
ATOM   1596  CB  PRO B 203     -25.202 -19.130  -5.541  1.00  0.87           C
ATOM   1597  CG  PRO B 203     -26.390 -18.264  -5.135  1.00  0.87           C
ATOM   1598  CD  PRO B 203     -27.584 -19.095  -5.604  1.00  0.87           C
ATOM   1599  N   GLU B 204     -24.425 -21.758  -3.534  1.00  0.85           N
ATOM   1600  CA  GLU B 204     -24.154 -22.256  -2.187  1.00  0.85           C
ATOM   1601  C   GLU B 204     -24.238 -21.175  -1.114  1.00  0.85           C
ATOM   1602  O   GLU B 204     -23.747 -20.060  -1.279  1.00  0.85           O
ATOM   1603  CB  GLU B 204     -22.791 -23.001  -2.076  1.00  0.85           C
ATOM   1604  CG  GLU B 204     -22.841 -24.499  -2.486  1.00  0.85           C
ATOM   1605  CD  GLU B 204     -23.536 -25.409  -1.475  1.00  0.85           C
ATOM   1606  OE1 GLU B 204     -23.549 -26.643  -1.705  1.00  0.85           O
ATOM   1607  OE2 GLU B 204     -24.068 -24.917  -0.442  1.00  0.85           O
ATOM   1608  N   ARG B 205     -24.912 -21.485   0.009  1.00  0.79           N
ATOM   1609  CA  ARG B 205     -25.148 -20.527   1.066  1.00  0.79           C
ATOM   1610  C   ARG B 205     -25.069 -21.204   2.408  1.00  0.79           C
ATOM   1611  O   ARG B 205     -25.083 -22.426   2.511  1.00  0.79           O
ATOM   1612  CB  ARG B 205     -26.504 -19.796   0.913  1.00  0.79           C
ATOM   1613  CG  ARG B 205     -26.406 -18.678  -0.139  1.00  0.79           C
ATOM   1614  CD  ARG B 205     -26.970 -17.348   0.342  1.00  0.79           C
ATOM   1615  NE  ARG B 205     -26.591 -16.279  -0.630  1.00  0.79           N
ATOM   1616  CZ  ARG B 205     -27.167 -16.097  -1.821  1.00  0.79           C
ATOM   1617  NH1 ARG B 205     -28.062 -16.942  -2.322  1.00  0.79           N
ATOM   1618  NH2 ARG B 205     -26.840 -15.023  -2.531  1.00  0.79           N
ATOM   1619  N   THR B 206     -24.944 -20.408   3.483  1.00  0.89           N
ATOM   1620  CA  THR B 206     -24.785 -20.876   4.848  1.00  0.89           C
ATOM   1621  C   THR B 206     -26.117 -20.898   5.575  1.00  0.89           C
ATOM   1622  O   THR B 206     -27.060 -20.194   5.216  1.00  0.89           O
ATOM   1623  CB  THR B 206     -23.787 -20.032   5.633  1.00  0.89           C
ATOM   1624  OG1 THR B 206     -24.282 -18.725   5.907  1.00  0.89           O
ATOM   1625  CG2 THR B 206     -22.533 -19.836   4.765  1.00  0.89           C
ATOM   1626  N   CYS B 207     -26.261 -21.747   6.610  1.00  0.93           N
ATOM   1627  CA  CYS B 207     -27.503 -21.847   7.347  1.00  0.93           C
ATOM   1628  C   CYS B 207     -27.774 -20.703   8.306  1.00  0.93           C
ATOM   1629  O   CYS B 207     -26.962 -20.351   9.153  1.00  0.93           O
ATOM   1630  CB  CYS B 207     -27.709 -23.243   8.000  1.00  0.93           C
ATOM   1631  SG  CYS B 207     -26.286 -24.133   8.699  1.00  0.93           S
ATOM   1632  N   CYS B 208     -28.947 -20.055   8.197  1.00  0.91           N
ATOM   1633  CA  CYS B 208     -29.318 -18.956   9.065  1.00  0.91           C
ATOM   1634  C   CYS B 208     -29.480 -19.335  10.544  1.00  0.91           C
ATOM   1635  O   CYS B 208     -30.205 -20.257  10.910  1.00  0.91           O
ATOM   1636  CB  CYS B 208     -30.462 -18.114   8.422  1.00  0.91           C
ATOM   1637  SG  CYS B 208     -31.513 -17.098   9.506  1.00  0.91           S
ATOM   1638  N   LEU B 209     -28.715 -18.594  11.383  1.00  0.80           N
ATOM   1639  CA  LEU B 209     -28.525 -18.702  12.827  1.00  0.80           C
ATOM   1640  C   LEU B 209     -27.384 -19.658  13.158  1.00  0.80           C
ATOM   1641  O   LEU B 209     -27.029 -19.889  14.313  1.00  0.80           O
ATOM   1642  CB  LEU B 209     -29.845 -18.910  13.637  1.00  0.80           C
ATOM   1643  CG  LEU B 209     -30.062 -20.290  14.293  1.00  0.80           C
ATOM   1644  CD1 LEU B 209     -29.738 -20.264  15.794  1.00  0.80           C
ATOM   1645  CD2 LEU B 209     -31.496 -20.789  14.098  1.00  0.80           C
ATOM   1646  N   CYS B 210     -26.709 -20.198  12.137  1.00  0.91           N
ATOM   1647  CA  CYS B 210     -25.871 -21.362  12.273  1.00  0.91           C
ATOM   1648  C   CYS B 210     -24.548 -21.158  11.538  1.00  0.91           C
ATOM   1649  O   CYS B 210     -24.313 -20.136  10.902  1.00  0.91           O
ATOM   1650  CB  CYS B 210     -26.561 -22.587  11.635  1.00  0.91           C
ATOM   1651  SG  CYS B 210     -28.365 -22.748  11.903  1.00  0.91           S
ATOM   1652  N   ASP B 211     -23.654 -22.162  11.645  1.00  0.86           N
ATOM   1653  CA  ASP B 211     -22.329 -22.191  11.057  1.00  0.86           C
ATOM   1654  C   ASP B 211     -22.271 -22.771   9.621  1.00  0.86           C
ATOM   1655  O   ASP B 211     -21.919 -22.087   8.664  1.00  0.86           O
ATOM   1656  CB  ASP B 211     -21.534 -23.078  12.052  1.00  0.86           C
ATOM   1657  CG  ASP B 211     -20.046 -23.115  11.758  1.00  0.86           C
ATOM   1658  OD1 ASP B 211     -19.442 -22.028  11.614  1.00  0.86           O
ATOM   1659  OD2 ASP B 211     -19.521 -24.254  11.677  1.00  0.86           O
ATOM   1660  N   ARG B 212     -22.612 -24.073   9.445  1.00  0.76           N
ATOM   1661  CA  ARG B 212     -22.425 -24.811   8.181  1.00  0.76           C
ATOM   1662  C   ARG B 212     -23.257 -24.394   6.953  1.00  0.76           C
ATOM   1663  O   ARG B 212     -23.990 -23.414   6.939  1.00  0.76           O
ATOM   1664  CB  ARG B 212     -22.431 -26.355   8.397  1.00  0.76           C
ATOM   1665  CG  ARG B 212     -23.814 -27.008   8.636  1.00  0.76           C
ATOM   1666  CD  ARG B 212     -23.776 -28.538   8.824  1.00  0.76           C
ATOM   1667  NE  ARG B 212     -25.197 -29.021   8.942  1.00  0.76           N
ATOM   1668  CZ  ARG B 212     -25.558 -30.267   9.292  1.00  0.76           C
ATOM   1669  NH1 ARG B 212     -26.844 -30.546   9.508  1.00  0.76           N
ATOM   1670  NH2 ARG B 212     -24.682 -31.243   9.482  1.00  0.76           N
ATOM   1671  N   ARG B 213     -23.129 -25.131   5.822  1.00  0.79           N
ATOM   1672  CA  ARG B 213     -23.866 -24.872   4.588  1.00  0.79           C
ATOM   1673  C   ARG B 213     -25.353 -25.160   4.701  1.00  0.79           C
ATOM   1674  O   ARG B 213     -25.792 -25.991   5.495  1.00  0.79           O
ATOM   1675  CB  ARG B 213     -23.309 -25.581   3.320  1.00  0.79           C
ATOM   1676  CG  ARG B 213     -23.828 -27.015   3.094  1.00  0.79           C
ATOM   1677  CD  ARG B 213     -23.474 -27.589   1.719  1.00  0.79           C
ATOM   1678  NE  ARG B 213     -24.601 -28.502   1.345  1.00  0.79           N
ATOM   1679  CZ  ARG B 213     -25.688 -28.091   0.672  1.00  0.79           C
ATOM   1680  NH1 ARG B 213     -25.839 -26.851   0.214  1.00  0.79           N
ATOM   1681  NH2 ARG B 213     -26.660 -28.969   0.472  1.00  0.79           N
ATOM   1682  N   ALA B 214     -26.171 -24.492   3.872  1.00  0.94           N
ATOM   1683  CA  ALA B 214     -27.603 -24.627   3.890  1.00  0.94           C
ATOM   1684  C   ALA B 214     -28.155 -25.692   2.940  1.00  0.94           C
ATOM   1685  O   ALA B 214     -28.072 -25.623   1.715  1.00  0.94           O
ATOM   1686  CB  ALA B 214     -28.270 -23.274   3.608  1.00  0.94           C
ATOM   1687  N   THR B 215     -28.764 -26.730   3.538  1.00  0.92           N
ATOM   1688  CA  THR B 215     -29.629 -27.703   2.884  1.00  0.92           C
ATOM   1689  C   THR B 215     -31.001 -27.206   2.483  1.00  0.92           C
ATOM   1690  O   THR B 215     -31.509 -27.555   1.423  1.00  0.92           O
ATOM   1691  CB  THR B 215     -29.894 -28.891   3.781  1.00  0.92           C
ATOM   1692  OG1 THR B 215     -28.673 -29.550   4.085  1.00  0.92           O
ATOM   1693  CG2 THR B 215     -30.810 -29.906   3.108  1.00  0.92           C
ATOM   1694  N   CYS B 216     -31.676 -26.428   3.335  1.00  0.93           N
ATOM   1695  CA  CYS B 216     -33.102 -26.180   3.280  1.00  0.93           C
ATOM   1696  C   CYS B 216     -33.468 -24.727   3.017  1.00  0.93           C
ATOM   1697  O   CYS B 216     -32.698 -23.801   3.287  1.00  0.93           O
ATOM   1698  CB  CYS B 216     -33.812 -26.580   4.600  1.00  0.93           C
ATOM   1699  SG  CYS B 216     -33.438 -28.268   5.160  1.00  0.93           S
ATOM   1700  N   PHE B 217     -34.693 -24.513   2.497  1.00  0.90           N
ATOM   1701  CA  PHE B 217     -35.314 -23.211   2.297  1.00  0.90           C
ATOM   1702  C   PHE B 217     -36.726 -23.222   2.885  1.00  0.90           C
ATOM   1703  O   PHE B 217     -37.366 -24.266   2.973  1.00  0.90           O
ATOM   1704  CB  PHE B 217     -35.401 -22.888   0.781  1.00  0.90           C
ATOM   1705  CG  PHE B 217     -35.903 -21.505   0.470  1.00  0.90           C
ATOM   1706  CD1 PHE B 217     -37.209 -21.329  -0.018  1.00  0.90           C
ATOM   1707  CD2 PHE B 217     -35.103 -20.373   0.677  1.00  0.90           C
ATOM   1708  CE1 PHE B 217     -37.699 -20.048  -0.290  1.00  0.90           C
ATOM   1709  CE2 PHE B 217     -35.591 -19.089   0.408  1.00  0.90           C
ATOM   1710  CZ  PHE B 217     -36.891 -18.929  -0.075  1.00  0.90           C
ATOM   1711  N   SER B 218     -37.222 -22.046   3.317  1.00  0.88           N
ATOM   1712  CA  SER B 218     -38.577 -21.867   3.826  1.00  0.88           C
ATOM   1713  C   SER B 218     -39.268 -20.827   2.984  1.00  0.88           C
ATOM   1714  O   SER B 218     -38.738 -19.743   2.762  1.00  0.88           O
ATOM   1715  CB  SER B 218     -38.625 -21.328   5.281  1.00  0.88           C
ATOM   1716  OG  SER B 218     -39.966 -21.082   5.731  1.00  0.88           O
ATOM   1717  N   THR B 219     -40.476 -21.095   2.488  1.00  0.84           N
ATOM   1718  CA  THR B 219     -41.154 -20.121   1.645  1.00  0.84           C
ATOM   1719  C   THR B 219     -41.974 -19.130   2.467  1.00  0.84           C
ATOM   1720  O   THR B 219     -42.343 -18.065   1.980  1.00  0.84           O
ATOM   1721  CB  THR B 219     -42.040 -20.737   0.585  1.00  0.84           C
ATOM   1722  OG1 THR B 219     -42.944 -21.608   1.210  1.00  0.84           O
ATOM   1723  CG2 THR B 219     -41.271 -21.461  -0.542  1.00  0.84           C
ATOM   1724  N   ALA B 220     -42.241 -19.430   3.758  1.00  0.89           N
ATOM   1725  CA  ALA B 220     -43.009 -18.603   4.669  1.00  0.89           C
ATOM   1726  C   ALA B 220     -42.318 -17.298   5.049  1.00  0.89           C
ATOM   1727  O   ALA B 220     -42.940 -16.246   5.196  1.00  0.89           O
ATOM   1728  CB  ALA B 220     -43.334 -19.447   5.918  1.00  0.89           C
ATOM   1729  N   SER B 221     -40.992 -17.350   5.223  1.00  0.89           N
ATOM   1730  CA  SER B 221     -40.150 -16.194   5.448  1.00  0.89           C
ATOM   1731  C   SER B 221     -38.817 -16.511   4.846  1.00  0.89           C
ATOM   1732  O   SER B 221     -38.288 -17.601   5.056  1.00  0.89           O
ATOM   1733  CB  SER B 221     -39.906 -15.856   6.946  1.00  0.89           C
ATOM   1734  OG  SER B 221     -39.377 -16.968   7.676  1.00  0.89           O
ATOM   1735  N   ASP B 222     -38.223 -15.574   4.080  1.00  0.87           N
ATOM   1736  CA  ASP B 222     -37.009 -15.861   3.348  1.00  0.87           C
ATOM   1737  C   ASP B 222     -35.862 -16.214   4.296  1.00  0.87           C
ATOM   1738  O   ASP B 222     -35.391 -15.397   5.091  1.00  0.87           O
ATOM   1739  CB  ASP B 222     -36.689 -14.702   2.373  1.00  0.87           C
ATOM   1740  CG  ASP B 222     -35.762 -15.155   1.252  1.00  0.87           C
ATOM   1741  OD1 ASP B 222     -34.568 -15.428   1.533  1.00  0.87           O
ATOM   1742  OD2 ASP B 222     -36.255 -15.251   0.099  1.00  0.87           O
ATOM   1743  N   THR B 223     -35.473 -17.501   4.286  1.00  0.89           N
ATOM   1744  CA  THR B 223     -34.461 -18.034   5.176  1.00  0.89           C
ATOM   1745  C   THR B 223     -33.825 -19.259   4.545  1.00  0.89           C
ATOM   1746  O   THR B 223     -34.376 -19.935   3.679  1.00  0.89           O
ATOM   1747  CB  THR B 223     -34.919 -18.394   6.592  1.00  0.89           C
ATOM   1748  OG1 THR B 223     -36.176 -19.018   6.503  1.00  0.89           O
ATOM   1749  CG2 THR B 223     -35.132 -17.222   7.533  1.00  0.89           C
ATOM   1750  N   TYR B 224     -32.589 -19.560   4.988  1.00  0.90           N
ATOM   1751  CA  TYR B 224     -31.826 -20.734   4.612  1.00  0.90           C
ATOM   1752  C   TYR B 224     -31.468 -21.509   5.856  1.00  0.90           C
ATOM   1753  O   TYR B 224     -31.188 -20.921   6.894  1.00  0.90           O
ATOM   1754  CB  TYR B 224     -30.502 -20.354   3.914  1.00  0.90           C
ATOM   1755  CG  TYR B 224     -30.765 -19.605   2.649  1.00  0.90           C
ATOM   1756  CD1 TYR B 224     -31.491 -20.234   1.633  1.00  0.90           C
ATOM   1757  CD2 TYR B 224     -30.287 -18.301   2.431  1.00  0.90           C
ATOM   1758  CE1 TYR B 224     -31.721 -19.580   0.417  1.00  0.90           C
ATOM   1759  CE2 TYR B 224     -30.454 -17.691   1.179  1.00  0.90           C
ATOM   1760  CZ  TYR B 224     -31.164 -18.327   0.163  1.00  0.90           C
ATOM   1761  OH  TYR B 224     -31.355 -17.669  -1.075  1.00  0.90           O
ATOM   1762  N   ALA B 225     -31.450 -22.845   5.816  1.00  0.93           N
ATOM   1763  CA  ALA B 225     -31.154 -23.616   6.997  1.00  0.93           C
ATOM   1764  C   ALA B 225     -30.590 -24.944   6.590  1.00  0.93           C
ATOM   1765  O   ALA B 225     -30.508 -25.254   5.412  1.00  0.93           O
ATOM   1766  CB  ALA B 225     -32.369 -23.784   7.915  1.00  0.93           C
ATOM   1767  N   CYS B 226     -30.108 -25.747   7.546  1.00  0.87           N
ATOM   1768  CA  CYS B 226     -29.553 -27.052   7.269  1.00  0.87           C
ATOM   1769  C   CYS B 226     -30.431 -28.117   7.851  1.00  0.87           C
ATOM   1770  O   CYS B 226     -31.585 -27.883   8.194  1.00  0.87           O
ATOM   1771  CB  CYS B 226     -28.087 -27.202   7.743  1.00  0.87           C
ATOM   1772  SG  CYS B 226     -27.830 -27.053   9.527  1.00  0.87           S
ATOM   1773  N   TRP B 227     -29.927 -29.338   7.997  1.00  0.86           N
ATOM   1774  CA  TRP B 227     -30.706 -30.431   8.506  1.00  0.86           C
ATOM   1775  C   TRP B 227     -30.884 -30.374  10.004  1.00  0.86           C
ATOM   1776  O   TRP B 227     -31.654 -31.138  10.566  1.00  0.86           O
ATOM   1777  CB  TRP B 227     -30.002 -31.777   8.232  1.00  0.86           C
ATOM   1778  CG  TRP B 227     -29.624 -32.114   6.803  1.00  0.86           C
ATOM   1779  CD1 TRP B 227     -28.402 -32.468   6.296  1.00  0.86           C
ATOM   1780  CD2 TRP B 227     -30.570 -32.325   5.754  1.00  0.86           C
ATOM   1781  NE1 TRP B 227     -28.535 -32.910   5.004  1.00  0.86           N
ATOM   1782  CE2 TRP B 227     -29.857 -32.867   4.665  1.00  0.86           C
ATOM   1783  CE3 TRP B 227     -31.939 -32.131   5.681  1.00  0.86           C
ATOM   1784  CZ2 TRP B 227     -30.516 -33.243   3.518  1.00  0.86           C
ATOM   1785  CZ3 TRP B 227     -32.597 -32.457   4.494  1.00  0.86           C
ATOM   1786  CH2 TRP B 227     -31.889 -32.994   3.409  1.00  0.86           C
ATOM   1787  N   HIS B 228     -30.114 -29.534  10.726  1.00  0.84           N
ATOM   1788  CA  HIS B 228     -30.076 -29.699  12.171  1.00  0.84           C
ATOM   1789  C   HIS B 228     -31.087 -28.834  12.870  1.00  0.84           C
ATOM   1790  O   HIS B 228     -31.912 -29.316  13.641  1.00  0.84           O
ATOM   1791  CB  HIS B 228     -28.671 -29.432  12.734  1.00  0.84           C
ATOM   1792  CG  HIS B 228     -28.573 -29.483  14.229  1.00  0.84           C
ATOM   1793  ND1 HIS B 228     -28.550 -30.702  14.872  1.00  0.84           N
ATOM   1794  CD2 HIS B 228     -28.417 -28.473  15.122  1.00  0.84           C
ATOM   1795  CE1 HIS B 228     -28.359 -30.408  16.147  1.00  0.84           C
ATOM   1796  NE2 HIS B 228     -28.278 -29.072  16.352  1.00  0.84           N
ATOM   1797  N   HIS B 229     -31.028 -27.528  12.580  1.00  0.74           N
ATOM   1798  CA  HIS B 229     -31.750 -26.488  13.272  1.00  0.74           C
ATOM   1799  C   HIS B 229     -32.987 -26.063  12.505  1.00  0.74           C
ATOM   1800  O   HIS B 229     -33.560 -25.017  12.796  1.00  0.74           O
ATOM   1801  CB  HIS B 229     -30.872 -25.214  13.440  1.00  0.74           C
ATOM   1802  CG  HIS B 229     -29.383 -25.403  13.415  1.00  0.74           C
ATOM   1803  ND1 HIS B 229     -28.707 -25.920  12.322  1.00  0.74           N
ATOM   1804  CD2 HIS B 229     -28.496 -25.010  14.358  1.00  0.74           C
ATOM   1805  CE1 HIS B 229     -27.428 -25.835  12.634  1.00  0.74           C
ATOM   1806  NE2 HIS B 229     -27.246 -25.293  13.858  1.00  0.74           N
ATOM   1807  N   SER B 230     -33.421 -26.828  11.482  1.00  0.80           N
ATOM   1808  CA  SER B 230     -34.522 -26.413  10.621  1.00  0.80           C
ATOM   1809  C   SER B 230     -35.783 -27.235  10.819  1.00  0.80           C
ATOM   1810  O   SER B 230     -35.787 -28.456  10.759  1.00  0.80           O
ATOM   1811  CB  SER B 230     -34.155 -26.361   9.103  1.00  0.80           C
ATOM   1812  OG  SER B 230     -34.535 -27.498   8.317  1.00  0.80           O
ATOM   1813  N   ILE B 231     -36.920 -26.549  11.032  1.00  0.90           N
ATOM   1814  CA  ILE B 231     -38.233 -27.163  11.026  1.00  0.90           C
ATOM   1815  C   ILE B 231     -39.125 -26.087  10.455  1.00  0.90           C
ATOM   1816  O   ILE B 231     -38.806 -24.905  10.557  1.00  0.90           O
ATOM   1817  CB  ILE B 231     -38.823 -27.599  12.378  1.00  0.90           C
ATOM   1818  CG1 ILE B 231     -38.902 -26.479  13.447  1.00  0.90           C
ATOM   1819  CG2 ILE B 231     -38.066 -28.829  12.913  1.00  0.90           C
ATOM   1820  CD1 ILE B 231     -39.797 -26.842  14.642  1.00  0.90           C
ATOM   1821  N   GLY B 232     -40.244 -26.419   9.781  1.00  0.88           N
ATOM   1822  CA  GLY B 232     -41.070 -25.390   9.135  1.00  0.88           C
ATOM   1823  C   GLY B 232     -40.510 -24.918   7.824  1.00  0.88           C
ATOM   1824  O   GLY B 232     -41.091 -24.081   7.148  1.00  0.88           O
ATOM   1825  N   PHE B 233     -39.369 -25.492   7.428  1.00  0.87           N
ATOM   1826  CA  PHE B 233     -38.744 -25.288   6.147  1.00  0.87           C
ATOM   1827  C   PHE B 233     -39.328 -26.300   5.186  1.00  0.87           C
ATOM   1828  O   PHE B 233     -39.227 -27.507   5.396  1.00  0.87           O
ATOM   1829  CB  PHE B 233     -37.202 -25.458   6.239  1.00  0.87           C
ATOM   1830  CG  PHE B 233     -36.535 -24.236   6.815  1.00  0.87           C
ATOM   1831  CD1 PHE B 233     -36.813 -23.745   8.104  1.00  0.87           C
ATOM   1832  CD2 PHE B 233     -35.591 -23.550   6.040  1.00  0.87           C
ATOM   1833  CE1 PHE B 233     -36.209 -22.577   8.580  1.00  0.87           C
ATOM   1834  CE2 PHE B 233     -35.002 -22.370   6.496  1.00  0.87           C
ATOM   1835  CZ  PHE B 233     -35.315 -21.881   7.766  1.00  0.87           C
ATOM   1836  N   ASP B 234     -39.989 -25.822   4.118  1.00  0.89           N
ATOM   1837  CA  ASP B 234     -40.771 -26.634   3.224  1.00  0.89           C
ATOM   1838  C   ASP B 234     -39.983 -27.080   2.008  1.00  0.89           C
ATOM   1839  O   ASP B 234     -40.433 -27.918   1.237  1.00  0.89           O
ATOM   1840  CB  ASP B 234     -42.075 -25.875   2.839  1.00  0.89           C
ATOM   1841  CG  ASP B 234     -41.890 -24.511   2.212  1.00  0.89           C
ATOM   1842  OD1 ASP B 234     -41.069 -23.690   2.681  1.00  0.89           O
ATOM   1843  OD2 ASP B 234     -42.606 -24.266   1.217  1.00  0.89           O
ATOM   1844  N   TYR B 235     -38.754 -26.578   1.823  1.00  0.91           N
ATOM   1845  CA  TYR B 235     -38.020 -26.807   0.598  1.00  0.91           C
ATOM   1846  C   TYR B 235     -36.588 -27.268   0.800  1.00  0.91           C
ATOM   1847  O   TYR B 235     -35.940 -27.029   1.818  1.00  0.91           O
ATOM   1848  CB  TYR B 235     -37.971 -25.487  -0.200  1.00  0.91           C
ATOM   1849  CG  TYR B 235     -38.995 -25.470  -1.283  1.00  0.91           C
ATOM   1850  CD1 TYR B 235     -40.331 -25.250  -0.961  1.00  0.91           C
ATOM   1851  CD2 TYR B 235     -38.655 -25.592  -2.632  1.00  0.91           C
ATOM   1852  CE1 TYR B 235     -41.309 -25.126  -1.952  1.00  0.91           C
ATOM   1853  CE2 TYR B 235     -39.596 -25.354  -3.634  1.00  0.91           C
ATOM   1854  CZ  TYR B 235     -40.925 -25.140  -3.296  1.00  0.91           C
ATOM   1855  OH  TYR B 235     -41.860 -24.941  -4.323  1.00  0.91           O
ATOM   1856  N   VAL B 236     -36.039 -27.922  -0.242  1.00  0.93           N
ATOM   1857  CA  VAL B 236     -34.654 -28.368  -0.300  1.00  0.93           C
ATOM   1858  C   VAL B 236     -33.856 -27.443  -1.225  1.00  0.93           C
ATOM   1859  O   VAL B 236     -34.130 -27.345  -2.412  1.00  0.93           O
ATOM   1860  CB  VAL B 236     -34.550 -29.800  -0.819  1.00  0.93           C
ATOM   1861  CG1 VAL B 236     -33.129 -30.357  -0.603  1.00  0.93           C
ATOM   1862  CG2 VAL B 236     -35.571 -30.702  -0.099  1.00  0.93           C
ATOM   1863  N   TYR B 237     -32.863 -26.709  -0.681  1.00  0.91           N
ATOM   1864  CA  TYR B 237     -32.159 -25.594  -1.301  1.00  0.91           C
ATOM   1865  C   TYR B 237     -31.078 -25.952  -2.294  1.00  0.91           C
ATOM   1866  O   TYR B 237     -30.901 -25.299  -3.317  1.00  0.91           O
ATOM   1867  CB  TYR B 237     -31.453 -24.753  -0.193  1.00  0.91           C
ATOM   1868  CG  TYR B 237     -30.835 -23.510  -0.783  1.00  0.91           C
ATOM   1869  CD1 TYR B 237     -29.444 -23.347  -0.927  1.00  0.91           C
ATOM   1870  CD2 TYR B 237     -31.692 -22.589  -1.384  1.00  0.91           C
ATOM   1871  CE1 TYR B 237     -28.930 -22.229  -1.605  1.00  0.91           C
ATOM   1872  CE2 TYR B 237     -31.177 -21.511  -2.103  1.00  0.91           C
ATOM   1873  CZ  TYR B 237     -29.800 -21.290  -2.168  1.00  0.91           C
ATOM   1874  OH  TYR B 237     -29.333 -20.089  -2.735  1.00  0.91           O
ATOM   1875  N   ASN B 238     -30.260 -26.945  -1.959  1.00  0.91           N
ATOM   1876  CA  ASN B 238     -29.297 -27.466  -2.890  1.00  0.91           C
ATOM   1877  C   ASN B 238     -29.152 -28.951  -2.610  1.00  0.91           C
ATOM   1878  O   ASN B 238     -28.350 -29.362  -1.762  1.00  0.91           O
ATOM   1879  CB  ASN B 238     -27.935 -26.738  -2.808  1.00  0.91           C
ATOM   1880  CG  ASN B 238     -27.764 -25.790  -3.990  1.00  0.91           C
ATOM   1881  OD1 ASN B 238     -27.290 -26.210  -5.043  1.00  0.91           O
ATOM   1882  ND2 ASN B 238     -28.152 -24.506  -3.850  1.00  0.91           N
ATOM   1883  N   PRO B 239     -29.961 -29.776  -3.267  1.00  0.97           N
ATOM   1884  CA  PRO B 239     -29.726 -31.199  -3.356  1.00  0.97           C
ATOM   1885  C   PRO B 239     -28.774 -31.518  -4.481  1.00  0.97           C
ATOM   1886  O   PRO B 239     -28.638 -30.757  -5.435  1.00  0.97           O
ATOM   1887  CB  PRO B 239     -31.116 -31.765  -3.662  1.00  0.97           C
ATOM   1888  CG  PRO B 239     -31.788 -30.681  -4.499  1.00  0.97           C
ATOM   1889  CD  PRO B 239     -31.221 -29.387  -3.918  1.00  0.97           C
ATOM   1890  N   PHE B 240     -28.121 -32.679  -4.366  1.00  0.93           N
ATOM   1891  CA  PHE B 240     -27.286 -33.241  -5.393  1.00  0.93           C
ATOM   1892  C   PHE B 240     -27.894 -34.584  -5.744  1.00  0.93           C
ATOM   1893  O   PHE B 240     -28.783 -35.086  -5.054  1.00  0.93           O
ATOM   1894  CB  PHE B 240     -25.828 -33.451  -4.918  1.00  0.93           C
ATOM   1895  CG  PHE B 240     -25.140 -32.157  -4.593  1.00  0.93           C
ATOM   1896  CD1 PHE B 240     -25.265 -31.576  -3.320  1.00  0.93           C
ATOM   1897  CD2 PHE B 240     -24.329 -31.527  -5.548  1.00  0.93           C
ATOM   1898  CE1 PHE B 240     -24.592 -30.388  -3.007  1.00  0.93           C
ATOM   1899  CE2 PHE B 240     -23.662 -30.334  -5.243  1.00  0.93           C
ATOM   1900  CZ  PHE B 240     -23.795 -29.764  -3.972  1.00  0.93           C
ATOM   1901  N   MET B 241     -27.468 -35.199  -6.852  1.00  0.92           N
ATOM   1902  CA  MET B 241     -28.018 -36.468  -7.266  1.00  0.92           C
ATOM   1903  C   MET B 241     -27.105 -37.169  -8.239  1.00  0.92           C
ATOM   1904  O   MET B 241     -26.258 -36.557  -8.891  1.00  0.92           O
ATOM   1905  CB  MET B 241     -29.425 -36.296  -7.893  1.00  0.92           C
ATOM   1906  CG  MET B 241     -29.455 -35.315  -9.078  1.00  0.92           C
ATOM   1907  SD  MET B 241     -30.916 -34.241  -9.177  1.00  0.92           S
ATOM   1908  CE  MET B 241     -30.479 -33.186  -7.761  1.00  0.92           C
ATOM   1909  N   ILE B 242     -27.249 -38.499  -8.355  1.00  0.92           N
ATOM   1910  CA  ILE B 242     -26.537 -39.257  -9.359  1.00  0.92           C
ATOM   1911  C   ILE B 242     -27.388 -40.420  -9.809  1.00  0.92           C
ATOM   1912  O   ILE B 242     -28.051 -41.090  -9.016  1.00  0.92           O
ATOM   1913  CB  ILE B 242     -25.132 -39.685  -8.916  1.00  0.92           C
ATOM   1914  CG1 ILE B 242     -24.224 -40.154 -10.079  1.00  0.92           C
ATOM   1915  CG2 ILE B 242     -25.184 -40.751  -7.803  1.00  0.92           C
ATOM   1916  CD1 ILE B 242     -24.174 -39.180 -11.260  1.00  0.92           C
ATOM   1917  N   ASP B 243     -27.416 -40.666 -11.131  1.00  0.91           N
ATOM   1918  CA  ASP B 243     -28.087 -41.800 -11.713  1.00  0.91           C
ATOM   1919  C   ASP B 243     -27.131 -42.976 -11.797  1.00  0.91           C
ATOM   1920  O   ASP B 243     -26.008 -42.893 -12.290  1.00  0.91           O
ATOM   1921  CB  ASP B 243     -28.707 -41.423 -13.081  1.00  0.91           C
ATOM   1922  CG  ASP B 243     -29.655 -42.483 -13.637  1.00  0.91           C
ATOM   1923  OD1 ASP B 243     -29.620 -43.642 -13.161  1.00  0.91           O
ATOM   1924  OD2 ASP B 243     -30.426 -42.136 -14.561  1.00  0.91           O
ATOM   1925  N   VAL B 244     -27.604 -44.107 -11.255  1.00  0.93           N
ATOM   1926  CA  VAL B 244     -26.951 -45.388 -11.279  1.00  0.93           C
ATOM   1927  C   VAL B 244     -26.967 -45.983 -12.681  1.00  0.93           C
ATOM   1928  O   VAL B 244     -25.955 -46.469 -13.172  1.00  0.93           O
ATOM   1929  CB  VAL B 244     -27.625 -46.274 -10.242  1.00  0.93           C
ATOM   1930  CG1 VAL B 244     -27.210 -47.746 -10.363  1.00  0.93           C
ATOM   1931  CG2 VAL B 244     -27.246 -45.742  -8.842  1.00  0.93           C
ATOM   1932  N   GLN B 245     -28.100 -45.907 -13.411  1.00  0.87           N
ATOM   1933  CA  GLN B 245     -28.294 -46.498 -14.734  1.00  0.87           C
ATOM   1934  C   GLN B 245     -27.322 -45.935 -15.749  1.00  0.87           C
ATOM   1935  O   GLN B 245     -26.751 -46.654 -16.572  1.00  0.87           O
ATOM   1936  CB  GLN B 245     -29.761 -46.291 -15.170  1.00  0.87           C
ATOM   1937  CG  GLN B 245     -30.161 -46.807 -16.574  1.00  0.87           C
ATOM   1938  CD  GLN B 245     -30.218 -45.707 -17.638  1.00  0.87           C
ATOM   1939  OE1 GLN B 245     -30.802 -44.637 -17.469  1.00  0.87           O
ATOM   1940  NE2 GLN B 245     -29.635 -45.983 -18.826  1.00  0.87           N
ATOM   1941  N   GLN B 246     -27.036 -44.630 -15.608  1.00  0.86           N
ATOM   1942  CA  GLN B 246     -26.022 -43.865 -16.303  1.00  0.86           C
ATOM   1943  C   GLN B 246     -24.589 -44.415 -16.205  1.00  0.86           C
ATOM   1944  O   GLN B 246     -23.689 -43.983 -16.923  1.00  0.86           O
ATOM   1945  CB  GLN B 246     -26.100 -42.417 -15.764  1.00  0.86           C
ATOM   1946  CG  GLN B 246     -25.646 -41.332 -16.770  1.00  0.86           C
ATOM   1947  CD  GLN B 246     -26.750 -40.302 -17.008  1.00  0.86           C
ATOM   1948  OE1 GLN B 246     -27.702 -40.555 -17.748  1.00  0.86           O
ATOM   1949  NE2 GLN B 246     -26.638 -39.115 -16.372  1.00  0.86           N
ATOM   1950  N   TRP B 247     -24.345 -45.443 -15.361  1.00  0.86           N
ATOM   1951  CA  TRP B 247     -23.059 -46.106 -15.252  1.00  0.86           C
ATOM   1952  C   TRP B 247     -22.917 -47.327 -16.157  1.00  0.86           C
ATOM   1953  O   TRP B 247     -21.935 -48.058 -16.060  1.00  0.86           O
ATOM   1954  CB  TRP B 247     -22.715 -46.484 -13.787  1.00  0.86           C
ATOM   1955  CG  TRP B 247     -22.609 -45.285 -12.858  1.00  0.86           C
ATOM   1956  CD1 TRP B 247     -22.368 -43.975 -13.172  1.00  0.86           C
ATOM   1957  CD2 TRP B 247     -22.777 -45.357 -11.446  1.00  0.86           C
ATOM   1958  NE1 TRP B 247     -22.401 -43.212 -12.034  1.00  0.86           N
ATOM   1959  CE2 TRP B 247     -22.659 -44.011 -10.957  1.00  0.86           C
ATOM   1960  CE3 TRP B 247     -23.007 -46.410 -10.575  1.00  0.86           C
ATOM   1961  CZ2 TRP B 247     -22.801 -43.749  -9.614  1.00  0.86           C
ATOM   1962  CZ3 TRP B 247     -23.169 -46.126  -9.218  1.00  0.86           C
ATOM   1963  CH2 TRP B 247     -23.073 -44.806  -8.742  1.00  0.86           C
ATOM   1964  N   GLY B 248     -23.858 -47.547 -17.104  1.00  0.89           N
ATOM   1965  CA  GLY B 248     -23.694 -48.515 -18.195  1.00  0.89           C
ATOM   1966  C   GLY B 248     -24.122 -49.932 -17.940  1.00  0.89           C
ATOM   1967  O   GLY B 248     -23.703 -50.857 -18.626  1.00  0.89           O
ATOM   1968  N   PHE B 249     -24.994 -50.152 -16.958  1.00  0.91           N
ATOM   1969  CA  PHE B 249     -25.651 -51.424 -16.721  1.00  0.91           C
ATOM   1970  C   PHE B 249     -26.528 -51.953 -17.873  1.00  0.91           C
ATOM   1971  O   PHE B 249     -27.179 -51.197 -18.586  1.00  0.91           O
ATOM   1972  CB  PHE B 249     -26.568 -51.256 -15.510  1.00  0.91           C
ATOM   1973  CG  PHE B 249     -25.803 -50.950 -14.261  1.00  0.91           C
ATOM   1974  CD1 PHE B 249     -25.623 -49.621 -13.853  1.00  0.91           C
ATOM   1975  CD2 PHE B 249     -25.370 -51.986 -13.422  1.00  0.91           C
ATOM   1976  CE1 PHE B 249     -25.096 -49.338 -12.592  1.00  0.91           C
ATOM   1977  CE2 PHE B 249     -24.893 -51.694 -12.138  1.00  0.91           C
ATOM   1978  CZ  PHE B 249     -24.770 -50.366 -11.721  1.00  0.91           C
ATOM   1979  N   THR B 250     -26.571 -53.290 -18.071  1.00  0.88           N
ATOM   1980  CA  THR B 250     -27.315 -53.921 -19.165  1.00  0.88           C
ATOM   1981  C   THR B 250     -28.829 -53.991 -19.030  1.00  0.88           C
ATOM   1982  O   THR B 250     -29.548 -53.702 -19.981  1.00  0.88           O
ATOM   1983  CB  THR B 250     -26.872 -55.364 -19.409  1.00  0.88           C
ATOM   1984  OG1 THR B 250     -26.857 -56.117 -18.198  1.00  0.88           O
ATOM   1985  CG2 THR B 250     -25.445 -55.384 -19.968  1.00  0.88           C
ATOM   1986  N   GLY B 251     -29.358 -54.436 -17.869  1.00  0.94           N
ATOM   1987  CA  GLY B 251     -30.781 -54.737 -17.722  1.00  0.94           C
ATOM   1988  C   GLY B 251     -31.561 -53.672 -17.002  1.00  0.94           C
ATOM   1989  O   GLY B 251     -31.164 -52.517 -16.900  1.00  0.94           O
ATOM   1990  N   ASN B 252     -32.725 -54.054 -16.445  1.00  0.90           N
ATOM   1991  CA  ASN B 252     -33.500 -53.206 -15.568  1.00  0.90           C
ATOM   1992  C   ASN B 252     -32.972 -53.310 -14.142  1.00  0.90           C
ATOM   1993  O   ASN B 252     -32.175 -54.181 -13.817  1.00  0.90           O
ATOM   1994  CB  ASN B 252     -35.020 -53.527 -15.669  1.00  0.90           C
ATOM   1995  CG  ASN B 252     -35.350 -54.972 -15.297  1.00  0.90           C
ATOM   1996  OD1 ASN B 252     -34.838 -55.929 -15.877  1.00  0.90           O
ATOM   1997  ND2 ASN B 252     -36.258 -55.159 -14.314  1.00  0.90           N
ATOM   1998  N   LEU B 253     -33.392 -52.407 -13.231  1.00  0.91           N
ATOM   1999  CA  LEU B 253     -32.846 -52.372 -11.882  1.00  0.91           C
ATOM   2000  C   LEU B 253     -33.017 -53.662 -11.095  1.00  0.91           C
ATOM   2001  O   LEU B 253     -32.067 -54.166 -10.504  1.00  0.91           O
ATOM   2002  CB  LEU B 253     -33.461 -51.164 -11.145  1.00  0.91           C
ATOM   2003  CG  LEU B 253     -33.258 -51.060  -9.627  1.00  0.91           C
ATOM   2004  CD1 LEU B 253     -32.978 -49.612  -9.215  1.00  0.91           C
ATOM   2005  CD2 LEU B 253     -34.518 -51.557  -8.918  1.00  0.91           C
ATOM   2006  N   GLN B 254     -34.215 -54.268 -11.144  1.00  0.89           N
ATOM   2007  CA  GLN B 254     -34.540 -55.486 -10.428  1.00  0.89           C
ATOM   2008  C   GLN B 254     -33.650 -56.683 -10.758  1.00  0.89           C
ATOM   2009  O   GLN B 254     -33.131 -57.348  -9.874  1.00  0.89           O
ATOM   2010  CB  GLN B 254     -36.003 -55.826 -10.782  1.00  0.89           C
ATOM   2011  CG  GLN B 254     -36.580 -57.065 -10.057  1.00  0.89           C
ATOM   2012  CD  GLN B 254     -37.622 -56.818  -8.958  1.00  0.89           C
ATOM   2013  OE1 GLN B 254     -37.918 -57.725  -8.181  1.00  0.89           O
ATOM   2014  NE2 GLN B 254     -38.265 -55.633  -8.911  1.00  0.89           N
ATOM   2015  N   SER B 255     -33.378 -56.960 -12.051  1.00  0.91           N
ATOM   2016  CA  SER B 255     -32.541 -58.088 -12.440  1.00  0.91           C
ATOM   2017  C   SER B 255     -31.111 -57.986 -11.962  1.00  0.91           C
ATOM   2018  O   SER B 255     -30.497 -58.965 -11.546  1.00  0.91           O
ATOM   2019  CB  SER B 255     -32.489 -58.282 -13.977  1.00  0.91           C
ATOM   2020  OG  SER B 255     -32.116 -57.086 -14.663  1.00  0.91           O
ATOM   2021  N   ASN B 256     -30.544 -56.774 -12.033  1.00  0.89           N
ATOM   2022  CA  ASN B 256     -29.218 -56.469 -11.544  1.00  0.89           C
ATOM   2023  C   ASN B 256     -29.157 -56.497 -10.018  1.00  0.89           C
ATOM   2024  O   ASN B 256     -28.209 -57.012  -9.433  1.00  0.89           O
ATOM   2025  CB  ASN B 256     -28.774 -55.080 -12.067  1.00  0.89           C
ATOM   2026  CG  ASN B 256     -28.629 -55.053 -13.586  1.00  0.89           C
ATOM   2027  OD1 ASN B 256     -28.858 -56.011 -14.312  1.00  0.89           O
ATOM   2028  ND2 ASN B 256     -28.220 -53.869 -14.100  1.00  0.89           N
ATOM   2029  N   HIS B 257     -30.177 -55.937  -9.328  1.00  0.89           N
ATOM   2030  CA  HIS B 257     -30.228 -55.881  -7.871  1.00  0.89           C
ATOM   2031  C   HIS B 257     -30.276 -57.271  -7.247  1.00  0.89           C
ATOM   2032  O   HIS B 257     -29.494 -57.589  -6.352  1.00  0.89           O
ATOM   2033  CB  HIS B 257     -31.428 -55.028  -7.384  1.00  0.89           C
ATOM   2034  CG  HIS B 257     -31.606 -55.062  -5.897  1.00  0.89           C
ATOM   2035  ND1 HIS B 257     -30.772 -54.362  -5.039  1.00  0.89           N
ATOM   2036  CD2 HIS B 257     -32.355 -55.953  -5.205  1.00  0.89           C
ATOM   2037  CE1 HIS B 257     -31.042 -54.851  -3.846  1.00  0.89           C
ATOM   2038  NE2 HIS B 257     -31.983 -55.820  -3.891  1.00  0.89           N
ATOM   2039  N   ASP B 258     -31.143 -58.146  -7.787  1.00  0.90           N
ATOM   2040  CA  ASP B 258     -31.395 -59.492  -7.313  1.00  0.90           C
ATOM   2041  C   ASP B 258     -30.198 -60.436  -7.394  1.00  0.90           C
ATOM   2042  O   ASP B 258     -30.107 -61.409  -6.650  1.00  0.90           O
ATOM   2043  CB  ASP B 258     -32.575 -60.090  -8.115  1.00  0.90           C
ATOM   2044  CG  ASP B 258     -33.912 -59.436  -7.770  1.00  0.90           C
ATOM   2045  OD1 ASP B 258     -33.927 -58.386  -7.081  1.00  0.90           O
ATOM   2046  OD2 ASP B 258     -34.942 -59.997  -8.225  1.00  0.90           O
ATOM   2047  N   LEU B 259     -29.218 -60.180  -8.289  1.00  0.89           N
ATOM   2048  CA  LEU B 259     -27.979 -60.942  -8.320  1.00  0.89           C
ATOM   2049  C   LEU B 259     -27.161 -60.758  -7.057  1.00  0.89           C
ATOM   2050  O   LEU B 259     -26.582 -61.697  -6.516  1.00  0.89           O
ATOM   2051  CB  LEU B 259     -27.097 -60.548  -9.534  1.00  0.89           C
ATOM   2052  CG  LEU B 259     -25.756 -61.314  -9.658  1.00  0.89           C
ATOM   2053  CD1 LEU B 259     -25.964 -62.821  -9.873  1.00  0.89           C
ATOM   2054  CD2 LEU B 259     -24.888 -60.731 -10.782  1.00  0.89           C
ATOM   2055  N   TYR B 260     -27.084 -59.513  -6.559  1.00  0.88           N
ATOM   2056  CA  TYR B 260     -26.191 -59.196  -5.471  1.00  0.88           C
ATOM   2057  C   TYR B 260     -26.916 -59.188  -4.153  1.00  0.88           C
ATOM   2058  O   TYR B 260     -26.296 -59.278  -3.096  1.00  0.88           O
ATOM   2059  CB  TYR B 260     -25.635 -57.762  -5.645  1.00  0.88           C
ATOM   2060  CG  TYR B 260     -24.949 -57.551  -6.968  1.00  0.88           C
ATOM   2061  CD1 TYR B 260     -24.049 -58.497  -7.490  1.00  0.88           C
ATOM   2062  CD2 TYR B 260     -25.165 -56.358  -7.682  1.00  0.88           C
ATOM   2063  CE1 TYR B 260     -23.344 -58.232  -8.671  1.00  0.88           C
ATOM   2064  CE2 TYR B 260     -24.455 -56.090  -8.862  1.00  0.88           C
ATOM   2065  CZ  TYR B 260     -23.523 -57.018  -9.340  1.00  0.88           C
ATOM   2066  OH  TYR B 260     -22.714 -56.732 -10.459  1.00  0.88           O
ATOM   2067  N   CYS B 261     -28.251 -59.053  -4.170  1.00  0.93           N
ATOM   2068  CA  CYS B 261     -28.987 -58.981  -2.935  1.00  0.93           C
ATOM   2069  C   CYS B 261     -30.275 -59.761  -2.941  1.00  0.93           C
ATOM   2070  O   CYS B 261     -31.240 -59.395  -3.601  1.00  0.93           O
ATOM   2071  CB  CYS B 261     -29.253 -57.495  -2.593  1.00  0.93           C
ATOM   2072  SG  CYS B 261     -30.193 -57.206  -1.049  1.00  0.93           S
ATOM   2073  N   GLN B 262     -30.350 -60.811  -2.100  1.00  0.86           N
ATOM   2074  CA  GLN B 262     -31.555 -61.616  -2.002  1.00  0.86           C
ATOM   2075  C   GLN B 262     -32.390 -61.222  -0.790  1.00  0.86           C
ATOM   2076  O   GLN B 262     -33.488 -61.731  -0.581  1.00  0.86           O
ATOM   2077  CB  GLN B 262     -31.259 -63.146  -1.977  1.00  0.86           C
ATOM   2078  CG  GLN B 262     -29.790 -63.564  -1.725  1.00  0.86           C
ATOM   2079  CD  GLN B 262     -28.915 -63.597  -2.980  1.00  0.86           C
ATOM   2080  OE1 GLN B 262     -29.358 -63.973  -4.067  1.00  0.86           O
ATOM   2081  NE2 GLN B 262     -27.618 -63.256  -2.816  1.00  0.86           N
ATOM   2082  N   VAL B 263     -31.893 -60.284   0.039  1.00  0.90           N
ATOM   2083  CA  VAL B 263     -32.606 -59.739   1.187  1.00  0.90           C
ATOM   2084  C   VAL B 263     -33.799 -58.868   0.825  1.00  0.90           C
ATOM   2085  O   VAL B 263     -34.848 -58.916   1.467  1.00  0.90           O
ATOM   2086  CB  VAL B 263     -31.644 -58.992   2.100  1.00  0.90           C
ATOM   2087  CG1 VAL B 263     -32.370 -58.084   3.113  1.00  0.90           C
ATOM   2088  CG2 VAL B 263     -30.814 -60.045   2.854  1.00  0.90           C
ATOM   2089  N   HIS B 264     -33.673 -58.032  -0.219  1.00  0.84           N
ATOM   2090  CA  HIS B 264     -34.739 -57.121  -0.598  1.00  0.84           C
ATOM   2091  C   HIS B 264     -35.647 -57.805  -1.600  1.00  0.84           C
ATOM   2092  O   HIS B 264     -35.305 -57.915  -2.772  1.00  0.84           O
ATOM   2093  CB  HIS B 264     -34.254 -55.791  -1.249  1.00  0.84           C
ATOM   2094  CG  HIS B 264     -33.245 -54.964  -0.492  1.00  0.84           C
ATOM   2095  ND1 HIS B 264     -32.701 -55.392   0.703  1.00  0.84           N
ATOM   2096  CD2 HIS B 264     -32.688 -53.777  -0.844  1.00  0.84           C
ATOM   2097  CE1 HIS B 264     -31.838 -54.473   1.058  1.00  0.84           C
ATOM   2098  NE2 HIS B 264     -31.784 -53.475   0.155  1.00  0.84           N
ATOM   2099  N   GLY B 265     -36.832 -58.290  -1.173  1.00  0.83           N
ATOM   2100  CA  GLY B 265     -37.832 -58.815  -2.100  1.00  0.83           C
ATOM   2101  C   GLY B 265     -38.544 -57.748  -2.891  1.00  0.83           C
ATOM   2102  O   GLY B 265     -38.291 -56.558  -2.733  1.00  0.83           O
ATOM   2103  N   ASN B 266     -39.512 -58.144  -3.736  1.00  0.72           N
ATOM   2104  CA  ASN B 266     -40.250 -57.199  -4.544  1.00  0.72           C
ATOM   2105  C   ASN B 266     -41.666 -56.992  -4.051  1.00  0.72           C
ATOM   2106  O   ASN B 266     -42.524 -57.872  -4.092  1.00  0.72           O
ATOM   2107  CB  ASN B 266     -40.296 -57.644  -6.023  1.00  0.72           C
ATOM   2108  CG  ASN B 266     -40.791 -56.505  -6.907  1.00  0.72           C
ATOM   2109  OD1 ASN B 266     -40.294 -55.382  -6.843  1.00  0.72           O
ATOM   2110  ND2 ASN B 266     -41.835 -56.767  -7.722  1.00  0.72           N
ATOM   2111  N   ALA B 267     -41.947 -55.758  -3.637  1.00  0.91           N
ATOM   2112  CA  ALA B 267     -43.279 -55.237  -3.578  1.00  0.91           C
ATOM   2113  C   ALA B 267     -43.195 -53.965  -4.365  1.00  0.91           C
ATOM   2114  O   ALA B 267     -42.243 -53.213  -4.189  1.00  0.91           O
ATOM   2115  CB  ALA B 267     -43.684 -54.967  -2.122  1.00  0.91           C
ATOM   2116  N   HIS B 268     -44.154 -53.662  -5.258  1.00  0.80           N
ATOM   2117  CA  HIS B 268     -43.959 -52.570  -6.207  1.00  0.80           C
ATOM   2118  C   HIS B 268     -44.366 -51.232  -5.595  1.00  0.80           C
ATOM   2119  O   HIS B 268     -44.810 -50.302  -6.254  1.00  0.80           O
ATOM   2120  CB  HIS B 268     -44.677 -52.850  -7.563  1.00  0.80           C
ATOM   2121  CG  HIS B 268     -43.859 -52.628  -8.808  1.00  0.80           C
ATOM   2122  ND1 HIS B 268     -42.622 -52.047  -8.718  1.00  0.80           N
ATOM   2123  CD2 HIS B 268     -44.186 -52.812 -10.114  1.00  0.80           C
ATOM   2124  CE1 HIS B 268     -42.208 -51.866  -9.950  1.00  0.80           C
ATOM   2125  NE2 HIS B 268     -43.124 -52.317 -10.844  1.00  0.80           N
ATOM   2126  N   VAL B 269     -44.242 -51.126  -4.261  1.00  0.89           N
ATOM   2127  CA  VAL B 269     -44.331 -49.917  -3.483  1.00  0.89           C
ATOM   2128  C   VAL B 269     -43.070 -49.111  -3.741  1.00  0.89           C
ATOM   2129  O   VAL B 269     -41.975 -49.657  -3.661  1.00  0.89           O
ATOM   2130  CB  VAL B 269     -44.429 -50.225  -1.982  1.00  0.89           C
ATOM   2131  CG1 VAL B 269     -45.063 -49.051  -1.215  1.00  0.89           C
ATOM   2132  CG2 VAL B 269     -45.244 -51.514  -1.741  1.00  0.89           C
ATOM   2133  N   ALA B 270     -43.174 -47.800  -4.021  1.00  0.96           N
ATOM   2134  CA  ALA B 270     -42.068 -46.967  -4.466  1.00  0.96           C
ATOM   2135  C   ALA B 270     -40.810 -46.974  -3.603  1.00  0.96           C
ATOM   2136  O   ALA B 270     -39.698 -46.881  -4.112  1.00  0.96           O
ATOM   2137  CB  ALA B 270     -42.554 -45.518  -4.637  1.00  0.96           C
ATOM   2138  N   SER B 271     -40.921 -47.101  -2.258  1.00  0.94           N
ATOM   2139  CA  SER B 271     -39.741 -47.272  -1.415  1.00  0.94           C
ATOM   2140  C   SER B 271     -38.889 -48.457  -1.784  1.00  0.94           C
ATOM   2141  O   SER B 271     -37.665 -48.373  -1.761  1.00  0.94           O
ATOM   2142  CB  SER B 271     -40.046 -47.370   0.101  1.00  0.94           C
ATOM   2143  OG  SER B 271     -40.906 -48.476   0.404  1.00  0.94           O
ATOM   2144  N   CYS B 272     -39.489 -49.582  -2.189  1.00  0.93           N
ATOM   2145  CA  CYS B 272     -38.752 -50.780  -2.520  1.00  0.93           C
ATOM   2146  C   CYS B 272     -37.758 -50.594  -3.673  1.00  0.93           C
ATOM   2147  O   CYS B 272     -36.577 -50.902  -3.523  1.00  0.93           O
ATOM   2148  CB  CYS B 272     -39.774 -51.891  -2.833  1.00  0.93           C
ATOM   2149  SG  CYS B 272     -39.052 -53.546  -3.029  1.00  0.93           S
ATOM   2150  N   ASP B 273     -38.195 -49.990  -4.804  1.00  0.91           N
ATOM   2151  CA  ASP B 273     -37.345 -49.673  -5.941  1.00  0.91           C
ATOM   2152  C   ASP B 273     -36.248 -48.670  -5.550  1.00  0.91           C
ATOM   2153  O   ASP B 273     -35.064 -48.880  -5.811  1.00  0.91           O
ATOM   2154  CB  ASP B 273     -38.213 -49.187  -7.141  1.00  0.91           C
ATOM   2155  CG  ASP B 273     -38.418 -50.292  -8.177  1.00  0.91           C
ATOM   2156  OD1 ASP B 273     -37.669 -50.320  -9.189  1.00  0.91           O
ATOM   2157  OD2 ASP B 273     -39.298 -51.159  -7.951  1.00  0.91           O
ATOM   2158  N   ALA B 274     -36.605 -47.606  -4.791  1.00  0.95           N
ATOM   2159  CA  ALA B 274     -35.660 -46.669  -4.200  1.00  0.95           C
ATOM   2160  C   ALA B 274     -34.603 -47.304  -3.263  1.00  0.95           C
ATOM   2161  O   ALA B 274     -33.421 -46.963  -3.333  1.00  0.95           O
ATOM   2162  CB  ALA B 274     -36.435 -45.547  -3.482  1.00  0.95           C
ATOM   2163  N   ILE B 275     -34.973 -48.277  -2.381  1.00  0.91           N
ATOM   2164  CA  ILE B 275     -34.044 -49.076  -1.569  1.00  0.91           C
ATOM   2165  C   ILE B 275     -33.083 -49.867  -2.441  1.00  0.91           C
ATOM   2166  O   ILE B 275     -31.868 -49.851  -2.217  1.00  0.91           O
ATOM   2167  CB  ILE B 275     -34.726 -50.090  -0.626  1.00  0.91           C
ATOM   2168  CG1 ILE B 275     -35.663 -49.461   0.421  1.00  0.91           C
ATOM   2169  CG2 ILE B 275     -33.691 -50.875   0.207  1.00  0.91           C
ATOM   2170  CD1 ILE B 275     -36.654 -50.469   1.023  1.00  0.91           C
ATOM   2171  N   MET B 276     -33.600 -50.549  -3.486  1.00  0.90           N
ATOM   2172  CA  MET B 276     -32.785 -51.327  -4.401  1.00  0.90           C
ATOM   2173  C   MET B 276     -31.727 -50.492  -5.098  1.00  0.90           C
ATOM   2174  O   MET B 276     -30.555 -50.868  -5.115  1.00  0.90           O
ATOM   2175  CB  MET B 276     -33.640 -52.009  -5.480  1.00  0.90           C
ATOM   2176  CG  MET B 276     -34.475 -53.199  -4.986  1.00  0.90           C
ATOM   2177  SD  MET B 276     -35.291 -54.075  -6.357  1.00  0.90           S
ATOM   2178  CE  MET B 276     -36.117 -55.357  -5.374  1.00  0.90           C
ATOM   2179  N   THR B 277     -32.076 -49.285  -5.598  1.00  0.91           N
ATOM   2180  CA  THR B 277     -31.125 -48.374  -6.239  1.00  0.91           C
ATOM   2181  C   THR B 277     -29.945 -48.048  -5.360  1.00  0.91           C
ATOM   2182  O   THR B 277     -28.793 -48.051  -5.783  1.00  0.91           O
ATOM   2183  CB  THR B 277     -31.715 -47.022  -6.639  1.00  0.91           C
ATOM   2184  OG1 THR B 277     -33.058 -47.154  -7.054  1.00  0.91           O
ATOM   2185  CG2 THR B 277     -30.957 -46.461  -7.842  1.00  0.91           C
ATOM   2186  N   ARG B 278     -30.209 -47.784  -4.066  1.00  0.85           N
ATOM   2187  CA  ARG B 278     -29.150 -47.564  -3.116  1.00  0.85           C
ATOM   2188  C   ARG B 278     -28.298 -48.791  -2.817  1.00  0.85           C
ATOM   2189  O   ARG B 278     -27.075 -48.722  -2.758  1.00  0.85           O
ATOM   2190  CB  ARG B 278     -29.709 -46.996  -1.796  1.00  0.85           C
ATOM   2191  CG  ARG B 278     -28.720 -45.972  -1.221  1.00  0.85           C
ATOM   2192  CD  ARG B 278     -29.015 -45.486   0.193  1.00  0.85           C
ATOM   2193  NE  ARG B 278     -27.918 -45.947   1.097  1.00  0.85           N
ATOM   2194  CZ  ARG B 278     -27.876 -47.130   1.715  1.00  0.85           C
ATOM   2195  NH1 ARG B 278     -28.852 -48.022   1.636  1.00  0.85           N
ATOM   2196  NH2 ARG B 278     -26.818 -47.398   2.479  1.00  0.85           N
ATOM   2197  N   CYS B 279     -28.941 -49.954  -2.617  1.00  0.91           N
ATOM   2198  CA  CYS B 279     -28.292 -51.206  -2.274  1.00  0.91           C
ATOM   2199  C   CYS B 279     -27.330 -51.708  -3.350  1.00  0.91           C
ATOM   2200  O   CYS B 279     -26.198 -52.103  -3.082  1.00  0.91           O
ATOM   2201  CB  CYS B 279     -29.388 -52.264  -2.039  1.00  0.91           C
ATOM   2202  SG  CYS B 279     -28.770 -53.797  -1.285  1.00  0.91           S
ATOM   2203  N   LEU B 280     -27.787 -51.644  -4.616  1.00  0.90           N
ATOM   2204  CA  LEU B 280     -27.000 -51.905  -5.804  1.00  0.90           C
ATOM   2205  C   LEU B 280     -25.877 -50.905  -5.994  1.00  0.90           C
ATOM   2206  O   LEU B 280     -24.751 -51.270  -6.327  1.00  0.90           O
ATOM   2207  CB  LEU B 280     -27.917 -51.922  -7.050  1.00  0.90           C
ATOM   2208  CG  LEU B 280     -27.213 -52.222  -8.389  1.00  0.90           C
ATOM   2209  CD1 LEU B 280     -28.108 -53.046  -9.316  1.00  0.90           C
ATOM   2210  CD2 LEU B 280     -26.831 -50.923  -9.094  1.00  0.90           C
ATOM   2211  N   ALA B 281     -26.129 -49.600  -5.757  1.00  0.94           N
ATOM   2212  CA  ALA B 281     -25.088 -48.596  -5.807  1.00  0.94           C
ATOM   2213  C   ALA B 281     -23.992 -48.811  -4.770  1.00  0.94           C
ATOM   2214  O   ALA B 281     -22.808 -48.655  -5.045  1.00  0.94           O
ATOM   2215  CB  ALA B 281     -25.696 -47.193  -5.671  1.00  0.94           C
ATOM   2216  N   VAL B 282     -24.380 -49.237  -3.546  1.00  0.92           N
ATOM   2217  CA  VAL B 282     -23.456 -49.669  -2.511  1.00  0.92           C
ATOM   2218  C   VAL B 282     -22.613 -50.843  -2.983  1.00  0.92           C
ATOM   2219  O   VAL B 282     -21.399 -50.846  -2.806  1.00  0.92           O
ATOM   2220  CB  VAL B 282     -24.208 -49.982  -1.213  1.00  0.92           C
ATOM   2221  CG1 VAL B 282     -23.393 -50.862  -0.243  1.00  0.92           C
ATOM   2222  CG2 VAL B 282     -24.600 -48.656  -0.525  1.00  0.92           C
ATOM   2223  N   HIS B 283     -23.202 -51.844  -3.666  1.00  0.88           N
ATOM   2224  CA  HIS B 283     -22.428 -52.960  -4.186  1.00  0.88           C
ATOM   2225  C   HIS B 283     -21.353 -52.551  -5.197  1.00  0.88           C
ATOM   2226  O   HIS B 283     -20.174 -52.853  -5.049  1.00  0.88           O
ATOM   2227  CB  HIS B 283     -23.373 -53.977  -4.862  1.00  0.88           C
ATOM   2228  CG  HIS B 283     -22.692 -55.228  -5.312  1.00  0.88           C
ATOM   2229  ND1 HIS B 283     -22.105 -55.238  -6.557  1.00  0.88           N
ATOM   2230  CD2 HIS B 283     -22.501 -56.418  -4.690  1.00  0.88           C
ATOM   2231  CE1 HIS B 283     -21.568 -56.431  -6.678  1.00  0.88           C
ATOM   2232  NE2 HIS B 283     -21.776 -57.187  -5.573  1.00  0.88           N
ATOM   2233  N   GLU B 284     -21.746 -51.757  -6.207  1.00  0.88           N
ATOM   2234  CA  GLU B 284     -20.898 -51.371  -7.318  1.00  0.88           C
ATOM   2235  C   GLU B 284     -19.655 -50.599  -6.944  1.00  0.88           C
ATOM   2236  O   GLU B 284     -18.622 -50.640  -7.612  1.00  0.88           O
ATOM   2237  CB  GLU B 284     -21.712 -50.507  -8.297  1.00  0.88           C
ATOM   2238  CG  GLU B 284     -21.973 -51.251  -9.619  1.00  0.88           C
ATOM   2239  CD  GLU B 284     -20.684 -51.575 -10.378  1.00  0.88           C
ATOM   2240  OE1 GLU B 284     -20.542 -52.738 -10.817  1.00  0.88           O
ATOM   2241  OE2 GLU B 284     -19.802 -50.664 -10.517  1.00  0.88           O
ATOM   2242  N   CYS B 285     -19.763 -49.794  -5.887  1.00  0.89           N
ATOM   2243  CA  CYS B 285     -18.667 -49.013  -5.380  1.00  0.89           C
ATOM   2244  C   CYS B 285     -17.944 -49.718  -4.259  1.00  0.89           C
ATOM   2245  O   CYS B 285     -16.722 -49.672  -4.196  1.00  0.89           O
ATOM   2246  CB  CYS B 285     -19.185 -47.642  -4.900  1.00  0.89           C
ATOM   2247  SG  CYS B 285     -20.125 -46.813  -6.243  1.00  0.89           S
ATOM   2248  N   PHE B 286     -18.676 -50.386  -3.343  1.00  0.87           N
ATOM   2249  CA  PHE B 286     -18.099 -50.785  -2.071  1.00  0.87           C
ATOM   2250  C   PHE B 286     -18.095 -52.272  -1.765  1.00  0.87           C
ATOM   2251  O   PHE B 286     -17.548 -52.687  -0.748  1.00  0.87           O
ATOM   2252  CB  PHE B 286     -18.804 -50.054  -0.903  1.00  0.87           C
ATOM   2253  CG  PHE B 286     -18.695 -48.558  -1.014  1.00  0.87           C
ATOM   2254  CD1 PHE B 286     -17.467 -47.941  -1.300  1.00  0.87           C
ATOM   2255  CD2 PHE B 286     -19.824 -47.750  -0.798  1.00  0.87           C
ATOM   2256  CE1 PHE B 286     -17.370 -46.548  -1.354  1.00  0.87           C
ATOM   2257  CE2 PHE B 286     -19.739 -46.359  -0.896  1.00  0.87           C
ATOM   2258  CZ  PHE B 286     -18.507 -45.758  -1.163  1.00  0.87           C
ATOM   2259  N   VAL B 287     -18.608 -53.141  -2.664  1.00  0.85           N
ATOM   2260  CA  VAL B 287     -18.208 -54.545  -2.647  1.00  0.85           C
ATOM   2261  C   VAL B 287     -16.846 -54.655  -3.305  1.00  0.85           C
ATOM   2262  O   VAL B 287     -16.095 -55.622  -3.065  1.00  0.85           O
ATOM   2263  CB  VAL B 287     -19.258 -55.463  -3.273  1.00  0.85           C
ATOM   2264  CG1 VAL B 287     -18.644 -56.710  -3.940  1.00  0.85           C
ATOM   2265  CG2 VAL B 287     -20.250 -55.866  -2.169  1.00  0.85           C
ATOM   2266  N   LYS B 288     -16.403 -53.652  -4.066  1.00  0.72           N
ATOM   2267  CA  LYS B 288     -15.013 -53.450  -4.422  1.00  0.72           C
ATOM   2268  C   LYS B 288     -14.237 -53.088  -3.166  1.00  0.72           C
ATOM   2269  O   LYS B 288     -14.607 -52.181  -2.420  1.00  0.72           O
ATOM   2270  CB  LYS B 288     -14.841 -52.402  -5.548  1.00  0.72           C
ATOM   2271  CG  LYS B 288     -15.602 -52.824  -6.819  1.00  0.72           C
ATOM   2272  CD  LYS B 288     -15.633 -51.779  -7.952  1.00  0.72           C
ATOM   2273  CE  LYS B 288     -16.532 -52.249  -9.118  1.00  0.72           C
ATOM   2274  NZ  LYS B 288     -17.075 -51.131  -9.927  1.00  0.72           N
ATOM   2275  N   ARG B 289     -13.196 -53.870  -2.832  1.00  0.65           N
ATOM   2276  CA  ARG B 289     -12.767 -53.965  -1.451  1.00  0.65           C
ATOM   2277  C   ARG B 289     -11.887 -52.827  -0.988  1.00  0.65           C
ATOM   2278  O   ARG B 289     -10.757 -52.670  -1.435  1.00  0.65           O
ATOM   2279  CB  ARG B 289     -12.034 -55.294  -1.105  1.00  0.65           C
ATOM   2280  CG  ARG B 289     -12.976 -56.475  -0.806  1.00  0.65           C
ATOM   2281  CD  ARG B 289     -13.466 -57.203  -2.057  1.00  0.65           C
ATOM   2282  NE  ARG B 289     -14.884 -57.588  -1.816  1.00  0.65           N
ATOM   2283  CZ  ARG B 289     -15.348 -58.814  -1.555  1.00  0.65           C
ATOM   2284  NH1 ARG B 289     -14.534 -59.844  -1.372  1.00  0.65           N
ATOM   2285  NH2 ARG B 289     -16.664 -58.995  -1.460  1.00  0.65           N
ATOM   2286  N   VAL B 290     -12.415 -52.071  -0.006  1.00  0.72           N
ATOM   2287  CA  VAL B 290     -11.679 -51.226   0.916  1.00  0.72           C
ATOM   2288  C   VAL B 290     -10.667 -50.285   0.281  1.00  0.72           C
ATOM   2289  O   VAL B 290      -9.468 -50.367   0.526  1.00  0.72           O
ATOM   2290  CB  VAL B 290     -11.080 -51.990   2.099  1.00  0.72           C
ATOM   2291  CG1 VAL B 290     -10.813 -51.009   3.260  1.00  0.72           C
ATOM   2292  CG2 VAL B 290     -12.025 -53.122   2.560  1.00  0.72           C
ATOM   2293  N   ASP B 291     -11.118 -49.343  -0.580  1.00  0.75           N
ATOM   2294  CA  ASP B 291     -10.232 -48.297  -1.063  1.00  0.75           C
ATOM   2295  C   ASP B 291      -9.698 -47.440   0.089  1.00  0.75           C
ATOM   2296  O   ASP B 291     -10.409 -47.000   0.995  1.00  0.75           O
ATOM   2297  CB  ASP B 291     -10.875 -47.439  -2.198  1.00  0.75           C
ATOM   2298  CG  ASP B 291      -9.940 -46.363  -2.742  1.00  0.75           C
ATOM   2299  OD1 ASP B 291      -9.821 -45.294  -2.085  1.00  0.75           O
ATOM   2300  OD2 ASP B 291      -9.294 -46.592  -3.786  1.00  0.75           O
ATOM   2301  N   TRP B 292      -8.378 -47.212   0.051  1.00  0.60           N
ATOM   2302  CA  TRP B 292      -7.667 -46.478   1.061  1.00  0.60           C
ATOM   2303  C   TRP B 292      -7.237 -45.106   0.553  1.00  0.60           C
ATOM   2304  O   TRP B 292      -6.482 -44.418   1.230  1.00  0.60           O
ATOM   2305  CB  TRP B 292      -6.458 -47.318   1.576  1.00  0.60           C
ATOM   2306  CG  TRP B 292      -6.722 -48.177   2.825  1.00  0.60           C
ATOM   2307  CD1 TRP B 292      -6.824 -47.729   4.114  1.00  0.60           C
ATOM   2308  CD2 TRP B 292      -6.869 -49.610   2.888  1.00  0.60           C
ATOM   2309  NE1 TRP B 292      -7.077 -48.775   4.971  1.00  0.60           N
ATOM   2310  CE2 TRP B 292      -7.111 -49.939   4.255  1.00  0.60           C
ATOM   2311  CE3 TRP B 292      -6.827 -50.609   1.922  1.00  0.60           C
ATOM   2312  CZ2 TRP B 292      -7.324 -51.248   4.646  1.00  0.60           C
ATOM   2313  CZ3 TRP B 292      -7.066 -51.931   2.324  1.00  0.60           C
ATOM   2314  CH2 TRP B 292      -7.311 -52.248   3.669  1.00  0.60           C
ATOM   2315  N   THR B 293      -7.715 -44.639  -0.617  1.00  0.83           N
ATOM   2316  CA  THR B 293      -7.356 -43.317  -1.129  1.00  0.83           C
ATOM   2317  C   THR B 293      -8.425 -42.284  -0.794  1.00  0.83           C
ATOM   2318  O   THR B 293      -8.138 -41.102  -0.618  1.00  0.83           O
ATOM   2319  CB  THR B 293      -7.085 -43.276  -2.620  1.00  0.83           C
ATOM   2320  OG1 THR B 293      -8.275 -43.531  -3.322  1.00  0.83           O
ATOM   2321  CG2 THR B 293      -6.014 -44.257  -3.095  1.00  0.83           C
ATOM   2322  N   ILE B 294      -9.690 -42.720  -0.621  1.00  0.87           N
ATOM   2323  CA  ILE B 294     -10.801 -41.920  -0.137  1.00  0.87           C
ATOM   2324  C   ILE B 294     -10.539 -41.290   1.215  1.00  0.87           C
ATOM   2325  O   ILE B 294      -9.963 -41.928   2.094  1.00  0.87           O
ATOM   2326  CB  ILE B 294     -12.085 -42.759  -0.059  1.00  0.87           C
ATOM   2327  CG1 ILE B 294     -11.835 -44.150   0.591  1.00  0.87           C
ATOM   2328  CG2 ILE B 294     -12.589 -42.885  -1.507  1.00  0.87           C
ATOM   2329  CD1 ILE B 294     -13.073 -44.920   1.071  1.00  0.87           C
ATOM   2330  N   GLU B 295     -11.027 -40.056   1.465  1.00  0.73           N
ATOM   2331  CA  GLU B 295     -10.987 -39.467   2.796  1.00  0.73           C
ATOM   2332  C   GLU B 295     -12.369 -38.991   3.197  1.00  0.73           C
ATOM   2333  O   GLU B 295     -13.151 -38.538   2.368  1.00  0.73           O
ATOM   2334  CB  GLU B 295      -9.949 -38.347   3.009  1.00  0.73           C
ATOM   2335  CG  GLU B 295      -9.150 -38.533   4.329  1.00  0.73           C
ATOM   2336  CD  GLU B 295      -7.963 -39.502   4.205  1.00  0.73           C
ATOM   2337  OE1 GLU B 295      -8.066 -40.643   4.726  1.00  0.73           O
ATOM   2338  OE2 GLU B 295      -6.939 -39.095   3.609  1.00  0.73           O
ATOM   2339  N   TYR B 296     -12.722 -39.137   4.484  1.00  0.79           N
ATOM   2340  CA  TYR B 296     -14.067 -38.961   5.005  1.00  0.79           C
ATOM   2341  C   TYR B 296     -13.940 -38.237   6.340  1.00  0.79           C
ATOM   2342  O   TYR B 296     -13.165 -38.707   7.168  1.00  0.79           O
ATOM   2343  CB  TYR B 296     -14.810 -40.312   5.327  1.00  0.79           C
ATOM   2344  CG  TYR B 296     -15.204 -41.202   4.154  1.00  0.79           C
ATOM   2345  CD1 TYR B 296     -15.465 -40.706   2.864  1.00  0.79           C
ATOM   2346  CD2 TYR B 296     -15.349 -42.589   4.364  1.00  0.79           C
ATOM   2347  CE1 TYR B 296     -15.764 -41.575   1.801  1.00  0.79           C
ATOM   2348  CE2 TYR B 296     -15.654 -43.457   3.309  1.00  0.79           C
ATOM   2349  CZ  TYR B 296     -15.853 -42.953   2.029  1.00  0.79           C
ATOM   2350  OH  TYR B 296     -16.118 -43.854   0.988  1.00  0.79           O
ATOM   2351  N   PRO B 297     -14.609 -37.123   6.638  1.00  0.87           N
ATOM   2352  CA  PRO B 297     -14.468 -36.501   7.943  1.00  0.87           C
ATOM   2353  C   PRO B 297     -15.267 -37.245   8.994  1.00  0.87           C
ATOM   2354  O   PRO B 297     -16.375 -37.684   8.707  1.00  0.87           O
ATOM   2355  CB  PRO B 297     -14.990 -35.064   7.755  1.00  0.87           C
ATOM   2356  CG  PRO B 297     -15.930 -35.153   6.552  1.00  0.87           C
ATOM   2357  CD  PRO B 297     -15.253 -36.221   5.687  1.00  0.87           C
ATOM   2358  N   ILE B 298     -14.743 -37.402  10.226  1.00  0.87           N
ATOM   2359  CA  ILE B 298     -15.468 -38.109  11.270  1.00  0.87           C
ATOM   2360  C   ILE B 298     -16.184 -37.185  12.249  1.00  0.87           C
ATOM   2361  O   ILE B 298     -15.596 -36.421  13.012  1.00  0.87           O
ATOM   2362  CB  ILE B 298     -14.592 -39.113  12.026  1.00  0.87           C
ATOM   2363  CG1 ILE B 298     -15.322 -39.830  13.188  1.00  0.87           C
ATOM   2364  CG2 ILE B 298     -13.320 -38.429  12.570  1.00  0.87           C
ATOM   2365  CD1 ILE B 298     -16.521 -40.685  12.776  1.00  0.87           C
ATOM   2366  N   ILE B 299     -17.523 -37.284  12.289  1.00  0.71           N
ATOM   2367  CA  ILE B 299     -18.312 -36.903  13.447  1.00  0.71           C
ATOM   2368  C   ILE B 299     -19.287 -38.039  13.736  1.00  0.71           C
ATOM   2369  O   ILE B 299     -20.108 -38.379  12.896  1.00  0.71           O
ATOM   2370  CB  ILE B 299     -19.056 -35.570  13.336  1.00  0.71           C
ATOM   2371  CG1 ILE B 299     -19.168 -35.020  11.897  1.00  0.71           C
ATOM   2372  CG2 ILE B 299     -18.296 -34.546  14.207  1.00  0.71           C
ATOM   2373  CD1 ILE B 299     -20.195 -35.725  11.009  1.00  0.71           C
ATOM   2374  N   GLY B 300     -19.256 -38.695  14.920  1.00  0.79           N
ATOM   2375  CA  GLY B 300     -18.292 -38.522  16.007  1.00  0.79           C
ATOM   2376  C   GLY B 300     -18.184 -39.734  16.907  1.00  0.79           C
ATOM   2377  O   GLY B 300     -18.561 -40.832  16.508  1.00  0.79           O
ATOM   2378  N   ASP B 301     -17.605 -39.572  18.127  1.00  0.74           N
ATOM   2379  CA  ASP B 301     -17.432 -40.606  19.161  1.00  0.74           C
ATOM   2380  C   ASP B 301     -16.319 -41.619  18.817  1.00  0.74           C
ATOM   2381  O   ASP B 301     -15.508 -42.028  19.645  1.00  0.74           O
ATOM   2382  CB  ASP B 301     -18.790 -41.255  19.543  1.00  0.74           C
ATOM   2383  CG  ASP B 301     -18.633 -42.309  20.626  1.00  0.74           C
ATOM   2384  OD1 ASP B 301     -19.107 -43.448  20.402  1.00  0.74           O
ATOM   2385  OD2 ASP B 301     -18.012 -41.973  21.669  1.00  0.74           O
ATOM   2386  N   GLU B 302     -16.189 -41.945  17.533  1.00  0.73           N
ATOM   2387  CA  GLU B 302     -15.324 -42.928  16.923  1.00  0.73           C
ATOM   2388  C   GLU B 302     -13.847 -43.004  17.276  1.00  0.73           C
ATOM   2389  O   GLU B 302     -13.306 -44.084  17.430  1.00  0.73           O
ATOM   2390  CB  GLU B 302     -15.440 -42.730  15.417  1.00  0.73           C
ATOM   2391  CG  GLU B 302     -15.345 -44.028  14.612  1.00  0.73           C
ATOM   2392  CD  GLU B 302     -13.944 -44.629  14.606  1.00  0.73           C
ATOM   2393  OE1 GLU B 302     -12.946 -43.887  14.428  1.00  0.73           O
ATOM   2394  OE2 GLU B 302     -13.867 -45.876  14.734  1.00  0.73           O
ATOM   2395  N   LEU B 303     -13.107 -41.894  17.442  1.00  0.87           N
ATOM   2396  CA  LEU B 303     -11.664 -41.946  17.669  1.00  0.87           C
ATOM   2397  C   LEU B 303     -11.298 -42.693  18.958  1.00  0.87           C
ATOM   2398  O   LEU B 303     -10.281 -43.378  19.070  1.00  0.87           O
ATOM   2399  CB  LEU B 303     -11.130 -40.487  17.601  1.00  0.87           C
ATOM   2400  CG  LEU B 303      -9.746 -40.203  16.961  1.00  0.87           C
ATOM   2401  CD1 LEU B 303      -9.332 -41.238  15.906  1.00  0.87           C
ATOM   2402  CD2 LEU B 303      -9.767 -38.804  16.311  1.00  0.87           C
ATOM   2403  N   LYS B 304     -12.208 -42.630  19.952  1.00  0.86           N
ATOM   2404  CA  LYS B 304     -12.180 -43.479  21.117  1.00  0.86           C
ATOM   2405  C   LYS B 304     -12.459 -44.961  20.810  1.00  0.86           C
ATOM   2406  O   LYS B 304     -11.752 -45.832  21.311  1.00  0.86           O
ATOM   2407  CB  LYS B 304     -13.145 -42.921  22.182  1.00  0.86           C
ATOM   2408  CG  LYS B 304     -12.817 -41.513  22.700  1.00  0.86           C
ATOM   2409  CD  LYS B 304     -13.889 -41.034  23.696  1.00  0.86           C
ATOM   2410  CE  LYS B 304     -13.563 -39.709  24.385  1.00  0.86           C
ATOM   2411  NZ  LYS B 304     -14.679 -39.347  25.285  1.00  0.86           N
ATOM   2412  N   ILE B 305     -13.446 -45.281  19.931  1.00  0.89           N
ATOM   2413  CA  ILE B 305     -13.726 -46.628  19.421  1.00  0.89           C
ATOM   2414  C   ILE B 305     -12.502 -47.219  18.736  1.00  0.89           C
ATOM   2415  O   ILE B 305     -12.100 -48.345  19.022  1.00  0.89           O
ATOM   2416  CB  ILE B 305     -14.913 -46.651  18.432  1.00  0.89           C
ATOM   2417  CG1 ILE B 305     -16.242 -46.243  19.116  1.00  0.89           C
ATOM   2418  CG2 ILE B 305     -15.060 -48.029  17.735  1.00  0.89           C
ATOM   2419  CD1 ILE B 305     -17.403 -45.942  18.151  1.00  0.89           C
ATOM   2420  N   ASN B 306     -11.837 -46.437  17.868  1.00  0.86           N
ATOM   2421  CA  ASN B 306     -10.661 -46.819  17.115  1.00  0.86           C
ATOM   2422  C   ASN B 306      -9.469 -47.205  17.984  1.00  0.86           C
ATOM   2423  O   ASN B 306      -8.825 -48.237  17.786  1.00  0.86           O
ATOM   2424  CB  ASN B 306     -10.289 -45.621  16.209  1.00  0.86           C
ATOM   2425  CG  ASN B 306      -9.845 -46.041  14.822  1.00  0.86           C
ATOM   2426  OD1 ASN B 306      -9.829 -47.221  14.433  1.00  0.86           O
ATOM   2427  ND2 ASN B 306      -9.503 -45.026  14.007  1.00  0.86           N
ATOM   2428  N   ALA B 307      -9.173 -46.392  19.019  1.00  0.92           N
ATOM   2429  CA  ALA B 307      -8.182 -46.724  20.015  1.00  0.92           C
ATOM   2430  C   ALA B 307      -8.571 -47.922  20.881  1.00  0.92           C
ATOM   2431  O   ALA B 307      -7.759 -48.812  21.129  1.00  0.92           O
ATOM   2432  CB  ALA B 307      -7.888 -45.476  20.864  1.00  0.92           C
ATOM   2433  N   ALA B 308      -9.845 -48.004  21.323  1.00  0.91           N
ATOM   2434  CA  ALA B 308     -10.373 -49.103  22.113  1.00  0.91           C
ATOM   2435  C   ALA B 308     -10.251 -50.435  21.397  1.00  0.91           C
ATOM   2436  O   ALA B 308      -9.871 -51.450  21.975  1.00  0.91           O
ATOM   2437  CB  ALA B 308     -11.841 -48.812  22.467  1.00  0.91           C
ATOM   2438  N   CYS B 309     -10.481 -50.408  20.079  1.00  0.91           N
ATOM   2439  CA  CYS B 309     -10.351 -51.511  19.162  1.00  0.91           C
ATOM   2440  C   CYS B 309      -8.983 -52.171  19.173  1.00  0.91           C
ATOM   2441  O   CYS B 309      -8.873 -53.391  19.141  1.00  0.91           O
ATOM   2442  CB  CYS B 309     -10.699 -50.999  17.740  1.00  0.91           C
ATOM   2443  SG  CYS B 309     -11.284 -52.299  16.611  1.00  0.91           S
ATOM   2444  N   ARG B 310      -7.900 -51.371  19.245  1.00  0.81           N
ATOM   2445  CA  ARG B 310      -6.554 -51.881  19.427  1.00  0.81           C
ATOM   2446  C   ARG B 310      -6.279 -52.348  20.857  1.00  0.81           C
ATOM   2447  O   ARG B 310      -5.666 -53.386  21.084  1.00  0.81           O
ATOM   2448  CB  ARG B 310      -5.504 -50.834  18.985  1.00  0.81           C
ATOM   2449  CG  ARG B 310      -5.712 -50.265  17.559  1.00  0.81           C
ATOM   2450  CD  ARG B 310      -5.751 -51.309  16.426  1.00  0.81           C
ATOM   2451  NE  ARG B 310      -7.161 -51.411  15.919  1.00  0.81           N
ATOM   2452  CZ  ARG B 310      -7.541 -52.214  14.916  1.00  0.81           C
ATOM   2453  NH1 ARG B 310      -6.712 -53.095  14.364  1.00  0.81           N
ATOM   2454  NH2 ARG B 310      -8.786 -52.125  14.455  1.00  0.81           N
ATOM   2455  N   LYS B 311      -6.745 -51.599  21.879  1.00  0.86           N
ATOM   2456  CA  LYS B 311      -6.531 -51.948  23.278  1.00  0.86           C
ATOM   2457  C   LYS B 311      -7.191 -53.252  23.700  1.00  0.86           C
ATOM   2458  O   LYS B 311      -6.581 -54.099  24.350  1.00  0.86           O
ATOM   2459  CB  LYS B 311      -6.985 -50.790  24.200  1.00  0.86           C
ATOM   2460  CG  LYS B 311      -6.099 -49.546  24.031  1.00  0.86           C
ATOM   2461  CD  LYS B 311      -6.603 -48.337  24.831  1.00  0.86           C
ATOM   2462  CE  LYS B 311      -5.747 -47.091  24.588  1.00  0.86           C
ATOM   2463  NZ  LYS B 311      -6.261 -45.948  25.374  1.00  0.86           N
ATOM   2464  N   VAL B 312      -8.455 -53.476  23.294  1.00  0.93           N
ATOM   2465  CA  VAL B 312      -9.122 -54.750  23.485  1.00  0.93           C
ATOM   2466  C   VAL B 312      -8.452 -55.884  22.705  1.00  0.93           C
ATOM   2467  O   VAL B 312      -8.227 -56.964  23.252  1.00  0.93           O
ATOM   2468  CB  VAL B 312     -10.618 -54.656  23.219  1.00  0.93           C
ATOM   2469  CG1 VAL B 312     -11.288 -56.024  23.455  1.00  0.93           C
ATOM   2470  CG2 VAL B 312     -11.253 -53.610  24.163  1.00  0.93           C
ATOM   2471  N   GLN B 313      -8.048 -55.639  21.433  1.00  0.88           N
ATOM   2472  CA  GLN B 313      -7.306 -56.584  20.606  1.00  0.88           C
ATOM   2473  C   GLN B 313      -6.011 -57.076  21.221  1.00  0.88           C
ATOM   2474  O   GLN B 313      -5.768 -58.280  21.271  1.00  0.88           O
ATOM   2475  CB  GLN B 313      -6.911 -55.920  19.260  1.00  0.88           C
ATOM   2476  CG  GLN B 313      -6.239 -56.872  18.242  1.00  0.88           C
ATOM   2477  CD  GLN B 313      -5.666 -56.163  17.011  1.00  0.88           C
ATOM   2478  OE1 GLN B 313      -5.226 -55.010  17.011  1.00  0.88           O
ATOM   2479  NE2 GLN B 313      -5.607 -56.930  15.896  1.00  0.88           N
ATOM   2480  N   HIS B 314      -5.165 -56.153  21.725  1.00  0.88           N
ATOM   2481  CA  HIS B 314      -3.855 -56.442  22.287  1.00  0.88           C
ATOM   2482  C   HIS B 314      -3.956 -57.353  23.488  1.00  0.88           C
ATOM   2483  O   HIS B 314      -3.265 -58.362  23.603  1.00  0.88           O
ATOM   2484  CB  HIS B 314      -3.131 -55.130  22.709  1.00  0.88           C
ATOM   2485  CG  HIS B 314      -1.830 -55.326  23.451  1.00  0.88           C
ATOM   2486  ND1 HIS B 314      -1.544 -54.571  24.575  1.00  0.88           N
ATOM   2487  CD2 HIS B 314      -0.792 -56.155  23.176  1.00  0.88           C
ATOM   2488  CE1 HIS B 314      -0.339 -54.946  24.948  1.00  0.88           C
ATOM   2489  NE2 HIS B 314       0.163 -55.907  24.138  1.00  0.88           N
ATOM   2490  N   MET B 315      -4.877 -57.023  24.403  1.00  0.86           N
ATOM   2491  CA  MET B 315      -5.111 -57.794  25.596  1.00  0.86           C
ATOM   2492  C   MET B 315      -5.696 -59.182  25.385  1.00  0.86           C
ATOM   2493  O   MET B 315      -5.220 -60.144  25.990  1.00  0.86           O
ATOM   2494  CB  MET B 315      -5.992 -56.938  26.525  1.00  0.86           C
ATOM   2495  CG  MET B 315      -6.605 -57.666  27.733  1.00  0.86           C
ATOM   2496  SD  MET B 315      -6.299 -56.946  29.361  1.00  0.86           S
ATOM   2497  CE  MET B 315      -6.009 -55.178  29.129  1.00  0.86           C
ATOM   2498  N   VAL B 316      -6.733 -59.343  24.532  1.00  0.94           N
ATOM   2499  CA  VAL B 316      -7.404 -60.631  24.400  1.00  0.94           C
ATOM   2500  C   VAL B 316      -6.494 -61.709  23.825  1.00  0.94           C
ATOM   2501  O   VAL B 316      -6.389 -62.811  24.357  1.00  0.94           O
ATOM   2502  CB  VAL B 316      -8.742 -60.534  23.659  1.00  0.94           C
ATOM   2503  CG1 VAL B 316      -8.561 -60.094  22.195  1.00  0.94           C
ATOM   2504  CG2 VAL B 316      -9.509 -61.871  23.745  1.00  0.94           C
ATOM   2505  N   VAL B 317      -5.735 -61.390  22.760  1.00  0.93           N
ATOM   2506  CA  VAL B 317      -4.811 -62.321  22.148  1.00  0.93           C
ATOM   2507  C   VAL B 317      -3.536 -62.550  22.958  1.00  0.93           C
ATOM   2508  O   VAL B 317      -2.978 -63.644  22.936  1.00  0.93           O
ATOM   2509  CB  VAL B 317      -4.570 -61.911  20.711  1.00  0.93           C
ATOM   2510  CG1 VAL B 317      -3.869 -60.557  20.643  1.00  0.93           C
ATOM   2511  CG2 VAL B 317      -3.773 -62.975  19.940  1.00  0.93           C
ATOM   2512  N   LYS B 318      -3.072 -61.566  23.773  1.00  0.88           N
ATOM   2513  CA  LYS B 318      -2.013 -61.795  24.754  1.00  0.88           C
ATOM   2514  C   LYS B 318      -2.435 -62.804  25.806  1.00  0.88           C
ATOM   2515  O   LYS B 318      -1.735 -63.775  26.081  1.00  0.88           O
ATOM   2516  CB  LYS B 318      -1.609 -60.471  25.472  1.00  0.88           C
ATOM   2517  CG  LYS B 318      -0.591 -60.625  26.627  1.00  0.88           C
ATOM   2518  CD  LYS B 318      -0.177 -59.305  27.317  1.00  0.88           C
ATOM   2519  CE  LYS B 318      -1.330 -58.557  28.007  1.00  0.88           C
ATOM   2520  NZ  LYS B 318      -0.830 -57.381  28.763  1.00  0.88           N
ATOM   2521  N   ALA B 319      -3.637 -62.627  26.386  1.00  0.93           N
ATOM   2522  CA  ALA B 319      -4.168 -63.541  27.367  1.00  0.93           C
ATOM   2523  C   ALA B 319      -4.404 -64.938  26.802  1.00  0.93           C
ATOM   2524  O   ALA B 319      -4.013 -65.930  27.407  1.00  0.93           O
ATOM   2525  CB  ALA B 319      -5.420 -62.920  28.009  1.00  0.93           C
ATOM   2526  N   ALA B 320      -4.959 -65.050  25.580  1.00  0.95           N
ATOM   2527  CA  ALA B 320      -5.136 -66.318  24.902  1.00  0.95           C
ATOM   2528  C   ALA B 320      -3.841 -67.098  24.677  1.00  0.95           C
ATOM   2529  O   ALA B 320      -3.743 -68.289  24.978  1.00  0.95           O
ATOM   2530  CB  ALA B 320      -5.800 -66.017  23.550  1.00  0.95           C
ATOM   2531  N   LEU B 321      -2.771 -66.425  24.206  1.00  0.92           N
ATOM   2532  CA  LEU B 321      -1.460 -67.037  24.108  1.00  0.92           C
ATOM   2533  C   LEU B 321      -0.879 -67.476  25.458  1.00  0.92           C
ATOM   2534  O   LEU B 321      -0.316 -68.559  25.575  1.00  0.92           O
ATOM   2535  CB  LEU B 321      -0.449 -66.131  23.361  1.00  0.92           C
ATOM   2536  CG  LEU B 321      -0.740 -65.887  21.861  1.00  0.92           C
ATOM   2537  CD1 LEU B 321       0.375 -65.036  21.236  1.00  0.92           C
ATOM   2538  CD2 LEU B 321      -0.908 -67.199  21.082  1.00  0.92           C
ATOM   2539  N   LEU B 322      -1.027 -66.670  26.532  1.00  0.89           N
ATOM   2540  CA  LEU B 322      -0.612 -67.059  27.875  1.00  0.89           C
ATOM   2541  C   LEU B 322      -1.355 -68.285  28.417  1.00  0.89           C
ATOM   2542  O   LEU B 322      -0.731 -69.169  29.007  1.00  0.89           O
ATOM   2543  CB  LEU B 322      -0.761 -65.874  28.876  1.00  0.89           C
ATOM   2544  CG  LEU B 322       0.445 -64.909  29.023  1.00  0.89           C
ATOM   2545  CD1 LEU B 322       1.084 -64.435  27.708  1.00  0.89           C
ATOM   2546  CD2 LEU B 322       0.003 -63.700  29.862  1.00  0.89           C
ATOM   2547  N   ALA B 323      -2.691 -68.358  28.238  1.00  0.93           N
ATOM   2548  CA  ALA B 323      -3.527 -69.417  28.769  1.00  0.93           C
ATOM   2549  C   ALA B 323      -3.295 -70.800  28.176  1.00  0.93           C
ATOM   2550  O   ALA B 323      -3.065 -71.767  28.901  1.00  0.93           O
ATOM   2551  CB  ALA B 323      -4.993 -69.026  28.505  1.00  0.93           C
ATOM   2552  N   ASP B 324      -3.312 -70.892  26.832  1.00  0.92           N
ATOM   2553  CA  ASP B 324      -3.335 -72.161  26.130  1.00  0.92           C
ATOM   2554  C   ASP B 324      -2.023 -72.437  25.411  1.00  0.92           C
ATOM   2555  O   ASP B 324      -1.800 -73.518  24.869  1.00  0.92           O
ATOM   2556  CB  ASP B 324      -4.496 -72.114  25.117  1.00  0.92           C
ATOM   2557  CG  ASP B 324      -5.786 -72.071  25.941  1.00  0.92           C
ATOM   2558  OD1 ASP B 324      -6.378 -70.980  26.096  1.00  0.92           O
ATOM   2559  OD2 ASP B 324      -6.199 -73.106  26.497  1.00  0.92           O
ATOM   2560  N   LYS B 325      -1.084 -71.467  25.446  1.00  0.88           N
ATOM   2561  CA  LYS B 325       0.319 -71.652  25.103  1.00  0.88           C
ATOM   2562  C   LYS B 325       0.579 -72.093  23.663  1.00  0.88           C
ATOM   2563  O   LYS B 325       1.430 -72.941  23.404  1.00  0.88           O
ATOM   2564  CB  LYS B 325       1.016 -72.662  26.060  1.00  0.88           C
ATOM   2565  CG  LYS B 325       0.719 -72.512  27.563  1.00  0.88           C
ATOM   2566  CD  LYS B 325       1.713 -71.636  28.340  1.00  0.88           C
ATOM   2567  CE  LYS B 325       1.368 -71.628  29.834  1.00  0.88           C
ATOM   2568  NZ  LYS B 325       2.314 -70.799  30.613  1.00  0.88           N
ATOM   2569  N   PHE B 326      -0.152 -71.535  22.680  1.00  0.90           N
ATOM   2570  CA  PHE B 326      -0.113 -72.007  21.304  1.00  0.90           C
ATOM   2571  C   PHE B 326       1.264 -71.959  20.611  1.00  0.90           C
ATOM   2572  O   PHE B 326       1.963 -70.956  20.750  1.00  0.90           O
ATOM   2573  CB  PHE B 326      -1.087 -71.198  20.416  1.00  0.90           C
ATOM   2574  CG  PHE B 326      -2.504 -71.342  20.884  1.00  0.90           C
ATOM   2575  CD1 PHE B 326      -3.111 -70.349  21.670  1.00  0.90           C
ATOM   2576  CD2 PHE B 326      -3.269 -72.448  20.479  1.00  0.90           C
ATOM   2577  CE1 PHE B 326      -4.462 -70.442  22.015  1.00  0.90           C
ATOM   2578  CE2 PHE B 326      -4.623 -72.543  20.821  1.00  0.90           C
ATOM   2579  CZ  PHE B 326      -5.218 -71.540  21.593  1.00  0.90           C
ATOM   2580  N   PRO B 327       1.691 -72.965  19.825  1.00  0.91           N
ATOM   2581  CA  PRO B 327       2.995 -72.949  19.154  1.00  0.91           C
ATOM   2582  C   PRO B 327       3.099 -71.875  18.093  1.00  0.91           C
ATOM   2583  O   PRO B 327       4.158 -71.276  17.914  1.00  0.91           O
ATOM   2584  CB  PRO B 327       3.115 -74.344  18.505  1.00  0.91           C
ATOM   2585  CG  PRO B 327       2.190 -75.242  19.332  1.00  0.91           C
ATOM   2586  CD  PRO B 327       1.085 -74.299  19.806  1.00  0.91           C
ATOM   2587  N   VAL B 328       1.993 -71.643  17.376  1.00  0.91           N
ATOM   2588  CA  VAL B 328       1.937 -70.770  16.229  1.00  0.91           C
ATOM   2589  C   VAL B 328       0.618 -70.026  16.287  1.00  0.91           C
ATOM   2590  O   VAL B 328      -0.385 -70.533  16.797  1.00  0.91           O
ATOM   2591  CB  VAL B 328       2.092 -71.528  14.911  1.00  0.91           C
ATOM   2592  CG1 VAL B 328       0.956 -72.547  14.732  1.00  0.91           C
ATOM   2593  CG2 VAL B 328       2.170 -70.564  13.709  1.00  0.91           C
ATOM   2594  N   LEU B 329       0.590 -68.778  15.793  1.00  0.92           N
ATOM   2595  CA  LEU B 329      -0.611 -67.997  15.628  1.00  0.92           C
ATOM   2596  C   LEU B 329      -0.735 -67.640  14.164  1.00  0.92           C
ATOM   2597  O   LEU B 329       0.172 -67.082  13.548  1.00  0.92           O
ATOM   2598  CB  LEU B 329      -0.588 -66.731  16.523  1.00  0.92           C
ATOM   2599  CG  LEU B 329      -1.822 -65.801  16.441  1.00  0.92           C
ATOM   2600  CD1 LEU B 329      -2.000 -65.023  17.752  1.00  0.92           C
ATOM   2601  CD2 LEU B 329      -1.711 -64.788  15.294  1.00  0.92           C
ATOM   2602  N   HIS B 330      -1.891 -67.965  13.565  1.00  0.90           N
ATOM   2603  CA  HIS B 330      -2.161 -67.715  12.168  1.00  0.90           C
ATOM   2604  C   HIS B 330      -3.088 -66.514  12.056  1.00  0.90           C
ATOM   2605  O   HIS B 330      -4.263 -66.577  12.408  1.00  0.90           O
ATOM   2606  CB  HIS B 330      -2.851 -68.939  11.521  1.00  0.90           C
ATOM   2607  CG  HIS B 330      -2.036 -70.211  11.508  1.00  0.90           C
ATOM   2608  ND1 HIS B 330      -1.399 -70.602  10.340  1.00  0.90           N
ATOM   2609  CD2 HIS B 330      -1.922 -71.185  12.452  1.00  0.90           C
ATOM   2610  CE1 HIS B 330      -0.925 -71.814  10.602  1.00  0.90           C
ATOM   2611  NE2 HIS B 330      -1.207 -72.205  11.863  1.00  0.90           N
ATOM   2612  N   ASP B 331      -2.572 -65.375  11.579  1.00  0.93           N
ATOM   2613  CA  ASP B 331      -3.253 -64.101  11.580  1.00  0.93           C
ATOM   2614  C   ASP B 331      -3.865 -63.875  10.202  1.00  0.93           C
ATOM   2615  O   ASP B 331      -3.159 -63.811   9.195  1.00  0.93           O
ATOM   2616  CB  ASP B 331      -2.171 -63.057  11.941  1.00  0.93           C
ATOM   2617  CG  ASP B 331      -2.683 -61.666  12.258  1.00  0.93           C
ATOM   2618  OD1 ASP B 331      -3.917 -61.448  12.288  1.00  0.93           O
ATOM   2619  OD2 ASP B 331      -1.805 -60.797  12.502  1.00  0.93           O
ATOM   2620  N   ILE B 332      -5.210 -63.826  10.102  1.00  0.93           N
ATOM   2621  CA  ILE B 332      -5.892 -63.829   8.819  1.00  0.93           C
ATOM   2622  C   ILE B 332      -6.682 -62.552   8.614  1.00  0.93           C
ATOM   2623  O   ILE B 332      -7.598 -62.226   9.367  1.00  0.93           O
ATOM   2624  CB  ILE B 332      -6.805 -65.040   8.626  1.00  0.93           C
ATOM   2625  CG1 ILE B 332      -6.130 -66.310   9.207  1.00  0.93           C
ATOM   2626  CG2 ILE B 332      -7.142 -65.197   7.125  1.00  0.93           C
ATOM   2627  CD1 ILE B 332      -6.649 -67.638   8.648  1.00  0.93           C
ATOM   2628  N   GLY B 333      -6.365 -61.806   7.539  1.00  0.94           N
ATOM   2629  CA  GLY B 333      -6.938 -60.500   7.252  1.00  0.94           C
ATOM   2630  C   GLY B 333      -6.040 -59.381   7.695  1.00  0.94           C
ATOM   2631  O   GLY B 333      -6.512 -58.306   8.058  1.00  0.94           O
ATOM   2632  N   ASN B 334      -4.709 -59.603   7.674  1.00  0.87           N
ATOM   2633  CA  ASN B 334      -3.723 -58.599   8.025  1.00  0.87           C
ATOM   2634  C   ASN B 334      -2.932 -58.188   6.771  1.00  0.87           C
ATOM   2635  O   ASN B 334      -2.075 -58.946   6.315  1.00  0.87           O
ATOM   2636  CB  ASN B 334      -2.777 -59.142   9.137  1.00  0.87           C
ATOM   2637  CG  ASN B 334      -2.170 -58.011   9.967  1.00  0.87           C
ATOM   2638  OD1 ASN B 334      -2.274 -56.828   9.613  1.00  0.87           O
ATOM   2639  ND2 ASN B 334      -1.561 -58.376  11.117  1.00  0.87           N
ATOM   2640  N   PRO B 335      -3.152 -57.004   6.175  1.00  0.86           N
ATOM   2641  CA  PRO B 335      -2.504 -56.650   4.909  1.00  0.86           C
ATOM   2642  C   PRO B 335      -1.056 -56.266   5.089  1.00  0.86           C
ATOM   2643  O   PRO B 335      -0.347 -56.061   4.108  1.00  0.86           O
ATOM   2644  CB  PRO B 335      -3.286 -55.419   4.415  1.00  0.86           C
ATOM   2645  CG  PRO B 335      -4.676 -55.581   5.022  1.00  0.86           C
ATOM   2646  CD  PRO B 335      -4.403 -56.263   6.359  1.00  0.86           C
ATOM   2647  N   LYS B 336      -0.615 -56.094   6.337  1.00  0.80           N
ATOM   2648  CA  LYS B 336       0.680 -55.574   6.682  1.00  0.80           C
ATOM   2649  C   LYS B 336       1.079 -56.315   7.935  1.00  0.80           C
ATOM   2650  O   LYS B 336       0.236 -56.871   8.607  1.00  0.80           O
ATOM   2651  CB  LYS B 336       0.634 -54.031   6.893  1.00  0.80           C
ATOM   2652  CG  LYS B 336      -0.702 -53.493   7.450  1.00  0.80           C
ATOM   2653  CD  LYS B 336      -0.692 -51.968   7.677  1.00  0.80           C
ATOM   2654  CE  LYS B 336      -1.429 -51.129   6.619  1.00  0.80           C
ATOM   2655  NZ  LYS B 336      -2.890 -51.384   6.657  1.00  0.80           N
ATOM   2656  N   ALA B 337       2.377 -56.412   8.283  1.00  0.85           N
ATOM   2657  CA  ALA B 337       2.785 -57.327   9.338  1.00  0.85           C
ATOM   2658  C   ALA B 337       2.177 -57.102  10.730  1.00  0.85           C
ATOM   2659  O   ALA B 337       1.622 -58.009  11.321  1.00  0.85           O
ATOM   2660  CB  ALA B 337       4.322 -57.258   9.444  1.00  0.85           C
ATOM   2661  N   ILE B 338       2.248 -55.870  11.264  1.00  0.77           N
ATOM   2662  CA  ILE B 338       1.562 -55.374  12.461  1.00  0.77           C
ATOM   2663  C   ILE B 338       1.117 -56.392  13.528  1.00  0.77           C
ATOM   2664  O   ILE B 338      -0.064 -56.676  13.711  1.00  0.77           O
ATOM   2665  CB  ILE B 338       0.424 -54.441  12.049  1.00  0.77           C
ATOM   2666  CG1 ILE B 338       0.857 -53.478  10.910  1.00  0.77           C
ATOM   2667  CG2 ILE B 338      -0.136 -53.645  13.251  1.00  0.77           C
ATOM   2668  CD1 ILE B 338       2.043 -52.567  11.253  1.00  0.77           C
ATOM   2669  N   LYS B 339       2.085 -56.980  14.270  1.00  0.83           N
ATOM   2670  CA  LYS B 339       1.798 -57.904  15.357  1.00  0.83           C
ATOM   2671  C   LYS B 339       1.065 -57.245  16.522  1.00  0.83           C
ATOM   2672  O   LYS B 339       1.619 -56.401  17.225  1.00  0.83           O
ATOM   2673  CB  LYS B 339       3.086 -58.567  15.923  1.00  0.83           C
ATOM   2674  CG  LYS B 339       3.815 -59.519  14.961  1.00  0.83           C
ATOM   2675  CD  LYS B 339       5.135 -60.045  15.564  1.00  0.83           C
ATOM   2676  CE  LYS B 339       5.461 -61.485  15.157  1.00  0.83           C
ATOM   2677  NZ  LYS B 339       6.696 -61.969  15.819  1.00  0.83           N
ATOM   2678  N   CYS B 340      -0.202 -57.642  16.777  1.00  0.92           N
ATOM   2679  CA  CYS B 340      -1.044 -57.055  17.811  1.00  0.92           C
ATOM   2680  C   CYS B 340      -0.495 -57.216  19.216  1.00  0.92           C
ATOM   2681  O   CYS B 340      -0.712 -56.362  20.071  1.00  0.92           O
ATOM   2682  CB  CYS B 340      -2.503 -57.564  17.741  1.00  0.92           C
ATOM   2683  SG  CYS B 340      -2.623 -59.377  17.770  1.00  0.92           S
ATOM   2684  N   VAL B 341       0.268 -58.295  19.474  1.00  0.89           N
ATOM   2685  CA  VAL B 341       1.149 -58.372  20.624  1.00  0.89           C
ATOM   2686  C   VAL B 341       2.582 -58.335  20.116  1.00  0.89           C
ATOM   2687  O   VAL B 341       2.959 -59.241  19.373  1.00  0.89           O
ATOM   2688  CB  VAL B 341       0.997 -59.634  21.461  1.00  0.89           C
ATOM   2689  CG1 VAL B 341       1.260 -59.302  22.937  1.00  0.89           C
ATOM   2690  CG2 VAL B 341      -0.419 -60.196  21.349  1.00  0.89           C
ATOM   2691  N   PRO B 342       3.434 -57.360  20.440  1.00  0.85           N
ATOM   2692  CA  PRO B 342       4.629 -57.141  19.634  1.00  0.85           C
ATOM   2693  C   PRO B 342       5.677 -58.183  19.920  1.00  0.85           C
ATOM   2694  O   PRO B 342       6.413 -58.588  19.021  1.00  0.85           O
ATOM   2695  CB  PRO B 342       5.122 -55.741  20.055  1.00  0.85           C
ATOM   2696  CG  PRO B 342       4.407 -55.438  21.377  1.00  0.85           C
ATOM   2697  CD  PRO B 342       3.079 -56.161  21.196  1.00  0.85           C
ATOM   2698  N   GLN B 343       5.757 -58.604  21.186  1.00  0.84           N
ATOM   2699  CA  GLN B 343       6.753 -59.516  21.677  1.00  0.84           C
ATOM   2700  C   GLN B 343       6.070 -60.720  22.284  1.00  0.84           C
ATOM   2701  O   GLN B 343       5.345 -60.635  23.276  1.00  0.84           O
ATOM   2702  CB  GLN B 343       7.697 -58.831  22.699  1.00  0.84           C
ATOM   2703  CG  GLN B 343       6.992 -57.764  23.572  1.00  0.84           C
ATOM   2704  CD  GLN B 343       7.942 -57.082  24.556  1.00  0.84           C
ATOM   2705  OE1 GLN B 343       9.007 -57.581  24.920  1.00  0.84           O
ATOM   2706  NE2 GLN B 343       7.536 -55.882  25.030  1.00  0.84           N
ATOM   2707  N   ALA B 344       6.292 -61.883  21.660  1.00  0.84           N
ATOM   2708  CA  ALA B 344       5.890 -63.164  22.163  1.00  0.84           C
ATOM   2709  C   ALA B 344       6.711 -64.162  21.391  1.00  0.84           C
ATOM   2710  O   ALA B 344       7.009 -63.938  20.218  1.00  0.84           O
ATOM   2711  CB  ALA B 344       4.390 -63.454  21.926  1.00  0.84           C
ATOM   2712  N   ASP B 345       7.056 -65.299  22.018  1.00  0.83           N
ATOM   2713  CA  ASP B 345       7.936 -66.290  21.430  1.00  0.83           C
ATOM   2714  C   ASP B 345       7.241 -67.086  20.336  1.00  0.83           C
ATOM   2715  O   ASP B 345       7.865 -67.788  19.545  1.00  0.83           O
ATOM   2716  CB  ASP B 345       8.428 -67.255  22.535  1.00  0.83           C
ATOM   2717  CG  ASP B 345       9.259 -66.532  23.588  1.00  0.83           C
ATOM   2718  OD1 ASP B 345       9.625 -65.350  23.372  1.00  0.83           O
ATOM   2719  OD2 ASP B 345       9.499 -67.164  24.646  1.00  0.83           O
ATOM   2720  N   VAL B 346       5.901 -66.970  20.275  1.00  0.90           N
ATOM   2721  CA  VAL B 346       5.039 -67.653  19.335  1.00  0.90           C
ATOM   2722  C   VAL B 346       5.420 -67.447  17.866  1.00  0.90           C
ATOM   2723  O   VAL B 346       5.724 -66.333  17.421  1.00  0.90           O
ATOM   2724  CB  VAL B 346       3.587 -67.242  19.589  1.00  0.90           C
ATOM   2725  CG1 VAL B 346       3.330 -65.786  19.149  1.00  0.90           C
ATOM   2726  CG2 VAL B 346       2.625 -68.201  18.876  1.00  0.90           C
ATOM   2727  N   GLU B 347       5.412 -68.522  17.040  1.00  0.84           N
ATOM   2728  CA  GLU B 347       5.550 -68.355  15.599  1.00  0.84           C
ATOM   2729  C   GLU B 347       4.337 -67.620  15.040  1.00  0.84           C
ATOM   2730  O   GLU B 347       3.196 -67.925  15.371  1.00  0.84           O
ATOM   2731  CB  GLU B 347       5.793 -69.684  14.839  1.00  0.84           C
ATOM   2732  CG  GLU B 347       6.275 -69.499  13.370  1.00  0.84           C
ATOM   2733  CD  GLU B 347       6.346 -70.797  12.557  1.00  0.84           C
ATOM   2734  OE1 GLU B 347       5.809 -71.834  13.007  1.00  0.84           O
ATOM   2735  OE2 GLU B 347       6.887 -70.733  11.416  1.00  0.84           O
ATOM   2736  N   TRP B 348       4.527 -66.590  14.201  1.00  0.86           N
ATOM   2737  CA  TRP B 348       3.415 -65.760  13.782  1.00  0.86           C
ATOM   2738  C   TRP B 348       3.387 -65.725  12.281  1.00  0.86           C
ATOM   2739  O   TRP B 348       4.354 -65.328  11.629  1.00  0.86           O
ATOM   2740  CB  TRP B 348       3.536 -64.334  14.367  1.00  0.86           C
ATOM   2741  CG  TRP B 348       2.265 -63.486  14.436  1.00  0.86           C
ATOM   2742  CD1 TRP B 348       1.363 -63.173  13.455  1.00  0.86           C
ATOM   2743  CD2 TRP B 348       1.834 -62.776  15.614  1.00  0.86           C
ATOM   2744  NE1 TRP B 348       0.417 -62.294  13.939  1.00  0.86           N
ATOM   2745  CE2 TRP B 348       0.669 -62.058  15.260  1.00  0.86           C
ATOM   2746  CE3 TRP B 348       2.352 -62.705  16.905  1.00  0.86           C
ATOM   2747  CZ2 TRP B 348      -0.008 -61.291  16.188  1.00  0.86           C
ATOM   2748  CZ3 TRP B 348       1.664 -61.927  17.846  1.00  0.86           C
ATOM   2749  CH2 TRP B 348       0.490 -61.245  17.495  1.00  0.86           C
ATOM   2750  N   LYS B 349       2.269 -66.175  11.701  1.00  0.84           N
ATOM   2751  CA  LYS B 349       2.132 -66.313  10.275  1.00  0.84           C
ATOM   2752  C   LYS B 349       1.007 -65.442   9.778  1.00  0.84           C
ATOM   2753  O   LYS B 349      -0.060 -65.365  10.380  1.00  0.84           O
ATOM   2754  CB  LYS B 349       1.875 -67.787   9.902  1.00  0.84           C
ATOM   2755  CG  LYS B 349       3.083 -68.682  10.203  1.00  0.84           C
ATOM   2756  CD  LYS B 349       3.662 -69.373   8.960  1.00  0.84           C
ATOM   2757  CE  LYS B 349       4.929 -70.127   9.355  1.00  0.84           C
ATOM   2758  NZ  LYS B 349       5.494 -70.943   8.265  1.00  0.84           N
ATOM   2759  N   PHE B 350       1.237 -64.747   8.654  1.00  0.86           N
ATOM   2760  CA  PHE B 350       0.347 -63.717   8.171  1.00  0.86           C
ATOM   2761  C   PHE B 350      -0.325 -64.176   6.900  1.00  0.86           C
ATOM   2762  O   PHE B 350       0.312 -64.718   5.996  1.00  0.86           O
ATOM   2763  CB  PHE B 350       1.120 -62.423   7.815  1.00  0.86           C
ATOM   2764  CG  PHE B 350       1.810 -61.803   8.994  1.00  0.86           C
ATOM   2765  CD1 PHE B 350       1.095 -61.476  10.152  1.00  0.86           C
ATOM   2766  CD2 PHE B 350       3.176 -61.476   8.932  1.00  0.86           C
ATOM   2767  CE1 PHE B 350       1.745 -60.877  11.233  1.00  0.86           C
ATOM   2768  CE2 PHE B 350       3.823 -60.845   9.999  1.00  0.86           C
ATOM   2769  CZ  PHE B 350       3.107 -60.564  11.162  1.00  0.86           C
ATOM   2770  N   TYR B 351      -1.643 -63.951   6.801  1.00  0.87           N
ATOM   2771  CA  TYR B 351      -2.413 -64.329   5.639  1.00  0.87           C
ATOM   2772  C   TYR B 351      -3.385 -63.219   5.299  1.00  0.87           C
ATOM   2773  O   TYR B 351      -4.078 -62.696   6.172  1.00  0.87           O
ATOM   2774  CB  TYR B 351      -3.248 -65.613   5.887  1.00  0.87           C
ATOM   2775  CG  TYR B 351      -2.391 -66.735   6.393  1.00  0.87           C
ATOM   2776  CD1 TYR B 351      -1.763 -67.617   5.505  1.00  0.87           C
ATOM   2777  CD2 TYR B 351      -2.199 -66.906   7.773  1.00  0.87           C
ATOM   2778  CE1 TYR B 351      -0.968 -68.669   5.988  1.00  0.87           C
ATOM   2779  CE2 TYR B 351      -1.423 -67.962   8.256  1.00  0.87           C
ATOM   2780  CZ  TYR B 351      -0.819 -68.853   7.367  1.00  0.87           C
ATOM   2781  OH  TYR B 351      -0.077 -69.929   7.888  1.00  0.87           O
ATOM   2782  N   ASP B 352      -3.490 -62.849   4.012  1.00  0.87           N
ATOM   2783  CA  ASP B 352      -4.592 -62.026   3.560  1.00  0.87           C
ATOM   2784  C   ASP B 352      -4.771 -62.204   2.067  1.00  0.87           C
ATOM   2785  O   ASP B 352      -3.908 -62.735   1.370  1.00  0.87           O
ATOM   2786  CB  ASP B 352      -4.418 -60.518   3.902  1.00  0.87           C
ATOM   2787  CG  ASP B 352      -5.721 -59.748   3.730  1.00  0.87           C
ATOM   2788  OD1 ASP B 352      -6.802 -60.387   3.838  1.00  0.87           O
ATOM   2789  OD2 ASP B 352      -5.652 -58.544   3.405  1.00  0.87           O
ATOM   2790  N   ALA B 353      -5.938 -61.787   1.553  1.00  0.87           N
ATOM   2791  CA  ALA B 353      -6.265 -61.836   0.152  1.00  0.87           C
ATOM   2792  C   ALA B 353      -5.470 -60.847  -0.678  1.00  0.87           C
ATOM   2793  O   ALA B 353      -5.073 -61.138  -1.802  1.00  0.87           O
ATOM   2794  CB  ALA B 353      -7.776 -61.642  -0.050  1.00  0.87           C
ATOM   2795  N   GLN B 354      -5.213 -59.644  -0.141  1.00  0.78           N
ATOM   2796  CA  GLN B 354      -4.374 -58.682  -0.809  1.00  0.78           C
ATOM   2797  C   GLN B 354      -3.268 -58.253   0.142  1.00  0.78           C
ATOM   2798  O   GLN B 354      -3.512 -57.456   1.045  1.00  0.78           O
ATOM   2799  CB  GLN B 354      -5.229 -57.478  -1.278  1.00  0.78           C
ATOM   2800  CG  GLN B 354      -5.849 -57.728  -2.677  1.00  0.78           C
ATOM   2801  CD  GLN B 354      -7.370 -57.590  -2.758  1.00  0.78           C
ATOM   2802  OE1 GLN B 354      -8.082 -57.030  -1.925  1.00  0.78           O
ATOM   2803  NE2 GLN B 354      -7.913 -58.124  -3.880  1.00  0.78           N
ATOM   2804  N   PRO B 355      -2.029 -58.718  -0.008  1.00  0.83           N
ATOM   2805  CA  PRO B 355      -0.921 -58.223   0.792  1.00  0.83           C
ATOM   2806  C   PRO B 355      -0.497 -56.848   0.311  1.00  0.83           C
ATOM   2807  O   PRO B 355      -0.530 -56.580  -0.891  1.00  0.83           O
ATOM   2808  CB  PRO B 355       0.187 -59.264   0.549  1.00  0.83           C
ATOM   2809  CG  PRO B 355      -0.091 -59.785  -0.864  1.00  0.83           C
ATOM   2810  CD  PRO B 355      -1.618 -59.798  -0.917  1.00  0.83           C
ATOM   2811  N   CYS B 356      -0.098 -55.941   1.224  1.00  0.79           N
ATOM   2812  CA  CYS B 356       0.592 -54.716   0.855  1.00  0.79           C
ATOM   2813  C   CYS B 356       1.894 -54.976   0.125  1.00  0.79           C
ATOM   2814  O   CYS B 356       2.566 -55.984   0.324  1.00  0.79           O
ATOM   2815  CB  CYS B 356       0.927 -53.795   2.051  1.00  0.79           C
ATOM   2816  SG  CYS B 356      -0.531 -53.005   2.807  1.00  0.79           S
ATOM   2817  N   SER B 357       2.274 -54.049  -0.778  1.00  0.78           N
ATOM   2818  CA  SER B 357       3.501 -54.168  -1.546  1.00  0.78           C
ATOM   2819  C   SER B 357       4.730 -54.174  -0.673  1.00  0.78           C
ATOM   2820  O   SER B 357       5.603 -55.037  -0.791  1.00  0.78           O
ATOM   2821  CB  SER B 357       3.649 -53.020  -2.573  1.00  0.78           C
ATOM   2822  OG  SER B 357       2.460 -52.902  -3.356  1.00  0.78           O
ATOM   2823  N   ASP B 358       4.817 -53.248   0.293  1.00  0.81           N
ATOM   2824  CA  ASP B 358       5.684 -53.411   1.420  1.00  0.81           C
ATOM   2825  C   ASP B 358       5.169 -54.526   2.330  1.00  0.81           C
ATOM   2826  O   ASP B 358       3.974 -54.675   2.542  1.00  0.81           O
ATOM   2827  CB  ASP B 358       5.843 -52.054   2.130  1.00  0.81           C
ATOM   2828  CG  ASP B 358       4.503 -51.617   2.698  1.00  0.81           C
ATOM   2829  OD1 ASP B 358       3.657 -51.150   1.900  1.00  0.81           O
ATOM   2830  OD2 ASP B 358       4.307 -51.792   3.929  1.00  0.81           O
ATOM   2831  N   LYS B 359       6.080 -55.372   2.841  1.00  0.72           N
ATOM   2832  CA  LYS B 359       5.768 -56.476   3.732  1.00  0.72           C
ATOM   2833  C   LYS B 359       5.267 -57.706   2.992  1.00  0.72           C
ATOM   2834  O   LYS B 359       5.128 -58.757   3.618  1.00  0.72           O
ATOM   2835  CB  LYS B 359       4.854 -56.084   4.938  1.00  0.72           C
ATOM   2836  CG  LYS B 359       5.443 -54.972   5.832  1.00  0.72           C
ATOM   2837  CD  LYS B 359       4.369 -54.081   6.486  1.00  0.72           C
ATOM   2838  CE  LYS B 359       4.673 -53.617   7.914  1.00  0.72           C
ATOM   2839  NZ  LYS B 359       5.955 -52.881   7.963  1.00  0.72           N
ATOM   2840  N   ALA B 360       5.091 -57.668   1.657  1.00  0.82           N
ATOM   2841  CA  ALA B 360       4.563 -58.725   0.799  1.00  0.82           C
ATOM   2842  C   ALA B 360       5.197 -60.080   1.045  1.00  0.82           C
ATOM   2843  O   ALA B 360       4.531 -61.096   1.150  1.00  0.82           O
ATOM   2844  CB  ALA B 360       4.740 -58.355  -0.694  1.00  0.82           C
ATOM   2845  N   TYR B 361       6.518 -60.108   1.261  1.00  0.78           N
ATOM   2846  CA  TYR B 361       7.293 -61.294   1.537  1.00  0.78           C
ATOM   2847  C   TYR B 361       7.015 -61.971   2.882  1.00  0.78           C
ATOM   2848  O   TYR B 361       7.474 -63.082   3.130  1.00  0.78           O
ATOM   2849  CB  TYR B 361       8.800 -60.935   1.415  1.00  0.78           C
ATOM   2850  CG  TYR B 361       9.286 -60.053   2.544  1.00  0.78           C
ATOM   2851  CD1 TYR B 361       8.892 -58.707   2.653  1.00  0.78           C
ATOM   2852  CD2 TYR B 361      10.143 -60.585   3.521  1.00  0.78           C
ATOM   2853  CE1 TYR B 361       9.365 -57.906   3.698  1.00  0.78           C
ATOM   2854  CE2 TYR B 361      10.619 -59.782   4.567  1.00  0.78           C
ATOM   2855  CZ  TYR B 361      10.226 -58.442   4.658  1.00  0.78           C
ATOM   2856  OH  TYR B 361      10.715 -57.626   5.700  1.00  0.78           O
ATOM   2857  N   LYS B 362       6.293 -61.303   3.803  1.00  0.79           N
ATOM   2858  CA  LYS B 362       6.006 -61.836   5.114  1.00  0.79           C
ATOM   2859  C   LYS B 362       4.618 -62.440   5.158  1.00  0.79           C
ATOM   2860  O   LYS B 362       4.231 -63.021   6.170  1.00  0.79           O
ATOM   2861  CB  LYS B 362       5.990 -60.696   6.164  1.00  0.79           C
ATOM   2862  CG  LYS B 362       7.349 -60.121   6.577  1.00  0.79           C
ATOM   2863  CD  LYS B 362       7.125 -58.955   7.554  1.00  0.79           C
ATOM   2864  CE  LYS B 362       8.149 -58.853   8.686  1.00  0.79           C
ATOM   2865  NZ  LYS B 362       9.496 -58.528   8.177  1.00  0.79           N
ATOM   2866  N   ILE B 363       3.830 -62.312   4.081  1.00  0.83           N
ATOM   2867  CA  ILE B 363       2.416 -62.625   4.097  1.00  0.83           C
ATOM   2868  C   ILE B 363       2.121 -63.622   3.004  1.00  0.83           C
ATOM   2869  O   ILE B 363       2.525 -63.444   1.859  1.00  0.83           O
ATOM   2870  CB  ILE B 363       1.543 -61.386   3.877  1.00  0.83           C
ATOM   2871  CG1 ILE B 363       1.960 -60.221   4.805  1.00  0.83           C
ATOM   2872  CG2 ILE B 363       0.052 -61.745   4.076  1.00  0.83           C
ATOM   2873  CD1 ILE B 363       1.142 -58.952   4.569  1.00  0.83           C
ATOM   2874  N   GLU B 364       1.395 -64.705   3.321  1.00  0.82           N
ATOM   2875  CA  GLU B 364       0.944 -65.639   2.310  1.00  0.82           C
ATOM   2876  C   GLU B 364      -0.381 -65.174   1.709  1.00  0.82           C
ATOM   2877  O   GLU B 364      -1.238 -64.612   2.399  1.00  0.82           O
ATOM   2878  CB  GLU B 364       0.818 -67.051   2.920  1.00  0.82           C
ATOM   2879  CG  GLU B 364       0.355 -68.161   1.945  1.00  0.82           C
ATOM   2880  CD  GLU B 364       1.312 -68.333   0.767  1.00  0.82           C
ATOM   2881  OE1 GLU B 364       1.199 -67.536  -0.199  1.00  0.82           O
ATOM   2882  OE2 GLU B 364       2.160 -69.259   0.836  1.00  0.82           O
ATOM   2883  N   GLU B 365      -0.583 -65.379   0.392  1.00  0.82           N
ATOM   2884  CA  GLU B 365      -1.778 -64.929  -0.303  1.00  0.82           C
ATOM   2885  C   GLU B 365      -2.904 -65.933  -0.118  1.00  0.82           C
ATOM   2886  O   GLU B 365      -2.844 -67.066  -0.589  1.00  0.82           O
ATOM   2887  CB  GLU B 365      -1.527 -64.734  -1.822  1.00  0.82           C
ATOM   2888  CG  GLU B 365      -2.718 -64.123  -2.611  1.00  0.82           C
ATOM   2889  CD  GLU B 365      -2.574 -64.297  -4.125  1.00  0.82           C
ATOM   2890  OE1 GLU B 365      -2.183 -63.310  -4.801  1.00  0.82           O
ATOM   2891  OE2 GLU B 365      -2.892 -65.410  -4.621  1.00  0.82           O
ATOM   2892  N   LEU B 366      -3.985 -65.557   0.597  1.00  0.88           N
ATOM   2893  CA  LEU B 366      -5.114 -66.457   0.723  1.00  0.88           C
ATOM   2894  C   LEU B 366      -6.445 -65.767   0.927  1.00  0.88           C
ATOM   2895  O   LEU B 366      -6.602 -64.889   1.769  1.00  0.88           O
ATOM   2896  CB  LEU B 366      -4.947 -67.470   1.895  1.00  0.88           C
ATOM   2897  CG  LEU B 366      -4.525 -68.902   1.498  1.00  0.88           C
ATOM   2898  CD1 LEU B 366      -4.711 -69.843   2.698  1.00  0.88           C
ATOM   2899  CD2 LEU B 366      -5.306 -69.436   0.287  1.00  0.88           C
ATOM   2900  N   PHE B 367      -7.490 -66.247   0.225  1.00  0.84           N
ATOM   2901  CA  PHE B 367      -8.863 -65.960   0.577  1.00  0.84           C
ATOM   2902  C   PHE B 367      -9.369 -67.141   1.386  1.00  0.84           C
ATOM   2903  O   PHE B 367      -9.496 -68.251   0.869  1.00  0.84           O
ATOM   2904  CB  PHE B 367      -9.724 -65.788  -0.702  1.00  0.84           C
ATOM   2905  CG  PHE B 367     -11.059 -65.097  -0.509  1.00  0.84           C
ATOM   2906  CD1 PHE B 367     -11.762 -65.018   0.709  1.00  0.84           C
ATOM   2907  CD2 PHE B 367     -11.653 -64.530  -1.647  1.00  0.84           C
ATOM   2908  CE1 PHE B 367     -13.008 -64.384   0.791  1.00  0.84           C
ATOM   2909  CE2 PHE B 367     -12.898 -63.896  -1.575  1.00  0.84           C
ATOM   2910  CZ  PHE B 367     -13.575 -63.819  -0.354  1.00  0.84           C
ATOM   2911  N   TYR B 368      -9.641 -66.940   2.690  1.00  0.89           N
ATOM   2912  CA  TYR B 368     -10.228 -67.960   3.533  1.00  0.89           C
ATOM   2913  C   TYR B 368     -11.623 -68.403   3.085  1.00  0.89           C
ATOM   2914  O   TYR B 368     -12.464 -67.595   2.700  1.00  0.89           O
ATOM   2915  CB  TYR B 368     -10.205 -67.506   5.020  1.00  0.89           C
ATOM   2916  CG  TYR B 368     -10.371 -68.654   5.998  1.00  0.89           C
ATOM   2917  CD1 TYR B 368      -9.245 -69.343   6.475  1.00  0.89           C
ATOM   2918  CD2 TYR B 368     -11.638 -69.071   6.445  1.00  0.89           C
ATOM   2919  CE1 TYR B 368      -9.389 -70.424   7.357  1.00  0.89           C
ATOM   2920  CE2 TYR B 368     -11.792 -70.186   7.277  1.00  0.89           C
ATOM   2921  CZ  TYR B 368     -10.661 -70.866   7.731  1.00  0.89           C
ATOM   2922  OH  TYR B 368     -10.812 -71.996   8.555  1.00  0.89           O
ATOM   2923  N   SER B 369     -11.876 -69.717   3.133  1.00  0.89           N
ATOM   2924  CA  SER B 369     -13.203 -70.295   3.029  1.00  0.89           C
ATOM   2925  C   SER B 369     -13.169 -71.509   3.913  1.00  0.89           C
ATOM   2926  O   SER B 369     -12.220 -72.292   3.861  1.00  0.89           O
ATOM   2927  CB  SER B 369     -13.560 -70.732   1.577  1.00  0.89           C
ATOM   2928  OG  SER B 369     -14.658 -71.653   1.495  1.00  0.89           O
ATOM   2929  N   TYR B 370     -14.199 -71.733   4.752  1.00  0.89           N
ATOM   2930  CA  TYR B 370     -14.225 -72.857   5.670  1.00  0.89           C
ATOM   2931  C   TYR B 370     -14.173 -74.181   4.941  1.00  0.89           C
ATOM   2932  O   TYR B 370     -13.493 -75.112   5.364  1.00  0.89           O
ATOM   2933  CB  TYR B 370     -15.470 -72.786   6.587  1.00  0.89           C
ATOM   2934  CG  TYR B 370     -15.505 -73.883   7.624  1.00  0.89           C
ATOM   2935  CD1 TYR B 370     -14.856 -73.723   8.857  1.00  0.89           C
ATOM   2936  CD2 TYR B 370     -16.199 -75.079   7.371  1.00  0.89           C
ATOM   2937  CE1 TYR B 370     -14.934 -74.717   9.839  1.00  0.89           C
ATOM   2938  CE2 TYR B 370     -16.265 -76.083   8.347  1.00  0.89           C
ATOM   2939  CZ  TYR B 370     -15.633 -75.898   9.580  1.00  0.89           C
ATOM   2940  OH  TYR B 370     -15.696 -76.897  10.565  1.00  0.89           O
ATOM   2941  N   ALA B 371     -14.864 -74.253   3.790  1.00  0.91           N
ATOM   2942  CA  ALA B 371     -14.909 -75.419   2.945  1.00  0.91           C
ATOM   2943  C   ALA B 371     -13.544 -75.863   2.439  1.00  0.91           C
ATOM   2944  O   ALA B 371     -13.262 -77.051   2.331  1.00  0.91           O
ATOM   2945  CB  ALA B 371     -15.856 -75.134   1.768  1.00  0.91           C
ATOM   2946  N   THR B 372     -12.648 -74.914   2.121  1.00  0.91           N
ATOM   2947  CA  THR B 372     -11.344 -75.256   1.578  1.00  0.91           C
ATOM   2948  C   THR B 372     -10.267 -75.297   2.642  1.00  0.91           C
ATOM   2949  O   THR B 372      -9.195 -75.880   2.434  1.00  0.91           O
ATOM   2950  CB  THR B 372     -10.863 -74.243   0.533  1.00  0.91           C
ATOM   2951  OG1 THR B 372     -11.943 -73.497  -0.015  1.00  0.91           O
ATOM   2952  CG2 THR B 372     -10.206 -75.004  -0.626  1.00  0.91           C
ATOM   2953  N   HIS B 373     -10.484 -74.650   3.807  1.00  0.86           N
ATOM   2954  CA  HIS B 373      -9.389 -74.372   4.722  1.00  0.86           C
ATOM   2955  C   HIS B 373      -9.539 -74.839   6.155  1.00  0.86           C
ATOM   2956  O   HIS B 373      -8.603 -74.670   6.931  1.00  0.86           O
ATOM   2957  CB  HIS B 373      -9.045 -72.867   4.715  1.00  0.86           C
ATOM   2958  CG  HIS B 373      -8.538 -72.395   3.383  1.00  0.86           C
ATOM   2959  ND1 HIS B 373      -8.810 -71.108   2.981  1.00  0.86           N
ATOM   2960  CD2 HIS B 373      -7.742 -73.010   2.467  1.00  0.86           C
ATOM   2961  CE1 HIS B 373      -8.185 -70.957   1.830  1.00  0.86           C
ATOM   2962  NE2 HIS B 373      -7.520 -72.081   1.471  1.00  0.86           N
ATOM   2963  N   SER B 374     -10.636 -75.514   6.548  1.00  0.86           N
ATOM   2964  CA  SER B 374     -10.791 -76.063   7.896  1.00  0.86           C
ATOM   2965  C   SER B 374      -9.724 -77.087   8.258  1.00  0.86           C
ATOM   2966  O   SER B 374      -9.118 -77.033   9.325  1.00  0.86           O
ATOM   2967  CB  SER B 374     -12.187 -76.710   8.067  1.00  0.86           C
ATOM   2968  OG  SER B 374     -12.401 -77.709   7.069  1.00  0.86           O
ATOM   2969  N   ASP B 375      -9.413 -77.978   7.304  1.00  0.86           N
ATOM   2970  CA  ASP B 375      -8.328 -78.929   7.343  1.00  0.86           C
ATOM   2971  C   ASP B 375      -6.948 -78.348   7.647  1.00  0.86           C
ATOM   2972  O   ASP B 375      -6.126 -78.977   8.300  1.00  0.86           O
ATOM   2973  CB  ASP B 375      -8.149 -79.507   5.924  1.00  0.86           C
ATOM   2974  CG  ASP B 375      -9.288 -80.375   5.431  1.00  0.86           C
ATOM   2975  OD1 ASP B 375     -10.090 -80.870   6.254  1.00  0.86           O
ATOM   2976  OD2 ASP B 375      -9.328 -80.532   4.181  1.00  0.86           O
ATOM   2977  N   LYS B 376      -6.620 -77.158   7.097  1.00  0.83           N
ATOM   2978  CA  LYS B 376      -5.233 -76.798   6.851  1.00  0.83           C
ATOM   2979  C   LYS B 376      -4.639 -75.937   7.945  1.00  0.83           C
ATOM   2980  O   LYS B 376      -3.440 -75.680   7.953  1.00  0.83           O
ATOM   2981  CB  LYS B 376      -5.115 -75.969   5.537  1.00  0.83           C
ATOM   2982  CG  LYS B 376      -5.949 -76.449   4.331  1.00  0.83           C
ATOM   2983  CD  LYS B 376      -5.499 -77.781   3.715  1.00  0.83           C
ATOM   2984  CE  LYS B 376      -6.548 -78.480   2.827  1.00  0.83           C
ATOM   2985  NZ  LYS B 376      -7.140 -77.593   1.801  1.00  0.83           N
ATOM   2986  N   PHE B 377      -5.480 -75.477   8.882  1.00  0.86           N
ATOM   2987  CA  PHE B 377      -5.103 -74.552   9.934  1.00  0.86           C
ATOM   2988  C   PHE B 377      -5.404 -75.202  11.279  1.00  0.86           C
ATOM   2989  O   PHE B 377      -5.931 -74.587  12.208  1.00  0.86           O
ATOM   2990  CB  PHE B 377      -5.845 -73.189   9.809  1.00  0.86           C
ATOM   2991  CG  PHE B 377      -5.360 -72.358   8.647  1.00  0.86           C
ATOM   2992  CD1 PHE B 377      -5.725 -72.668   7.327  1.00  0.86           C
ATOM   2993  CD2 PHE B 377      -4.582 -71.211   8.875  1.00  0.86           C
ATOM   2994  CE1 PHE B 377      -5.311 -71.864   6.257  1.00  0.86           C
ATOM   2995  CE2 PHE B 377      -4.156 -70.411   7.808  1.00  0.86           C
ATOM   2996  CZ  PHE B 377      -4.516 -70.740   6.499  1.00  0.86           C
ATOM   2997  N   THR B 378      -5.117 -76.510  11.398  1.00  0.86           N
ATOM   2998  CA  THR B 378      -5.315 -77.286  12.609  1.00  0.86           C
ATOM   2999  C   THR B 378      -4.332 -76.938  13.706  1.00  0.86           C
ATOM   3000  O   THR B 378      -4.683 -76.936  14.883  1.00  0.86           O
ATOM   3001  CB  THR B 378      -5.267 -78.794  12.377  1.00  0.86           C
ATOM   3002  OG1 THR B 378      -4.108 -79.156  11.637  1.00  0.86           O
ATOM   3003  CG2 THR B 378      -6.493 -79.228  11.558  1.00  0.86           C
ATOM   3004  N   ASP B 379      -3.059 -76.674  13.365  1.00  0.89           N
ATOM   3005  CA  ASP B 379      -2.033 -76.327  14.317  1.00  0.89           C
ATOM   3006  C   ASP B 379      -2.156 -74.910  14.898  1.00  0.89           C
ATOM   3007  O   ASP B 379      -2.489 -73.934  14.235  1.00  0.89           O
ATOM   3008  CB  ASP B 379      -0.642 -76.592  13.693  1.00  0.89           C
ATOM   3009  CG  ASP B 379      -0.537 -75.808  12.395  1.00  0.89           C
ATOM   3010  OD1 ASP B 379      -0.013 -74.668  12.426  1.00  0.89           O
ATOM   3011  OD2 ASP B 379      -1.047 -76.327  11.373  1.00  0.89           O
ATOM   3012  N   GLY B 380      -1.850 -74.769  16.207  1.00  0.94           N
ATOM   3013  CA  GLY B 380      -1.919 -73.487  16.904  1.00  0.94           C
ATOM   3014  C   GLY B 380      -3.278 -72.833  17.025  1.00  0.94           C
ATOM   3015  O   GLY B 380      -4.277 -73.470  17.351  1.00  0.94           O
ATOM   3016  N   VAL B 381      -3.323 -71.499  16.850  1.00  0.95           N
ATOM   3017  CA  VAL B 381      -4.553 -70.730  16.942  1.00  0.95           C
ATOM   3018  C   VAL B 381      -4.690 -69.838  15.729  1.00  0.95           C
ATOM   3019  O   VAL B 381      -3.702 -69.415  15.125  1.00  0.95           O
ATOM   3020  CB  VAL B 381      -4.632 -69.891  18.221  1.00  0.95           C
ATOM   3021  CG1 VAL B 381      -3.809 -68.591  18.127  1.00  0.95           C
ATOM   3022  CG2 VAL B 381      -6.092 -69.581  18.607  1.00  0.95           C
ATOM   3023  N   CYS B 382      -5.929 -69.494  15.347  1.00  0.94           N
ATOM   3024  CA  CYS B 382      -6.190 -68.579  14.261  1.00  0.94           C
ATOM   3025  C   CYS B 382      -6.739 -67.286  14.817  1.00  0.94           C
ATOM   3026  O   CYS B 382      -7.543 -67.268  15.748  1.00  0.94           O
ATOM   3027  CB  CYS B 382      -7.181 -69.163  13.229  1.00  0.94           C
ATOM   3028  SG  CYS B 382      -6.479 -70.651  12.453  1.00  0.94           S
ATOM   3029  N   LEU B 383      -6.300 -66.152  14.268  1.00  0.94           N
ATOM   3030  CA  LEU B 383      -6.790 -64.851  14.651  1.00  0.94           C
ATOM   3031  C   LEU B 383      -7.436 -64.221  13.441  1.00  0.94           C
ATOM   3032  O   LEU B 383      -6.860 -64.188  12.357  1.00  0.94           O
ATOM   3033  CB  LEU B 383      -5.632 -63.958  15.151  1.00  0.94           C
ATOM   3034  CG  LEU B 383      -5.987 -62.486  15.454  1.00  0.94           C
ATOM   3035  CD1 LEU B 383      -6.891 -62.327  16.682  1.00  0.94           C
ATOM   3036  CD2 LEU B 383      -4.704 -61.677  15.662  1.00  0.94           C
ATOM   3037  N   PHE B 384      -8.667 -63.703  13.592  1.00  0.93           N
ATOM   3038  CA  PHE B 384      -9.300 -62.951  12.527  1.00  0.93           C
ATOM   3039  C   PHE B 384      -9.738 -61.623  13.117  1.00  0.93           C
ATOM   3040  O   PHE B 384     -10.740 -61.553  13.825  1.00  0.93           O
ATOM   3041  CB  PHE B 384     -10.567 -63.666  11.962  1.00  0.93           C
ATOM   3042  CG  PHE B 384     -10.320 -65.057  11.448  1.00  0.93           C
ATOM   3043  CD1 PHE B 384     -10.266 -66.116  12.363  1.00  0.93           C
ATOM   3044  CD2 PHE B 384     -10.244 -65.350  10.074  1.00  0.93           C
ATOM   3045  CE1 PHE B 384     -10.106 -67.435  11.930  1.00  0.93           C
ATOM   3046  CE2 PHE B 384     -10.076 -66.672   9.635  1.00  0.93           C
ATOM   3047  CZ  PHE B 384      -9.997 -67.715  10.565  1.00  0.93           C
ATOM   3048  N   TRP B 385      -9.035 -60.501  12.875  1.00  0.90           N
ATOM   3049  CA  TRP B 385      -9.448 -59.252  13.501  1.00  0.90           C
ATOM   3050  C   TRP B 385     -10.056 -58.307  12.489  1.00  0.90           C
ATOM   3051  O   TRP B 385      -9.375 -57.619  11.736  1.00  0.90           O
ATOM   3052  CB  TRP B 385      -8.305 -58.605  14.313  1.00  0.90           C
ATOM   3053  CG  TRP B 385      -8.788 -57.576  15.329  1.00  0.90           C
ATOM   3054  CD1 TRP B 385      -8.874 -56.217  15.211  1.00  0.90           C
ATOM   3055  CD2 TRP B 385      -9.283 -57.907  16.634  1.00  0.90           C
ATOM   3056  NE1 TRP B 385      -9.404 -55.676  16.360  1.00  0.90           N
ATOM   3057  CE2 TRP B 385      -9.675 -56.685  17.245  1.00  0.90           C
ATOM   3058  CE3 TRP B 385      -9.408 -59.117  17.309  1.00  0.90           C
ATOM   3059  CZ2 TRP B 385     -10.210 -56.670  18.521  1.00  0.90           C
ATOM   3060  CZ3 TRP B 385      -9.920 -59.091  18.612  1.00  0.90           C
ATOM   3061  CH2 TRP B 385     -10.321 -57.884  19.208  1.00  0.90           C
ATOM   3062  N   ASN B 386     -11.406 -58.293  12.465  1.00  0.91           N
ATOM   3063  CA  ASN B 386     -12.235 -57.616  11.485  1.00  0.91           C
ATOM   3064  C   ASN B 386     -12.067 -58.229  10.115  1.00  0.91           C
ATOM   3065  O   ASN B 386     -12.272 -57.594   9.084  1.00  0.91           O
ATOM   3066  CB  ASN B 386     -12.041 -56.082  11.426  1.00  0.91           C
ATOM   3067  CG  ASN B 386     -12.501 -55.437  12.718  1.00  0.91           C
ATOM   3068  OD1 ASN B 386     -12.948 -56.073  13.676  1.00  0.91           O
ATOM   3069  ND2 ASN B 386     -12.423 -54.088  12.766  1.00  0.91           N
ATOM   3070  N   CYS B 387     -11.743 -59.526  10.088  1.00  0.94           N
ATOM   3071  CA  CYS B 387     -11.747 -60.316   8.890  1.00  0.94           C
ATOM   3072  C   CYS B 387     -13.034 -61.123   8.872  1.00  0.94           C
ATOM   3073  O   CYS B 387     -13.313 -61.936   9.760  1.00  0.94           O
ATOM   3074  CB  CYS B 387     -10.489 -61.193   8.859  1.00  0.94           C
ATOM   3075  SG  CYS B 387     -10.378 -62.284   7.402  1.00  0.94           S
ATOM   3076  N   ASN B 388     -13.901 -60.868   7.876  1.00  0.86           N
ATOM   3077  CA  ASN B 388     -15.299 -61.229   7.972  1.00  0.86           C
ATOM   3078  C   ASN B 388     -15.603 -62.371   7.018  1.00  0.86           C
ATOM   3079  O   ASN B 388     -15.708 -62.166   5.809  1.00  0.86           O
ATOM   3080  CB  ASN B 388     -16.212 -60.023   7.615  1.00  0.86           C
ATOM   3081  CG  ASN B 388     -15.773 -58.723   8.290  1.00  0.86           C
ATOM   3082  OD1 ASN B 388     -15.992 -58.500   9.483  1.00  0.86           O
ATOM   3083  ND2 ASN B 388     -15.164 -57.812   7.495  1.00  0.86           N
ATOM   3084  N   VAL B 389     -15.763 -63.602   7.536  1.00  0.87           N
ATOM   3085  CA  VAL B 389     -15.724 -64.793   6.705  1.00  0.87           C
ATOM   3086  C   VAL B 389     -16.965 -65.620   6.987  1.00  0.87           C
ATOM   3087  O   VAL B 389     -17.734 -65.302   7.901  1.00  0.87           O
ATOM   3088  CB  VAL B 389     -14.446 -65.610   6.924  1.00  0.87           C
ATOM   3089  CG1 VAL B 389     -14.138 -66.424   5.658  1.00  0.87           C
ATOM   3090  CG2 VAL B 389     -13.270 -64.670   7.263  1.00  0.87           C
ATOM   3091  N   ASP B 390     -17.227 -66.671   6.188  1.00  0.81           N
ATOM   3092  CA  ASP B 390     -18.064 -67.802   6.523  1.00  0.81           C
ATOM   3093  C   ASP B 390     -17.575 -68.550   7.779  1.00  0.81           C
ATOM   3094  O   ASP B 390     -16.710 -68.070   8.507  1.00  0.81           O
ATOM   3095  CB  ASP B 390     -18.247 -68.718   5.288  1.00  0.81           C
ATOM   3096  CG  ASP B 390     -16.908 -69.142   4.711  1.00  0.81           C
ATOM   3097  OD1 ASP B 390     -16.591 -70.353   4.789  1.00  0.81           O
ATOM   3098  OD2 ASP B 390     -16.187 -68.260   4.186  1.00  0.81           O
ATOM   3099  N   ARG B 391     -18.167 -69.720   8.130  1.00  0.76           N
ATOM   3100  CA  ARG B 391     -18.038 -70.247   9.485  1.00  0.76           C
ATOM   3101  C   ARG B 391     -16.624 -70.461  10.006  1.00  0.76           C
ATOM   3102  O   ARG B 391     -15.731 -70.928   9.313  1.00  0.76           O
ATOM   3103  CB  ARG B 391     -19.010 -71.433   9.792  1.00  0.76           C
ATOM   3104  CG  ARG B 391     -18.423 -72.858   9.842  1.00  0.76           C
ATOM   3105  CD  ARG B 391     -19.465 -73.924  10.226  1.00  0.76           C
ATOM   3106  NE  ARG B 391     -20.008 -74.540   8.970  1.00  0.76           N
ATOM   3107  CZ  ARG B 391     -21.304 -74.645   8.644  1.00  0.76           C
ATOM   3108  NH1 ARG B 391     -22.265 -74.014   9.312  1.00  0.76           N
ATOM   3109  NH2 ARG B 391     -21.640 -75.417   7.608  1.00  0.76           N
ATOM   3110  N   TYR B 392     -16.362 -70.058  11.262  1.00  0.89           N
ATOM   3111  CA  TYR B 392     -15.004 -69.963  11.755  1.00  0.89           C
ATOM   3112  C   TYR B 392     -14.449 -71.313  12.246  1.00  0.89           C
ATOM   3113  O   TYR B 392     -15.199 -72.110  12.817  1.00  0.89           O
ATOM   3114  CB  TYR B 392     -14.908 -68.882  12.873  1.00  0.89           C
ATOM   3115  CG  TYR B 392     -15.113 -67.466  12.340  1.00  0.89           C
ATOM   3116  CD1 TYR B 392     -14.335 -66.991  11.269  1.00  0.89           C
ATOM   3117  CD2 TYR B 392     -16.083 -66.596  12.877  1.00  0.89           C
ATOM   3118  CE1 TYR B 392     -14.515 -65.698  10.749  1.00  0.89           C
ATOM   3119  CE2 TYR B 392     -16.270 -65.310  12.341  1.00  0.89           C
ATOM   3120  CZ  TYR B 392     -15.472 -64.835  11.298  1.00  0.89           C
ATOM   3121  OH  TYR B 392     -15.627 -63.496  10.845  1.00  0.89           O
ATOM   3122  N   PRO B 393     -13.154 -71.626  12.030  1.00  0.92           N
ATOM   3123  CA  PRO B 393     -12.465 -72.770  12.637  1.00  0.92           C
ATOM   3124  C   PRO B 393     -12.560 -72.803  14.144  1.00  0.92           C
ATOM   3125  O   PRO B 393     -12.675 -71.759  14.774  1.00  0.92           O
ATOM   3126  CB  PRO B 393     -11.014 -72.636  12.152  1.00  0.92           C
ATOM   3127  CG  PRO B 393     -10.816 -71.134  11.968  1.00  0.92           C
ATOM   3128  CD  PRO B 393     -12.187 -70.663  11.493  1.00  0.92           C
ATOM   3129  N   ALA B 394     -12.522 -74.007  14.741  1.00  0.91           N
ATOM   3130  CA  ALA B 394     -12.769 -74.228  16.147  1.00  0.91           C
ATOM   3131  C   ALA B 394     -11.787 -73.506  17.066  1.00  0.91           C
ATOM   3132  O   ALA B 394     -12.148 -72.932  18.091  1.00  0.91           O
ATOM   3133  CB  ALA B 394     -12.768 -75.753  16.387  1.00  0.91           C
ATOM   3134  N   ASN B 395     -10.508 -73.505  16.674  1.00  0.89           N
ATOM   3135  CA  ASN B 395      -9.395 -72.860  17.338  1.00  0.89           C
ATOM   3136  C   ASN B 395      -9.160 -71.415  16.904  1.00  0.89           C
ATOM   3137  O   ASN B 395      -8.181 -71.091  16.238  1.00  0.89           O
ATOM   3138  CB  ASN B 395      -8.107 -73.685  17.095  1.00  0.89           C
ATOM   3139  CG  ASN B 395      -7.978 -74.113  15.628  1.00  0.89           C
ATOM   3140  OD1 ASN B 395      -8.683 -75.033  15.190  1.00  0.89           O
ATOM   3141  ND2 ASN B 395      -7.121 -73.430  14.842  1.00  0.89           N
ATOM   3142  N   SER B 396     -10.041 -70.488  17.308  1.00  0.93           N
ATOM   3143  CA  SER B 396     -10.028 -69.137  16.777  1.00  0.93           C
ATOM   3144  C   SER B 396     -10.240 -68.055  17.822  1.00  0.93           C
ATOM   3145  O   SER B 396     -10.904 -68.257  18.833  1.00  0.93           O
ATOM   3146  CB  SER B 396     -11.109 -68.972  15.685  1.00  0.93           C
ATOM   3147  OG  SER B 396     -10.999 -67.718  15.018  1.00  0.93           O
ATOM   3148  N   ILE B 397      -9.670 -66.862  17.582  1.00  0.94           N
ATOM   3149  CA  ILE B 397      -9.921 -65.621  18.303  1.00  0.94           C
ATOM   3150  C   ILE B 397     -10.404 -64.630  17.251  1.00  0.94           C
ATOM   3151  O   ILE B 397      -9.690 -64.334  16.294  1.00  0.94           O
ATOM   3152  CB  ILE B 397      -8.649 -65.060  18.953  1.00  0.94           C
ATOM   3153  CG1 ILE B 397      -8.002 -66.087  19.906  1.00  0.94           C
ATOM   3154  CG2 ILE B 397      -8.912 -63.732  19.708  1.00  0.94           C
ATOM   3155  CD1 ILE B 397      -6.485 -65.904  20.021  1.00  0.94           C
ATOM   3156  N   VAL B 398     -11.631 -64.084  17.358  1.00  0.94           N
ATOM   3157  CA  VAL B 398     -12.160 -63.261  16.278  1.00  0.94           C
ATOM   3158  C   VAL B 398     -13.003 -62.111  16.770  1.00  0.94           C
ATOM   3159  O   VAL B 398     -13.808 -62.220  17.697  1.00  0.94           O
ATOM   3160  CB  VAL B 398     -12.881 -64.066  15.186  1.00  0.94           C
ATOM   3161  CG1 VAL B 398     -13.953 -64.987  15.773  1.00  0.94           C
ATOM   3162  CG2 VAL B 398     -13.538 -63.179  14.106  1.00  0.94           C
ATOM   3163  N   CYS B 399     -12.809 -60.947  16.121  1.00  0.95           N
ATOM   3164  CA  CYS B 399     -13.660 -59.791  16.252  1.00  0.95           C
ATOM   3165  C   CYS B 399     -14.410 -59.618  14.946  1.00  0.95           C
ATOM   3166  O   CYS B 399     -13.817 -59.571  13.867  1.00  0.95           O
ATOM   3167  CB  CYS B 399     -12.836 -58.522  16.548  1.00  0.95           C
ATOM   3168  SG  CYS B 399     -13.866 -57.056  16.881  1.00  0.95           S
ATOM   3169  N   ARG B 400     -15.750 -59.554  15.021  1.00  0.86           N
ATOM   3170  CA  ARG B 400     -16.612 -59.373  13.873  1.00  0.86           C
ATOM   3171  C   ARG B 400     -17.586 -58.267  14.208  1.00  0.86           C
ATOM   3172  O   ARG B 400     -18.124 -58.204  15.311  1.00  0.86           O
ATOM   3173  CB  ARG B 400     -17.409 -60.669  13.545  1.00  0.86           C
ATOM   3174  CG  ARG B 400     -18.495 -60.566  12.439  1.00  0.86           C
ATOM   3175  CD  ARG B 400     -18.007 -60.404  10.990  1.00  0.86           C
ATOM   3176  NE  ARG B 400     -18.183 -61.703  10.240  1.00  0.86           N
ATOM   3177  CZ  ARG B 400     -19.308 -62.062   9.598  1.00  0.86           C
ATOM   3178  NH1 ARG B 400     -20.375 -61.268   9.548  1.00  0.86           N
ATOM   3179  NH2 ARG B 400     -19.362 -63.249   8.998  1.00  0.86           N
ATOM   3180  N   PHE B 401     -17.842 -57.355  13.260  1.00  0.92           N
ATOM   3181  CA  PHE B 401     -18.887 -56.355  13.368  1.00  0.92           C
ATOM   3182  C   PHE B 401     -20.313 -56.965  13.362  1.00  0.92           C
ATOM   3183  O   PHE B 401     -20.626 -57.757  12.470  1.00  0.92           O
ATOM   3184  CB  PHE B 401     -18.698 -55.393  12.162  1.00  0.92           C
ATOM   3185  CG  PHE B 401     -19.290 -54.055  12.455  1.00  0.92           C
ATOM   3186  CD1 PHE B 401     -20.651 -53.814  12.238  1.00  0.92           C
ATOM   3187  CD2 PHE B 401     -18.495 -53.044  13.015  1.00  0.92           C
ATOM   3188  CE1 PHE B 401     -21.221 -52.598  12.626  1.00  0.92           C
ATOM   3189  CE2 PHE B 401     -19.066 -51.837  13.427  1.00  0.92           C
ATOM   3190  CZ  PHE B 401     -20.434 -51.616  13.238  1.00  0.92           C
ATOM   3191  N   ASP B 402     -21.220 -56.625  14.316  1.00  0.91           N
ATOM   3192  CA  ASP B 402     -22.636 -56.984  14.209  1.00  0.91           C
ATOM   3193  C   ASP B 402     -23.359 -55.954  13.336  1.00  0.91           C
ATOM   3194  O   ASP B 402     -23.458 -54.776  13.664  1.00  0.91           O
ATOM   3195  CB  ASP B 402     -23.337 -57.221  15.596  1.00  0.91           C
ATOM   3196  CG  ASP B 402     -24.716 -57.870  15.510  1.00  0.91           C
ATOM   3197  OD1 ASP B 402     -25.363 -57.803  14.441  1.00  0.91           O
ATOM   3198  OD2 ASP B 402     -25.194 -58.448  16.518  1.00  0.91           O
ATOM   3199  N   THR B 403     -23.897 -56.401  12.177  1.00  0.89           N
ATOM   3200  CA  THR B 403     -24.595 -55.549  11.219  1.00  0.89           C
ATOM   3201  C   THR B 403     -25.949 -55.129  11.726  1.00  0.89           C
ATOM   3202  O   THR B 403     -26.569 -54.210  11.194  1.00  0.89           O
ATOM   3203  CB  THR B 403     -24.817 -56.174   9.832  1.00  0.89           C
ATOM   3204  OG1 THR B 403     -25.531 -57.412   9.853  1.00  0.89           O
ATOM   3205  CG2 THR B 403     -23.457 -56.430   9.169  1.00  0.89           C
ATOM   3206  N   ARG B 404     -26.467 -55.797  12.768  1.00  0.79           N
ATOM   3207  CA  ARG B 404     -27.780 -55.530  13.289  1.00  0.79           C
ATOM   3208  C   ARG B 404     -27.862 -54.279  14.138  1.00  0.79           C
ATOM   3209  O   ARG B 404     -28.891 -53.610  14.179  1.00  0.79           O
ATOM   3210  CB  ARG B 404     -28.245 -56.747  14.101  1.00  0.79           C
ATOM   3211  CG  ARG B 404     -28.203 -58.038  13.259  1.00  0.79           C
ATOM   3212  CD  ARG B 404     -28.608 -59.280  14.041  1.00  0.79           C
ATOM   3213  NE  ARG B 404     -27.650 -59.426  15.175  1.00  0.79           N
ATOM   3214  CZ  ARG B 404     -27.879 -60.151  16.274  1.00  0.79           C
ATOM   3215  NH1 ARG B 404     -28.901 -61.002  16.331  1.00  0.79           N
ATOM   3216  NH2 ARG B 404     -27.059 -60.006  17.303  1.00  0.79           N
ATOM   3217  N   VAL B 405     -26.782 -53.946  14.874  1.00  0.90           N
ATOM   3218  CA  VAL B 405     -26.775 -52.786  15.744  1.00  0.90           C
ATOM   3219  C   VAL B 405     -26.744 -51.480  14.967  1.00  0.90           C
ATOM   3220  O   VAL B 405     -26.267 -51.404  13.835  1.00  0.90           O
ATOM   3221  CB  VAL B 405     -25.698 -52.781  16.826  1.00  0.90           C
ATOM   3222  CG1 VAL B 405     -25.589 -54.174  17.477  1.00  0.90           C
ATOM   3223  CG2 VAL B 405     -24.335 -52.329  16.275  1.00  0.90           C
ATOM   3224  N   LEU B 406     -27.240 -50.382  15.565  1.00  0.83           N
ATOM   3225  CA  LEU B 406     -27.280 -49.115  14.870  1.00  0.83           C
ATOM   3226  C   LEU B 406     -26.443 -48.073  15.584  1.00  0.83           C
ATOM   3227  O   LEU B 406     -26.601 -47.789  16.770  1.00  0.83           O
ATOM   3228  CB  LEU B 406     -28.734 -48.632  14.657  1.00  0.83           C
ATOM   3229  CG  LEU B 406     -29.052 -48.097  13.238  1.00  0.83           C
ATOM   3230  CD1 LEU B 406     -28.157 -46.921  12.821  1.00  0.83           C
ATOM   3231  CD2 LEU B 406     -29.024 -49.213  12.180  1.00  0.83           C
ATOM   3232  N   SER B 407     -25.508 -47.467  14.843  1.00  0.81           N
ATOM   3233  CA  SER B 407     -24.662 -46.389  15.295  1.00  0.81           C
ATOM   3234  C   SER B 407     -24.629 -45.416  14.154  1.00  0.81           C
ATOM   3235  O   SER B 407     -24.982 -45.769  13.031  1.00  0.81           O
ATOM   3236  CB  SER B 407     -23.203 -46.818  15.652  1.00  0.81           C
ATOM   3237  OG  SER B 407     -22.460 -47.319  14.534  1.00  0.81           O
ATOM   3238  N   ASN B 408     -24.193 -44.160  14.390  1.00  0.81           N
ATOM   3239  CA  ASN B 408     -24.094 -43.175  13.322  1.00  0.81           C
ATOM   3240  C   ASN B 408     -23.109 -43.594  12.226  1.00  0.81           C
ATOM   3241  O   ASN B 408     -23.300 -43.304  11.052  1.00  0.81           O
ATOM   3242  CB  ASN B 408     -23.869 -41.736  13.878  1.00  0.81           C
ATOM   3243  CG  ASN B 408     -22.417 -41.432  14.226  1.00  0.81           C
ATOM   3244  OD1 ASN B 408     -21.634 -41.015  13.378  1.00  0.81           O
ATOM   3245  ND2 ASN B 408     -22.023 -41.648  15.496  1.00  0.81           N
ATOM   3246  N   LEU B 409     -22.054 -44.332  12.627  1.00  0.86           N
ATOM   3247  CA  LEU B 409     -21.043 -44.883  11.756  1.00  0.86           C
ATOM   3248  C   LEU B 409     -21.531 -45.883  10.704  1.00  0.86           C
ATOM   3249  O   LEU B 409     -20.955 -45.944   9.622  1.00  0.86           O
ATOM   3250  CB  LEU B 409     -19.917 -45.586  12.561  1.00  0.86           C
ATOM   3251  CG  LEU B 409     -19.046 -44.751  13.538  1.00  0.86           C
ATOM   3252  CD1 LEU B 409     -18.960 -43.254  13.216  1.00  0.86           C
ATOM   3253  CD2 LEU B 409     -19.397 -44.984  15.016  1.00  0.86           C
ATOM   3254  N   ASN B 410     -22.552 -46.740  10.972  1.00  0.88           N
ATOM   3255  CA  ASN B 410     -22.882 -47.817  10.035  1.00  0.88           C
ATOM   3256  C   ASN B 410     -24.185 -47.620   9.274  1.00  0.88           C
ATOM   3257  O   ASN B 410     -25.172 -47.095   9.787  1.00  0.88           O
ATOM   3258  CB  ASN B 410     -22.661 -49.262  10.581  1.00  0.88           C
ATOM   3259  CG  ASN B 410     -23.825 -49.960  11.277  1.00  0.88           C
ATOM   3260  OD1 ASN B 410     -23.956 -51.177  11.120  1.00  0.88           O
ATOM   3261  ND2 ASN B 410     -24.662 -49.228  12.029  1.00  0.88           N
ATOM   3262  N   LEU B 411     -24.175 -48.010   7.985  1.00  0.89           N
ATOM   3263  CA  LEU B 411     -25.183 -47.674   7.003  1.00  0.89           C
ATOM   3264  C   LEU B 411     -25.704 -48.956   6.342  1.00  0.89           C
ATOM   3265  O   LEU B 411     -24.918 -49.893   6.213  1.00  0.89           O
ATOM   3266  CB  LEU B 411     -24.543 -46.789   5.902  1.00  0.89           C
ATOM   3267  CG  LEU B 411     -23.594 -45.683   6.425  1.00  0.89           C
ATOM   3268  CD1 LEU B 411     -22.971 -44.908   5.259  1.00  0.89           C
ATOM   3269  CD2 LEU B 411     -24.248 -44.706   7.408  1.00  0.89           C
ATOM   3270  N   PRO B 412     -26.956 -49.104   5.886  1.00  0.92           N
ATOM   3271  CA  PRO B 412     -27.452 -50.360   5.296  1.00  0.92           C
ATOM   3272  C   PRO B 412     -26.745 -50.787   4.011  1.00  0.92           C
ATOM   3273  O   PRO B 412     -26.391 -49.903   3.230  1.00  0.92           O
ATOM   3274  CB  PRO B 412     -28.932 -50.053   4.982  1.00  0.92           C
ATOM   3275  CG  PRO B 412     -29.320 -48.934   5.954  1.00  0.92           C
ATOM   3276  CD  PRO B 412     -28.029 -48.132   6.109  1.00  0.92           C
ATOM   3277  N   GLY B 413     -26.552 -52.092   3.725  1.00  0.89           N
ATOM   3278  CA  GLY B 413     -25.955 -52.523   2.459  1.00  0.89           C
ATOM   3279  C   GLY B 413     -26.509 -53.815   1.907  1.00  0.89           C
ATOM   3280  O   GLY B 413     -27.605 -54.262   2.239  1.00  0.89           O
ATOM   3281  N   CYS B 414     -25.742 -54.458   1.012  1.00  0.90           N
ATOM   3282  CA  CYS B 414     -26.088 -55.734   0.419  1.00  0.90           C
ATOM   3283  C   CYS B 414     -25.371 -56.886   1.132  1.00  0.90           C
ATOM   3284  O   CYS B 414     -24.187 -56.807   1.424  1.00  0.90           O
ATOM   3285  CB  CYS B 414     -25.749 -55.747  -1.099  1.00  0.90           C
ATOM   3286  SG  CYS B 414     -24.118 -54.995  -1.455  1.00  0.90           S
ATOM   3287  N   ASP B 415     -26.034 -58.005   1.459  1.00  0.87           N
ATOM   3288  CA  ASP B 415     -27.447 -58.199   1.616  1.00  0.87           C
ATOM   3289  C   ASP B 415     -27.745 -58.580   3.056  1.00  0.87           C
ATOM   3290  O   ASP B 415     -27.434 -59.647   3.570  1.00  0.87           O
ATOM   3291  CB  ASP B 415     -27.930 -59.176   0.541  1.00  0.87           C
ATOM   3292  CG  ASP B 415     -27.291 -60.552   0.552  1.00  0.87           C
ATOM   3293  OD1 ASP B 415     -26.068 -60.688   0.788  1.00  0.87           O
ATOM   3294  OD2 ASP B 415     -28.063 -61.485   0.225  1.00  0.87           O
ATOM   3295  N   GLY B 416     -28.287 -57.598   3.808  1.00  0.88           N
ATOM   3296  CA  GLY B 416     -28.310 -57.635   5.272  1.00  0.88           C
ATOM   3297  C   GLY B 416     -26.965 -57.297   5.869  1.00  0.88           C
ATOM   3298  O   GLY B 416     -26.791 -57.210   7.085  1.00  0.88           O
ATOM   3299  N   GLY B 417     -25.973 -57.064   4.989  1.00  0.94           N
ATOM   3300  CA  GLY B 417     -24.712 -56.433   5.305  1.00  0.94           C
ATOM   3301  C   GLY B 417     -24.900 -55.007   5.729  1.00  0.94           C
ATOM   3302  O   GLY B 417     -25.883 -54.352   5.382  1.00  0.94           O
ATOM   3303  N   SER B 418     -23.918 -54.458   6.447  1.00  0.92           N
ATOM   3304  CA  SER B 418     -23.871 -53.035   6.714  1.00  0.92           C
ATOM   3305  C   SER B 418     -22.539 -52.501   6.252  1.00  0.92           C
ATOM   3306  O   SER B 418     -21.562 -53.225   6.062  1.00  0.92           O
ATOM   3307  CB  SER B 418     -24.216 -52.588   8.171  1.00  0.92           C
ATOM   3308  OG  SER B 418     -23.227 -52.925   9.146  1.00  0.92           O
ATOM   3309  N   LEU B 419     -22.482 -51.195   5.971  1.00  0.90           N
ATOM   3310  CA  LEU B 419     -21.280 -50.542   5.521  1.00  0.90           C
ATOM   3311  C   LEU B 419     -20.864 -49.609   6.625  1.00  0.90           C
ATOM   3312  O   LEU B 419     -21.575 -48.668   6.967  1.00  0.90           O
ATOM   3313  CB  LEU B 419     -21.551 -49.802   4.195  1.00  0.90           C
ATOM   3314  CG  LEU B 419     -20.356 -49.021   3.629  1.00  0.90           C
ATOM   3315  CD1 LEU B 419     -20.170 -49.310   2.141  1.00  0.90           C
ATOM   3316  CD2 LEU B 419     -20.561 -47.521   3.855  1.00  0.90           C
ATOM   3317  N   TYR B 420     -19.714 -49.893   7.258  1.00  0.88           N
ATOM   3318  CA  TYR B 420     -19.293 -49.201   8.455  1.00  0.88           C
ATOM   3319  C   TYR B 420     -18.293 -48.140   8.058  1.00  0.88           C
ATOM   3320  O   TYR B 420     -17.294 -48.404   7.388  1.00  0.88           O
ATOM   3321  CB  TYR B 420     -18.738 -50.223   9.489  1.00  0.88           C
ATOM   3322  CG  TYR B 420     -18.054 -49.626  10.701  1.00  0.88           C
ATOM   3323  CD1 TYR B 420     -16.673 -49.803  10.876  1.00  0.88           C
ATOM   3324  CD2 TYR B 420     -18.770 -48.939  11.694  1.00  0.88           C
ATOM   3325  CE1 TYR B 420     -16.025 -49.324  12.021  1.00  0.88           C
ATOM   3326  CE2 TYR B 420     -18.132 -48.504  12.869  1.00  0.88           C
ATOM   3327  CZ  TYR B 420     -16.755 -48.696  13.030  1.00  0.88           C
ATOM   3328  OH  TYR B 420     -16.087 -48.342  14.221  1.00  0.88           O
ATOM   3329  N   VAL B 421     -18.581 -46.889   8.446  1.00  0.88           N
ATOM   3330  CA  VAL B 421     -17.787 -45.745   8.089  1.00  0.88           C
ATOM   3331  C   VAL B 421     -17.198 -45.131   9.326  1.00  0.88           C
ATOM   3332  O   VAL B 421     -17.882 -44.694  10.244  1.00  0.88           O
ATOM   3333  CB  VAL B 421     -18.595 -44.655   7.397  1.00  0.88           C
ATOM   3334  CG1 VAL B 421     -17.658 -43.574   6.823  1.00  0.88           C
ATOM   3335  CG2 VAL B 421     -19.429 -45.290   6.280  1.00  0.88           C
ATOM   3336  N   ASN B 422     -15.872 -45.045   9.345  1.00  0.83           N
ATOM   3337  CA  ASN B 422     -15.145 -44.229  10.276  1.00  0.83           C
ATOM   3338  C   ASN B 422     -14.060 -43.549   9.475  1.00  0.83           C
ATOM   3339  O   ASN B 422     -14.162 -42.378   9.126  1.00  0.83           O
ATOM   3340  CB  ASN B 422     -14.616 -45.024  11.498  1.00  0.83           C
ATOM   3341  CG  ASN B 422     -13.996 -46.404  11.238  1.00  0.83           C
ATOM   3342  OD1 ASN B 422     -13.951 -46.904  10.134  1.00  0.83           O
ATOM   3343  ND2 ASN B 422     -13.518 -47.038  12.341  1.00  0.83           N
ATOM   3344  N   LYS B 423     -13.042 -44.308   9.044  1.00  0.80           N
ATOM   3345  CA  LYS B 423     -12.305 -43.972   7.853  1.00  0.80           C
ATOM   3346  C   LYS B 423     -12.162 -45.266   7.069  1.00  0.80           C
ATOM   3347  O   LYS B 423     -12.540 -46.323   7.544  1.00  0.80           O
ATOM   3348  CB  LYS B 423     -10.975 -43.224   8.101  1.00  0.80           C
ATOM   3349  CG  LYS B 423     -10.686 -42.026   7.162  1.00  0.80           C
ATOM   3350  CD  LYS B 423     -10.590 -42.344   5.658  1.00  0.80           C
ATOM   3351  CE  LYS B 423     -11.902 -42.340   4.878  1.00  0.80           C
ATOM   3352  NZ  LYS B 423     -11.790 -42.997   3.576  1.00  0.80           N
ATOM   3353  N   HIS B 424     -11.710 -45.217   5.806  1.00  0.70           N
ATOM   3354  CA  HIS B 424     -11.564 -46.333   4.886  1.00  0.70           C
ATOM   3355  C   HIS B 424     -12.698 -47.344   4.859  1.00  0.70           C
ATOM   3356  O   HIS B 424     -12.449 -48.536   4.977  1.00  0.70           O
ATOM   3357  CB  HIS B 424     -10.190 -46.963   5.151  1.00  0.70           C
ATOM   3358  CG  HIS B 424      -9.133 -45.884   5.152  1.00  0.70           C
ATOM   3359  ND1 HIS B 424      -8.500 -45.522   6.324  1.00  0.70           N
ATOM   3360  CD2 HIS B 424      -8.765 -45.040   4.149  1.00  0.70           C
ATOM   3361  CE1 HIS B 424      -7.751 -44.477   6.012  1.00  0.70           C
ATOM   3362  NE2 HIS B 424      -7.881 -44.143   4.709  1.00  0.70           N
ATOM   3363  N   ALA B 425     -13.965 -46.886   4.721  1.00  0.83           N
ATOM   3364  CA  ALA B 425     -15.153 -47.700   4.927  1.00  0.83           C
ATOM   3365  C   ALA B 425     -15.202 -49.092   4.298  1.00  0.83           C
ATOM   3366  O   ALA B 425     -15.134 -49.270   3.081  1.00  0.83           O
ATOM   3367  CB  ALA B 425     -16.449 -46.955   4.549  1.00  0.83           C
ATOM   3368  N   PHE B 426     -15.370 -50.117   5.152  1.00  0.83           N
ATOM   3369  CA  PHE B 426     -15.474 -51.495   4.730  1.00  0.83           C
ATOM   3370  C   PHE B 426     -16.924 -51.937   4.756  1.00  0.83           C
ATOM   3371  O   PHE B 426     -17.588 -51.974   5.793  1.00  0.83           O
ATOM   3372  CB  PHE B 426     -14.586 -52.518   5.518  1.00  0.83           C
ATOM   3373  CG  PHE B 426     -13.918 -51.959   6.744  1.00  0.83           C
ATOM   3374  CD1 PHE B 426     -12.776 -51.159   6.605  1.00  0.83           C
ATOM   3375  CD2 PHE B 426     -14.382 -52.258   8.037  1.00  0.83           C
ATOM   3376  CE1 PHE B 426     -12.139 -50.615   7.724  1.00  0.83           C
ATOM   3377  CE2 PHE B 426     -13.736 -51.730   9.165  1.00  0.83           C
ATOM   3378  CZ  PHE B 426     -12.624 -50.893   9.006  1.00  0.83           C
ATOM   3379  N   HIS B 427     -17.464 -52.305   3.577  1.00  0.86           N
ATOM   3380  CA  HIS B 427     -18.693 -53.067   3.483  1.00  0.86           C
ATOM   3381  C   HIS B 427     -18.484 -54.445   4.100  1.00  0.86           C
ATOM   3382  O   HIS B 427     -17.438 -55.061   3.883  1.00  0.86           O
ATOM   3383  CB  HIS B 427     -19.138 -53.213   2.012  1.00  0.86           C
ATOM   3384  CG  HIS B 427     -20.477 -53.856   1.863  1.00  0.86           C
ATOM   3385  ND1 HIS B 427     -20.670 -54.790   0.870  1.00  0.86           N
ATOM   3386  CD2 HIS B 427     -21.582 -53.757   2.643  1.00  0.86           C
ATOM   3387  CE1 HIS B 427     -21.884 -55.252   1.068  1.00  0.86           C
ATOM   3388  NE2 HIS B 427     -22.481 -54.660   2.131  1.00  0.86           N
ATOM   3389  N   THR B 428     -19.424 -54.954   4.920  1.00  0.90           N
ATOM   3390  CA  THR B 428     -19.217 -56.209   5.634  1.00  0.90           C
ATOM   3391  C   THR B 428     -20.351 -57.185   5.360  1.00  0.90           C
ATOM   3392  O   THR B 428     -21.500 -56.747   5.287  1.00  0.90           O
ATOM   3393  CB  THR B 428     -18.991 -56.037   7.152  1.00  0.90           C
ATOM   3394  OG1 THR B 428     -20.170 -56.182   7.936  1.00  0.90           O
ATOM   3395  CG2 THR B 428     -18.436 -54.639   7.458  1.00  0.90           C
ATOM   3396  N   PRO B 429     -20.128 -58.500   5.198  1.00  0.91           N
ATOM   3397  CA  PRO B 429     -21.181 -59.511   5.281  1.00  0.91           C
ATOM   3398  C   PRO B 429     -22.121 -59.379   6.461  1.00  0.91           C
ATOM   3399  O   PRO B 429     -21.688 -58.966   7.534  1.00  0.91           O
ATOM   3400  CB  PRO B 429     -20.431 -60.855   5.362  1.00  0.91           C
ATOM   3401  CG  PRO B 429     -19.076 -60.565   4.721  1.00  0.91           C
ATOM   3402  CD  PRO B 429     -18.806 -59.126   5.156  1.00  0.91           C
ATOM   3403  N   ALA B 430     -23.396 -59.779   6.319  1.00  0.92           N
ATOM   3404  CA  ALA B 430     -24.310 -59.827   7.441  1.00  0.92           C
ATOM   3405  C   ALA B 430     -23.830 -60.592   8.682  1.00  0.92           C
ATOM   3406  O   ALA B 430     -23.020 -61.524   8.622  1.00  0.92           O
ATOM   3407  CB  ALA B 430     -25.655 -60.425   7.011  1.00  0.92           C
ATOM   3408  N   PHE B 431     -24.312 -60.187   9.872  1.00  0.86           N
ATOM   3409  CA  PHE B 431     -24.051 -60.921  11.095  1.00  0.86           C
ATOM   3410  C   PHE B 431     -24.840 -62.233  11.127  1.00  0.86           C
ATOM   3411  O   PHE B 431     -26.070 -62.238  11.085  1.00  0.86           O
ATOM   3412  CB  PHE B 431     -24.327 -60.039  12.338  1.00  0.86           C
ATOM   3413  CG  PHE B 431     -24.005 -60.723  13.643  1.00  0.86           C
ATOM   3414  CD1 PHE B 431     -22.718 -60.664  14.203  1.00  0.86           C
ATOM   3415  CD2 PHE B 431     -25.019 -61.400  14.341  1.00  0.86           C
ATOM   3416  CE1 PHE B 431     -22.460 -61.249  15.451  1.00  0.86           C
ATOM   3417  CE2 PHE B 431     -24.761 -61.998  15.579  1.00  0.86           C
ATOM   3418  CZ  PHE B 431     -23.481 -61.917  16.137  1.00  0.86           C
ATOM   3419  N   ASP B 432     -24.126 -63.373  11.203  1.00  0.85           N
ATOM   3420  CA  ASP B 432     -24.708 -64.698  11.179  1.00  0.85           C
ATOM   3421  C   ASP B 432     -24.245 -65.498  12.390  1.00  0.85           C
ATOM   3422  O   ASP B 432     -23.058 -65.619  12.671  1.00  0.85           O
ATOM   3423  CB  ASP B 432     -24.313 -65.427   9.862  1.00  0.85           C
ATOM   3424  CG  ASP B 432     -24.809 -66.863   9.805  1.00  0.85           C
ATOM   3425  OD1 ASP B 432     -25.806 -67.172  10.513  1.00  0.85           O
ATOM   3426  OD2 ASP B 432     -24.124 -67.694   9.154  1.00  0.85           O
ATOM   3427  N   LYS B 433     -25.197 -66.129  13.109  1.00  0.83           N
ATOM   3428  CA  LYS B 433     -24.902 -67.040  14.195  1.00  0.83           C
ATOM   3429  C   LYS B 433     -24.273 -68.335  13.712  1.00  0.83           C
ATOM   3430  O   LYS B 433     -23.494 -68.965  14.422  1.00  0.83           O
ATOM   3431  CB  LYS B 433     -26.165 -67.374  15.017  1.00  0.83           C
ATOM   3432  CG  LYS B 433     -26.644 -66.223  15.916  1.00  0.83           C
ATOM   3433  CD  LYS B 433     -27.904 -66.638  16.695  1.00  0.83           C
ATOM   3434  CE  LYS B 433     -28.491 -65.549  17.598  1.00  0.83           C
ATOM   3435  NZ  LYS B 433     -29.677 -66.075  18.319  1.00  0.83           N
ATOM   3436  N   SER B 434     -24.566 -68.742  12.460  1.00  0.89           N
ATOM   3437  CA  SER B 434     -24.017 -69.941  11.847  1.00  0.89           C
ATOM   3438  C   SER B 434     -22.504 -69.876  11.663  1.00  0.89           C
ATOM   3439  O   SER B 434     -21.817 -70.900  11.674  1.00  0.89           O
ATOM   3440  CB  SER B 434     -24.772 -70.322  10.534  1.00  0.89           C
ATOM   3441  OG  SER B 434     -23.921 -70.590   9.409  1.00  0.89           O
ATOM   3442  N   ALA B 435     -21.937 -68.660  11.528  1.00  0.89           N
ATOM   3443  CA  ALA B 435     -20.510 -68.469  11.475  1.00  0.89           C
ATOM   3444  C   ALA B 435     -19.777 -68.723  12.795  1.00  0.89           C
ATOM   3445  O   ALA B 435     -18.579 -69.006  12.802  1.00  0.89           O
ATOM   3446  CB  ALA B 435     -20.143 -67.072  10.936  1.00  0.89           C
ATOM   3447  N   PHE B 436     -20.479 -68.663  13.946  1.00  0.88           N
ATOM   3448  CA  PHE B 436     -19.844 -68.720  15.258  1.00  0.88           C
ATOM   3449  C   PHE B 436     -20.083 -70.019  16.008  1.00  0.88           C
ATOM   3450  O   PHE B 436     -19.728 -70.136  17.175  1.00  0.88           O
ATOM   3451  CB  PHE B 436     -20.297 -67.567  16.180  1.00  0.88           C
ATOM   3452  CG  PHE B 436     -20.046 -66.242  15.533  1.00  0.88           C
ATOM   3453  CD1 PHE B 436     -18.752 -65.714  15.395  1.00  0.88           C
ATOM   3454  CD2 PHE B 436     -21.132 -65.498  15.065  1.00  0.88           C
ATOM   3455  CE1 PHE B 436     -18.562 -64.455  14.808  1.00  0.88           C
ATOM   3456  CE2 PHE B 436     -20.952 -64.234  14.503  1.00  0.88           C
ATOM   3457  CZ  PHE B 436     -19.665 -63.711  14.375  1.00  0.88           C
ATOM   3458  N   VAL B 437     -20.644 -71.049  15.349  1.00  0.91           N
ATOM   3459  CA  VAL B 437     -21.062 -72.318  15.946  1.00  0.91           C
ATOM   3460  C   VAL B 437     -19.960 -73.082  16.665  1.00  0.91           C
ATOM   3461  O   VAL B 437     -20.143 -73.678  17.730  1.00  0.91           O
ATOM   3462  CB  VAL B 437     -21.614 -73.204  14.830  1.00  0.91           C
ATOM   3463  CG1 VAL B 437     -21.819 -74.673  15.258  1.00  0.91           C
ATOM   3464  CG2 VAL B 437     -22.937 -72.606  14.320  1.00  0.91           C
ATOM   3465  N   ASN B 438     -18.755 -73.111  16.074  1.00  0.87           N
ATOM   3466  CA  ASN B 438     -17.624 -73.771  16.682  1.00  0.87           C
ATOM   3467  C   ASN B 438     -17.121 -73.045  17.913  1.00  0.87           C
ATOM   3468  O   ASN B 438     -16.719 -73.686  18.882  1.00  0.87           O
ATOM   3469  CB  ASN B 438     -16.480 -73.963  15.675  1.00  0.87           C
ATOM   3470  CG  ASN B 438     -17.033 -74.760  14.507  1.00  0.87           C
ATOM   3471  OD1 ASN B 438     -17.537 -75.868  14.682  1.00  0.87           O
ATOM   3472  ND2 ASN B 438     -16.984 -74.183  13.292  1.00  0.87           N
ATOM   3473  N   LEU B 439     -17.158 -71.706  17.877  1.00  0.88           N
ATOM   3474  CA  LEU B 439     -16.677 -70.794  18.886  1.00  0.88           C
ATOM   3475  C   LEU B 439     -17.648 -70.624  20.042  1.00  0.88           C
ATOM   3476  O   LEU B 439     -18.720 -71.226  20.098  1.00  0.88           O
ATOM   3477  CB  LEU B 439     -16.343 -69.417  18.250  1.00  0.88           C
ATOM   3478  CG  LEU B 439     -15.357 -69.495  17.064  1.00  0.88           C
ATOM   3479  CD1 LEU B 439     -14.863 -68.104  16.648  1.00  0.88           C
ATOM   3480  CD2 LEU B 439     -14.144 -70.382  17.367  1.00  0.88           C
ATOM   3481  N   LYS B 440     -17.263 -69.822  21.046  1.00  0.85           N
ATOM   3482  CA  LYS B 440     -18.168 -69.354  22.069  1.00  0.85           C
ATOM   3483  C   LYS B 440     -17.912 -67.879  22.314  1.00  0.85           C
ATOM   3484  O   LYS B 440     -16.838 -67.347  22.030  1.00  0.85           O
ATOM   3485  CB  LYS B 440     -18.041 -70.149  23.394  1.00  0.85           C
ATOM   3486  CG  LYS B 440     -18.780 -71.494  23.338  1.00  0.85           C
ATOM   3487  CD  LYS B 440     -18.835 -72.220  24.686  1.00  0.85           C
ATOM   3488  CE  LYS B 440     -19.805 -73.400  24.656  1.00  0.85           C
ATOM   3489  NZ  LYS B 440     -19.820 -74.071  25.970  1.00  0.85           N
ATOM   3490  N   GLN B 441     -18.941 -67.154  22.796  1.00  0.85           N
ATOM   3491  CA  GLN B 441     -18.852 -65.735  23.083  1.00  0.85           C
ATOM   3492  C   GLN B 441     -17.849 -65.409  24.183  1.00  0.85           C
ATOM   3493  O   GLN B 441     -17.738 -66.138  25.164  1.00  0.85           O
ATOM   3494  CB  GLN B 441     -20.253 -65.163  23.409  1.00  0.85           C
ATOM   3495  CG  GLN B 441     -20.649 -64.001  22.474  1.00  0.85           C
ATOM   3496  CD  GLN B 441     -22.055 -63.491  22.776  1.00  0.85           C
ATOM   3497  OE1 GLN B 441     -22.874 -64.132  23.436  1.00  0.85           O
ATOM   3498  NE2 GLN B 441     -22.361 -62.280  22.257  1.00  0.85           N
ATOM   3499  N   LEU B 442     -17.080 -64.313  24.043  1.00  0.89           N
ATOM   3500  CA  LEU B 442     -15.999 -64.001  24.963  1.00  0.89           C
ATOM   3501  C   LEU B 442     -16.508 -63.244  26.192  1.00  0.89           C
ATOM   3502  O   LEU B 442     -17.071 -62.155  26.045  1.00  0.89           O
ATOM   3503  CB  LEU B 442     -14.926 -63.211  24.171  1.00  0.89           C
ATOM   3504  CG  LEU B 442     -13.502 -63.044  24.757  1.00  0.89           C
ATOM   3505  CD1 LEU B 442     -13.413 -61.777  25.610  1.00  0.89           C
ATOM   3506  CD2 LEU B 442     -12.942 -64.283  25.468  1.00  0.89           C
ATOM   3507  N   PRO B 443     -16.376 -63.735  27.427  1.00  0.90           N
ATOM   3508  CA  PRO B 443     -16.762 -62.959  28.592  1.00  0.90           C
ATOM   3509  C   PRO B 443     -15.723 -61.902  28.863  1.00  0.90           C
ATOM   3510  O   PRO B 443     -14.534 -62.192  28.774  1.00  0.90           O
ATOM   3511  CB  PRO B 443     -16.810 -63.983  29.747  1.00  0.90           C
ATOM   3512  CG  PRO B 443     -16.858 -65.349  29.055  1.00  0.90           C
ATOM   3513  CD  PRO B 443     -16.040 -65.111  27.790  1.00  0.90           C
ATOM   3514  N   PHE B 444     -16.138 -60.674  29.225  1.00  0.91           N
ATOM   3515  CA  PHE B 444     -15.215 -59.643  29.657  1.00  0.91           C
ATOM   3516  C   PHE B 444     -14.302 -60.112  30.794  1.00  0.91           C
ATOM   3517  O   PHE B 444     -14.756 -60.690  31.784  1.00  0.91           O
ATOM   3518  CB  PHE B 444     -15.983 -58.347  30.076  1.00  0.91           C
ATOM   3519  CG  PHE B 444     -15.067 -57.302  30.672  1.00  0.91           C
ATOM   3520  CD1 PHE B 444     -14.305 -56.447  29.865  1.00  0.91           C
ATOM   3521  CD2 PHE B 444     -14.858 -57.282  32.060  1.00  0.91           C
ATOM   3522  CE1 PHE B 444     -13.366 -55.574  30.427  1.00  0.91           C
ATOM   3523  CE2 PHE B 444     -13.898 -56.437  32.620  1.00  0.91           C
ATOM   3524  CZ  PHE B 444     -13.155 -55.573  31.810  1.00  0.91           C
ATOM   3525  N   PHE B 445     -13.005 -59.790  30.656  1.00  0.91           N
ATOM   3526  CA  PHE B 445     -12.017 -59.889  31.700  1.00  0.91           C
ATOM   3527  C   PHE B 445     -10.963 -58.829  31.440  1.00  0.91           C
ATOM   3528  O   PHE B 445     -10.885 -58.253  30.358  1.00  0.91           O
ATOM   3529  CB  PHE B 445     -11.345 -61.289  31.833  1.00  0.91           C
ATOM   3530  CG  PHE B 445     -10.629 -61.727  30.586  1.00  0.91           C
ATOM   3531  CD1 PHE B 445      -9.304 -61.317  30.367  1.00  0.91           C
ATOM   3532  CD2 PHE B 445     -11.248 -62.558  29.643  1.00  0.91           C
ATOM   3533  CE1 PHE B 445      -8.625 -61.682  29.202  1.00  0.91           C
ATOM   3534  CE2 PHE B 445     -10.550 -62.972  28.502  1.00  0.91           C
ATOM   3535  CZ  PHE B 445      -9.245 -62.519  28.269  1.00  0.91           C
ATOM   3536  N   TYR B 446     -10.106 -58.563  32.438  1.00  0.91           N
ATOM   3537  CA  TYR B 446      -8.976 -57.667  32.305  1.00  0.91           C
ATOM   3538  C   TYR B 446      -7.747 -58.401  32.836  1.00  0.91           C
ATOM   3539  O   TYR B 446      -7.820 -59.041  33.882  1.00  0.91           O
ATOM   3540  CB  TYR B 446      -9.301 -56.329  33.034  1.00  0.91           C
ATOM   3541  CG  TYR B 446      -8.103 -55.496  33.412  1.00  0.91           C
ATOM   3542  CD1 TYR B 446      -7.540 -54.613  32.480  1.00  0.91           C
ATOM   3543  CD2 TYR B 446      -7.479 -55.656  34.662  1.00  0.91           C
ATOM   3544  CE1 TYR B 446      -6.349 -53.924  32.774  1.00  0.91           C
ATOM   3545  CE2 TYR B 446      -6.282 -54.996  34.944  1.00  0.91           C
ATOM   3546  CZ  TYR B 446      -5.713 -54.133  34.013  1.00  0.91           C
ATOM   3547  OH  TYR B 446      -4.479 -53.566  34.386  1.00  0.91           O
ATOM   3548  N   TYR B 447      -6.613 -58.351  32.102  1.00  0.88           N
ATOM   3549  CA  TYR B 447      -5.366 -59.038  32.402  1.00  0.88           C
ATOM   3550  C   TYR B 447      -4.200 -58.074  32.306  1.00  0.88           C
ATOM   3551  O   TYR B 447      -3.905 -57.487  31.264  1.00  0.88           O
ATOM   3552  CB  TYR B 447      -5.071 -60.272  31.461  1.00  0.88           C
ATOM   3553  CG  TYR B 447      -3.807 -61.063  31.827  1.00  0.88           C
ATOM   3554  CD1 TYR B 447      -2.530 -60.518  31.591  1.00  0.88           C
ATOM   3555  CD2 TYR B 447      -3.857 -62.333  32.430  1.00  0.88           C
ATOM   3556  CE1 TYR B 447      -1.368 -61.133  32.071  1.00  0.88           C
ATOM   3557  CE2 TYR B 447      -2.698 -62.961  32.908  1.00  0.88           C
ATOM   3558  CZ  TYR B 447      -1.461 -62.344  32.758  1.00  0.88           C
ATOM   3559  OH  TYR B 447      -0.330 -62.968  33.307  1.00  0.88           O
ATOM   3560  N   SER B 448      -3.403 -57.977  33.371  1.00  0.85           N
ATOM   3561  CA  SER B 448      -2.151 -57.271  33.285  1.00  0.85           C
ATOM   3562  C   SER B 448      -1.203 -58.015  34.166  1.00  0.85           C
ATOM   3563  O   SER B 448      -1.602 -58.607  35.164  1.00  0.85           O
ATOM   3564  CB  SER B 448      -2.294 -55.772  33.653  1.00  0.85           C
ATOM   3565  OG  SER B 448      -1.074 -55.039  33.539  1.00  0.85           O
ATOM   3566  N   ASP B 449       0.066 -58.064  33.770  1.00  0.86           N
ATOM   3567  CA  ASP B 449       1.117 -58.662  34.531  1.00  0.86           C
ATOM   3568  C   ASP B 449       1.958 -57.424  34.768  1.00  0.86           C
ATOM   3569  O   ASP B 449       2.392 -56.750  33.833  1.00  0.86           O
ATOM   3570  CB  ASP B 449       1.756 -59.830  33.737  1.00  0.86           C
ATOM   3571  CG  ASP B 449       3.110 -60.204  34.303  1.00  0.86           C
ATOM   3572  OD1 ASP B 449       3.225 -60.247  35.553  1.00  0.86           O
ATOM   3573  OD2 ASP B 449       4.037 -60.404  33.482  1.00  0.86           O
ATOM   3574  N   SER B 450       2.048 -56.995  36.032  1.00  0.79           N
ATOM   3575  CA  SER B 450       2.746 -55.797  36.417  1.00  0.79           C
ATOM   3576  C   SER B 450       2.925 -55.860  37.902  1.00  0.79           C
ATOM   3577  O   SER B 450       2.150 -56.547  38.558  1.00  0.79           O
ATOM   3578  CB  SER B 450       1.934 -54.501  36.251  1.00  0.79           C
ATOM   3579  OG  SER B 450       1.829 -54.165  34.904  1.00  0.79           O
ATOM   3580  N   PRO B 451       3.870 -55.165  38.509  1.00  0.77           N
ATOM   3581  CA  PRO B 451       3.873 -54.877  39.945  1.00  0.77           C
ATOM   3582  C   PRO B 451       2.760 -53.927  40.363  1.00  0.77           C
ATOM   3583  O   PRO B 451       2.345 -53.106  39.554  1.00  0.77           O
ATOM   3584  CB  PRO B 451       5.232 -54.180  40.159  1.00  0.77           C
ATOM   3585  CG  PRO B 451       5.577 -53.600  38.787  1.00  0.77           C
ATOM   3586  CD  PRO B 451       5.075 -54.678  37.850  1.00  0.77           C
ATOM   3587  N   CYS B 452       2.260 -53.961  41.619  1.00  0.77           N
ATOM   3588  CA  CYS B 452       1.339 -52.934  42.093  1.00  0.77           C
ATOM   3589  C   CYS B 452       1.911 -51.517  42.217  1.00  0.77           C
ATOM   3590  O   CYS B 452       1.223 -50.544  41.910  1.00  0.77           O
ATOM   3591  CB  CYS B 452       0.750 -53.315  43.485  1.00  0.77           C
ATOM   3592  SG  CYS B 452      -0.612 -54.522  43.611  1.00  0.77           S
ATOM   3593  N   GLU B 453       3.152 -51.354  42.711  1.00  0.54           N
ATOM   3594  CA  GLU B 453       3.619 -50.075  43.213  1.00  0.54           C
ATOM   3595  C   GLU B 453       4.539 -49.312  42.285  1.00  0.54           C
ATOM   3596  O   GLU B 453       4.830 -48.142  42.518  1.00  0.54           O
ATOM   3597  CB  GLU B 453       4.397 -50.362  44.504  1.00  0.54           C
ATOM   3598  CG  GLU B 453       3.499 -50.915  45.636  1.00  0.54           C
ATOM   3599  CD  GLU B 453       4.309 -51.388  46.842  1.00  0.54           C
ATOM   3600  OE1 GLU B 453       5.562 -51.375  46.760  1.00  0.54           O
ATOM   3601  OE2 GLU B 453       3.659 -51.800  47.835  1.00  0.54           O
ATOM   3602  N   SER B 454       4.967 -49.924  41.160  1.00  0.55           N
ATOM   3603  CA  SER B 454       5.815 -49.266  40.157  1.00  0.55           C
ATOM   3604  C   SER B 454       5.116 -48.048  39.589  1.00  0.55           C
ATOM   3605  O   SER B 454       5.658 -46.946  39.455  1.00  0.55           O
ATOM   3606  CB  SER B 454       6.137 -50.236  38.993  1.00  0.55           C
ATOM   3607  OG  SER B 454       7.046 -49.682  38.044  1.00  0.55           O
ATOM   3608  N   HIS B 455       3.816 -48.202  39.329  1.00  0.56           N
ATOM   3609  CA  HIS B 455       2.952 -47.215  38.768  1.00  0.56           C
ATOM   3610  C   HIS B 455       2.409 -46.230  39.794  1.00  0.56           C
ATOM   3611  O   HIS B 455       1.388 -45.586  39.564  1.00  0.56           O
ATOM   3612  CB  HIS B 455       1.748 -47.929  38.137  1.00  0.56           C
ATOM   3613  CG  HIS B 455       2.006 -48.846  36.954  1.00  0.56           C
ATOM   3614  ND1 HIS B 455       2.467 -50.114  37.251  1.00  0.56           N
ATOM   3615  CD2 HIS B 455       1.832 -48.723  35.604  1.00  0.56           C
ATOM   3616  CE1 HIS B 455       2.576 -50.718  36.094  1.00  0.56           C
ATOM   3617  NE2 HIS B 455       2.208 -49.931  35.060  1.00  0.56           N
ATOM   3618  N   GLY B 456       3.091 -46.030  40.940  1.00  0.54           N
ATOM   3619  CA  GLY B 456       2.684 -45.118  42.009  1.00  0.54           C
ATOM   3620  C   GLY B 456       2.565 -43.683  41.562  1.00  0.54           C
ATOM   3621  O   GLY B 456       1.815 -42.904  42.127  1.00  0.54           O
ATOM   3622  N   LYS B 457       3.273 -43.314  40.476  1.00  0.45           N
ATOM   3623  CA  LYS B 457       3.086 -42.060  39.767  1.00  0.45           C
ATOM   3624  C   LYS B 457       1.700 -41.902  39.159  1.00  0.45           C
ATOM   3625  O   LYS B 457       1.161 -40.804  39.095  1.00  0.45           O
ATOM   3626  CB  LYS B 457       4.146 -41.879  38.643  1.00  0.45           C
ATOM   3627  CG  LYS B 457       4.079 -40.517  37.916  1.00  0.45           C
ATOM   3628  CD  LYS B 457       5.173 -40.315  36.854  1.00  0.45           C
ATOM   3629  CE  LYS B 457       5.056 -38.962  36.140  1.00  0.45           C
ATOM   3630  NZ  LYS B 457       6.145 -38.822  35.150  1.00  0.45           N
ATOM   3631  N   GLN B 458       1.051 -42.980  38.690  1.00  0.46           N
ATOM   3632  CA  GLN B 458      -0.187 -42.853  37.949  1.00  0.46           C
ATOM   3633  C   GLN B 458      -1.371 -42.578  38.873  1.00  0.46           C
ATOM   3634  O   GLN B 458      -2.440 -42.200  38.427  1.00  0.46           O
ATOM   3635  CB  GLN B 458      -0.451 -44.083  37.053  1.00  0.46           C
ATOM   3636  CG  GLN B 458       0.506 -44.265  35.844  1.00  0.46           C
ATOM   3637  CD  GLN B 458       0.308 -43.255  34.711  1.00  0.46           C
ATOM   3638  OE1 GLN B 458      -0.632 -42.457  34.645  1.00  0.46           O
ATOM   3639  NE2 GLN B 458       1.246 -43.283  33.735  1.00  0.46           N
ATOM   3640  N   VAL B 459      -1.167 -42.653  40.206  1.00  0.49           N
ATOM   3641  CA  VAL B 459      -2.106 -42.270  41.259  1.00  0.49           C
ATOM   3642  C   VAL B 459      -2.717 -40.892  41.054  1.00  0.49           C
ATOM   3643  O   VAL B 459      -3.868 -40.651  41.401  1.00  0.49           O
ATOM   3644  CB  VAL B 459      -1.380 -42.310  42.607  1.00  0.49           C
ATOM   3645  CG1 VAL B 459      -2.151 -41.623  43.756  1.00  0.49           C
ATOM   3646  CG2 VAL B 459      -1.099 -43.776  42.989  1.00  0.49           C
ATOM   3647  N   VAL B 460      -1.961 -39.941  40.464  1.00  0.38           N
ATOM   3648  CA  VAL B 460      -2.458 -38.598  40.229  1.00  0.38           C
ATOM   3649  C   VAL B 460      -3.101 -38.411  38.868  1.00  0.38           C
ATOM   3650  O   VAL B 460      -3.563 -37.319  38.541  1.00  0.38           O
ATOM   3651  CB  VAL B 460      -1.363 -37.548  40.367  1.00  0.38           C
ATOM   3652  CG1 VAL B 460      -0.718 -37.633  41.762  1.00  0.38           C
ATOM   3653  CG2 VAL B 460      -0.299 -37.660  39.254  1.00  0.38           C
ATOM   3654  N   SER B 461      -3.163 -39.468  38.037  1.00  0.44           N
ATOM   3655  CA  SER B 461      -3.927 -39.463  36.805  1.00  0.44           C
ATOM   3656  C   SER B 461      -5.236 -40.209  36.947  1.00  0.44           C
ATOM   3657  O   SER B 461      -6.073 -40.183  36.042  1.00  0.44           O
ATOM   3658  CB  SER B 461      -3.107 -40.048  35.624  1.00  0.44           C
ATOM   3659  OG  SER B 461      -2.938 -41.463  35.706  1.00  0.44           O
ATOM   3660  N   ASP B 462      -5.478 -40.839  38.116  1.00  0.52           N
ATOM   3661  CA  ASP B 462      -6.740 -41.450  38.446  1.00  0.52           C
ATOM   3662  C   ASP B 462      -7.920 -40.485  38.390  1.00  0.52           C
ATOM   3663  O   ASP B 462      -7.879 -39.376  38.914  1.00  0.52           O
ATOM   3664  CB  ASP B 462      -6.735 -42.061  39.870  1.00  0.52           C
ATOM   3665  CG  ASP B 462      -5.877 -43.306  40.015  1.00  0.52           C
ATOM   3666  OD1 ASP B 462      -5.241 -43.743  39.031  1.00  0.52           O
ATOM   3667  OD2 ASP B 462      -5.934 -43.908  41.120  1.00  0.52           O
ATOM   3668  N   ILE B 463      -9.025 -40.911  37.745  1.00  0.47           N
ATOM   3669  CA  ILE B 463     -10.217 -40.088  37.609  1.00  0.47           C
ATOM   3670  C   ILE B 463     -11.151 -40.280  38.795  1.00  0.47           C
ATOM   3671  O   ILE B 463     -11.502 -39.332  39.493  1.00  0.47           O
ATOM   3672  CB  ILE B 463     -10.914 -40.428  36.290  1.00  0.47           C
ATOM   3673  CG1 ILE B 463     -10.007 -40.040  35.091  1.00  0.47           C
ATOM   3674  CG2 ILE B 463     -12.303 -39.756  36.192  1.00  0.47           C
ATOM   3675  CD1 ILE B 463     -10.483 -40.562  33.728  1.00  0.47           C
ATOM   3676  N   ASP B 464     -11.549 -41.531  39.090  1.00  0.49           N
ATOM   3677  CA  ASP B 464     -12.298 -41.842  40.289  1.00  0.49           C
ATOM   3678  C   ASP B 464     -11.415 -42.042  41.506  1.00  0.49           C
ATOM   3679  O   ASP B 464     -10.324 -42.604  41.422  1.00  0.49           O
ATOM   3680  CB  ASP B 464     -13.021 -43.187  40.160  1.00  0.49           C
ATOM   3681  CG  ASP B 464     -14.136 -43.187  39.141  1.00  0.49           C
ATOM   3682  OD1 ASP B 464     -14.619 -42.101  38.754  1.00  0.49           O
ATOM   3683  OD2 ASP B 464     -14.536 -44.329  38.798  1.00  0.49           O
ATOM   3684  N   TYR B 465     -11.902 -41.667  42.703  1.00  0.52           N
ATOM   3685  CA  TYR B 465     -11.170 -41.881  43.933  1.00  0.52           C
ATOM   3686  C   TYR B 465     -11.389 -43.257  44.570  1.00  0.52           C
ATOM   3687  O   TYR B 465     -10.444 -43.986  44.882  1.00  0.52           O
ATOM   3688  CB  TYR B 465     -11.596 -40.777  44.940  1.00  0.52           C
ATOM   3689  CG  TYR B 465     -10.775 -40.840  46.198  1.00  0.52           C
ATOM   3690  CD1 TYR B 465     -11.314 -41.357  47.390  1.00  0.52           C
ATOM   3691  CD2 TYR B 465      -9.421 -40.482  46.157  1.00  0.52           C
ATOM   3692  CE1 TYR B 465     -10.495 -41.543  48.514  1.00  0.52           C
ATOM   3693  CE2 TYR B 465      -8.608 -40.649  47.284  1.00  0.52           C
ATOM   3694  CZ  TYR B 465      -9.143 -41.185  48.458  1.00  0.52           C
ATOM   3695  OH  TYR B 465      -8.301 -41.359  49.569  1.00  0.52           O
ATOM   3696  N   VAL B 466     -12.659 -43.620  44.823  1.00  0.64           N
ATOM   3697  CA  VAL B 466     -13.036 -44.798  45.589  1.00  0.64           C
ATOM   3698  C   VAL B 466     -12.646 -46.125  44.948  1.00  0.64           C
ATOM   3699  O   VAL B 466     -12.612 -46.237  43.713  1.00  0.64           O
ATOM   3700  CB  VAL B 466     -14.515 -44.828  45.958  1.00  0.64           C
ATOM   3701  CG1 VAL B 466     -14.844 -43.597  46.821  1.00  0.64           C
ATOM   3702  CG2 VAL B 466     -15.400 -44.900  44.701  1.00  0.64           C
ATOM   3703  N   PRO B 467     -12.334 -47.155  45.736  1.00  0.76           N
ATOM   3704  CA  PRO B 467     -11.991 -48.455  45.195  1.00  0.76           C
ATOM   3705  C   PRO B 467     -13.191 -49.149  44.588  1.00  0.76           C
ATOM   3706  O   PRO B 467     -14.282 -49.112  45.150  1.00  0.76           O
ATOM   3707  CB  PRO B 467     -11.458 -49.224  46.412  1.00  0.76           C
ATOM   3708  CG  PRO B 467     -12.114 -48.578  47.629  1.00  0.76           C
ATOM   3709  CD  PRO B 467     -12.218 -47.119  47.203  1.00  0.76           C
ATOM   3710  N   LEU B 468     -12.997 -49.795  43.428  1.00  0.72           N
ATOM   3711  CA  LEU B 468     -14.009 -50.616  42.804  1.00  0.72           C
ATOM   3712  C   LEU B 468     -13.396 -51.997  42.705  1.00  0.72           C
ATOM   3713  O   LEU B 468     -12.421 -52.213  41.986  1.00  0.72           O
ATOM   3714  CB  LEU B 468     -14.396 -50.068  41.401  1.00  0.72           C
ATOM   3715  CG  LEU B 468     -15.900 -50.100  41.041  1.00  0.72           C
ATOM   3716  CD1 LEU B 468     -16.178 -49.227  39.802  1.00  0.72           C
ATOM   3717  CD2 LEU B 468     -16.432 -51.523  40.815  1.00  0.72           C
ATOM   3718  N   LYS B 469     -13.921 -52.969  43.471  1.00  0.68           N
ATOM   3719  CA  LYS B 469     -13.463 -54.339  43.393  1.00  0.68           C
ATOM   3720  C   LYS B 469     -14.296 -55.107  42.386  1.00  0.68           C
ATOM   3721  O   LYS B 469     -15.526 -55.135  42.455  1.00  0.68           O
ATOM   3722  CB  LYS B 469     -13.459 -55.015  44.790  1.00  0.68           C
ATOM   3723  CG  LYS B 469     -13.157 -56.526  44.817  1.00  0.68           C
ATOM   3724  CD  LYS B 469     -14.425 -57.383  44.635  1.00  0.68           C
ATOM   3725  CE  LYS B 469     -14.277 -58.811  45.152  1.00  0.68           C
ATOM   3726  NZ  LYS B 469     -15.607 -59.457  45.228  1.00  0.68           N
ATOM   3727  N   SER B 470     -13.632 -55.795  41.439  1.00  0.74           N
ATOM   3728  CA  SER B 470     -14.302 -56.627  40.453  1.00  0.74           C
ATOM   3729  C   SER B 470     -13.958 -58.072  40.698  1.00  0.74           C
ATOM   3730  O   SER B 470     -12.826 -58.438  41.000  1.00  0.74           O
ATOM   3731  CB  SER B 470     -13.952 -56.321  38.974  1.00  0.74           C
ATOM   3732  OG  SER B 470     -14.602 -57.238  38.079  1.00  0.74           O
ATOM   3733  N   ALA B 471     -14.969 -58.945  40.573  1.00  0.69           N
ATOM   3734  CA  ALA B 471     -14.772 -60.369  40.544  1.00  0.69           C
ATOM   3735  C   ALA B 471     -14.169 -60.816  39.234  1.00  0.69           C
ATOM   3736  O   ALA B 471     -13.261 -61.636  39.190  1.00  0.69           O
ATOM   3737  CB  ALA B 471     -16.109 -61.079  40.807  1.00  0.69           C
ATOM   3738  N   THR B 472     -14.640 -60.238  38.116  1.00  0.75           N
ATOM   3739  CA  THR B 472     -14.022 -60.520  36.842  1.00  0.75           C
ATOM   3740  C   THR B 472     -12.952 -59.498  36.563  1.00  0.75           C
ATOM   3741  O   THR B 472     -13.141 -58.462  35.914  1.00  0.75           O
ATOM   3742  CB  THR B 472     -14.975 -60.709  35.672  1.00  0.75           C
ATOM   3743  OG1 THR B 472     -14.239 -60.846  34.459  1.00  0.75           O
ATOM   3744  CG2 THR B 472     -15.988 -59.554  35.594  1.00  0.75           C
ATOM   3745  N   CYS B 473     -11.753 -59.823  37.036  1.00  0.69           N
ATOM   3746  CA  CYS B 473     -10.541 -59.426  36.396  1.00  0.69           C
ATOM   3747  C   CYS B 473      -9.477 -60.353  36.927  1.00  0.69           C
ATOM   3748  O   CYS B 473      -9.730 -61.080  37.886  1.00  0.69           O
ATOM   3749  CB  CYS B 473     -10.213 -57.924  36.620  1.00  0.69           C
ATOM   3750  SG  CYS B 473      -9.354 -57.464  38.149  1.00  0.69           S
ATOM   3751  N   ILE B 474      -8.259 -60.369  36.364  1.00  0.85           N
ATOM   3752  CA  ILE B 474      -7.150 -60.924  37.117  1.00  0.85           C
ATOM   3753  C   ILE B 474      -6.408 -59.717  37.675  1.00  0.85           C
ATOM   3754  O   ILE B 474      -5.779 -58.935  36.970  1.00  0.85           O
ATOM   3755  CB  ILE B 474      -6.306 -61.954  36.363  1.00  0.85           C
ATOM   3756  CG1 ILE B 474      -5.597 -61.395  35.133  1.00  0.85           C
ATOM   3757  CG2 ILE B 474      -7.198 -63.137  35.935  1.00  0.85           C
ATOM   3758  CD1 ILE B 474      -4.150 -61.036  35.433  1.00  0.85           C
ATOM   3759  N   THR B 475      -6.551 -59.434  38.992  1.00  0.61           N
ATOM   3760  CA  THR B 475      -5.879 -58.294  39.629  1.00  0.61           C
ATOM   3761  C   THR B 475      -4.419 -58.627  39.642  1.00  0.61           C
ATOM   3762  O   THR B 475      -4.095 -59.795  39.744  1.00  0.61           O
ATOM   3763  CB  THR B 475      -6.355 -57.890  41.041  1.00  0.61           C
ATOM   3764  OG1 THR B 475      -5.750 -58.570  42.118  1.00  0.61           O
ATOM   3765  CG2 THR B 475      -7.847 -58.173  41.178  1.00  0.61           C
ATOM   3766  N   ARG B 476      -3.464 -57.686  39.580  1.00  0.58           N
ATOM   3767  CA  ARG B 476      -2.079 -58.100  39.466  1.00  0.58           C
ATOM   3768  C   ARG B 476      -1.555 -58.486  40.837  1.00  0.58           C
ATOM   3769  O   ARG B 476      -0.431 -58.972  40.990  1.00  0.58           O
ATOM   3770  CB  ARG B 476      -1.126 -57.063  38.804  1.00  0.58           C
ATOM   3771  CG  ARG B 476      -1.479 -56.461  37.417  1.00  0.58           C
ATOM   3772  CD  ARG B 476      -2.058 -55.037  37.453  1.00  0.58           C
ATOM   3773  NE  ARG B 476      -1.396 -54.127  36.446  1.00  0.58           N
ATOM   3774  CZ  ARG B 476      -1.282 -52.804  36.539  1.00  0.58           C
ATOM   3775  NH1 ARG B 476      -2.025 -52.054  37.324  1.00  0.58           N
ATOM   3776  NH2 ARG B 476      -0.362 -52.179  35.806  1.00  0.58           N
ATOM   3777  N   CYS B 477      -2.376 -58.316  41.884  1.00  0.71           N
ATOM   3778  CA  CYS B 477      -2.020 -58.694  43.230  1.00  0.71           C
ATOM   3779  C   CYS B 477      -3.230 -59.241  43.991  1.00  0.71           C
ATOM   3780  O   CYS B 477      -3.763 -58.581  44.890  1.00  0.71           O
ATOM   3781  CB  CYS B 477      -1.382 -57.501  44.026  1.00  0.71           C
ATOM   3782  SG  CYS B 477      -0.127 -56.455  43.129  1.00  0.71           S
ATOM   3783  N   ASN B 478      -3.733 -60.458  43.681  1.00  0.62           N
ATOM   3784  CA  ASN B 478      -5.053 -60.896  44.143  1.00  0.62           C
ATOM   3785  C   ASN B 478      -5.068 -61.550  45.524  1.00  0.62           C
ATOM   3786  O   ASN B 478      -5.924 -62.359  45.852  1.00  0.62           O
ATOM   3787  CB  ASN B 478      -5.767 -61.790  43.085  1.00  0.62           C
ATOM   3788  CG  ASN B 478      -7.286 -61.697  43.252  1.00  0.62           C
ATOM   3789  OD1 ASN B 478      -7.841 -60.596  43.314  1.00  0.62           O
ATOM   3790  ND2 ASN B 478      -7.979 -62.854  43.308  1.00  0.62           N
ATOM   3791  N   LEU B 479      -4.097 -61.208  46.381  1.00  0.55           N
ATOM   3792  CA  LEU B 479      -4.052 -61.602  47.770  1.00  0.55           C
ATOM   3793  C   LEU B 479      -5.169 -60.960  48.583  1.00  0.55           C
ATOM   3794  O   LEU B 479      -5.818 -61.607  49.396  1.00  0.55           O
ATOM   3795  CB  LEU B 479      -2.622 -61.226  48.253  1.00  0.55           C
ATOM   3796  CG  LEU B 479      -2.224 -61.328  49.744  1.00  0.55           C
ATOM   3797  CD1 LEU B 479      -2.671 -60.112  50.572  1.00  0.55           C
ATOM   3798  CD2 LEU B 479      -2.629 -62.652  50.399  1.00  0.55           C
ATOM   3799  N   GLY B 480      -5.415 -59.650  48.372  1.00  0.60           N
ATOM   3800  CA  GLY B 480      -6.299 -58.878  49.237  1.00  0.60           C
ATOM   3801  C   GLY B 480      -7.706 -58.779  48.721  1.00  0.60           C
ATOM   3802  O   GLY B 480      -8.268 -59.714  48.169  1.00  0.60           O
ATOM   3803  N   GLY B 481      -8.329 -57.591  48.879  1.00  0.73           N
ATOM   3804  CA  GLY B 481      -9.640 -57.295  48.291  1.00  0.73           C
ATOM   3805  C   GLY B 481      -9.876 -57.664  46.827  1.00  0.73           C
ATOM   3806  O   GLY B 481     -10.896 -58.266  46.509  1.00  0.73           O
ATOM   3807  N   ALA B 482      -8.993 -57.315  45.866  1.00  0.67           N
ATOM   3808  CA  ALA B 482      -7.827 -56.464  45.998  1.00  0.67           C
ATOM   3809  C   ALA B 482      -7.933 -55.257  45.102  1.00  0.67           C
ATOM   3810  O   ALA B 482      -7.813 -55.321  43.881  1.00  0.67           O
ATOM   3811  CB  ALA B 482      -6.522 -57.218  45.690  1.00  0.67           C
ATOM   3812  N   VAL B 483      -8.148 -54.088  45.721  1.00  0.72           N
ATOM   3813  CA  VAL B 483      -8.202 -52.823  45.028  1.00  0.72           C
ATOM   3814  C   VAL B 483      -6.872 -52.131  45.141  1.00  0.72           C
ATOM   3815  O   VAL B 483      -6.619 -51.285  46.002  1.00  0.72           O
ATOM   3816  CB  VAL B 483      -9.336 -51.949  45.519  1.00  0.72           C
ATOM   3817  CG1 VAL B 483     -10.603 -52.402  44.777  1.00  0.72           C
ATOM   3818  CG2 VAL B 483      -9.491 -52.099  47.046  1.00  0.72           C
ATOM   3819  N   CYS B 484      -5.956 -52.485  44.240  1.00  0.75           N
ATOM   3820  CA  CYS B 484      -4.617 -51.952  44.219  1.00  0.75           C
ATOM   3821  C   CYS B 484      -4.657 -50.748  43.331  1.00  0.75           C
ATOM   3822  O   CYS B 484      -5.027 -50.906  42.171  1.00  0.75           O
ATOM   3823  CB  CYS B 484      -3.664 -52.980  43.601  1.00  0.75           C
ATOM   3824  SG  CYS B 484      -3.923 -54.615  44.377  1.00  0.75           S
ATOM   3825  N   ARG B 485      -4.329 -49.524  43.808  1.00  0.66           N
ATOM   3826  CA  ARG B 485      -4.905 -48.320  43.208  1.00  0.66           C
ATOM   3827  C   ARG B 485      -4.734 -48.227  41.684  1.00  0.66           C
ATOM   3828  O   ARG B 485      -5.704 -48.034  40.955  1.00  0.66           O
ATOM   3829  CB  ARG B 485      -4.326 -47.038  43.864  1.00  0.66           C
ATOM   3830  CG  ARG B 485      -5.158 -45.761  43.606  1.00  0.66           C
ATOM   3831  CD  ARG B 485      -6.406 -45.561  44.483  1.00  0.66           C
ATOM   3832  NE  ARG B 485      -5.941 -44.952  45.775  1.00  0.66           N
ATOM   3833  CZ  ARG B 485      -6.666 -44.119  46.535  1.00  0.66           C
ATOM   3834  NH1 ARG B 485      -7.942 -43.843  46.294  1.00  0.66           N
ATOM   3835  NH2 ARG B 485      -6.090 -43.549  47.596  1.00  0.66           N
ATOM   3836  N   HIS B 486      -3.503 -48.514  41.187  1.00  0.70           N
ATOM   3837  CA  HIS B 486      -3.133 -48.581  39.775  1.00  0.70           C
ATOM   3838  C   HIS B 486      -3.897 -49.611  38.976  1.00  0.70           C
ATOM   3839  O   HIS B 486      -4.284 -49.372  37.848  1.00  0.70           O
ATOM   3840  CB  HIS B 486      -1.627 -48.912  39.533  1.00  0.70           C
ATOM   3841  CG  HIS B 486      -1.179 -48.527  38.160  1.00  0.70           C
ATOM   3842  ND1 HIS B 486      -0.934 -49.467  37.151  1.00  0.70           N
ATOM   3843  CD2 HIS B 486      -1.421 -47.340  37.614  1.00  0.70           C
ATOM   3844  CE1 HIS B 486      -1.045 -48.814  36.043  1.00  0.70           C
ATOM   3845  NE2 HIS B 486      -1.332 -47.530  36.290  1.00  0.70           N
ATOM   3846  N   HIS B 487      -4.138 -50.827  39.514  1.00  0.74           N
ATOM   3847  CA  HIS B 487      -4.953 -51.785  38.776  1.00  0.74           C
ATOM   3848  C   HIS B 487      -6.406 -51.412  38.785  1.00  0.74           C
ATOM   3849  O   HIS B 487      -7.090 -51.533  37.777  1.00  0.74           O
ATOM   3850  CB  HIS B 487      -4.863 -53.260  39.220  1.00  0.74           C
ATOM   3851  CG  HIS B 487      -3.599 -53.694  39.883  1.00  0.74           C
ATOM   3852  ND1 HIS B 487      -3.634 -54.930  40.465  1.00  0.74           N
ATOM   3853  CD2 HIS B 487      -2.371 -53.111  40.082  1.00  0.74           C
ATOM   3854  CE1 HIS B 487      -2.441 -55.097  41.012  1.00  0.74           C
ATOM   3855  NE2 HIS B 487      -1.666 -54.026  40.802  1.00  0.74           N
ATOM   3856  N   ALA B 488      -6.915 -50.943  39.929  1.00  0.76           N
ATOM   3857  CA  ALA B 488      -8.275 -50.517  40.112  1.00  0.76           C
ATOM   3858  C   ALA B 488      -8.637 -49.350  39.186  1.00  0.76           C
ATOM   3859  O   ALA B 488      -9.716 -49.307  38.609  1.00  0.76           O
ATOM   3860  CB  ALA B 488      -8.435 -50.233  41.616  1.00  0.76           C
ATOM   3861  N   ASN B 489      -7.695 -48.407  38.962  1.00  0.74           N
ATOM   3862  CA  ASN B 489      -7.752 -47.494  37.837  1.00  0.74           C
ATOM   3863  C   ASN B 489      -7.632 -48.133  36.445  1.00  0.74           C
ATOM   3864  O   ASN B 489      -8.510 -47.926  35.611  1.00  0.74           O
ATOM   3865  CB  ASN B 489      -6.660 -46.410  38.006  1.00  0.74           C
ATOM   3866  CG  ASN B 489      -6.704 -45.416  36.852  1.00  0.74           C
ATOM   3867  OD1 ASN B 489      -6.068 -45.606  35.815  1.00  0.74           O
ATOM   3868  ND2 ASN B 489      -7.564 -44.393  36.983  1.00  0.74           N
ATOM   3869  N   GLU B 490      -6.577 -48.924  36.148  1.00  0.78           N
ATOM   3870  CA  GLU B 490      -6.375 -49.437  34.797  1.00  0.78           C
ATOM   3871  C   GLU B 490      -7.487 -50.352  34.310  1.00  0.78           C
ATOM   3872  O   GLU B 490      -7.878 -50.329  33.149  1.00  0.78           O
ATOM   3873  CB  GLU B 490      -5.022 -50.145  34.607  1.00  0.78           C
ATOM   3874  CG  GLU B 490      -3.946 -49.282  33.915  1.00  0.78           C
ATOM   3875  CD  GLU B 490      -2.712 -50.113  33.590  1.00  0.78           C
ATOM   3876  OE1 GLU B 490      -2.709 -51.338  33.891  1.00  0.78           O
ATOM   3877  OE2 GLU B 490      -1.734 -49.544  33.066  1.00  0.78           O
ATOM   3878  N   TYR B 491      -8.055 -51.163  35.224  1.00  0.86           N
ATOM   3879  CA  TYR B 491      -9.256 -51.930  34.988  1.00  0.86           C
ATOM   3880  C   TYR B 491     -10.434 -51.056  34.585  1.00  0.86           C
ATOM   3881  O   TYR B 491     -11.140 -51.363  33.631  1.00  0.86           O
ATOM   3882  CB  TYR B 491      -9.611 -52.675  36.308  1.00  0.86           C
ATOM   3883  CG  TYR B 491     -10.931 -53.384  36.251  1.00  0.86           C
ATOM   3884  CD1 TYR B 491     -12.099 -52.714  36.644  1.00  0.86           C
ATOM   3885  CD2 TYR B 491     -11.028 -54.673  35.735  1.00  0.86           C
ATOM   3886  CE1 TYR B 491     -13.348 -53.333  36.530  1.00  0.86           C
ATOM   3887  CE2 TYR B 491     -12.271 -55.298  35.622  1.00  0.86           C
ATOM   3888  CZ  TYR B 491     -13.428 -54.630  36.015  1.00  0.86           C
ATOM   3889  OH  TYR B 491     -14.655 -55.294  35.881  1.00  0.86           O
ATOM   3890  N   ARG B 492     -10.667 -49.950  35.316  1.00  0.77           N
ATOM   3891  CA  ARG B 492     -11.801 -49.072  35.123  1.00  0.77           C
ATOM   3892  C   ARG B 492     -11.729 -48.416  33.746  1.00  0.77           C
ATOM   3893  O   ARG B 492     -12.666 -48.480  32.957  1.00  0.77           O
ATOM   3894  CB  ARG B 492     -11.794 -48.112  36.349  1.00  0.77           C
ATOM   3895  CG  ARG B 492     -13.061 -47.291  36.654  1.00  0.77           C
ATOM   3896  CD  ARG B 492     -13.446 -47.229  38.151  1.00  0.77           C
ATOM   3897  NE  ARG B 492     -12.298 -46.697  38.972  1.00  0.77           N
ATOM   3898  CZ  ARG B 492     -12.366 -46.525  40.301  1.00  0.77           C
ATOM   3899  NH1 ARG B 492     -13.512 -46.612  40.965  1.00  0.77           N
ATOM   3900  NH2 ARG B 492     -11.276 -46.162  40.984  1.00  0.77           N
ATOM   3901  N   LEU B 493     -10.535 -47.912  33.371  1.00  0.83           N
ATOM   3902  CA  LEU B 493     -10.259 -47.376  32.049  1.00  0.83           C
ATOM   3903  C   LEU B 493     -10.392 -48.384  30.912  1.00  0.83           C
ATOM   3904  O   LEU B 493     -10.956 -48.087  29.860  1.00  0.83           O
ATOM   3905  CB  LEU B 493      -8.828 -46.789  31.998  1.00  0.83           C
ATOM   3906  CG  LEU B 493      -8.576 -45.582  32.923  1.00  0.83           C
ATOM   3907  CD1 LEU B 493      -7.090 -45.200  32.890  1.00  0.83           C
ATOM   3908  CD2 LEU B 493      -9.429 -44.362  32.549  1.00  0.83           C
ATOM   3909  N   TYR B 494      -9.869 -49.619  31.083  1.00  0.88           N
ATOM   3910  CA  TYR B 494     -10.061 -50.678  30.111  1.00  0.88           C
ATOM   3911  C   TYR B 494     -11.519 -51.115  29.972  1.00  0.88           C
ATOM   3912  O   TYR B 494     -12.008 -51.264  28.857  1.00  0.88           O
ATOM   3913  CB  TYR B 494      -9.130 -51.879  30.431  1.00  0.88           C
ATOM   3914  CG  TYR B 494      -9.282 -53.008  29.442  1.00  0.88           C
ATOM   3915  CD1 TYR B 494     -10.059 -54.130  29.773  1.00  0.88           C
ATOM   3916  CD2 TYR B 494      -8.682 -52.950  28.174  1.00  0.88           C
ATOM   3917  CE1 TYR B 494     -10.223 -55.179  28.861  1.00  0.88           C
ATOM   3918  CE2 TYR B 494      -8.840 -54.006  27.263  1.00  0.88           C
ATOM   3919  CZ  TYR B 494      -9.612 -55.120  27.609  1.00  0.88           C
ATOM   3920  OH  TYR B 494      -9.750 -56.198  26.717  1.00  0.88           O
ATOM   3921  N   LEU B 495     -12.261 -51.310  31.082  1.00  0.89           N
ATOM   3922  CA  LEU B 495     -13.665 -51.688  31.026  1.00  0.89           C
ATOM   3923  C   LEU B 495     -14.537 -50.649  30.343  1.00  0.89           C
ATOM   3924  O   LEU B 495     -15.364 -50.993  29.499  1.00  0.89           O
ATOM   3925  CB  LEU B 495     -14.212 -52.040  32.430  1.00  0.89           C
ATOM   3926  CG  LEU B 495     -15.737 -52.275  32.508  1.00  0.89           C
ATOM   3927  CD1 LEU B 495     -16.067 -53.560  33.269  1.00  0.89           C
ATOM   3928  CD2 LEU B 495     -16.440 -51.093  33.191  1.00  0.89           C
ATOM   3929  N   ASP B 496     -14.339 -49.352  30.631  1.00  0.83           N
ATOM   3930  CA  ASP B 496     -15.031 -48.271  29.962  1.00  0.83           C
ATOM   3931  C   ASP B 496     -14.783 -48.236  28.449  1.00  0.83           C
ATOM   3932  O   ASP B 496     -15.709 -48.148  27.641  1.00  0.83           O
ATOM   3933  CB  ASP B 496     -14.566 -46.945  30.602  1.00  0.83           C
ATOM   3934  CG  ASP B 496     -15.232 -46.684  31.951  1.00  0.83           C
ATOM   3935  OD1 ASP B 496     -16.084 -47.499  32.386  1.00  0.83           O
ATOM   3936  OD2 ASP B 496     -14.901 -45.623  32.538  1.00  0.83           O
ATOM   3937  N   ALA B 497     -13.511 -48.374  28.019  1.00  0.85           N
ATOM   3938  CA  ALA B 497     -13.156 -48.509  26.619  1.00  0.85           C
ATOM   3939  C   ALA B 497     -13.655 -49.792  25.947  1.00  0.85           C
ATOM   3940  O   ALA B 497     -14.100 -49.777  24.803  1.00  0.85           O
ATOM   3941  CB  ALA B 497     -11.642 -48.333  26.406  1.00  0.85           C
ATOM   3942  N   TYR B 498     -13.631 -50.947  26.640  1.00  0.89           N
ATOM   3943  CA  TYR B 498     -14.278 -52.169  26.189  1.00  0.89           C
ATOM   3944  C   TYR B 498     -15.789 -52.021  26.002  1.00  0.89           C
ATOM   3945  O   TYR B 498     -16.347 -52.422  24.982  1.00  0.89           O
ATOM   3946  CB  TYR B 498     -13.985 -53.289  27.225  1.00  0.89           C
ATOM   3947  CG  TYR B 498     -14.571 -54.626  26.848  1.00  0.89           C
ATOM   3948  CD1 TYR B 498     -13.805 -55.559  26.135  1.00  0.89           C
ATOM   3949  CD2 TYR B 498     -15.885 -54.969  27.222  1.00  0.89           C
ATOM   3950  CE1 TYR B 498     -14.350 -56.796  25.767  1.00  0.89           C
ATOM   3951  CE2 TYR B 498     -16.431 -56.207  26.857  1.00  0.89           C
ATOM   3952  CZ  TYR B 498     -15.665 -57.115  26.119  1.00  0.89           C
ATOM   3953  OH  TYR B 498     -16.204 -58.360  25.747  1.00  0.89           O
ATOM   3954  N   ASN B 499     -16.486 -51.398  26.973  1.00  0.87           N
ATOM   3955  CA  ASN B 499     -17.921 -51.193  26.905  1.00  0.87           C
ATOM   3956  C   ASN B 499     -18.305 -50.190  25.822  1.00  0.87           C
ATOM   3957  O   ASN B 499     -19.388 -50.243  25.247  1.00  0.87           O
ATOM   3958  CB  ASN B 499     -18.488 -50.794  28.288  1.00  0.87           C
ATOM   3959  CG  ASN B 499     -18.645 -52.035  29.165  1.00  0.87           C
ATOM   3960  OD1 ASN B 499     -18.737 -53.174  28.701  1.00  0.87           O
ATOM   3961  ND2 ASN B 499     -18.729 -51.817  30.495  1.00  0.87           N
ATOM   3962  N   MET B 500     -17.396 -49.278  25.456  1.00  0.84           N
ATOM   3963  CA  MET B 500     -17.500 -48.515  24.234  1.00  0.84           C
ATOM   3964  C   MET B 500     -17.389 -49.336  22.943  1.00  0.84           C
ATOM   3965  O   MET B 500     -18.171 -49.159  22.013  1.00  0.84           O
ATOM   3966  CB  MET B 500     -16.436 -47.415  24.270  1.00  0.84           C
ATOM   3967  CG  MET B 500     -16.165 -46.783  22.907  1.00  0.84           C
ATOM   3968  SD  MET B 500     -15.286 -45.234  23.039  1.00  0.84           S
ATOM   3969  CE  MET B 500     -16.622 -44.278  23.806  1.00  0.84           C
ATOM   3970  N   MET B 501     -16.425 -50.278  22.851  1.00  0.87           N
ATOM   3971  CA  MET B 501     -16.248 -51.145  21.690  1.00  0.87           C
ATOM   3972  C   MET B 501     -17.457 -52.030  21.393  1.00  0.87           C
ATOM   3973  O   MET B 501     -17.896 -52.136  20.250  1.00  0.87           O
ATOM   3974  CB  MET B 501     -14.929 -51.967  21.819  1.00  0.87           C
ATOM   3975  CG  MET B 501     -14.978 -53.434  21.342  1.00  0.87           C
ATOM   3976  SD  MET B 501     -13.377 -54.135  20.870  1.00  0.87           S
ATOM   3977  CE  MET B 501     -13.426 -53.394  19.221  1.00  0.87           C
ATOM   3978  N   ILE B 502     -18.049 -52.657  22.427  1.00  0.89           N
ATOM   3979  CA  ILE B 502     -19.281 -53.423  22.308  1.00  0.89           C
ATOM   3980  C   ILE B 502     -20.495 -52.555  21.968  1.00  0.89           C
ATOM   3981  O   ILE B 502     -21.331 -52.931  21.150  1.00  0.89           O
ATOM   3982  CB  ILE B 502     -19.470 -54.328  23.521  1.00  0.89           C
ATOM   3983  CG1 ILE B 502     -20.433 -55.503  23.252  1.00  0.89           C
ATOM   3984  CG2 ILE B 502     -19.887 -53.506  24.748  1.00  0.89           C
ATOM   3985  CD1 ILE B 502     -20.554 -56.456  24.450  1.00  0.89           C
ATOM   3986  N   SER B 503     -20.590 -51.317  22.513  1.00  0.85           N
ATOM   3987  CA  SER B 503     -21.622 -50.339  22.158  1.00  0.85           C
ATOM   3988  C   SER B 503     -21.552 -49.868  20.717  1.00  0.85           C
ATOM   3989  O   SER B 503     -22.546 -49.431  20.146  1.00  0.85           O
ATOM   3990  CB  SER B 503     -21.579 -49.074  23.052  1.00  0.85           C
ATOM   3991  OG  SER B 503     -22.175 -49.343  24.322  1.00  0.85           O
ATOM   3992  N   ALA B 504     -20.381 -49.988  20.063  1.00  0.88           N
ATOM   3993  CA  ALA B 504     -20.239 -49.673  18.659  1.00  0.88           C
ATOM   3994  C   ALA B 504     -20.511 -50.883  17.769  1.00  0.88           C
ATOM   3995  O   ALA B 504     -20.484 -50.780  16.544  1.00  0.88           O
ATOM   3996  CB  ALA B 504     -18.813 -49.158  18.404  1.00  0.88           C
ATOM   3997  N   GLY B 505     -20.844 -52.042  18.377  1.00  0.92           N
ATOM   3998  CA  GLY B 505     -21.336 -53.228  17.687  1.00  0.92           C
ATOM   3999  C   GLY B 505     -20.332 -54.285  17.363  1.00  0.92           C
ATOM   4000  O   GLY B 505     -20.645 -55.268  16.697  1.00  0.92           O
ATOM   4001  N   PHE B 506     -19.081 -54.153  17.814  1.00  0.92           N
ATOM   4002  CA  PHE B 506     -18.114 -55.227  17.665  1.00  0.92           C
ATOM   4003  C   PHE B 506     -18.389 -56.414  18.591  1.00  0.92           C
ATOM   4004  O   PHE B 506     -18.651 -56.252  19.783  1.00  0.92           O
ATOM   4005  CB  PHE B 506     -16.677 -54.729  17.898  1.00  0.92           C
ATOM   4006  CG  PHE B 506     -16.266 -53.738  16.844  1.00  0.92           C
ATOM   4007  CD1 PHE B 506     -16.402 -52.359  17.072  1.00  0.92           C
ATOM   4008  CD2 PHE B 506     -15.709 -54.172  15.630  1.00  0.92           C
ATOM   4009  CE1 PHE B 506     -16.023 -51.433  16.095  1.00  0.92           C
ATOM   4010  CE2 PHE B 506     -15.301 -53.247  14.662  1.00  0.92           C
ATOM   4011  CZ  PHE B 506     -15.473 -51.876  14.887  1.00  0.92           C
ATOM   4012  N   SER B 507     -18.317 -57.653  18.066  1.00  0.93           N
ATOM   4013  CA  SER B 507     -18.623 -58.861  18.822  1.00  0.93           C
ATOM   4014  C   SER B 507     -17.366 -59.689  18.954  1.00  0.93           C
ATOM   4015  O   SER B 507     -16.659 -59.924  17.973  1.00  0.93           O
ATOM   4016  CB  SER B 507     -19.718 -59.735  18.142  1.00  0.93           C
ATOM   4017  OG  SER B 507     -20.254 -60.735  19.020  1.00  0.93           O
ATOM   4018  N   LEU B 508     -17.049 -60.147  20.181  1.00  0.92           N
ATOM   4019  CA  LEU B 508     -15.835 -60.890  20.453  1.00  0.92           C
ATOM   4020  C   LEU B 508     -16.144 -62.356  20.672  1.00  0.92           C
ATOM   4021  O   LEU B 508     -16.988 -62.738  21.486  1.00  0.92           O
ATOM   4022  CB  LEU B 508     -15.062 -60.380  21.701  1.00  0.92           C
ATOM   4023  CG  LEU B 508     -14.262 -59.062  21.553  1.00  0.92           C
ATOM   4024  CD1 LEU B 508     -13.688 -58.855  20.146  1.00  0.92           C
ATOM   4025  CD2 LEU B 508     -15.032 -57.815  22.012  1.00  0.92           C
ATOM   4026  N   TRP B 509     -15.433 -63.225  19.937  1.00  0.90           N
ATOM   4027  CA  TRP B 509     -15.664 -64.649  19.975  1.00  0.90           C
ATOM   4028  C   TRP B 509     -14.348 -65.386  20.117  1.00  0.90           C
ATOM   4029  O   TRP B 509     -13.326 -64.976  19.564  1.00  0.90           O
ATOM   4030  CB  TRP B 509     -16.348 -65.116  18.676  1.00  0.90           C
ATOM   4031  CG  TRP B 509     -17.710 -64.491  18.426  1.00  0.90           C
ATOM   4032  CD1 TRP B 509     -18.046 -63.333  17.781  1.00  0.90           C
ATOM   4033  CD2 TRP B 509     -18.922 -65.125  18.816  1.00  0.90           C
ATOM   4034  NE1 TRP B 509     -19.416 -63.244  17.686  1.00  0.90           N
ATOM   4035  CE2 TRP B 509     -19.985 -64.284  18.361  1.00  0.90           C
ATOM   4036  CE3 TRP B 509     -19.188 -66.319  19.464  1.00  0.90           C
ATOM   4037  CZ2 TRP B 509     -21.296 -64.651  18.563  1.00  0.90           C
ATOM   4038  CZ3 TRP B 509     -20.520 -66.680  19.669  1.00  0.90           C
ATOM   4039  CH2 TRP B 509     -21.564 -65.852  19.226  1.00  0.90           C
ATOM   4040  N   VAL B 510     -14.335 -66.501  20.872  1.00  0.93           N
ATOM   4041  CA  VAL B 510     -13.127 -67.284  21.058  1.00  0.93           C
ATOM   4042  C   VAL B 510     -13.410 -68.772  20.965  1.00  0.93           C
ATOM   4043  O   VAL B 510     -14.542 -69.243  20.977  1.00  0.93           O
ATOM   4044  CB  VAL B 510     -12.390 -67.035  22.376  1.00  0.93           C
ATOM   4045  CG1 VAL B 510     -11.866 -65.595  22.498  1.00  0.93           C
ATOM   4046  CG2 VAL B 510     -13.289 -67.343  23.581  1.00  0.93           C
ATOM   4047  N   TYR B 511     -12.342 -69.574  20.864  1.00  0.89           N
ATOM   4048  CA  TYR B 511     -12.345 -71.009  21.002  1.00  0.89           C
ATOM   4049  C   TYR B 511     -12.960 -71.525  22.306  1.00  0.89           C
ATOM   4050  O   TYR B 511     -12.784 -70.961  23.382  1.00  0.89           O
ATOM   4051  CB  TYR B 511     -10.907 -71.550  20.785  1.00  0.89           C
ATOM   4052  CG  TYR B 511      -9.886 -70.951  21.707  1.00  0.89           C
ATOM   4053  CD1 TYR B 511      -9.313 -69.682  21.486  1.00  0.89           C
ATOM   4054  CD2 TYR B 511      -9.436 -71.720  22.786  1.00  0.89           C
ATOM   4055  CE1 TYR B 511      -8.302 -69.205  22.311  1.00  0.89           C
ATOM   4056  CE2 TYR B 511      -8.432 -71.242  23.630  1.00  0.89           C
ATOM   4057  CZ  TYR B 511      -7.885 -69.974  23.369  1.00  0.89           C
ATOM   4058  OH  TYR B 511      -6.908 -69.356  24.125  1.00  0.89           O
ATOM   4059  N   LYS B 512     -13.704 -72.655  22.226  1.00  0.84           N
ATOM   4060  CA  LYS B 512     -14.460 -73.226  23.338  1.00  0.84           C
ATOM   4061  C   LYS B 512     -13.633 -73.605  24.546  1.00  0.84           C
ATOM   4062  O   LYS B 512     -14.155 -73.706  25.651  1.00  0.84           O
ATOM   4063  CB  LYS B 512     -15.235 -74.510  22.930  1.00  0.84           C
ATOM   4064  CG  LYS B 512     -16.290 -74.293  21.839  1.00  0.84           C
ATOM   4065  CD  LYS B 512     -17.578 -75.114  22.049  1.00  0.84           C
ATOM   4066  CE  LYS B 512     -17.738 -76.293  21.080  1.00  0.84           C
ATOM   4067  NZ  LYS B 512     -18.159 -75.836  19.736  1.00  0.84           N
ATOM   4068  N   GLN B 513     -12.334 -73.866  24.342  1.00  0.84           N
ATOM   4069  CA  GLN B 513     -11.453 -74.330  25.379  1.00  0.84           C
ATOM   4070  C   GLN B 513     -10.982 -73.230  26.322  1.00  0.84           C
ATOM   4071  O   GLN B 513     -10.473 -73.517  27.402  1.00  0.84           O
ATOM   4072  CB  GLN B 513     -10.224 -74.980  24.706  1.00  0.84           C
ATOM   4073  CG  GLN B 513      -9.629 -76.139  25.530  1.00  0.84           C
ATOM   4074  CD  GLN B 513      -8.197 -76.438  25.096  1.00  0.84           C
ATOM   4075  OE1 GLN B 513      -7.923 -76.671  23.915  1.00  0.84           O
ATOM   4076  NE2 GLN B 513      -7.253 -76.423  26.061  1.00  0.84           N
ATOM   4077  N   PHE B 514     -11.126 -71.943  25.922  1.00  0.87           N
ATOM   4078  CA  PHE B 514     -10.626 -70.818  26.692  1.00  0.87           C
ATOM   4079  C   PHE B 514     -11.222 -70.718  28.098  1.00  0.87           C
ATOM   4080  O   PHE B 514     -12.438 -70.745  28.289  1.00  0.87           O
ATOM   4081  CB  PHE B 514     -10.829 -69.480  25.909  1.00  0.87           C
ATOM   4082  CG  PHE B 514     -10.305 -68.275  26.657  1.00  0.87           C
ATOM   4083  CD1 PHE B 514     -11.149 -67.558  27.523  1.00  0.87           C
ATOM   4084  CD2 PHE B 514      -8.957 -67.899  26.565  1.00  0.87           C
ATOM   4085  CE1 PHE B 514     -10.654 -66.498  28.292  1.00  0.87           C
ATOM   4086  CE2 PHE B 514      -8.452 -66.846  27.338  1.00  0.87           C
ATOM   4087  CZ  PHE B 514      -9.303 -66.145  28.199  1.00  0.87           C
ATOM   4088  N   ASP B 515     -10.341 -70.531  29.098  1.00  0.86           N
ATOM   4089  CA  ASP B 515     -10.721 -70.340  30.478  1.00  0.86           C
ATOM   4090  C   ASP B 515      -9.852 -69.257  31.107  1.00  0.86           C
ATOM   4091  O   ASP B 515      -8.638 -69.172  30.918  1.00  0.86           O
ATOM   4092  CB  ASP B 515     -10.612 -71.681  31.259  1.00  0.86           C
ATOM   4093  CG  ASP B 515     -11.086 -71.643  32.711  1.00  0.86           C
ATOM   4094  OD1 ASP B 515     -11.487 -70.561  33.218  1.00  0.86           O
ATOM   4095  OD2 ASP B 515     -10.999 -72.709  33.363  1.00  0.86           O
ATOM   4096  N   THR B 516     -10.493 -68.413  31.933  1.00  0.86           N
ATOM   4097  CA  THR B 516      -9.880 -67.415  32.790  1.00  0.86           C
ATOM   4098  C   THR B 516      -8.938 -68.047  33.797  1.00  0.86           C
ATOM   4099  O   THR B 516      -7.889 -67.491  34.116  1.00  0.86           O
ATOM   4100  CB  THR B 516     -10.922 -66.577  33.526  1.00  0.86           C
ATOM   4101  OG1 THR B 516     -11.690 -65.844  32.579  1.00  0.86           O
ATOM   4102  CG2 THR B 516     -10.282 -65.541  34.463  1.00  0.86           C
ATOM   4103  N   TYR B 517      -9.265 -69.252  34.317  1.00  0.82           N
ATOM   4104  CA  TYR B 517      -8.504 -69.914  35.362  1.00  0.82           C
ATOM   4105  C   TYR B 517      -7.049 -70.173  34.984  1.00  0.82           C
ATOM   4106  O   TYR B 517      -6.141 -69.960  35.788  1.00  0.82           O
ATOM   4107  CB  TYR B 517      -9.222 -71.204  35.849  1.00  0.82           C
ATOM   4108  CG  TYR B 517      -8.464 -71.867  36.969  1.00  0.82           C
ATOM   4109  CD1 TYR B 517      -7.548 -72.888  36.667  1.00  0.82           C
ATOM   4110  CD2 TYR B 517      -8.573 -71.413  38.292  1.00  0.82           C
ATOM   4111  CE1 TYR B 517      -6.715 -73.410  37.664  1.00  0.82           C
ATOM   4112  CE2 TYR B 517      -7.756 -71.955  39.296  1.00  0.82           C
ATOM   4113  CZ  TYR B 517      -6.814 -72.941  38.976  1.00  0.82           C
ATOM   4114  OH  TYR B 517      -5.956 -73.455  39.967  1.00  0.82           O
ATOM   4115  N   ASN B 518      -6.773 -70.556  33.723  1.00  0.83           N
ATOM   4116  CA  ASN B 518      -5.420 -70.835  33.271  1.00  0.83           C
ATOM   4117  C   ASN B 518      -4.498 -69.612  33.336  1.00  0.83           C
ATOM   4118  O   ASN B 518      -3.273 -69.743  33.353  1.00  0.83           O
ATOM   4119  CB  ASN B 518      -5.449 -71.431  31.840  1.00  0.83           C
ATOM   4120  CG  ASN B 518      -5.897 -72.890  31.891  1.00  0.83           C
ATOM   4121  OD1 ASN B 518      -6.075 -73.487  32.955  1.00  0.83           O
ATOM   4122  ND2 ASN B 518      -6.060 -73.515  30.704  1.00  0.83           N
ATOM   4123  N   LEU B 519      -5.063 -68.391  33.449  1.00  0.85           N
ATOM   4124  CA  LEU B 519      -4.310 -67.164  33.612  1.00  0.85           C
ATOM   4125  C   LEU B 519      -3.805 -66.937  35.030  1.00  0.85           C
ATOM   4126  O   LEU B 519      -2.946 -66.092  35.260  1.00  0.85           O
ATOM   4127  CB  LEU B 519      -5.122 -65.923  33.165  1.00  0.85           C
ATOM   4128  CG  LEU B 519      -5.574 -65.951  31.691  1.00  0.85           C
ATOM   4129  CD1 LEU B 519      -6.431 -64.722  31.325  1.00  0.85           C
ATOM   4130  CD2 LEU B 519      -4.383 -66.137  30.739  1.00  0.85           C
ATOM   4131  N   TRP B 520      -4.289 -67.690  36.040  1.00  0.65           N
ATOM   4132  CA  TRP B 520      -3.768 -67.561  37.388  1.00  0.65           C
ATOM   4133  C   TRP B 520      -2.450 -68.311  37.524  1.00  0.65           C
ATOM   4134  O   TRP B 520      -1.603 -67.995  38.356  1.00  0.65           O
ATOM   4135  CB  TRP B 520      -4.767 -68.081  38.455  1.00  0.65           C
ATOM   4136  CG  TRP B 520      -6.123 -67.377  38.516  1.00  0.65           C
ATOM   4137  CD1 TRP B 520      -7.363 -67.928  38.348  1.00  0.65           C
ATOM   4138  CD2 TRP B 520      -6.338 -66.008  38.899  1.00  0.65           C
ATOM   4139  NE1 TRP B 520      -8.339 -66.987  38.583  1.00  0.65           N
ATOM   4140  CE2 TRP B 520      -7.747 -65.807  38.939  1.00  0.65           C
ATOM   4141  CE3 TRP B 520      -5.468 -64.976  39.221  1.00  0.65           C
ATOM   4142  CZ2 TRP B 520      -8.279 -64.583  39.306  1.00  0.65           C
ATOM   4143  CZ3 TRP B 520      -6.011 -63.738  39.588  1.00  0.65           C
ATOM   4144  CH2 TRP B 520      -7.400 -63.546  39.635  1.00  0.65           C
ATOM   4145  N   ASN B 521      -2.211 -69.290  36.628  1.00  0.76           N
ATOM   4146  CA  ASN B 521      -1.034 -70.138  36.659  1.00  0.76           C
ATOM   4147  C   ASN B 521       0.195 -69.423  36.125  1.00  0.76           C
ATOM   4148  O   ASN B 521       1.314 -69.908  36.263  1.00  0.76           O
ATOM   4149  CB  ASN B 521      -1.218 -71.439  35.834  1.00  0.76           C
ATOM   4150  CG  ASN B 521      -2.311 -72.335  36.411  1.00  0.76           C
ATOM   4151  OD1 ASN B 521      -3.063 -71.988  37.319  1.00  0.76           O
ATOM   4152  ND2 ASN B 521      -2.401 -73.567  35.858  1.00  0.76           N
ATOM   4153  N   THR B 522       0.021 -68.255  35.474  1.00  0.83           N
ATOM   4154  CA  THR B 522       1.135 -67.436  35.020  1.00  0.83           C
ATOM   4155  C   THR B 522       1.620 -66.479  36.093  1.00  0.83           C
ATOM   4156  O   THR B 522       2.753 -66.015  36.041  1.00  0.83           O
ATOM   4157  CB  THR B 522       0.834 -66.635  33.756  1.00  0.83           C
ATOM   4158  OG1 THR B 522      -0.318 -65.815  33.880  1.00  0.83           O
ATOM   4159  CG2 THR B 522       0.571 -67.620  32.607  1.00  0.83           C
ATOM   4160  N   PHE B 523       0.766 -66.201  37.101  1.00  0.78           N
ATOM   4161  CA  PHE B 523       1.070 -65.416  38.283  1.00  0.78           C
ATOM   4162  C   PHE B 523       1.791 -66.194  39.364  1.00  0.78           C
ATOM   4163  O   PHE B 523       2.695 -65.674  40.012  1.00  0.78           O
ATOM   4164  CB  PHE B 523      -0.238 -64.854  38.912  1.00  0.78           C
ATOM   4165  CG  PHE B 523      -0.761 -63.599  38.273  1.00  0.78           C
ATOM   4166  CD1 PHE B 523      -0.016 -62.796  37.388  1.00  0.78           C
ATOM   4167  CD2 PHE B 523      -2.028 -63.147  38.666  1.00  0.78           C
ATOM   4168  CE1 PHE B 523      -0.493 -61.556  36.957  1.00  0.78           C
ATOM   4169  CE2 PHE B 523      -2.487 -61.895  38.262  1.00  0.78           C
ATOM   4170  CZ  PHE B 523      -1.711 -61.086  37.431  1.00  0.78           C
ATOM   4171  N   THR B 524       1.376 -67.454  39.624  1.00  0.65           N
ATOM   4172  CA  THR B 524       1.985 -68.275  40.680  1.00  0.65           C
ATOM   4173  C   THR B 524       3.459 -68.576  40.386  1.00  0.65           C
ATOM   4174  O   THR B 524       3.817 -69.003  39.286  1.00  0.65           O
ATOM   4175  CB  THR B 524       1.163 -69.525  41.044  1.00  0.65           C
ATOM   4176  OG1 THR B 524       1.269 -69.839  42.427  1.00  0.65           O
ATOM   4177  CG2 THR B 524       1.586 -70.766  40.248  1.00  0.65           C
ATOM   4178  N   ARG B 525       4.357 -68.287  41.345  1.00  0.39           N
ATOM   4179  CA  ARG B 525       5.782 -68.207  41.130  1.00  0.39           C
ATOM   4180  C   ARG B 525       6.453 -68.141  42.520  1.00  0.39           C
ATOM   4181  O   ARG B 525       5.803 -67.735  43.521  1.00  0.39           O
ATOM   4182  CB  ARG B 525       6.152 -66.998  40.203  1.00  0.39           C
ATOM   4183  CG  ARG B 525       7.362 -67.194  39.253  1.00  0.39           C
ATOM   4184  CD  ARG B 525       8.773 -67.146  39.881  1.00  0.39           C
ATOM   4185  NE  ARG B 525       9.107 -65.726  40.304  1.00  0.39           N
ATOM   4186  CZ  ARG B 525       8.940 -65.179  41.522  1.00  0.39           C
ATOM   4187  NH1 ARG B 525       9.187 -63.895  41.711  1.00  0.39           N
ATOM   4188  NH2 ARG B 525       8.576 -65.846  42.617  1.00  0.39           N
ATOM   4189  OXT ARG B 525       7.666 -68.504  42.570  1.00  0.39           O
TER    4190      ARG B 525
ATOM   4191  N   ALA A   1     -49.072 -37.724 -28.615  1.00  0.70           N
ATOM   4192  CA  ALA A   1     -50.186 -37.249 -27.730  1.00  0.70           C
ATOM   4193  C   ALA A   1     -49.914 -36.015 -26.876  1.00  0.70           C
ATOM   4194  O   ALA A   1     -49.395 -36.101 -25.762  1.00  0.70           O
ATOM   4195  CB  ALA A   1     -50.682 -38.439 -26.881  1.00  0.70           C
ATOM   4196  N   GLY A   2     -50.233 -34.821 -27.420  1.00  0.78           N
ATOM   4197  CA  GLY A   2     -50.053 -33.545 -26.737  1.00  0.78           C
ATOM   4198  C   GLY A   2     -49.326 -32.579 -27.622  1.00  0.78           C
ATOM   4199  O   GLY A   2     -48.702 -32.991 -28.600  1.00  0.78           O
ATOM   4200  N   ASN A   3     -49.369 -31.279 -27.291  1.00  0.67           N
ATOM   4201  CA  ASN A   3     -48.937 -30.222 -28.189  1.00  0.67           C
ATOM   4202  C   ASN A   3     -47.639 -29.592 -27.707  1.00  0.67           C
ATOM   4203  O   ASN A   3     -47.518 -29.079 -26.598  1.00  0.67           O
ATOM   4204  CB  ASN A   3     -50.022 -29.112 -28.326  1.00  0.67           C
ATOM   4205  CG  ASN A   3     -50.900 -29.334 -29.556  1.00  0.67           C
ATOM   4206  OD1 ASN A   3     -51.027 -30.439 -30.086  1.00  0.67           O
ATOM   4207  ND2 ASN A   3     -51.507 -28.231 -30.056  1.00  0.67           N
ATOM   4208  N   ALA A   4     -46.589 -29.618 -28.542  1.00  0.72           N
ATOM   4209  CA  ALA A   4     -45.311 -29.047 -28.179  1.00  0.72           C
ATOM   4210  C   ALA A   4     -45.296 -27.524 -28.158  1.00  0.72           C
ATOM   4211  O   ALA A   4     -45.625 -26.870 -29.142  1.00  0.72           O
ATOM   4212  CB  ALA A   4     -44.207 -29.548 -29.118  1.00  0.72           C
ATOM   4213  N   THR A   5     -44.897 -26.921 -27.015  1.00  0.66           N
ATOM   4214  CA  THR A   5     -44.857 -25.464 -26.913  1.00  0.66           C
ATOM   4215  C   THR A   5     -43.447 -24.921 -27.075  1.00  0.66           C
ATOM   4216  O   THR A   5     -43.270 -23.753 -27.374  1.00  0.66           O
ATOM   4217  CB  THR A   5     -45.449 -24.945 -25.597  1.00  0.66           C
ATOM   4218  OG1 THR A   5     -45.891 -23.597 -25.690  1.00  0.66           O
ATOM   4219  CG2 THR A   5     -44.434 -24.996 -24.457  1.00  0.66           C
ATOM   4220  N   GLU A   6     -42.383 -25.728 -26.923  1.00  0.69           N
ATOM   4221  CA  GLU A   6     -41.023 -25.204 -26.846  1.00  0.69           C
ATOM   4222  C   GLU A   6     -40.018 -25.970 -27.684  1.00  0.69           C
ATOM   4223  O   GLU A   6     -40.301 -27.057 -28.195  1.00  0.69           O
ATOM   4224  CB  GLU A   6     -40.528 -25.198 -25.378  1.00  0.69           C
ATOM   4225  CG  GLU A   6     -40.742 -23.840 -24.672  1.00  0.69           C
ATOM   4226  CD  GLU A   6     -39.754 -22.768 -25.122  1.00  0.69           C
ATOM   4227  OE1 GLU A   6     -39.887 -21.621 -24.619  1.00  0.69           O
ATOM   4228  OE2 GLU A   6     -38.854 -23.021 -25.963  1.00  0.69           O
ATOM   4229  N   VAL A   7     -38.812 -25.385 -27.860  1.00  0.75           N
ATOM   4230  CA  VAL A   7     -37.780 -25.876 -28.770  1.00  0.75           C
ATOM   4231  C   VAL A   7     -36.469 -26.158 -28.019  1.00  0.75           C
ATOM   4232  O   VAL A   7     -36.176 -25.453 -27.048  1.00  0.75           O
ATOM   4233  CB  VAL A   7     -37.576 -24.969 -30.005  1.00  0.75           C
ATOM   4234  CG1 VAL A   7     -38.564 -23.785 -29.979  1.00  0.75           C
ATOM   4235  CG2 VAL A   7     -36.135 -24.434 -30.158  1.00  0.75           C
ATOM   4236  N   PRO A   8     -35.623 -27.148 -28.397  1.00  0.78           N
ATOM   4237  CA  PRO A   8     -34.523 -27.633 -27.565  1.00  0.78           C
ATOM   4238  C   PRO A   8     -33.496 -26.618 -27.142  1.00  0.78           C
ATOM   4239  O   PRO A   8     -32.835 -26.822 -26.130  1.00  0.78           O
ATOM   4240  CB  PRO A   8     -33.866 -28.732 -28.409  1.00  0.78           C
ATOM   4241  CG  PRO A   8     -35.046 -29.344 -29.152  1.00  0.78           C
ATOM   4242  CD  PRO A   8     -35.963 -28.146 -29.415  1.00  0.78           C
ATOM   4243  N   ALA A   9     -33.322 -25.537 -27.919  1.00  0.70           N
ATOM   4244  CA  ALA A   9     -32.332 -24.516 -27.675  1.00  0.70           C
ATOM   4245  C   ALA A   9     -32.513 -23.806 -26.328  1.00  0.70           C
ATOM   4246  O   ALA A   9     -31.545 -23.460 -25.656  1.00  0.70           O
ATOM   4247  CB  ALA A   9     -32.351 -23.541 -28.870  1.00  0.70           C
ATOM   4248  N   ASN A  10     -33.778 -23.617 -25.893  1.00  0.78           N
ATOM   4249  CA  ASN A  10     -34.105 -22.975 -24.635  1.00  0.78           C
ATOM   4250  C   ASN A  10     -34.076 -23.903 -23.427  1.00  0.78           C
ATOM   4251  O   ASN A  10     -34.039 -23.426 -22.299  1.00  0.78           O
ATOM   4252  CB  ASN A  10     -35.535 -22.385 -24.685  1.00  0.78           C
ATOM   4253  CG  ASN A  10     -35.593 -21.070 -25.440  1.00  0.78           C
ATOM   4254  OD1 ASN A  10     -34.604 -20.380 -25.697  1.00  0.78           O
ATOM   4255  ND2 ASN A  10     -36.833 -20.653 -25.773  1.00  0.78           N
ATOM   4256  N   SER A  11     -34.074 -25.239 -23.599  1.00  0.74           N
ATOM   4257  CA  SER A  11     -34.382 -26.212 -22.550  1.00  0.74           C
ATOM   4258  C   SER A  11     -33.618 -26.061 -21.258  1.00  0.74           C
ATOM   4259  O   SER A  11     -34.175 -26.130 -20.173  1.00  0.74           O
ATOM   4260  CB  SER A  11     -34.057 -27.643 -23.030  1.00  0.74           C
ATOM   4261  OG  SER A  11     -34.915 -28.016 -24.105  1.00  0.74           O
ATOM   4262  N   THR A  12     -32.301 -25.818 -21.363  1.00  0.76           N
ATOM   4263  CA  THR A  12     -31.422 -25.644 -20.230  1.00  0.76           C
ATOM   4264  C   THR A  12     -31.775 -24.408 -19.432  1.00  0.76           C
ATOM   4265  O   THR A  12     -31.776 -24.406 -18.206  1.00  0.76           O
ATOM   4266  CB  THR A  12     -29.966 -25.581 -20.675  1.00  0.76           C
ATOM   4267  OG1 THR A  12     -29.776 -24.562 -21.650  1.00  0.76           O
ATOM   4268  CG2 THR A  12     -29.609 -26.920 -21.346  1.00  0.76           C
ATOM   4269  N   VAL A  13     -32.100 -23.302 -20.123  1.00  0.86           N
ATOM   4270  CA  VAL A  13     -32.261 -22.011 -19.494  1.00  0.86           C
ATOM   4271  C   VAL A  13     -33.500 -21.955 -18.649  1.00  0.86           C
ATOM   4272  O   VAL A  13     -33.498 -21.538 -17.498  1.00  0.86           O
ATOM   4273  CB  VAL A  13     -32.366 -20.882 -20.507  1.00  0.86           C
ATOM   4274  CG1 VAL A  13     -31.976 -19.574 -19.803  1.00  0.86           C
ATOM   4275  CG2 VAL A  13     -31.442 -21.162 -21.703  1.00  0.86           C
ATOM   4276  N   LEU A  14     -34.610 -22.439 -19.240  1.00  0.83           N
ATOM   4277  CA  LEU A  14     -35.910 -22.421 -18.617  1.00  0.83           C
ATOM   4278  C   LEU A  14     -35.941 -23.279 -17.378  1.00  0.83           C
ATOM   4279  O   LEU A  14     -36.446 -22.873 -16.340  1.00  0.83           O
ATOM   4280  CB  LEU A  14     -37.032 -22.924 -19.556  1.00  0.83           C
ATOM   4281  CG  LEU A  14     -36.917 -22.510 -21.032  1.00  0.83           C
ATOM   4282  CD1 LEU A  14     -37.751 -23.442 -21.913  1.00  0.83           C
ATOM   4283  CD2 LEU A  14     -37.341 -21.069 -21.308  1.00  0.83           C
ATOM   4284  N   SER A  15     -35.356 -24.490 -17.449  1.00  0.79           N
ATOM   4285  CA  SER A  15     -35.284 -25.407 -16.334  1.00  0.79           C
ATOM   4286  C   SER A  15     -34.508 -24.863 -15.151  1.00  0.79           C
ATOM   4287  O   SER A  15     -34.970 -24.924 -14.014  1.00  0.79           O
ATOM   4288  CB  SER A  15     -34.707 -26.761 -16.802  1.00  0.79           C
ATOM   4289  OG  SER A  15     -33.432 -26.629 -17.417  1.00  0.79           O
ATOM   4290  N   PHE A  16     -33.346 -24.231 -15.414  1.00  0.79           N
ATOM   4291  CA  PHE A  16     -32.574 -23.516 -14.418  1.00  0.79           C
ATOM   4292  C   PHE A  16     -33.361 -22.389 -13.753  1.00  0.79           C
ATOM   4293  O   PHE A  16     -33.519 -22.368 -12.534  1.00  0.79           O
ATOM   4294  CB  PHE A  16     -31.261 -22.985 -15.077  1.00  0.79           C
ATOM   4295  CG  PHE A  16     -30.397 -22.127 -14.181  1.00  0.79           C
ATOM   4296  CD1 PHE A  16     -30.215 -22.434 -12.821  1.00  0.79           C
ATOM   4297  CD2 PHE A  16     -29.774 -20.979 -14.703  1.00  0.79           C
ATOM   4298  CE1 PHE A  16     -29.460 -21.594 -11.996  1.00  0.79           C
ATOM   4299  CE2 PHE A  16     -29.019 -20.140 -13.876  1.00  0.79           C
ATOM   4300  CZ  PHE A  16     -28.870 -20.442 -12.523  1.00  0.79           C
ATOM   4301  N   CYS A  17     -33.953 -21.468 -14.538  1.00  0.85           N
ATOM   4302  CA  CYS A  17     -34.727 -20.361 -13.996  1.00  0.85           C
ATOM   4303  C   CYS A  17     -35.957 -20.816 -13.245  1.00  0.85           C
ATOM   4304  O   CYS A  17     -36.347 -20.244 -12.230  1.00  0.85           O
ATOM   4305  CB  CYS A  17     -35.135 -19.385 -15.113  1.00  0.85           C
ATOM   4306  SG  CYS A  17     -33.638 -18.707 -15.902  1.00  0.85           S
ATOM   4307  N   ALA A  18     -36.589 -21.899 -13.726  1.00  0.80           N
ATOM   4308  CA  ALA A  18     -37.713 -22.520 -13.087  1.00  0.80           C
ATOM   4309  C   ALA A  18     -37.396 -23.052 -11.698  1.00  0.80           C
ATOM   4310  O   ALA A  18     -38.195 -22.898 -10.774  1.00  0.80           O
ATOM   4311  CB  ALA A  18     -38.238 -23.683 -13.953  1.00  0.80           C
ATOM   4312  N   PHE A  19     -36.242 -23.719 -11.509  1.00  0.72           N
ATOM   4313  CA  PHE A  19     -35.874 -24.269 -10.213  1.00  0.72           C
ATOM   4314  C   PHE A  19     -35.354 -23.233  -9.225  1.00  0.72           C
ATOM   4315  O   PHE A  19     -35.307 -23.486  -8.027  1.00  0.72           O
ATOM   4316  CB  PHE A  19     -34.804 -25.387 -10.347  1.00  0.72           C
ATOM   4317  CG  PHE A  19     -35.433 -26.747 -10.457  1.00  0.72           C
ATOM   4318  CD1 PHE A  19     -35.986 -27.357  -9.318  1.00  0.72           C
ATOM   4319  CD2 PHE A  19     -35.420 -27.461 -11.665  1.00  0.72           C
ATOM   4320  CE1 PHE A  19     -36.483 -28.663  -9.384  1.00  0.72           C
ATOM   4321  CE2 PHE A  19     -35.915 -28.770 -11.730  1.00  0.72           C
ATOM   4322  CZ  PHE A  19     -36.442 -29.376 -10.586  1.00  0.72           C
ATOM   4323  N   ALA A  20     -34.935 -22.043  -9.671  1.00  0.81           N
ATOM   4324  CA  ALA A  20     -34.305 -21.055  -8.828  1.00  0.81           C
ATOM   4325  C   ALA A  20     -35.142 -20.466  -7.691  1.00  0.81           C
ATOM   4326  O   ALA A  20     -36.365 -20.312  -7.752  1.00  0.81           O
ATOM   4327  CB  ALA A  20     -33.734 -19.943  -9.712  1.00  0.81           C
ATOM   4328  N   VAL A  21     -34.492 -20.105  -6.561  1.00  0.78           N
ATOM   4329  CA  VAL A  21     -35.138 -19.254  -5.563  1.00  0.78           C
ATOM   4330  C   VAL A  21     -35.430 -17.890  -6.122  1.00  0.78           C
ATOM   4331  O   VAL A  21     -36.576 -17.436  -6.095  1.00  0.78           O
ATOM   4332  CB  VAL A  21     -34.363 -19.074  -4.268  1.00  0.78           C
ATOM   4333  CG1 VAL A  21     -35.065 -19.946  -3.217  1.00  0.78           C
ATOM   4334  CG2 VAL A  21     -32.874 -19.406  -4.457  1.00  0.78           C
ATOM   4335  N   ASP A  22     -34.404 -17.278  -6.717  1.00  0.83           N
ATOM   4336  CA  ASP A  22     -34.484 -16.040  -7.436  1.00  0.83           C
ATOM   4337  C   ASP A  22     -34.425 -16.332  -8.930  1.00  0.83           C
ATOM   4338  O   ASP A  22     -33.370 -16.593  -9.507  1.00  0.83           O
ATOM   4339  CB  ASP A  22     -33.294 -15.162  -6.992  1.00  0.83           C
ATOM   4340  CG  ASP A  22     -33.415 -13.727  -7.473  1.00  0.83           C
ATOM   4341  OD1 ASP A  22     -33.918 -13.523  -8.607  1.00  0.83           O
ATOM   4342  OD2 ASP A  22     -32.956 -12.823  -6.735  1.00  0.83           O
ATOM   4343  N   ALA A  23     -35.585 -16.283  -9.608  1.00  0.89           N
ATOM   4344  CA  ALA A  23     -35.666 -16.514 -11.031  1.00  0.89           C
ATOM   4345  C   ALA A  23     -35.027 -15.398 -11.837  1.00  0.89           C
ATOM   4346  O   ALA A  23     -34.466 -15.610 -12.912  1.00  0.89           O
ATOM   4347  CB  ALA A  23     -37.148 -16.663 -11.405  1.00  0.89           C
ATOM   4348  N   ALA A  24     -35.108 -14.161 -11.312  1.00  0.90           N
ATOM   4349  CA  ALA A  24     -34.551 -13.004 -11.959  1.00  0.90           C
ATOM   4350  C   ALA A  24     -33.033 -13.005 -11.979  1.00  0.90           C
ATOM   4351  O   ALA A  24     -32.406 -12.785 -13.016  1.00  0.90           O
ATOM   4352  CB  ALA A  24     -35.010 -11.730 -11.230  1.00  0.90           C
ATOM   4353  N   LYS A  25     -32.401 -13.277 -10.823  1.00  0.84           N
ATOM   4354  CA  LYS A  25     -30.968 -13.394 -10.700  1.00  0.84           C
ATOM   4355  C   LYS A  25     -30.413 -14.568 -11.479  1.00  0.84           C
ATOM   4356  O   LYS A  25     -29.414 -14.423 -12.179  1.00  0.84           O
ATOM   4357  CB  LYS A  25     -30.474 -13.380  -9.232  1.00  0.84           C
ATOM   4358  CG  LYS A  25     -29.003 -13.767  -9.117  1.00  0.84           C
ATOM   4359  CD  LYS A  25     -28.326 -13.364  -7.811  1.00  0.84           C
ATOM   4360  CE  LYS A  25     -26.809 -13.587  -7.860  1.00  0.84           C
ATOM   4361  NZ  LYS A  25     -26.222 -12.942  -9.055  1.00  0.84           N
ATOM   4362  N   ALA A  26     -31.083 -15.737 -11.449  1.00  0.90           N
ATOM   4363  CA  ALA A  26     -30.640 -16.906 -12.175  1.00  0.90           C
ATOM   4364  C   ALA A  26     -30.478 -16.670 -13.674  1.00  0.90           C
ATOM   4365  O   ALA A  26     -29.464 -17.022 -14.269  1.00  0.90           O
ATOM   4366  CB  ALA A  26     -31.660 -18.029 -11.931  1.00  0.90           C
ATOM   4367  N   TYR A  27     -31.455 -15.988 -14.310  1.00  0.87           N
ATOM   4368  CA  TYR A  27     -31.368 -15.626 -15.712  1.00  0.87           C
ATOM   4369  C   TYR A  27     -30.218 -14.664 -16.002  1.00  0.87           C
ATOM   4370  O   TYR A  27     -29.445 -14.866 -16.935  1.00  0.87           O
ATOM   4371  CB  TYR A  27     -32.749 -15.077 -16.188  1.00  0.87           C
ATOM   4372  CG  TYR A  27     -32.886 -14.982 -17.693  1.00  0.87           C
ATOM   4373  CD1 TYR A  27     -32.601 -16.087 -18.512  1.00  0.87           C
ATOM   4374  CD2 TYR A  27     -33.296 -13.785 -18.306  1.00  0.87           C
ATOM   4375  CE1 TYR A  27     -32.610 -15.960 -19.911  1.00  0.87           C
ATOM   4376  CE2 TYR A  27     -33.304 -13.660 -19.703  1.00  0.87           C
ATOM   4377  CZ  TYR A  27     -32.944 -14.737 -20.507  1.00  0.87           C
ATOM   4378  OH  TYR A  27     -32.956 -14.595 -21.910  1.00  0.87           O
ATOM   4379  N   LYS A  28     -30.027 -13.630 -15.153  1.00  0.82           N
ATOM   4380  CA  LYS A  28     -28.956 -12.667 -15.311  1.00  0.82           C
ATOM   4381  C   LYS A  28     -27.587 -13.321 -15.239  1.00  0.82           C
ATOM   4382  O   LYS A  28     -26.735 -13.107 -16.096  1.00  0.82           O
ATOM   4383  CB  LYS A  28     -29.095 -11.558 -14.241  1.00  0.82           C
ATOM   4384  CG  LYS A  28     -30.351 -10.692 -14.441  1.00  0.82           C
ATOM   4385  CD  LYS A  28     -30.599  -9.721 -13.272  1.00  0.82           C
ATOM   4386  CE  LYS A  28     -31.291  -8.425 -13.712  1.00  0.82           C
ATOM   4387  NZ  LYS A  28     -31.570  -7.535 -12.559  1.00  0.82           N
ATOM   4388  N   ASP A  29     -27.387 -14.213 -14.252  1.00  0.83           N
ATOM   4389  CA  ASP A  29     -26.155 -14.953 -14.110  1.00  0.83           C
ATOM   4390  C   ASP A  29     -25.902 -15.884 -15.290  1.00  0.83           C
ATOM   4391  O   ASP A  29     -24.785 -15.986 -15.783  1.00  0.83           O
ATOM   4392  CB  ASP A  29     -26.113 -15.730 -12.782  1.00  0.83           C
ATOM   4393  CG  ASP A  29     -26.249 -14.801 -11.593  1.00  0.83           C
ATOM   4394  OD1 ASP A  29     -25.891 -13.599 -11.648  1.00  0.83           O
ATOM   4395  OD2 ASP A  29     -26.677 -15.277 -10.511  1.00  0.83           O
ATOM   4396  N   TYR A  30     -26.957 -16.549 -15.811  1.00  0.83           N
ATOM   4397  CA  TYR A  30     -26.866 -17.429 -16.964  1.00  0.83           C
ATOM   4398  C   TYR A  30     -26.362 -16.727 -18.223  1.00  0.83           C
ATOM   4399  O   TYR A  30     -25.526 -17.268 -18.944  1.00  0.83           O
ATOM   4400  CB  TYR A  30     -28.228 -18.129 -17.229  1.00  0.83           C
ATOM   4401  CG  TYR A  30     -28.139 -19.165 -18.322  1.00  0.83           C
ATOM   4402  CD1 TYR A  30     -27.648 -20.458 -18.068  1.00  0.83           C
ATOM   4403  CD2 TYR A  30     -28.528 -18.831 -19.629  1.00  0.83           C
ATOM   4404  CE1 TYR A  30     -27.547 -21.396 -19.108  1.00  0.83           C
ATOM   4405  CE2 TYR A  30     -28.436 -19.771 -20.662  1.00  0.83           C
ATOM   4406  CZ  TYR A  30     -27.940 -21.052 -20.404  1.00  0.83           C
ATOM   4407  OH  TYR A  30     -27.860 -21.993 -21.450  1.00  0.83           O
ATOM   4408  N   LEU A  31     -26.819 -15.484 -18.487  1.00  0.80           N
ATOM   4409  CA  LEU A  31     -26.286 -14.669 -19.568  1.00  0.80           C
ATOM   4410  C   LEU A  31     -24.789 -14.404 -19.437  1.00  0.80           C
ATOM   4411  O   LEU A  31     -24.039 -14.474 -20.410  1.00  0.80           O
ATOM   4412  CB  LEU A  31     -27.038 -13.318 -19.672  1.00  0.80           C
ATOM   4413  CG  LEU A  31     -28.450 -13.394 -20.292  1.00  0.80           C
ATOM   4414  CD1 LEU A  31     -29.095 -11.999 -20.309  1.00  0.80           C
ATOM   4415  CD2 LEU A  31     -28.424 -13.954 -21.721  1.00  0.80           C
ATOM   4416  N   ALA A  32     -24.303 -14.143 -18.208  1.00  0.78           N
ATOM   4417  CA  ALA A  32     -22.897 -13.939 -17.922  1.00  0.78           C
ATOM   4418  C   ALA A  32     -22.008 -15.147 -18.222  1.00  0.78           C
ATOM   4419  O   ALA A  32     -20.847 -15.008 -18.593  1.00  0.78           O
ATOM   4420  CB  ALA A  32     -22.734 -13.473 -16.465  1.00  0.78           C
ATOM   4421  N   SER A  33     -22.559 -16.369 -18.118  1.00  0.77           N
ATOM   4422  CA  SER A  33     -21.846 -17.622 -18.315  1.00  0.77           C
ATOM   4423  C   SER A  33     -21.566 -17.994 -19.753  1.00  0.77           C
ATOM   4424  O   SER A  33     -21.049 -19.075 -20.022  1.00  0.77           O
ATOM   4425  CB  SER A  33     -22.695 -18.810 -17.821  1.00  0.77           C
ATOM   4426  OG  SER A  33     -23.071 -18.606 -16.472  1.00  0.77           O
ATOM   4427  N   GLY A  34     -21.923 -17.149 -20.741  1.00  0.77           N
ATOM   4428  CA  GLY A  34     -21.846 -17.564 -22.138  1.00  0.77           C
ATOM   4429  C   GLY A  34     -23.062 -18.328 -22.588  1.00  0.77           C
ATOM   4430  O   GLY A  34     -23.083 -18.903 -23.673  1.00  0.77           O
ATOM   4431  N   GLY A  35     -24.122 -18.374 -21.757  1.00  0.81           N
ATOM   4432  CA  GLY A  35     -25.388 -18.978 -22.138  1.00  0.81           C
ATOM   4433  C   GLY A  35     -26.182 -18.130 -23.102  1.00  0.81           C
ATOM   4434  O   GLY A  35     -26.259 -16.913 -22.973  1.00  0.81           O
ATOM   4435  N   GLN A  36     -26.831 -18.761 -24.101  1.00  0.80           N
ATOM   4436  CA  GLN A  36     -27.709 -18.062 -25.027  1.00  0.80           C
ATOM   4437  C   GLN A  36     -28.961 -17.457 -24.362  1.00  0.80           C
ATOM   4438  O   GLN A  36     -29.530 -18.103 -23.478  1.00  0.80           O
ATOM   4439  CB  GLN A  36     -28.148 -18.996 -26.188  1.00  0.80           C
ATOM   4440  CG  GLN A  36     -27.014 -19.412 -27.160  1.00  0.80           C
ATOM   4441  CD  GLN A  36     -26.643 -18.295 -28.140  1.00  0.80           C
ATOM   4442  OE1 GLN A  36     -26.855 -17.104 -27.916  1.00  0.80           O
ATOM   4443  NE2 GLN A  36     -26.064 -18.686 -29.299  1.00  0.80           N
ATOM   4444  N   PRO A  37     -29.437 -16.257 -24.718  1.00  0.89           N
ATOM   4445  CA  PRO A  37     -30.736 -15.746 -24.287  1.00  0.89           C
ATOM   4446  C   PRO A  37     -31.914 -16.546 -24.823  1.00  0.89           C
ATOM   4447  O   PRO A  37     -31.776 -17.317 -25.772  1.00  0.89           O
ATOM   4448  CB  PRO A  37     -30.770 -14.297 -24.808  1.00  0.89           C
ATOM   4449  CG  PRO A  37     -29.812 -14.286 -26.000  1.00  0.89           C
ATOM   4450  CD  PRO A  37     -28.762 -15.334 -25.632  1.00  0.89           C
ATOM   4451  N   ILE A  38     -33.100 -16.373 -24.208  1.00  0.87           N
ATOM   4452  CA  ILE A  38     -34.338 -17.015 -24.624  1.00  0.87           C
ATOM   4453  C   ILE A  38     -34.775 -16.699 -26.051  1.00  0.87           C
ATOM   4454  O   ILE A  38     -35.025 -15.549 -26.414  1.00  0.87           O
ATOM   4455  CB  ILE A  38     -35.484 -16.708 -23.658  1.00  0.87           C
ATOM   4456  CG1 ILE A  38     -35.292 -17.524 -22.361  1.00  0.87           C
ATOM   4457  CG2 ILE A  38     -36.863 -17.015 -24.287  1.00  0.87           C
ATOM   4458  CD1 ILE A  38     -36.390 -17.296 -21.317  1.00  0.87           C
ATOM   4459  N   THR A  39     -34.964 -17.745 -26.884  1.00  0.81           N
ATOM   4460  CA  THR A  39     -35.468 -17.612 -28.249  1.00  0.81           C
ATOM   4461  C   THR A  39     -36.943 -17.981 -28.337  1.00  0.81           C
ATOM   4462  O   THR A  39     -37.599 -18.292 -27.343  1.00  0.81           O
ATOM   4463  CB  THR A  39     -34.640 -18.382 -29.282  1.00  0.81           C
ATOM   4464  OG1 THR A  39     -34.942 -18.001 -30.627  1.00  0.81           O
ATOM   4465  CG2 THR A  39     -34.870 -19.894 -29.126  1.00  0.81           C
ATOM   4466  N   ASN A  40     -37.526 -17.916 -29.550  1.00  0.69           N
ATOM   4467  CA  ASN A  40     -38.860 -18.380 -29.893  1.00  0.69           C
ATOM   4468  C   ASN A  40     -40.007 -17.513 -29.379  1.00  0.69           C
ATOM   4469  O   ASN A  40     -41.169 -17.761 -29.681  1.00  0.69           O
ATOM   4470  CB  ASN A  40     -39.002 -19.892 -29.533  1.00  0.69           C
ATOM   4471  CG  ASN A  40     -40.233 -20.597 -30.089  1.00  0.69           C
ATOM   4472  OD1 ASN A  40     -40.939 -21.324 -29.383  1.00  0.69           O
ATOM   4473  ND2 ASN A  40     -40.470 -20.452 -31.403  1.00  0.69           N
ATOM   4474  N   CYS A  41     -39.739 -16.418 -28.650  1.00  0.76           N
ATOM   4475  CA  CYS A  41     -40.767 -15.485 -28.222  1.00  0.76           C
ATOM   4476  C   CYS A  41     -41.552 -14.842 -29.362  1.00  0.76           C
ATOM   4477  O   CYS A  41     -40.990 -14.430 -30.372  1.00  0.76           O
ATOM   4478  CB  CYS A  41     -40.172 -14.381 -27.303  1.00  0.76           C
ATOM   4479  SG  CYS A  41     -38.438 -13.993 -27.737  1.00  0.76           S
ATOM   4480  N   VAL A  42     -42.895 -14.755 -29.211  1.00  0.79           N
ATOM   4481  CA  VAL A  42     -43.828 -14.308 -30.240  1.00  0.79           C
ATOM   4482  C   VAL A  42     -43.534 -12.928 -30.826  1.00  0.79           C
ATOM   4483  O   VAL A  42     -43.581 -11.908 -30.138  1.00  0.79           O
ATOM   4484  CB  VAL A  42     -45.288 -14.432 -29.780  1.00  0.79           C
ATOM   4485  CG1 VAL A  42     -45.439 -13.966 -28.327  1.00  0.79           C
ATOM   4486  CG2 VAL A  42     -46.256 -13.640 -30.681  1.00  0.79           C
ATOM   4487  N   LYS A  43     -43.243 -12.895 -32.145  1.00  0.69           N
ATOM   4488  CA  LYS A  43     -42.690 -11.752 -32.837  1.00  0.69           C
ATOM   4489  C   LYS A  43     -43.644 -11.231 -33.894  1.00  0.69           C
ATOM   4490  O   LYS A  43     -44.252 -12.011 -34.630  1.00  0.69           O
ATOM   4491  CB  LYS A  43     -41.354 -12.120 -33.537  1.00  0.69           C
ATOM   4492  CG  LYS A  43     -40.458 -10.891 -33.702  1.00  0.69           C
ATOM   4493  CD  LYS A  43     -39.369 -10.950 -34.782  1.00  0.69           C
ATOM   4494  CE  LYS A  43     -38.578  -9.648 -34.628  1.00  0.69           C
ATOM   4495  NZ  LYS A  43     -37.668  -9.301 -35.735  1.00  0.69           N
ATOM   4496  N   MET A  44     -43.807  -9.894 -33.986  1.00  0.68           N
ATOM   4497  CA  MET A  44     -44.917  -9.298 -34.701  1.00  0.68           C
ATOM   4498  C   MET A  44     -44.558  -8.697 -36.038  1.00  0.68           C
ATOM   4499  O   MET A  44     -43.612  -7.927 -36.181  1.00  0.68           O
ATOM   4500  CB  MET A  44     -45.687  -8.221 -33.880  1.00  0.68           C
ATOM   4501  CG  MET A  44     -46.521  -8.744 -32.691  1.00  0.68           C
ATOM   4502  SD  MET A  44     -46.856 -10.531 -32.760  1.00  0.68           S
ATOM   4503  CE  MET A  44     -48.525 -10.348 -32.181  1.00  0.68           C
ATOM   4504  N   LEU A  45     -45.363  -9.024 -37.070  1.00  0.72           N
ATOM   4505  CA  LEU A  45     -45.464  -8.226 -38.276  1.00  0.72           C
ATOM   4506  C   LEU A  45     -46.295  -6.991 -37.946  1.00  0.72           C
ATOM   4507  O   LEU A  45     -47.436  -7.088 -37.502  1.00  0.72           O
ATOM   4508  CB  LEU A  45     -46.129  -9.053 -39.408  1.00  0.72           C
ATOM   4509  CG  LEU A  45     -45.915  -8.628 -40.884  1.00  0.72           C
ATOM   4510  CD1 LEU A  45     -45.192  -7.289 -41.088  1.00  0.72           C
ATOM   4511  CD2 LEU A  45     -45.195  -9.753 -41.648  1.00  0.72           C
ATOM   4512  N   CYS A  46     -45.726  -5.787 -38.100  1.00  0.78           N
ATOM   4513  CA  CYS A  46     -46.355  -4.568 -37.657  1.00  0.78           C
ATOM   4514  C   CYS A  46     -46.087  -3.522 -38.715  1.00  0.78           C
ATOM   4515  O   CYS A  46     -45.258  -3.707 -39.601  1.00  0.78           O
ATOM   4516  CB  CYS A  46     -45.816  -4.107 -36.270  1.00  0.78           C
ATOM   4517  SG  CYS A  46     -46.762  -2.720 -35.525  1.00  0.78           S
ATOM   4518  N   THR A  47     -46.817  -2.396 -38.665  1.00  0.79           N
ATOM   4519  CA  THR A  47     -46.633  -1.252 -39.544  1.00  0.79           C
ATOM   4520  C   THR A  47     -45.402  -0.441 -39.159  1.00  0.79           C
ATOM   4521  O   THR A  47     -44.832   0.293 -39.960  1.00  0.79           O
ATOM   4522  CB  THR A  47     -47.908  -0.392 -39.540  1.00  0.79           C
ATOM   4523  OG1 THR A  47     -47.793   0.829 -40.255  1.00  0.79           O
ATOM   4524  CG2 THR A  47     -48.352  -0.076 -38.106  1.00  0.79           C
ATOM   4525  N   HIS A  48     -44.955  -0.580 -37.892  1.00  0.73           N
ATOM   4526  CA  HIS A  48     -43.844   0.148 -37.296  1.00  0.73           C
ATOM   4527  C   HIS A  48     -44.062   1.655 -37.302  1.00  0.73           C
ATOM   4528  O   HIS A  48     -43.141   2.468 -37.339  1.00  0.73           O
ATOM   4529  CB  HIS A  48     -42.454  -0.288 -37.822  1.00  0.73           C
ATOM   4530  CG  HIS A  48     -41.928  -1.598 -37.288  1.00  0.73           C
ATOM   4531  ND1 HIS A  48     -42.683  -2.758 -37.351  1.00  0.73           N
ATOM   4532  CD2 HIS A  48     -40.675  -1.886 -36.844  1.00  0.73           C
ATOM   4533  CE1 HIS A  48     -41.871  -3.720 -36.956  1.00  0.73           C
ATOM   4534  NE2 HIS A  48     -40.644  -3.249 -36.638  1.00  0.73           N
ATOM   4535  N   THR A  49     -45.336   2.039 -37.147  1.00  0.83           N
ATOM   4536  CA  THR A  49     -45.771   3.342 -36.690  1.00  0.83           C
ATOM   4537  C   THR A  49     -46.828   3.042 -35.658  1.00  0.83           C
ATOM   4538  O   THR A  49     -47.432   1.967 -35.674  1.00  0.83           O
ATOM   4539  CB  THR A  49     -46.321   4.280 -37.769  1.00  0.83           C
ATOM   4540  OG1 THR A  49     -46.559   5.588 -37.256  1.00  0.83           O
ATOM   4541  CG2 THR A  49     -47.640   3.766 -38.367  1.00  0.83           C
ATOM   4542  N   GLY A  50     -47.062   3.967 -34.721  1.00  0.73           N
ATOM   4543  CA  GLY A  50     -47.929   3.729 -33.585  1.00  0.73           C
ATOM   4544  C   GLY A  50     -47.376   4.442 -32.393  1.00  0.73           C
ATOM   4545  O   GLY A  50     -46.390   5.176 -32.468  1.00  0.73           O
ATOM   4546  N   THR A  51     -48.018   4.269 -31.234  1.00  0.81           N
ATOM   4547  CA  THR A  51     -47.491   4.682 -29.945  1.00  0.81           C
ATOM   4548  C   THR A  51     -46.207   3.946 -29.575  1.00  0.81           C
ATOM   4549  O   THR A  51     -46.105   2.734 -29.699  1.00  0.81           O
ATOM   4550  CB  THR A  51     -48.492   4.502 -28.791  1.00  0.81           C
ATOM   4551  OG1 THR A  51     -49.789   4.174 -29.264  1.00  0.81           O
ATOM   4552  CG2 THR A  51     -48.680   5.839 -28.062  1.00  0.81           C
ATOM   4553  N   GLY A  52     -45.188   4.638 -29.027  1.00  0.86           N
ATOM   4554  CA  GLY A  52     -43.948   3.982 -28.598  1.00  0.86           C
ATOM   4555  C   GLY A  52     -44.028   3.257 -27.282  1.00  0.86           C
ATOM   4556  O   GLY A  52     -43.035   2.721 -26.799  1.00  0.86           O
ATOM   4557  N   GLN A  53     -45.197   3.269 -26.620  1.00  0.80           N
ATOM   4558  CA  GLN A  53     -45.359   2.772 -25.270  1.00  0.80           C
ATOM   4559  C   GLN A  53     -45.028   1.299 -25.124  1.00  0.80           C
ATOM   4560  O   GLN A  53     -45.357   0.475 -25.967  1.00  0.80           O
ATOM   4561  CB  GLN A  53     -46.763   3.076 -24.707  1.00  0.80           C
ATOM   4562  CG  GLN A  53     -47.116   4.569 -24.870  1.00  0.80           C
ATOM   4563  CD  GLN A  53     -48.299   5.008 -24.008  1.00  0.80           C
ATOM   4564  OE1 GLN A  53     -48.984   4.233 -23.343  1.00  0.80           O
ATOM   4565  NE2 GLN A  53     -48.547   6.336 -24.017  1.00  0.80           N
ATOM   4566  N   ALA A  54     -44.322   0.937 -24.038  1.00  0.88           N
ATOM   4567  CA  ALA A  54     -43.942  -0.433 -23.794  1.00  0.88           C
ATOM   4568  C   ALA A  54     -45.115  -1.350 -23.517  1.00  0.88           C
ATOM   4569  O   ALA A  54     -45.146  -2.456 -24.027  1.00  0.88           O
ATOM   4570  CB  ALA A  54     -42.976  -0.485 -22.612  1.00  0.88           C
ATOM   4571  N   ILE A  55     -46.109  -0.914 -22.723  1.00  0.76           N
ATOM   4572  CA  ILE A  55     -47.350  -1.641 -22.509  1.00  0.76           C
ATOM   4573  C   ILE A  55     -48.411  -1.144 -23.481  1.00  0.76           C
ATOM   4574  O   ILE A  55     -48.778   0.030 -23.497  1.00  0.76           O
ATOM   4575  CB  ILE A  55     -47.843  -1.571 -21.052  1.00  0.76           C
ATOM   4576  CG1 ILE A  55     -49.176  -2.344 -20.820  1.00  0.76           C
ATOM   4577  CG2 ILE A  55     -47.889  -0.118 -20.523  1.00  0.76           C
ATOM   4578  CD1 ILE A  55     -50.456  -1.495 -20.884  1.00  0.76           C
ATOM   4579  N   THR A  56     -48.952  -2.034 -24.338  1.00  0.82           N
ATOM   4580  CA  THR A  56     -49.993  -1.669 -25.295  1.00  0.82           C
ATOM   4581  C   THR A  56     -51.036  -2.772 -25.364  1.00  0.82           C
ATOM   4582  O   THR A  56     -50.760  -3.947 -25.135  1.00  0.82           O
ATOM   4583  CB  THR A  56     -49.523  -1.341 -26.719  1.00  0.82           C
ATOM   4584  OG1 THR A  56     -48.759  -2.368 -27.334  1.00  0.82           O
ATOM   4585  CG2 THR A  56     -48.666  -0.071 -26.711  1.00  0.82           C
ATOM   4586  N   VAL A  57     -52.317  -2.425 -25.631  1.00  0.75           N
ATOM   4587  CA  VAL A  57     -53.390  -3.408 -25.756  1.00  0.75           C
ATOM   4588  C   VAL A  57     -53.461  -4.041 -27.137  1.00  0.75           C
ATOM   4589  O   VAL A  57     -53.907  -5.177 -27.280  1.00  0.75           O
ATOM   4590  CB  VAL A  57     -54.734  -2.817 -25.335  1.00  0.75           C
ATOM   4591  CG1 VAL A  57     -55.207  -1.718 -26.308  1.00  0.75           C
ATOM   4592  CG2 VAL A  57     -55.786  -3.931 -25.146  1.00  0.75           C
ATOM   4593  N   THR A  58     -52.959  -3.338 -28.168  1.00  0.74           N
ATOM   4594  CA  THR A  58     -52.752  -3.831 -29.523  1.00  0.74           C
ATOM   4595  C   THR A  58     -51.313  -3.490 -29.911  1.00  0.74           C
ATOM   4596  O   THR A  58     -50.769  -2.551 -29.327  1.00  0.74           O
ATOM   4597  CB  THR A  58     -53.721  -3.234 -30.527  1.00  0.74           C
ATOM   4598  OG1 THR A  58     -53.696  -1.814 -30.468  1.00  0.74           O
ATOM   4599  CG2 THR A  58     -55.145  -3.678 -30.167  1.00  0.74           C
ATOM   4600  N   PRO A  59     -50.573  -4.203 -30.771  1.00  0.79           N
ATOM   4601  CA  PRO A  59     -49.189  -3.854 -31.072  1.00  0.79           C
ATOM   4602  C   PRO A  59     -48.995  -2.471 -31.679  1.00  0.79           C
ATOM   4603  O   PRO A  59     -49.509  -2.204 -32.763  1.00  0.79           O
ATOM   4604  CB  PRO A  59     -48.726  -4.969 -32.017  1.00  0.79           C
ATOM   4605  CG  PRO A  59     -49.993  -5.346 -32.775  1.00  0.79           C
ATOM   4606  CD  PRO A  59     -51.070  -5.231 -31.690  1.00  0.79           C
ATOM   4607  N   GLU A  60     -48.191  -1.618 -31.024  1.00  0.75           N
ATOM   4608  CA  GLU A  60     -47.866  -0.288 -31.493  1.00  0.75           C
ATOM   4609  C   GLU A  60     -46.358  -0.126 -31.464  1.00  0.75           C
ATOM   4610  O   GLU A  60     -45.751  -0.197 -30.400  1.00  0.75           O
ATOM   4611  CB  GLU A  60     -48.430   0.781 -30.535  1.00  0.75           C
ATOM   4612  CG  GLU A  60     -49.950   0.720 -30.275  1.00  0.75           C
ATOM   4613  CD  GLU A  60     -50.745   1.611 -31.220  1.00  0.75           C
ATOM   4614  OE1 GLU A  60     -50.287   1.858 -32.364  1.00  0.75           O
ATOM   4615  OE2 GLU A  60     -51.806   2.099 -30.756  1.00  0.75           O
ATOM   4616  N   ALA A  61     -45.686   0.078 -32.609  1.00  0.78           N
ATOM   4617  CA  ALA A  61     -44.236   0.097 -32.635  1.00  0.78           C
ATOM   4618  C   ALA A  61     -43.692   1.321 -33.318  1.00  0.78           C
ATOM   4619  O   ALA A  61     -44.224   1.772 -34.325  1.00  0.78           O
ATOM   4620  CB  ALA A  61     -43.679  -1.145 -33.355  1.00  0.78           C
ATOM   4621  N   ASN A  62     -42.575   1.877 -32.815  1.00  0.79           N
ATOM   4622  CA  ASN A  62     -41.825   2.875 -33.555  1.00  0.79           C
ATOM   4623  C   ASN A  62     -41.003   2.181 -34.633  1.00  0.79           C
ATOM   4624  O   ASN A  62     -40.877   0.961 -34.634  1.00  0.79           O
ATOM   4625  CB  ASN A  62     -40.840   3.678 -32.670  1.00  0.79           C
ATOM   4626  CG  ASN A  62     -41.532   4.511 -31.602  1.00  0.79           C
ATOM   4627  OD1 ASN A  62     -42.752   4.605 -31.468  1.00  0.79           O
ATOM   4628  ND2 ASN A  62     -40.683   5.170 -30.785  1.00  0.79           N
ATOM   4629  N   MET A  63     -40.378   2.927 -35.563  1.00  0.77           N
ATOM   4630  CA  MET A  63     -39.459   2.337 -36.527  1.00  0.77           C
ATOM   4631  C   MET A  63     -38.252   1.659 -35.867  1.00  0.77           C
ATOM   4632  O   MET A  63     -37.791   0.608 -36.300  1.00  0.77           O
ATOM   4633  CB  MET A  63     -39.065   3.375 -37.611  1.00  0.77           C
ATOM   4634  CG  MET A  63     -40.171   3.575 -38.677  1.00  0.77           C
ATOM   4635  SD  MET A  63     -40.416   2.135 -39.772  1.00  0.77           S
ATOM   4636  CE  MET A  63     -41.684   2.841 -40.866  1.00  0.77           C
ATOM   4637  N   ASP A  64     -37.754   2.229 -34.760  1.00  0.76           N
ATOM   4638  CA  ASP A  64     -36.609   1.802 -33.990  1.00  0.76           C
ATOM   4639  C   ASP A  64     -36.926   0.644 -33.041  1.00  0.76           C
ATOM   4640  O   ASP A  64     -36.037   0.064 -32.413  1.00  0.76           O
ATOM   4641  CB  ASP A  64     -36.087   3.005 -33.139  1.00  0.76           C
ATOM   4642  CG  ASP A  64     -36.418   4.361 -33.755  1.00  0.76           C
ATOM   4643  OD1 ASP A  64     -35.490   5.048 -34.238  1.00  0.76           O
ATOM   4644  OD2 ASP A  64     -37.633   4.709 -33.739  1.00  0.76           O
ATOM   4645  N   GLN A  65     -38.212   0.293 -32.868  1.00  0.79           N
ATOM   4646  CA  GLN A  65     -38.658  -0.680 -31.901  1.00  0.79           C
ATOM   4647  C   GLN A  65     -39.278  -1.816 -32.657  1.00  0.79           C
ATOM   4648  O   GLN A  65     -39.873  -1.624 -33.713  1.00  0.79           O
ATOM   4649  CB  GLN A  65     -39.737  -0.141 -30.917  1.00  0.79           C
ATOM   4650  CG  GLN A  65     -39.254   1.064 -30.079  1.00  0.79           C
ATOM   4651  CD  GLN A  65     -40.335   1.774 -29.257  1.00  0.79           C
ATOM   4652  OE1 GLN A  65     -40.075   2.833 -28.687  1.00  0.79           O
ATOM   4653  NE2 GLN A  65     -41.563   1.222 -29.179  1.00  0.79           N
ATOM   4654  N   GLU A  66     -39.188  -3.041 -32.129  1.00  0.78           N
ATOM   4655  CA  GLU A  66     -39.939  -4.133 -32.697  1.00  0.78           C
ATOM   4656  C   GLU A  66     -40.941  -4.621 -31.693  1.00  0.78           C
ATOM   4657  O   GLU A  66     -40.841  -4.372 -30.490  1.00  0.78           O
ATOM   4658  CB  GLU A  66     -39.068  -5.266 -33.255  1.00  0.78           C
ATOM   4659  CG  GLU A  66     -38.040  -4.721 -34.268  1.00  0.78           C
ATOM   4660  CD  GLU A  66     -37.468  -5.818 -35.141  1.00  0.78           C
ATOM   4661  OE1 GLU A  66     -37.293  -6.964 -34.650  1.00  0.78           O
ATOM   4662  OE2 GLU A  66     -37.242  -5.570 -36.347  1.00  0.78           O
ATOM   4663  N   SER A  67     -41.986  -5.283 -32.196  1.00  0.81           N
ATOM   4664  CA  SER A  67     -43.163  -5.586 -31.420  1.00  0.81           C
ATOM   4665  C   SER A  67     -43.284  -7.059 -31.110  1.00  0.81           C
ATOM   4666  O   SER A  67     -43.114  -7.924 -31.969  1.00  0.81           O
ATOM   4667  CB  SER A  67     -44.392  -5.061 -32.178  1.00  0.81           C
ATOM   4668  OG  SER A  67     -45.624  -5.304 -31.516  1.00  0.81           O
ATOM   4669  N   PHE A  68     -43.550  -7.372 -29.829  1.00  0.80           N
ATOM   4670  CA  PHE A  68     -43.609  -8.728 -29.334  1.00  0.80           C
ATOM   4671  C   PHE A  68     -44.920  -8.991 -28.610  1.00  0.80           C
ATOM   4672  O   PHE A  68     -45.522  -8.114 -27.992  1.00  0.80           O
ATOM   4673  CB  PHE A  68     -42.445  -9.016 -28.345  1.00  0.80           C
ATOM   4674  CG  PHE A  68     -41.152  -9.273 -29.072  1.00  0.80           C
ATOM   4675  CD1 PHE A  68     -40.707 -10.592 -29.264  1.00  0.80           C
ATOM   4676  CD2 PHE A  68     -40.359  -8.215 -29.549  1.00  0.80           C
ATOM   4677  CE1 PHE A  68     -39.501 -10.852 -29.925  1.00  0.80           C
ATOM   4678  CE2 PHE A  68     -39.166  -8.472 -30.238  1.00  0.80           C
ATOM   4679  CZ  PHE A  68     -38.735  -9.791 -30.424  1.00  0.80           C
ATOM   4680  N   GLY A  69     -45.388 -10.262 -28.629  1.00  0.81           N
ATOM   4681  CA  GLY A  69     -46.652 -10.634 -27.986  1.00  0.81           C
ATOM   4682  C   GLY A  69     -46.529 -10.718 -26.490  1.00  0.81           C
ATOM   4683  O   GLY A  69     -47.517 -10.803 -25.768  1.00  0.81           O
ATOM   4684  N   GLY A  70     -45.286 -10.623 -25.981  1.00  0.67           N
ATOM   4685  CA  GLY A  70     -44.949 -10.125 -24.652  1.00  0.67           C
ATOM   4686  C   GLY A  70     -45.152 -11.059 -23.507  1.00  0.67           C
ATOM   4687  O   GLY A  70     -44.333 -11.117 -22.598  1.00  0.67           O
ATOM   4688  N   ALA A  71     -46.208 -11.878 -23.526  1.00  0.83           N
ATOM   4689  CA  ALA A  71     -46.480 -12.896 -22.532  1.00  0.83           C
ATOM   4690  C   ALA A  71     -45.372 -13.943 -22.512  1.00  0.83           C
ATOM   4691  O   ALA A  71     -45.041 -14.532 -21.485  1.00  0.83           O
ATOM   4692  CB  ALA A  71     -47.849 -13.518 -22.845  1.00  0.83           C
ATOM   4693  N   SER A  72     -44.725 -14.108 -23.678  1.00  0.79           N
ATOM   4694  CA  SER A  72     -43.545 -14.905 -23.917  1.00  0.79           C
ATOM   4695  C   SER A  72     -42.256 -14.280 -23.442  1.00  0.79           C
ATOM   4696  O   SER A  72     -41.237 -14.966 -23.327  1.00  0.79           O
ATOM   4697  CB  SER A  72     -43.322 -15.083 -25.437  1.00  0.79           C
ATOM   4698  OG  SER A  72     -43.310 -13.813 -26.101  1.00  0.79           O
ATOM   4699  N   CYS A  73     -42.272 -12.954 -23.219  1.00  0.88           N
ATOM   4700  CA  CYS A  73     -41.117 -12.167 -22.839  1.00  0.88           C
ATOM   4701  C   CYS A  73     -41.180 -11.803 -21.378  1.00  0.88           C
ATOM   4702  O   CYS A  73     -40.241 -11.251 -20.813  1.00  0.88           O
ATOM   4703  CB  CYS A  73     -41.003 -10.855 -23.651  1.00  0.88           C
ATOM   4704  SG  CYS A  73     -40.990 -11.188 -25.443  1.00  0.88           S
ATOM   4705  N   CYS A  74     -42.277 -12.157 -20.698  1.00  0.88           N
ATOM   4706  CA  CYS A  74     -42.331 -12.239 -19.257  1.00  0.88           C
ATOM   4707  C   CYS A  74     -41.745 -13.574 -18.849  1.00  0.88           C
ATOM   4708  O   CYS A  74     -42.302 -14.630 -19.137  1.00  0.88           O
ATOM   4709  CB  CYS A  74     -43.792 -12.164 -18.729  1.00  0.88           C
ATOM   4710  SG  CYS A  74     -43.944 -12.493 -16.916  1.00  0.88           S
ATOM   4711  N   LEU A  75     -40.618 -13.556 -18.117  1.00  0.91           N
ATOM   4712  CA  LEU A  75     -39.911 -14.748 -17.697  1.00  0.91           C
ATOM   4713  C   LEU A  75     -40.748 -15.697 -16.863  1.00  0.91           C
ATOM   4714  O   LEU A  75     -40.736 -16.908 -17.043  1.00  0.91           O
ATOM   4715  CB  LEU A  75     -38.709 -14.310 -16.838  1.00  0.91           C
ATOM   4716  CG  LEU A  75     -37.775 -15.452 -16.400  1.00  0.91           C
ATOM   4717  CD1 LEU A  75     -37.053 -16.073 -17.602  1.00  0.91           C
ATOM   4718  CD2 LEU A  75     -36.755 -14.929 -15.386  1.00  0.91           C
ATOM   4719  N   TYR A  76     -41.524 -15.141 -15.925  1.00  0.85           N
ATOM   4720  CA  TYR A  76     -42.350 -15.881 -14.992  1.00  0.85           C
ATOM   4721  C   TYR A  76     -43.485 -16.651 -15.682  1.00  0.85           C
ATOM   4722  O   TYR A  76     -43.725 -17.820 -15.397  1.00  0.85           O
ATOM   4723  CB  TYR A  76     -42.849 -14.962 -13.842  1.00  0.85           C
ATOM   4724  CG  TYR A  76     -41.682 -14.255 -13.170  1.00  0.85           C
ATOM   4725  CD1 TYR A  76     -41.119 -13.110 -13.759  1.00  0.85           C
ATOM   4726  CD2 TYR A  76     -41.139 -14.701 -11.950  1.00  0.85           C
ATOM   4727  CE1 TYR A  76     -40.045 -12.444 -13.164  1.00  0.85           C
ATOM   4728  CE2 TYR A  76     -40.034 -14.059 -11.368  1.00  0.85           C
ATOM   4729  CZ  TYR A  76     -39.498 -12.921 -11.974  1.00  0.85           C
ATOM   4730  OH  TYR A  76     -38.463 -12.197 -11.361  1.00  0.85           O
ATOM   4731  N   CYS A  77     -44.163 -16.026 -16.674  1.00  0.79           N
ATOM   4732  CA  CYS A  77     -45.103 -16.690 -17.575  1.00  0.79           C
ATOM   4733  C   CYS A  77     -44.467 -17.695 -18.505  1.00  0.79           C
ATOM   4734  O   CYS A  77     -45.087 -18.665 -18.910  1.00  0.79           O
ATOM   4735  CB  CYS A  77     -45.832 -15.680 -18.488  1.00  0.79           C
ATOM   4736  SG  CYS A  77     -47.108 -14.794 -17.558  1.00  0.79           S
ATOM   4737  N   ARG A  78     -43.224 -17.427 -18.928  1.00  0.71           N
ATOM   4738  CA  ARG A  78     -42.491 -18.290 -19.821  1.00  0.71           C
ATOM   4739  C   ARG A  78     -42.007 -19.575 -19.160  1.00  0.71           C
ATOM   4740  O   ARG A  78     -42.046 -20.647 -19.756  1.00  0.71           O
ATOM   4741  CB  ARG A  78     -41.317 -17.503 -20.459  1.00  0.71           C
ATOM   4742  CG  ARG A  78     -40.624 -18.241 -21.621  1.00  0.71           C
ATOM   4743  CD  ARG A  78     -41.595 -18.571 -22.758  1.00  0.71           C
ATOM   4744  NE  ARG A  78     -40.843 -19.183 -23.884  1.00  0.71           N
ATOM   4745  CZ  ARG A  78     -40.205 -18.517 -24.848  1.00  0.71           C
ATOM   4746  NH1 ARG A  78     -40.113 -17.198 -24.881  1.00  0.71           N
ATOM   4747  NH2 ARG A  78     -39.610 -19.241 -25.789  1.00  0.71           N
ATOM   4748  N   CYS A  79     -41.539 -19.480 -17.898  1.00  0.78           N
ATOM   4749  CA  CYS A  79     -40.958 -20.583 -17.143  1.00  0.78           C
ATOM   4750  C   CYS A  79     -41.949 -21.265 -16.226  1.00  0.78           C
ATOM   4751  O   CYS A  79     -41.606 -22.202 -15.501  1.00  0.78           O
ATOM   4752  CB  CYS A  79     -39.804 -20.079 -16.238  1.00  0.78           C
ATOM   4753  SG  CYS A  79     -38.394 -19.493 -17.232  1.00  0.78           S
ATOM   4754  N   HIS A  80     -43.205 -20.810 -16.244  1.00  0.72           N
ATOM   4755  CA  HIS A  80     -44.306 -21.386 -15.505  1.00  0.72           C
ATOM   4756  C   HIS A  80     -44.127 -21.369 -14.001  1.00  0.72           C
ATOM   4757  O   HIS A  80     -44.192 -22.398 -13.328  1.00  0.72           O
ATOM   4758  CB  HIS A  80     -44.751 -22.770 -16.045  1.00  0.72           C
ATOM   4759  CG  HIS A  80     -44.957 -22.763 -17.534  1.00  0.72           C
ATOM   4760  ND1 HIS A  80     -45.438 -21.602 -18.091  1.00  0.72           N
ATOM   4761  CD2 HIS A  80     -44.846 -23.725 -18.487  1.00  0.72           C
ATOM   4762  CE1 HIS A  80     -45.615 -21.865 -19.363  1.00  0.72           C
ATOM   4763  NE2 HIS A  80     -45.272 -23.139 -19.662  1.00  0.72           N
ATOM   4764  N   ILE A  81     -43.870 -20.173 -13.437  1.00  0.75           N
ATOM   4765  CA  ILE A  81     -43.578 -19.996 -12.023  1.00  0.75           C
ATOM   4766  C   ILE A  81     -44.285 -18.767 -11.491  1.00  0.75           C
ATOM   4767  O   ILE A  81     -44.647 -17.877 -12.260  1.00  0.75           O
ATOM   4768  CB  ILE A  81     -42.081 -19.818 -11.772  1.00  0.75           C
ATOM   4769  CG1 ILE A  81     -41.568 -18.527 -12.455  1.00  0.75           C
ATOM   4770  CG2 ILE A  81     -41.343 -21.073 -12.282  1.00  0.75           C
ATOM   4771  CD1 ILE A  81     -40.053 -18.448 -12.607  1.00  0.75           C
ATOM   4772  N   ASP A  82     -44.480 -18.684 -10.158  1.00  0.75           N
ATOM   4773  CA  ASP A  82     -45.154 -17.583  -9.494  1.00  0.75           C
ATOM   4774  C   ASP A  82     -44.597 -16.184  -9.825  1.00  0.75           C
ATOM   4775  O   ASP A  82     -43.392 -15.975  -9.977  1.00  0.75           O
ATOM   4776  CB  ASP A  82     -45.185 -17.806  -7.952  1.00  0.75           C
ATOM   4777  CG  ASP A  82     -45.600 -19.237  -7.630  1.00  0.75           C
ATOM   4778  OD1 ASP A  82     -46.634 -19.680  -8.179  1.00  0.75           O
ATOM   4779  OD2 ASP A  82     -44.844 -19.929  -6.895  1.00  0.75           O
ATOM   4780  N   HIS A  83     -45.484 -15.185 -10.000  1.00  0.75           N
ATOM   4781  CA  HIS A  83     -45.137 -13.830 -10.402  1.00  0.75           C
ATOM   4782  C   HIS A  83     -44.531 -12.946  -9.314  1.00  0.75           C
ATOM   4783  O   HIS A  83     -44.746 -13.192  -8.133  1.00  0.75           O
ATOM   4784  CB  HIS A  83     -46.348 -13.122 -11.053  1.00  0.75           C
ATOM   4785  CG  HIS A  83     -46.611 -13.734 -12.387  1.00  0.75           C
ATOM   4786  ND1 HIS A  83     -47.386 -14.871 -12.479  1.00  0.75           N
ATOM   4787  CD2 HIS A  83     -45.969 -13.504 -13.560  1.00  0.75           C
ATOM   4788  CE1 HIS A  83     -47.197 -15.320 -13.699  1.00  0.75           C
ATOM   4789  NE2 HIS A  83     -46.347 -14.530 -14.397  1.00  0.75           N
ATOM   4790  N   PRO A  84     -43.765 -11.884  -9.640  1.00  0.78           N
ATOM   4791  CA  PRO A  84     -43.195 -10.992  -8.629  1.00  0.78           C
ATOM   4792  C   PRO A  84     -44.239 -10.242  -7.833  1.00  0.78           C
ATOM   4793  O   PRO A  84     -43.983  -9.855  -6.697  1.00  0.78           O
ATOM   4794  CB  PRO A  84     -42.304 -10.022  -9.427  1.00  0.78           C
ATOM   4795  CG  PRO A  84     -41.921 -10.814 -10.674  1.00  0.78           C
ATOM   4796  CD  PRO A  84     -43.177 -11.635 -10.960  1.00  0.78           C
ATOM   4797  N   ASN A  85     -45.410  -9.970  -8.435  1.00  0.72           N
ATOM   4798  CA  ASN A  85     -46.541  -9.396  -7.746  1.00  0.72           C
ATOM   4799  C   ASN A  85     -47.070 -10.324  -6.638  1.00  0.72           C
ATOM   4800  O   ASN A  85     -47.186 -11.524  -6.882  1.00  0.72           O
ATOM   4801  CB  ASN A  85     -47.623  -9.073  -8.807  1.00  0.72           C
ATOM   4802  CG  ASN A  85     -48.865  -8.435  -8.207  1.00  0.72           C
ATOM   4803  OD1 ASN A  85     -49.692  -9.101  -7.579  1.00  0.72           O
ATOM   4804  ND2 ASN A  85     -48.990  -7.102  -8.370  1.00  0.72           N
ATOM   4805  N   PRO A  86     -47.432  -9.853  -5.435  1.00  0.75           N
ATOM   4806  CA  PRO A  86     -47.655 -10.750  -4.308  1.00  0.75           C
ATOM   4807  C   PRO A  86     -48.922 -11.562  -4.423  1.00  0.75           C
ATOM   4808  O   PRO A  86     -49.043 -12.575  -3.736  1.00  0.75           O
ATOM   4809  CB  PRO A  86     -47.737  -9.814  -3.088  1.00  0.75           C
ATOM   4810  CG  PRO A  86     -48.107  -8.455  -3.683  1.00  0.75           C
ATOM   4811  CD  PRO A  86     -47.307  -8.465  -4.981  1.00  0.75           C
ATOM   4812  N   LYS A  87     -49.895 -11.139  -5.241  1.00  0.73           N
ATOM   4813  CA  LYS A  87     -51.115 -11.892  -5.400  1.00  0.73           C
ATOM   4814  C   LYS A  87     -51.856 -11.468  -6.653  1.00  0.73           C
ATOM   4815  O   LYS A  87     -52.569 -10.469  -6.685  1.00  0.73           O
ATOM   4816  CB  LYS A  87     -52.076 -11.715  -4.193  1.00  0.73           C
ATOM   4817  CG  LYS A  87     -53.503 -12.278  -4.377  1.00  0.73           C
ATOM   4818  CD  LYS A  87     -53.589 -13.781  -4.696  1.00  0.73           C
ATOM   4819  CE  LYS A  87     -54.823 -14.170  -5.525  1.00  0.73           C
ATOM   4820  NZ  LYS A  87     -56.052 -13.512  -5.020  1.00  0.73           N
ATOM   4821  N   GLY A  88     -51.786 -12.227  -7.748  1.00  0.69           N
ATOM   4822  CA  GLY A  88     -50.762 -13.226  -8.058  1.00  0.69           C
ATOM   4823  C   GLY A  88     -50.548 -13.142  -9.530  1.00  0.69           C
ATOM   4824  O   GLY A  88     -50.270 -14.132 -10.199  1.00  0.69           O
ATOM   4825  N   PHE A  89     -50.816 -11.948 -10.079  1.00  0.64           N
ATOM   4826  CA  PHE A  89     -51.134 -11.736 -11.476  1.00  0.64           C
ATOM   4827  C   PHE A  89     -49.999 -11.061 -12.210  1.00  0.64           C
ATOM   4828  O   PHE A  89     -49.074 -10.514 -11.614  1.00  0.64           O
ATOM   4829  CB  PHE A  89     -52.433 -10.890 -11.677  1.00  0.64           C
ATOM   4830  CG  PHE A  89     -53.689 -11.465 -11.058  1.00  0.64           C
ATOM   4831  CD1 PHE A  89     -53.804 -12.796 -10.613  1.00  0.64           C
ATOM   4832  CD2 PHE A  89     -54.824 -10.638 -10.975  1.00  0.64           C
ATOM   4833  CE1 PHE A  89     -55.003 -13.279 -10.077  1.00  0.64           C
ATOM   4834  CE2 PHE A  89     -56.025 -11.114 -10.434  1.00  0.64           C
ATOM   4835  CZ  PHE A  89     -56.115 -12.436  -9.984  1.00  0.64           C
ATOM   4836  N   CYS A  90     -50.054 -11.122 -13.552  1.00  0.74           N
ATOM   4837  CA  CYS A  90     -48.980 -10.696 -14.424  1.00  0.74           C
ATOM   4838  C   CYS A  90     -49.350  -9.532 -15.324  1.00  0.74           C
ATOM   4839  O   CYS A  90     -50.368  -9.555 -16.015  1.00  0.74           O
ATOM   4840  CB  CYS A  90     -48.599 -11.872 -15.355  1.00  0.74           C
ATOM   4841  SG  CYS A  90     -47.245 -11.488 -16.529  1.00  0.74           S
ATOM   4842  N   ASP A  91     -48.465  -8.524 -15.397  1.00  0.77           N
ATOM   4843  CA  ASP A  91     -48.585  -7.332 -16.215  1.00  0.77           C
ATOM   4844  C   ASP A  91     -48.662  -7.578 -17.720  1.00  0.77           C
ATOM   4845  O   ASP A  91     -49.453  -6.966 -18.439  1.00  0.77           O
ATOM   4846  CB  ASP A  91     -47.350  -6.430 -15.967  1.00  0.77           C
ATOM   4847  CG  ASP A  91     -47.035  -6.422 -14.482  1.00  0.77           C
ATOM   4848  OD1 ASP A  91     -47.794  -5.796 -13.709  1.00  0.77           O
ATOM   4849  OD2 ASP A  91     -46.079  -7.150 -14.108  1.00  0.77           O
ATOM   4850  N   LEU A  92     -47.813  -8.496 -18.234  1.00  0.80           N
ATOM   4851  CA  LEU A  92     -47.594  -8.670 -19.663  1.00  0.80           C
ATOM   4852  C   LEU A  92     -48.441  -9.764 -20.276  1.00  0.80           C
ATOM   4853  O   LEU A  92     -48.321 -10.077 -21.459  1.00  0.80           O
ATOM   4854  CB  LEU A  92     -46.126  -9.052 -19.996  1.00  0.80           C
ATOM   4855  CG  LEU A  92     -45.035  -8.006 -19.697  1.00  0.80           C
ATOM   4856  CD1 LEU A  92     -43.866  -8.226 -20.673  1.00  0.80           C
ATOM   4857  CD2 LEU A  92     -45.546  -6.560 -19.784  1.00  0.80           C
ATOM   4858  N   LYS A  93     -49.346 -10.390 -19.511  1.00  0.67           N
ATOM   4859  CA  LYS A  93     -50.256 -11.349 -20.095  1.00  0.67           C
ATOM   4860  C   LYS A  93     -51.538 -10.627 -20.472  1.00  0.67           C
ATOM   4861  O   LYS A  93     -52.199  -9.987 -19.659  1.00  0.67           O
ATOM   4862  CB  LYS A  93     -50.512 -12.580 -19.185  1.00  0.67           C
ATOM   4863  CG  LYS A  93     -49.975 -13.904 -19.769  1.00  0.67           C
ATOM   4864  CD  LYS A  93     -50.465 -15.175 -19.034  1.00  0.67           C
ATOM   4865  CE  LYS A  93     -50.511 -16.426 -19.927  1.00  0.67           C
ATOM   4866  NZ  LYS A  93     -51.197 -17.600 -19.338  1.00  0.67           N
ATOM   4867  N   GLY A  94     -51.918 -10.691 -21.763  1.00  0.74           N
ATOM   4868  CA  GLY A  94     -53.059  -9.946 -22.258  1.00  0.74           C
ATOM   4869  C   GLY A  94     -52.710  -8.597 -22.842  1.00  0.74           C
ATOM   4870  O   GLY A  94     -53.629  -7.838 -23.160  1.00  0.74           O
ATOM   4871  N   LYS A  95     -51.408  -8.282 -23.010  1.00  0.69           N
ATOM   4872  CA  LYS A  95     -50.899  -7.029 -23.550  1.00  0.69           C
ATOM   4873  C   LYS A  95     -49.685  -7.297 -24.438  1.00  0.69           C
ATOM   4874  O   LYS A  95     -49.068  -8.355 -24.349  1.00  0.69           O
ATOM   4875  CB  LYS A  95     -50.437  -6.050 -22.433  1.00  0.69           C
ATOM   4876  CG  LYS A  95     -51.376  -5.933 -21.218  1.00  0.69           C
ATOM   4877  CD  LYS A  95     -52.700  -5.187 -21.458  1.00  0.69           C
ATOM   4878  CE  LYS A  95     -53.679  -5.418 -20.296  1.00  0.69           C
ATOM   4879  NZ  LYS A  95     -54.168  -4.144 -19.719  1.00  0.69           N
ATOM   4880  N   TYR A  96     -49.305  -6.349 -25.314  1.00  0.76           N
ATOM   4881  CA  TYR A  96     -48.120  -6.443 -26.158  1.00  0.76           C
ATOM   4882  C   TYR A  96     -46.963  -5.663 -25.543  1.00  0.76           C
ATOM   4883  O   TYR A  96     -47.177  -4.798 -24.691  1.00  0.76           O
ATOM   4884  CB  TYR A  96     -48.373  -5.880 -27.586  1.00  0.76           C
ATOM   4885  CG  TYR A  96     -49.419  -6.683 -28.307  1.00  0.76           C
ATOM   4886  CD1 TYR A  96     -50.778  -6.358 -28.166  1.00  0.76           C
ATOM   4887  CD2 TYR A  96     -49.075  -7.805 -29.077  1.00  0.76           C
ATOM   4888  CE1 TYR A  96     -51.780  -7.156 -28.741  1.00  0.76           C
ATOM   4889  CE2 TYR A  96     -50.087  -8.565 -29.679  1.00  0.76           C
ATOM   4890  CZ  TYR A  96     -51.429  -8.262 -29.511  1.00  0.76           C
ATOM   4891  OH  TYR A  96     -52.385  -9.194 -29.961  1.00  0.76           O
ATOM   4892  N   VAL A  97     -45.703  -5.950 -25.963  1.00  0.88           N
ATOM   4893  CA  VAL A  97     -44.533  -5.223 -25.475  1.00  0.88           C
ATOM   4894  C   VAL A  97     -43.545  -4.900 -26.581  1.00  0.88           C
ATOM   4895  O   VAL A  97     -43.283  -5.701 -27.476  1.00  0.88           O
ATOM   4896  CB  VAL A  97     -43.841  -5.879 -24.269  1.00  0.88           C
ATOM   4897  CG1 VAL A  97     -42.439  -5.300 -23.974  1.00  0.88           C
ATOM   4898  CG2 VAL A  97     -44.722  -5.649 -23.031  1.00  0.88           C
ATOM   4899  N   GLN A  98     -42.967  -3.678 -26.556  1.00  0.80           N
ATOM   4900  CA  GLN A  98     -42.036  -3.233 -27.570  1.00  0.80           C
ATOM   4901  C   GLN A  98     -40.628  -3.169 -27.013  1.00  0.80           C
ATOM   4902  O   GLN A  98     -40.426  -2.839 -25.845  1.00  0.80           O
ATOM   4903  CB  GLN A  98     -42.402  -1.844 -28.146  1.00  0.80           C
ATOM   4904  CG  GLN A  98     -43.907  -1.478 -28.111  1.00  0.80           C
ATOM   4905  CD  GLN A  98     -44.842  -2.439 -28.849  1.00  0.80           C
ATOM   4906  OE1 GLN A  98     -44.616  -2.902 -29.976  1.00  0.80           O
ATOM   4907  NE2 GLN A  98     -45.956  -2.793 -28.178  1.00  0.80           N
ATOM   4908  N   ILE A  99     -39.608  -3.483 -27.833  1.00  0.86           N
ATOM   4909  CA  ILE A  99     -38.217  -3.386 -27.418  1.00  0.86           C
ATOM   4910  C   ILE A  99     -37.425  -2.773 -28.570  1.00  0.86           C
ATOM   4911  O   ILE A  99     -37.669  -3.169 -29.712  1.00  0.86           O
ATOM   4912  CB  ILE A  99     -37.621  -4.743 -27.027  1.00  0.86           C
ATOM   4913  CG1 ILE A  99     -38.267  -5.300 -25.738  1.00  0.86           C
ATOM   4914  CG2 ILE A  99     -36.093  -4.650 -26.829  1.00  0.86           C
ATOM   4915  CD1 ILE A  99     -39.452  -6.234 -26.005  1.00  0.86           C
ATOM   4916  N   PRO A 100     -36.500  -1.811 -28.380  1.00  0.82           N
ATOM   4917  CA  PRO A 100     -35.495  -1.426 -29.378  1.00  0.82           C
ATOM   4918  C   PRO A 100     -34.843  -2.572 -30.135  1.00  0.82           C
ATOM   4919  O   PRO A 100     -34.390  -3.516 -29.500  1.00  0.82           O
ATOM   4920  CB  PRO A 100     -34.449  -0.646 -28.568  1.00  0.82           C
ATOM   4921  CG  PRO A 100     -35.242  -0.023 -27.418  1.00  0.82           C
ATOM   4922  CD  PRO A 100     -36.353  -1.037 -27.140  1.00  0.82           C
ATOM   4923  N   THR A 101     -34.725  -2.503 -31.476  1.00  0.80           N
ATOM   4924  CA  THR A 101     -34.321  -3.643 -32.314  1.00  0.80           C
ATOM   4925  C   THR A 101     -32.991  -4.285 -31.933  1.00  0.80           C
ATOM   4926  O   THR A 101     -32.833  -5.502 -31.922  1.00  0.80           O
ATOM   4927  CB  THR A 101     -34.229  -3.273 -33.792  1.00  0.80           C
ATOM   4928  OG1 THR A 101     -35.408  -2.622 -34.221  1.00  0.80           O
ATOM   4929  CG2 THR A 101     -34.084  -4.518 -34.674  1.00  0.80           C
ATOM   4930  N   THR A 102     -31.990  -3.471 -31.552  1.00  0.76           N
ATOM   4931  CA  THR A 102     -30.680  -3.911 -31.074  1.00  0.76           C
ATOM   4932  C   THR A 102     -30.720  -4.758 -29.815  1.00  0.76           C
ATOM   4933  O   THR A 102     -29.933  -5.685 -29.644  1.00  0.76           O
ATOM   4934  CB  THR A 102     -29.757  -2.737 -30.766  1.00  0.76           C
ATOM   4935  OG1 THR A 102     -30.449  -1.727 -30.038  1.00  0.76           O
ATOM   4936  CG2 THR A 102     -29.272  -2.097 -32.073  1.00  0.76           C
ATOM   4937  N   CYS A 103     -31.643  -4.441 -28.888  1.00  0.86           N
ATOM   4938  CA  CYS A 103     -31.726  -5.072 -27.588  1.00  0.86           C
ATOM   4939  C   CYS A 103     -32.820  -6.122 -27.569  1.00  0.86           C
ATOM   4940  O   CYS A 103     -33.077  -6.774 -26.564  1.00  0.86           O
ATOM   4941  CB  CYS A 103     -31.935  -4.001 -26.488  1.00  0.86           C
ATOM   4942  SG  CYS A 103     -31.051  -4.424 -24.939  1.00  0.86           S
ATOM   4943  N   ALA A 104     -33.441  -6.373 -28.739  1.00  0.89           N
ATOM   4944  CA  ALA A 104     -34.523  -7.318 -28.905  1.00  0.89           C
ATOM   4945  C   ALA A 104     -34.000  -8.707 -29.248  1.00  0.89           C
ATOM   4946  O   ALA A 104     -34.753  -9.632 -29.535  1.00  0.89           O
ATOM   4947  CB  ALA A 104     -35.477  -6.801 -29.999  1.00  0.89           C
ATOM   4948  N   ASN A 105     -32.665  -8.883 -29.149  1.00  0.83           N
ATOM   4949  CA  ASN A 105     -31.984 -10.163 -29.107  1.00  0.83           C
ATOM   4950  C   ASN A 105     -32.365 -10.935 -27.839  1.00  0.83           C
ATOM   4951  O   ASN A 105     -32.622 -12.133 -27.872  1.00  0.83           O
ATOM   4952  CB  ASN A 105     -30.454  -9.913 -29.163  1.00  0.83           C
ATOM   4953  CG  ASN A 105     -29.684 -11.179 -29.521  1.00  0.83           C
ATOM   4954  OD1 ASN A 105     -30.192 -12.121 -30.126  1.00  0.83           O
ATOM   4955  ND2 ASN A 105     -28.383 -11.198 -29.153  1.00  0.83           N
ATOM   4956  N   ASP A 106     -32.456 -10.220 -26.693  1.00  0.88           N
ATOM   4957  CA  ASP A 106     -33.011 -10.749 -25.460  1.00  0.88           C
ATOM   4958  C   ASP A 106     -34.190  -9.885 -25.001  1.00  0.88           C
ATOM   4959  O   ASP A 106     -34.007  -8.924 -24.251  1.00  0.88           O
ATOM   4960  CB  ASP A 106     -31.938 -10.745 -24.344  1.00  0.88           C
ATOM   4961  CG  ASP A 106     -32.504 -11.292 -23.036  1.00  0.88           C
ATOM   4962  OD1 ASP A 106     -32.142 -10.743 -21.973  1.00  0.88           O
ATOM   4963  OD2 ASP A 106     -33.368 -12.213 -23.053  1.00  0.88           O
ATOM   4964  N   PRO A 107     -35.432 -10.200 -25.348  1.00  0.92           N
ATOM   4965  CA  PRO A 107     -36.536  -9.357 -24.918  1.00  0.92           C
ATOM   4966  C   PRO A 107     -36.920  -9.716 -23.517  1.00  0.92           C
ATOM   4967  O   PRO A 107     -37.579  -8.931 -22.841  1.00  0.92           O
ATOM   4968  CB  PRO A 107     -37.679  -9.707 -25.881  1.00  0.92           C
ATOM   4969  CG  PRO A 107     -36.979 -10.265 -27.116  1.00  0.92           C
ATOM   4970  CD  PRO A 107     -35.777 -10.996 -26.528  1.00  0.92           C
ATOM   4971  N   VAL A 108     -36.580 -10.934 -23.082  1.00  0.93           N
ATOM   4972  CA  VAL A 108     -36.985 -11.444 -21.799  1.00  0.93           C
ATOM   4973  C   VAL A 108     -36.254 -10.745 -20.668  1.00  0.93           C
ATOM   4974  O   VAL A 108     -36.866 -10.304 -19.701  1.00  0.93           O
ATOM   4975  CB  VAL A 108     -36.851 -12.955 -21.723  1.00  0.93           C
ATOM   4976  CG1 VAL A 108     -37.775 -13.495 -20.616  1.00  0.93           C
ATOM   4977  CG2 VAL A 108     -37.271 -13.563 -23.077  1.00  0.93           C
ATOM   4978  N   GLY A 109     -34.924 -10.534 -20.764  1.00  0.90           N
ATOM   4979  CA  GLY A 109     -34.214  -9.776 -19.740  1.00  0.90           C
ATOM   4980  C   GLY A 109     -34.471  -8.303 -19.803  1.00  0.90           C
ATOM   4981  O   GLY A 109     -34.319  -7.604 -18.813  1.00  0.90           O
ATOM   4982  N   PHE A 110     -34.920  -7.791 -20.963  1.00  0.87           N
ATOM   4983  CA  PHE A 110     -35.366  -6.421 -21.111  1.00  0.87           C
ATOM   4984  C   PHE A 110     -36.608  -6.121 -20.284  1.00  0.87           C
ATOM   4985  O   PHE A 110     -36.701  -5.077 -19.644  1.00  0.87           O
ATOM   4986  CB  PHE A 110     -35.596  -6.117 -22.612  1.00  0.87           C
ATOM   4987  CG  PHE A 110     -35.493  -4.645 -22.915  1.00  0.87           C
ATOM   4988  CD1 PHE A 110     -36.486  -3.743 -22.500  1.00  0.87           C
ATOM   4989  CD2 PHE A 110     -34.408  -4.152 -23.656  1.00  0.87           C
ATOM   4990  CE1 PHE A 110     -36.407  -2.387 -22.833  1.00  0.87           C
ATOM   4991  CE2 PHE A 110     -34.323  -2.794 -23.988  1.00  0.87           C
ATOM   4992  CZ  PHE A 110     -35.331  -1.913 -23.586  1.00  0.87           C
ATOM   4993  N   THR A 111     -37.589  -7.052 -20.247  1.00  0.87           N
ATOM   4994  CA  THR A 111     -38.787  -6.892 -19.427  1.00  0.87           C
ATOM   4995  C   THR A 111     -38.493  -6.820 -17.936  1.00  0.87           C
ATOM   4996  O   THR A 111     -39.106  -6.055 -17.203  1.00  0.87           O
ATOM   4997  CB  THR A 111     -39.876  -7.946 -19.641  1.00  0.87           C
ATOM   4998  OG1 THR A 111     -39.498  -9.228 -19.157  1.00  0.87           O
ATOM   4999  CG2 THR A 111     -40.299  -8.067 -21.114  1.00  0.87           C
ATOM   5000  N   LEU A 112     -37.547  -7.652 -17.463  1.00  0.87           N
ATOM   5001  CA  LEU A 112     -37.025  -7.639 -16.112  1.00  0.87           C
ATOM   5002  C   LEU A 112     -36.100  -6.479 -15.752  1.00  0.87           C
ATOM   5003  O   LEU A 112     -36.082  -6.009 -14.620  1.00  0.87           O
ATOM   5004  CB  LEU A 112     -36.295  -8.977 -15.839  1.00  0.87           C
ATOM   5005  CG  LEU A 112     -37.114  -9.989 -15.018  1.00  0.87           C
ATOM   5006  CD1 LEU A 112     -36.385 -11.338 -15.016  1.00  0.87           C
ATOM   5007  CD2 LEU A 112     -37.345  -9.499 -13.579  1.00  0.87           C
ATOM   5008  N   LYS A 113     -35.228  -6.041 -16.677  1.00  0.85           N
ATOM   5009  CA  LYS A 113     -34.233  -5.019 -16.414  1.00  0.85           C
ATOM   5010  C   LYS A 113     -34.789  -3.623 -16.205  1.00  0.85           C
ATOM   5011  O   LYS A 113     -34.282  -2.857 -15.387  1.00  0.85           O
ATOM   5012  CB  LYS A 113     -33.201  -5.017 -17.565  1.00  0.85           C
ATOM   5013  CG  LYS A 113     -32.026  -4.051 -17.396  1.00  0.85           C
ATOM   5014  CD  LYS A 113     -31.061  -4.123 -18.584  1.00  0.85           C
ATOM   5015  CE  LYS A 113     -29.978  -3.056 -18.467  1.00  0.85           C
ATOM   5016  NZ  LYS A 113     -29.077  -3.113 -19.633  1.00  0.85           N
ATOM   5017  N   ASN A 114     -35.826  -3.255 -16.968  1.00  0.85           N
ATOM   5018  CA  ASN A 114     -36.308  -1.900 -17.038  1.00  0.85           C
ATOM   5019  C   ASN A 114     -37.751  -1.884 -16.576  1.00  0.85           C
ATOM   5020  O   ASN A 114     -38.509  -2.810 -16.845  1.00  0.85           O
ATOM   5021  CB  ASN A 114     -36.212  -1.363 -18.494  1.00  0.85           C
ATOM   5022  CG  ASN A 114     -34.760  -1.264 -18.957  1.00  0.85           C
ATOM   5023  OD1 ASN A 114     -34.106  -2.216 -19.389  1.00  0.85           O
ATOM   5024  ND2 ASN A 114     -34.198  -0.034 -18.897  1.00  0.85           N
ATOM   5025  N   THR A 115     -38.188  -0.817 -15.878  1.00  0.80           N
ATOM   5026  CA  THR A 115     -39.579  -0.676 -15.452  1.00  0.80           C
ATOM   5027  C   THR A 115     -40.160   0.566 -16.100  1.00  0.80           C
ATOM   5028  O   THR A 115     -39.520   1.617 -16.165  1.00  0.80           O
ATOM   5029  CB  THR A 115     -39.765  -0.583 -13.940  1.00  0.80           C
ATOM   5030  OG1 THR A 115     -39.056  -1.637 -13.309  1.00  0.80           O
ATOM   5031  CG2 THR A 115     -41.237  -0.757 -13.541  1.00  0.80           C
ATOM   5032  N   VAL A 116     -41.384   0.482 -16.663  1.00  0.86           N
ATOM   5033  CA  VAL A 116     -42.078   1.625 -17.246  1.00  0.86           C
ATOM   5034  C   VAL A 116     -42.458   2.684 -16.229  1.00  0.86           C
ATOM   5035  O   VAL A 116     -42.673   2.382 -15.057  1.00  0.86           O
ATOM   5036  CB  VAL A 116     -43.320   1.253 -18.038  1.00  0.86           C
ATOM   5037  CG1 VAL A 116     -42.927   0.237 -19.117  1.00  0.86           C
ATOM   5038  CG2 VAL A 116     -44.428   0.700 -17.119  1.00  0.86           C
ATOM   5039  N   CYS A 117     -42.542   3.971 -16.637  1.00  0.80           N
ATOM   5040  CA  CYS A 117     -42.932   5.012 -15.702  1.00  0.80           C
ATOM   5041  C   CYS A 117     -44.408   5.314 -15.788  1.00  0.80           C
ATOM   5042  O   CYS A 117     -45.023   5.234 -16.848  1.00  0.80           O
ATOM   5043  CB  CYS A 117     -42.117   6.335 -15.845  1.00  0.80           C
ATOM   5044  SG  CYS A 117     -42.663   7.448 -17.206  1.00  0.80           S
ATOM   5045  N   THR A 118     -45.003   5.781 -14.679  1.00  0.80           N
ATOM   5046  CA  THR A 118     -46.444   6.006 -14.616  1.00  0.80           C
ATOM   5047  C   THR A 118     -46.812   7.386 -15.143  1.00  0.80           C
ATOM   5048  O   THR A 118     -47.967   7.792 -15.135  1.00  0.80           O
ATOM   5049  CB  THR A 118     -46.983   5.882 -13.185  1.00  0.80           C
ATOM   5050  OG1 THR A 118     -46.299   4.850 -12.487  1.00  0.80           O
ATOM   5051  CG2 THR A 118     -48.468   5.493 -13.171  1.00  0.80           C
ATOM   5052  N   VAL A 119     -45.820   8.161 -15.629  1.00  0.84           N
ATOM   5053  CA  VAL A 119     -46.032   9.513 -16.124  1.00  0.84           C
ATOM   5054  C   VAL A 119     -46.432   9.548 -17.586  1.00  0.84           C
ATOM   5055  O   VAL A 119     -47.408  10.193 -17.959  1.00  0.84           O
ATOM   5056  CB  VAL A 119     -44.774  10.363 -15.976  1.00  0.84           C
ATOM   5057  CG1 VAL A 119     -45.058  11.829 -16.360  1.00  0.84           C
ATOM   5058  CG2 VAL A 119     -44.264  10.314 -14.525  1.00  0.84           C
ATOM   5059  N   CYS A 120     -45.677   8.861 -18.469  1.00  0.83           N
ATOM   5060  CA  CYS A 120     -45.980   8.828 -19.891  1.00  0.83           C
ATOM   5061  C   CYS A 120     -46.285   7.426 -20.376  1.00  0.83           C
ATOM   5062  O   CYS A 120     -46.522   7.204 -21.562  1.00  0.83           O
ATOM   5063  CB  CYS A 120     -44.830   9.433 -20.748  1.00  0.83           C
ATOM   5064  SG  CYS A 120     -43.199   8.637 -20.508  1.00  0.83           S
ATOM   5065  N   GLY A 121     -46.290   6.434 -19.461  1.00  0.78           N
ATOM   5066  CA  GLY A 121     -46.664   5.058 -19.778  1.00  0.78           C
ATOM   5067  C   GLY A 121     -45.657   4.312 -20.624  1.00  0.78           C
ATOM   5068  O   GLY A 121     -45.966   3.301 -21.249  1.00  0.78           O
ATOM   5069  N   MET A 122     -44.409   4.801 -20.689  1.00  0.76           N
ATOM   5070  CA  MET A 122     -43.429   4.380 -21.669  1.00  0.76           C
ATOM   5071  C   MET A 122     -42.145   3.917 -20.986  1.00  0.76           C
ATOM   5072  O   MET A 122     -41.971   4.075 -19.775  1.00  0.76           O
ATOM   5073  CB  MET A 122     -43.191   5.564 -22.634  1.00  0.76           C
ATOM   5074  CG  MET A 122     -42.379   5.281 -23.907  1.00  0.76           C
ATOM   5075  SD  MET A 122     -42.306   6.709 -25.031  1.00  0.76           S
ATOM   5076  CE  MET A 122     -44.030   6.709 -25.596  1.00  0.76           C
ATOM   5077  N   TRP A 123     -41.217   3.260 -21.724  1.00  0.78           N
ATOM   5078  CA  TRP A 123     -39.968   2.776 -21.163  1.00  0.78           C
ATOM   5079  C   TRP A 123     -39.097   3.868 -20.549  1.00  0.78           C
ATOM   5080  O   TRP A 123     -38.865   4.916 -21.137  1.00  0.78           O
ATOM   5081  CB  TRP A 123     -39.095   2.029 -22.215  1.00  0.78           C
ATOM   5082  CG  TRP A 123     -39.416   0.564 -22.473  1.00  0.78           C
ATOM   5083  CD1 TRP A 123     -39.537  -0.073 -23.678  1.00  0.78           C
ATOM   5084  CD2 TRP A 123     -39.586  -0.452 -21.466  1.00  0.78           C
ATOM   5085  NE1 TRP A 123     -39.799  -1.409 -23.491  1.00  0.78           N
ATOM   5086  CE2 TRP A 123     -39.830  -1.671 -22.145  1.00  0.78           C
ATOM   5087  CE3 TRP A 123     -39.547  -0.407 -20.077  1.00  0.78           C
ATOM   5088  CZ2 TRP A 123     -40.043  -2.850 -21.447  1.00  0.78           C
ATOM   5089  CZ3 TRP A 123     -39.815  -1.586 -19.382  1.00  0.78           C
ATOM   5090  CH2 TRP A 123     -40.035  -2.796 -20.048  1.00  0.78           C
ATOM   5091  N   LYS A 124     -38.543   3.629 -19.344  1.00  0.82           N
ATOM   5092  CA  LYS A 124     -37.615   4.556 -18.729  1.00  0.82           C
ATOM   5093  C   LYS A 124     -36.192   4.348 -19.246  1.00  0.82           C
ATOM   5094  O   LYS A 124     -35.629   3.257 -19.169  1.00  0.82           O
ATOM   5095  CB  LYS A 124     -37.688   4.393 -17.192  1.00  0.82           C
ATOM   5096  CG  LYS A 124     -37.081   5.523 -16.341  1.00  0.82           C
ATOM   5097  CD  LYS A 124     -38.038   6.708 -16.144  1.00  0.82           C
ATOM   5098  CE  LYS A 124     -37.413   7.837 -15.313  1.00  0.82           C
ATOM   5099  NZ  LYS A 124     -38.333   8.980 -15.274  1.00  0.82           N
ATOM   5100  N   GLY A 125     -35.582   5.403 -19.833  1.00  0.84           N
ATOM   5101  CA  GLY A 125     -34.203   5.390 -20.330  1.00  0.84           C
ATOM   5102  C   GLY A 125     -34.064   5.014 -21.783  1.00  0.84           C
ATOM   5103  O   GLY A 125     -33.093   5.388 -22.426  1.00  0.84           O
ATOM   5104  N   TYR A 126     -35.070   4.331 -22.357  1.00  0.78           N
ATOM   5105  CA  TYR A 126     -35.128   4.030 -23.783  1.00  0.78           C
ATOM   5106  C   TYR A 126     -36.201   4.732 -24.664  1.00  0.78           C
ATOM   5107  O   TYR A 126     -36.458   4.279 -25.774  1.00  0.78           O
ATOM   5108  CB  TYR A 126     -35.301   2.495 -23.948  1.00  0.78           C
ATOM   5109  CG  TYR A 126     -33.990   1.767 -23.834  1.00  0.78           C
ATOM   5110  CD1 TYR A 126     -33.615   1.120 -22.645  1.00  0.78           C
ATOM   5111  CD2 TYR A 126     -33.160   1.647 -24.961  1.00  0.78           C
ATOM   5112  CE1 TYR A 126     -32.445   0.348 -22.593  1.00  0.78           C
ATOM   5113  CE2 TYR A 126     -31.987   0.880 -24.910  1.00  0.78           C
ATOM   5114  CZ  TYR A 126     -31.629   0.232 -23.723  1.00  0.78           C
ATOM   5115  OH  TYR A 126     -30.464  -0.559 -23.680  1.00  0.78           O
ATOM   5116  N   GLY A 127     -36.874   5.847 -24.295  1.00  0.60           N
ATOM   5117  CA  GLY A 127     -36.721   6.651 -23.102  1.00  0.60           C
ATOM   5118  C   GLY A 127     -37.854   7.578 -22.885  1.00  0.60           C
ATOM   5119  O   GLY A 127     -38.924   7.447 -23.473  1.00  0.60           O
ATOM   5120  N   CYS A 128     -37.648   8.538 -21.980  1.00  0.66           N
ATOM   5121  CA  CYS A 128     -38.721   9.330 -21.439  1.00  0.66           C
ATOM   5122  C   CYS A 128     -38.551  10.801 -21.714  1.00  0.66           C
ATOM   5123  O   CYS A 128     -37.451  11.327 -21.767  1.00  0.66           O
ATOM   5124  CB  CYS A 128     -38.809   9.155 -19.908  1.00  0.66           C
ATOM   5125  SG  CYS A 128     -39.697   7.636 -19.464  1.00  0.66           S
ATOM   5126  N   SER A 129     -39.691  11.498 -21.883  1.00  0.75           N
ATOM   5127  CA  SER A 129     -39.753  12.952 -21.955  1.00  0.75           C
ATOM   5128  C   SER A 129     -39.667  13.558 -20.565  1.00  0.75           C
ATOM   5129  O   SER A 129     -39.307  14.711 -20.363  1.00  0.75           O
ATOM   5130  CB  SER A 129     -41.096  13.323 -22.635  1.00  0.75           C
ATOM   5131  OG  SER A 129     -41.208  14.703 -22.969  1.00  0.75           O
ATOM   5132  N   CYS A 130     -39.987  12.747 -19.543  1.00  0.76           N
ATOM   5133  CA  CYS A 130     -39.579  12.975 -18.175  1.00  0.76           C
ATOM   5134  C   CYS A 130     -38.092  12.727 -17.956  1.00  0.76           C
ATOM   5135  O   CYS A 130     -37.570  11.719 -18.434  1.00  0.76           O
ATOM   5136  CB  CYS A 130     -40.422  12.139 -17.160  1.00  0.76           C
ATOM   5137  SG  CYS A 130     -41.671  11.039 -17.936  1.00  0.76           S
ATOM   5138  N   ASP A 131     -37.478  13.630 -17.165  1.00  0.62           N
ATOM   5139  CA  ASP A 131     -36.088  13.648 -16.754  1.00  0.62           C
ATOM   5140  C   ASP A 131     -35.197  14.379 -17.803  1.00  0.62           C
ATOM   5141  O   ASP A 131     -35.764  15.066 -18.695  1.00  0.62           O
ATOM   5142  CB  ASP A 131     -35.516  12.273 -16.310  1.00  0.62           C
ATOM   5143  CG  ASP A 131     -36.269  11.652 -15.144  1.00  0.62           C
ATOM   5144  OD1 ASP A 131     -37.503  11.395 -15.227  1.00  0.62           O
ATOM   5145  OD2 ASP A 131     -35.620  11.284 -14.136  1.00  0.62           O
ATOM   5146  OXT ASP A 131     -33.943  14.312 -17.680  1.00  0.62           O
TER    5147      ASP A 131
ATOM   5148 ZN   ZN  _   1     -46.320 -13.552 -16.506  1.00215.38          Zn
ATOM   5149 ZN   ZN  _   2     -41.779   8.811 -18.675  1.00261.86          Zn
ATOM   5150 ZN   ZN  _   3     -27.444 -24.739  10.948  1.00225.21          Zn
ATOM   5151 ZN   ZN  _   4     -30.795 -55.503  -1.590  1.00160.42          Zn
ATOM   5152 MG   MG  _   6     -37.552 -44.263 -11.357  1.00132.39          Mg
ATOM   5153 ZN   ZN  C 603      -2.543 -54.752  42.131  1.00147.18          Zn
ATOM   5153 ZN   ZN  C 603    19671  16819  19432   2120  -3078  -1992      Zn
ENDMDL
END



If you find results from this site helpful for your research, please cite one of our papers:

elNémo is maintained by Yves-Henri Sanejouand.
It was developed by Karsten Suhre.
Between 2003 and 2014, it was hosted by IGS (Marseille).
Last modification: October 18th, 2018.