CNRS Nantes University UFIP UFIP
home |  start a new run |  job status |  references&downloads |  examples |  help  

Should you encounter any unexpected behaviour,
please let us know.


***  HYDROLASE 07-OCT-03 1R42  ***

elNémo ID: 20071807150278234

Job options:

ID        	=	 20071807150278234
JOBID     	=	 HYDROLASE 07-OCT-03 1R42
USERID    	=	 unknown
PRIVAT    	=	 0

NMODES    	=	 5
DQMIN     	=	 -100
DQMAX     	=	 100
DQSTEP    	=	 20
DOGRAPHS  	=	 on

DOPROJMODS	=	 on
DORMSD    	=	 on

NRBL      	=	 0
CUTOFF    	=	 0
CAONLY    	=	 0


Input data for this run:


HEADER    HYDROLASE                               07-OCT-03   1R42              
TITLE     NATIVE HUMAN ANGIOTENSIN CONVERTING ENZYME-RELATED CARBOXYPEPTIDASE   
TITLE    2 (ACE2)                                                               
COMPND    MOL_ID: 1;                                                            
COMPND   2 MOLECULE: ANGIOTENSIN I CONVERTING ENZYME 2;                         
COMPND   3 CHAIN: A;                                                            
COMPND   4 FRAGMENT: EXTRACELLULAR DOMAINS;                                     
COMPND   5 SYNONYM: ANGIOTENSIN CONVERTING ENZYME-LIKE PROTEIN, ANGIOTENSIN     
COMPND   6 CONVERTING ENZYME-RELATED CARBOXYPEPTIDASE;                          
COMPND   7 ENGINEERED: YES;                                                     
COMPND   8 MOL_ID: 2;                                                           
COMPND   9 MOLECULE: DISORDERED SEGMENT OF COLLECTRIN HOMOLOGY DOMAIN;          
COMPND  10 CHAIN: B;                                                            
COMPND  11 ENGINEERED: YES;                                                     
COMPND  12 MOL_ID: 3;                                                           
COMPND  13 MOLECULE: DISORDERED SEGMENT OF COLLECTRIN HOMOLOGY DOMAIN;          
COMPND  14 CHAIN: C;                                                            
COMPND  15 ENGINEERED: YES;                                                     
COMPND  16 MOL_ID: 4;                                                           
COMPND  17 MOLECULE: DISORDERED SEGMENT OF COLLECTRIN HOMOLOGY DOMAIN;          
COMPND  18 CHAIN: D;                                                            
COMPND  19 ENGINEERED: YES;                                                     
COMPND  20 MOL_ID: 5;                                                           
COMPND  21 MOLECULE: DISORDERED SEGMENT OF COLLECTRIN HOMOLOGY DOMAIN;          
COMPND  22 CHAIN: E;                                                            
COMPND  23 ENGINEERED: YES                                                      
SOURCE    MOL_ID: 1;                                                            
SOURCE   2 ORGANISM_SCIENTIFIC: HOMO SAPIENS;                                   
SOURCE   3 ORGANISM_COMMON: HUMAN;                                              
SOURCE   4 ORGANISM_TAXID: 9606;                                                
SOURCE   5 GENE: ACE2;                                                          
SOURCE   6 EXPRESSION_SYSTEM: SPODOPTERA FRUGIPERDA;                            
SOURCE   7 EXPRESSION_SYSTEM_COMMON: FALL ARMYWORM;                             
SOURCE   8 EXPRESSION_SYSTEM_TAXID: 7108;                                       
SOURCE   9 EXPRESSION_SYSTEM_CELL_LINE: SF9;                                    
SOURCE  10 EXPRESSION_SYSTEM_VECTOR_TYPE: BACULOVIRUS;                          
SOURCE  11 EXPRESSION_SYSTEM_VECTOR: PBAC PAK9;                                 
SOURCE  12 MOL_ID: 2;                                                           
SOURCE  13 ORGANISM_SCIENTIFIC: HOMO SAPIENS;                                   
SOURCE  14 ORGANISM_COMMON: HUMAN;                                              
SOURCE  15 ORGANISM_TAXID: 9606;                                                
SOURCE  16 GENE: ACE2;                                                          
SOURCE  17 EXPRESSION_SYSTEM: SPODOPTERA FRUGIPERDA;                            
SOURCE  18 EXPRESSION_SYSTEM_COMMON: FALL ARMYWORM;                             
SOURCE  19 EXPRESSION_SYSTEM_TAXID: 7108;                                       
SOURCE  20 EXPRESSION_SYSTEM_CELL_LINE: SF9;                                    
SOURCE  21 EXPRESSION_SYSTEM_VECTOR_TYPE: BACULOVIRUS;                          
SOURCE  22 EXPRESSION_SYSTEM_VECTOR: PBAC PAK9;                                 
SOURCE  23 MOL_ID: 3;                                                           
SOURCE  24 ORGANISM_SCIENTIFIC: HOMO SAPIENS;                                   
SOURCE  25 ORGANISM_COMMON: HUMAN;                                              
SOURCE  26 ORGANISM_TAXID: 9606;                                                
SOURCE  27 GENE: ACE2;                                                          
SOURCE  28 EXPRESSION_SYSTEM: SPODOPTERA FRUGIPERDA;                            
SOURCE  29 EXPRESSION_SYSTEM_COMMON: FALL ARMYWORM;                             
SOURCE  30 EXPRESSION_SYSTEM_TAXID: 7108;                                       
SOURCE  31 EXPRESSION_SYSTEM_CELL_LINE: SF9;                                    
SOURCE  32 EXPRESSION_SYSTEM_VECTOR_TYPE: BACULOVIRUS;                          
SOURCE  33 EXPRESSION_SYSTEM_VECTOR: PBAC PAK9;                                 
SOURCE  34 MOL_ID: 4;                                                           
SOURCE  35 ORGANISM_SCIENTIFIC: HOMO SAPIENS;                                   
SOURCE  36 ORGANISM_COMMON: HUMAN;                                              
SOURCE  37 ORGANISM_TAXID: 9606;                                                
SOURCE  38 GENE: ACE2;                                                          
SOURCE  39 EXPRESSION_SYSTEM: SPODOPTERA FRUGIPERDA;                            
SOURCE  40 EXPRESSION_SYSTEM_COMMON: FALL ARMYWORM;                             
SOURCE  41 EXPRESSION_SYSTEM_TAXID: 7108;                                       
SOURCE  42 EXPRESSION_SYSTEM_CELL_LINE: SF9;                                    
SOURCE  43 EXPRESSION_SYSTEM_VECTOR_TYPE: BACULOVIRUS;                          
SOURCE  44 EXPRESSION_SYSTEM_VECTOR: PBAC PAK9;                                 
SOURCE  45 MOL_ID: 5;                                                           
SOURCE  46 ORGANISM_SCIENTIFIC: HOMO SAPIENS;                                   
SOURCE  47 ORGANISM_COMMON: HUMAN;                                              
SOURCE  48 ORGANISM_TAXID: 9606;                                                
SOURCE  49 GENE: ACE2;                                                          
SOURCE  50 EXPRESSION_SYSTEM: SPODOPTERA FRUGIPERDA;                            
SOURCE  51 EXPRESSION_SYSTEM_COMMON: FALL ARMYWORM;                             
SOURCE  52 EXPRESSION_SYSTEM_TAXID: 7108;                                       
SOURCE  53 EXPRESSION_SYSTEM_CELL_LINE: SF9;                                    
SOURCE  54 EXPRESSION_SYSTEM_VECTOR_TYPE: BACULOVIRUS;                          
SOURCE  55 EXPRESSION_SYSTEM_VECTOR: PBAC PAK9                                  
KEYWDS    ZINC METALLOPEPTIDASE DOMAIN, COLLECTRIN HOMOLOGY DOMAIN, NATIVE OR   
KEYWDS   2 OPEN CONFORMATION, CHLORIDE ION BINDING SITE, ZINC BINDING SITE,     
KEYWDS   3 HYDROLASE                                                            
EXPDTA    X-RAY DIFFRACTION                                                     
AUTHOR    P.TOWLER,B.STAKER,S.G.PRASAD,S.MENON,D.RYAN,J.TANG,T.PARSONS,         
AUTHOR   2 M.FISHER,D.WILLIAMS,N.A.DALES,M.A.PATANE,M.W.PANTOLIANO              
REVDAT   5   24-JAN-18 1R42    1       JRNL                                     
REVDAT   4   13-JUL-11 1R42    1       VERSN                                    
REVDAT   3   24-FEB-09 1R42    1       VERSN                                    
REVDAT   2   27-APR-04 1R42    1       JRNL                                     
REVDAT   1   03-FEB-04 1R42    0                                                
JRNL        AUTH   P.TOWLER,B.STAKER,S.G.PRASAD,S.MENON,J.TANG,T.PARSONS,       
JRNL        AUTH 2 D.RYAN,M.FISHER,D.WILLIAMS,N.A.DALES,M.A.PATANE,             
JRNL        AUTH 3 M.W.PANTOLIANO                                               
JRNL        TITL   ACE2 X-RAY STRUCTURES REVEAL A LARGE HINGE-BENDING MOTION    
JRNL        TITL 2 IMPORTANT FOR INHIBITOR BINDING AND CATALYSIS.               
JRNL        REF    J.BIOL.CHEM.                  V. 279 17996 2004              
JRNL        REFN                   ISSN 0021-9258                               
JRNL        PMID   14754895                                                     
JRNL        DOI    10.1074/JBC.M311191200                                       
REMARK   1                                                                      
REMARK   1 REFERENCE 1                                                          
REMARK   1  AUTH   N.A DALES,A.E.GOULD,J.A.BROWN,E.F.CALDERWOOD,B.GUAN,         
REMARK   1  AUTH 2 C.A.MINOR,J.M.GAVIN,P.HALES,V.K.KAUSHIK,M.STEWART,           
REMARK   1  AUTH 3 P.J.TUMMINO,C.S.VICKERS,T.D.OCAIN,M.A.PANTANE                
REMARK   1  TITL   SUBSTRATE-BASED DESIGN OF THE FIRST CLASS OF                 
REMARK   1  TITL 2 ANGIOTENSIN-CONVERTING ENZYME-RELATED CARBOXYPEPTIDASE       
REMARK   1  TITL 3 (ACE2) INHIBITORS                                            
REMARK   1  REF    J.AM.CHEM.SOC.                V. 124 11852 2002              
REMARK   1  REFN                   ISSN 0002-7863                               
REMARK   1  DOI    10.1021/JA0277226                                            
REMARK   1 REFERENCE 2                                                          
REMARK   1  AUTH   C.VICKERS,P.HALES,V.KAUSHIK,L.DICK,J.GAVIN,J.TANG,K.GODBOUT, 
REMARK   1  AUTH 2 T.PARSONS,E.BARONAS,F.HSIEH,S.ACTON,M.PATANE,A.NICHOLS,      
REMARK   1  AUTH 3 P.TUMMINO                                                    
REMARK   1  TITL   HYDROLYSIS OF BIOLOGICAL PEPTIDES BY HUMAN                   
REMARK   1  TITL 2 ANGIOTENSIN-CONVERTING ENZYME-RELATED CARBOXYPEPTIDASE       
REMARK   1  REF    J.BIOL.CHEM.                  V. 277 14838 2002              
REMARK   1  REFN                   ISSN 0021-9258                               
REMARK   1  DOI    10.1074/JBC.M200581200                                       
REMARK   2                                                                      
REMARK   2 RESOLUTION.    2.20 ANGSTROMS.                                       
REMARK   3                                                                      
REMARK   3 REFINEMENT.                                                          
REMARK   3   PROGRAM     : CNX 2002                                             
REMARK   3   AUTHORS     : BRUNGER,ADAMS,CLORE,DELANO,GROS,GROSSE-              
REMARK   3               : KUNSTLEVE,JIANG,KUSZEWSKI,NILGES,PANNU,              
REMARK   3               : READ,RICE,SIMONSON,WARREN,ACCELRYS                   
REMARK   3               : SOFTWARE INC.(BADGER,BERARD,KUMAR,SZALMA,            
REMARK   3               : YIP,DZAKULA)                                         
REMARK   3                                                                      
REMARK   3  DATA USED IN REFINEMENT.                                            
REMARK   3   RESOLUTION RANGE HIGH (ANGSTROMS) : 2.20                           
REMARK   3   RESOLUTION RANGE LOW  (ANGSTROMS) : 46.74                          
REMARK   3   DATA CUTOFF            (SIGMA(F)) : 0.000                          
REMARK   3   DATA CUTOFF HIGH         (ABS(F)) : 2383730.950                    
REMARK   3   DATA CUTOFF LOW          (ABS(F)) : 0.0000                         
REMARK   3   COMPLETENESS (WORKING+TEST)   (%) : 96.3                           
REMARK   3   NUMBER OF REFLECTIONS             : 47465                          
REMARK   3                                                                      
REMARK   3  FIT TO DATA USED IN REFINEMENT.                                     
REMARK   3   CROSS-VALIDATION METHOD          : THROUGHOUT                      
REMARK   3   FREE R VALUE TEST SET SELECTION  : RANDOM                          
REMARK   3   R VALUE     (WORKING + TEST SET) : 0.235                           
REMARK   3   R VALUE            (WORKING SET) : 0.235                           
REMARK   3   FREE R VALUE                     : 0.287                           
REMARK   3   FREE R VALUE TEST SET SIZE   (%) : 10.100                          
REMARK   3   FREE R VALUE TEST SET COUNT      : 4798                            
REMARK   3   ESTIMATED ERROR OF FREE R VALUE  : 0.004                           
REMARK   3                                                                      
REMARK   3  FIT/AGREEMENT OF MODEL WITH ALL DATA.                               
REMARK   3   R VALUE     (WORKING + TEST SET, NO CUTOFF) : NULL                 
REMARK   3   R VALUE            (WORKING SET, NO CUTOFF) : NULL                 
REMARK   3   FREE R VALUE                    (NO CUTOFF) : NULL                 
REMARK   3   FREE R VALUE TEST SET SIZE   (%, NO CUTOFF) : NULL                 
REMARK   3   FREE R VALUE TEST SET COUNT     (NO CUTOFF) : NULL                 
REMARK   3   ESTIMATED ERROR OF FREE R VALUE (NO CUTOFF) : NULL                 
REMARK   3   TOTAL NUMBER OF REFLECTIONS     (NO CUTOFF) : NULL                 
REMARK   3                                                                      
REMARK   3  FIT IN THE HIGHEST RESOLUTION BIN.                                  
REMARK   3   TOTAL NUMBER OF BINS USED           : 6                            
REMARK   3   BIN RESOLUTION RANGE HIGH       (A) : 2.20                         
REMARK   3   BIN RESOLUTION RANGE LOW        (A) : 2.34                         
REMARK   3   BIN COMPLETENESS (WORKING+TEST) (%) : 81.80                        
REMARK   3   REFLECTIONS IN BIN    (WORKING SET) : 5982                         
REMARK   3   BIN R VALUE           (WORKING SET) : 0.3790                       
REMARK   3   BIN FREE R VALUE                    : 0.3980                       
REMARK   3   BIN FREE R VALUE TEST SET SIZE  (%) : 9.90                         
REMARK   3   BIN FREE R VALUE TEST SET COUNT     : 659                          
REMARK   3   ESTIMATED ERROR OF BIN FREE R VALUE : 0.015                        
REMARK   3                                                                      
REMARK   3  NUMBER OF NON-HYDROGEN ATOMS USED IN REFINEMENT.                    
REMARK   3   PROTEIN ATOMS            : 5165                                    
REMARK   3   NUCLEIC ACID ATOMS       : 0                                       
REMARK   3   HETEROGEN ATOMS          : 44                                      
REMARK   3   SOLVENT ATOMS            : 302                                     
REMARK   3                                                                      
REMARK   3  B VALUES.                                                           
REMARK   3   FROM WILSON PLOT           (A**2) : 52.80                          
REMARK   3   MEAN B VALUE      (OVERALL, A**2) : 59.90                          
REMARK   3   OVERALL ANISOTROPIC B VALUE.                                       
REMARK   3    B11 (A**2) : -6.61000                                             
REMARK   3    B22 (A**2) : 6.46000                                              
REMARK   3    B33 (A**2) : 0.14000                                              
REMARK   3    B12 (A**2) : 0.00000                                              
REMARK   3    B13 (A**2) : 11.31000                                             
REMARK   3    B23 (A**2) : 0.00000                                              
REMARK   3                                                                      
REMARK   3  ESTIMATED COORDINATE ERROR.                                         
REMARK   3   ESD FROM LUZZATI PLOT        (A) : 0.33                            
REMARK   3   ESD FROM SIGMAA              (A) : 0.40                            
REMARK   3   LOW RESOLUTION CUTOFF        (A) : 5.00                            
REMARK   3                                                                      
REMARK   3  CROSS-VALIDATED ESTIMATED COORDINATE ERROR.                         
REMARK   3   ESD FROM C-V LUZZATI PLOT    (A) : 0.41                            
REMARK   3   ESD FROM C-V SIGMAA          (A) : 0.43                            
REMARK   3                                                                      
REMARK   3  RMS DEVIATIONS FROM IDEAL VALUES.                                   
REMARK   3   BOND LENGTHS                 (A) : 0.008                           
REMARK   3   BOND ANGLES            (DEGREES) : 1.400                           
REMARK   3   DIHEDRAL ANGLES        (DEGREES) : 21.70                           
REMARK   3   IMPROPER ANGLES        (DEGREES) : 0.920                           
REMARK   3                                                                      
REMARK   3  ISOTROPIC THERMAL MODEL : RESTRAINED                                
REMARK   3                                                                      
REMARK   3  ISOTROPIC THERMAL FACTOR RESTRAINTS.    RMS    SIGMA                
REMARK   3   MAIN-CHAIN BOND              (A**2) : 2.040 ; 1.500                
REMARK   3   MAIN-CHAIN ANGLE             (A**2) : 3.090 ; 2.000                
REMARK   3   SIDE-CHAIN BOND              (A**2) : 3.300 ; 2.000                
REMARK   3   SIDE-CHAIN ANGLE             (A**2) : 4.420 ; 2.500                
REMARK   3                                                                      
REMARK   3  BULK SOLVENT MODELING.                                              
REMARK   3   METHOD USED : FLAT MODEL                                           
REMARK   3   KSOL        : 0.34                                                 
REMARK   3   BSOL        : 64.55                                                
REMARK   3                                                                      
REMARK   3  NCS MODEL : NULL                                                    
REMARK   3                                                                      
REMARK   3  NCS RESTRAINTS.                         RMS   SIGMA/WEIGHT          
REMARK   3   GROUP  1  POSITIONAL            (A) : NULL  ; NULL                 
REMARK   3   GROUP  1  B-FACTOR           (A**2) : NULL  ; NULL                 
REMARK   3                                                                      
REMARK   3  PARAMETER FILE  1  : PROTEIN_REP.PARAM                              
REMARK   3  PARAMETER FILE  2  : DNA-RNA_REP.PARAM                              
REMARK   3  PARAMETER FILE  3  : WATER_REP.PARAM                                
REMARK   3  PARAMETER FILE  4  : ION.PARAM                                      
REMARK   3  PARAMETER FILE  5  : CARBOHYDRATE.PARAM                             
REMARK   3  PARAMETER FILE  6  : NULL                                           
REMARK   3  TOPOLOGY FILE  1   : PROTEIN.TOP                                    
REMARK   3  TOPOLOGY FILE  2   : CARBOHYDRATE.TOP                               
REMARK   3  TOPOLOGY FILE  3   : WATER.TOP                                      
REMARK   3  TOPOLOGY FILE  4   : ION.TOP                                        
REMARK   3  TOPOLOGY FILE  5   : NULL                                           
REMARK   3  TOPOLOGY FILE  6   : NULL                                           
REMARK   3                                                                      
REMARK   3  OTHER REFINEMENT REMARKS: NULL                                      
REMARK   4                                                                      
REMARK   4 1R42 COMPLIES WITH FORMAT V. 3.30, 13-JUL-11                         
REMARK 100                                                                      
REMARK 100 THIS ENTRY HAS BEEN PROCESSED BY RCSB ON 07-OCT-03.                  
REMARK 100 THE DEPOSITION ID IS D_1000020410.                                   
REMARK 200                                                                      
REMARK 200 EXPERIMENTAL DETAILS                                                 
REMARK 200  EXPERIMENT TYPE                : X-RAY DIFFRACTION                  
REMARK 200  DATE OF DATA COLLECTION        : 21-JUN-01                          
REMARK 200  TEMPERATURE           (KELVIN) : 140                                
REMARK 200  PH                             : 8.5                                
REMARK 200  NUMBER OF CRYSTALS USED        : 1                                  
REMARK 200                                                                      
REMARK 200  SYNCHROTRON              (Y/N) : Y                                  
REMARK 200  RADIATION SOURCE               : NSLS                               
REMARK 200  BEAMLINE                       : X25                                
REMARK 200  X-RAY GENERATOR MODEL          : NULL                               
REMARK 200  MONOCHROMATIC OR LAUE    (M/L) : M                                  
REMARK 200  WAVELENGTH OR RANGE        (A) : 1.28                               
REMARK 200  MONOCHROMATOR                  : NULL                               
REMARK 200  OPTICS                         : NULL                               
REMARK 200                                                                      
REMARK 200  DETECTOR TYPE                  : AREA DETECTOR                      
REMARK 200  DETECTOR MANUFACTURER          : NULL                               
REMARK 200  INTENSITY-INTEGRATION SOFTWARE : DENZO                              
REMARK 200  DATA SCALING SOFTWARE          : SCALEPACK                          
REMARK 200                                                                      
REMARK 200  NUMBER OF UNIQUE REFLECTIONS   : 49286                              
REMARK 200  RESOLUTION RANGE HIGH      (A) : 2.200                              
REMARK 200  RESOLUTION RANGE LOW       (A) : 40.000                             
REMARK 200  REJECTION CRITERIA  (SIGMA(I)) : 0.000                              
REMARK 200                                                                      
REMARK 200 OVERALL.                                                             
REMARK 200  COMPLETENESS FOR RANGE     (%) : 96.3                               
REMARK 200  DATA REDUNDANCY                : 15.90                              
REMARK 200  R MERGE                    (I) : NULL                               
REMARK 200  R SYM                      (I) : 0.05700                            
REMARK 200   FOR THE DATA SET  : 21.4000                            
REMARK 200                                                                      
REMARK 200 IN THE HIGHEST RESOLUTION SHELL.                                     
REMARK 200  HIGHEST RESOLUTION SHELL, RANGE HIGH (A) : NULL                     
REMARK 200  HIGHEST RESOLUTION SHELL, RANGE LOW  (A) : NULL                     
REMARK 200  COMPLETENESS FOR SHELL     (%) : NULL                               
REMARK 200  DATA REDUNDANCY IN SHELL       : NULL                               
REMARK 200  R MERGE FOR SHELL          (I) : NULL                               
REMARK 200  R SYM FOR SHELL            (I) : NULL                               
REMARK 200   FOR SHELL         : NULL                               
REMARK 200                                                                      
REMARK 200 DIFFRACTION PROTOCOL: SINGLE WAVELENGTH                              
REMARK 200 METHOD USED TO DETERMINE THE STRUCTURE: MIR                          
REMARK 200 SOFTWARE USED: MLPHARE                                               
REMARK 200 STARTING MODEL: NULL                                                 
REMARK 200                                                                      
REMARK 200 REMARK: NULL                                                         
REMARK 280                                                                      
REMARK 280 CRYSTAL                                                              
REMARK 280 SOLVENT CONTENT, VS   (%): 53.00                                     
REMARK 280 MATTHEWS COEFFICIENT, VM (ANGSTROMS**3/DA): 3.24                     
REMARK 280                                                                      
REMARK 280 CRYSTALLIZATION CONDITIONS: 100 MM TRIS-HCL, 200 MM MGCL2, 14% PEG   
REMARK 280  8000, PH 8.5, VAPOR DIFFUSION, HANGING DROP, TEMPERATURE 291K       
REMARK 290                                                                      
REMARK 290 CRYSTALLOGRAPHIC SYMMETRY                                            
REMARK 290 SYMMETRY OPERATORS FOR SPACE GROUP: C 1 2 1                          
REMARK 290                                                                      
REMARK 290      SYMOP   SYMMETRY                                                
REMARK 290     NNNMMM   OPERATOR                                                
REMARK 290       1555   X,Y,Z                                                   
REMARK 290       2555   -X,Y,-Z                                                 
REMARK 290       3555   X+1/2,Y+1/2,Z                                           
REMARK 290       4555   -X+1/2,Y+1/2,-Z                                         
REMARK 290                                                                      
REMARK 290     WHERE NNN -> OPERATOR NUMBER                                     
REMARK 290           MMM -> TRANSLATION VECTOR                                  
REMARK 290                                                                      
REMARK 290 CRYSTALLOGRAPHIC SYMMETRY TRANSFORMATIONS                            
REMARK 290 THE FOLLOWING TRANSFORMATIONS OPERATE ON THE ATOM/HETATM             
REMARK 290 RECORDS IN THIS ENTRY TO PRODUCE CRYSTALLOGRAPHICALLY                
REMARK 290 RELATED MOLECULES.                                                   
REMARK 290   SMTRY1   1  1.000000  0.000000  0.000000        0.00000            
REMARK 290   SMTRY2   1  0.000000  1.000000  0.000000        0.00000            
REMARK 290   SMTRY3   1  0.000000  0.000000  1.000000        0.00000            
REMARK 290   SMTRY1   2 -1.000000  0.000000  0.000000        0.00000            
REMARK 290   SMTRY2   2  0.000000  1.000000  0.000000        0.00000            
REMARK 290   SMTRY3   2  0.000000  0.000000 -1.000000        0.00000            
REMARK 290   SMTRY1   3  1.000000  0.000000  0.000000       51.81900            
REMARK 290   SMTRY2   3  0.000000  1.000000  0.000000       44.73900            
REMARK 290   SMTRY3   3  0.000000  0.000000  1.000000        0.00000            
REMARK 290   SMTRY1   4 -1.000000  0.000000  0.000000       51.81900            
REMARK 290   SMTRY2   4  0.000000  1.000000  0.000000       44.73900            
REMARK 290   SMTRY3   4  0.000000  0.000000 -1.000000        0.00000            
REMARK 290                                                                      
REMARK 290 REMARK: NULL                                                         
REMARK 300                                                                      
REMARK 300 BIOMOLECULE: 1                                                       
REMARK 300 SEE REMARK 350 FOR THE AUTHOR PROVIDED AND/OR PROGRAM                
REMARK 300 GENERATED ASSEMBLY INFORMATION FOR THE STRUCTURE IN                  
REMARK 300 THIS ENTRY. THE REMARK MAY ALSO PROVIDE INFORMATION ON               
REMARK 300 BURIED SURFACE AREA.                                                 
REMARK 350                                                                      
REMARK 350 COORDINATES FOR A COMPLETE MULTIMER REPRESENTING THE KNOWN           
REMARK 350 BIOLOGICALLY SIGNIFICANT OLIGOMERIZATION STATE OF THE                
REMARK 350 MOLECULE CAN BE GENERATED BY APPLYING BIOMT TRANSFORMATIONS          
REMARK 350 GIVEN BELOW.  BOTH NON-CRYSTALLOGRAPHIC AND                          
REMARK 350 CRYSTALLOGRAPHIC OPERATIONS ARE GIVEN.                               
REMARK 350                                                                      
REMARK 350 BIOMOLECULE: 1                                                       
REMARK 350 AUTHOR DETERMINED BIOLOGICAL UNIT: PENTAMERIC                        
REMARK 350 APPLY THE FOLLOWING TO CHAINS: A, B, C, D, E                         
REMARK 350   BIOMT1   1  1.000000  0.000000  0.000000        0.00000            
REMARK 350   BIOMT2   1  0.000000  1.000000  0.000000        0.00000            
REMARK 350   BIOMT3   1  0.000000  0.000000  1.000000        0.00000            
REMARK 465                                                                      
REMARK 465 MISSING RESIDUES                                                     
REMARK 465 THE FOLLOWING RESIDUES WERE NOT LOCATED IN THE                       
REMARK 465 EXPERIMENT. (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN               
REMARK 465 IDENTIFIER; SSSEQ=SEQUENCE NUMBER; I=INSERTION CODE.)                
REMARK 465                                                                      
REMARK 465   M RES C SSSEQI                                                     
REMARK 465     MET A     1                                                      
REMARK 465     SER A     2                                                      
REMARK 465     SER A     3                                                      
REMARK 465     SER A     4                                                      
REMARK 465     SER A     5                                                      
REMARK 465     TRP A     6                                                      
REMARK 465     LEU A     7                                                      
REMARK 465     LEU A     8                                                      
REMARK 465     LEU A     9                                                      
REMARK 465     SER A    10                                                      
REMARK 465     LEU A    11                                                      
REMARK 465     VAL A    12                                                      
REMARK 465     ALA A    13                                                      
REMARK 465     VAL A    14                                                      
REMARK 465     THR A    15                                                      
REMARK 465     ALA A    16                                                      
REMARK 465     ALA A    17                                                      
REMARK 465     GLN A    18                                                      
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: CLOSE CONTACTS IN SAME ASYMMETRIC UNIT                     
REMARK 500                                                                      
REMARK 500 THE FOLLOWING ATOMS ARE IN CLOSE CONTACT.                            
REMARK 500                                                                      
REMARK 500  ATM1  RES C  SSEQI   ATM2  RES C  SSEQI           DISTANCE          
REMARK 500   O    GLY A   605     O    HOH A   915              2.19            
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: CLOSE CONTACTS                                             
REMARK 500                                                                      
REMARK 500 THE FOLLOWING ATOMS THAT ARE RELATED BY CRYSTALLOGRAPHIC             
REMARK 500 SYMMETRY ARE IN CLOSE CONTACT.  AN ATOM LOCATED WITHIN 0.15          
REMARK 500 ANGSTROMS OF A SYMMETRY RELATED ATOM IS ASSUMED TO BE ON A           
REMARK 500 SPECIAL POSITION AND IS, THEREFORE, LISTED IN REMARK 375             
REMARK 500 INSTEAD OF REMARK 500.  ATOMS WITH NON-BLANK ALTERNATE               
REMARK 500 LOCATION INDICATORS ARE NOT INCLUDED IN THE CALCULATIONS.            
REMARK 500                                                                      
REMARK 500 DISTANCE CUTOFF:                                                     
REMARK 500 2.2 ANGSTROMS FOR CONTACTS NOT INVOLVING HYDROGEN ATOMS              
REMARK 500 1.6 ANGSTROMS FOR CONTACTS INVOLVING HYDROGEN ATOMS                  
REMARK 500                                                                      
REMARK 500  ATM1  RES C  SSEQI   ATM2  RES C  SSEQI  SSYMOP   DISTANCE          
REMARK 500   OE1  GLN A    89     OE1  GLN A    89     2756     2.15            
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: COVALENT BOND ANGLES                                       
REMARK 500                                                                      
REMARK 500 THE STEREOCHEMICAL PARAMETERS OF THE FOLLOWING RESIDUES              
REMARK 500 HAVE VALUES WHICH DEVIATE FROM EXPECTED VALUES BY MORE               
REMARK 500 THAN 6*RMSD (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN               
REMARK 500 IDENTIFIER; SSEQ=SEQUENCE NUMBER; I=INSERTION CODE).                 
REMARK 500                                                                      
REMARK 500 STANDARD TABLE:                                                      
REMARK 500 FORMAT: (10X,I3,1X,A3,1X,A1,I4,A1,3(1X,A4,2X),12X,F5.1)              
REMARK 500                                                                      
REMARK 500 EXPECTED VALUES PROTEIN: ENGH AND HUBER, 1999                        
REMARK 500 EXPECTED VALUES NUCLEIC ACID: CLOWNEY ET AL 1996                     
REMARK 500                                                                      
REMARK 500  M RES CSSEQI ATM1   ATM2   ATM3                                     
REMARK 500    LEU A 456   CA  -  CB  -  CG  ANGL. DEV. =  15.3 DEGREES          
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: TORSION ANGLES                                             
REMARK 500                                                                      
REMARK 500 TORSION ANGLES OUTSIDE THE EXPECTED RAMACHANDRAN REGIONS:            
REMARK 500 (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN IDENTIFIER;               
REMARK 500 SSEQ=SEQUENCE NUMBER; I=INSERTION CODE).                             
REMARK 500                                                                      
REMARK 500 STANDARD TABLE:                                                      
REMARK 500 FORMAT:(10X,I3,1X,A3,1X,A1,I4,A1,4X,F7.2,3X,F7.2)                    
REMARK 500                                                                      
REMARK 500 EXPECTED VALUES: GJ KLEYWEGT AND TA JONES (1996). PHI/PSI-           
REMARK 500 CHOLOGY: RAMACHANDRAN REVISITED. STRUCTURE 4, 1395 - 1400            
REMARK 500                                                                      
REMARK 500  M RES CSSEQI        PSI       PHI                                   
REMARK 500    ILE A  21       36.02    -66.62                                   
REMARK 500    GLU A  22      -49.48   -134.41                                   
REMARK 500    MET A  82      -35.67    -38.35                                   
REMARK 500    GLU A  87        3.92    -69.15                                   
REMARK 500    ASN A  90       91.77    -57.37                                   
REMARK 500    GLN A 101       40.27    -82.78                                   
REMARK 500    ASN A 137       89.44   -166.42                                   
REMARK 500    HIS A 195       37.14     74.12                                   
REMARK 500    THR A 294        3.36    -61.74                                   
REMARK 500    LYS A 353       49.36     38.53                                   
REMARK 500    ASN A 546      -13.39     79.81                                   
REMARK 500    UNK B 905     -129.45    -86.72                                   
REMARK 500    UNK C 908      114.29   -175.16                                   
REMARK 500    UNK C 913     -118.67   -114.93                                   
REMARK 500    UNK C 914       17.26   -179.41                                   
REMARK 500    UNK C 915       34.24     71.09                                   
REMARK 500    UNK C 916       63.48   -172.12                                   
REMARK 500    UNK C 917       -7.98    -17.99                                   
REMARK 500    UNK C 919     -163.14    168.17                                   
REMARK 500    UNK C 920      111.81    178.64                                   
REMARK 500    UNK C 921      130.01    -18.13                                   
REMARK 500    UNK C 922     -149.93    -79.68                                   
REMARK 500    UNK C 923      -94.86     52.86                                   
REMARK 500    UNK C 924       60.70     20.39                                   
REMARK 500    UNK E 946      105.00    -54.13                                   
REMARK 500    UNK E 948      172.40    -53.82                                   
REMARK 500    UNK E 957     -139.85     55.40                                   
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 620                                                                      
REMARK 620 METAL COORDINATION                                                   
REMARK 620 (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN IDENTIFIER;               
REMARK 620 SSEQ=SEQUENCE NUMBER; I=INSERTION CODE):                             
REMARK 620                                                                      
REMARK 620 COORDINATION ANGLES FOR:  M RES CSSEQI METAL                         
REMARK 620                              ZN A 804  ZN                            
REMARK 620 N RES CSSEQI ATOM                                                    
REMARK 620 1 HIS A 374   NE2                                                    
REMARK 620 2 HOH A 823   O   118.5                                              
REMARK 620 3 HIS A 378   NE2  93.0  96.8                                        
REMARK 620 4 GLU A 402   OE2  93.0 135.5 113.1                                  
REMARK 620 5 GLU A 402   OE1 151.6  89.1  90.3  60.0                            
REMARK 620 N                    1     2     3     4                             
REMARK 800                                                                      
REMARK 800 SITE                                                                 
REMARK 800 SITE_IDENTIFIER: AC1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE NAG A 800                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AC2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE NAG A 801                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AC3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE NAG A 802                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AC4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE CL A 803                  
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AC5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE ZN A 804                  
REMARK 900                                                                      
REMARK 900 RELATED ENTRIES                                                      
REMARK 900 RELATED ID: 1R4L   RELATED DB: PDB                                   
REMARK 900 INHIBITOR BOUND HUMAN ANGIOTENSIN CONVERTING ENZYME-RELATED          
REMARK 900 CARBOXYPEPTIDASE (ACE2)                                              
REMARK 999                                                                      
REMARK 999 SEQUENCE                                                             
REMARK 999 THE COMPLETE SEQUENCE CRYSTALLIZED BY THE AUTHORS                    
REMARK 999 (RESIDUES 1-740 OF REFERENCE SEQUENCE GB 11225609)                   
REMARK 999 IS AS FOLLOWS:                                                       
REMARK 999 MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNY                   
REMARK 999 NTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQ                  
REMARK 999 QNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNPQECLLLEPGLNEIM                  
REMARK 999 ANSLDYNERLWAWESWRSEVGKQLRPLYEEYVVLKNEMARANHYEDYGDYW                  
REMARK 999 RGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLMNAYPS                  
REMARK 999 YISPIGCLPAHLLGDMWGRFWTNLYSLTVPFGQKPNIDVTDAMVDQAWDAQ                  
REMARK 999 RIFKEAEKFFVSVGLPNMTQGFWENSMLTDPGNVQKAVCHPTAWDLGKGDF                  
REMARK 999 RILMCTKVTMDDFLTAHHEMGHIQYDMAYAAQPFLLRNGANEGFHEAVGEI                  
REMARK 999 MSLSAATPKHLKSIGLLSPDFQEDNETEINFLLKQALTIVGTLPFTYMLEK                  
REMARK 999 WRWMVFKGEIPKDQWMKKWWEMKREIVGVVEPVPHDETYCDPASLFHVSND                  
REMARK 999 YSFIRYYTRTLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQKLFNMLRL                  
REMARK 999 GKSEPWTLALENVVGAKNMNVRPLLNYFEPLFTWLKDQNKNSFVGWSTDWS                  
REMARK 999 PYADQSIKVRISLKSALGDKAYEWNDNEMYLFRSSVAYAMRQYFLKVKNQ                   
REMARK 999 MILFGEEDVRVANLKPRISFNFFVTAPKNVSDIIPRTEVEKAIRMSRSRIN                  
REMARK 999 DAFRLNDNSLEFLGIQPTLGPPNQPPVS                                         
REMARK 999 THE ELECTRON DENSITY MAP FOR MUCH OF THE COLLECTRIN                  
REMARK 999 HOMOLOGY DOMAIN (RESIDUES 616-740) IS WEAK.  ONLY                    
REMARK 999 ABOUT HALF OF THIS DOMAIN WAS VISIBLE IN THE ELECTRON                
REMARK 999 DENSITY MAP, AND WHAT CAN BE SEEN IS AMBIGUOUS DUE TO                
REMARK 999 TOPOLOGY AND CONNECTIVITY ISSUES.  FOR THIS REASON,                  
REMARK 999 RESIDUES BEGINNING AT 901 ARE LABELED AS UNKNOWN (UNK).              
REMARK 999 EACH FRAGMENT OF UNKNOWN RESIDUES HAS BEEN ASSIGNED                  
REMARK 999 A UNIQUE CHAIN ID. HOWEVER, IT SHOULD BE UNDERSTOOD                  
REMARK 999 THAT ONLY ONE SEQUENCE (RESIDUES 1-740) WAS CRYSTALLIZED.            
DBREF  1R42 A    1   615  GB     11225609 NP_068576        1    615             
DBREF  1R42 B  901   906  PDB    1R42     1R42           901    906             
DBREF  1R42 C  907   926  PDB    1R42     1R42           907    926             
DBREF  1R42 D  927   944  PDB    1R42     1R42           927    944             
DBREF  1R42 E  945   958  PDB    1R42     1R42           945    958             
SEQRES   1 A  615  MET SER SER SER SER TRP LEU LEU LEU SER LEU VAL ALA          
SEQRES   2 A  615  VAL THR ALA ALA GLN SER THR ILE GLU GLU GLN ALA LYS          
SEQRES   3 A  615  THR PHE LEU ASP LYS PHE ASN HIS GLU ALA GLU ASP LEU          
SEQRES   4 A  615  PHE TYR GLN SER SER LEU ALA SER TRP ASN TYR ASN THR          
SEQRES   5 A  615  ASN ILE THR GLU GLU ASN VAL GLN ASN MET ASN ASN ALA          
SEQRES   6 A  615  GLY ASP LYS TRP SER ALA PHE LEU LYS GLU GLN SER THR          
SEQRES   7 A  615  LEU ALA GLN MET TYR PRO LEU GLN GLU ILE GLN ASN LEU          
SEQRES   8 A  615  THR VAL LYS LEU GLN LEU GLN ALA LEU GLN GLN ASN GLY          
SEQRES   9 A  615  SER SER VAL LEU SER GLU ASP LYS SER LYS ARG LEU ASN          
SEQRES  10 A  615  THR ILE LEU ASN THR MET SER THR ILE TYR SER THR GLY          
SEQRES  11 A  615  LYS VAL CYS ASN PRO ASP ASN PRO GLN GLU CYS LEU LEU          
SEQRES  12 A  615  LEU GLU PRO GLY LEU ASN GLU ILE MET ALA ASN SER LEU          
SEQRES  13 A  615  ASP TYR ASN GLU ARG LEU TRP ALA TRP GLU SER TRP ARG          
SEQRES  14 A  615  SER GLU VAL GLY LYS GLN LEU ARG PRO LEU TYR GLU GLU          
SEQRES  15 A  615  TYR VAL VAL LEU LYS ASN GLU MET ALA ARG ALA ASN HIS          
SEQRES  16 A  615  TYR GLU ASP TYR GLY ASP TYR TRP ARG GLY ASP TYR GLU          
SEQRES  17 A  615  VAL ASN GLY VAL ASP GLY TYR ASP TYR SER ARG GLY GLN          
SEQRES  18 A  615  LEU ILE GLU ASP VAL GLU HIS THR PHE GLU GLU ILE LYS          
SEQRES  19 A  615  PRO LEU TYR GLU HIS LEU HIS ALA TYR VAL ARG ALA LYS          
SEQRES  20 A  615  LEU MET ASN ALA TYR PRO SER TYR ILE SER PRO ILE GLY          
SEQRES  21 A  615  CYS LEU PRO ALA HIS LEU LEU GLY ASP MET TRP GLY ARG          
SEQRES  22 A  615  PHE TRP THR ASN LEU TYR SER LEU THR VAL PRO PHE GLY          
SEQRES  23 A  615  GLN LYS PRO ASN ILE ASP VAL THR ASP ALA MET VAL ASP          
SEQRES  24 A  615  GLN ALA TRP ASP ALA GLN ARG ILE PHE LYS GLU ALA GLU          
SEQRES  25 A  615  LYS PHE PHE VAL SER VAL GLY LEU PRO ASN MET THR GLN          
SEQRES  26 A  615  GLY PHE TRP GLU ASN SER MET LEU THR ASP PRO GLY ASN          
SEQRES  27 A  615  VAL GLN LYS ALA VAL CYS HIS PRO THR ALA TRP ASP LEU          
SEQRES  28 A  615  GLY LYS GLY ASP PHE ARG ILE LEU MET CYS THR LYS VAL          
SEQRES  29 A  615  THR MET ASP ASP PHE LEU THR ALA HIS HIS GLU MET GLY          
SEQRES  30 A  615  HIS ILE GLN TYR ASP MET ALA TYR ALA ALA GLN PRO PHE          
SEQRES  31 A  615  LEU LEU ARG ASN GLY ALA ASN GLU GLY PHE HIS GLU ALA          
SEQRES  32 A  615  VAL GLY GLU ILE MET SER LEU SER ALA ALA THR PRO LYS          
SEQRES  33 A  615  HIS LEU LYS SER ILE GLY LEU LEU SER PRO ASP PHE GLN          
SEQRES  34 A  615  GLU ASP ASN GLU THR GLU ILE ASN PHE LEU LEU LYS GLN          
SEQRES  35 A  615  ALA LEU THR ILE VAL GLY THR LEU PRO PHE THR TYR MET          
SEQRES  36 A  615  LEU GLU LYS TRP ARG TRP MET VAL PHE LYS GLY GLU ILE          
SEQRES  37 A  615  PRO LYS ASP GLN TRP MET LYS LYS TRP TRP GLU MET LYS          
SEQRES  38 A  615  ARG GLU ILE VAL GLY VAL VAL GLU PRO VAL PRO HIS ASP          
SEQRES  39 A  615  GLU THR TYR CYS ASP PRO ALA SER LEU PHE HIS VAL SER          
SEQRES  40 A  615  ASN ASP TYR SER PHE ILE ARG TYR TYR THR ARG THR LEU          
SEQRES  41 A  615  TYR GLN PHE GLN PHE GLN GLU ALA LEU CYS GLN ALA ALA          
SEQRES  42 A  615  LYS HIS GLU GLY PRO LEU HIS LYS CYS ASP ILE SER ASN          
SEQRES  43 A  615  SER THR GLU ALA GLY GLN LYS LEU PHE ASN MET LEU ARG          
SEQRES  44 A  615  LEU GLY LYS SER GLU PRO TRP THR LEU ALA LEU GLU ASN          
SEQRES  45 A  615  VAL VAL GLY ALA LYS ASN MET ASN VAL ARG PRO LEU LEU          
SEQRES  46 A  615  ASN TYR PHE GLU PRO LEU PHE THR TRP LEU LYS ASP GLN          
SEQRES  47 A  615  ASN LYS ASN SER PHE VAL GLY TRP SER THR ASP TRP SER          
SEQRES  48 A  615  PRO TYR ALA ASP                                              
SEQRES   1 B    6  UNK UNK UNK UNK UNK UNK                                      
SEQRES   1 C   20  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   2 C   20  UNK UNK UNK UNK UNK UNK UNK                                  
SEQRES   1 D   18  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   2 D   18  UNK UNK UNK UNK UNK                                          
SEQRES   1 E   14  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES   2 E   14  UNK                                                          
MODRES 1R42 ASN A   90  ASN  GLYCOSYLATION SITE                                 
MODRES 1R42 ASN A  103  ASN  GLYCOSYLATION SITE                                 
MODRES 1R42 ASN A  546  ASN  GLYCOSYLATION SITE                                 
HET    NAG  A 800      14                                                       
HET    NAG  A 801      14                                                       
HET    NAG  A 802      14                                                       
HET     CL  A 803       1                                                       
HET     ZN  A 804       1                                                       
HETNAM     NAG N-ACETYL-D-GLUCOSAMINE                                           
HETNAM      CL CHLORIDE ION                                                     
HETNAM      ZN ZINC ION                                                         
FORMUL   6  NAG    3(C8 H15 N O6)                                               
FORMUL   9   CL    CL 1-                                                        
FORMUL  10   ZN    ZN 2+                                                        
FORMUL  11  HOH   *302(H2 O)                                                    
HELIX    1   1 GLU A   22  ASN A   53  1                                  32    
HELIX    2   2 THR A   55  THR A   78  1                                  24    
HELIX    3   3 ASN A   90  GLN A  101  1                                  12    
HELIX    4   4 ASN A  103  LEU A  108  5                                   6    
HELIX    5   5 SER A  109  GLY A  130  1                                  22    
HELIX    6   6 GLY A  147  SER A  155  1                                   9    
HELIX    7   7 ASP A  157  VAL A  172  1                                  16    
HELIX    8   8 VAL A  172  ASN A  194  1                                  23    
HELIX    9   9 ASP A  198  GLY A  205  1                                   8    
HELIX   10  10 ARG A  219  TYR A  252  1                                  34    
HELIX   11  11 HIS A  265  LEU A  267  5                                   3    
HELIX   12  12 TRP A  275  ASN A  277  5                                   3    
HELIX   13  13 LEU A  278  VAL A  283  1                                   6    
HELIX   14  14 MET A  297  ALA A  301  5                                   5    
HELIX   15  15 ASP A  303  SER A  317  1                                  15    
HELIX   16  16 GLY A  326  SER A  331  1                                   6    
HELIX   17  17 THR A  365  TYR A  385  1                                  21    
HELIX   18  18 PRO A  389  ARG A  393  5                                   5    
HELIX   19  19 GLY A  399  THR A  414  1                                  16    
HELIX   20  20 THR A  414  ILE A  421  1                                   8    
HELIX   21  21 ASP A  431  VAL A  447  1                                  17    
HELIX   22  22 GLY A  448  GLY A  466  1                                  19    
HELIX   23  23 PRO A  469  ASP A  471  5                                   3    
HELIX   24  24 GLN A  472  ILE A  484  1                                  13    
HELIX   25  25 CYS A  498  SER A  502  5                                   5    
HELIX   26  26 LEU A  503  ASN A  508  1                                   6    
HELIX   27  27 ILE A  513  ALA A  532  1                                  20    
HELIX   28  28 PRO A  538  CYS A  542  5                                   5    
HELIX   29  29 SER A  547  ARG A  559  1                                  13    
HELIX   30  30 PRO A  565  GLY A  575  1                                  11    
HELIX   31  31 VAL A  581  ASN A  599  1                                  19    
HELIX   32  32 UNK D  927  UNK D  943  1                                  17    
HELIX   33  33 UNK E  949  UNK E  951  5                                   3    
SHEET    1   A 2 LYS A 131  ASN A 134  0                                        
SHEET    2   A 2 ASN A 137  LEU A 143 -1  O  LEU A 142   N  VAL A 132           
SHEET    1   B 2 LEU A 262  PRO A 263  0                                        
SHEET    2   B 2 VAL A 487  VAL A 488  1  O  VAL A 488   N  LEU A 262           
SHEET    1   C 2 THR A 347  GLY A 352  0                                        
SHEET    2   C 2 ASP A 355  LEU A 359 -1  O  ARG A 357   N  TRP A 349           
SHEET    1   D 2 UNK C 909  UNK C 912  0                                        
SHEET    2   D 2 UNK E 953  UNK E 956 -1  O  UNK E 956   N  UNK C 909           
SSBOND   1 CYS A  133    CYS A  141                          1555   1555  2.04  
SSBOND   2 CYS A  344    CYS A  361                          1555   1555  2.03  
SSBOND   3 CYS A  530    CYS A  542                          1555   1555  2.03  
LINK         ND2 ASN A  90                 C1  NAG A 800     1555   1555  1.45  
LINK         ND2 ASN A 103                 C1  NAG A 801     1555   1555  1.45  
LINK         ND2 ASN A 546                 C1  NAG A 802     1555   1555  1.45  
LINK        ZN    ZN A 804                 NE2 HIS A 374     1555   1555  1.97  
LINK        ZN    ZN A 804                 O   HOH A 823     1555   1555  2.46  
LINK        ZN    ZN A 804                 NE2 HIS A 378     1555   1555  2.26  
LINK        ZN    ZN A 804                 OE2 GLU A 402     1555   1555  2.23  
LINK        ZN    ZN A 804                 OE1 GLU A 402     1555   1555  2.14  
CISPEP   1 GLU A  145    PRO A  146          0        -0.21                     
SITE     1 AC1  4 LYS A  26  ASN A  90  HOH A 971  HOH A 994                    
SITE     1 AC2  5 GLN A  81  ASN A 103  HOH A 909  HOH A1027                    
SITE     2 AC2  5 HOH A1065                                                     
SITE     1 AC3  2 SER A 420  ASN A 546                                          
SITE     1 AC4  3 ARG A 169  TRP A 477  TRP A 478                               
SITE     1 AC5  6 HIS A 374  GLU A 375  HIS A 378  GLU A 402                    
SITE     2 AC5  6 HOH A 823  HOH A 901                                          
CRYST1  103.638   89.478  112.399  90.00 109.15  90.00 C 1 2 1       4          
ORIGX1      1.000000  0.000000  0.000000        0.00000                         
ORIGX2      0.000000  1.000000  0.000000        0.00000                         
ORIGX3      0.000000  0.000000  1.000000        0.00000                         
SCALE1      0.009649  0.000000  0.003351        0.00000                         
SCALE2      0.000000  0.011176  0.000000        0.00000                         
SCALE3      0.000000  0.000000  0.009418        0.00000                         
ATOM      1  N   SER A  19      96.155  70.201  45.493  1.00100.66           N  
ATOM      2  CA  SER A  19      94.696  70.434  45.702  1.00101.02           C  
ATOM      3  C   SER A  19      93.987  69.087  45.880  1.00100.43           C  
ATOM      4  O   SER A  19      94.494  68.054  45.439  1.00 99.56           O  
ATOM      5  CB  SER A  19      94.116  71.194  44.499  1.00102.01           C  
ATOM      6  OG  SER A  19      92.778  71.609  44.730  1.00102.75           O  
ATOM      7  N   THR A  20      92.825  69.102  46.535  1.00100.27           N  
ATOM      8  CA  THR A  20      92.051  67.879  46.776  1.00 99.38           C  
ATOM      9  C   THR A  20      91.073  67.584  45.641  1.00 98.31           C  
ATOM     10  O   THR A  20      90.444  68.499  45.100  1.00 98.40           O  
ATOM     11  CB  THR A  20      91.236  67.973  48.092  1.00 98.99           C  
ATOM     12  OG1 THR A  20      92.126  68.161  49.199  1.00100.97           O  
ATOM     13  CG2 THR A  20      90.435  66.697  48.320  1.00 98.68           C  
ATOM     14  N   ILE A  21      90.946  66.305  45.289  1.00 97.23           N  
ATOM     15  CA  ILE A  21      90.028  65.874  44.232  1.00 96.91           C  
ATOM     16  C   ILE A  21      88.577  66.107  44.659  1.00 95.29           C  
ATOM     17  O   ILE A  21      87.687  65.320  44.350  1.00 95.10           O  
ATOM     18  CB  ILE A  21      90.209  64.370  43.890  1.00 97.49           C  
ATOM     19  CG1 ILE A  21      89.957  63.500  45.130  1.00 98.25           C  
ATOM     20  CG2 ILE A  21      91.599  64.132  43.332  1.00 96.62           C  
ATOM     21  CD1 ILE A  21      90.970  63.669  46.256  1.00 98.93           C  
ATOM     22  N   GLU A  22      88.366  67.199  45.383  1.00 94.23           N  
ATOM     23  CA  GLU A  22      87.061  67.600  45.886  1.00 91.81           C  
ATOM     24  C   GLU A  22      86.943  69.080  45.591  1.00 89.40           C  
ATOM     25  O   GLU A  22      85.948  69.541  45.039  1.00 90.17           O  
ATOM     26  CB  GLU A  22      86.982  67.395  47.400  1.00 94.73           C  
ATOM     27  CG  GLU A  22      85.759  68.027  48.049  1.00 96.35           C  
ATOM     28  CD  GLU A  22      84.573  67.093  48.064  1.00 98.28           C  
ATOM     29  OE1 GLU A  22      84.387  66.375  47.058  1.00100.17           O  
ATOM     30  OE2 GLU A  22      83.828  67.080  49.071  1.00 97.24           O  
ATOM     31  N   GLU A  23      87.978  69.821  45.967  1.00 86.05           N  
ATOM     32  CA  GLU A  23      87.993  71.256  45.746  1.00 83.95           C  
ATOM     33  C   GLU A  23      88.307  71.545  44.294  1.00 79.92           C  
ATOM     34  O   GLU A  23      88.001  72.620  43.789  1.00 77.73           O  
ATOM     35  CB  GLU A  23      89.027  71.939  46.650  1.00 86.41           C  
ATOM     36  CG  GLU A  23      89.086  73.460  46.481  1.00 88.67           C  
ATOM     37  CD  GLU A  23      87.761  74.149  46.800  1.00 90.24           C  
ATOM     38  OE1 GLU A  23      87.382  75.080  46.052  1.00 91.33           O  
ATOM     39  OE2 GLU A  23      87.104  73.772  47.799  1.00 88.01           O  
ATOM     40  N   GLN A  24      88.937  70.592  43.621  1.00 77.79           N  
ATOM     41  CA  GLN A  24      89.236  70.798  42.215  1.00 78.95           C  
ATOM     42  C   GLN A  24      87.999  70.347  41.425  1.00 76.15           C  
ATOM     43  O   GLN A  24      87.712  70.867  40.351  1.00 72.82           O  
ATOM     44  CB  GLN A  24      90.508  70.035  41.801  1.00 81.61           C  
ATOM     45  CG  GLN A  24      90.470  68.527  41.972  1.00 85.53           C  
ATOM     46  CD  GLN A  24      91.846  67.891  41.788  1.00 88.76           C  
ATOM     47  OE1 GLN A  24      92.513  68.098  40.769  1.00 89.50           O  
ATOM     48  NE2 GLN A  24      92.273  67.109  42.777  1.00 87.62           N  
ATOM     49  N   ALA A  25      87.257  69.399  41.994  1.00 74.28           N  
ATOM     50  CA  ALA A  25      86.032  68.910  41.382  1.00 71.62           C  
ATOM     51  C   ALA A  25      85.074  70.074  41.500  1.00 71.53           C  
ATOM     52  O   ALA A  25      84.259  70.327  40.607  1.00 71.06           O  
ATOM     53  CB  ALA A  25      85.484  67.710  42.147  1.00 71.04           C  
ATOM     54  N   LYS A  26      85.176  70.790  42.613  1.00 68.60           N  
ATOM     55  CA  LYS A  26      84.317  71.938  42.815  1.00 66.74           C  
ATOM     56  C   LYS A  26      84.665  73.030  41.822  1.00 63.90           C  
ATOM     57  O   LYS A  26      83.792  73.798  41.416  1.00 64.98           O  
ATOM     58  CB  LYS A  26      84.444  72.485  44.240  1.00 68.95           C  
ATOM     59  CG  LYS A  26      83.837  71.609  45.326  1.00 69.85           C  
ATOM     60  CD  LYS A  26      83.763  72.376  46.639  1.00 69.77           C  
ATOM     61  CE  LYS A  26      82.978  71.621  47.688  1.00 71.00           C  
ATOM     62  NZ  LYS A  26      82.613  72.497  48.830  1.00 70.02           N  
ATOM     63  N   THR A  27      85.931  73.112  41.424  1.00 61.78           N  
ATOM     64  CA  THR A  27      86.313  74.154  40.477  1.00 61.06           C  
ATOM     65  C   THR A  27      85.918  73.707  39.083  1.00 57.64           C  
ATOM     66  O   THR A  27      85.531  74.527  38.255  1.00 57.40           O  
ATOM     67  CB  THR A  27      87.838  74.479  40.509  1.00 62.18           C  
ATOM     68  OG1 THR A  27      88.578  73.376  39.982  1.00 68.06           O  
ATOM     69  CG2 THR A  27      88.300  74.763  41.935  1.00 61.97           C  
ATOM     70  N   PHE A  28      86.011  72.406  38.830  1.00 55.68           N  
ATOM     71  CA  PHE A  28      85.623  71.852  37.541  1.00 55.88           C  
ATOM     72  C   PHE A  28      84.139  72.151  37.320  1.00 53.72           C  
ATOM     73  O   PHE A  28      83.747  72.667  36.273  1.00 54.55           O  
ATOM     74  CB  PHE A  28      85.856  70.344  37.518  1.00 57.42           C  
ATOM     75  CG  PHE A  28      85.125  69.631  36.402  1.00 62.75           C  
ATOM     76  CD1 PHE A  28      83.892  69.039  36.626  1.00 61.98           C  
ATOM     77  CD2 PHE A  28      85.678  69.544  35.134  1.00 63.16           C  
ATOM     78  CE1 PHE A  28      83.233  68.379  35.615  1.00 63.48           C  
ATOM     79  CE2 PHE A  28      85.016  68.882  34.114  1.00 64.61           C  
ATOM     80  CZ  PHE A  28      83.795  68.299  34.356  1.00 63.87           C  
ATOM     81  N   LEU A  29      83.333  71.847  38.332  1.00 51.40           N  
ATOM     82  CA  LEU A  29      81.902  72.078  38.289  1.00 52.82           C  
ATOM     83  C   LEU A  29      81.567  73.551  38.113  1.00 54.08           C  
ATOM     84  O   LEU A  29      80.663  73.899  37.347  1.00 54.89           O  
ATOM     85  CB  LEU A  29      81.230  71.543  39.559  1.00 52.25           C  
ATOM     86  CG  LEU A  29      80.497  70.200  39.504  1.00 54.01           C  
ATOM     87  CD1 LEU A  29      80.698  69.547  38.146  1.00 54.07           C  
ATOM     88  CD2 LEU A  29      80.986  69.294  40.624  1.00 54.10           C  
ATOM     89  N   ASP A  30      82.280  74.423  38.817  1.00 53.96           N  
ATOM     90  CA  ASP A  30      82.017  75.852  38.687  1.00 57.32           C  
ATOM     91  C   ASP A  30      82.256  76.299  37.234  1.00 54.77           C  
ATOM     92  O   ASP A  30      81.478  77.079  36.689  1.00 56.45           O  
ATOM     93  CB  ASP A  30      82.899  76.664  39.660  1.00 60.62           C  
ATOM     94  CG  ASP A  30      82.493  78.150  39.736  1.00 65.24           C  
ATOM     95  OD1 ASP A  30      81.278  78.456  39.785  1.00 68.61           O  
ATOM     96  OD2 ASP A  30      83.386  79.022  39.761  1.00 68.17           O  
ATOM     97  N   LYS A  31      83.320  75.803  36.609  1.00 52.19           N  
ATOM     98  CA  LYS A  31      83.602  76.167  35.223  1.00 56.56           C  
ATOM     99  C   LYS A  31      82.476  75.659  34.293  1.00 55.65           C  
ATOM    100  O   LYS A  31      82.022  76.381  33.397  1.00 52.45           O  
ATOM    101  CB  LYS A  31      84.960  75.605  34.784  1.00 57.95           C  
ATOM    102  CG  LYS A  31      86.150  76.207  35.536  1.00 63.32           C  
ATOM    103  CD  LYS A  31      87.485  75.707  34.984  1.00 65.02           C  
ATOM    104  CE  LYS A  31      88.647  76.120  35.889  1.00 65.61           C  
ATOM    105  NZ  LYS A  31      89.993  75.848  35.286  1.00 65.43           N  
ATOM    106  N   PHE A  32      82.035  74.422  34.528  1.00 51.97           N  
ATOM    107  CA  PHE A  32      80.955  73.802  33.766  1.00 50.59           C  
ATOM    108  C   PHE A  32      79.654  74.599  33.786  1.00 51.11           C  
ATOM    109  O   PHE A  32      79.080  74.908  32.742  1.00 51.11           O  
ATOM    110  CB  PHE A  32      80.681  72.399  34.306  1.00 52.15           C  
ATOM    111  CG  PHE A  32      79.476  71.745  33.695  1.00 51.39           C  
ATOM    112  CD1 PHE A  32      78.220  71.892  34.268  1.00 50.24           C  
ATOM    113  CD2 PHE A  32      79.597  70.996  32.528  1.00 48.31           C  
ATOM    114  CE1 PHE A  32      77.107  71.299  33.682  1.00 48.86           C  
ATOM    115  CE2 PHE A  32      78.498  70.413  31.957  1.00 42.53           C  
ATOM    116  CZ  PHE A  32      77.254  70.564  32.532  1.00 43.56           C  
ATOM    117  N   ASN A  33      79.185  74.934  34.980  1.00 52.33           N  
ATOM    118  CA  ASN A  33      77.946  75.675  35.125  1.00 53.63           C  
ATOM    119  C   ASN A  33      77.909  76.980  34.338  1.00 55.39           C  
ATOM    120  O   ASN A  33      76.896  77.288  33.700  1.00 54.61           O  
ATOM    121  CB  ASN A  33      77.669  75.915  36.609  1.00 52.87           C  
ATOM    122  CG  ASN A  33      77.398  74.621  37.356  1.00 58.76           C  
ATOM    123  OD1 ASN A  33      77.551  74.544  38.572  1.00 63.89           O  
ATOM    124  ND2 ASN A  33      76.989  73.591  36.622  1.00 59.29           N  
ATOM    125  N   HIS A  34      79.001  77.743  34.365  1.00 57.47           N  
ATOM    126  CA  HIS A  34      79.041  79.002  33.624  1.00 53.96           C  
ATOM    127  C   HIS A  34      79.120  78.718  32.126  1.00 53.17           C  
ATOM    128  O   HIS A  34      78.399  79.331  31.347  1.00 55.45           O  
ATOM    129  CB  HIS A  34      80.213  79.873  34.097  1.00 52.18           C  
ATOM    130  CG  HIS A  34      80.028  80.424  35.477  1.00 49.33           C  
ATOM    131  ND1 HIS A  34      79.203  81.499  35.747  1.00 49.97           N  
ATOM    132  CD2 HIS A  34      80.472  79.980  36.678  1.00 47.95           C  
ATOM    133  CE1 HIS A  34      79.139  81.686  37.055  1.00 46.78           C  
ATOM    134  NE2 HIS A  34      79.897  80.776  37.642  1.00 47.14           N  
ATOM    135  N   GLU A  35      79.973  77.790  31.707  1.00 52.45           N  
ATOM    136  CA  GLU A  35      80.026  77.480  30.284  1.00 53.91           C  
ATOM    137  C   GLU A  35      78.703  76.866  29.825  1.00 52.83           C  
ATOM    138  O   GLU A  35      78.138  77.301  28.824  1.00 52.38           O  
ATOM    139  CB  GLU A  35      81.181  76.515  29.951  1.00 58.83           C  
ATOM    140  CG  GLU A  35      82.552  77.189  29.839  1.00 63.59           C  
ATOM    141  CD  GLU A  35      83.627  76.292  29.242  1.00 67.16           C  
ATOM    142  OE1 GLU A  35      83.792  75.154  29.731  1.00 70.07           O  
ATOM    143  OE2 GLU A  35      84.321  76.734  28.293  1.00 71.53           O  
ATOM    144  N   ALA A  36      78.202  75.874  30.570  1.00 52.05           N  
ATOM    145  CA  ALA A  36      76.946  75.182  30.229  1.00 50.52           C  
ATOM    146  C   ALA A  36      75.766  76.116  30.169  1.00 50.06           C  
ATOM    147  O   ALA A  36      74.976  76.058  29.240  1.00 49.77           O  
ATOM    148  CB  ALA A  36      76.646  74.050  31.240  1.00 47.95           C  
ATOM    149  N   GLU A  37      75.635  76.979  31.165  1.00 52.67           N  
ATOM    150  CA  GLU A  37      74.511  77.903  31.185  1.00 55.96           C  
ATOM    151  C   GLU A  37      74.469  78.720  29.898  1.00 58.07           C  
ATOM    152  O   GLU A  37      73.398  78.970  29.344  1.00 60.52           O  
ATOM    153  CB  GLU A  37      74.624  78.848  32.379  1.00 58.78           C  
ATOM    154  CG  GLU A  37      73.401  79.707  32.639  1.00 58.88           C  
ATOM    155  CD  GLU A  37      72.675  79.311  33.915  1.00 65.95           C  
ATOM    156  OE1 GLU A  37      73.319  78.686  34.800  1.00 66.05           O  
ATOM    157  OE2 GLU A  37      71.470  79.639  34.038  1.00 66.17           O  
ATOM    158  N   ASP A  38      75.636  79.139  29.418  1.00 59.83           N  
ATOM    159  CA  ASP A  38      75.693  79.941  28.198  1.00 60.18           C  
ATOM    160  C   ASP A  38      75.414  79.150  26.915  1.00 56.28           C  
ATOM    161  O   ASP A  38      74.668  79.611  26.061  1.00 55.68           O  
ATOM    162  CB  ASP A  38      77.041  80.648  28.089  1.00 62.33           C  
ATOM    163  CG  ASP A  38      77.146  81.472  26.836  1.00 65.70           C  
ATOM    164  OD1 ASP A  38      76.286  82.358  26.641  1.00 68.72           O  
ATOM    165  OD2 ASP A  38      78.081  81.231  26.043  1.00 67.24           O  
ATOM    166  N   LEU A  39      75.997  77.966  26.779  1.00 52.55           N  
ATOM    167  CA  LEU A  39      75.758  77.164  25.579  1.00 54.51           C  
ATOM    168  C   LEU A  39      74.336  76.621  25.538  1.00 55.29           C  
ATOM    169  O   LEU A  39      73.764  76.430  24.459  1.00 57.63           O  
ATOM    170  CB  LEU A  39      76.747  76.000  25.494  1.00 53.66           C  
ATOM    171  CG  LEU A  39      78.169  76.388  25.102  1.00 58.45           C  
ATOM    172  CD1 LEU A  39      79.097  75.187  25.215  1.00 59.49           C  
ATOM    173  CD2 LEU A  39      78.162  76.929  23.668  1.00 59.42           C  
ATOM    174  N   PHE A  40      73.755  76.365  26.706  1.00 53.82           N  
ATOM    175  CA  PHE A  40      72.401  75.852  26.738  1.00 51.47           C  
ATOM    176  C   PHE A  40      71.454  76.981  26.366  1.00 53.27           C  
ATOM    177  O   PHE A  40      70.415  76.748  25.748  1.00 54.20           O  
ATOM    178  CB  PHE A  40      72.044  75.315  28.123  1.00 48.97           C  
ATOM    179  CG  PHE A  40      70.672  74.688  28.193  1.00 44.60           C  
ATOM    180  CD1 PHE A  40      70.461  73.397  27.728  1.00 49.24           C  
ATOM    181  CD2 PHE A  40      69.595  75.403  28.704  1.00 45.50           C  
ATOM    182  CE1 PHE A  40      69.196  72.822  27.769  1.00 49.89           C  
ATOM    183  CE2 PHE A  40      68.334  74.846  28.752  1.00 47.86           C  
ATOM    184  CZ  PHE A  40      68.129  73.553  28.285  1.00 48.88           C  
ATOM    185  N   TYR A  41      71.810  78.203  26.752  1.00 53.80           N  
ATOM    186  CA  TYR A  41      70.978  79.355  26.424  1.00 57.29           C  
ATOM    187  C   TYR A  41      70.987  79.636  24.919  1.00 58.87           C  
ATOM    188  O   TYR A  41      69.950  79.961  24.337  1.00 58.59           O  
ATOM    189  CB  TYR A  41      71.448  80.611  27.159  1.00 56.46           C  
ATOM    190  CG  TYR A  41      70.428  81.725  27.109  1.00 57.52           C  
ATOM    191  CD1 TYR A  41      69.234  81.620  27.798  1.00 57.87           C  
ATOM    192  CD2 TYR A  41      70.647  82.873  26.353  1.00 61.97           C  
ATOM    193  CE1 TYR A  41      68.279  82.621  27.742  1.00 61.71           C  
ATOM    194  CE2 TYR A  41      69.690  83.887  26.291  1.00 61.87           C  
ATOM    195  CZ  TYR A  41      68.506  83.751  26.989  1.00 63.59           C  
ATOM    196  OH  TYR A  41      67.530  84.729  26.930  1.00 64.62           O  
ATOM    197  N   GLN A  42      72.156  79.519  24.293  1.00 59.70           N  
ATOM    198  CA  GLN A  42      72.269  79.763  22.859  1.00 61.30           C  
ATOM    199  C   GLN A  42      71.459  78.698  22.125  1.00 63.11           C  
ATOM    200  O   GLN A  42      70.688  79.004  21.214  1.00 65.49           O  
ATOM    201  CB  GLN A  42      73.740  79.719  22.422  1.00 61.24           C  
ATOM    202  CG  GLN A  42      74.611  80.863  23.000  1.00 68.60           C  
ATOM    203  CD  GLN A  42      76.112  80.752  22.647  1.00 71.71           C  
ATOM    204  OE1 GLN A  42      76.500  80.768  21.474  1.00 75.43           O  
ATOM    205  NE2 GLN A  42      76.952  80.651  23.668  1.00 72.34           N  
ATOM    206  N   SER A  43      71.625  77.449  22.547  1.00 63.26           N  
ATOM    207  CA  SER A  43      70.917  76.324  21.961  1.00 60.60           C  
ATOM    208  C   SER A  43      69.412  76.417  22.175  1.00 62.17           C  
ATOM    209  O   SER A  43      68.641  76.060  21.277  1.00 64.06           O  
ATOM    210  CB  SER A  43      71.425  75.017  22.551  1.00 62.28           C  
ATOM    211  OG  SER A  43      70.822  73.917  21.902  1.00 61.78           O  
ATOM    212  N   SER A  44      68.989  76.882  23.352  1.00 58.42           N  
ATOM    213  CA  SER A  44      67.563  77.032  23.641  1.00 58.06           C  
ATOM    214  C   SER A  44      66.925  78.105  22.754  1.00 57.93           C  
ATOM    215  O   SER A  44      65.864  77.881  22.159  1.00 52.65           O  
ATOM    216  CB  SER A  44      67.334  77.403  25.112  1.00 60.63           C  
ATOM    217  OG  SER A  44      67.652  76.327  25.968  1.00 61.97           O  
ATOM    218  N   LEU A  45      67.568  79.272  22.696  1.00 57.87           N  
ATOM    219  CA  LEU A  45      67.097  80.395  21.882  1.00 60.76           C  
ATOM    220  C   LEU A  45      66.955  79.990  20.425  1.00 59.96           C  
ATOM    221  O   LEU A  45      65.996  80.351  19.764  1.00 58.77           O  
ATOM    222  CB  LEU A  45      68.066  81.565  21.970  1.00 62.94           C  
ATOM    223  CG  LEU A  45      67.605  82.752  22.801  1.00 66.79           C  
ATOM    224  CD1 LEU A  45      68.793  83.658  23.090  1.00 68.77           C  
ATOM    225  CD2 LEU A  45      66.501  83.496  22.055  1.00 68.80           C  
ATOM    226  N   ALA A  46      67.925  79.240  19.928  1.00 60.19           N  
ATOM    227  CA  ALA A  46      67.881  78.781  18.554  1.00 60.51           C  
ATOM    228  C   ALA A  46      66.662  77.896  18.327  1.00 64.06           C  
ATOM    229  O   ALA A  46      65.960  78.050  17.327  1.00 66.48           O  
ATOM    230  CB  ALA A  46      69.140  78.008  18.228  1.00 61.45           C  
ATOM    231  N   SER A  47      66.416  76.959  19.246  1.00 63.97           N  
ATOM    232  CA  SER A  47      65.277  76.057  19.113  1.00 61.67           C  
ATOM    233  C   SER A  47      63.970  76.809  19.221  1.00 61.18           C  
ATOM    234  O   SER A  47      62.983  76.454  18.587  1.00 60.53           O  
ATOM    235  CB  SER A  47      65.314  74.962  20.174  1.00 60.54           C  
ATOM    236  OG  SER A  47      66.322  74.014  19.860  1.00 65.91           O  
ATOM    237  N   TRP A  48      63.967  77.856  20.026  1.00 61.56           N  
ATOM    238  CA  TRP A  48      62.765  78.641  20.209  1.00 64.51           C  
ATOM    239  C   TRP A  48      62.398  79.392  18.931  1.00 65.92           C  
ATOM    240  O   TRP A  48      61.224  79.565  18.627  1.00 66.51           O  
ATOM    241  CB  TRP A  48      62.966  79.613  21.371  1.00 66.58           C  
ATOM    242  CG  TRP A  48      61.874  80.605  21.507  1.00 69.98           C  
ATOM    243  CD1 TRP A  48      61.803  81.836  20.919  1.00 70.43           C  
ATOM    244  CD2 TRP A  48      60.663  80.441  22.251  1.00 70.35           C  
ATOM    245  NE1 TRP A  48      60.618  82.449  21.254  1.00 73.34           N  
ATOM    246  CE2 TRP A  48      59.900  81.613  22.070  1.00 70.49           C  
ATOM    247  CE3 TRP A  48      60.149  79.414  23.053  1.00 69.57           C  
ATOM    248  CZ2 TRP A  48      58.650  81.789  22.659  1.00 71.52           C  
ATOM    249  CZ3 TRP A  48      58.909  79.586  23.638  1.00 68.56           C  
ATOM    250  CH2 TRP A  48      58.171  80.766  23.438  1.00 71.23           C  
ATOM    251  N   ASN A  49      63.409  79.832  18.188  1.00 67.90           N  
ATOM    252  CA  ASN A  49      63.199  80.560  16.942  1.00 68.81           C  
ATOM    253  C   ASN A  49      62.525  79.649  15.946  1.00 70.84           C  
ATOM    254  O   ASN A  49      61.556  80.038  15.303  1.00 73.00           O  
ATOM    255  CB  ASN A  49      64.529  81.019  16.358  1.00 67.43           C  
ATOM    256  CG  ASN A  49      65.114  82.186  17.099  1.00 65.03           C  
ATOM    257  OD1 ASN A  49      66.308  82.461  16.990  1.00 67.03           O  
ATOM    258  ND2 ASN A  49      64.276  82.898  17.849  1.00 65.94           N  
ATOM    259  N   TYR A  50      63.044  78.431  15.831  1.00 70.64           N  
ATOM    260  CA  TYR A  50      62.505  77.442  14.908  1.00 72.08           C  
ATOM    261  C   TYR A  50      61.087  76.957  15.232  1.00 73.54           C  
ATOM    262  O   TYR A  50      60.319  76.641  14.317  1.00 75.57           O  
ATOM    263  CB  TYR A  50      63.443  76.242  14.840  1.00 73.25           C  
ATOM    264  CG  TYR A  50      62.870  75.061  14.094  1.00 78.28           C  
ATOM    265  CD1 TYR A  50      63.007  74.947  12.715  1.00 80.80           C  
ATOM    266  CD2 TYR A  50      62.200  74.053  14.772  1.00 78.39           C  
ATOM    267  CE1 TYR A  50      62.494  73.856  12.036  1.00 81.32           C  
ATOM    268  CE2 TYR A  50      61.686  72.965  14.106  1.00 81.26           C  
ATOM    269  CZ  TYR A  50      61.834  72.868  12.740  1.00 82.64           C  
ATOM    270  OH  TYR A  50      61.307  71.781  12.087  1.00 84.67           O  
ATOM    271  N   ASN A  51      60.736  76.883  16.518  1.00 71.08           N  
ATOM    272  CA  ASN A  51      59.399  76.424  16.902  1.00 70.19           C  
ATOM    273  C   ASN A  51      58.389  77.557  16.894  1.00 72.34           C  
ATOM    274  O   ASN A  51      57.191  77.325  17.044  1.00 74.32           O  
ATOM    275  CB  ASN A  51      59.400  75.771  18.295  1.00 65.80           C  
ATOM    276  CG  ASN A  51      60.051  74.403  18.299  1.00 62.36           C  
ATOM    277  OD1 ASN A  51      61.271  74.284  18.206  1.00 65.11           O  
ATOM    278  ND2 ASN A  51      59.238  73.357  18.395  1.00 59.79           N  
ATOM    279  N   THR A  52      58.871  78.783  16.731  1.00 73.46           N  
ATOM    280  CA  THR A  52      57.993  79.947  16.695  1.00 74.93           C  
ATOM    281  C   THR A  52      57.924  80.532  15.285  1.00 76.24           C  
ATOM    282  O   THR A  52      56.993  81.264  14.948  1.00 76.71           O  
ATOM    283  CB  THR A  52      58.489  81.039  17.640  1.00 74.79           C  
ATOM    284  OG1 THR A  52      59.869  81.310  17.362  1.00 73.63           O  
ATOM    285  CG2 THR A  52      58.321  80.607  19.090  1.00 76.61           C  
ATOM    286  N   ASN A  53      58.929  80.210  14.478  1.00 78.03           N  
ATOM    287  CA  ASN A  53      59.024  80.681  13.105  1.00 77.13           C  
ATOM    288  C   ASN A  53      59.743  79.627  12.301  1.00 77.86           C  
ATOM    289  O   ASN A  53      60.925  79.778  12.006  1.00 75.81           O  
ATOM    290  CB  ASN A  53      59.833  81.974  13.018  1.00 79.63           C  
ATOM    291  CG  ASN A  53      59.953  82.489  11.585  1.00 83.28           C  
ATOM    292  OD1 ASN A  53      60.844  83.281  11.262  1.00 84.58           O  
ATOM    293  ND2 ASN A  53      59.044  82.042  10.720  1.00 82.10           N  
ATOM    294  N   ILE A  54      59.041  78.555  11.952  1.00 79.76           N  
ATOM    295  CA  ILE A  54      59.660  77.500  11.176  1.00 82.44           C  
ATOM    296  C   ILE A  54      60.231  78.102   9.899  1.00 85.61           C  
ATOM    297  O   ILE A  54      59.491  78.580   9.038  1.00 87.35           O  
ATOM    298  CB  ILE A  54      58.646  76.395  10.822  1.00 83.60           C  
ATOM    299  CG1 ILE A  54      58.044  75.815  12.106  1.00 86.06           C  
ATOM    300  CG2 ILE A  54      59.333  75.278  10.050  1.00 83.48           C  
ATOM    301  CD1 ILE A  54      57.204  74.550  11.895  1.00 83.99           C  
ATOM    302  N   THR A  55      61.558  78.095   9.806  1.00 87.96           N  
ATOM    303  CA  THR A  55      62.292  78.622   8.654  1.00 89.68           C  
ATOM    304  C   THR A  55      63.375  77.601   8.297  1.00 92.14           C  
ATOM    305  O   THR A  55      63.638  76.677   9.069  1.00 93.10           O  
ATOM    306  CB  THR A  55      62.961  79.990   8.991  1.00 89.25           C  
ATOM    307  OG1 THR A  55      61.980  81.037   8.955  1.00 88.54           O  
ATOM    308  CG2 THR A  55      64.065  80.310   8.012  1.00 87.76           C  
ATOM    309  N   GLU A  56      63.989  77.749   7.127  1.00 94.04           N  
ATOM    310  CA  GLU A  56      65.040  76.825   6.714  1.00 96.12           C  
ATOM    311  C   GLU A  56      66.372  77.149   7.396  1.00 96.32           C  
ATOM    312  O   GLU A  56      67.151  76.249   7.723  1.00 95.31           O  
ATOM    313  CB  GLU A  56      65.223  76.856   5.194  1.00 97.64           C  
ATOM    314  CG  GLU A  56      66.302  75.903   4.705  1.00 98.58           C  
ATOM    315  CD  GLU A  56      66.034  74.473   5.130  1.00 99.86           C  
ATOM    316  OE1 GLU A  56      66.930  73.616   4.947  1.00 99.79           O  
ATOM    317  OE2 GLU A  56      64.922  74.210   5.643  1.00 99.13           O  
ATOM    318  N   GLU A  57      66.641  78.435   7.599  1.00 95.33           N  
ATOM    319  CA  GLU A  57      67.875  78.833   8.255  1.00 95.45           C  
ATOM    320  C   GLU A  57      67.696  78.760   9.769  1.00 93.63           C  
ATOM    321  O   GLU A  57      68.673  78.633  10.511  1.00 93.19           O  
ATOM    322  CB  GLU A  57      68.297  80.247   7.832  1.00 97.97           C  
ATOM    323  CG  GLU A  57      67.159  81.211   7.562  1.00101.51           C  
ATOM    324  CD  GLU A  57      66.627  81.106   6.141  1.00104.85           C  
ATOM    325  OE1 GLU A  57      66.087  80.038   5.778  1.00107.50           O  
ATOM    326  OE2 GLU A  57      66.755  82.094   5.382  1.00105.18           O  
ATOM    327  N   ASN A  58      66.446  78.840  10.220  1.00 90.38           N  
ATOM    328  CA  ASN A  58      66.157  78.755  11.643  1.00 87.27           C  
ATOM    329  C   ASN A  58      66.293  77.319  12.126  1.00 86.04           C  
ATOM    330  O   ASN A  58      66.519  77.081  13.313  1.00 85.48           O  
ATOM    331  CB  ASN A  58      64.762  79.294  11.952  1.00 86.12           C  
ATOM    332  CG  ASN A  58      64.778  80.773  12.285  1.00 86.39           C  
ATOM    333  OD1 ASN A  58      63.758  81.354  12.648  1.00 86.71           O  
ATOM    334  ND2 ASN A  58      65.946  81.391  12.164  1.00 87.58           N  
ATOM    335  N   VAL A  59      66.157  76.364  11.207  1.00 84.52           N  
ATOM    336  CA  VAL A  59      66.314  74.956  11.561  1.00 85.10           C  
ATOM    337  C   VAL A  59      67.818  74.721  11.548  1.00 85.66           C  
ATOM    338  O   VAL A  59      68.340  73.904  12.298  1.00 86.37           O  
ATOM    339  CB  VAL A  59      65.667  74.005  10.524  1.00 85.37           C  
ATOM    340  CG1 VAL A  59      66.584  73.834   9.323  1.00 84.01           C  
ATOM    341  CG2 VAL A  59      65.393  72.650  11.159  1.00 85.65           C  
ATOM    342  N   GLN A  60      68.502  75.465  10.684  1.00 86.55           N  
ATOM    343  CA  GLN A  60      69.948  75.387  10.541  1.00 85.18           C  
ATOM    344  C   GLN A  60      70.595  75.918  11.813  1.00 83.45           C  
ATOM    345  O   GLN A  60      71.396  75.236  12.438  1.00 82.47           O  
ATOM    346  CB  GLN A  60      70.395  76.224   9.333  1.00 88.20           C  
ATOM    347  CG  GLN A  60      71.910  76.363   9.157  1.00 90.14           C  
ATOM    348  CD  GLN A  60      72.584  75.081   8.690  1.00 91.55           C  
ATOM    349  OE1 GLN A  60      73.809  75.032   8.525  1.00 91.33           O  
ATOM    350  NE2 GLN A  60      71.787  74.037   8.471  1.00 91.31           N  
ATOM    351  N   ASN A  61      70.242  77.140  12.192  1.00 83.10           N  
ATOM    352  CA  ASN A  61      70.795  77.745  13.395  1.00 82.86           C  
ATOM    353  C   ASN A  61      70.599  76.840  14.600  1.00 82.81           C  
ATOM    354  O   ASN A  61      71.505  76.680  15.424  1.00 81.01           O  
ATOM    355  CB  ASN A  61      70.130  79.094  13.664  1.00 84.31           C  
ATOM    356  CG  ASN A  61      70.773  80.228  12.887  1.00 86.50           C  
ATOM    357  OD1 ASN A  61      70.307  81.365  12.935  1.00 88.53           O  
ATOM    358  ND2 ASN A  61      71.857  79.926  12.176  1.00 85.86           N  
ATOM    359  N   MET A  62      69.414  76.245  14.693  1.00 81.78           N  
ATOM    360  CA  MET A  62      69.092  75.367  15.806  1.00 80.62           C  
ATOM    361  C   MET A  62      69.897  74.076  15.822  1.00 80.69           C  
ATOM    362  O   MET A  62      70.520  73.747  16.832  1.00 82.05           O  
ATOM    363  CB  MET A  62      67.600  75.029  15.808  1.00 78.66           C  
ATOM    364  CG  MET A  62      67.245  73.878  16.738  1.00 76.58           C  
ATOM    365  SD  MET A  62      65.498  73.447  16.738  1.00 71.06           S  
ATOM    366  CE  MET A  62      65.352  72.684  15.098  1.00 74.61           C  
ATOM    367  N   ASN A  63      69.891  73.341  14.716  1.00 80.33           N  
ATOM    368  CA  ASN A  63      70.622  72.081  14.679  1.00 80.62           C  
ATOM    369  C   ASN A  63      72.100  72.290  15.003  1.00 79.18           C  
ATOM    370  O   ASN A  63      72.720  71.458  15.658  1.00 78.02           O  
ATOM    371  CB  ASN A  63      70.450  71.385  13.319  1.00 83.16           C  
ATOM    372  CG  ASN A  63      70.980  72.214  12.159  1.00 89.12           C  
ATOM    373  OD1 ASN A  63      72.167  72.544  12.108  1.00 92.76           O  
ATOM    374  ND2 ASN A  63      70.102  72.549  11.213  1.00 90.28           N  
ATOM    375  N   ASN A  64      72.660  73.409  14.561  1.00 77.49           N  
ATOM    376  CA  ASN A  64      74.063  73.700  14.829  1.00 76.62           C  
ATOM    377  C   ASN A  64      74.297  74.119  16.285  1.00 74.47           C  
ATOM    378  O   ASN A  64      75.279  73.714  16.904  1.00 73.97           O  
ATOM    379  CB  ASN A  64      74.563  74.798  13.885  1.00 80.17           C  
ATOM    380  CG  ASN A  64      74.582  74.353  12.430  1.00 82.86           C  
ATOM    381  OD1 ASN A  64      75.140  73.305  12.102  1.00 83.98           O  
ATOM    382  ND2 ASN A  64      73.979  75.151  11.551  1.00 81.96           N  
ATOM    383  N   ALA A  65      73.404  74.939  16.826  1.00 72.07           N  
ATOM    384  CA  ALA A  65      73.539  75.384  18.208  1.00 69.94           C  
ATOM    385  C   ALA A  65      73.362  74.166  19.103  1.00 68.49           C  
ATOM    386  O   ALA A  65      73.959  74.074  20.180  1.00 67.16           O  
ATOM    387  CB  ALA A  65      72.489  76.437  18.535  1.00 67.66           C  
ATOM    388  N   GLY A  66      72.549  73.226  18.635  1.00 64.99           N  
ATOM    389  CA  GLY A  66      72.307  72.022  19.398  1.00 65.29           C  
ATOM    390  C   GLY A  66      73.494  71.081  19.393  1.00 64.58           C  
ATOM    391  O   GLY A  66      73.800  70.463  20.408  1.00 67.16           O  
ATOM    392  N   ASP A  67      74.165  70.974  18.253  1.00 65.25           N  
ATOM    393  CA  ASP A  67      75.330  70.099  18.103  1.00 66.99           C  
ATOM    394  C   ASP A  67      76.560  70.626  18.843  1.00 66.34           C  
ATOM    395  O   ASP A  67      77.482  69.872  19.153  1.00 65.99           O  
ATOM    396  CB  ASP A  67      75.649  69.925  16.615  1.00 69.38           C  
ATOM    397  CG  ASP A  67      74.688  68.961  15.919  1.00 72.71           C  
ATOM    398  OD1 ASP A  67      73.457  69.031  16.174  1.00 68.61           O  
ATOM    399  OD2 ASP A  67      75.173  68.134  15.111  1.00 75.62           O  
ATOM    400  N   LYS A  68      76.568  71.929  19.105  1.00 66.46           N  
ATOM    401  CA  LYS A  68      77.655  72.572  19.833  1.00 66.50           C  
ATOM    402  C   LYS A  68      77.468  72.213  21.311  1.00 65.17           C  
ATOM    403  O   LYS A  68      78.439  72.005  22.037  1.00 66.11           O  
ATOM    404  CB  LYS A  68      77.589  74.095  19.636  1.00 68.02           C  
ATOM    405  CG  LYS A  68      78.758  74.871  20.218  1.00 69.16           C  
ATOM    406  CD  LYS A  68      79.245  75.948  19.245  1.00 72.98           C  
ATOM    407  CE  LYS A  68      79.796  75.324  17.944  1.00 75.81           C  
ATOM    408  NZ  LYS A  68      80.422  76.303  16.988  1.00 75.23           N  
ATOM    409  N   TRP A  69      76.209  72.130  21.738  1.00 62.09           N  
ATOM    410  CA  TRP A  69      75.877  71.776  23.110  1.00 62.63           C  
ATOM    411  C   TRP A  69      76.201  70.315  23.398  1.00 62.77           C  
ATOM    412  O   TRP A  69      76.757  69.994  24.448  1.00 61.24           O  
ATOM    413  CB  TRP A  69      74.395  72.054  23.379  1.00 63.69           C  
ATOM    414  CG  TRP A  69      73.855  71.419  24.639  1.00 63.92           C  
ATOM    415  CD1 TRP A  69      73.013  70.344  24.717  1.00 62.10           C  
ATOM    416  CD2 TRP A  69      74.127  71.813  25.993  1.00 61.22           C  
ATOM    417  NE1 TRP A  69      72.744  70.048  26.030  1.00 62.30           N  
ATOM    418  CE2 TRP A  69      73.414  70.933  26.835  1.00 62.78           C  
ATOM    419  CE3 TRP A  69      74.903  72.823  26.574  1.00 60.61           C  
ATOM    420  CZ2 TRP A  69      73.453  71.033  28.229  1.00 58.36           C  
ATOM    421  CZ3 TRP A  69      74.941  72.922  27.960  1.00 58.79           C  
ATOM    422  CH2 TRP A  69      74.219  72.032  28.769  1.00 60.13           C  
ATOM    423  N   SER A  70      75.866  69.432  22.460  1.00 62.87           N  
ATOM    424  CA  SER A  70      76.128  67.998  22.620  1.00 61.50           C  
ATOM    425  C   SER A  70      77.612  67.688  22.661  1.00 57.88           C  
ATOM    426  O   SER A  70      78.050  66.822  23.412  1.00 59.93           O  
ATOM    427  CB  SER A  70      75.486  67.208  21.481  1.00 60.96           C  
ATOM    428  OG  SER A  70      74.081  67.374  21.507  1.00 64.59           O  
ATOM    429  N   ALA A  71      78.379  68.396  21.845  1.00 56.88           N  
ATOM    430  CA  ALA A  71      79.817  68.203  21.796  1.00 58.19           C  
ATOM    431  C   ALA A  71      80.477  68.735  23.077  1.00 59.44           C  
ATOM    432  O   ALA A  71      81.514  68.237  23.507  1.00 59.01           O  
ATOM    433  CB  ALA A  71      80.387  68.909  20.580  1.00 59.54           C  
ATOM    434  N   PHE A  72      79.880  69.762  23.669  1.00 59.10           N  
ATOM    435  CA  PHE A  72      80.394  70.338  24.908  1.00 59.32           C  
ATOM    436  C   PHE A  72      80.130  69.332  26.031  1.00 59.84           C  
ATOM    437  O   PHE A  72      81.014  69.025  26.839  1.00 59.89           O  
ATOM    438  CB  PHE A  72      79.675  71.667  25.193  1.00 56.83           C  
ATOM    439  CG  PHE A  72      79.898  72.204  26.577  1.00 58.68           C  
ATOM    440  CD1 PHE A  72      81.160  72.606  26.990  1.00 58.92           C  
ATOM    441  CD2 PHE A  72      78.838  72.327  27.462  1.00 58.94           C  
ATOM    442  CE1 PHE A  72      81.363  73.126  28.258  1.00 59.30           C  
ATOM    443  CE2 PHE A  72      79.029  72.847  28.737  1.00 61.33           C  
ATOM    444  CZ  PHE A  72      80.298  73.248  29.134  1.00 59.68           C  
ATOM    445  N   LEU A  73      78.912  68.797  26.041  1.00 59.28           N  
ATOM    446  CA  LEU A  73      78.480  67.840  27.053  1.00 60.23           C  
ATOM    447  C   LEU A  73      79.315  66.576  27.051  1.00 59.35           C  
ATOM    448  O   LEU A  73      79.494  65.943  28.088  1.00 62.14           O  
ATOM    449  CB  LEU A  73      77.016  67.476  26.827  1.00 59.54           C  
ATOM    450  CG  LEU A  73      76.066  67.506  28.018  1.00 57.82           C  
ATOM    451  CD1 LEU A  73      76.145  68.850  28.721  1.00 61.20           C  
ATOM    452  CD2 LEU A  73      74.651  67.260  27.517  1.00 54.80           C  
ATOM    453  N   LYS A  74      79.830  66.219  25.885  1.00 59.78           N  
ATOM    454  CA  LYS A  74      80.633  65.020  25.744  1.00 59.80           C  
ATOM    455  C   LYS A  74      82.073  65.261  26.185  1.00 60.17           C  
ATOM    456  O   LYS A  74      82.693  64.396  26.808  1.00 57.83           O  
ATOM    457  CB  LYS A  74      80.601  64.545  24.287  1.00 63.29           C  
ATOM    458  CG  LYS A  74      81.167  63.155  24.081  1.00 65.54           C  
ATOM    459  CD  LYS A  74      81.290  62.806  22.610  1.00 70.87           C  
ATOM    460  CE  LYS A  74      81.702  61.351  22.444  1.00 74.27           C  
ATOM    461  NZ  LYS A  74      82.874  61.015  23.313  1.00 77.42           N  
ATOM    462  N   GLU A  75      82.620  66.425  25.854  1.00 58.97           N  
ATOM    463  CA  GLU A  75      83.984  66.700  26.269  1.00 62.86           C  
ATOM    464  C   GLU A  75      83.992  66.847  27.792  1.00 63.45           C  
ATOM    465  O   GLU A  75      84.918  66.393  28.469  1.00 63.19           O  
ATOM    466  CB  GLU A  75      84.524  67.988  25.630  1.00 66.32           C  
ATOM    467  CG  GLU A  75      85.935  68.321  26.130  1.00 75.62           C  
ATOM    468  CD  GLU A  75      86.518  69.610  25.562  1.00 81.12           C  
ATOM    469  OE1 GLU A  75      87.688  69.925  25.898  1.00 82.96           O  
ATOM    470  OE2 GLU A  75      85.820  70.307  24.792  1.00 85.09           O  
ATOM    471  N   GLN A  76      82.947  67.478  28.319  1.00 59.57           N  
ATOM    472  CA  GLN A  76      82.830  67.704  29.748  1.00 59.05           C  
ATOM    473  C   GLN A  76      82.595  66.417  30.524  1.00 61.62           C  
ATOM    474  O   GLN A  76      83.033  66.281  31.668  1.00 62.43           O  
ATOM    475  CB  GLN A  76      81.702  68.692  30.017  1.00 54.12           C  
ATOM    476  CG  GLN A  76      81.999  70.082  29.495  1.00 51.15           C  
ATOM    477  CD  GLN A  76      83.176  70.706  30.211  1.00 53.23           C  
ATOM    478  OE1 GLN A  76      83.233  70.701  31.441  1.00 47.54           O  
ATOM    479  NE2 GLN A  76      84.123  71.249  29.448  1.00 50.32           N  
ATOM    480  N   SER A  77      81.894  65.477  29.906  1.00 62.45           N  
ATOM    481  CA  SER A  77      81.629  64.200  30.544  1.00 64.34           C  
ATOM    482  C   SER A  77      82.915  63.381  30.603  1.00 65.35           C  
ATOM    483  O   SER A  77      83.283  62.853  31.643  1.00 63.24           O  
ATOM    484  CB  SER A  77      80.577  63.427  29.757  1.00 65.93           C  
ATOM    485  OG  SER A  77      80.340  62.171  30.359  1.00 71.70           O  
ATOM    486  N   THR A  78      83.602  63.288  29.474  1.00 69.15           N  
ATOM    487  CA  THR A  78      84.835  62.528  29.399  1.00 73.71           C  
ATOM    488  C   THR A  78      86.016  63.351  29.903  1.00 75.34           C  
ATOM    489  O   THR A  78      87.156  63.162  29.470  1.00 77.89           O  
ATOM    490  CB  THR A  78      85.095  62.077  27.955  1.00 76.71           C  
ATOM    491  OG1 THR A  78      85.285  63.228  27.120  1.00 80.29           O  
ATOM    492  CG2 THR A  78      83.898  61.274  27.434  1.00 77.79           C  
ATOM    493  N   LEU A  79      85.729  64.262  30.827  1.00 74.35           N  
ATOM    494  CA  LEU A  79      86.738  65.131  31.412  1.00 72.47           C  
ATOM    495  C   LEU A  79      86.459  65.178  32.903  1.00 73.96           C  
ATOM    496  O   LEU A  79      87.278  65.643  33.690  1.00 73.17           O  
ATOM    497  CB  LEU A  79      86.620  66.535  30.827  1.00 71.25           C  
ATOM    498  CG  LEU A  79      87.798  67.501  30.963  1.00 69.68           C  
ATOM    499  CD1 LEU A  79      88.996  66.964  30.198  1.00 66.00           C  
ATOM    500  CD2 LEU A  79      87.397  68.860  30.418  1.00 69.28           C  
ATOM    501  N   ALA A  80      85.277  64.698  33.276  1.00 75.29           N  
ATOM    502  CA  ALA A  80      84.858  64.660  34.666  1.00 77.32           C  
ATOM    503  C   ALA A  80      85.213  63.305  35.263  1.00 78.68           C  
ATOM    504  O   ALA A  80      85.250  63.148  36.483  1.00 77.72           O  
ATOM    505  CB  ALA A  80      83.362  64.898  34.766  1.00 76.89           C  
ATOM    506  N   GLN A  81      85.465  62.327  34.398  1.00 81.12           N  
ATOM    507  CA  GLN A  81      85.824  60.984  34.846  1.00 84.91           C  
ATOM    508  C   GLN A  81      87.005  61.110  35.804  1.00 88.26           C  
ATOM    509  O   GLN A  81      87.079  60.434  36.832  1.00 89.33           O  
ATOM    510  CB  GLN A  81      86.243  60.121  33.657  1.00 84.36           C  
ATOM    511  CG  GLN A  81      85.234  60.028  32.518  1.00 84.15           C  
ATOM    512  CD  GLN A  81      83.960  59.327  32.920  1.00 83.16           C  
ATOM    513  OE1 GLN A  81      83.953  58.513  33.844  1.00 83.26           O  
ATOM    514  NE2 GLN A  81      82.873  59.625  32.215  1.00 82.42           N  
ATOM    515  N   MET A  82      87.923  61.997  35.440  1.00 91.07           N  
ATOM    516  CA  MET A  82      89.130  62.279  36.205  1.00 94.16           C  
ATOM    517  C   MET A  82      88.936  62.280  37.723  1.00 94.16           C  
ATOM    518  O   MET A  82      89.823  61.846  38.458  1.00 94.47           O  
ATOM    519  CB  MET A  82      89.691  63.635  35.763  1.00 97.45           C  
ATOM    520  CG  MET A  82      91.079  63.973  36.288  1.00103.21           C  
ATOM    521  SD  MET A  82      91.635  65.626  35.750  1.00108.38           S  
ATOM    522  CE  MET A  82      91.590  66.533  37.314  1.00107.73           C  
ATOM    523  N   TYR A  83      87.780  62.751  38.188  1.00 94.22           N  
ATOM    524  CA  TYR A  83      87.509  62.840  39.625  1.00 95.90           C  
ATOM    525  C   TYR A  83      86.819  61.633  40.244  1.00 98.09           C  
ATOM    526  O   TYR A  83      85.599  61.491  40.166  1.00 98.23           O  
ATOM    527  CB  TYR A  83      86.695  64.102  39.922  1.00 92.32           C  
ATOM    528  CG  TYR A  83      87.282  65.323  39.260  1.00 91.51           C  
ATOM    529  CD1 TYR A  83      86.922  65.676  37.962  1.00 91.24           C  
ATOM    530  CD2 TYR A  83      88.261  66.072  39.893  1.00 89.95           C  
ATOM    531  CE1 TYR A  83      87.526  66.738  37.316  1.00 88.60           C  
ATOM    532  CE2 TYR A  83      88.870  67.131  39.255  1.00 89.69           C  
ATOM    533  CZ  TYR A  83      88.500  67.458  37.969  1.00 88.95           C  
ATOM    534  OH  TYR A  83      89.118  68.505  37.338  1.00 87.04           O  
ATOM    535  N   PRO A  84      87.602  60.760  40.898  1.00 99.93           N  
ATOM    536  CA  PRO A  84      87.139  59.538  41.563  1.00100.87           C  
ATOM    537  C   PRO A  84      85.861  59.769  42.358  1.00101.55           C  
ATOM    538  O   PRO A  84      85.860  60.485  43.360  1.00101.55           O  
ATOM    539  CB  PRO A  84      88.313  59.170  42.465  1.00101.12           C  
ATOM    540  CG  PRO A  84      89.492  59.641  41.675  1.00101.65           C  
ATOM    541  CD  PRO A  84      89.030  60.996  41.176  1.00101.18           C  
ATOM    542  N   LEU A  85      84.774  59.163  41.899  1.00101.94           N  
ATOM    543  CA  LEU A  85      83.486  59.298  42.559  1.00103.12           C  
ATOM    544  C   LEU A  85      83.557  58.920  44.045  1.00102.98           C  
ATOM    545  O   LEU A  85      82.918  59.560  44.883  1.00101.64           O  
ATOM    546  CB  LEU A  85      82.439  58.438  41.834  1.00104.42           C  
ATOM    547  CG  LEU A  85      82.649  56.917  41.741  1.00106.38           C  
ATOM    548  CD1 LEU A  85      81.552  56.314  40.871  1.00105.71           C  
ATOM    549  CD2 LEU A  85      84.016  56.596  41.150  1.00106.18           C  
ATOM    550  N   GLN A  86      84.344  57.897  44.372  1.00102.75           N  
ATOM    551  CA  GLN A  86      84.468  57.459  45.761  1.00102.94           C  
ATOM    552  C   GLN A  86      85.268  58.455  46.600  1.00101.55           C  
ATOM    553  O   GLN A  86      84.974  58.667  47.778  1.00101.40           O  
ATOM    554  CB  GLN A  86      85.121  56.072  45.832  1.00104.41           C  
ATOM    555  CG  GLN A  86      85.029  55.430  47.217  1.00108.36           C  
ATOM    556  CD  GLN A  86      85.542  53.992  47.261  1.00110.94           C  
ATOM    557  OE1 GLN A  86      86.735  53.737  47.083  1.00112.09           O  
ATOM    558  NE2 GLN A  86      84.635  53.047  47.500  1.00111.60           N  
ATOM    559  N   GLU A  87      86.277  59.066  45.989  1.00 99.65           N  
ATOM    560  CA  GLU A  87      87.107  60.044  46.682  1.00 98.09           C  
ATOM    561  C   GLU A  87      86.302  61.306  46.965  1.00 96.78           C  
ATOM    562  O   GLU A  87      86.839  62.284  47.479  1.00 96.53           O  
ATOM    563  CB  GLU A  87      88.316  60.414  45.821  1.00 99.81           C  
ATOM    564  CG  GLU A  87      89.673  59.947  46.337  1.00101.77           C  
ATOM    565  CD  GLU A  87      89.799  58.437  46.397  1.00103.68           C  
ATOM    566  OE1 GLU A  87      89.435  57.847  47.439  1.00102.92           O  
ATOM    567  OE2 GLU A  87      90.255  57.841  45.395  1.00104.13           O  
ATOM    568  N   ILE A  88      85.015  61.280  46.627  1.00 96.60           N  
ATOM    569  CA  ILE A  88      84.141  62.436  46.820  1.00 95.69           C  
ATOM    570  C   ILE A  88      83.312  62.354  48.100  1.00 95.45           C  
ATOM    571  O   ILE A  88      82.871  61.275  48.498  1.00 96.20           O  
ATOM    572  CB  ILE A  88      83.181  62.610  45.618  1.00 95.00           C  
ATOM    573  CG1 ILE A  88      83.980  62.627  44.309  1.00 94.78           C  
ATOM    574  CG2 ILE A  88      82.386  63.905  45.770  1.00 93.19           C  
ATOM    575  CD1 ILE A  88      84.981  63.770  44.196  1.00 92.24           C  
ATOM    576  N   GLN A  89      83.091  63.507  48.726  1.00 94.15           N  
ATOM    577  CA  GLN A  89      82.337  63.581  49.970  1.00 94.43           C  
ATOM    578  C   GLN A  89      81.042  64.385  49.880  1.00 93.71           C  
ATOM    579  O   GLN A  89      79.967  63.878  50.208  1.00 93.72           O  
ATOM    580  CB  GLN A  89      83.225  64.180  51.060  1.00 97.05           C  
ATOM    581  CG  GLN A  89      82.462  64.768  52.232  1.00 99.34           C  
ATOM    582  CD  GLN A  89      83.289  65.774  53.013  1.00101.26           C  
ATOM    583  OE1 GLN A  89      84.286  65.422  53.649  1.00100.01           O  
ATOM    584  NE2 GLN A  89      82.884  67.040  52.956  1.00101.87           N  
ATOM    585  N   ASN A  90      81.158  65.643  49.457  1.00 92.79           N  
ATOM    586  CA  ASN A  90      80.016  66.553  49.322  1.00 90.90           C  
ATOM    587  C   ASN A  90      78.946  65.979  48.381  1.00 90.26           C  
ATOM    588  O   ASN A  90      78.998  66.198  47.173  1.00 91.08           O  
ATOM    589  CB  ASN A  90      80.509  67.899  48.786  1.00 89.39           C  
ATOM    590  CG  ASN A  90      79.440  68.970  48.821  1.00 90.70           C  
ATOM    591  OD1 ASN A  90      78.297  68.724  48.434  1.00 92.11           O  
ATOM    592  ND2 ASN A  90      79.822  70.163  49.277  1.00 89.55           N  
ATOM    593  N   LEU A  91      77.977  65.257  48.940  1.00 88.12           N  
ATOM    594  CA  LEU A  91      76.910  64.631  48.153  1.00 85.40           C  
ATOM    595  C   LEU A  91      76.329  65.516  47.047  1.00 84.35           C  
ATOM    596  O   LEU A  91      75.912  65.022  45.998  1.00 84.64           O  
ATOM    597  CB  LEU A  91      75.776  64.156  49.072  1.00 83.90           C  
ATOM    598  CG  LEU A  91      76.119  63.066  50.091  1.00 84.40           C  
ATOM    599  CD1 LEU A  91      77.111  63.614  51.104  1.00 86.11           C  
ATOM    600  CD2 LEU A  91      74.857  62.596  50.795  1.00 83.84           C  
ATOM    601  N   THR A  92      76.297  66.821  47.278  1.00 81.99           N  
ATOM    602  CA  THR A  92      75.766  67.731  46.281  1.00 80.55           C  
ATOM    603  C   THR A  92      76.680  67.783  45.061  1.00 80.91           C  
ATOM    604  O   THR A  92      76.205  67.939  43.927  1.00 81.61           O  
ATOM    605  CB  THR A  92      75.608  69.140  46.851  1.00 80.63           C  
ATOM    606  OG1 THR A  92      74.728  69.087  47.979  1.00 84.14           O  
ATOM    607  CG2 THR A  92      75.030  70.084  45.802  1.00 79.94           C  
ATOM    608  N   VAL A  93      77.988  67.656  45.286  1.00 76.81           N  
ATOM    609  CA  VAL A  93      78.922  67.683  44.175  1.00 74.09           C  
ATOM    610  C   VAL A  93      78.964  66.313  43.535  1.00 71.84           C  
ATOM    611  O   VAL A  93      79.305  66.189  42.362  1.00 71.16           O  
ATOM    612  CB  VAL A  93      80.353  68.070  44.603  1.00 74.81           C  
ATOM    613  CG1 VAL A  93      80.319  69.344  45.427  1.00 75.69           C  
ATOM    614  CG2 VAL A  93      80.998  66.938  45.352  1.00 76.40           C  
ATOM    615  N   LYS A  94      78.608  65.283  44.298  1.00 69.93           N  
ATOM    616  CA  LYS A  94      78.607  63.927  43.751  1.00 70.92           C  
ATOM    617  C   LYS A  94      77.476  63.827  42.721  1.00 68.93           C  
ATOM    618  O   LYS A  94      77.664  63.286  41.634  1.00 67.89           O  
ATOM    619  CB  LYS A  94      78.407  62.870  44.855  1.00 70.89           C  
ATOM    620  CG  LYS A  94      78.868  61.473  44.416  1.00 73.63           C  
ATOM    621  CD  LYS A  94      78.466  60.351  45.379  1.00 78.15           C  
ATOM    622  CE  LYS A  94      76.985  59.968  45.224  1.00 80.34           C  
ATOM    623  NZ  LYS A  94      76.590  58.775  46.046  1.00 77.92           N  
ATOM    624  N   LEU A  95      76.307  64.358  43.075  1.00 67.34           N  
ATOM    625  CA  LEU A  95      75.151  64.358  42.178  1.00 65.87           C  
ATOM    626  C   LEU A  95      75.542  64.924  40.824  1.00 63.56           C  
ATOM    627  O   LEU A  95      75.390  64.263  39.799  1.00 65.40           O  
ATOM    628  CB  LEU A  95      74.014  65.208  42.756  1.00 62.56           C  
ATOM    629  CG  LEU A  95      73.308  64.657  43.990  1.00 62.33           C  
ATOM    630  CD1 LEU A  95      72.277  65.681  44.480  1.00 59.82           C  
ATOM    631  CD2 LEU A  95      72.659  63.314  43.648  1.00 55.94           C  
ATOM    632  N   GLN A  96      76.040  66.157  40.828  1.00 62.44           N  
ATOM    633  CA  GLN A  96      76.454  66.829  39.599  1.00 60.35           C  
ATOM    634  C   GLN A  96      77.487  66.016  38.838  1.00 60.37           C  
ATOM    635  O   GLN A  96      77.352  65.770  37.639  1.00 57.33           O  
ATOM    636  CB  GLN A  96      77.039  68.193  39.930  1.00 58.70           C  
ATOM    637  CG  GLN A  96      76.008  69.232  40.228  1.00 59.52           C  
ATOM    638  CD  GLN A  96      76.600  70.430  40.925  1.00 59.21           C  
ATOM    639  OE1 GLN A  96      76.848  70.395  42.126  1.00 62.83           O  
ATOM    640  NE2 GLN A  96      76.842  71.494  40.176  1.00 57.13           N  
ATOM    641  N   LEU A  97      78.524  65.609  39.554  1.00 60.69           N  
ATOM    642  CA  LEU A  97      79.602  64.830  38.980  1.00 62.07           C  
ATOM    643  C   LEU A  97      79.019  63.535  38.437  1.00 63.49           C  
ATOM    644  O   LEU A  97      79.398  63.059  37.371  1.00 62.66           O  
ATOM    645  CB  LEU A  97      80.635  64.548  40.066  1.00 64.03           C  
ATOM    646  CG  LEU A  97      82.030  64.059  39.693  1.00 67.28           C  
ATOM    647  CD1 LEU A  97      82.701  65.051  38.740  1.00 69.09           C  
ATOM    648  CD2 LEU A  97      82.838  63.906  40.978  1.00 66.72           C  
ATOM    649  N   GLN A  98      78.072  62.979  39.179  1.00 66.77           N  
ATOM    650  CA  GLN A  98      77.419  61.737  38.794  1.00 69.42           C  
ATOM    651  C   GLN A  98      76.743  61.905  37.433  1.00 69.42           C  
ATOM    652  O   GLN A  98      77.017  61.156  36.488  1.00 68.75           O  
ATOM    653  CB  GLN A  98      76.382  61.356  39.856  1.00 70.34           C  
ATOM    654  CG  GLN A  98      75.971  59.894  39.866  1.00 76.34           C  
ATOM    655  CD  GLN A  98      75.104  59.555  41.070  1.00 79.88           C  
ATOM    656  OE1 GLN A  98      73.934  59.944  41.145  1.00 81.11           O  
ATOM    657  NE2 GLN A  98      75.681  58.837  42.027  1.00 80.81           N  
ATOM    658  N   ALA A  99      75.864  62.896  37.338  1.00 67.40           N  
ATOM    659  CA  ALA A  99      75.155  63.157  36.099  1.00 68.76           C  
ATOM    660  C   ALA A  99      76.117  63.268  34.915  1.00 71.66           C  
ATOM    661  O   ALA A  99      75.907  62.644  33.870  1.00 72.73           O  
ATOM    662  CB  ALA A  99      74.343  64.426  36.234  1.00 65.63           C  
ATOM    663  N   LEU A 100      77.181  64.046  35.094  1.00 72.26           N  
ATOM    664  CA  LEU A 100      78.174  64.267  34.052  1.00 73.07           C  
ATOM    665  C   LEU A 100      78.997  63.075  33.544  1.00 76.69           C  
ATOM    666  O   LEU A 100      79.096  62.867  32.331  1.00 76.47           O  
ATOM    667  CB  LEU A 100      79.135  65.381  34.484  1.00 69.34           C  
ATOM    668  CG  LEU A 100      78.694  66.809  34.171  1.00 65.59           C  
ATOM    669  CD1 LEU A 100      79.789  67.812  34.524  1.00 60.84           C  
ATOM    670  CD2 LEU A 100      78.380  66.885  32.690  1.00 62.54           C  
ATOM    671  N   GLN A 101      79.595  62.297  34.444  1.00 79.82           N  
ATOM    672  CA  GLN A 101      80.428  61.180  34.003  1.00 81.93           C  
ATOM    673  C   GLN A 101      79.694  59.897  33.654  1.00 84.08           C  
ATOM    674  O   GLN A 101      80.159  58.793  33.946  1.00 85.98           O  
ATOM    675  CB  GLN A 101      81.533  60.893  35.025  1.00 80.73           C  
ATOM    676  CG  GLN A 101      81.093  60.789  36.461  1.00 82.32           C  
ATOM    677  CD  GLN A 101      82.263  60.508  37.389  1.00 82.78           C  
ATOM    678  OE1 GLN A 101      82.902  59.458  37.298  1.00 84.07           O  
ATOM    679  NE2 GLN A 101      82.557  61.452  38.279  1.00 79.96           N  
ATOM    680  N   GLN A 102      78.557  60.063  32.995  1.00 85.31           N  
ATOM    681  CA  GLN A 102      77.719  58.956  32.562  1.00 86.29           C  
ATOM    682  C   GLN A 102      78.037  58.748  31.079  1.00 86.68           C  
ATOM    683  O   GLN A 102      77.651  59.569  30.244  1.00 86.96           O  
ATOM    684  CB  GLN A 102      76.259  59.359  32.749  1.00 87.37           C  
ATOM    685  CG  GLN A 102      75.238  58.269  32.591  1.00 90.79           C  
ATOM    686  CD  GLN A 102      73.826  58.832  32.612  1.00 93.78           C  
ATOM    687  OE1 GLN A 102      73.459  59.584  33.519  1.00 94.22           O  
ATOM    688  NE2 GLN A 102      73.027  58.473  31.610  1.00 93.12           N  
ATOM    689  N   ASN A 103      78.743  57.665  30.751  1.00 86.05           N  
ATOM    690  CA  ASN A 103      79.114  57.402  29.360  1.00 86.29           C  
ATOM    691  C   ASN A 103      77.944  57.058  28.447  1.00 86.53           C  
ATOM    692  O   ASN A 103      77.755  57.686  27.405  1.00 87.60           O  
ATOM    693  CB  ASN A 103      80.153  56.283  29.274  1.00 86.71           C  
ATOM    694  CG  ASN A 103      81.480  56.670  29.891  1.00 87.05           C  
ATOM    695  OD1 ASN A 103      81.897  57.827  29.816  1.00 85.80           O  
ATOM    696  ND2 ASN A 103      82.159  55.695  30.485  1.00 87.90           N  
ATOM    697  N   GLY A 104      77.168  56.051  28.830  1.00 85.63           N  
ATOM    698  CA  GLY A 104      76.034  55.658  28.018  1.00 82.81           C  
ATOM    699  C   GLY A 104      76.451  54.886  26.781  1.00 81.70           C  
ATOM    700  O   GLY A 104      77.173  53.897  26.874  1.00 81.65           O  
ATOM    701  N   SER A 105      75.998  55.349  25.620  1.00 80.78           N  
ATOM    702  CA  SER A 105      76.302  54.701  24.351  1.00 80.70           C  
ATOM    703  C   SER A 105      77.760  54.838  23.938  1.00 79.24           C  
ATOM    704  O   SER A 105      78.303  53.954  23.258  1.00 76.75           O  
ATOM    705  CB  SER A 105      75.403  55.269  23.253  1.00 81.72           C  
ATOM    706  OG  SER A 105      74.037  55.058  23.576  1.00 88.00           O  
ATOM    707  N   SER A 106      78.388  55.944  24.344  1.00 77.86           N  
ATOM    708  CA  SER A 106      79.793  56.199  24.016  1.00 75.95           C  
ATOM    709  C   SER A 106      80.683  55.099  24.590  1.00 73.84           C  
ATOM    710  O   SER A 106      81.875  55.044  24.302  1.00 75.28           O  
ATOM    711  CB  SER A 106      80.242  57.557  24.572  1.00 77.50           C  
ATOM    712  OG  SER A 106      80.443  57.497  25.979  1.00 78.57           O  
ATOM    713  N   VAL A 107      80.096  54.226  25.405  1.00 72.41           N  
ATOM    714  CA  VAL A 107      80.832  53.127  26.010  1.00 70.10           C  
ATOM    715  C   VAL A 107      80.904  51.985  25.008  1.00 70.17           C  
ATOM    716  O   VAL A 107      81.497  50.945  25.274  1.00 69.93           O  
ATOM    717  CB  VAL A 107      80.140  52.631  27.294  1.00 69.70           C  
ATOM    718  CG1 VAL A 107      79.086  51.592  26.950  1.00 68.25           C  
ATOM    719  CG2 VAL A 107      81.163  52.075  28.252  1.00 67.59           C  
ATOM    720  N   LEU A 108      80.296  52.195  23.847  1.00 70.82           N  
ATOM    721  CA  LEU A 108      80.284  51.200  22.782  1.00 72.73           C  
ATOM    722  C   LEU A 108      81.338  51.515  21.728  1.00 72.95           C  
ATOM    723  O   LEU A 108      81.748  52.662  21.567  1.00 72.13           O  
ATOM    724  CB  LEU A 108      78.907  51.152  22.101  1.00 73.55           C  
ATOM    725  CG  LEU A 108      77.720  50.554  22.865  1.00 73.34           C  
ATOM    726  CD1 LEU A 108      76.425  50.901  22.135  1.00 72.21           C  
ATOM    727  CD2 LEU A 108      77.894  49.039  22.999  1.00 70.38           C  
ATOM    728  N   SER A 109      81.763  50.484  21.006  1.00 72.80           N  
ATOM    729  CA  SER A 109      82.748  50.645  19.953  1.00 74.11           C  
ATOM    730  C   SER A 109      82.055  51.328  18.779  1.00 76.30           C  
ATOM    731  O   SER A 109      80.935  50.973  18.429  1.00 78.27           O  
ATOM    732  CB  SER A 109      83.261  49.284  19.519  1.00 71.87           C  
ATOM    733  OG  SER A 109      82.231  48.549  18.899  1.00 69.77           O  
ATOM    734  N   GLU A 110      82.728  52.297  18.169  1.00 77.63           N  
ATOM    735  CA  GLU A 110      82.172  53.048  17.048  1.00 79.07           C  
ATOM    736  C   GLU A 110      81.231  52.274  16.120  1.00 77.50           C  
ATOM    737  O   GLU A 110      80.158  52.770  15.783  1.00 76.20           O  
ATOM    738  CB  GLU A 110      83.303  53.676  16.229  1.00 82.04           C  
ATOM    739  CG  GLU A 110      82.828  54.537  15.060  1.00 89.37           C  
ATOM    740  CD  GLU A 110      81.819  55.611  15.470  1.00 92.84           C  
ATOM    741  OE1 GLU A 110      80.670  55.260  15.829  1.00 94.08           O  
ATOM    742  OE2 GLU A 110      82.176  56.810  15.434  1.00 94.82           O  
ATOM    743  N   ASP A 111      81.619  51.069  15.707  1.00 75.30           N  
ATOM    744  CA  ASP A 111      80.770  50.277  14.818  1.00 73.62           C  
ATOM    745  C   ASP A 111      79.455  49.859  15.474  1.00 72.52           C  
ATOM    746  O   ASP A 111      78.456  49.648  14.789  1.00 70.71           O  
ATOM    747  CB  ASP A 111      81.507  49.026  14.323  1.00 76.22           C  
ATOM    748  CG  ASP A 111      82.637  49.354  13.348  1.00 79.86           C  
ATOM    749  OD1 ASP A 111      82.485  50.305  12.545  1.00 79.21           O  
ATOM    750  OD2 ASP A 111      83.671  48.649  13.373  1.00 80.87           O  
ATOM    751  N   LYS A 112      79.465  49.733  16.798  1.00 69.70           N  
ATOM    752  CA  LYS A 112      78.271  49.355  17.542  1.00 67.28           C  
ATOM    753  C   LYS A 112      77.348  50.573  17.684  1.00 64.91           C  
ATOM    754  O   LYS A 112      76.159  50.505  17.382  1.00 59.06           O  
ATOM    755  CB  LYS A 112      78.652  48.828  18.931  1.00 67.06           C  
ATOM    756  CG  LYS A 112      79.386  47.472  18.942  1.00 67.82           C  
ATOM    757  CD  LYS A 112      78.482  46.326  18.522  1.00 66.20           C  
ATOM    758  CE  LYS A 112      79.161  44.969  18.709  1.00 68.16           C  
ATOM    759  NZ  LYS A 112      79.490  44.663  20.129  1.00 61.37           N  
ATOM    760  N   SER A 113      77.918  51.681  18.145  1.00 62.69           N  
ATOM    761  CA  SER A 113      77.179  52.919  18.330  1.00 61.31           C  
ATOM    762  C   SER A 113      76.535  53.338  17.021  1.00 59.74           C  
ATOM    763  O   SER A 113      75.415  53.843  16.996  1.00 60.06           O  
ATOM    764  CB  SER A 113      78.122  54.024  18.803  1.00 59.82           C  
ATOM    765  OG  SER A 113      78.666  53.704  20.063  1.00 66.04           O  
ATOM    766  N   LYS A 114      77.262  53.129  15.937  1.00 58.88           N  
ATOM    767  CA  LYS A 114      76.780  53.483  14.620  1.00 60.41           C  
ATOM    768  C   LYS A 114      75.565  52.613  14.299  1.00 58.30           C  
ATOM    769  O   LYS A 114      74.527  53.110  13.847  1.00 58.52           O  
ATOM    770  CB  LYS A 114      77.895  53.266  13.582  1.00 63.11           C  
ATOM    771  CG  LYS A 114      77.747  54.072  12.281  1.00 67.88           C  
ATOM    772  CD  LYS A 114      76.562  53.593  11.447  1.00 73.84           C  
ATOM    773  CE  LYS A 114      76.383  54.428  10.186  1.00 76.98           C  
ATOM    774  NZ  LYS A 114      75.981  55.826  10.498  1.00 76.33           N  
ATOM    775  N   ARG A 115      75.685  51.316  14.545  1.00 56.55           N  
ATOM    776  CA  ARG A 115      74.581  50.403  14.250  1.00 56.91           C  
ATOM    777  C   ARG A 115      73.374  50.701  15.139  1.00 55.18           C  
ATOM    778  O   ARG A 115      72.245  50.753  14.653  1.00 54.01           O  
ATOM    779  CB  ARG A 115      75.036  48.950  14.414  1.00 57.34           C  
ATOM    780  CG  ARG A 115      73.969  47.912  14.153  1.00 56.61           C  
ATOM    781  CD  ARG A 115      73.419  48.003  12.743  1.00 62.62           C  
ATOM    782  NE  ARG A 115      72.361  47.016  12.532  1.00 64.22           N  
ATOM    783  CZ  ARG A 115      71.500  47.034  11.522  1.00 64.74           C  
ATOM    784  NH1 ARG A 115      70.576  46.087  11.430  1.00 66.05           N  
ATOM    785  NH2 ARG A 115      71.555  47.995  10.609  1.00 66.49           N  
ATOM    786  N   LEU A 116      73.611  50.925  16.429  1.00 54.28           N  
ATOM    787  CA  LEU A 116      72.517  51.224  17.342  1.00 54.49           C  
ATOM    788  C   LEU A 116      71.779  52.475  16.879  1.00 55.82           C  
ATOM    789  O   LEU A 116      70.548  52.496  16.875  1.00 59.76           O  
ATOM    790  CB  LEU A 116      73.022  51.428  18.776  1.00 51.14           C  
ATOM    791  CG  LEU A 116      71.982  51.965  19.777  1.00 53.12           C  
ATOM    792  CD1 LEU A 116      70.786  51.023  19.816  1.00 53.21           C  
ATOM    793  CD2 LEU A 116      72.588  52.107  21.179  1.00 47.25           C  
ATOM    794  N   ASN A 117      72.515  53.513  16.483  1.00 53.56           N  
ATOM    795  CA  ASN A 117      71.871  54.743  16.034  1.00 53.15           C  
ATOM    796  C   ASN A 117      71.046  54.520  14.768  1.00 49.72           C  
ATOM    797  O   ASN A 117      69.964  55.082  14.614  1.00 48.28           O  
ATOM    798  CB  ASN A 117      72.910  55.855  15.819  1.00 55.23           C  
ATOM    799  CG  ASN A 117      73.374  56.472  17.130  1.00 60.81           C  
ATOM    800  OD1 ASN A 117      72.657  56.422  18.143  1.00 63.42           O  
ATOM    801  ND2 ASN A 117      74.567  57.065  17.123  1.00 60.10           N  
ATOM    802  N   THR A 118      71.567  53.698  13.870  1.00 49.21           N  
ATOM    803  CA  THR A 118      70.867  53.365  12.646  1.00 51.63           C  
ATOM    804  C   THR A 118      69.569  52.658  13.041  1.00 51.25           C  
ATOM    805  O   THR A 118      68.491  53.029  12.593  1.00 53.22           O  
ATOM    806  CB  THR A 118      71.732  52.443  11.757  1.00 54.31           C  
ATOM    807  OG1 THR A 118      72.881  53.165  11.303  1.00 57.83           O  
ATOM    808  CG2 THR A 118      70.955  51.963  10.560  1.00 54.78           C  
ATOM    809  N   ILE A 119      69.664  51.662  13.911  1.00 48.76           N  
ATOM    810  CA  ILE A 119      68.468  50.955  14.345  1.00 47.22           C  
ATOM    811  C   ILE A 119      67.450  51.875  14.998  1.00 46.84           C  
ATOM    812  O   ILE A 119      66.256  51.755  14.758  1.00 48.59           O  
ATOM    813  CB  ILE A 119      68.798  49.812  15.320  1.00 44.09           C  
ATOM    814  CG1 ILE A 119      69.518  48.694  14.569  1.00 43.60           C  
ATOM    815  CG2 ILE A 119      67.528  49.241  15.903  1.00 43.23           C  
ATOM    816  CD1 ILE A 119      69.941  47.559  15.468  1.00 49.95           C  
ATOM    817  N   LEU A 120      67.901  52.796  15.833  1.00 48.35           N  
ATOM    818  CA  LEU A 120      66.948  53.704  16.463  1.00 50.24           C  
ATOM    819  C   LEU A 120      66.272  54.572  15.385  1.00 50.80           C  
ATOM    820  O   LEU A 120      65.044  54.702  15.362  1.00 49.35           O  
ATOM    821  CB  LEU A 120      67.648  54.583  17.511  1.00 47.47           C  
ATOM    822  CG  LEU A 120      68.163  53.846  18.761  1.00 52.58           C  
ATOM    823  CD1 LEU A 120      69.080  54.755  19.605  1.00 48.80           C  
ATOM    824  CD2 LEU A 120      66.970  53.376  19.590  1.00 49.48           C  
ATOM    825  N   ASN A 121      67.062  55.141  14.476  1.00 50.93           N  
ATOM    826  CA  ASN A 121      66.481  55.991  13.439  1.00 51.01           C  
ATOM    827  C   ASN A 121      65.528  55.233  12.542  1.00 49.39           C  
ATOM    828  O   ASN A 121      64.476  55.750  12.161  1.00 50.26           O  
ATOM    829  CB  ASN A 121      67.580  56.664  12.614  1.00 50.01           C  
ATOM    830  CG  ASN A 121      68.338  57.707  13.424  1.00 58.41           C  
ATOM    831  OD1 ASN A 121      67.734  58.490  14.170  1.00 57.76           O  
ATOM    832  ND2 ASN A 121      69.662  57.727  13.284  1.00 60.24           N  
ATOM    833  N   THR A 122      65.883  53.997  12.225  1.00 48.30           N  
ATOM    834  CA  THR A 122      65.047  53.173  11.376  1.00 47.20           C  
ATOM    835  C   THR A 122      63.721  52.848  12.059  1.00 50.34           C  
ATOM    836  O   THR A 122      62.668  53.048  11.463  1.00 52.08           O  
ATOM    837  CB  THR A 122      65.770  51.866  10.996  1.00 46.23           C  
ATOM    838  OG1 THR A 122      67.089  52.178  10.535  1.00 44.13           O  
ATOM    839  CG2 THR A 122      65.018  51.135   9.875  1.00 43.39           C  
ATOM    840  N   MET A 123      63.760  52.366  13.307  1.00 48.98           N  
ATOM    841  CA  MET A 123      62.524  52.019  14.005  1.00 47.15           C  
ATOM    842  C   MET A 123      61.659  53.259  14.096  1.00 46.96           C  
ATOM    843  O   MET A 123      60.433  53.217  13.944  1.00 46.14           O  
ATOM    844  CB  MET A 123      62.793  51.502  15.437  1.00 46.47           C  
ATOM    845  CG  MET A 123      63.479  50.138  15.547  1.00 46.52           C  
ATOM    846  SD  MET A 123      63.332  49.382  17.211  1.00 48.13           S  
ATOM    847  CE  MET A 123      64.448  50.456  18.191  1.00 43.47           C  
ATOM    848  N   SER A 124      62.312  54.379  14.357  1.00 45.10           N  
ATOM    849  CA  SER A 124      61.589  55.624  14.490  1.00 45.57           C  
ATOM    850  C   SER A 124      60.860  56.046  13.217  1.00 43.30           C  
ATOM    851  O   SER A 124      59.719  56.507  13.263  1.00 42.41           O  
ATOM    852  CB  SER A 124      62.540  56.736  14.900  1.00 42.83           C  
ATOM    853  OG  SER A 124      61.793  57.887  15.187  1.00 45.69           O  
ATOM    854  N   THR A 125      61.531  55.904  12.087  1.00 44.99           N  
ATOM    855  CA  THR A 125      60.933  56.316  10.839  1.00 49.14           C  
ATOM    856  C   THR A 125      59.851  55.359  10.384  1.00 49.29           C  
ATOM    857  O   THR A 125      58.810  55.821   9.939  1.00 49.80           O  
ATOM    858  CB  THR A 125      61.984  56.488   9.721  1.00 48.30           C  
ATOM    859  OG1 THR A 125      62.567  55.221   9.425  1.00 60.68           O  
ATOM    860  CG2 THR A 125      63.074  57.442  10.154  1.00 47.17           C  
ATOM    861  N   ILE A 126      60.051  54.041  10.499  1.00 47.56           N  
ATOM    862  CA  ILE A 126      58.982  53.159  10.047  1.00 46.49           C  
ATOM    863  C   ILE A 126      57.745  53.405  10.906  1.00 45.92           C  
ATOM    864  O   ILE A 126      56.631  53.217  10.438  1.00 45.77           O  
ATOM    865  CB  ILE A 126      59.344  51.645  10.101  1.00 51.70           C  
ATOM    866  CG1 ILE A 126      59.015  51.084  11.462  1.00 50.90           C  
ATOM    867  CG2 ILE A 126      60.797  51.403   9.765  1.00 50.94           C  
ATOM    868  CD1 ILE A 126      57.683  50.380  11.474  1.00 58.81           C  
ATOM    869  N   TYR A 127      57.927  53.848  12.153  1.00 40.08           N  
ATOM    870  CA  TYR A 127      56.781  54.134  13.021  1.00 38.45           C  
ATOM    871  C   TYR A 127      56.031  55.392  12.589  1.00 40.30           C  
ATOM    872  O   TYR A 127      54.796  55.443  12.595  1.00 41.50           O  
ATOM    873  CB  TYR A 127      57.235  54.342  14.488  1.00 37.76           C  
ATOM    874  CG  TYR A 127      56.097  54.626  15.461  1.00 34.98           C  
ATOM    875  CD1 TYR A 127      55.652  55.924  15.717  1.00 36.37           C  
ATOM    876  CD2 TYR A 127      55.431  53.583  16.076  1.00 36.29           C  
ATOM    877  CE1 TYR A 127      54.579  56.146  16.552  1.00 31.00           C  
ATOM    878  CE2 TYR A 127      54.366  53.801  16.897  1.00 31.26           C  
ATOM    879  CZ  TYR A 127      53.943  55.055  17.137  1.00 33.23           C  
ATOM    880  OH  TYR A 127      52.877  55.178  18.003  1.00 35.94           O  
ATOM    881  N   SER A 128      56.772  56.426  12.222  1.00 40.35           N  
ATOM    882  CA  SER A 128      56.105  57.671  11.861  1.00 44.39           C  
ATOM    883  C   SER A 128      55.733  57.731  10.396  1.00 42.49           C  
ATOM    884  O   SER A 128      54.978  58.593  10.004  1.00 43.42           O  
ATOM    885  CB  SER A 128      56.991  58.865  12.189  1.00 42.39           C  
ATOM    886  OG  SER A 128      58.140  58.831  11.374  1.00 52.66           O  
ATOM    887  N   THR A 129      56.217  56.784   9.609  1.00 42.60           N  
ATOM    888  CA  THR A 129      55.948  56.814   8.190  1.00 47.13           C  
ATOM    889  C   THR A 129      55.283  55.561   7.621  1.00 47.30           C  
ATOM    890  O   THR A 129      54.889  55.530   6.460  1.00 48.95           O  
ATOM    891  CB  THR A 129      57.261  57.137   7.442  1.00 48.29           C  
ATOM    892  OG1 THR A 129      56.946  57.652   6.151  1.00 63.79           O  
ATOM    893  CG2 THR A 129      58.134  55.906   7.304  1.00 41.73           C  
ATOM    894  N   GLY A 130      55.135  54.537   8.449  1.00 46.75           N  
ATOM    895  CA  GLY A 130      54.501  53.321   7.988  1.00 45.85           C  
ATOM    896  C   GLY A 130      53.027  53.545   7.720  1.00 47.69           C  
ATOM    897  O   GLY A 130      52.381  54.400   8.338  1.00 45.48           O  
ATOM    898  N   LYS A 131      52.473  52.780   6.793  1.00 47.64           N  
ATOM    899  CA  LYS A 131      51.064  52.933   6.486  1.00 50.98           C  
ATOM    900  C   LYS A 131      50.390  51.629   6.113  1.00 49.80           C  
ATOM    901  O   LYS A 131      51.036  50.662   5.722  1.00 50.68           O  
ATOM    902  CB  LYS A 131      50.877  53.969   5.365  1.00 51.67           C  
ATOM    903  CG  LYS A 131      51.687  53.705   4.124  1.00 61.30           C  
ATOM    904  CD  LYS A 131      51.525  54.873   3.156  1.00 66.53           C  
ATOM    905  CE  LYS A 131      51.687  56.207   3.892  1.00 68.37           C  
ATOM    906  NZ  LYS A 131      51.442  57.407   3.029  1.00 69.30           N  
ATOM    907  N   VAL A 132      49.078  51.588   6.253  1.00 50.20           N  
ATOM    908  CA  VAL A 132      48.368  50.375   5.888  1.00 53.55           C  
ATOM    909  C   VAL A 132      47.398  50.789   4.795  1.00 54.86           C  
ATOM    910  O   VAL A 132      46.951  51.936   4.760  1.00 55.43           O  
ATOM    911  CB  VAL A 132      47.601  49.770   7.093  1.00 51.16           C  
ATOM    912  CG1 VAL A 132      48.560  49.474   8.216  1.00 49.54           C  
ATOM    913  CG2 VAL A 132      46.544  50.712   7.564  1.00 49.77           C  
ATOM    914  N   CYS A 133      47.078  49.877   3.891  1.00 55.50           N  
ATOM    915  CA  CYS A 133      46.162  50.239   2.822  1.00 56.53           C  
ATOM    916  C   CYS A 133      44.901  49.385   2.861  1.00 55.57           C  
ATOM    917  O   CYS A 133      44.922  48.240   3.314  1.00 56.66           O  
ATOM    918  CB  CYS A 133      46.850  50.103   1.462  1.00 55.34           C  
ATOM    919  SG  CYS A 133      48.441  50.985   1.264  1.00 65.94           S  
ATOM    920  N   ASN A 134      43.801  49.969   2.403  1.00 54.31           N  
ATOM    921  CA  ASN A 134      42.521  49.298   2.349  1.00 57.20           C  
ATOM    922  C   ASN A 134      42.594  48.046   1.466  1.00 59.43           C  
ATOM    923  O   ASN A 134      43.139  48.085   0.362  1.00 60.82           O  
ATOM    924  CB  ASN A 134      41.481  50.247   1.783  1.00 57.36           C  
ATOM    925  CG  ASN A 134      40.112  49.625   1.724  1.00 60.31           C  
ATOM    926  OD1 ASN A 134      39.974  48.442   1.437  1.00 56.89           O  
ATOM    927  ND2 ASN A 134      39.085  50.424   1.983  1.00 65.29           N  
ATOM    928  N   PRO A 135      42.042  46.916   1.942  1.00 60.03           N  
ATOM    929  CA  PRO A 135      42.080  45.687   1.146  1.00 62.56           C  
ATOM    930  C   PRO A 135      41.287  45.824  -0.159  1.00 64.29           C  
ATOM    931  O   PRO A 135      41.653  45.244  -1.176  1.00 63.40           O  
ATOM    932  CB  PRO A 135      41.468  44.641   2.082  1.00 64.43           C  
ATOM    933  CG  PRO A 135      41.719  45.212   3.467  1.00 65.12           C  
ATOM    934  CD  PRO A 135      41.421  46.672   3.255  1.00 61.42           C  
ATOM    935  N   ASP A 136      40.206  46.599  -0.122  1.00 65.66           N  
ATOM    936  CA  ASP A 136      39.373  46.794  -1.297  1.00 66.13           C  
ATOM    937  C   ASP A 136      39.838  47.973  -2.155  1.00 65.17           C  
ATOM    938  O   ASP A 136      39.188  48.329  -3.144  1.00 67.32           O  
ATOM    939  CB  ASP A 136      37.901  46.974  -0.892  1.00 69.62           C  
ATOM    940  CG  ASP A 136      37.477  48.438  -0.812  1.00 78.34           C  
ATOM    941  OD1 ASP A 136      37.540  49.027   0.294  1.00 81.73           O  
ATOM    942  OD2 ASP A 136      37.077  49.006  -1.861  1.00 82.61           O  
ATOM    943  N   ASN A 137      40.963  48.577  -1.776  1.00 60.44           N  
ATOM    944  CA  ASN A 137      41.524  49.695  -2.532  1.00 54.21           C  
ATOM    945  C   ASN A 137      42.949  49.967  -2.085  1.00 51.34           C  
ATOM    946  O   ASN A 137      43.185  50.758  -1.182  1.00 48.64           O  
ATOM    947  CB  ASN A 137      40.675  50.954  -2.357  1.00 51.81           C  
ATOM    948  CG  ASN A 137      41.207  52.126  -3.160  1.00 51.54           C  
ATOM    949  OD1 ASN A 137      40.627  53.211  -3.149  1.00 53.27           O  
ATOM    950  ND2 ASN A 137      42.317  51.916  -3.858  1.00 50.08           N  
ATOM    951  N   PRO A 138      43.919  49.301  -2.730  1.00 50.59           N  
ATOM    952  CA  PRO A 138      45.359  49.390  -2.481  1.00 49.58           C  
ATOM    953  C   PRO A 138      45.917  50.808  -2.549  1.00 51.18           C  
ATOM    954  O   PRO A 138      47.037  51.049  -2.115  1.00 50.92           O  
ATOM    955  CB  PRO A 138      45.948  48.501  -3.569  1.00 49.37           C  
ATOM    956  CG  PRO A 138      44.881  47.453  -3.767  1.00 46.67           C  
ATOM    957  CD  PRO A 138      43.631  48.302  -3.775  1.00 49.05           C  
ATOM    958  N   GLN A 139      45.139  51.739  -3.095  1.00 49.29           N  
ATOM    959  CA  GLN A 139      45.588  53.122  -3.225  1.00 49.72           C  
ATOM    960  C   GLN A 139      45.112  54.014  -2.064  1.00 50.19           C  
ATOM    961  O   GLN A 139      45.552  55.151  -1.918  1.00 46.16           O  
ATOM    962  CB  GLN A 139      45.131  53.702  -4.577  1.00 49.39           C  
ATOM    963  CG  GLN A 139      45.943  53.205  -5.781  1.00 47.81           C  
ATOM    964  CD  GLN A 139      45.794  51.714  -6.029  1.00 48.35           C  
ATOM    965  OE1 GLN A 139      46.781  50.973  -6.067  1.00 51.48           O  
ATOM    966  NE2 GLN A 139      44.553  51.263  -6.187  1.00 48.01           N  
ATOM    967  N   GLU A 140      44.211  53.493  -1.246  1.00 49.85           N  
ATOM    968  CA  GLU A 140      43.736  54.243  -0.098  1.00 54.96           C  
ATOM    969  C   GLU A 140      44.618  53.740   1.038  1.00 55.47           C  
ATOM    970  O   GLU A 140      44.456  52.618   1.505  1.00 57.42           O  
ATOM    971  CB  GLU A 140      42.270  53.918   0.192  1.00 56.94           C  
ATOM    972  CG  GLU A 140      41.594  54.936   1.088  1.00 63.65           C  
ATOM    973  CD  GLU A 140      40.349  54.394   1.762  1.00 68.96           C  
ATOM    974  OE1 GLU A 140      39.490  53.803   1.071  1.00 71.10           O  
ATOM    975  OE2 GLU A 140      40.225  54.571   2.994  1.00 75.40           O  
ATOM    976  N   CYS A 141      45.579  54.547   1.454  1.00 55.78           N  
ATOM    977  CA  CYS A 141      46.478  54.133   2.519  1.00 58.91           C  
ATOM    978  C   CYS A 141      46.462  55.160   3.650  1.00 58.76           C  
ATOM    979  O   CYS A 141      46.368  56.365   3.411  1.00 61.75           O  
ATOM    980  CB  CYS A 141      47.890  53.964   1.960  1.00 59.51           C  
ATOM    981  SG  CYS A 141      48.007  52.838   0.521  1.00 62.56           S  
ATOM    982  N   LEU A 142      46.540  54.674   4.881  1.00 56.14           N  
ATOM    983  CA  LEU A 142      46.503  55.534   6.059  1.00 53.31           C  
ATOM    984  C   LEU A 142      47.755  55.417   6.927  1.00 51.99           C  
ATOM    985  O   LEU A 142      48.331  54.339   7.062  1.00 52.02           O  
ATOM    986  CB  LEU A 142      45.297  55.174   6.924  1.00 57.03           C  
ATOM    987  CG  LEU A 142      43.889  55.142   6.319  1.00 59.17           C  
ATOM    988  CD1 LEU A 142      42.958  54.446   7.300  1.00 55.95           C  
ATOM    989  CD2 LEU A 142      43.391  56.561   6.031  1.00 58.25           C  
ATOM    990  N   LEU A 143      48.162  56.541   7.506  1.00 48.95           N  
ATOM    991  CA  LEU A 143      49.295  56.593   8.412  1.00 48.13           C  
ATOM    992  C   LEU A 143      48.657  56.384   9.777  1.00 45.99           C  
ATOM    993  O   LEU A 143      47.433  56.454   9.908  1.00 40.81           O  
ATOM    994  CB  LEU A 143      49.966  57.985   8.404  1.00 47.10           C  
ATOM    995  CG  LEU A 143      50.868  58.424   7.239  1.00 51.40           C  
ATOM    996  CD1 LEU A 143      50.154  58.187   5.924  1.00 57.98           C  
ATOM    997  CD2 LEU A 143      51.207  59.905   7.365  1.00 51.36           C  
ATOM    998  N   LEU A 144      49.476  56.131  10.793  1.00 46.17           N  
ATOM    999  CA  LEU A 144      48.952  55.970  12.149  1.00 45.50           C  
ATOM   1000  C   LEU A 144      48.264  57.285  12.518  1.00 40.89           C  
ATOM   1001  O   LEU A 144      47.152  57.301  13.040  1.00 44.40           O  
ATOM   1002  CB  LEU A 144      50.096  55.719  13.140  1.00 43.15           C  
ATOM   1003  CG  LEU A 144      49.602  55.714  14.578  1.00 46.53           C  
ATOM   1004  CD1 LEU A 144      48.563  54.587  14.711  1.00 44.11           C  
ATOM   1005  CD2 LEU A 144      50.766  55.521  15.560  1.00 45.33           C  
ATOM   1006  N   GLU A 145      48.950  58.387  12.247  1.00 40.22           N  
ATOM   1007  CA  GLU A 145      48.428  59.710  12.566  1.00 45.82           C  
ATOM   1008  C   GLU A 145      48.334  60.625  11.347  1.00 46.65           C  
ATOM   1009  O   GLU A 145      49.345  60.955  10.735  1.00 48.94           O  
ATOM   1010  CB  GLU A 145      49.323  60.389  13.601  1.00 43.82           C  
ATOM   1011  CG  GLU A 145      48.967  61.856  13.874  1.00 46.73           C  
ATOM   1012  CD  GLU A 145      47.614  62.057  14.557  1.00 49.80           C  
ATOM   1013  OE1 GLU A 145      47.046  61.099  15.124  1.00 51.55           O  
ATOM   1014  OE2 GLU A 145      47.115  63.203  14.548  1.00 57.46           O  
ATOM   1015  N   PRO A 146      47.119  61.034  10.977  1.00 49.70           N  
ATOM   1016  CA  PRO A 146      45.873  60.670  11.646  1.00 51.88           C  
ATOM   1017  C   PRO A 146      45.413  59.501  10.801  1.00 53.11           C  
ATOM   1018  O   PRO A 146      46.190  58.980  10.009  1.00 60.08           O  
ATOM   1019  CB  PRO A 146      45.018  61.906  11.422  1.00 51.21           C  
ATOM   1020  CG  PRO A 146      45.347  62.229   9.969  1.00 47.66           C  
ATOM   1021  CD  PRO A 146      46.855  61.975   9.865  1.00 52.49           C  
ATOM   1022  N   GLY A 147      44.183  59.058  10.931  1.00 51.56           N  
ATOM   1023  CA  GLY A 147      43.800  57.974  10.044  1.00 48.02           C  
ATOM   1024  C   GLY A 147      43.481  56.742  10.829  1.00 47.73           C  
ATOM   1025  O   GLY A 147      42.323  56.462  11.112  1.00 48.02           O  
ATOM   1026  N   LEU A 148      44.521  56.001  11.178  1.00 45.46           N  
ATOM   1027  CA  LEU A 148      44.349  54.808  11.970  1.00 43.23           C  
ATOM   1028  C   LEU A 148      43.917  55.280  13.365  1.00 42.90           C  
ATOM   1029  O   LEU A 148      43.041  54.680  13.995  1.00 44.98           O  
ATOM   1030  CB  LEU A 148      45.669  54.045  12.010  1.00 41.48           C  
ATOM   1031  CG  LEU A 148      45.701  52.754  11.196  1.00 44.84           C  
ATOM   1032  CD1 LEU A 148      44.750  52.804  10.023  1.00 43.39           C  
ATOM   1033  CD2 LEU A 148      47.116  52.509  10.744  1.00 48.53           C  
ATOM   1034  N   ASN A 149      44.517  56.367  13.836  1.00 41.64           N  
ATOM   1035  CA  ASN A 149      44.164  56.914  15.139  1.00 43.15           C  
ATOM   1036  C   ASN A 149      42.729  57.403  15.103  1.00 45.76           C  
ATOM   1037  O   ASN A 149      41.961  57.184  16.051  1.00 45.90           O  
ATOM   1038  CB  ASN A 149      45.060  58.110  15.496  1.00 43.87           C  
ATOM   1039  CG  ASN A 149      46.413  57.702  16.082  1.00 46.60           C  
ATOM   1040  OD1 ASN A 149      47.328  58.519  16.133  1.00 42.68           O  
ATOM   1041  ND2 ASN A 149      46.539  56.446  16.534  1.00 40.19           N  
ATOM   1042  N   GLU A 150      42.359  58.077  14.013  1.00 45.75           N  
ATOM   1043  CA  GLU A 150      41.004  58.623  13.911  1.00 45.88           C  
ATOM   1044  C   GLU A 150      39.992  57.508  13.997  1.00 46.49           C  
ATOM   1045  O   GLU A 150      38.947  57.647  14.641  1.00 46.67           O  
ATOM   1046  CB  GLU A 150      40.824  59.413  12.612  1.00 49.52           C  
ATOM   1047  CG  GLU A 150      39.487  60.157  12.518  1.00 56.91           C  
ATOM   1048  CD  GLU A 150      38.318  59.240  12.153  1.00 60.78           C  
ATOM   1049  OE1 GLU A 150      37.155  59.559  12.507  1.00 61.93           O  
ATOM   1050  OE2 GLU A 150      38.564  58.205  11.492  1.00 61.58           O  
ATOM   1051  N   ILE A 151      40.316  56.392  13.354  1.00 46.61           N  
ATOM   1052  CA  ILE A 151      39.449  55.222  13.363  1.00 45.61           C  
ATOM   1053  C   ILE A 151      39.367  54.592  14.741  1.00 45.90           C  
ATOM   1054  O   ILE A 151      38.280  54.354  15.255  1.00 45.76           O  
ATOM   1055  CB  ILE A 151      39.978  54.116  12.431  1.00 48.45           C  
ATOM   1056  CG1 ILE A 151      39.795  54.509  10.965  1.00 46.05           C  
ATOM   1057  CG2 ILE A 151      39.276  52.800  12.746  1.00 44.08           C  
ATOM   1058  CD1 ILE A 151      40.455  53.525  10.025  1.00 43.84           C  
ATOM   1059  N   MET A 152      40.524  54.298  15.333  1.00 46.46           N  
ATOM   1060  CA  MET A 152      40.549  53.641  16.635  1.00 43.94           C  
ATOM   1061  C   MET A 152      39.879  54.447  17.732  1.00 43.28           C  
ATOM   1062  O   MET A 152      39.441  53.893  18.751  1.00 41.67           O  
ATOM   1063  CB  MET A 152      41.992  53.283  17.022  1.00 46.92           C  
ATOM   1064  CG  MET A 152      42.666  52.293  16.051  1.00 45.27           C  
ATOM   1065  SD  MET A 152      41.630  50.809  15.760  1.00 47.16           S  
ATOM   1066  CE  MET A 152      41.820  49.985  17.417  1.00 33.26           C  
ATOM   1067  N   ALA A 153      39.750  55.750  17.510  1.00 42.12           N  
ATOM   1068  CA  ALA A 153      39.122  56.606  18.501  1.00 43.24           C  
ATOM   1069  C   ALA A 153      37.641  56.851  18.247  1.00 48.17           C  
ATOM   1070  O   ALA A 153      36.877  57.086  19.199  1.00 47.00           O  
ATOM   1071  CB  ALA A 153      39.848  57.943  18.565  1.00 40.64           C  
ATOM   1072  N   ASN A 154      37.217  56.770  16.984  1.00 46.85           N  
ATOM   1073  CA  ASN A 154      35.824  57.091  16.669  1.00 50.97           C  
ATOM   1074  C   ASN A 154      34.909  56.023  16.070  1.00 51.30           C  
ATOM   1075  O   ASN A 154      33.689  56.130  16.186  1.00 51.95           O  
ATOM   1076  CB  ASN A 154      35.793  58.331  15.765  1.00 50.93           C  
ATOM   1077  CG  ASN A 154      36.523  59.524  16.384  1.00 55.23           C  
ATOM   1078  OD1 ASN A 154      37.568  59.957  15.893  1.00 58.09           O  
ATOM   1079  ND2 ASN A 154      35.981  60.044  17.474  1.00 56.25           N  
ATOM   1080  N   SER A 155      35.485  54.995  15.457  1.00 49.70           N  
ATOM   1081  CA  SER A 155      34.696  53.955  14.827  1.00 49.68           C  
ATOM   1082  C   SER A 155      33.960  53.047  15.794  1.00 51.93           C  
ATOM   1083  O   SER A 155      34.461  52.757  16.882  1.00 51.95           O  
ATOM   1084  CB  SER A 155      35.588  53.112  13.912  1.00 49.14           C  
ATOM   1085  OG  SER A 155      34.903  51.957  13.462  1.00 46.51           O  
ATOM   1086  N   LEU A 156      32.765  52.599  15.385  1.00 52.43           N  
ATOM   1087  CA  LEU A 156      31.952  51.693  16.200  1.00 50.67           C  
ATOM   1088  C   LEU A 156      31.741  50.389  15.460  1.00 50.97           C  
ATOM   1089  O   LEU A 156      30.897  49.579  15.843  1.00 52.49           O  
ATOM   1090  CB  LEU A 156      30.586  52.306  16.530  1.00 50.55           C  
ATOM   1091  CG  LEU A 156      30.505  53.272  17.715  1.00 52.54           C  
ATOM   1092  CD1 LEU A 156      31.596  54.303  17.602  1.00 57.37           C  
ATOM   1093  CD2 LEU A 156      29.149  53.969  17.726  1.00 58.98           C  
ATOM   1094  N   ASP A 157      32.506  50.189  14.394  1.00 51.91           N  
ATOM   1095  CA  ASP A 157      32.399  48.974  13.598  1.00 51.79           C  
ATOM   1096  C   ASP A 157      33.478  47.962  13.986  1.00 51.03           C  
ATOM   1097  O   ASP A 157      34.657  48.182  13.756  1.00 52.92           O  
ATOM   1098  CB  ASP A 157      32.534  49.302  12.116  1.00 54.76           C  
ATOM   1099  CG  ASP A 157      32.530  48.057  11.249  1.00 61.26           C  
ATOM   1100  OD1 ASP A 157      31.545  47.844  10.521  1.00 69.21           O  
ATOM   1101  OD2 ASP A 157      33.504  47.277  11.304  1.00 64.53           O  
ATOM   1102  N   TYR A 158      33.059  46.847  14.556  1.00 48.99           N  
ATOM   1103  CA  TYR A 158      33.975  45.811  14.984  1.00 51.52           C  
ATOM   1104  C   TYR A 158      35.003  45.436  13.911  1.00 53.70           C  
ATOM   1105  O   TYR A 158      36.206  45.365  14.187  1.00 54.40           O  
ATOM   1106  CB  TYR A 158      33.177  44.568  15.400  1.00 48.22           C  
ATOM   1107  CG  TYR A 158      33.998  43.467  16.031  1.00 48.10           C  
ATOM   1108  CD1 TYR A 158      34.096  43.350  17.412  1.00 48.60           C  
ATOM   1109  CD2 TYR A 158      34.672  42.535  15.249  1.00 46.54           C  
ATOM   1110  CE1 TYR A 158      34.839  42.331  17.997  1.00 46.55           C  
ATOM   1111  CE2 TYR A 158      35.421  41.521  15.828  1.00 42.71           C  
ATOM   1112  CZ  TYR A 158      35.495  41.425  17.199  1.00 45.44           C  
ATOM   1113  OH  TYR A 158      36.229  40.412  17.778  1.00 50.38           O  
ATOM   1114  N   ASN A 159      34.544  45.205  12.687  1.00 52.29           N  
ATOM   1115  CA  ASN A 159      35.469  44.804  11.635  1.00 51.36           C  
ATOM   1116  C   ASN A 159      36.453  45.867  11.186  1.00 46.61           C  
ATOM   1117  O   ASN A 159      37.616  45.566  10.944  1.00 45.96           O  
ATOM   1118  CB  ASN A 159      34.702  44.270  10.425  1.00 51.22           C  
ATOM   1119  CG  ASN A 159      33.805  43.106  10.784  1.00 55.05           C  
ATOM   1120  OD1 ASN A 159      34.214  42.182  11.500  1.00 54.52           O  
ATOM   1121  ND2 ASN A 159      32.575  43.135  10.278  1.00 53.89           N  
ATOM   1122  N   GLU A 160      35.998  47.106  11.062  1.00 44.95           N  
ATOM   1123  CA  GLU A 160      36.892  48.179  10.642  1.00 46.80           C  
ATOM   1124  C   GLU A 160      37.999  48.384  11.710  1.00 45.39           C  
ATOM   1125  O   GLU A 160      39.182  48.530  11.385  1.00 45.27           O  
ATOM   1126  CB  GLU A 160      36.091  49.470  10.446  1.00 46.17           C  
ATOM   1127  CG  GLU A 160      36.914  50.600   9.880  1.00 50.19           C  
ATOM   1128  CD  GLU A 160      36.196  51.931   9.938  1.00 55.80           C  
ATOM   1129  OE1 GLU A 160      36.646  52.874   9.247  1.00 59.01           O  
ATOM   1130  OE2 GLU A 160      35.188  52.045  10.675  1.00 59.21           O  
ATOM   1131  N   ARG A 161      37.605  48.393  12.982  1.00 45.38           N  
ATOM   1132  CA  ARG A 161      38.568  48.558  14.066  1.00 47.50           C  
ATOM   1133  C   ARG A 161      39.539  47.374  14.072  1.00 46.48           C  
ATOM   1134  O   ARG A 161      40.728  47.540  14.334  1.00 44.85           O  
ATOM   1135  CB  ARG A 161      37.861  48.642  15.428  1.00 43.17           C  
ATOM   1136  CG  ARG A 161      36.962  49.839  15.614  1.00 46.64           C  
ATOM   1137  CD  ARG A 161      36.358  49.833  17.017  1.00 45.67           C  
ATOM   1138  NE  ARG A 161      37.419  50.040  17.988  1.00 43.83           N  
ATOM   1139  CZ  ARG A 161      37.821  51.233  18.397  1.00 41.83           C  
ATOM   1140  NH1 ARG A 161      37.228  52.334  17.943  1.00 39.73           N  
ATOM   1141  NH2 ARG A 161      38.867  51.326  19.197  1.00 39.96           N  
ATOM   1142  N   LEU A 162      39.031  46.182  13.782  1.00 45.08           N  
ATOM   1143  CA  LEU A 162      39.886  45.006  13.777  1.00 46.38           C  
ATOM   1144  C   LEU A 162      40.855  45.133  12.621  1.00 47.59           C  
ATOM   1145  O   LEU A 162      42.050  44.840  12.750  1.00 49.48           O  
ATOM   1146  CB  LEU A 162      39.060  43.724  13.622  1.00 47.74           C  
ATOM   1147  CG  LEU A 162      39.902  42.462  13.419  1.00 52.10           C  
ATOM   1148  CD1 LEU A 162      40.755  42.262  14.656  1.00 51.13           C  
ATOM   1149  CD2 LEU A 162      39.013  41.234  13.182  1.00 50.62           C  
ATOM   1150  N   TRP A 163      40.342  45.561  11.475  1.00 46.39           N  
ATOM   1151  CA  TRP A 163      41.203  45.726  10.321  1.00 44.60           C  
ATOM   1152  C   TRP A 163      42.374  46.662  10.626  1.00 42.26           C  
ATOM   1153  O   TRP A 163      43.516  46.366  10.304  1.00 43.44           O  
ATOM   1154  CB  TRP A 163      40.430  46.301   9.138  1.00 44.79           C  
ATOM   1155  CG  TRP A 163      41.399  46.758   8.090  1.00 43.39           C  
ATOM   1156  CD1 TRP A 163      42.199  45.965   7.312  1.00 43.76           C  
ATOM   1157  CD2 TRP A 163      41.776  48.108   7.808  1.00 42.53           C  
ATOM   1158  NE1 TRP A 163      43.056  46.742   6.571  1.00 46.24           N  
ATOM   1159  CE2 TRP A 163      42.813  48.063   6.856  1.00 44.33           C  
ATOM   1160  CE3 TRP A 163      41.340  49.352   8.273  1.00 44.69           C  
ATOM   1161  CZ2 TRP A 163      43.425  49.221   6.354  1.00 46.89           C  
ATOM   1162  CZ3 TRP A 163      41.949  50.503   7.774  1.00 50.35           C  
ATOM   1163  CH2 TRP A 163      42.979  50.427   6.824  1.00 46.03           C  
ATOM   1164  N   ALA A 164      42.076  47.813  11.219  1.00 43.19           N  
ATOM   1165  CA  ALA A 164      43.112  48.793  11.553  1.00 41.14           C  
ATOM   1166  C   ALA A 164      44.110  48.278  12.629  1.00 40.66           C  
ATOM   1167  O   ALA A 164      45.330  48.439  12.492  1.00 43.60           O  
ATOM   1168  CB  ALA A 164      42.443  50.117  12.005  1.00 34.14           C  
ATOM   1169  N   TRP A 165      43.594  47.666  13.687  1.00 41.38           N  
ATOM   1170  CA  TRP A 165      44.431  47.125  14.776  1.00 42.42           C  
ATOM   1171  C   TRP A 165      45.448  46.108  14.257  1.00 40.94           C  
ATOM   1172  O   TRP A 165      46.645  46.282  14.454  1.00 42.04           O  
ATOM   1173  CB  TRP A 165      43.541  46.461  15.836  1.00 38.76           C  
ATOM   1174  CG  TRP A 165      44.232  46.029  17.094  1.00 40.46           C  
ATOM   1175  CD1 TRP A 165      44.401  46.767  18.239  1.00 42.42           C  
ATOM   1176  CD2 TRP A 165      44.835  44.750  17.350  1.00 39.98           C  
ATOM   1177  NE1 TRP A 165      45.072  46.020  19.189  1.00 41.98           N  
ATOM   1178  CE2 TRP A 165      45.350  44.783  18.667  1.00 40.30           C  
ATOM   1179  CE3 TRP A 165      44.989  43.582  16.594  1.00 41.21           C  
ATOM   1180  CZ2 TRP A 165      46.009  43.700  19.238  1.00 42.24           C  
ATOM   1181  CZ3 TRP A 165      45.648  42.500  17.163  1.00 43.25           C  
ATOM   1182  CH2 TRP A 165      46.151  42.568  18.472  1.00 41.47           C  
ATOM   1183  N   GLU A 166      44.960  45.058  13.593  1.00 43.18           N  
ATOM   1184  CA  GLU A 166      45.790  43.980  13.027  1.00 41.02           C  
ATOM   1185  C   GLU A 166      46.730  44.422  11.912  1.00 42.69           C  
ATOM   1186  O   GLU A 166      47.885  43.960  11.834  1.00 40.80           O  
ATOM   1187  CB  GLU A 166      44.879  42.858  12.493  1.00 48.28           C  
ATOM   1188  CG  GLU A 166      45.585  41.758  11.689  1.00 47.82           C  
ATOM   1189  CD  GLU A 166      46.605  40.961  12.520  1.00 51.63           C  
ATOM   1190  OE1 GLU A 166      46.531  40.990  13.761  1.00 51.75           O  
ATOM   1191  OE2 GLU A 166      47.473  40.291  11.933  1.00 49.59           O  
ATOM   1192  N   SER A 167      46.240  45.296  11.032  1.00 39.17           N  
ATOM   1193  CA  SER A 167      47.066  45.792   9.922  1.00 43.57           C  
ATOM   1194  C   SER A 167      48.268  46.606  10.436  1.00 44.55           C  
ATOM   1195  O   SER A 167      49.383  46.487   9.915  1.00 45.67           O  
ATOM   1196  CB  SER A 167      46.227  46.670   8.976  1.00 45.98           C  
ATOM   1197  OG  SER A 167      45.161  45.929   8.414  1.00 54.83           O  
ATOM   1198  N   TRP A 168      48.031  47.448  11.440  1.00 41.00           N  
ATOM   1199  CA  TRP A 168      49.106  48.254  12.011  1.00 41.59           C  
ATOM   1200  C   TRP A 168      50.162  47.288  12.514  1.00 37.14           C  
ATOM   1201  O   TRP A 168      51.320  47.412  12.188  1.00 38.57           O  
ATOM   1202  CB  TRP A 168      48.588  49.101  13.190  1.00 41.19           C  
ATOM   1203  CG  TRP A 168      49.642  49.985  13.786  1.00 43.26           C  
ATOM   1204  CD1 TRP A 168      50.037  50.032  15.097  1.00 43.27           C  
ATOM   1205  CD2 TRP A 168      50.453  50.937  13.091  1.00 42.65           C  
ATOM   1206  NE1 TRP A 168      51.047  50.955  15.255  1.00 42.03           N  
ATOM   1207  CE2 TRP A 168      51.320  51.524  14.039  1.00 45.32           C  
ATOM   1208  CE3 TRP A 168      50.531  51.350  11.760  1.00 42.15           C  
ATOM   1209  CZ2 TRP A 168      52.252  52.504  13.693  1.00 43.42           C  
ATOM   1210  CZ3 TRP A 168      51.459  52.326  11.414  1.00 41.19           C  
ATOM   1211  CH2 TRP A 168      52.305  52.890  12.378  1.00 45.58           C  
ATOM   1212  N   ARG A 169      49.750  46.293  13.291  1.00 39.14           N  
ATOM   1213  CA  ARG A 169      50.720  45.340  13.821  1.00 39.66           C  
ATOM   1214  C   ARG A 169      51.285  44.404  12.774  1.00 39.78           C  
ATOM   1215  O   ARG A 169      52.429  43.996  12.845  1.00 39.24           O  
ATOM   1216  CB  ARG A 169      50.082  44.556  14.973  1.00 40.33           C  
ATOM   1217  CG  ARG A 169      49.820  45.451  16.184  1.00 38.98           C  
ATOM   1218  CD  ARG A 169      48.823  44.861  17.143  1.00 38.74           C  
ATOM   1219  NE  ARG A 169      48.739  45.678  18.352  1.00 41.41           N  
ATOM   1220  CZ  ARG A 169      48.106  46.844  18.422  1.00 40.74           C  
ATOM   1221  NH1 ARG A 169      48.087  47.534  19.560  1.00 34.90           N  
ATOM   1222  NH2 ARG A 169      47.469  47.312  17.360  1.00 36.83           N  
ATOM   1223  N   SER A 170      50.487  44.070  11.774  1.00 47.88           N  
ATOM   1224  CA  SER A 170      50.977  43.165  10.758  1.00 49.75           C  
ATOM   1225  C   SER A 170      51.920  43.817   9.769  1.00 49.84           C  
ATOM   1226  O   SER A 170      52.935  43.232   9.423  1.00 50.53           O  
ATOM   1227  CB  SER A 170      49.818  42.516  10.019  1.00 52.41           C  
ATOM   1228  OG  SER A 170      50.309  41.356   9.388  1.00 63.67           O  
ATOM   1229  N   GLU A 171      51.610  45.027   9.314  1.00 51.82           N  
ATOM   1230  CA  GLU A 171      52.497  45.684   8.359  1.00 53.53           C  
ATOM   1231  C   GLU A 171      53.696  46.410   8.958  1.00 52.48           C  
ATOM   1232  O   GLU A 171      54.801  46.286   8.449  1.00 55.00           O  
ATOM   1233  CB  GLU A 171      51.733  46.676   7.487  1.00 62.67           C  
ATOM   1234  CG  GLU A 171      51.307  46.116   6.158  1.00 71.80           C  
ATOM   1235  CD  GLU A 171      50.239  45.077   6.310  1.00 76.92           C  
ATOM   1236  OE1 GLU A 171      49.120  45.453   6.720  1.00 81.42           O  
ATOM   1237  OE2 GLU A 171      50.516  43.890   6.033  1.00 80.59           O  
ATOM   1238  N   VAL A 172      53.513  47.185  10.017  1.00 48.52           N  
ATOM   1239  CA  VAL A 172      54.675  47.874  10.539  1.00 49.14           C  
ATOM   1240  C   VAL A 172      55.287  47.155  11.719  1.00 45.48           C  
ATOM   1241  O   VAL A 172      56.498  47.041  11.807  1.00 49.15           O  
ATOM   1242  CB  VAL A 172      54.354  49.362  10.907  1.00 52.33           C  
ATOM   1243  CG1 VAL A 172      53.603  50.023   9.769  1.00 54.23           C  
ATOM   1244  CG2 VAL A 172      53.538  49.432  12.165  1.00 59.04           C  
ATOM   1245  N   GLY A 173      54.463  46.651  12.624  1.00 46.08           N  
ATOM   1246  CA  GLY A 173      55.012  45.957  13.779  1.00 45.13           C  
ATOM   1247  C   GLY A 173      56.027  44.904  13.393  1.00 45.13           C  
ATOM   1248  O   GLY A 173      57.110  44.809  13.974  1.00 47.80           O  
ATOM   1249  N   LYS A 174      55.688  44.103  12.390  1.00 45.82           N  
ATOM   1250  CA  LYS A 174      56.595  43.057  11.940  1.00 45.72           C  
ATOM   1251  C   LYS A 174      57.905  43.590  11.388  1.00 44.65           C  
ATOM   1252  O   LYS A 174      58.913  42.907  11.435  1.00 45.00           O  
ATOM   1253  CB  LYS A 174      55.916  42.176  10.889  1.00 47.18           C  
ATOM   1254  CG  LYS A 174      54.796  41.319  11.448  1.00 46.49           C  
ATOM   1255  CD  LYS A 174      54.339  40.368  10.381  1.00 47.83           C  
ATOM   1256  CE  LYS A 174      53.157  39.553  10.830  1.00 50.32           C  
ATOM   1257  NZ  LYS A 174      52.868  38.490   9.822  1.00 57.21           N  
ATOM   1258  N   GLN A 175      57.896  44.801  10.841  1.00 44.99           N  
ATOM   1259  CA  GLN A 175      59.132  45.369  10.321  1.00 42.52           C  
ATOM   1260  C   GLN A 175      60.029  45.665  11.510  1.00 41.26           C  
ATOM   1261  O   GLN A 175      61.245  45.626  11.418  1.00 41.57           O  
ATOM   1262  CB  GLN A 175      58.862  46.674   9.589  1.00 43.68           C  
ATOM   1263  CG  GLN A 175      58.026  46.533   8.332  1.00 44.74           C  
ATOM   1264  CD  GLN A 175      57.987  47.821   7.565  1.00 45.51           C  
ATOM   1265  OE1 GLN A 175      59.037  48.390   7.244  1.00 50.56           O  
ATOM   1266  NE2 GLN A 175      56.786  48.308   7.272  1.00 44.92           N  
ATOM   1267  N   LEU A 176      59.397  45.965  12.630  1.00 43.48           N  
ATOM   1268  CA  LEU A 176      60.100  46.306  13.839  1.00 46.07           C  
ATOM   1269  C   LEU A 176      60.691  45.116  14.578  1.00 47.47           C  
ATOM   1270  O   LEU A 176      61.661  45.269  15.306  1.00 46.87           O  
ATOM   1271  CB  LEU A 176      59.148  47.044  14.767  1.00 46.25           C  
ATOM   1272  CG  LEU A 176      59.164  48.572  14.800  1.00 51.99           C  
ATOM   1273  CD1 LEU A 176      59.959  49.131  13.665  1.00 49.23           C  
ATOM   1274  CD2 LEU A 176      57.742  49.072  14.778  1.00 48.87           C  
ATOM   1275  N   ARG A 177      60.105  43.937  14.400  1.00 48.05           N  
ATOM   1276  CA  ARG A 177      60.570  42.763  15.127  1.00 49.20           C  
ATOM   1277  C   ARG A 177      62.074  42.538  15.036  1.00 50.27           C  
ATOM   1278  O   ARG A 177      62.758  42.472  16.058  1.00 48.80           O  
ATOM   1279  CB  ARG A 177      59.797  41.517  14.675  1.00 49.21           C  
ATOM   1280  CG  ARG A 177      60.177  40.243  15.413  1.00 50.17           C  
ATOM   1281  CD  ARG A 177      59.940  40.333  16.918  1.00 51.21           C  
ATOM   1282  NE  ARG A 177      60.655  39.266  17.627  1.00 49.26           N  
ATOM   1283  CZ  ARG A 177      60.067  38.324  18.362  1.00 49.89           C  
ATOM   1284  NH1 ARG A 177      60.798  37.395  18.975  1.00 48.75           N  
ATOM   1285  NH2 ARG A 177      58.749  38.316  18.495  1.00 40.95           N  
ATOM   1286  N   PRO A 178      62.615  42.439  13.811  1.00 50.34           N  
ATOM   1287  CA  PRO A 178      64.046  42.226  13.584  1.00 49.93           C  
ATOM   1288  C   PRO A 178      64.894  43.305  14.258  1.00 50.49           C  
ATOM   1289  O   PRO A 178      65.881  43.013  14.931  1.00 47.70           O  
ATOM   1290  CB  PRO A 178      64.169  42.312  12.066  1.00 48.29           C  
ATOM   1291  CG  PRO A 178      62.847  41.944  11.595  1.00 47.50           C  
ATOM   1292  CD  PRO A 178      61.920  42.619  12.532  1.00 46.19           C  
ATOM   1293  N   LEU A 179      64.508  44.556  14.034  1.00 48.29           N  
ATOM   1294  CA  LEU A 179      65.226  45.686  14.591  1.00 48.69           C  
ATOM   1295  C   LEU A 179      65.206  45.697  16.116  1.00 46.59           C  
ATOM   1296  O   LEU A 179      66.226  45.952  16.756  1.00 45.44           O  
ATOM   1297  CB  LEU A 179      64.629  46.997  14.057  1.00 47.07           C  
ATOM   1298  CG  LEU A 179      64.696  47.083  12.527  1.00 47.67           C  
ATOM   1299  CD1 LEU A 179      63.813  48.207  11.986  1.00 42.75           C  
ATOM   1300  CD2 LEU A 179      66.135  47.276  12.125  1.00 45.13           C  
ATOM   1301  N   TYR A 180      64.049  45.429  16.697  1.00 45.46           N  
ATOM   1302  CA  TYR A 180      63.924  45.442  18.149  1.00 47.65           C  
ATOM   1303  C   TYR A 180      64.829  44.431  18.849  1.00 46.70           C  
ATOM   1304  O   TYR A 180      65.391  44.735  19.889  1.00 43.21           O  
ATOM   1305  CB  TYR A 180      62.472  45.199  18.576  1.00 45.88           C  
ATOM   1306  CG  TYR A 180      62.184  45.783  19.938  1.00 42.70           C  
ATOM   1307  CD1 TYR A 180      62.187  47.155  20.126  1.00 40.60           C  
ATOM   1308  CD2 TYR A 180      61.987  44.969  21.043  1.00 42.08           C  
ATOM   1309  CE1 TYR A 180      62.002  47.709  21.377  1.00 42.13           C  
ATOM   1310  CE2 TYR A 180      61.810  45.510  22.313  1.00 41.56           C  
ATOM   1311  CZ  TYR A 180      61.816  46.879  22.475  1.00 45.54           C  
ATOM   1312  OH  TYR A 180      61.652  47.427  23.731  1.00 43.27           O  
ATOM   1313  N   GLU A 181      64.968  43.237  18.278  1.00 48.99           N  
ATOM   1314  CA  GLU A 181      65.812  42.198  18.875  1.00 50.96           C  
ATOM   1315  C   GLU A 181      67.261  42.653  18.897  1.00 51.19           C  
ATOM   1316  O   GLU A 181      67.936  42.568  19.922  1.00 51.56           O  
ATOM   1317  CB  GLU A 181      65.691  40.876  18.098  1.00 50.22           C  
ATOM   1318  CG  GLU A 181      64.314  40.235  18.206  1.00 49.31           C  
ATOM   1319  CD  GLU A 181      64.146  39.021  17.309  1.00 52.43           C  
ATOM   1320  OE1 GLU A 181      65.099  38.679  16.578  1.00 52.95           O  
ATOM   1321  OE2 GLU A 181      63.053  38.408  17.334  1.00 52.31           O  
ATOM   1322  N   GLU A 182      67.744  43.143  17.765  1.00 49.95           N  
ATOM   1323  CA  GLU A 182      69.112  43.620  17.715  1.00 52.23           C  
ATOM   1324  C   GLU A 182      69.250  44.762  18.732  1.00 50.24           C  
ATOM   1325  O   GLU A 182      70.236  44.839  19.455  1.00 53.90           O  
ATOM   1326  CB  GLU A 182      69.447  44.091  16.302  1.00 54.63           C  
ATOM   1327  CG  GLU A 182      70.932  44.241  16.042  1.00 60.95           C  
ATOM   1328  CD  GLU A 182      71.223  44.630  14.609  1.00 66.62           C  
ATOM   1329  OE1 GLU A 182      72.383  44.996  14.318  1.00 68.79           O  
ATOM   1330  OE2 GLU A 182      70.292  44.563  13.775  1.00 69.82           O  
ATOM   1331  N   TYR A 183      68.238  45.623  18.808  1.00 48.18           N  
ATOM   1332  CA  TYR A 183      68.228  46.743  19.746  1.00 46.19           C  
ATOM   1333  C   TYR A 183      68.389  46.382  21.228  1.00 47.08           C  
ATOM   1334  O   TYR A 183      69.136  47.039  21.928  1.00 47.19           O  
ATOM   1335  CB  TYR A 183      66.959  47.566  19.534  1.00 42.72           C  
ATOM   1336  CG  TYR A 183      66.448  48.355  20.730  1.00 39.06           C  
ATOM   1337  CD1 TYR A 183      65.630  47.747  21.701  1.00 35.14           C  
ATOM   1338  CD2 TYR A 183      66.708  49.713  20.854  1.00 36.02           C  
ATOM   1339  CE1 TYR A 183      65.095  48.469  22.740  1.00 33.74           C  
ATOM   1340  CE2 TYR A 183      66.159  50.462  21.913  1.00 35.18           C  
ATOM   1341  CZ  TYR A 183      65.361  49.842  22.845  1.00 36.10           C  
ATOM   1342  OH  TYR A 183      64.807  50.577  23.891  1.00 36.22           O  
ATOM   1343  N   VAL A 184      67.696  45.360  21.722  1.00 47.63           N  
ATOM   1344  CA  VAL A 184      67.861  45.016  23.128  1.00 50.68           C  
ATOM   1345  C   VAL A 184      69.285  44.524  23.383  1.00 50.01           C  
ATOM   1346  O   VAL A 184      69.879  44.856  24.413  1.00 51.49           O  
ATOM   1347  CB  VAL A 184      66.840  43.924  23.613  1.00 52.85           C  
ATOM   1348  CG1 VAL A 184      65.418  44.417  23.456  1.00 53.77           C  
ATOM   1349  CG2 VAL A 184      67.027  42.686  22.865  1.00 49.45           C  
ATOM   1350  N   VAL A 185      69.825  43.741  22.445  1.00 51.26           N  
ATOM   1351  CA  VAL A 185      71.194  43.216  22.546  1.00 51.53           C  
ATOM   1352  C   VAL A 185      72.160  44.375  22.748  1.00 51.24           C  
ATOM   1353  O   VAL A 185      72.876  44.449  23.747  1.00 51.43           O  
ATOM   1354  CB  VAL A 185      71.621  42.449  21.253  1.00 51.05           C  
ATOM   1355  CG1 VAL A 185      73.092  42.144  21.290  1.00 47.16           C  
ATOM   1356  CG2 VAL A 185      70.860  41.135  21.132  1.00 51.22           C  
ATOM   1357  N   LEU A 186      72.150  45.294  21.794  1.00 49.24           N  
ATOM   1358  CA  LEU A 186      73.015  46.456  21.842  1.00 48.85           C  
ATOM   1359  C   LEU A 186      72.807  47.309  23.075  1.00 46.69           C  
ATOM   1360  O   LEU A 186      73.759  47.852  23.624  1.00 49.59           O  
ATOM   1361  CB  LEU A 186      72.801  47.317  20.590  1.00 51.63           C  
ATOM   1362  CG  LEU A 186      73.811  47.193  19.450  1.00 53.91           C  
ATOM   1363  CD1 LEU A 186      74.645  45.933  19.599  1.00 55.35           C  
ATOM   1364  CD2 LEU A 186      73.060  47.201  18.134  1.00 55.66           C  
ATOM   1365  N   LYS A 187      71.563  47.436  23.505  1.00 46.79           N  
ATOM   1366  CA  LYS A 187      71.231  48.253  24.668  1.00 46.69           C  
ATOM   1367  C   LYS A 187      71.675  47.600  25.979  1.00 48.89           C  
ATOM   1368  O   LYS A 187      72.143  48.283  26.900  1.00 42.27           O  
ATOM   1369  CB  LYS A 187      69.723  48.511  24.698  1.00 49.23           C  
ATOM   1370  CG  LYS A 187      69.315  49.987  24.813  1.00 53.66           C  
ATOM   1371  CD  LYS A 187      69.958  50.841  23.750  1.00 49.14           C  
ATOM   1372  CE  LYS A 187      69.111  52.081  23.379  1.00 53.28           C  
ATOM   1373  NZ  LYS A 187      69.237  53.303  24.236  1.00 45.11           N  
ATOM   1374  N   ASN A 188      71.509  46.282  26.070  1.00 48.85           N  
ATOM   1375  CA  ASN A 188      71.917  45.574  27.273  1.00 52.86           C  
ATOM   1376  C   ASN A 188      73.428  45.635  27.364  1.00 55.23           C  
ATOM   1377  O   ASN A 188      73.999  45.648  28.456  1.00 57.31           O  
ATOM   1378  CB  ASN A 188      71.470  44.114  27.251  1.00 47.26           C  
ATOM   1379  CG  ASN A 188      70.122  43.913  27.904  1.00 51.39           C  
ATOM   1380  OD1 ASN A 188      69.720  44.687  28.788  1.00 46.38           O  
ATOM   1381  ND2 ASN A 188      69.423  42.852  27.503  1.00 50.97           N  
ATOM   1382  N   GLU A 189      74.071  45.687  26.206  1.00 56.30           N  
ATOM   1383  CA  GLU A 189      75.522  45.758  26.155  1.00 58.89           C  
ATOM   1384  C   GLU A 189      75.958  47.121  26.678  1.00 58.57           C  
ATOM   1385  O   GLU A 189      76.869  47.218  27.478  1.00 58.60           O  
ATOM   1386  CB  GLU A 189      75.987  45.564  24.717  1.00 63.65           C  
ATOM   1387  CG  GLU A 189      77.434  45.189  24.577  1.00 69.67           C  
ATOM   1388  CD  GLU A 189      77.728  44.605  23.216  1.00 75.35           C  
ATOM   1389  OE1 GLU A 189      76.939  43.735  22.771  1.00 74.94           O  
ATOM   1390  OE2 GLU A 189      78.746  45.004  22.601  1.00 78.22           O  
ATOM   1391  N   MET A 190      75.298  48.181  26.224  1.00 58.29           N  
ATOM   1392  CA  MET A 190      75.639  49.510  26.689  1.00 56.08           C  
ATOM   1393  C   MET A 190      75.494  49.500  28.196  1.00 55.02           C  
ATOM   1394  O   MET A 190      76.423  49.861  28.920  1.00 57.97           O  
ATOM   1395  CB  MET A 190      74.705  50.564  26.064  1.00 58.79           C  
ATOM   1396  CG  MET A 190      74.754  51.960  26.705  1.00 54.15           C  
ATOM   1397  SD  MET A 190      73.334  52.305  27.803  1.00 67.15           S  
ATOM   1398  CE  MET A 190      74.050  52.282  29.393  1.00 59.79           C  
ATOM   1399  N   ALA A 191      74.335  49.054  28.662  1.00 51.03           N  
ATOM   1400  CA  ALA A 191      74.033  49.014  30.085  1.00 51.89           C  
ATOM   1401  C   ALA A 191      75.044  48.228  30.956  1.00 54.43           C  
ATOM   1402  O   ALA A 191      75.486  48.718  31.997  1.00 52.65           O  
ATOM   1403  CB  ALA A 191      72.632  48.470  30.283  1.00 47.04           C  
ATOM   1404  N   ARG A 192      75.402  47.018  30.539  1.00 56.23           N  
ATOM   1405  CA  ARG A 192      76.350  46.205  31.298  1.00 58.28           C  
ATOM   1406  C   ARG A 192      77.698  46.916  31.418  1.00 58.56           C  
ATOM   1407  O   ARG A 192      78.259  47.025  32.511  1.00 58.94           O  
ATOM   1408  CB  ARG A 192      76.548  44.839  30.631  1.00 56.21           C  
ATOM   1409  CG  ARG A 192      75.368  43.888  30.766  1.00 55.16           C  
ATOM   1410  CD  ARG A 192      75.800  42.463  30.474  1.00 52.73           C  
ATOM   1411  NE  ARG A 192      76.299  42.297  29.110  1.00 55.56           N  
ATOM   1412  CZ  ARG A 192      75.518  42.116  28.045  1.00 57.36           C  
ATOM   1413  NH1 ARG A 192      76.052  41.975  26.841  1.00 57.55           N  
ATOM   1414  NH2 ARG A 192      74.200  42.069  28.185  1.00 56.33           N  
ATOM   1415  N   ALA A 193      78.198  47.416  30.293  1.00 57.75           N  
ATOM   1416  CA  ALA A 193      79.475  48.109  30.264  1.00 57.66           C  
ATOM   1417  C   ALA A 193      79.443  49.378  31.091  1.00 60.45           C  
ATOM   1418  O   ALA A 193      80.488  49.939  31.408  1.00 63.35           O  
ATOM   1419  CB  ALA A 193      79.850  48.428  28.850  1.00 56.66           C  
ATOM   1420  N   ASN A 194      78.239  49.829  31.428  1.00 62.12           N  
ATOM   1421  CA  ASN A 194      78.037  51.034  32.234  1.00 60.49           C  
ATOM   1422  C   ASN A 194      77.802  50.632  33.683  1.00 59.42           C  
ATOM   1423  O   ASN A 194      77.399  51.451  34.513  1.00 58.58           O  
ATOM   1424  CB  ASN A 194      76.832  51.819  31.715  1.00 63.68           C  
ATOM   1425  CG  ASN A 194      77.203  52.797  30.625  1.00 65.73           C  
ATOM   1426  OD1 ASN A 194      77.762  53.861  30.898  1.00 69.53           O  
ATOM   1427  ND2 ASN A 194      76.908  52.442  29.380  1.00 64.47           N  
ATOM   1428  N   HIS A 195      78.030  49.352  33.958  1.00 59.05           N  
ATOM   1429  CA  HIS A 195      77.898  48.787  35.292  1.00 60.18           C  
ATOM   1430  C   HIS A 195      76.474  48.579  35.812  1.00 59.91           C  
ATOM   1431  O   HIS A 195      76.185  48.765  37.002  1.00 62.07           O  
ATOM   1432  CB  HIS A 195      78.748  49.621  36.274  1.00 61.18           C  
ATOM   1433  CG  HIS A 195      80.152  49.831  35.794  1.00 63.80           C  
ATOM   1434  ND1 HIS A 195      80.657  51.080  35.491  1.00 63.65           N  
ATOM   1435  CD2 HIS A 195      81.098  48.939  35.408  1.00 63.46           C  
ATOM   1436  CE1 HIS A 195      81.845  50.947  34.926  1.00 64.42           C  
ATOM   1437  NE2 HIS A 195      82.134  49.658  34.862  1.00 65.27           N  
ATOM   1438  N   TYR A 196      75.587  48.185  34.905  1.00 56.74           N  
ATOM   1439  CA  TYR A 196      74.205  47.884  35.247  1.00 53.70           C  
ATOM   1440  C   TYR A 196      73.971  46.459  34.756  1.00 52.60           C  
ATOM   1441  O   TYR A 196      74.689  45.970  33.872  1.00 51.52           O  
ATOM   1442  CB  TYR A 196      73.236  48.834  34.523  1.00 55.65           C  
ATOM   1443  CG  TYR A 196      73.232  50.257  35.035  1.00 50.55           C  
ATOM   1444  CD1 TYR A 196      72.451  50.619  36.124  1.00 47.08           C  
ATOM   1445  CD2 TYR A 196      74.020  51.233  34.432  1.00 45.73           C  
ATOM   1446  CE1 TYR A 196      72.449  51.914  36.606  1.00 49.20           C  
ATOM   1447  CE2 TYR A 196      74.029  52.530  34.908  1.00 49.02           C  
ATOM   1448  CZ  TYR A 196      73.242  52.866  35.994  1.00 51.64           C  
ATOM   1449  OH  TYR A 196      73.254  54.155  36.466  1.00 52.63           O  
ATOM   1450  N   GLU A 197      72.966  45.796  35.316  1.00 55.15           N  
ATOM   1451  CA  GLU A 197      72.622  44.422  34.920  1.00 56.28           C  
ATOM   1452  C   GLU A 197      72.093  44.338  33.488  1.00 56.25           C  
ATOM   1453  O   GLU A 197      72.490  43.468  32.706  1.00 56.79           O  
ATOM   1454  CB  GLU A 197      71.549  43.872  35.854  1.00 57.24           C  
ATOM   1455  CG  GLU A 197      71.939  43.847  37.308  1.00 59.62           C  
ATOM   1456  CD  GLU A 197      70.737  43.878  38.214  1.00 64.50           C  
ATOM   1457  OE1 GLU A 197      69.757  43.134  37.945  1.00 63.51           O  
ATOM   1458  OE2 GLU A 197      70.774  44.656  39.195  1.00 63.79           O  
ATOM   1459  N   ASP A 198      71.170  45.239  33.167  1.00 56.16           N  
ATOM   1460  CA  ASP A 198      70.545  45.287  31.850  1.00 56.53           C  
ATOM   1461  C   ASP A 198      69.943  46.672  31.603  1.00 54.91           C  
ATOM   1462  O   ASP A 198      69.847  47.499  32.517  1.00 51.77           O  
ATOM   1463  CB  ASP A 198      69.450  44.222  31.756  1.00 57.09           C  
ATOM   1464  CG  ASP A 198      68.508  44.257  32.940  1.00 62.79           C  
ATOM   1465  OD1 ASP A 198      68.521  43.290  33.737  1.00 62.81           O  
ATOM   1466  OD2 ASP A 198      67.757  45.256  33.086  1.00 64.77           O  
ATOM   1467  N   TYR A 199      69.513  46.909  30.370  1.00 53.75           N  
ATOM   1468  CA  TYR A 199      68.954  48.205  29.999  1.00 50.58           C  
ATOM   1469  C   TYR A 199      67.806  48.665  30.907  1.00 48.84           C  
ATOM   1470  O   TYR A 199      67.692  49.852  31.226  1.00 45.89           O  
ATOM   1471  CB  TYR A 199      68.520  48.171  28.535  1.00 48.33           C  
ATOM   1472  CG  TYR A 199      68.170  49.532  27.983  1.00 51.39           C  
ATOM   1473  CD1 TYR A 199      68.986  50.624  28.223  1.00 51.51           C  
ATOM   1474  CD2 TYR A 199      67.047  49.711  27.187  1.00 52.25           C  
ATOM   1475  CE1 TYR A 199      68.702  51.851  27.687  1.00 52.92           C  
ATOM   1476  CE2 TYR A 199      66.751  50.928  26.642  1.00 50.91           C  
ATOM   1477  CZ  TYR A 199      67.581  51.994  26.891  1.00 55.39           C  
ATOM   1478  OH  TYR A 199      67.315  53.196  26.312  1.00 53.79           O  
ATOM   1479  N   GLY A 200      66.974  47.727  31.346  1.00 46.40           N  
ATOM   1480  CA  GLY A 200      65.878  48.089  32.219  1.00 43.61           C  
ATOM   1481  C   GLY A 200      66.351  48.509  33.601  1.00 46.53           C  
ATOM   1482  O   GLY A 200      65.751  49.372  34.244  1.00 42.66           O  
ATOM   1483  N   ASP A 201      67.414  47.868  34.079  1.00 47.76           N  
ATOM   1484  CA  ASP A 201      67.990  48.194  35.381  1.00 46.70           C  
ATOM   1485  C   ASP A 201      68.525  49.636  35.249  1.00 44.03           C  
ATOM   1486  O   ASP A 201      68.412  50.456  36.153  1.00 39.61           O  
ATOM   1487  CB  ASP A 201      69.121  47.182  35.687  1.00 50.00           C  
ATOM   1488  CG  ASP A 201      69.871  47.486  36.979  1.00 51.37           C  
ATOM   1489  OD1 ASP A 201      69.234  47.745  38.025  1.00 54.90           O  
ATOM   1490  OD2 ASP A 201      71.118  47.455  36.945  1.00 61.26           O  
ATOM   1491  N   TYR A 202      69.104  49.918  34.090  1.00 46.21           N  
ATOM   1492  CA  TYR A 202      69.631  51.235  33.756  1.00 49.61           C  
ATOM   1493  C   TYR A 202      68.545  52.319  33.921  1.00 48.73           C  
ATOM   1494  O   TYR A 202      68.793  53.362  34.529  1.00 50.43           O  
ATOM   1495  CB  TYR A 202      70.134  51.197  32.309  1.00 53.12           C  
ATOM   1496  CG  TYR A 202      70.719  52.490  31.780  1.00 56.64           C  
ATOM   1497  CD1 TYR A 202      72.003  52.897  32.141  1.00 60.66           C  
ATOM   1498  CD2 TYR A 202      70.006  53.279  30.878  1.00 55.72           C  
ATOM   1499  CE1 TYR A 202      72.568  54.050  31.611  1.00 62.17           C  
ATOM   1500  CE2 TYR A 202      70.549  54.430  30.344  1.00 58.76           C  
ATOM   1501  CZ  TYR A 202      71.835  54.812  30.707  1.00 65.33           C  
ATOM   1502  OH  TYR A 202      72.405  55.929  30.132  1.00 68.51           O  
ATOM   1503  N   TRP A 203      67.342  52.067  33.395  1.00 44.93           N  
ATOM   1504  CA  TRP A 203      66.236  53.036  33.497  1.00 43.50           C  
ATOM   1505  C   TRP A 203      65.764  53.283  34.926  1.00 41.99           C  
ATOM   1506  O   TRP A 203      65.425  54.416  35.302  1.00 40.97           O  
ATOM   1507  CB  TRP A 203      65.009  52.573  32.671  1.00 42.70           C  
ATOM   1508  CG  TRP A 203      65.087  52.834  31.191  1.00 46.05           C  
ATOM   1509  CD1 TRP A 203      65.935  53.691  30.549  1.00 47.20           C  
ATOM   1510  CD2 TRP A 203      64.271  52.243  30.171  1.00 43.74           C  
ATOM   1511  NE1 TRP A 203      65.703  53.663  29.198  1.00 44.41           N  
ATOM   1512  CE2 TRP A 203      64.687  52.781  28.940  1.00 44.09           C  
ATOM   1513  CE3 TRP A 203      63.229  51.308  30.181  1.00 47.12           C  
ATOM   1514  CZ2 TRP A 203      64.097  52.416  27.725  1.00 45.38           C  
ATOM   1515  CZ3 TRP A 203      62.645  50.942  28.976  1.00 43.17           C  
ATOM   1516  CH2 TRP A 203      63.084  51.496  27.765  1.00 44.11           C  
ATOM   1517  N   ARG A 204      65.674  52.209  35.704  1.00 41.94           N  
ATOM   1518  CA  ARG A 204      65.233  52.319  37.082  1.00 43.68           C  
ATOM   1519  C   ARG A 204      66.275  53.150  37.844  1.00 44.56           C  
ATOM   1520  O   ARG A 204      66.039  53.615  38.956  1.00 45.28           O  
ATOM   1521  CB  ARG A 204      65.055  50.920  37.688  1.00 45.75           C  
ATOM   1522  CG  ARG A 204      63.981  50.081  36.993  1.00 43.67           C  
ATOM   1523  CD  ARG A 204      63.688  48.766  37.736  1.00 48.12           C  
ATOM   1524  NE  ARG A 204      64.795  47.800  37.711  1.00 41.66           N  
ATOM   1525  CZ  ARG A 204      64.968  46.878  36.766  1.00 48.35           C  
ATOM   1526  NH1 ARG A 204      64.112  46.793  35.757  1.00 53.00           N  
ATOM   1527  NH2 ARG A 204      65.977  46.014  36.840  1.00 48.25           N  
ATOM   1528  N   GLY A 205      67.421  53.350  37.207  1.00 47.17           N  
ATOM   1529  CA  GLY A 205      68.474  54.161  37.780  1.00 47.42           C  
ATOM   1530  C   GLY A 205      67.999  55.563  38.120  1.00 50.83           C  
ATOM   1531  O   GLY A 205      68.657  56.250  38.926  1.00 48.17           O  
ATOM   1532  N   ASP A 206      66.864  55.992  37.544  1.00 48.28           N  
ATOM   1533  CA  ASP A 206      66.327  57.348  37.814  1.00 47.90           C  
ATOM   1534  C   ASP A 206      65.756  57.521  39.209  1.00 48.03           C  
ATOM   1535  O   ASP A 206      65.651  58.647  39.690  1.00 47.01           O  
ATOM   1536  CB  ASP A 206      65.222  57.732  36.816  1.00 47.77           C  
ATOM   1537  CG  ASP A 206      64.732  59.177  36.992  1.00 48.16           C  
ATOM   1538  OD1 ASP A 206      63.699  59.403  37.666  1.00 44.01           O  
ATOM   1539  OD2 ASP A 206      65.393  60.101  36.456  1.00 49.42           O  
ATOM   1540  N   TYR A 207      65.363  56.415  39.845  1.00 47.43           N  
ATOM   1541  CA  TYR A 207      64.794  56.477  41.187  1.00 48.36           C  
ATOM   1542  C   TYR A 207      65.814  56.156  42.303  1.00 49.31           C  
ATOM   1543  O   TYR A 207      65.550  56.362  43.494  1.00 43.32           O  
ATOM   1544  CB  TYR A 207      63.617  55.516  41.298  1.00 48.85           C  
ATOM   1545  CG  TYR A 207      62.520  55.806  40.305  1.00 48.55           C  
ATOM   1546  CD1 TYR A 207      62.563  55.282  39.015  1.00 50.67           C  
ATOM   1547  CD2 TYR A 207      61.468  56.640  40.645  1.00 47.26           C  
ATOM   1548  CE1 TYR A 207      61.581  55.595  38.089  1.00 53.57           C  
ATOM   1549  CE2 TYR A 207      60.482  56.958  39.736  1.00 51.32           C  
ATOM   1550  CZ  TYR A 207      60.543  56.436  38.459  1.00 51.85           C  
ATOM   1551  OH  TYR A 207      59.558  56.772  37.559  1.00 55.41           O  
ATOM   1552  N   GLU A 208      66.979  55.671  41.906  1.00 48.39           N  
ATOM   1553  CA  GLU A 208      68.010  55.318  42.860  1.00 54.12           C  
ATOM   1554  C   GLU A 208      68.647  56.486  43.602  1.00 57.28           C  
ATOM   1555  O   GLU A 208      69.049  57.482  43.003  1.00 59.35           O  
ATOM   1556  CB  GLU A 208      69.108  54.516  42.170  1.00 50.96           C  
ATOM   1557  CG  GLU A 208      70.345  54.377  43.011  1.00 55.45           C  
ATOM   1558  CD  GLU A 208      71.339  53.393  42.444  1.00 59.42           C  
ATOM   1559  OE1 GLU A 208      71.609  53.434  41.216  1.00 61.40           O  
ATOM   1560  OE2 GLU A 208      71.869  52.580  43.234  1.00 65.33           O  
ATOM   1561  N   VAL A 209      68.720  56.364  44.919  1.00 58.16           N  
ATOM   1562  CA  VAL A 209      69.361  57.384  45.717  1.00 63.63           C  
ATOM   1563  C   VAL A 209      70.208  56.668  46.773  1.00 65.87           C  
ATOM   1564  O   VAL A 209      69.741  55.729  47.427  1.00 64.62           O  
ATOM   1565  CB  VAL A 209      68.328  58.333  46.355  1.00 64.32           C  
ATOM   1566  CG1 VAL A 209      66.938  57.805  46.119  1.00 63.53           C  
ATOM   1567  CG2 VAL A 209      68.627  58.529  47.840  1.00 60.57           C  
ATOM   1568  N   ASN A 210      71.465  57.096  46.903  1.00 66.94           N  
ATOM   1569  CA  ASN A 210      72.402  56.486  47.843  1.00 68.14           C  
ATOM   1570  C   ASN A 210      73.171  57.457  48.727  1.00 69.92           C  
ATOM   1571  O   ASN A 210      73.107  58.682  48.553  1.00 69.15           O  
ATOM   1572  CB  ASN A 210      73.401  55.632  47.078  1.00 67.77           C  
ATOM   1573  CG  ASN A 210      72.738  54.467  46.383  1.00 73.38           C  
ATOM   1574  OD1 ASN A 210      73.377  53.710  45.656  1.00 74.04           O  
ATOM   1575  ND2 ASN A 210      71.437  54.314  46.609  1.00 74.11           N  
ATOM   1576  N   GLY A 211      73.902  56.887  49.684  1.00 69.66           N  
ATOM   1577  CA  GLY A 211      74.703  57.687  50.597  1.00 68.95           C  
ATOM   1578  C   GLY A 211      73.921  58.705  51.400  1.00 68.33           C  
ATOM   1579  O   GLY A 211      74.446  59.754  51.769  1.00 70.66           O  
ATOM   1580  N   VAL A 212      72.658  58.407  51.665  1.00 68.63           N  
ATOM   1581  CA  VAL A 212      71.815  59.302  52.442  1.00 69.01           C  
ATOM   1582  C   VAL A 212      70.975  58.436  53.365  1.00 71.26           C  
ATOM   1583  O   VAL A 212      69.948  57.906  52.961  1.00 72.61           O  
ATOM   1584  CB  VAL A 212      70.881  60.128  51.542  1.00 67.03           C  
ATOM   1585  CG1 VAL A 212      70.019  61.046  52.395  1.00 66.46           C  
ATOM   1586  CG2 VAL A 212      71.698  60.933  50.546  1.00 66.74           C  
ATOM   1587  N   ASP A 213      71.424  58.295  54.607  1.00 73.31           N  
ATOM   1588  CA  ASP A 213      70.728  57.474  55.592  1.00 73.51           C  
ATOM   1589  C   ASP A 213      69.257  57.849  55.784  1.00 69.55           C  
ATOM   1590  O   ASP A 213      68.930  58.988  56.109  1.00 68.91           O  
ATOM   1591  CB  ASP A 213      71.463  57.557  56.936  1.00 78.93           C  
ATOM   1592  CG  ASP A 213      72.898  57.048  56.851  1.00 85.65           C  
ATOM   1593  OD1 ASP A 213      73.092  55.823  56.678  1.00 85.93           O  
ATOM   1594  OD2 ASP A 213      73.834  57.877  56.952  1.00 90.65           O  
ATOM   1595  N   GLY A 214      68.371  56.880  55.580  1.00 67.33           N  
ATOM   1596  CA  GLY A 214      66.955  57.138  55.764  1.00 66.22           C  
ATOM   1597  C   GLY A 214      66.159  57.520  54.523  1.00 65.06           C  
ATOM   1598  O   GLY A 214      64.938  57.646  54.587  1.00 65.12           O  
ATOM   1599  N   TYR A 215      66.831  57.711  53.396  1.00 60.50           N  
ATOM   1600  CA  TYR A 215      66.129  58.078  52.178  1.00 59.95           C  
ATOM   1601  C   TYR A 215      66.667  57.296  50.998  1.00 58.77           C  
ATOM   1602  O   TYR A 215      66.308  57.567  49.854  1.00 62.75           O  
ATOM   1603  CB  TYR A 215      66.271  59.576  51.918  1.00 54.21           C  
ATOM   1604  CG  TYR A 215      65.613  60.432  52.967  1.00 55.74           C  
ATOM   1605  CD1 TYR A 215      64.236  60.625  52.977  1.00 52.18           C  
ATOM   1606  CD2 TYR A 215      66.376  61.070  53.954  1.00 61.87           C  
ATOM   1607  CE1 TYR A 215      63.634  61.432  53.932  1.00 57.30           C  
ATOM   1608  CE2 TYR A 215      65.779  61.886  54.923  1.00 55.81           C  
ATOM   1609  CZ  TYR A 215      64.417  62.062  54.901  1.00 58.90           C  
ATOM   1610  OH  TYR A 215      63.839  62.894  55.823  1.00 61.04           O  
ATOM   1611  N   ASP A 216      67.536  56.329  51.271  1.00 55.66           N  
ATOM   1612  CA  ASP A 216      68.096  55.518  50.203  1.00 56.18           C  
ATOM   1613  C   ASP A 216      67.006  54.715  49.485  1.00 53.19           C  
ATOM   1614  O   ASP A 216      65.932  54.469  50.030  1.00 53.82           O  
ATOM   1615  CB  ASP A 216      69.188  54.593  50.740  1.00 55.40           C  
ATOM   1616  CG  ASP A 216      70.532  55.296  50.859  1.00 61.25           C  
ATOM   1617  OD1 ASP A 216      71.548  54.627  51.150  1.00 66.34           O  
ATOM   1618  OD2 ASP A 216      70.579  56.523  50.657  1.00 62.95           O  
ATOM   1619  N   TYR A 217      67.287  54.311  48.258  1.00 49.24           N  
ATOM   1620  CA  TYR A 217      66.300  53.595  47.485  1.00 47.58           C  
ATOM   1621  C   TYR A 217      66.999  52.815  46.404  1.00 43.49           C  
ATOM   1622  O   TYR A 217      67.775  53.356  45.627  1.00 47.10           O  
ATOM   1623  CB  TYR A 217      65.311  54.597  46.863  1.00 50.05           C  
ATOM   1624  CG  TYR A 217      64.059  53.955  46.303  1.00 47.08           C  
ATOM   1625  CD1 TYR A 217      62.936  53.772  47.088  1.00 47.16           C  
ATOM   1626  CD2 TYR A 217      64.027  53.490  45.001  1.00 47.37           C  
ATOM   1627  CE1 TYR A 217      61.812  53.139  46.589  1.00 49.55           C  
ATOM   1628  CE2 TYR A 217      62.913  52.852  44.497  1.00 50.36           C  
ATOM   1629  CZ  TYR A 217      61.810  52.676  45.290  1.00 49.17           C  
ATOM   1630  OH  TYR A 217      60.718  52.006  44.774  1.00 49.16           O  
ATOM   1631  N   SER A 218      66.702  51.532  46.349  1.00 45.62           N  
ATOM   1632  CA  SER A 218      67.313  50.630  45.381  1.00 49.02           C  
ATOM   1633  C   SER A 218      66.597  50.612  44.019  1.00 46.94           C  
ATOM   1634  O   SER A 218      65.428  50.978  43.918  1.00 47.75           O  
ATOM   1635  CB  SER A 218      67.325  49.211  45.971  1.00 45.81           C  
ATOM   1636  OG  SER A 218      67.780  48.266  45.013  1.00 57.50           O  
ATOM   1637  N   ARG A 219      67.303  50.157  42.988  1.00 47.42           N  
ATOM   1638  CA  ARG A 219      66.730  50.075  41.654  1.00 52.48           C  
ATOM   1639  C   ARG A 219      65.710  48.936  41.592  1.00 56.32           C  
ATOM   1640  O   ARG A 219      64.646  49.085  40.976  1.00 57.68           O  
ATOM   1641  CB  ARG A 219      67.828  49.856  40.604  1.00 47.25           C  
ATOM   1642  CG  ARG A 219      68.835  50.970  40.547  1.00 47.15           C  
ATOM   1643  CD  ARG A 219      69.564  51.007  39.224  1.00 49.48           C  
ATOM   1644  NE  ARG A 219      70.576  49.964  39.073  1.00 54.68           N  
ATOM   1645  CZ  ARG A 219      71.842  50.074  39.478  1.00 54.05           C  
ATOM   1646  NH1 ARG A 219      72.280  51.184  40.071  1.00 48.45           N  
ATOM   1647  NH2 ARG A 219      72.681  49.073  39.267  1.00 49.62           N  
ATOM   1648  N   GLY A 220      66.035  47.809  42.233  1.00 55.85           N  
ATOM   1649  CA  GLY A 220      65.134  46.660  42.264  1.00 50.97           C  
ATOM   1650  C   GLY A 220      63.941  46.946  43.151  1.00 49.91           C  
ATOM   1651  O   GLY A 220      62.867  46.355  43.008  1.00 50.99           O  
ATOM   1652  N   GLN A 221      64.132  47.872  44.078  1.00 48.05           N  
ATOM   1653  CA  GLN A 221      63.083  48.269  45.003  1.00 47.21           C  
ATOM   1654  C   GLN A 221      61.920  48.955  44.265  1.00 48.49           C  
ATOM   1655  O   GLN A 221      60.803  49.004  44.777  1.00 45.54           O  
ATOM   1656  CB  GLN A 221      63.677  49.214  46.049  1.00 49.38           C  
ATOM   1657  CG  GLN A 221      62.765  49.589  47.188  1.00 55.96           C  
ATOM   1658  CD  GLN A 221      63.499  50.349  48.283  1.00 67.46           C  
ATOM   1659  OE1 GLN A 221      64.680  50.089  48.565  1.00 70.40           O  
ATOM   1660  NE2 GLN A 221      62.800  51.281  48.922  1.00 71.25           N  
ATOM   1661  N   LEU A 222      62.192  49.508  43.077  1.00 50.06           N  
ATOM   1662  CA  LEU A 222      61.155  50.159  42.271  1.00 44.41           C  
ATOM   1663  C   LEU A 222      60.177  49.079  41.816  1.00 42.77           C  
ATOM   1664  O   LEU A 222      58.967  49.226  41.913  1.00 42.08           O  
ATOM   1665  CB  LEU A 222      61.757  50.825  41.024  1.00 46.44           C  
ATOM   1666  CG  LEU A 222      60.731  51.477  40.073  1.00 44.61           C  
ATOM   1667  CD1 LEU A 222      60.075  52.686  40.752  1.00 47.35           C  
ATOM   1668  CD2 LEU A 222      61.413  51.916  38.797  1.00 51.72           C  
ATOM   1669  N   ILE A 223      60.716  47.987  41.307  1.00 45.34           N  
ATOM   1670  CA  ILE A 223      59.879  46.900  40.839  1.00 49.01           C  
ATOM   1671  C   ILE A 223      58.922  46.395  41.899  1.00 51.39           C  
ATOM   1672  O   ILE A 223      57.779  46.083  41.582  1.00 57.98           O  
ATOM   1673  CB  ILE A 223      60.703  45.686  40.373  1.00 48.83           C  
ATOM   1674  CG1 ILE A 223      61.731  46.106  39.333  1.00 45.97           C  
ATOM   1675  CG2 ILE A 223      59.759  44.629  39.812  1.00 47.43           C  
ATOM   1676  CD1 ILE A 223      62.533  44.952  38.757  1.00 46.96           C  
ATOM   1677  N   GLU A 224      59.355  46.301  43.154  1.00 52.10           N  
ATOM   1678  CA  GLU A 224      58.439  45.787  44.172  1.00 53.43           C  
ATOM   1679  C   GLU A 224      57.455  46.818  44.714  1.00 50.70           C  
ATOM   1680  O   GLU A 224      56.345  46.466  45.115  1.00 47.99           O  
ATOM   1681  CB  GLU A 224      59.199  45.067  45.318  1.00 58.19           C  
ATOM   1682  CG  GLU A 224      60.139  45.894  46.178  1.00 65.71           C  
ATOM   1683  CD  GLU A 224      61.065  45.021  47.042  1.00 70.40           C  
ATOM   1684  OE1 GLU A 224      61.891  44.282  46.464  1.00 71.48           O  
ATOM   1685  OE2 GLU A 224      60.974  45.072  48.294  1.00 71.24           O  
ATOM   1686  N   ASP A 225      57.825  48.092  44.718  1.00 49.34           N  
ATOM   1687  CA  ASP A 225      56.874  49.089  45.194  1.00 47.61           C  
ATOM   1688  C   ASP A 225      55.784  49.288  44.144  1.00 46.96           C  
ATOM   1689  O   ASP A 225      54.644  49.615  44.473  1.00 43.62           O  
ATOM   1690  CB  ASP A 225      57.578  50.406  45.488  1.00 51.78           C  
ATOM   1691  CG  ASP A 225      58.555  50.277  46.632  1.00 57.96           C  
ATOM   1692  OD1 ASP A 225      58.215  49.582  47.617  1.00 60.88           O  
ATOM   1693  OD2 ASP A 225      59.646  50.863  46.558  1.00 60.99           O  
ATOM   1694  N   VAL A 226      56.147  49.083  42.879  1.00 45.20           N  
ATOM   1695  CA  VAL A 226      55.193  49.207  41.782  1.00 47.37           C  
ATOM   1696  C   VAL A 226      54.204  48.039  41.926  1.00 43.31           C  
ATOM   1697  O   VAL A 226      52.993  48.229  42.033  1.00 45.69           O  
ATOM   1698  CB  VAL A 226      55.934  49.169  40.377  1.00 44.11           C  
ATOM   1699  CG1 VAL A 226      54.950  48.901  39.259  1.00 44.92           C  
ATOM   1700  CG2 VAL A 226      56.620  50.515  40.109  1.00 45.69           C  
ATOM   1701  N   GLU A 227      54.727  46.827  41.971  1.00 48.17           N  
ATOM   1702  CA  GLU A 227      53.872  45.649  42.107  1.00 48.96           C  
ATOM   1703  C   GLU A 227      53.031  45.637  43.370  1.00 48.83           C  
ATOM   1704  O   GLU A 227      51.893  45.189  43.343  1.00 50.72           O  
ATOM   1705  CB  GLU A 227      54.727  44.399  42.029  1.00 50.84           C  
ATOM   1706  CG  GLU A 227      55.570  44.425  40.780  1.00 53.80           C  
ATOM   1707  CD  GLU A 227      56.320  43.150  40.540  1.00 59.10           C  
ATOM   1708  OE1 GLU A 227      56.853  42.588  41.525  1.00 61.80           O  
ATOM   1709  OE2 GLU A 227      56.395  42.730  39.357  1.00 55.85           O  
ATOM   1710  N   HIS A 228      53.572  46.148  44.472  1.00 48.24           N  
ATOM   1711  CA  HIS A 228      52.826  46.169  45.731  1.00 50.58           C  
ATOM   1712  C   HIS A 228      51.708  47.187  45.648  1.00 49.55           C  
ATOM   1713  O   HIS A 228      50.583  46.942  46.091  1.00 53.67           O  
ATOM   1714  CB  HIS A 228      53.760  46.491  46.922  1.00 50.99           C  
ATOM   1715  CG  HIS A 228      53.037  46.821  48.193  1.00 56.14           C  
ATOM   1716  ND1 HIS A 228      52.414  48.036  48.407  1.00 62.44           N  
ATOM   1717  CD2 HIS A 228      52.817  46.088  49.313  1.00 61.37           C  
ATOM   1718  CE1 HIS A 228      51.842  48.036  49.600  1.00 61.27           C  
ATOM   1719  NE2 HIS A 228      52.071  46.865  50.170  1.00 61.15           N  
ATOM   1720  N   THR A 229      52.010  48.342  45.087  1.00 47.14           N  
ATOM   1721  CA  THR A 229      50.988  49.368  44.953  1.00 46.95           C  
ATOM   1722  C   THR A 229      49.938  48.949  43.889  1.00 43.41           C  
ATOM   1723  O   THR A 229      48.755  49.258  44.001  1.00 42.40           O  
ATOM   1724  CB  THR A 229      51.640  50.714  44.569  1.00 48.14           C  
ATOM   1725  OG1 THR A 229      50.621  51.703  44.446  1.00 61.31           O  
ATOM   1726  CG2 THR A 229      52.403  50.598  43.244  1.00 35.15           C  
ATOM   1727  N   PHE A 230      50.371  48.223  42.868  1.00 44.54           N  
ATOM   1728  CA  PHE A 230      49.456  47.784  41.829  1.00 47.61           C  
ATOM   1729  C   PHE A 230      48.382  46.833  42.380  1.00 49.90           C  
ATOM   1730  O   PHE A 230      47.209  46.916  41.993  1.00 47.47           O  
ATOM   1731  CB  PHE A 230      50.230  47.116  40.696  1.00 48.01           C  
ATOM   1732  CG  PHE A 230      49.368  46.741  39.545  1.00 50.55           C  
ATOM   1733  CD1 PHE A 230      48.670  47.720  38.854  1.00 48.24           C  
ATOM   1734  CD2 PHE A 230      49.180  45.404  39.203  1.00 51.35           C  
ATOM   1735  CE1 PHE A 230      47.793  47.384  37.845  1.00 48.09           C  
ATOM   1736  CE2 PHE A 230      48.298  45.058  38.193  1.00 50.58           C  
ATOM   1737  CZ  PHE A 230      47.604  46.048  37.514  1.00 50.90           C  
ATOM   1738  N   GLU A 231      48.781  45.949  43.298  1.00 52.41           N  
ATOM   1739  CA  GLU A 231      47.851  45.004  43.932  1.00 52.36           C  
ATOM   1740  C   GLU A 231      46.677  45.724  44.560  1.00 49.53           C  
ATOM   1741  O   GLU A 231      45.536  45.291  44.435  1.00 50.81           O  
ATOM   1742  CB  GLU A 231      48.552  44.189  45.018  1.00 55.50           C  
ATOM   1743  CG  GLU A 231      49.387  43.035  44.501  1.00 65.99           C  
ATOM   1744  CD  GLU A 231      48.548  41.956  43.830  1.00 70.56           C  
ATOM   1745  OE1 GLU A 231      47.473  41.617  44.379  1.00 73.90           O  
ATOM   1746  OE2 GLU A 231      48.972  41.441  42.767  1.00 73.54           O  
ATOM   1747  N   GLU A 232      46.958  46.823  45.245  1.00 47.42           N  
ATOM   1748  CA  GLU A 232      45.901  47.605  45.879  1.00 49.60           C  
ATOM   1749  C   GLU A 232      44.978  48.298  44.884  1.00 47.92           C  
ATOM   1750  O   GLU A 232      43.883  48.712  45.239  1.00 50.81           O  
ATOM   1751  CB  GLU A 232      46.508  48.675  46.787  1.00 54.22           C  
ATOM   1752  CG  GLU A 232      46.870  48.196  48.179  1.00 64.26           C  
ATOM   1753  CD  GLU A 232      47.601  49.256  48.977  1.00 67.17           C  
ATOM   1754  OE1 GLU A 232      48.800  49.490  48.687  1.00 72.80           O  
ATOM   1755  OE2 GLU A 232      46.974  49.856  49.879  1.00 66.71           O  
ATOM   1756  N   ILE A 233      45.427  48.447  43.645  1.00 47.41           N  
ATOM   1757  CA  ILE A 233      44.624  49.124  42.635  1.00 50.68           C  
ATOM   1758  C   ILE A 233      43.703  48.136  41.906  1.00 48.41           C  
ATOM   1759  O   ILE A 233      42.663  48.510  41.377  1.00 48.06           O  
ATOM   1760  CB  ILE A 233      45.556  49.857  41.620  1.00 52.01           C  
ATOM   1761  CG1 ILE A 233      45.037  51.252  41.339  1.00 53.39           C  
ATOM   1762  CG2 ILE A 233      45.584  49.122  40.308  1.00 55.14           C  
ATOM   1763  CD1 ILE A 233      43.869  51.257  40.393  1.00 54.56           C  
ATOM   1764  N   LYS A 234      44.082  46.867  41.914  1.00 50.67           N  
ATOM   1765  CA  LYS A 234      43.310  45.830  41.239  1.00 53.80           C  
ATOM   1766  C   LYS A 234      41.796  45.781  41.461  1.00 52.37           C  
ATOM   1767  O   LYS A 234      41.052  45.639  40.502  1.00 54.07           O  
ATOM   1768  CB  LYS A 234      43.900  44.449  41.537  1.00 51.34           C  
ATOM   1769  CG  LYS A 234      45.193  44.137  40.808  1.00 55.23           C  
ATOM   1770  CD  LYS A 234      45.629  42.676  41.070  1.00 57.52           C  
ATOM   1771  CE  LYS A 234      46.964  42.360  40.419  1.00 60.70           C  
ATOM   1772  NZ  LYS A 234      47.432  40.964  40.666  1.00 64.37           N  
ATOM   1773  N   PRO A 235      41.318  45.879  42.717  1.00 52.27           N  
ATOM   1774  CA  PRO A 235      39.866  45.828  42.904  1.00 50.42           C  
ATOM   1775  C   PRO A 235      39.150  46.952  42.164  1.00 50.15           C  
ATOM   1776  O   PRO A 235      38.129  46.733  41.514  1.00 51.90           O  
ATOM   1777  CB  PRO A 235      39.703  45.926  44.425  1.00 52.00           C  
ATOM   1778  CG  PRO A 235      40.951  45.274  44.932  1.00 50.26           C  
ATOM   1779  CD  PRO A 235      42.010  45.861  44.019  1.00 55.55           C  
ATOM   1780  N   LEU A 236      39.681  48.161  42.267  1.00 48.59           N  
ATOM   1781  CA  LEU A 236      39.071  49.281  41.578  1.00 47.72           C  
ATOM   1782  C   LEU A 236      39.075  49.010  40.068  1.00 45.59           C  
ATOM   1783  O   LEU A 236      38.069  49.202  39.398  1.00 44.65           O  
ATOM   1784  CB  LEU A 236      39.838  50.573  41.872  1.00 47.96           C  
ATOM   1785  CG  LEU A 236      39.381  51.753  41.020  1.00 47.32           C  
ATOM   1786  CD1 LEU A 236      37.905  52.037  41.280  1.00 47.06           C  
ATOM   1787  CD2 LEU A 236      40.221  52.962  41.342  1.00 48.64           C  
ATOM   1788  N   TYR A 237      40.202  48.556  39.541  1.00 44.58           N  
ATOM   1789  CA  TYR A 237      40.305  48.280  38.112  1.00 46.85           C  
ATOM   1790  C   TYR A 237      39.345  47.195  37.633  1.00 49.03           C  
ATOM   1791  O   TYR A 237      38.639  47.393  36.646  1.00 49.90           O  
ATOM   1792  CB  TYR A 237      41.732  47.882  37.751  1.00 46.93           C  
ATOM   1793  CG  TYR A 237      41.910  47.596  36.276  1.00 44.95           C  
ATOM   1794  CD1 TYR A 237      41.742  48.600  35.334  1.00 41.54           C  
ATOM   1795  CD2 TYR A 237      42.195  46.315  35.825  1.00 39.75           C  
ATOM   1796  CE1 TYR A 237      41.850  48.335  33.983  1.00 39.62           C  
ATOM   1797  CE2 TYR A 237      42.300  46.041  34.480  1.00 42.76           C  
ATOM   1798  CZ  TYR A 237      42.129  47.058  33.559  1.00 43.52           C  
ATOM   1799  OH  TYR A 237      42.270  46.800  32.208  1.00 39.87           O  
ATOM   1800  N   GLU A 238      39.324  46.052  38.321  1.00 48.83           N  
ATOM   1801  CA  GLU A 238      38.426  44.944  37.970  1.00 50.10           C  
ATOM   1802  C   GLU A 238      36.968  45.398  37.858  1.00 49.81           C  
ATOM   1803  O   GLU A 238      36.245  44.940  36.979  1.00 52.07           O  
ATOM   1804  CB  GLU A 238      38.490  43.824  39.018  1.00 47.15           C  
ATOM   1805  CG  GLU A 238      39.798  43.100  39.089  1.00 58.34           C  
ATOM   1806  CD  GLU A 238      39.756  41.908  40.044  1.00 65.67           C  
ATOM   1807  OE1 GLU A 238      40.806  41.228  40.196  1.00 67.95           O  
ATOM   1808  OE2 GLU A 238      38.678  41.658  40.637  1.00 62.80           O  
ATOM   1809  N   HIS A 239      36.542  46.273  38.767  1.00 46.17           N  
ATOM   1810  CA  HIS A 239      35.180  46.783  38.770  1.00 46.40           C  
ATOM   1811  C   HIS A 239      34.954  47.776  37.644  1.00 47.86           C  
ATOM   1812  O   HIS A 239      33.847  47.895  37.098  1.00 48.84           O  
ATOM   1813  CB  HIS A 239      34.869  47.444  40.114  1.00 48.69           C  
ATOM   1814  CG  HIS A 239      34.464  46.468  41.173  1.00 51.53           C  
ATOM   1815  ND1 HIS A 239      33.203  45.916  41.229  1.00 53.42           N  
ATOM   1816  CD2 HIS A 239      35.173  45.888  42.168  1.00 50.72           C  
ATOM   1817  CE1 HIS A 239      33.153  45.036  42.212  1.00 51.07           C  
ATOM   1818  NE2 HIS A 239      34.335  44.999  42.796  1.00 54.57           N  
ATOM   1819  N   LEU A 240      36.010  48.494  37.304  1.00 43.13           N  
ATOM   1820  CA  LEU A 240      35.939  49.448  36.233  1.00 42.93           C  
ATOM   1821  C   LEU A 240      35.848  48.581  34.976  1.00 39.85           C  
ATOM   1822  O   LEU A 240      35.066  48.842  34.078  1.00 39.89           O  
ATOM   1823  CB  LEU A 240      37.214  50.299  36.241  1.00 42.82           C  
ATOM   1824  CG  LEU A 240      37.229  51.560  35.373  1.00 43.56           C  
ATOM   1825  CD1 LEU A 240      37.913  51.293  34.087  1.00 46.06           C  
ATOM   1826  CD2 LEU A 240      35.819  52.048  35.164  1.00 40.50           C  
ATOM   1827  N   HIS A 241      36.649  47.527  34.955  1.00 39.76           N  
ATOM   1828  CA  HIS A 241      36.716  46.589  33.851  1.00 40.34           C  
ATOM   1829  C   HIS A 241      35.382  45.877  33.601  1.00 43.11           C  
ATOM   1830  O   HIS A 241      34.949  45.762  32.458  1.00 44.51           O  
ATOM   1831  CB  HIS A 241      37.827  45.578  34.144  1.00 39.18           C  
ATOM   1832  CG  HIS A 241      37.996  44.526  33.093  1.00 42.51           C  
ATOM   1833  ND1 HIS A 241      37.044  43.559  32.841  1.00 42.16           N  
ATOM   1834  CD2 HIS A 241      39.027  44.265  32.256  1.00 44.74           C  
ATOM   1835  CE1 HIS A 241      37.484  42.748  31.896  1.00 40.83           C  
ATOM   1836  NE2 HIS A 241      38.686  43.153  31.526  1.00 45.21           N  
ATOM   1837  N   ALA A 242      34.745  45.403  34.674  1.00 45.07           N  
ATOM   1838  CA  ALA A 242      33.464  44.700  34.594  1.00 46.13           C  
ATOM   1839  C   ALA A 242      32.369  45.645  34.143  1.00 46.12           C  
ATOM   1840  O   ALA A 242      31.453  45.262  33.424  1.00 50.38           O  
ATOM   1841  CB  ALA A 242      33.099  44.103  35.955  1.00 44.72           C  
ATOM   1842  N   TYR A 243      32.458  46.892  34.566  1.00 47.59           N  
ATOM   1843  CA  TYR A 243      31.448  47.850  34.176  1.00 45.30           C  
ATOM   1844  C   TYR A 243      31.595  48.256  32.707  1.00 47.30           C  
ATOM   1845  O   TYR A 243      30.600  48.334  31.980  1.00 47.74           O  
ATOM   1846  CB  TYR A 243      31.512  49.088  35.075  1.00 39.17           C  
ATOM   1847  CG  TYR A 243      30.652  50.236  34.596  1.00 36.29           C  
ATOM   1848  CD1 TYR A 243      29.291  50.271  34.861  1.00 37.69           C  
ATOM   1849  CD2 TYR A 243      31.207  51.284  33.872  1.00 34.23           C  
ATOM   1850  CE1 TYR A 243      28.494  51.332  34.415  1.00 44.45           C  
ATOM   1851  CE2 TYR A 243      30.430  52.340  33.425  1.00 43.89           C  
ATOM   1852  CZ  TYR A 243      29.074  52.358  33.697  1.00 44.06           C  
ATOM   1853  OH  TYR A 243      28.300  53.394  33.225  1.00 49.40           O  
ATOM   1854  N   VAL A 244      32.812  48.515  32.241  1.00 45.54           N  
ATOM   1855  CA  VAL A 244      32.895  48.921  30.850  1.00 46.64           C  
ATOM   1856  C   VAL A 244      32.704  47.691  29.965  1.00 47.60           C  
ATOM   1857  O   VAL A 244      32.139  47.794  28.886  1.00 44.97           O  
ATOM   1858  CB  VAL A 244      34.228  49.666  30.489  1.00 45.81           C  
ATOM   1859  CG1 VAL A 244      34.744  50.510  31.696  1.00 40.13           C  
ATOM   1860  CG2 VAL A 244      35.242  48.692  29.969  1.00 45.66           C  
ATOM   1861  N   ARG A 245      33.153  46.525  30.424  1.00 48.86           N  
ATOM   1862  CA  ARG A 245      32.960  45.307  29.640  1.00 53.46           C  
ATOM   1863  C   ARG A 245      31.458  45.040  29.403  1.00 56.24           C  
ATOM   1864  O   ARG A 245      31.077  44.506  28.361  1.00 57.65           O  
ATOM   1865  CB  ARG A 245      33.623  44.104  30.328  1.00 51.97           C  
ATOM   1866  CG  ARG A 245      32.666  43.097  30.884  1.00 57.07           C  
ATOM   1867  CD  ARG A 245      32.838  41.736  30.261  1.00 47.52           C  
ATOM   1868  NE  ARG A 245      33.987  41.005  30.770  1.00 48.81           N  
ATOM   1869  CZ  ARG A 245      34.198  40.705  32.051  1.00 44.98           C  
ATOM   1870  NH1 ARG A 245      35.282  40.021  32.409  1.00 44.36           N  
ATOM   1871  NH2 ARG A 245      33.342  41.088  32.974  1.00 44.06           N  
ATOM   1872  N   ALA A 246      30.603  45.412  30.357  1.00 55.46           N  
ATOM   1873  CA  ALA A 246      29.163  45.215  30.174  1.00 54.83           C  
ATOM   1874  C   ALA A 246      28.581  46.261  29.215  1.00 55.22           C  
ATOM   1875  O   ALA A 246      27.626  45.986  28.484  1.00 53.54           O  
ATOM   1876  CB  ALA A 246      28.443  45.276  31.514  1.00 55.39           C  
ATOM   1877  N   LYS A 247      29.160  47.458  29.224  1.00 52.79           N  
ATOM   1878  CA  LYS A 247      28.715  48.536  28.358  1.00 53.43           C  
ATOM   1879  C   LYS A 247      29.128  48.258  26.923  1.00 52.53           C  
ATOM   1880  O   LYS A 247      28.376  48.546  25.993  1.00 52.90           O  
ATOM   1881  CB  LYS A 247      29.313  49.870  28.810  1.00 55.34           C  
ATOM   1882  CG  LYS A 247      28.679  50.445  30.065  1.00 59.73           C  
ATOM   1883  CD  LYS A 247      27.304  51.019  29.767  1.00 62.64           C  
ATOM   1884  CE  LYS A 247      26.719  51.696  30.990  1.00 64.23           C  
ATOM   1885  NZ  LYS A 247      25.372  52.269  30.701  1.00 67.48           N  
ATOM   1886  N   LEU A 248      30.326  47.703  26.748  1.00 49.18           N  
ATOM   1887  CA  LEU A 248      30.825  47.380  25.420  1.00 49.93           C  
ATOM   1888  C   LEU A 248      30.026  46.220  24.817  1.00 53.39           C  
ATOM   1889  O   LEU A 248      30.008  46.040  23.593  1.00 54.44           O  
ATOM   1890  CB  LEU A 248      32.307  47.011  25.464  1.00 45.92           C  
ATOM   1891  CG  LEU A 248      33.350  48.114  25.682  1.00 49.86           C  
ATOM   1892  CD1 LEU A 248      34.738  47.484  25.756  1.00 43.04           C  
ATOM   1893  CD2 LEU A 248      33.284  49.131  24.547  1.00 49.81           C  
ATOM   1894  N   MET A 249      29.383  45.421  25.668  1.00 53.68           N  
ATOM   1895  CA  MET A 249      28.578  44.315  25.163  1.00 57.59           C  
ATOM   1896  C   MET A 249      27.344  44.863  24.457  1.00 57.11           C  
ATOM   1897  O   MET A 249      26.917  44.325  23.440  1.00 59.00           O  
ATOM   1898  CB  MET A 249      28.179  43.357  26.287  1.00 55.72           C  
ATOM   1899  CG  MET A 249      29.331  42.467  26.719  1.00 58.68           C  
ATOM   1900  SD  MET A 249      28.906  41.289  28.013  1.00 63.02           S  
ATOM   1901  CE  MET A 249      28.609  42.361  29.372  1.00 63.36           C  
ATOM   1902  N   ASN A 250      26.785  45.950  24.973  1.00 57.32           N  
ATOM   1903  CA  ASN A 250      25.622  46.543  24.332  1.00 57.74           C  
ATOM   1904  C   ASN A 250      26.063  47.164  23.013  1.00 58.15           C  
ATOM   1905  O   ASN A 250      25.326  47.130  22.025  1.00 56.21           O  
ATOM   1906  CB  ASN A 250      24.979  47.624  25.216  1.00 57.93           C  
ATOM   1907  CG  ASN A 250      24.475  47.077  26.556  1.00 62.54           C  
ATOM   1908  OD1 ASN A 250      24.197  45.878  26.699  1.00 58.59           O  
ATOM   1909  ND2 ASN A 250      24.335  47.966  27.539  1.00 61.20           N  
ATOM   1910  N   ALA A 251      27.276  47.715  22.996  1.00 57.54           N  
ATOM   1911  CA  ALA A 251      27.823  48.362  21.796  1.00 55.25           C  
ATOM   1912  C   ALA A 251      28.258  47.385  20.705  1.00 52.88           C  
ATOM   1913  O   ALA A 251      28.216  47.719  19.528  1.00 55.84           O  
ATOM   1914  CB  ALA A 251      29.001  49.265  22.173  1.00 52.97           C  
ATOM   1915  N   TYR A 252      28.677  46.189  21.103  1.00 51.77           N  
ATOM   1916  CA  TYR A 252      29.139  45.160  20.170  1.00 51.37           C  
ATOM   1917  C   TYR A 252      28.438  43.836  20.493  1.00 51.76           C  
ATOM   1918  O   TYR A 252      29.064  42.838  20.867  1.00 50.50           O  
ATOM   1919  CB  TYR A 252      30.659  45.008  20.301  1.00 49.21           C  
ATOM   1920  CG  TYR A 252      31.427  46.263  19.942  1.00 48.35           C  
ATOM   1921  CD1 TYR A 252      31.550  46.677  18.621  1.00 40.87           C  
ATOM   1922  CD2 TYR A 252      32.019  47.052  20.936  1.00 51.01           C  
ATOM   1923  CE1 TYR A 252      32.243  47.838  18.298  1.00 43.86           C  
ATOM   1924  CE2 TYR A 252      32.714  48.221  20.615  1.00 44.15           C  
ATOM   1925  CZ  TYR A 252      32.826  48.606  19.301  1.00 47.18           C  
ATOM   1926  OH  TYR A 252      33.548  49.750  18.985  1.00 46.71           O  
ATOM   1927  N   PRO A 253      27.112  43.814  20.336  1.00 54.10           N  
ATOM   1928  CA  PRO A 253      26.281  42.639  20.612  1.00 54.70           C  
ATOM   1929  C   PRO A 253      26.858  41.337  20.064  1.00 55.69           C  
ATOM   1930  O   PRO A 253      27.178  41.253  18.886  1.00 53.47           O  
ATOM   1931  CB  PRO A 253      24.951  42.998  19.962  1.00 54.94           C  
ATOM   1932  CG  PRO A 253      24.929  44.497  20.010  1.00 54.29           C  
ATOM   1933  CD  PRO A 253      26.341  44.860  19.642  1.00 53.61           C  
ATOM   1934  N   SER A 254      26.992  40.341  20.938  1.00 56.67           N  
ATOM   1935  CA  SER A 254      27.496  39.016  20.584  1.00 59.60           C  
ATOM   1936  C   SER A 254      28.973  38.882  20.233  1.00 58.55           C  
ATOM   1937  O   SER A 254      29.401  37.860  19.705  1.00 61.64           O  
ATOM   1938  CB  SER A 254      26.654  38.434  19.443  1.00 64.14           C  
ATOM   1939  OG  SER A 254      25.329  38.172  19.892  1.00 69.06           O  
ATOM   1940  N   TYR A 255      29.759  39.902  20.532  1.00 57.89           N  
ATOM   1941  CA  TYR A 255      31.184  39.858  20.240  1.00 56.58           C  
ATOM   1942  C   TYR A 255      32.013  39.638  21.496  1.00 54.58           C  
ATOM   1943  O   TYR A 255      33.157  39.212  21.412  1.00 56.39           O  
ATOM   1944  CB  TYR A 255      31.632  41.170  19.574  1.00 56.53           C  
ATOM   1945  CG  TYR A 255      31.369  41.253  18.082  1.00 59.50           C  
ATOM   1946  CD1 TYR A 255      30.627  42.297  17.536  1.00 60.11           C  
ATOM   1947  CD2 TYR A 255      31.913  40.310  17.209  1.00 60.46           C  
ATOM   1948  CE1 TYR A 255      30.441  42.399  16.153  1.00 58.51           C  
ATOM   1949  CE2 TYR A 255      31.734  40.405  15.842  1.00 57.06           C  
ATOM   1950  CZ  TYR A 255      30.999  41.448  15.316  1.00 61.08           C  
ATOM   1951  OH  TYR A 255      30.840  41.531  13.943  1.00 59.81           O  
ATOM   1952  N   ILE A 256      31.428  39.903  22.660  1.00 53.74           N  
ATOM   1953  CA  ILE A 256      32.175  39.800  23.909  1.00 54.01           C  
ATOM   1954  C   ILE A 256      31.543  38.913  24.979  1.00 52.08           C  
ATOM   1955  O   ILE A 256      30.351  38.978  25.210  1.00 55.01           O  
ATOM   1956  CB  ILE A 256      32.373  41.212  24.510  1.00 52.12           C  
ATOM   1957  CG1 ILE A 256      33.084  42.104  23.491  1.00 50.47           C  
ATOM   1958  CG2 ILE A 256      33.159  41.120  25.820  1.00 51.76           C  
ATOM   1959  CD1 ILE A 256      32.957  43.590  23.789  1.00 52.24           C  
ATOM   1960  N   SER A 257      32.365  38.103  25.634  1.00 51.77           N  
ATOM   1961  CA  SER A 257      31.917  37.203  26.694  1.00 52.05           C  
ATOM   1962  C   SER A 257      31.727  37.947  28.034  1.00 53.59           C  
ATOM   1963  O   SER A 257      32.477  38.862  28.372  1.00 54.28           O  
ATOM   1964  CB  SER A 257      32.938  36.081  26.861  1.00 47.38           C  
ATOM   1965  OG  SER A 257      32.686  35.323  28.031  1.00 54.64           O  
ATOM   1966  N   PRO A 258      30.705  37.564  28.804  1.00 54.66           N  
ATOM   1967  CA  PRO A 258      30.398  38.176  30.103  1.00 52.68           C  
ATOM   1968  C   PRO A 258      31.506  37.944  31.113  1.00 48.60           C  
ATOM   1969  O   PRO A 258      31.593  38.639  32.132  1.00 47.21           O  
ATOM   1970  CB  PRO A 258      29.102  37.465  30.532  1.00 57.33           C  
ATOM   1971  CG  PRO A 258      28.499  36.993  29.223  1.00 56.86           C  
ATOM   1972  CD  PRO A 258      29.709  36.534  28.459  1.00 56.55           C  
ATOM   1973  N   ILE A 259      32.336  36.941  30.851  1.00 45.70           N  
ATOM   1974  CA  ILE A 259      33.416  36.632  31.768  1.00 48.63           C  
ATOM   1975  C   ILE A 259      34.797  36.797  31.143  1.00 48.41           C  
ATOM   1976  O   ILE A 259      35.813  36.559  31.805  1.00 47.89           O  
ATOM   1977  CB  ILE A 259      33.330  35.176  32.272  1.00 48.93           C  
ATOM   1978  CG1 ILE A 259      33.595  34.223  31.101  1.00 50.35           C  
ATOM   1979  CG2 ILE A 259      31.978  34.927  32.945  1.00 46.42           C  
ATOM   1980  CD1 ILE A 259      34.060  32.833  31.526  1.00 50.29           C  
ATOM   1981  N   GLY A 260      34.839  37.207  29.881  1.00 47.41           N  
ATOM   1982  CA  GLY A 260      36.123  37.325  29.217  1.00 49.62           C  
ATOM   1983  C   GLY A 260      36.830  38.668  29.204  1.00 52.45           C  
ATOM   1984  O   GLY A 260      36.289  39.702  29.615  1.00 52.34           O  
ATOM   1985  N   CYS A 261      38.074  38.625  28.740  1.00 50.98           N  
ATOM   1986  CA  CYS A 261      38.897  39.811  28.598  1.00 49.33           C  
ATOM   1987  C   CYS A 261      38.270  40.688  27.508  1.00 50.48           C  
ATOM   1988  O   CYS A 261      37.478  40.212  26.682  1.00 49.15           O  
ATOM   1989  CB  CYS A 261      40.306  39.419  28.163  1.00 44.67           C  
ATOM   1990  SG  CYS A 261      41.324  38.589  29.435  1.00 55.23           S  
ATOM   1991  N   LEU A 262      38.630  41.965  27.513  1.00 46.05           N  
ATOM   1992  CA  LEU A 262      38.141  42.906  26.529  1.00 47.30           C  
ATOM   1993  C   LEU A 262      38.980  42.726  25.288  1.00 45.85           C  
ATOM   1994  O   LEU A 262      40.195  42.626  25.374  1.00 45.26           O  
ATOM   1995  CB  LEU A 262      38.309  44.334  27.039  1.00 48.06           C  
ATOM   1996  CG  LEU A 262      37.507  44.594  28.305  1.00 50.82           C  
ATOM   1997  CD1 LEU A 262      37.797  45.995  28.864  1.00 46.03           C  
ATOM   1998  CD2 LEU A 262      36.023  44.407  27.962  1.00 49.54           C  
ATOM   1999  N   PRO A 263      38.341  42.639  24.116  1.00 45.39           N  
ATOM   2000  CA  PRO A 263      39.132  42.475  22.900  1.00 46.53           C  
ATOM   2001  C   PRO A 263      39.987  43.736  22.704  1.00 45.65           C  
ATOM   2002  O   PRO A 263      39.493  44.856  22.799  1.00 46.36           O  
ATOM   2003  CB  PRO A 263      38.065  42.293  21.822  1.00 50.08           C  
ATOM   2004  CG  PRO A 263      36.970  41.567  22.571  1.00 48.47           C  
ATOM   2005  CD  PRO A 263      36.915  42.384  23.858  1.00 46.15           C  
ATOM   2006  N   ALA A 264      41.273  43.535  22.439  1.00 44.69           N  
ATOM   2007  CA  ALA A 264      42.232  44.619  22.259  1.00 43.71           C  
ATOM   2008  C   ALA A 264      41.875  45.780  21.300  1.00 45.19           C  
ATOM   2009  O   ALA A 264      42.269  46.944  21.541  1.00 41.81           O  
ATOM   2010  CB  ALA A 264      43.556  44.021  21.860  1.00 44.14           C  
ATOM   2011  N   HIS A 265      41.128  45.486  20.234  1.00 41.80           N  
ATOM   2012  CA  HIS A 265      40.780  46.516  19.245  1.00 40.05           C  
ATOM   2013  C   HIS A 265      39.545  47.350  19.526  1.00 39.56           C  
ATOM   2014  O   HIS A 265      39.189  48.186  18.717  1.00 38.58           O  
ATOM   2015  CB  HIS A 265      40.625  45.877  17.859  1.00 44.97           C  
ATOM   2016  CG  HIS A 265      39.442  44.966  17.745  1.00 44.22           C  
ATOM   2017  ND1 HIS A 265      39.290  43.842  18.528  1.00 43.94           N  
ATOM   2018  CD2 HIS A 265      38.364  45.003  16.924  1.00 48.01           C  
ATOM   2019  CE1 HIS A 265      38.172  43.221  18.191  1.00 50.36           C  
ATOM   2020  NE2 HIS A 265      37.592  43.905  17.218  1.00 49.18           N  
ATOM   2021  N   LEU A 266      38.895  47.144  20.666  1.00 41.62           N  
ATOM   2022  CA  LEU A 266      37.687  47.893  20.988  1.00 42.13           C  
ATOM   2023  C   LEU A 266      37.849  48.908  22.130  1.00 43.88           C  
ATOM   2024  O   LEU A 266      36.860  49.332  22.710  1.00 44.94           O  
ATOM   2025  CB  LEU A 266      36.568  46.909  21.375  1.00 43.06           C  
ATOM   2026  CG  LEU A 266      36.255  45.749  20.408  1.00 44.20           C  
ATOM   2027  CD1 LEU A 266      35.110  44.868  20.938  1.00 41.05           C  
ATOM   2028  CD2 LEU A 266      35.879  46.322  19.062  1.00 42.96           C  
ATOM   2029  N   LEU A 267      39.070  49.333  22.439  1.00 47.16           N  
ATOM   2030  CA  LEU A 267      39.258  50.214  23.599  1.00 45.45           C  
ATOM   2031  C   LEU A 267      39.411  51.717  23.431  1.00 46.77           C  
ATOM   2032  O   LEU A 267      39.669  52.417  24.407  1.00 46.05           O  
ATOM   2033  CB  LEU A 267      40.433  49.707  24.428  1.00 42.24           C  
ATOM   2034  CG  LEU A 267      40.412  48.222  24.808  1.00 43.22           C  
ATOM   2035  CD1 LEU A 267      41.832  47.787  25.244  1.00 40.19           C  
ATOM   2036  CD2 LEU A 267      39.376  47.984  25.896  1.00 39.57           C  
ATOM   2037  N   GLY A 268      39.301  52.248  22.226  1.00 44.30           N  
ATOM   2038  CA  GLY A 268      39.396  53.695  22.164  1.00 47.84           C  
ATOM   2039  C   GLY A 268      40.634  54.315  21.577  1.00 43.23           C  
ATOM   2040  O   GLY A 268      40.639  55.499  21.276  1.00 48.01           O  
ATOM   2041  N   ASP A 269      41.705  53.549  21.476  1.00 40.64           N  
ATOM   2042  CA  ASP A 269      42.889  54.049  20.820  1.00 40.84           C  
ATOM   2043  C   ASP A 269      43.555  52.814  20.270  1.00 37.55           C  
ATOM   2044  O   ASP A 269      43.048  51.706  20.456  1.00 39.95           O  
ATOM   2045  CB  ASP A 269      43.774  54.968  21.723  1.00 42.78           C  
ATOM   2046  CG  ASP A 269      44.590  54.234  22.809  1.00 45.47           C  
ATOM   2047  OD1 ASP A 269      44.828  54.899  23.835  1.00 46.89           O  
ATOM   2048  OD2 ASP A 269      45.045  53.078  22.659  1.00 38.91           O  
ATOM   2049  N   MET A 270      44.653  52.983  19.571  1.00 35.89           N  
ATOM   2050  CA  MET A 270      45.278  51.848  18.931  1.00 39.83           C  
ATOM   2051  C   MET A 270      45.809  50.725  19.827  1.00 42.98           C  
ATOM   2052  O   MET A 270      46.071  49.615  19.338  1.00 42.26           O  
ATOM   2053  CB  MET A 270      46.382  52.364  18.017  1.00 35.76           C  
ATOM   2054  CG  MET A 270      47.108  51.283  17.183  1.00 42.06           C  
ATOM   2055  SD  MET A 270      45.997  50.369  16.080  1.00 41.55           S  
ATOM   2056  CE  MET A 270      46.251  51.328  14.575  1.00 43.14           C  
ATOM   2057  N   TRP A 271      45.917  50.980  21.128  1.00 40.81           N  
ATOM   2058  CA  TRP A 271      46.519  49.990  22.024  1.00 41.86           C  
ATOM   2059  C   TRP A 271      45.723  49.732  23.296  1.00 43.64           C  
ATOM   2060  O   TRP A 271      45.896  48.698  23.943  1.00 44.34           O  
ATOM   2061  CB  TRP A 271      47.917  50.472  22.446  1.00 39.11           C  
ATOM   2062  CG  TRP A 271      48.789  50.949  21.323  1.00 40.52           C  
ATOM   2063  CD1 TRP A 271      49.653  50.195  20.571  1.00 39.74           C  
ATOM   2064  CD2 TRP A 271      48.849  52.278  20.788  1.00 36.12           C  
ATOM   2065  NE1 TRP A 271      50.236  50.974  19.603  1.00 39.32           N  
ATOM   2066  CE2 TRP A 271      49.759  52.256  19.719  1.00 38.13           C  
ATOM   2067  CE3 TRP A 271      48.220  53.487  21.115  1.00 41.33           C  
ATOM   2068  CZ2 TRP A 271      50.060  53.397  18.971  1.00 39.75           C  
ATOM   2069  CZ3 TRP A 271      48.521  54.620  20.372  1.00 34.52           C  
ATOM   2070  CH2 TRP A 271      49.428  54.566  19.317  1.00 37.02           C  
ATOM   2071  N   GLY A 272      44.841  50.661  23.639  1.00 41.58           N  
ATOM   2072  CA  GLY A 272      44.113  50.537  24.881  1.00 39.79           C  
ATOM   2073  C   GLY A 272      44.940  51.215  25.984  1.00 41.54           C  
ATOM   2074  O   GLY A 272      44.819  50.885  27.175  1.00 41.22           O  
ATOM   2075  N   ARG A 273      45.802  52.153  25.588  1.00 37.39           N  
ATOM   2076  CA  ARG A 273      46.620  52.873  26.542  1.00 40.30           C  
ATOM   2077  C   ARG A 273      45.726  53.664  27.477  1.00 41.56           C  
ATOM   2078  O   ARG A 273      45.967  53.719  28.697  1.00 37.84           O  
ATOM   2079  CB  ARG A 273      47.597  53.811  25.833  1.00 40.26           C  
ATOM   2080  CG  ARG A 273      48.532  54.489  26.803  1.00 39.38           C  
ATOM   2081  CD  ARG A 273      49.452  55.493  26.149  1.00 45.63           C  
ATOM   2082  NE  ARG A 273      50.275  56.140  27.164  1.00 41.66           N  
ATOM   2083  CZ  ARG A 273      50.931  57.275  26.986  1.00 43.32           C  
ATOM   2084  NH1 ARG A 273      51.656  57.769  27.982  1.00 44.53           N  
ATOM   2085  NH2 ARG A 273      50.860  57.916  25.824  1.00 40.97           N  
ATOM   2086  N   PHE A 274      44.693  54.282  26.907  1.00 38.90           N  
ATOM   2087  CA  PHE A 274      43.721  55.045  27.705  1.00 39.04           C  
ATOM   2088  C   PHE A 274      42.349  54.594  27.209  1.00 37.66           C  
ATOM   2089  O   PHE A 274      42.240  54.215  26.057  1.00 39.14           O  
ATOM   2090  CB  PHE A 274      43.867  56.546  27.453  1.00 37.20           C  
ATOM   2091  CG  PHE A 274      45.239  57.087  27.731  1.00 39.25           C  
ATOM   2092  CD1 PHE A 274      46.022  57.570  26.698  1.00 37.67           C  
ATOM   2093  CD2 PHE A 274      45.718  57.184  29.045  1.00 38.03           C  
ATOM   2094  CE1 PHE A 274      47.266  58.159  26.950  1.00 39.70           C  
ATOM   2095  CE2 PHE A 274      46.956  57.763  29.319  1.00 35.36           C  
ATOM   2096  CZ  PHE A 274      47.735  58.258  28.269  1.00 41.82           C  
ATOM   2097  N   TRP A 275      41.327  54.607  28.064  1.00 36.87           N  
ATOM   2098  CA  TRP A 275      39.977  54.209  27.656  1.00 36.95           C  
ATOM   2099  C   TRP A 275      39.140  55.469  27.501  1.00 38.02           C  
ATOM   2100  O   TRP A 275      37.910  55.418  27.392  1.00 36.08           O  
ATOM   2101  CB  TRP A 275      39.318  53.282  28.689  1.00 35.56           C  
ATOM   2102  CG  TRP A 275      39.941  51.944  28.787  1.00 39.12           C  
ATOM   2103  CD1 TRP A 275      40.930  51.441  27.992  1.00 36.47           C  
ATOM   2104  CD2 TRP A 275      39.626  50.912  29.740  1.00 41.36           C  
ATOM   2105  NE1 TRP A 275      41.254  50.165  28.389  1.00 39.10           N  
ATOM   2106  CE2 TRP A 275      40.467  49.815  29.458  1.00 39.91           C  
ATOM   2107  CE3 TRP A 275      38.713  50.808  30.794  1.00 41.90           C  
ATOM   2108  CZ2 TRP A 275      40.421  48.627  30.193  1.00 39.29           C  
ATOM   2109  CZ3 TRP A 275      38.667  49.621  31.524  1.00 44.43           C  
ATOM   2110  CH2 TRP A 275      39.516  48.548  31.217  1.00 41.76           C  
ATOM   2111  N   THR A 276      39.827  56.605  27.494  1.00 39.75           N  
ATOM   2112  CA  THR A 276      39.188  57.912  27.344  1.00 43.76           C  
ATOM   2113  C   THR A 276      38.050  57.929  26.318  1.00 42.63           C  
ATOM   2114  O   THR A 276      36.949  58.393  26.592  1.00 42.49           O  
ATOM   2115  CB  THR A 276      40.206  58.977  26.873  1.00 44.61           C  
ATOM   2116  OG1 THR A 276      41.411  58.867  27.633  1.00 46.54           O  
ATOM   2117  CG2 THR A 276      39.629  60.370  27.041  1.00 37.67           C  
ATOM   2118  N   ASN A 277      38.329  57.434  25.123  1.00 44.46           N  
ATOM   2119  CA  ASN A 277      37.323  57.455  24.062  1.00 47.76           C  
ATOM   2120  C   ASN A 277      36.142  56.504  24.222  1.00 48.52           C  
ATOM   2121  O   ASN A 277      35.252  56.489  23.387  1.00 51.85           O  
ATOM   2122  CB  ASN A 277      38.012  57.244  22.720  1.00 44.98           C  
ATOM   2123  CG  ASN A 277      39.066  58.304  22.458  1.00 45.62           C  
ATOM   2124  OD1 ASN A 277      40.152  58.027  21.916  1.00 43.37           O  
ATOM   2125  ND2 ASN A 277      38.754  59.527  22.845  1.00 42.40           N  
ATOM   2126  N   LEU A 278      36.127  55.732  25.303  1.00 46.88           N  
ATOM   2127  CA  LEU A 278      35.025  54.821  25.576  1.00 45.32           C  
ATOM   2128  C   LEU A 278      33.966  55.589  26.352  1.00 45.07           C  
ATOM   2129  O   LEU A 278      33.000  55.007  26.842  1.00 50.24           O  
ATOM   2130  CB  LEU A 278      35.512  53.635  26.427  1.00 44.45           C  
ATOM   2131  CG  LEU A 278      35.771  52.274  25.770  1.00 46.14           C  
ATOM   2132  CD1 LEU A 278      36.271  52.472  24.370  1.00 37.88           C  
ATOM   2133  CD2 LEU A 278      36.732  51.447  26.606  1.00 41.63           C  
ATOM   2134  N   TYR A 279      34.121  56.900  26.461  1.00 42.94           N  
ATOM   2135  CA  TYR A 279      33.160  57.661  27.246  1.00 46.45           C  
ATOM   2136  C   TYR A 279      31.724  57.689  26.717  1.00 48.49           C  
ATOM   2137  O   TYR A 279      30.778  57.541  27.486  1.00 52.76           O  
ATOM   2138  CB  TYR A 279      33.653  59.092  27.472  1.00 43.06           C  
ATOM   2139  CG  TYR A 279      32.864  59.797  28.538  1.00 42.63           C  
ATOM   2140  CD1 TYR A 279      32.872  59.339  29.840  1.00 44.25           C  
ATOM   2141  CD2 TYR A 279      32.086  60.920  28.240  1.00 50.65           C  
ATOM   2142  CE1 TYR A 279      32.136  59.971  30.826  1.00 47.24           C  
ATOM   2143  CE2 TYR A 279      31.335  61.566  29.227  1.00 46.96           C  
ATOM   2144  CZ  TYR A 279      31.369  61.087  30.518  1.00 49.91           C  
ATOM   2145  OH  TYR A 279      30.644  61.717  31.514  1.00 46.68           O  
ATOM   2146  N   SER A 280      31.546  57.882  25.421  1.00 51.46           N  
ATOM   2147  CA  SER A 280      30.197  57.901  24.849  1.00 54.18           C  
ATOM   2148  C   SER A 280      29.477  56.553  24.972  1.00 56.54           C  
ATOM   2149  O   SER A 280      28.250  56.497  24.993  1.00 60.84           O  
ATOM   2150  CB  SER A 280      30.265  58.295  23.381  1.00 55.89           C  
ATOM   2151  OG  SER A 280      30.545  59.679  23.264  1.00 65.57           O  
ATOM   2152  N   LEU A 281      30.238  55.469  25.056  1.00 54.85           N  
ATOM   2153  CA  LEU A 281      29.661  54.145  25.171  1.00 51.46           C  
ATOM   2154  C   LEU A 281      29.502  53.715  26.631  1.00 52.26           C  
ATOM   2155  O   LEU A 281      28.791  52.745  26.921  1.00 52.24           O  
ATOM   2156  CB  LEU A 281      30.550  53.113  24.458  1.00 53.12           C  
ATOM   2157  CG  LEU A 281      31.178  53.383  23.080  1.00 57.28           C  
ATOM   2158  CD1 LEU A 281      32.202  54.534  23.165  1.00 58.73           C  
ATOM   2159  CD2 LEU A 281      31.896  52.119  22.591  1.00 54.54           C  
ATOM   2160  N   THR A 282      30.151  54.421  27.558  1.00 50.05           N  
ATOM   2161  CA  THR A 282      30.084  54.019  28.969  1.00 45.80           C  
ATOM   2162  C   THR A 282      29.502  55.041  29.948  1.00 46.39           C  
ATOM   2163  O   THR A 282      29.266  54.718  31.108  1.00 48.41           O  
ATOM   2164  CB  THR A 282      31.505  53.618  29.495  1.00 47.16           C  
ATOM   2165  OG1 THR A 282      32.417  54.712  29.314  1.00 43.93           O  
ATOM   2166  CG2 THR A 282      32.054  52.410  28.759  1.00 39.95           C  
ATOM   2167  N   VAL A 283      29.277  56.269  29.499  1.00 47.31           N  
ATOM   2168  CA  VAL A 283      28.755  57.307  30.389  1.00 50.63           C  
ATOM   2169  C   VAL A 283      27.532  56.890  31.228  1.00 53.38           C  
ATOM   2170  O   VAL A 283      26.466  56.597  30.697  1.00 55.63           O  
ATOM   2171  CB  VAL A 283      28.439  58.612  29.584  1.00 52.30           C  
ATOM   2172  CG1 VAL A 283      27.356  58.352  28.543  1.00 49.66           C  
ATOM   2173  CG2 VAL A 283      28.041  59.733  30.534  1.00 53.12           C  
ATOM   2174  N   PRO A 284      27.683  56.875  32.568  1.00 54.51           N  
ATOM   2175  CA  PRO A 284      26.654  56.507  33.546  1.00 53.83           C  
ATOM   2176  C   PRO A 284      25.283  57.195  33.387  1.00 56.67           C  
ATOM   2177  O   PRO A 284      24.242  56.546  33.528  1.00 53.90           O  
ATOM   2178  CB  PRO A 284      27.314  56.849  34.881  1.00 55.88           C  
ATOM   2179  CG  PRO A 284      28.777  56.630  34.608  1.00 52.36           C  
ATOM   2180  CD  PRO A 284      28.936  57.260  33.245  1.00 52.28           C  
ATOM   2181  N   PHE A 285      25.285  58.505  33.133  1.00 58.13           N  
ATOM   2182  CA  PHE A 285      24.046  59.270  32.967  1.00 58.08           C  
ATOM   2183  C   PHE A 285      24.184  60.222  31.791  1.00 61.38           C  
ATOM   2184  O   PHE A 285      24.461  61.415  31.962  1.00 60.14           O  
ATOM   2185  CB  PHE A 285      23.723  60.068  34.238  1.00 57.05           C  
ATOM   2186  CG  PHE A 285      23.690  59.226  35.481  1.00 55.35           C  
ATOM   2187  CD1 PHE A 285      24.833  59.053  36.244  1.00 50.97           C  
ATOM   2188  CD2 PHE A 285      22.538  58.525  35.830  1.00 55.10           C  
ATOM   2189  CE1 PHE A 285      24.838  58.188  37.331  1.00 52.39           C  
ATOM   2190  CE2 PHE A 285      22.529  57.658  36.912  1.00 51.78           C  
ATOM   2191  CZ  PHE A 285      23.683  57.485  37.666  1.00 54.98           C  
ATOM   2192  N   GLY A 286      23.969  59.685  30.594  1.00 64.48           N  
ATOM   2193  CA  GLY A 286      24.089  60.472  29.377  1.00 67.86           C  
ATOM   2194  C   GLY A 286      23.246  61.725  29.246  1.00 69.82           C  
ATOM   2195  O   GLY A 286      23.513  62.561  28.382  1.00 71.29           O  
ATOM   2196  N   GLN A 287      22.239  61.872  30.097  1.00 72.64           N  
ATOM   2197  CA  GLN A 287      21.355  63.033  30.044  1.00 76.93           C  
ATOM   2198  C   GLN A 287      21.937  64.255  30.744  1.00 78.69           C  
ATOM   2199  O   GLN A 287      21.737  65.385  30.298  1.00 78.01           O  
ATOM   2200  CB  GLN A 287      20.005  62.685  30.669  1.00 78.90           C  
ATOM   2201  CG  GLN A 287      19.745  61.179  30.771  1.00 81.98           C  
ATOM   2202  CD  GLN A 287      20.634  60.494  31.805  1.00 80.09           C  
ATOM   2203  OE1 GLN A 287      20.591  59.278  31.967  1.00 82.34           O  
ATOM   2204  NE2 GLN A 287      21.436  61.279  32.508  1.00 80.85           N  
ATOM   2205  N   LYS A 288      22.649  64.027  31.846  1.00 81.22           N  
ATOM   2206  CA  LYS A 288      23.257  65.123  32.596  1.00 82.29           C  
ATOM   2207  C   LYS A 288      24.296  65.833  31.741  1.00 84.76           C  
ATOM   2208  O   LYS A 288      25.082  65.199  31.038  1.00 84.74           O  
ATOM   2209  CB  LYS A 288      23.916  64.599  33.874  1.00 78.72           C  
ATOM   2210  CG  LYS A 288      22.942  64.146  34.955  1.00 78.05           C  
ATOM   2211  CD  LYS A 288      22.213  65.332  35.573  1.00 78.57           C  
ATOM   2212  CE  LYS A 288      21.128  64.891  36.552  1.00 77.75           C  
ATOM   2213  NZ  LYS A 288      21.674  64.134  37.710  1.00 79.05           N  
ATOM   2214  N   PRO A 289      24.297  67.172  31.780  1.00 87.73           N  
ATOM   2215  CA  PRO A 289      25.241  67.996  31.015  1.00 89.87           C  
ATOM   2216  C   PRO A 289      26.661  67.925  31.585  1.00 90.14           C  
ATOM   2217  O   PRO A 289      26.873  68.107  32.785  1.00 89.55           O  
ATOM   2218  CB  PRO A 289      24.654  69.406  31.134  1.00 89.46           C  
ATOM   2219  CG  PRO A 289      23.188  69.153  31.365  1.00 89.87           C  
ATOM   2220  CD  PRO A 289      23.213  67.998  32.333  1.00 88.11           C  
ATOM   2221  N   ASN A 290      27.622  67.656  30.711  1.00 90.23           N  
ATOM   2222  CA  ASN A 290      29.023  67.577  31.095  1.00 91.50           C  
ATOM   2223  C   ASN A 290      29.545  69.014  31.218  1.00 91.36           C  
ATOM   2224  O   ASN A 290      29.580  69.746  30.226  1.00 92.26           O  
ATOM   2225  CB  ASN A 290      29.793  66.816  30.010  1.00 94.49           C  
ATOM   2226  CG  ASN A 290      31.269  66.656  30.329  1.00 96.32           C  
ATOM   2227  OD1 ASN A 290      31.646  65.937  31.258  1.00 98.27           O  
ATOM   2228  ND2 ASN A 290      32.115  67.325  29.552  1.00 97.07           N  
ATOM   2229  N   ILE A 291      29.933  69.421  32.426  1.00 88.24           N  
ATOM   2230  CA  ILE A 291      30.442  70.778  32.648  1.00 85.48           C  
ATOM   2231  C   ILE A 291      31.436  71.186  31.566  1.00 83.39           C  
ATOM   2232  O   ILE A 291      32.433  70.505  31.342  1.00 84.33           O  
ATOM   2233  CB  ILE A 291      31.146  70.910  34.017  1.00 84.81           C  
ATOM   2234  CG1 ILE A 291      30.149  70.676  35.151  1.00 83.20           C  
ATOM   2235  CG2 ILE A 291      31.750  72.293  34.152  1.00 85.29           C  
ATOM   2236  CD1 ILE A 291      30.726  70.939  36.523  1.00 82.70           C  
ATOM   2237  N   ASP A 292      31.166  72.305  30.903  1.00 81.44           N  
ATOM   2238  CA  ASP A 292      32.035  72.785  29.831  1.00 80.43           C  
ATOM   2239  C   ASP A 292      31.846  74.278  29.578  1.00 79.80           C  
ATOM   2240  O   ASP A 292      30.974  74.679  28.805  1.00 79.92           O  
ATOM   2241  CB  ASP A 292      31.751  72.012  28.546  1.00 78.75           C  
ATOM   2242  CG  ASP A 292      32.539  72.538  27.376  1.00 80.95           C  
ATOM   2243  OD1 ASP A 292      32.497  71.909  26.297  1.00 82.66           O  
ATOM   2244  OD2 ASP A 292      33.199  73.588  27.536  1.00 77.89           O  
ATOM   2245  N   VAL A 293      32.693  75.089  30.206  1.00 77.30           N  
ATOM   2246  CA  VAL A 293      32.616  76.541  30.087  1.00 76.06           C  
ATOM   2247  C   VAL A 293      33.213  77.126  28.801  1.00 73.74           C  
ATOM   2248  O   VAL A 293      33.327  78.339  28.670  1.00 68.81           O  
ATOM   2249  CB  VAL A 293      33.305  77.212  31.303  1.00 78.83           C  
ATOM   2250  CG1 VAL A 293      33.105  78.717  31.252  1.00 81.41           C  
ATOM   2251  CG2 VAL A 293      32.744  76.651  32.606  1.00 76.26           C  
ATOM   2252  N   THR A 294      33.564  76.275  27.843  1.00 73.29           N  
ATOM   2253  CA  THR A 294      34.169  76.751  26.604  1.00 75.81           C  
ATOM   2254  C   THR A 294      33.257  77.683  25.802  1.00 77.27           C  
ATOM   2255  O   THR A 294      33.611  78.127  24.705  1.00 74.06           O  
ATOM   2256  CB  THR A 294      34.624  75.562  25.711  1.00 77.49           C  
ATOM   2257  OG1 THR A 294      35.395  76.057  24.610  1.00 81.45           O  
ATOM   2258  CG2 THR A 294      33.432  74.800  25.169  1.00 83.19           C  
ATOM   2259  N   ASP A 295      32.090  77.981  26.368  1.00 79.11           N  
ATOM   2260  CA  ASP A 295      31.104  78.857  25.740  1.00 79.44           C  
ATOM   2261  C   ASP A 295      30.964  80.125  26.573  1.00 77.82           C  
ATOM   2262  O   ASP A 295      30.854  81.227  26.037  1.00 76.29           O  
ATOM   2263  CB  ASP A 295      29.751  78.136  25.631  1.00 82.71           C  
ATOM   2264  CG  ASP A 295      29.795  76.937  24.667  1.00 87.03           C  
ATOM   2265  OD1 ASP A 295      29.788  77.170  23.438  1.00 82.40           O  
ATOM   2266  OD2 ASP A 295      29.847  75.768  25.137  1.00 87.55           O  
ATOM   2267  N   ALA A 296      30.987  79.960  27.893  1.00 77.86           N  
ATOM   2268  CA  ALA A 296      30.876  81.089  28.810  1.00 76.03           C  
ATOM   2269  C   ALA A 296      32.112  81.981  28.705  1.00 77.71           C  
ATOM   2270  O   ALA A 296      32.079  83.152  29.089  1.00 78.92           O  
ATOM   2271  CB  ALA A 296      30.712  80.588  30.234  1.00 74.57           C  
ATOM   2272  N   MET A 297      33.203  81.414  28.193  1.00 78.03           N  
ATOM   2273  CA  MET A 297      34.451  82.149  28.015  1.00 77.84           C  
ATOM   2274  C   MET A 297      34.252  83.092  26.834  1.00 79.13           C  
ATOM   2275  O   MET A 297      34.599  84.274  26.888  1.00 78.04           O  
ATOM   2276  CB  MET A 297      35.611  81.182  27.722  1.00 75.49           C  
ATOM   2277  CG  MET A 297      36.143  80.407  28.941  1.00 73.03           C  
ATOM   2278  SD  MET A 297      37.219  78.999  28.490  1.00 70.90           S  
ATOM   2279  CE  MET A 297      38.643  79.845  27.782  1.00 70.88           C  
ATOM   2280  N   VAL A 298      33.681  82.553  25.766  1.00 80.81           N  
ATOM   2281  CA  VAL A 298      33.418  83.332  24.567  1.00 82.43           C  
ATOM   2282  C   VAL A 298      32.520  84.534  24.870  1.00 84.19           C  
ATOM   2283  O   VAL A 298      32.919  85.685  24.672  1.00 82.45           O  
ATOM   2284  CB  VAL A 298      32.750  82.456  23.494  1.00 81.27           C  
ATOM   2285  CG1 VAL A 298      32.468  83.277  22.249  1.00 78.82           C  
ATOM   2286  CG2 VAL A 298      33.650  81.276  23.172  1.00 79.22           C  
ATOM   2287  N   ASP A 299      31.314  84.263  25.366  1.00 86.50           N  
ATOM   2288  CA  ASP A 299      30.356  85.320  25.689  1.00 88.48           C  
ATOM   2289  C   ASP A 299      30.939  86.410  26.598  1.00 88.47           C  
ATOM   2290  O   ASP A 299      30.386  87.507  26.703  1.00 88.26           O  
ATOM   2291  CB  ASP A 299      29.099  84.710  26.327  1.00 90.88           C  
ATOM   2292  CG  ASP A 299      28.028  85.756  26.649  1.00 93.78           C  
ATOM   2293  OD1 ASP A 299      27.976  86.237  27.810  1.00 91.49           O  
ATOM   2294  OD2 ASP A 299      27.240  86.101  25.733  1.00 94.34           O  
ATOM   2295  N   GLN A 300      32.054  86.117  27.255  1.00 88.45           N  
ATOM   2296  CA  GLN A 300      32.676  87.107  28.123  1.00 87.74           C  
ATOM   2297  C   GLN A 300      33.873  87.731  27.412  1.00 87.11           C  
ATOM   2298  O   GLN A 300      34.631  88.507  27.998  1.00 86.34           O  
ATOM   2299  CB  GLN A 300      33.106  86.467  29.444  1.00 89.08           C  
ATOM   2300  CG  GLN A 300      31.954  85.848  30.219  1.00 88.83           C  
ATOM   2301  CD  GLN A 300      32.281  85.616  31.679  1.00 88.77           C  
ATOM   2302  OE1 GLN A 300      31.487  85.038  32.413  1.00 90.05           O  
ATOM   2303  NE2 GLN A 300      33.450  86.075  32.110  1.00 88.77           N  
ATOM   2304  N   ALA A 301      34.023  87.390  26.136  1.00 85.45           N  
ATOM   2305  CA  ALA A 301      35.107  87.912  25.322  1.00 84.74           C  
ATOM   2306  C   ALA A 301      36.444  87.642  25.976  1.00 85.18           C  
ATOM   2307  O   ALA A 301      37.194  88.575  26.265  1.00 86.31           O  
ATOM   2308  CB  ALA A 301      34.929  89.410  25.109  1.00 84.56           C  
ATOM   2309  N   TRP A 302      36.733  86.366  26.222  1.00 85.13           N  
ATOM   2310  CA  TRP A 302      37.999  85.967  26.833  1.00 82.82           C  
ATOM   2311  C   TRP A 302      38.998  85.663  25.736  1.00 81.86           C  
ATOM   2312  O   TRP A 302      38.628  85.189  24.664  1.00 81.86           O  
ATOM   2313  CB  TRP A 302      37.819  84.725  27.714  1.00 82.02           C  
ATOM   2314  CG  TRP A 302      37.455  85.029  29.141  1.00 80.11           C  
ATOM   2315  CD1 TRP A 302      36.563  85.963  29.578  1.00 79.82           C  
ATOM   2316  CD2 TRP A 302      37.941  84.361  30.313  1.00 78.92           C  
ATOM   2317  NE1 TRP A 302      36.461  85.918  30.947  1.00 79.29           N  
ATOM   2318  CE2 TRP A 302      37.295  84.942  31.423  1.00 78.02           C  
ATOM   2319  CE3 TRP A 302      38.859  83.330  30.532  1.00 78.72           C  
ATOM   2320  CZ2 TRP A 302      37.537  84.526  32.733  1.00 78.05           C  
ATOM   2321  CZ3 TRP A 302      39.100  82.919  31.838  1.00 78.68           C  
ATOM   2322  CH2 TRP A 302      38.440  83.516  32.919  1.00 77.07           C  
ATOM   2323  N   ASP A 303      40.267  85.944  26.009  1.00 81.65           N  
ATOM   2324  CA  ASP A 303      41.329  85.700  25.043  1.00 81.18           C  
ATOM   2325  C   ASP A 303      42.539  85.092  25.735  1.00 78.21           C  
ATOM   2326  O   ASP A 303      42.576  84.987  26.962  1.00 77.41           O  
ATOM   2327  CB  ASP A 303      41.724  87.009  24.339  1.00 83.55           C  
ATOM   2328  CG  ASP A 303      41.913  88.165  25.311  1.00 87.32           C  
ATOM   2329  OD1 ASP A 303      42.853  88.116  26.138  1.00 88.91           O  
ATOM   2330  OD2 ASP A 303      41.115  89.128  25.250  1.00 89.82           O  
ATOM   2331  N   ALA A 304      43.519  84.699  24.930  1.00 73.86           N  
ATOM   2332  CA  ALA A 304      44.746  84.097  25.412  1.00 72.08           C  
ATOM   2333  C   ALA A 304      45.300  84.820  26.633  1.00 71.83           C  
ATOM   2334  O   ALA A 304      45.597  84.205  27.656  1.00 73.08           O  
ATOM   2335  CB  ALA A 304      45.776  84.090  24.301  1.00 70.06           C  
ATOM   2336  N   GLN A 305      45.441  86.131  26.529  1.00 72.04           N  
ATOM   2337  CA  GLN A 305      45.976  86.916  27.635  1.00 71.09           C  
ATOM   2338  C   GLN A 305      45.206  86.718  28.935  1.00 68.38           C  
ATOM   2339  O   GLN A 305      45.807  86.551  30.000  1.00 66.84           O  
ATOM   2340  CB  GLN A 305      45.979  88.395  27.263  1.00 72.34           C  
ATOM   2341  CG  GLN A 305      46.879  88.720  26.090  1.00 78.53           C  
ATOM   2342  CD  GLN A 305      48.350  88.561  26.421  1.00 79.61           C  
ATOM   2343  OE1 GLN A 305      48.843  89.124  27.408  1.00 77.68           O  
ATOM   2344  NE2 GLN A 305      49.066  87.802  25.591  1.00 77.89           N  
ATOM   2345  N   ARG A 306      43.878  86.753  28.843  1.00 65.42           N  
ATOM   2346  CA  ARG A 306      43.024  86.588  30.010  1.00 63.53           C  
ATOM   2347  C   ARG A 306      43.170  85.175  30.577  1.00 61.22           C  
ATOM   2348  O   ARG A 306      43.162  84.982  31.787  1.00 59.95           O  
ATOM   2349  CB  ARG A 306      41.565  86.860  29.635  1.00 64.27           C  
ATOM   2350  CG  ARG A 306      40.587  86.732  30.792  1.00 64.46           C  
ATOM   2351  CD  ARG A 306      40.897  87.727  31.894  1.00 66.37           C  
ATOM   2352  NE  ARG A 306      39.969  87.603  33.012  1.00 66.44           N  
ATOM   2353  CZ  ARG A 306      38.645  87.675  32.898  1.00 70.47           C  
ATOM   2354  NH1 ARG A 306      38.086  87.871  31.706  1.00 69.50           N  
ATOM   2355  NH2 ARG A 306      37.877  87.550  33.977  1.00 70.09           N  
ATOM   2356  N   ILE A 307      43.301  84.194  29.692  1.00 59.26           N  
ATOM   2357  CA  ILE A 307      43.476  82.811  30.116  1.00 60.94           C  
ATOM   2358  C   ILE A 307      44.739  82.663  30.976  1.00 63.07           C  
ATOM   2359  O   ILE A 307      44.665  82.169  32.103  1.00 62.91           O  
ATOM   2360  CB  ILE A 307      43.557  81.884  28.905  1.00 57.81           C  
ATOM   2361  CG1 ILE A 307      42.147  81.712  28.328  1.00 57.73           C  
ATOM   2362  CG2 ILE A 307      44.211  80.569  29.288  1.00 55.36           C  
ATOM   2363  CD1 ILE A 307      42.060  80.807  27.136  1.00 53.75           C  
ATOM   2364  N   PHE A 308      45.881  83.122  30.462  1.00 63.69           N  
ATOM   2365  CA  PHE A 308      47.147  83.036  31.198  1.00 64.77           C  
ATOM   2366  C   PHE A 308      47.221  84.004  32.373  1.00 66.20           C  
ATOM   2367  O   PHE A 308      47.977  83.792  33.326  1.00 69.17           O  
ATOM   2368  CB  PHE A 308      48.325  83.274  30.253  1.00 61.00           C  
ATOM   2369  CG  PHE A 308      48.643  82.093  29.388  1.00 59.75           C  
ATOM   2370  CD1 PHE A 308      49.555  81.131  29.813  1.00 58.51           C  
ATOM   2371  CD2 PHE A 308      47.998  81.913  28.174  1.00 55.31           C  
ATOM   2372  CE1 PHE A 308      49.820  80.004  29.043  1.00 54.92           C  
ATOM   2373  CE2 PHE A 308      48.251  80.797  27.399  1.00 56.37           C  
ATOM   2374  CZ  PHE A 308      49.167  79.832  27.836  1.00 58.76           C  
ATOM   2375  N   LYS A 309      46.427  85.062  32.319  1.00 67.37           N  
ATOM   2376  CA  LYS A 309      46.425  86.031  33.399  1.00 67.90           C  
ATOM   2377  C   LYS A 309      45.637  85.427  34.550  1.00 69.03           C  
ATOM   2378  O   LYS A 309      45.945  85.661  35.725  1.00 69.86           O  
ATOM   2379  CB  LYS A 309      45.781  87.344  32.946  1.00 70.16           C  
ATOM   2380  CG  LYS A 309      45.900  88.469  33.964  1.00 69.59           C  
ATOM   2381  CD  LYS A 309      46.846  89.560  33.482  1.00 66.63           C  
ATOM   2382  CE  LYS A 309      48.148  88.980  32.988  1.00 64.75           C  
ATOM   2383  NZ  LYS A 309      49.128  90.049  32.650  1.00 66.67           N  
ATOM   2384  N   GLU A 310      44.620  84.639  34.214  1.00 67.04           N  
ATOM   2385  CA  GLU A 310      43.809  83.993  35.241  1.00 66.36           C  
ATOM   2386  C   GLU A 310      44.623  82.845  35.875  1.00 61.34           C  
ATOM   2387  O   GLU A 310      44.538  82.601  37.071  1.00 57.37           O  
ATOM   2388  CB  GLU A 310      42.503  83.474  34.622  1.00 70.17           C  
ATOM   2389  CG  GLU A 310      41.305  83.478  35.567  1.00 73.34           C  
ATOM   2390  CD  GLU A 310      40.844  84.879  35.961  1.00 74.84           C  
ATOM   2391  OE1 GLU A 310      40.572  85.701  35.058  1.00 77.11           O  
ATOM   2392  OE2 GLU A 310      40.737  85.152  37.176  1.00 73.90           O  
ATOM   2393  N   ALA A 311      45.421  82.158  35.061  1.00 60.07           N  
ATOM   2394  CA  ALA A 311      46.276  81.080  35.553  1.00 59.38           C  
ATOM   2395  C   ALA A 311      47.306  81.713  36.492  1.00 60.52           C  
ATOM   2396  O   ALA A 311      47.557  81.209  37.584  1.00 62.27           O  
ATOM   2397  CB  ALA A 311      46.980  80.380  34.390  1.00 53.16           C  
ATOM   2398  N   GLU A 312      47.894  82.828  36.070  1.00 60.75           N  
ATOM   2399  CA  GLU A 312      48.872  83.515  36.903  1.00 59.58           C  
ATOM   2400  C   GLU A 312      48.248  83.917  38.230  1.00 58.16           C  
ATOM   2401  O   GLU A 312      48.881  83.807  39.285  1.00 60.02           O  
ATOM   2402  CB  GLU A 312      49.413  84.756  36.186  1.00 59.99           C  
ATOM   2403  CG  GLU A 312      50.310  85.640  37.055  1.00 59.73           C  
ATOM   2404  CD  GLU A 312      50.803  86.877  36.309  1.00 63.65           C  
ATOM   2405  OE1 GLU A 312      49.957  87.634  35.784  1.00 64.41           O  
ATOM   2406  OE2 GLU A 312      52.031  87.091  36.244  1.00 61.95           O  
ATOM   2407  N   LYS A 313      47.002  84.373  38.184  1.00 56.13           N  
ATOM   2408  CA  LYS A 313      46.324  84.789  39.400  1.00 57.03           C  
ATOM   2409  C   LYS A 313      46.070  83.587  40.317  1.00 58.09           C  
ATOM   2410  O   LYS A 313      46.035  83.725  41.549  1.00 56.43           O  
ATOM   2411  CB  LYS A 313      45.006  85.495  39.063  1.00 59.15           C  
ATOM   2412  CG  LYS A 313      44.215  85.960  40.281  1.00 62.86           C  
ATOM   2413  CD  LYS A 313      43.058  86.891  39.908  1.00 66.57           C  
ATOM   2414  CE  LYS A 313      42.282  87.307  41.161  1.00 69.92           C  
ATOM   2415  NZ  LYS A 313      41.104  88.193  40.895  1.00 72.54           N  
ATOM   2416  N   PHE A 314      45.889  82.409  39.719  1.00 55.71           N  
ATOM   2417  CA  PHE A 314      45.657  81.206  40.503  1.00 51.53           C  
ATOM   2418  C   PHE A 314      46.861  80.886  41.390  1.00 50.55           C  
ATOM   2419  O   PHE A 314      46.701  80.552  42.559  1.00 48.36           O  
ATOM   2420  CB  PHE A 314      45.376  80.019  39.588  1.00 54.32           C  
ATOM   2421  CG  PHE A 314      45.547  78.687  40.264  1.00 54.76           C  
ATOM   2422  CD1 PHE A 314      44.609  78.229  41.170  1.00 56.52           C  
ATOM   2423  CD2 PHE A 314      46.657  77.898  39.995  1.00 53.92           C  
ATOM   2424  CE1 PHE A 314      44.766  77.003  41.797  1.00 57.78           C  
ATOM   2425  CE2 PHE A 314      46.824  76.676  40.616  1.00 56.93           C  
ATOM   2426  CZ  PHE A 314      45.874  76.226  41.519  1.00 57.91           C  
ATOM   2427  N   PHE A 315      48.066  80.989  40.835  1.00 50.89           N  
ATOM   2428  CA  PHE A 315      49.280  80.692  41.596  1.00 54.06           C  
ATOM   2429  C   PHE A 315      49.566  81.713  42.696  1.00 57.15           C  
ATOM   2430  O   PHE A 315      49.811  81.343  43.860  1.00 58.31           O  
ATOM   2431  CB  PHE A 315      50.468  80.580  40.654  1.00 51.02           C  
ATOM   2432  CG  PHE A 315      50.384  79.413  39.715  1.00 50.90           C  
ATOM   2433  CD1 PHE A 315      50.583  78.122  40.174  1.00 52.79           C  
ATOM   2434  CD2 PHE A 315      50.078  79.600  38.380  1.00 48.60           C  
ATOM   2435  CE1 PHE A 315      50.474  77.030  39.310  1.00 50.99           C  
ATOM   2436  CE2 PHE A 315      49.969  78.522  37.519  1.00 47.80           C  
ATOM   2437  CZ  PHE A 315      50.167  77.238  37.987  1.00 49.31           C  
ATOM   2438  N   VAL A 316      49.525  82.992  42.337  1.00 58.00           N  
ATOM   2439  CA  VAL A 316      49.746  84.058  43.306  1.00 58.29           C  
ATOM   2440  C   VAL A 316      48.790  83.853  44.482  1.00 58.40           C  
ATOM   2441  O   VAL A 316      49.137  84.102  45.634  1.00 57.94           O  
ATOM   2442  CB  VAL A 316      49.493  85.457  42.666  1.00 59.02           C  
ATOM   2443  CG1 VAL A 316      49.357  86.526  43.741  1.00 55.37           C  
ATOM   2444  CG2 VAL A 316      50.646  85.806  41.737  1.00 57.63           C  
ATOM   2445  N   SER A 317      47.589  83.372  44.193  1.00 59.73           N  
ATOM   2446  CA  SER A 317      46.602  83.159  45.245  1.00 60.58           C  
ATOM   2447  C   SER A 317      47.072  82.163  46.299  1.00 61.85           C  
ATOM   2448  O   SER A 317      46.529  82.144  47.400  1.00 61.36           O  
ATOM   2449  CB  SER A 317      45.278  82.680  44.654  1.00 60.84           C  
ATOM   2450  OG  SER A 317      45.329  81.293  44.383  1.00 64.65           O  
ATOM   2451  N   VAL A 318      48.057  81.323  45.974  1.00 60.17           N  
ATOM   2452  CA  VAL A 318      48.558  80.378  46.979  1.00 60.09           C  
ATOM   2453  C   VAL A 318      49.994  80.680  47.430  1.00 60.99           C  
ATOM   2454  O   VAL A 318      50.670  79.816  48.004  1.00 59.00           O  
ATOM   2455  CB  VAL A 318      48.491  78.891  46.506  1.00 58.68           C  
ATOM   2456  CG1 VAL A 318      47.049  78.481  46.261  1.00 57.78           C  
ATOM   2457  CG2 VAL A 318      49.334  78.691  45.266  1.00 56.09           C  
ATOM   2458  N   GLY A 319      50.461  81.898  47.161  1.00 60.20           N  
ATOM   2459  CA  GLY A 319      51.795  82.280  47.596  1.00 64.44           C  
ATOM   2460  C   GLY A 319      52.947  82.208  46.601  1.00 66.64           C  
ATOM   2461  O   GLY A 319      54.086  82.566  46.943  1.00 65.92           O  
ATOM   2462  N   LEU A 320      52.677  81.738  45.385  1.00 64.71           N  
ATOM   2463  CA  LEU A 320      53.723  81.653  44.376  1.00 62.85           C  
ATOM   2464  C   LEU A 320      53.821  83.019  43.715  1.00 62.26           C  
ATOM   2465  O   LEU A 320      52.903  83.834  43.825  1.00 64.89           O  
ATOM   2466  CB  LEU A 320      53.393  80.560  43.347  1.00 59.02           C  
ATOM   2467  CG  LEU A 320      53.355  79.142  43.935  1.00 60.33           C  
ATOM   2468  CD1 LEU A 320      52.785  78.152  42.930  1.00 57.01           C  
ATOM   2469  CD2 LEU A 320      54.753  78.731  44.350  1.00 58.50           C  
ATOM   2470  N   PRO A 321      54.948  83.297  43.038  1.00 63.45           N  
ATOM   2471  CA  PRO A 321      55.196  84.566  42.351  1.00 62.37           C  
ATOM   2472  C   PRO A 321      54.505  84.738  41.007  1.00 64.75           C  
ATOM   2473  O   PRO A 321      54.094  83.767  40.371  1.00 63.47           O  
ATOM   2474  CB  PRO A 321      56.716  84.578  42.207  1.00 62.24           C  
ATOM   2475  CG  PRO A 321      57.036  83.145  42.005  1.00 61.80           C  
ATOM   2476  CD  PRO A 321      56.178  82.480  43.071  1.00 62.84           C  
ATOM   2477  N   ASN A 322      54.386  85.995  40.588  1.00 65.70           N  
ATOM   2478  CA  ASN A 322      53.779  86.355  39.308  1.00 66.11           C  
ATOM   2479  C   ASN A 322      54.709  85.833  38.229  1.00 64.76           C  
ATOM   2480  O   ASN A 322      55.862  85.507  38.500  1.00 64.59           O  
ATOM   2481  CB  ASN A 322      53.704  87.884  39.158  1.00 66.94           C  
ATOM   2482  CG  ASN A 322      52.399  88.476  39.662  1.00 70.28           C  
ATOM   2483  OD1 ASN A 322      51.320  88.152  39.158  1.00 71.26           O  
ATOM   2484  ND2 ASN A 322      52.492  89.366  40.647  1.00 70.85           N  
ATOM   2485  N   MET A 323      54.215  85.745  37.005  1.00 63.56           N  
ATOM   2486  CA  MET A 323      55.074  85.324  35.909  1.00 64.21           C  
ATOM   2487  C   MET A 323      56.100  86.451  35.777  1.00 65.94           C  
ATOM   2488  O   MET A 323      55.854  87.565  36.256  1.00 68.85           O  
ATOM   2489  CB  MET A 323      54.262  85.211  34.627  1.00 62.19           C  
ATOM   2490  CG  MET A 323      53.399  83.971  34.567  1.00 62.18           C  
ATOM   2491  SD  MET A 323      54.449  82.507  34.539  1.00 63.01           S  
ATOM   2492  CE  MET A 323      54.516  82.118  36.283  1.00 58.67           C  
ATOM   2493  N   THR A 324      57.247  86.190  35.157  1.00 62.85           N  
ATOM   2494  CA  THR A 324      58.223  87.257  35.014  1.00 60.96           C  
ATOM   2495  C   THR A 324      57.893  88.184  33.859  1.00 64.79           C  
ATOM   2496  O   THR A 324      57.130  87.840  32.946  1.00 61.95           O  
ATOM   2497  CB  THR A 324      59.638  86.755  34.727  1.00 60.70           C  
ATOM   2498  OG1 THR A 324      59.668  86.131  33.435  1.00 56.80           O  
ATOM   2499  CG2 THR A 324      60.110  85.800  35.815  1.00 59.12           C  
ATOM   2500  N   GLN A 325      58.484  89.373  33.927  1.00 67.22           N  
ATOM   2501  CA  GLN A 325      58.354  90.377  32.885  1.00 70.68           C  
ATOM   2502  C   GLN A 325      59.224  89.723  31.823  1.00 69.02           C  
ATOM   2503  O   GLN A 325      60.359  89.342  32.097  1.00 71.29           O  
ATOM   2504  CB  GLN A 325      58.980  91.694  33.364  1.00 74.71           C  
ATOM   2505  CG  GLN A 325      58.790  92.887  32.433  1.00 82.47           C  
ATOM   2506  CD  GLN A 325      59.388  92.662  31.061  1.00 85.05           C  
ATOM   2507  OE1 GLN A 325      60.579  92.356  30.927  1.00 87.17           O  
ATOM   2508  NE2 GLN A 325      58.565  92.814  30.028  1.00 88.76           N  
ATOM   2509  N   GLY A 326      58.723  89.564  30.615  1.00 68.77           N  
ATOM   2510  CA  GLY A 326      59.562  88.898  29.632  1.00 68.84           C  
ATOM   2511  C   GLY A 326      58.888  87.590  29.307  1.00 66.80           C  
ATOM   2512  O   GLY A 326      58.877  87.157  28.157  1.00 68.69           O  
ATOM   2513  N   PHE A 327      58.345  86.943  30.334  1.00 65.23           N  
ATOM   2514  CA  PHE A 327      57.589  85.732  30.107  1.00 63.53           C  
ATOM   2515  C   PHE A 327      56.440  86.247  29.244  1.00 60.74           C  
ATOM   2516  O   PHE A 327      56.150  85.704  28.190  1.00 60.91           O  
ATOM   2517  CB  PHE A 327      57.040  85.157  31.418  1.00 63.39           C  
ATOM   2518  CG  PHE A 327      55.828  84.287  31.223  1.00 63.17           C  
ATOM   2519  CD1 PHE A 327      54.548  84.806  31.393  1.00 60.27           C  
ATOM   2520  CD2 PHE A 327      55.965  82.969  30.805  1.00 62.40           C  
ATOM   2521  CE1 PHE A 327      53.435  84.038  31.149  1.00 59.35           C  
ATOM   2522  CE2 PHE A 327      54.855  82.193  30.556  1.00 62.11           C  
ATOM   2523  CZ  PHE A 327      53.581  82.727  30.727  1.00 61.99           C  
ATOM   2524  N   TRP A 328      55.809  87.327  29.687  1.00 60.40           N  
ATOM   2525  CA  TRP A 328      54.707  87.927  28.932  1.00 65.01           C  
ATOM   2526  C   TRP A 328      55.143  88.519  27.583  1.00 66.23           C  
ATOM   2527  O   TRP A 328      54.373  88.527  26.620  1.00 65.77           O  
ATOM   2528  CB  TRP A 328      54.033  89.028  29.752  1.00 62.91           C  
ATOM   2529  CG  TRP A 328      53.282  88.530  30.935  1.00 60.27           C  
ATOM   2530  CD1 TRP A 328      53.610  88.703  32.242  1.00 58.56           C  
ATOM   2531  CD2 TRP A 328      52.059  87.783  30.921  1.00 60.56           C  
ATOM   2532  NE1 TRP A 328      52.667  88.113  33.050  1.00 60.93           N  
ATOM   2533  CE2 TRP A 328      51.705  87.539  32.262  1.00 61.89           C  
ATOM   2534  CE3 TRP A 328      51.232  87.295  29.908  1.00 58.20           C  
ATOM   2535  CZ2 TRP A 328      50.555  86.833  32.612  1.00 62.86           C  
ATOM   2536  CZ3 TRP A 328      50.094  86.599  30.255  1.00 56.47           C  
ATOM   2537  CH2 TRP A 328      49.764  86.372  31.592  1.00 61.15           C  
ATOM   2538  N   GLU A 329      56.379  89.004  27.516  1.00 69.20           N  
ATOM   2539  CA  GLU A 329      56.895  89.599  26.286  1.00 73.05           C  
ATOM   2540  C   GLU A 329      57.499  88.607  25.294  1.00 73.39           C  
ATOM   2541  O   GLU A 329      57.355  88.764  24.081  1.00 75.53           O  
ATOM   2542  CB  GLU A 329      57.937  90.670  26.615  1.00 77.83           C  
ATOM   2543  CG  GLU A 329      58.456  91.434  25.386  1.00 87.03           C  
ATOM   2544  CD  GLU A 329      57.415  92.377  24.757  1.00 90.64           C  
ATOM   2545  OE1 GLU A 329      56.279  91.931  24.468  1.00 91.19           O  
ATOM   2546  OE2 GLU A 329      57.744  93.568  24.542  1.00 93.04           O  
ATOM   2547  N   ASN A 330      58.169  87.579  25.796  1.00 73.29           N  
ATOM   2548  CA  ASN A 330      58.797  86.597  24.917  1.00 71.70           C  
ATOM   2549  C   ASN A 330      57.932  85.389  24.572  1.00 70.42           C  
ATOM   2550  O   ASN A 330      58.254  84.650  23.643  1.00 70.99           O  
ATOM   2551  CB  ASN A 330      60.098  86.119  25.548  1.00 71.80           C  
ATOM   2552  CG  ASN A 330      61.005  87.258  25.911  1.00 71.46           C  
ATOM   2553  OD1 ASN A 330      61.567  87.295  27.004  1.00 68.86           O  
ATOM   2554  ND2 ASN A 330      61.159  88.203  24.987  1.00 72.24           N  
ATOM   2555  N   SER A 331      56.850  85.184  25.320  1.00 70.20           N  
ATOM   2556  CA  SER A 331      55.959  84.044  25.091  1.00 70.53           C  
ATOM   2557  C   SER A 331      55.102  84.195  23.847  1.00 71.10           C  
ATOM   2558  O   SER A 331      54.661  85.293  23.510  1.00 73.33           O  
ATOM   2559  CB  SER A 331      55.000  83.835  26.280  1.00 69.64           C  
ATOM   2560  OG  SER A 331      55.636  83.352  27.447  1.00 67.38           O  
ATOM   2561  N   MET A 332      54.868  83.079  23.173  1.00 71.54           N  
ATOM   2562  CA  MET A 332      54.002  83.052  22.007  1.00 72.01           C  
ATOM   2563  C   MET A 332      52.752  82.345  22.520  1.00 72.59           C  
ATOM   2564  O   MET A 332      52.658  81.121  22.472  1.00 72.63           O  
ATOM   2565  CB  MET A 332      54.619  82.243  20.860  1.00 70.56           C  
ATOM   2566  CG  MET A 332      53.677  82.077  19.680  1.00 72.34           C  
ATOM   2567  SD  MET A 332      54.361  81.198  18.259  1.00 74.33           S  
ATOM   2568  CE  MET A 332      55.301  82.531  17.492  1.00 77.67           C  
ATOM   2569  N   LEU A 333      51.807  83.123  23.032  1.00 72.53           N  
ATOM   2570  CA  LEU A 333      50.564  82.589  23.570  1.00 74.00           C  
ATOM   2571  C   LEU A 333      49.454  82.362  22.529  1.00 76.36           C  
ATOM   2572  O   LEU A 333      48.372  81.887  22.875  1.00 74.89           O  
ATOM   2573  CB  LEU A 333      50.055  83.521  24.679  1.00 70.63           C  
ATOM   2574  CG  LEU A 333      50.547  83.281  26.110  1.00 71.79           C  
ATOM   2575  CD1 LEU A 333      51.949  82.741  26.094  1.00 73.43           C  
ATOM   2576  CD2 LEU A 333      50.468  84.575  26.912  1.00 70.26           C  
ATOM   2577  N   THR A 334      49.720  82.692  21.263  1.00 80.29           N  
ATOM   2578  CA  THR A 334      48.726  82.530  20.184  1.00 82.33           C  
ATOM   2579  C   THR A 334      49.359  82.101  18.861  1.00 83.11           C  
ATOM   2580  O   THR A 334      50.516  82.409  18.596  1.00 83.36           O  
ATOM   2581  CB  THR A 334      47.957  83.850  19.926  1.00 82.53           C  
ATOM   2582  OG1 THR A 334      48.883  84.944  19.922  1.00 83.58           O  
ATOM   2583  CG2 THR A 334      46.903  84.091  20.998  1.00 83.76           C  
ATOM   2584  N   ASP A 335      48.606  81.391  18.025  1.00 86.17           N  
ATOM   2585  CA  ASP A 335      49.142  80.964  16.736  1.00 89.66           C  
ATOM   2586  C   ASP A 335      49.241  82.202  15.860  1.00 91.18           C  
ATOM   2587  O   ASP A 335      48.256  82.914  15.671  1.00 91.35           O  
ATOM   2588  CB  ASP A 335      48.229  79.923  16.071  1.00 90.09           C  
ATOM   2589  CG  ASP A 335      48.834  79.339  14.791  1.00 92.03           C  
ATOM   2590  OD1 ASP A 335      48.311  78.318  14.287  1.00 90.12           O  
ATOM   2591  OD2 ASP A 335      49.832  79.903  14.285  1.00 93.16           O  
ATOM   2592  N   PRO A 336      50.441  82.484  15.330  1.00 92.85           N  
ATOM   2593  CA  PRO A 336      50.697  83.644  14.468  1.00 95.62           C  
ATOM   2594  C   PRO A 336      49.967  83.563  13.126  1.00 97.31           C  
ATOM   2595  O   PRO A 336      50.051  84.482  12.308  1.00 96.59           O  
ATOM   2596  CB  PRO A 336      52.215  83.622  14.298  1.00 94.92           C  
ATOM   2597  CG  PRO A 336      52.693  82.910  15.512  1.00 93.46           C  
ATOM   2598  CD  PRO A 336      51.699  81.793  15.646  1.00 92.84           C  
ATOM   2599  N   GLY A 337      49.261  82.454  12.912  1.00 99.66           N  
ATOM   2600  CA  GLY A 337      48.512  82.257  11.683  1.00100.75           C  
ATOM   2601  C   GLY A 337      49.342  81.768  10.511  1.00102.54           C  
ATOM   2602  O   GLY A 337      50.238  80.932  10.664  1.00102.48           O  
ATOM   2603  N   ASN A 338      49.030  82.299   9.332  1.00103.92           N  
ATOM   2604  CA  ASN A 338      49.717  81.945   8.094  1.00104.06           C  
ATOM   2605  C   ASN A 338      51.009  82.741   7.915  1.00103.66           C  
ATOM   2606  O   ASN A 338      51.116  83.879   8.379  1.00104.24           O  
ATOM   2607  CB  ASN A 338      48.789  82.203   6.900  1.00105.29           C  
ATOM   2608  CG  ASN A 338      48.267  83.640   6.860  1.00106.94           C  
ATOM   2609  OD1 ASN A 338      47.590  84.043   5.911  1.00107.47           O  
ATOM   2610  ND2 ASN A 338      48.579  84.416   7.896  1.00106.57           N  
ATOM   2611  N   VAL A 339      51.983  82.138   7.237  1.00102.57           N  
ATOM   2612  CA  VAL A 339      53.268  82.787   6.980  1.00102.77           C  
ATOM   2613  C   VAL A 339      54.125  82.832   8.249  1.00102.90           C  
ATOM   2614  O   VAL A 339      55.241  83.362   8.255  1.00102.47           O  
ATOM   2615  CB  VAL A 339      53.064  84.228   6.435  1.00102.66           C  
ATOM   2616  CG1 VAL A 339      54.392  84.808   5.969  1.00102.72           C  
ATOM   2617  CG2 VAL A 339      52.063  84.214   5.286  1.00101.81           C  
ATOM   2618  N   GLN A 340      53.588  82.268   9.324  1.00102.89           N  
ATOM   2619  CA  GLN A 340      54.283  82.208  10.605  1.00100.89           C  
ATOM   2620  C   GLN A 340      54.111  80.808  11.171  1.00100.04           C  
ATOM   2621  O   GLN A 340      53.737  80.629  12.330  1.00101.80           O  
ATOM   2622  CB  GLN A 340      53.706  83.239  11.577  1.00100.23           C  
ATOM   2623  CG  GLN A 340      54.397  84.596  11.556  1.00 96.32           C  
ATOM   2624  CD  GLN A 340      55.776  84.557  12.191  1.00 94.09           C  
ATOM   2625  OE1 GLN A 340      56.647  83.801  11.760  1.00 94.00           O  
ATOM   2626  NE2 GLN A 340      55.980  85.374  13.221  1.00 90.31           N  
ATOM   2627  N   LYS A 341      54.377  79.815  10.333  1.00 98.15           N  
ATOM   2628  CA  LYS A 341      54.255  78.430  10.741  1.00 98.17           C  
ATOM   2629  C   LYS A 341      55.049  78.181  12.021  1.00 97.76           C  
ATOM   2630  O   LYS A 341      56.148  78.712  12.209  1.00 97.01           O  
ATOM   2631  CB  LYS A 341      54.741  77.509   9.615  1.00 99.02           C  
ATOM   2632  CG  LYS A 341      56.146  77.816   9.109  1.00100.81           C  
ATOM   2633  CD  LYS A 341      56.485  77.040   7.830  1.00101.63           C  
ATOM   2634  CE  LYS A 341      56.471  75.525   8.031  1.00100.48           C  
ATOM   2635  NZ  LYS A 341      55.119  74.985   8.358  1.00 98.34           N  
ATOM   2636  N   ALA A 342      54.470  77.378  12.906  1.00 96.23           N  
ATOM   2637  CA  ALA A 342      55.102  77.045  14.173  1.00 94.00           C  
ATOM   2638  C   ALA A 342      54.520  75.744  14.686  1.00 92.37           C  
ATOM   2639  O   ALA A 342      53.439  75.330  14.267  1.00 92.49           O  
ATOM   2640  CB  ALA A 342      54.855  78.154  15.186  1.00 92.37           C  
ATOM   2641  N   VAL A 343      55.240  75.088  15.585  1.00 90.77           N  
ATOM   2642  CA  VAL A 343      54.735  73.855  16.161  1.00 88.70           C  
ATOM   2643  C   VAL A 343      53.806  74.322  17.290  1.00 87.55           C  
ATOM   2644  O   VAL A 343      54.197  75.140  18.124  1.00 86.22           O  
ATOM   2645  CB  VAL A 343      55.891  72.986  16.705  1.00 88.74           C  
ATOM   2646  CG1 VAL A 343      57.110  73.143  15.802  1.00 87.66           C  
ATOM   2647  CG2 VAL A 343      56.221  73.364  18.133  1.00 89.49           C  
ATOM   2648  N   CYS A 344      52.570  73.828  17.303  1.00 86.40           N  
ATOM   2649  CA  CYS A 344      51.609  74.245  18.321  1.00 83.34           C  
ATOM   2650  C   CYS A 344      51.461  73.362  19.550  1.00 79.64           C  
ATOM   2651  O   CYS A 344      50.598  73.616  20.389  1.00 79.64           O  
ATOM   2652  CB  CYS A 344      50.230  74.443  17.697  1.00 85.40           C  
ATOM   2653  SG  CYS A 344      50.047  75.973  16.728  1.00 86.77           S  
ATOM   2654  N   HIS A 345      52.272  72.320  19.659  1.00 76.96           N  
ATOM   2655  CA  HIS A 345      52.196  71.463  20.837  1.00 74.09           C  
ATOM   2656  C   HIS A 345      52.480  72.369  22.032  1.00 67.87           C  
ATOM   2657  O   HIS A 345      53.483  73.071  22.060  1.00 64.87           O  
ATOM   2658  CB  HIS A 345      53.248  70.353  20.768  1.00 77.44           C  
ATOM   2659  CG  HIS A 345      53.119  69.470  19.564  1.00 84.94           C  
ATOM   2660  ND1 HIS A 345      53.202  69.952  18.274  1.00 88.34           N  
ATOM   2661  CD2 HIS A 345      52.933  68.132  19.455  1.00 87.51           C  
ATOM   2662  CE1 HIS A 345      53.075  68.948  17.421  1.00 88.83           C  
ATOM   2663  NE2 HIS A 345      52.911  67.834  18.111  1.00 89.64           N  
ATOM   2664  N   PRO A 346      51.581  72.392  23.020  1.00 65.05           N  
ATOM   2665  CA  PRO A 346      51.804  73.242  24.197  1.00 64.53           C  
ATOM   2666  C   PRO A 346      53.132  72.837  24.863  1.00 64.06           C  
ATOM   2667  O   PRO A 346      53.414  71.644  25.025  1.00 64.16           O  
ATOM   2668  CB  PRO A 346      50.598  72.927  25.087  1.00 66.00           C  
ATOM   2669  CG  PRO A 346      49.554  72.436  24.107  1.00 64.05           C  
ATOM   2670  CD  PRO A 346      50.347  71.602  23.156  1.00 60.69           C  
ATOM   2671  N   THR A 347      53.947  73.816  25.234  1.00 59.37           N  
ATOM   2672  CA  THR A 347      55.226  73.521  25.856  1.00 59.64           C  
ATOM   2673  C   THR A 347      55.704  74.650  26.767  1.00 60.90           C  
ATOM   2674  O   THR A 347      55.486  75.834  26.482  1.00 58.83           O  
ATOM   2675  CB  THR A 347      56.308  73.247  24.801  1.00 59.14           C  
ATOM   2676  OG1 THR A 347      56.288  74.293  23.830  1.00 62.12           O  
ATOM   2677  CG2 THR A 347      56.081  71.908  24.113  1.00 58.65           C  
ATOM   2678  N   ALA A 348      56.345  74.268  27.873  1.00 59.46           N  
ATOM   2679  CA  ALA A 348      56.869  75.227  28.852  1.00 57.63           C  
ATOM   2680  C   ALA A 348      58.383  75.254  28.716  1.00 54.03           C  
ATOM   2681  O   ALA A 348      59.031  74.213  28.756  1.00 55.61           O  
ATOM   2682  CB  ALA A 348      56.461  74.810  30.265  1.00 52.64           C  
ATOM   2683  N   TRP A 349      58.958  76.437  28.559  1.00 53.50           N  
ATOM   2684  CA  TRP A 349      60.394  76.511  28.368  1.00 53.08           C  
ATOM   2685  C   TRP A 349      61.184  77.163  29.482  1.00 52.65           C  
ATOM   2686  O   TRP A 349      60.784  78.181  30.046  1.00 55.24           O  
ATOM   2687  CB  TRP A 349      60.731  77.260  27.071  1.00 55.09           C  
ATOM   2688  CG  TRP A 349      60.219  76.650  25.798  1.00 55.44           C  
ATOM   2689  CD1 TRP A 349      58.916  76.378  25.487  1.00 54.58           C  
ATOM   2690  CD2 TRP A 349      60.985  76.334  24.625  1.00 53.32           C  
ATOM   2691  NE1 TRP A 349      58.824  75.921  24.198  1.00 55.38           N  
ATOM   2692  CE2 TRP A 349      60.074  75.883  23.643  1.00 54.35           C  
ATOM   2693  CE3 TRP A 349      62.348  76.393  24.308  1.00 55.76           C  
ATOM   2694  CZ2 TRP A 349      60.481  75.495  22.358  1.00 54.17           C  
ATOM   2695  CZ3 TRP A 349      62.756  76.011  23.031  1.00 58.47           C  
ATOM   2696  CH2 TRP A 349      61.820  75.566  22.070  1.00 58.83           C  
ATOM   2697  N   ASP A 350      62.329  76.563  29.767  1.00 53.35           N  
ATOM   2698  CA  ASP A 350      63.269  77.063  30.761  1.00 53.91           C  
ATOM   2699  C   ASP A 350      64.542  77.219  29.920  1.00 49.88           C  
ATOM   2700  O   ASP A 350      65.363  76.326  29.839  1.00 48.44           O  
ATOM   2701  CB  ASP A 350      63.440  76.031  31.886  1.00 53.82           C  
ATOM   2702  CG  ASP A 350      64.463  76.462  32.941  1.00 60.89           C  
ATOM   2703  OD1 ASP A 350      64.383  75.950  34.076  1.00 61.59           O  
ATOM   2704  OD2 ASP A 350      65.352  77.296  32.648  1.00 62.12           O  
ATOM   2705  N   LEU A 351      64.687  78.359  29.261  1.00 53.49           N  
ATOM   2706  CA  LEU A 351      65.836  78.562  28.384  1.00 55.43           C  
ATOM   2707  C   LEU A 351      67.156  78.784  29.080  1.00 55.79           C  
ATOM   2708  O   LEU A 351      68.214  78.597  28.482  1.00 58.25           O  
ATOM   2709  CB  LEU A 351      65.578  79.727  27.425  1.00 60.71           C  
ATOM   2710  CG  LEU A 351      64.406  79.559  26.452  1.00 61.76           C  
ATOM   2711  CD1 LEU A 351      63.098  79.861  27.176  1.00 63.36           C  
ATOM   2712  CD2 LEU A 351      64.588  80.505  25.265  1.00 62.33           C  
ATOM   2713  N   GLY A 352      67.092  79.170  30.345  1.00 54.80           N  
ATOM   2714  CA  GLY A 352      68.294  79.428  31.096  1.00 54.51           C  
ATOM   2715  C   GLY A 352      68.345  80.889  31.481  1.00 55.27           C  
ATOM   2716  O   GLY A 352      67.493  81.688  31.078  1.00 49.60           O  
ATOM   2717  N   LYS A 353      69.346  81.223  32.286  1.00 58.42           N  
ATOM   2718  CA  LYS A 353      69.573  82.580  32.755  1.00 60.24           C  
ATOM   2719  C   LYS A 353      68.295  83.355  33.089  1.00 60.81           C  
ATOM   2720  O   LYS A 353      68.111  84.500  32.649  1.00 61.67           O  
ATOM   2721  CB  LYS A 353      70.405  83.333  31.718  1.00 63.28           C  
ATOM   2722  CG  LYS A 353      70.922  84.677  32.217  1.00 73.55           C  
ATOM   2723  CD  LYS A 353      71.545  84.571  33.620  1.00 77.29           C  
ATOM   2724  CE  LYS A 353      71.997  85.948  34.132  1.00 79.86           C  
ATOM   2725  NZ  LYS A 353      70.884  86.952  34.139  1.00 77.02           N  
ATOM   2726  N   GLY A 354      67.417  82.726  33.875  1.00 58.38           N  
ATOM   2727  CA  GLY A 354      66.173  83.360  34.273  1.00 55.23           C  
ATOM   2728  C   GLY A 354      65.157  83.629  33.168  1.00 54.49           C  
ATOM   2729  O   GLY A 354      64.223  84.416  33.349  1.00 51.95           O  
ATOM   2730  N   ASP A 355      65.323  82.978  32.023  1.00 54.41           N  
ATOM   2731  CA  ASP A 355      64.405  83.177  30.902  1.00 53.95           C  
ATOM   2732  C   ASP A 355      63.359  82.048  30.818  1.00 53.87           C  
ATOM   2733  O   ASP A 355      63.678  80.902  30.490  1.00 53.03           O  
ATOM   2734  CB  ASP A 355      65.221  83.255  29.616  1.00 54.46           C  
ATOM   2735  CG  ASP A 355      64.390  83.645  28.411  1.00 57.94           C  
ATOM   2736  OD1 ASP A 355      64.999  84.023  27.392  1.00 63.76           O  
ATOM   2737  OD2 ASP A 355      63.145  83.572  28.470  1.00 57.97           O  
ATOM   2738  N   PHE A 356      62.108  82.379  31.112  1.00 55.02           N  
ATOM   2739  CA  PHE A 356      61.031  81.394  31.097  1.00 56.97           C  
ATOM   2740  C   PHE A 356      59.973  81.774  30.070  1.00 57.94           C  
ATOM   2741  O   PHE A 356      59.608  82.939  29.966  1.00 58.12           O  
ATOM   2742  CB  PHE A 356      60.394  81.305  32.488  1.00 51.38           C  
ATOM   2743  CG  PHE A 356      61.387  81.046  33.589  1.00 55.82           C  
ATOM   2744  CD1 PHE A 356      61.916  82.094  34.330  1.00 51.94           C  
ATOM   2745  CD2 PHE A 356      61.827  79.749  33.861  1.00 54.62           C  
ATOM   2746  CE1 PHE A 356      62.874  81.857  35.331  1.00 54.67           C  
ATOM   2747  CE2 PHE A 356      62.781  79.506  34.853  1.00 54.70           C  
ATOM   2748  CZ  PHE A 356      63.306  80.559  35.591  1.00 51.98           C  
ATOM   2749  N   ARG A 357      59.475  80.798  29.315  1.00 57.83           N  
ATOM   2750  CA  ARG A 357      58.452  81.086  28.309  1.00 57.06           C  
ATOM   2751  C   ARG A 357      57.522  79.923  28.062  1.00 56.90           C  
ATOM   2752  O   ARG A 357      57.901  78.760  28.232  1.00 59.94           O  
ATOM   2753  CB  ARG A 357      59.083  81.429  26.959  1.00 54.96           C  
ATOM   2754  CG  ARG A 357      60.120  82.523  26.987  1.00 61.07           C  
ATOM   2755  CD  ARG A 357      60.738  82.731  25.615  1.00 59.53           C  
ATOM   2756  NE  ARG A 357      61.934  83.561  25.716  1.00 62.08           N  
ATOM   2757  CZ  ARG A 357      62.637  83.999  24.677  1.00 58.61           C  
ATOM   2758  NH1 ARG A 357      63.713  84.741  24.884  1.00 54.24           N  
ATOM   2759  NH2 ARG A 357      62.263  83.702  23.437  1.00 56.09           N  
ATOM   2760  N   ILE A 358      56.299  80.244  27.655  1.00 57.34           N  
ATOM   2761  CA  ILE A 358      55.326  79.220  27.278  1.00 54.97           C  
ATOM   2762  C   ILE A 358      54.999  79.431  25.796  1.00 56.47           C  
ATOM   2763  O   ILE A 358      54.769  80.564  25.344  1.00 55.29           O  
ATOM   2764  CB  ILE A 358      54.024  79.296  28.108  1.00 52.18           C  
ATOM   2765  CG1 ILE A 358      54.246  78.632  29.479  1.00 46.78           C  
ATOM   2766  CG2 ILE A 358      52.882  78.613  27.339  1.00 48.60           C  
ATOM   2767  CD1 ILE A 358      53.045  78.695  30.433  1.00 44.56           C  
ATOM   2768  N   LEU A 359      55.027  78.336  25.045  1.00 57.24           N  
ATOM   2769  CA  LEU A 359      54.718  78.328  23.626  1.00 55.38           C  
ATOM   2770  C   LEU A 359      53.443  77.521  23.497  1.00 59.75           C  
ATOM   2771  O   LEU A 359      53.414  76.330  23.819  1.00 58.48           O  
ATOM   2772  CB  LEU A 359      55.843  77.658  22.825  1.00 58.15           C  
ATOM   2773  CG  LEU A 359      55.533  77.196  21.388  1.00 61.77           C  
ATOM   2774  CD1 LEU A 359      54.716  78.233  20.646  1.00 60.54           C  
ATOM   2775  CD2 LEU A 359      56.829  76.927  20.655  1.00 59.42           C  
ATOM   2776  N   MET A 360      52.381  78.169  23.037  1.00 61.42           N  
ATOM   2777  CA  MET A 360      51.110  77.495  22.894  1.00 62.46           C  
ATOM   2778  C   MET A 360      50.184  78.328  22.008  1.00 66.12           C  
ATOM   2779  O   MET A 360      50.044  79.541  22.202  1.00 64.89           O  
ATOM   2780  CB  MET A 360      50.494  77.311  24.280  1.00 62.47           C  
ATOM   2781  CG  MET A 360      49.380  76.283  24.389  1.00 62.52           C  
ATOM   2782  SD  MET A 360      48.647  76.269  26.062  1.00 68.28           S  
ATOM   2783  CE  MET A 360      46.930  76.500  25.722  1.00 63.98           C  
ATOM   2784  N   CYS A 361      49.557  77.681  21.031  1.00 69.72           N  
ATOM   2785  CA  CYS A 361      48.624  78.380  20.147  1.00 73.15           C  
ATOM   2786  C   CYS A 361      47.289  78.267  20.854  1.00 73.33           C  
ATOM   2787  O   CYS A 361      46.464  77.414  20.528  1.00 73.54           O  
ATOM   2788  CB  CYS A 361      48.583  77.709  18.770  1.00 75.89           C  
ATOM   2789  SG  CYS A 361      50.256  77.465  18.091  1.00 80.51           S  
ATOM   2790  N   THR A 362      47.103  79.143  21.837  1.00 73.91           N  
ATOM   2791  CA  THR A 362      45.913  79.166  22.670  1.00 75.18           C  
ATOM   2792  C   THR A 362      44.592  79.491  21.975  1.00 76.55           C  
ATOM   2793  O   THR A 362      44.488  80.461  21.230  1.00 76.71           O  
ATOM   2794  CB  THR A 362      46.109  80.151  23.836  1.00 76.49           C  
ATOM   2795  OG1 THR A 362      47.339  79.852  24.507  1.00 79.43           O  
ATOM   2796  CG2 THR A 362      44.971  80.043  24.832  1.00 76.38           C  
ATOM   2797  N   LYS A 363      43.591  78.657  22.244  1.00 77.11           N  
ATOM   2798  CA  LYS A 363      42.239  78.811  21.715  1.00 77.20           C  
ATOM   2799  C   LYS A 363      41.347  79.109  22.920  1.00 77.52           C  
ATOM   2800  O   LYS A 363      41.654  78.688  24.039  1.00 78.50           O  
ATOM   2801  CB  LYS A 363      41.766  77.515  21.060  1.00 78.12           C  
ATOM   2802  CG  LYS A 363      42.675  76.975  19.967  1.00 82.55           C  
ATOM   2803  CD  LYS A 363      42.169  75.616  19.468  1.00 83.61           C  
ATOM   2804  CE  LYS A 363      43.057  75.037  18.369  1.00 85.33           C  
ATOM   2805  NZ  LYS A 363      42.469  73.798  17.782  1.00 84.21           N  
ATOM   2806  N   VAL A 364      40.246  79.821  22.704  1.00 75.77           N  
ATOM   2807  CA  VAL A 364      39.348  80.155  23.804  1.00 75.46           C  
ATOM   2808  C   VAL A 364      38.426  78.993  24.170  1.00 76.88           C  
ATOM   2809  O   VAL A 364      37.212  79.065  23.980  1.00 78.19           O  
ATOM   2810  CB  VAL A 364      38.491  81.387  23.464  1.00 73.98           C  
ATOM   2811  CG1 VAL A 364      37.604  81.755  24.650  1.00 73.74           C  
ATOM   2812  CG2 VAL A 364      39.396  82.550  23.108  1.00 73.02           C  
ATOM   2813  N   THR A 365      39.011  77.926  24.708  1.00 76.08           N  
ATOM   2814  CA  THR A 365      38.258  76.746  25.102  1.00 74.10           C  
ATOM   2815  C   THR A 365      38.519  76.409  26.563  1.00 72.64           C  
ATOM   2816  O   THR A 365      39.452  76.932  27.169  1.00 70.70           O  
ATOM   2817  CB  THR A 365      38.660  75.544  24.249  1.00 75.67           C  
ATOM   2818  OG1 THR A 365      38.410  75.845  22.872  1.00 78.42           O  
ATOM   2819  CG2 THR A 365      37.853  74.304  24.644  1.00 79.97           C  
ATOM   2820  N   MET A 366      37.687  75.545  27.134  1.00 70.73           N  
ATOM   2821  CA  MET A 366      37.886  75.145  28.515  1.00 69.54           C  
ATOM   2822  C   MET A 366      39.170  74.324  28.545  1.00 68.47           C  
ATOM   2823  O   MET A 366      40.003  74.483  29.436  1.00 69.75           O  
ATOM   2824  CB  MET A 366      36.719  74.296  29.015  1.00 68.14           C  
ATOM   2825  CG  MET A 366      36.744  74.066  30.522  1.00 68.11           C  
ATOM   2826  SD  MET A 366      35.450  72.964  31.126  1.00 67.95           S  
ATOM   2827  CE  MET A 366      36.308  71.368  30.973  1.00 68.26           C  
ATOM   2828  N   ASP A 367      39.339  73.462  27.551  1.00 65.68           N  
ATOM   2829  CA  ASP A 367      40.525  72.630  27.487  1.00 66.12           C  
ATOM   2830  C   ASP A 367      41.837  73.411  27.497  1.00 66.73           C  
ATOM   2831  O   ASP A 367      42.803  72.975  28.119  1.00 67.81           O  
ATOM   2832  CB  ASP A 367      40.480  71.719  26.259  1.00 66.63           C  
ATOM   2833  CG  ASP A 367      39.492  70.566  26.421  1.00 70.64           C  
ATOM   2834  OD1 ASP A 367      38.884  70.442  27.511  1.00 69.09           O  
ATOM   2835  OD2 ASP A 367      39.328  69.780  25.460  1.00 72.64           O  
ATOM   2836  N   ASP A 368      41.886  74.556  26.821  1.00 65.42           N  
ATOM   2837  CA  ASP A 368      43.120  75.343  26.783  1.00 63.63           C  
ATOM   2838  C   ASP A 368      43.317  76.192  28.015  1.00 60.43           C  
ATOM   2839  O   ASP A 368      44.418  76.661  28.284  1.00 60.17           O  
ATOM   2840  CB  ASP A 368      43.167  76.214  25.529  1.00 63.95           C  
ATOM   2841  CG  ASP A 368      43.517  75.416  24.309  1.00 64.04           C  
ATOM   2842  OD1 ASP A 368      42.975  74.302  24.178  1.00 66.89           O  
ATOM   2843  OD2 ASP A 368      44.326  75.888  23.484  1.00 70.78           O  
ATOM   2844  N   PHE A 369      42.238  76.392  28.756  1.00 57.90           N  
ATOM   2845  CA  PHE A 369      42.291  77.159  29.987  1.00 56.90           C  
ATOM   2846  C   PHE A 369      42.954  76.269  31.052  1.00 56.20           C  
ATOM   2847  O   PHE A 369      43.662  76.757  31.933  1.00 56.44           O  
ATOM   2848  CB  PHE A 369      40.863  77.568  30.385  1.00 52.69           C  
ATOM   2849  CG  PHE A 369      40.707  77.981  31.832  1.00 56.45           C  
ATOM   2850  CD1 PHE A 369      40.384  77.042  32.807  1.00 53.75           C  
ATOM   2851  CD2 PHE A 369      40.828  79.308  32.206  1.00 56.10           C  
ATOM   2852  CE1 PHE A 369      40.181  77.415  34.123  1.00 51.89           C  
ATOM   2853  CE2 PHE A 369      40.624  79.693  33.525  1.00 59.72           C  
ATOM   2854  CZ  PHE A 369      40.297  78.739  34.486  1.00 58.76           C  
ATOM   2855  N   LEU A 370      42.730  74.958  30.942  1.00 56.91           N  
ATOM   2856  CA  LEU A 370      43.291  73.976  31.872  1.00 55.54           C  
ATOM   2857  C   LEU A 370      44.726  73.651  31.483  1.00 55.81           C  
ATOM   2858  O   LEU A 370      45.573  73.422  32.347  1.00 56.10           O  
ATOM   2859  CB  LEU A 370      42.468  72.690  31.852  1.00 52.74           C  
ATOM   2860  CG  LEU A 370      40.990  72.834  32.200  1.00 54.62           C  
ATOM   2861  CD1 LEU A 370      40.272  71.517  31.947  1.00 51.33           C  
ATOM   2862  CD2 LEU A 370      40.850  73.279  33.654  1.00 54.74           C  
ATOM   2863  N   THR A 371      44.998  73.622  30.180  1.00 53.53           N  
ATOM   2864  CA  THR A 371      46.348  73.335  29.708  1.00 53.64           C  
ATOM   2865  C   THR A 371      47.290  74.468  30.106  1.00 54.37           C  
ATOM   2866  O   THR A 371      48.477  74.249  30.403  1.00 54.24           O  
ATOM   2867  CB  THR A 371      46.377  73.135  28.184  1.00 51.86           C  
ATOM   2868  OG1 THR A 371      45.777  71.878  27.867  1.00 50.38           O  
ATOM   2869  CG2 THR A 371      47.787  73.132  27.671  1.00 47.48           C  
ATOM   2870  N   ALA A 372      46.746  75.678  30.132  1.00 52.99           N  
ATOM   2871  CA  ALA A 372      47.517  76.849  30.515  1.00 52.05           C  
ATOM   2872  C   ALA A 372      47.942  76.725  31.983  1.00 51.28           C  
ATOM   2873  O   ALA A 372      49.060  77.096  32.342  1.00 51.10           O  
ATOM   2874  CB  ALA A 372      46.683  78.109  30.319  1.00 52.64           C  
ATOM   2875  N   HIS A 373      47.040  76.240  32.832  1.00 48.19           N  
ATOM   2876  CA  HIS A 373      47.360  76.066  34.240  1.00 49.40           C  
ATOM   2877  C   HIS A 373      48.414  74.963  34.369  1.00 50.74           C  
ATOM   2878  O   HIS A 373      49.432  75.127  35.054  1.00 48.51           O  
ATOM   2879  CB  HIS A 373      46.113  75.691  35.040  1.00 50.96           C  
ATOM   2880  CG  HIS A 373      45.216  76.849  35.337  1.00 53.25           C  
ATOM   2881  ND1 HIS A 373      44.382  77.408  34.394  1.00 56.26           N  
ATOM   2882  CD2 HIS A 373      45.038  77.567  36.470  1.00 53.91           C  
ATOM   2883  CE1 HIS A 373      43.729  78.423  34.934  1.00 55.38           C  
ATOM   2884  NE2 HIS A 373      44.109  78.540  36.193  1.00 54.56           N  
ATOM   2885  N   HIS A 374      48.171  73.841  33.693  1.00 48.51           N  
ATOM   2886  CA  HIS A 374      49.117  72.741  33.718  1.00 45.77           C  
ATOM   2887  C   HIS A 374      50.488  73.254  33.299  1.00 48.37           C  
ATOM   2888  O   HIS A 374      51.467  73.108  34.037  1.00 47.48           O  
ATOM   2889  CB  HIS A 374      48.654  71.625  32.774  1.00 41.31           C  
ATOM   2890  CG  HIS A 374      49.703  70.593  32.490  1.00 32.87           C  
ATOM   2891  ND1 HIS A 374      49.507  69.249  32.730  1.00 37.53           N  
ATOM   2892  CD2 HIS A 374      50.934  70.698  31.933  1.00 39.56           C  
ATOM   2893  CE1 HIS A 374      50.571  68.571  32.325  1.00 40.23           C  
ATOM   2894  NE2 HIS A 374      51.455  69.428  31.836  1.00 31.38           N  
ATOM   2895  N   GLU A 375      50.557  73.867  32.114  1.00 52.44           N  
ATOM   2896  CA  GLU A 375      51.818  74.385  31.606  1.00 50.62           C  
ATOM   2897  C   GLU A 375      52.401  75.495  32.478  1.00 49.22           C  
ATOM   2898  O   GLU A 375      53.610  75.551  32.685  1.00 48.47           O  
ATOM   2899  CB  GLU A 375      51.661  74.863  30.166  1.00 56.18           C  
ATOM   2900  CG  GLU A 375      51.352  73.737  29.168  1.00 62.55           C  
ATOM   2901  CD  GLU A 375      52.421  72.653  29.127  1.00 63.98           C  
ATOM   2902  OE1 GLU A 375      53.623  72.993  29.116  1.00 68.72           O  
ATOM   2903  OE2 GLU A 375      52.064  71.457  29.091  1.00 67.20           O  
ATOM   2904  N   MET A 376      51.577  76.386  33.007  1.00 46.59           N  
ATOM   2905  CA  MET A 376      52.175  77.397  33.851  1.00 47.32           C  
ATOM   2906  C   MET A 376      52.666  76.722  35.134  1.00 49.32           C  
ATOM   2907  O   MET A 376      53.447  77.303  35.875  1.00 52.45           O  
ATOM   2908  CB  MET A 376      51.182  78.507  34.188  1.00 49.52           C  
ATOM   2909  CG  MET A 376      51.853  79.726  34.826  1.00 51.19           C  
ATOM   2910  SD  MET A 376      50.716  81.086  35.160  1.00 57.91           S  
ATOM   2911  CE  MET A 376      50.733  81.841  33.517  1.00 47.14           C  
ATOM   2912  N   GLY A 377      52.199  75.498  35.393  1.00 51.40           N  
ATOM   2913  CA  GLY A 377      52.616  74.768  36.579  1.00 45.62           C  
ATOM   2914  C   GLY A 377      54.081  74.413  36.439  1.00 45.65           C  
ATOM   2915  O   GLY A 377      54.858  74.501  37.394  1.00 44.49           O  
ATOM   2916  N   HIS A 378      54.455  74.017  35.228  1.00 41.87           N  
ATOM   2917  CA  HIS A 378      55.830  73.672  34.911  1.00 43.25           C  
ATOM   2918  C   HIS A 378      56.785  74.849  35.067  1.00 44.95           C  
ATOM   2919  O   HIS A 378      57.928  74.690  35.510  1.00 40.55           O  
ATOM   2920  CB  HIS A 378      55.947  73.222  33.474  1.00 46.34           C  
ATOM   2921  CG  HIS A 378      55.372  71.877  33.208  1.00 52.07           C  
ATOM   2922  ND1 HIS A 378      55.812  70.744  33.855  1.00 51.10           N  
ATOM   2923  CD2 HIS A 378      54.475  71.463  32.285  1.00 50.01           C  
ATOM   2924  CE1 HIS A 378      55.218  69.687  33.334  1.00 48.65           C  
ATOM   2925  NE2 HIS A 378      54.402  70.097  32.380  1.00 49.95           N  
ATOM   2926  N   ILE A 379      56.334  76.017  34.625  1.00 44.77           N  
ATOM   2927  CA  ILE A 379      57.148  77.213  34.702  1.00 47.13           C  
ATOM   2928  C   ILE A 379      57.458  77.497  36.173  1.00 48.54           C  
ATOM   2929  O   ILE A 379      58.609  77.725  36.569  1.00 48.67           O  
ATOM   2930  CB  ILE A 379      56.401  78.420  34.093  1.00 46.86           C  
ATOM   2931  CG1 ILE A 379      56.088  78.149  32.618  1.00 41.03           C  
ATOM   2932  CG2 ILE A 379      57.261  79.689  34.249  1.00 43.97           C  
ATOM   2933  CD1 ILE A 379      57.331  78.100  31.722  1.00 41.27           C  
ATOM   2934  N   GLN A 380      56.406  77.452  36.972  1.00 48.00           N  
ATOM   2935  CA  GLN A 380      56.495  77.695  38.392  1.00 49.85           C  
ATOM   2936  C   GLN A 380      57.582  76.804  38.992  1.00 51.15           C  
ATOM   2937  O   GLN A 380      58.432  77.254  39.772  1.00 52.83           O  
ATOM   2938  CB  GLN A 380      55.145  77.372  39.017  1.00 52.54           C  
ATOM   2939  CG  GLN A 380      54.891  78.097  40.280  1.00 56.88           C  
ATOM   2940  CD  GLN A 380      54.733  79.567  40.042  1.00 59.43           C  
ATOM   2941  OE1 GLN A 380      55.236  80.372  40.804  1.00 62.15           O  
ATOM   2942  NE2 GLN A 380      54.022  79.929  38.980  1.00 59.81           N  
ATOM   2943  N   TYR A 381      57.551  75.537  38.606  1.00 49.33           N  
ATOM   2944  CA  TYR A 381      58.500  74.565  39.093  1.00 48.74           C  
ATOM   2945  C   TYR A 381      59.887  74.972  38.627  1.00 46.53           C  
ATOM   2946  O   TYR A 381      60.849  74.889  39.387  1.00 49.42           O  
ATOM   2947  CB  TYR A 381      58.122  73.175  38.562  1.00 46.71           C  
ATOM   2948  CG  TYR A 381      58.723  71.992  39.297  1.00 42.59           C  
ATOM   2949  CD1 TYR A 381      58.226  70.702  39.082  1.00 43.78           C  
ATOM   2950  CD2 TYR A 381      59.773  72.151  40.197  1.00 38.11           C  
ATOM   2951  CE1 TYR A 381      58.754  69.600  39.747  1.00 46.37           C  
ATOM   2952  CE2 TYR A 381      60.314  71.054  40.871  1.00 40.94           C  
ATOM   2953  CZ  TYR A 381      59.799  69.781  40.639  1.00 43.15           C  
ATOM   2954  OH  TYR A 381      60.344  68.683  41.243  1.00 37.50           O  
ATOM   2955  N   ASP A 382      59.993  75.419  37.383  1.00 46.09           N  
ATOM   2956  CA  ASP A 382      61.276  75.850  36.836  1.00 46.60           C  
ATOM   2957  C   ASP A 382      61.846  77.066  37.578  1.00 48.34           C  
ATOM   2958  O   ASP A 382      63.057  77.165  37.813  1.00 46.23           O  
ATOM   2959  CB  ASP A 382      61.121  76.228  35.375  1.00 52.40           C  
ATOM   2960  CG  ASP A 382      60.798  75.048  34.500  1.00 53.50           C  
ATOM   2961  OD1 ASP A 382      61.357  73.956  34.748  1.00 53.39           O  
ATOM   2962  OD2 ASP A 382      60.006  75.227  33.550  1.00 58.46           O  
ATOM   2963  N   MET A 383      60.961  77.994  37.923  1.00 46.98           N  
ATOM   2964  CA  MET A 383      61.353  79.200  38.624  1.00 48.26           C  
ATOM   2965  C   MET A 383      61.778  78.895  40.048  1.00 49.45           C  
ATOM   2966  O   MET A 383      62.772  79.437  40.535  1.00 53.71           O  
ATOM   2967  CB  MET A 383      60.198  80.197  38.626  1.00 47.34           C  
ATOM   2968  CG  MET A 383      59.877  80.767  37.246  1.00 49.35           C  
ATOM   2969  SD  MET A 383      58.356  81.709  37.263  1.00 57.14           S  
ATOM   2970  CE  MET A 383      58.675  82.868  38.540  1.00 54.75           C  
ATOM   2971  N   ALA A 384      61.036  78.013  40.707  1.00 48.84           N  
ATOM   2972  CA  ALA A 384      61.331  77.652  42.085  1.00 47.77           C  
ATOM   2973  C   ALA A 384      62.732  77.081  42.273  1.00 47.56           C  
ATOM   2974  O   ALA A 384      63.361  77.307  43.302  1.00 52.46           O  
ATOM   2975  CB  ALA A 384      60.271  76.668  42.607  1.00 43.45           C  
ATOM   2976  N   TYR A 385      63.245  76.356  41.290  1.00 46.37           N  
ATOM   2977  CA  TYR A 385      64.581  75.793  41.446  1.00 44.77           C  
ATOM   2978  C   TYR A 385      65.660  76.437  40.568  1.00 43.10           C  
ATOM   2979  O   TYR A 385      66.722  75.857  40.355  1.00 40.24           O  
ATOM   2980  CB  TYR A 385      64.539  74.270  41.215  1.00 46.25           C  
ATOM   2981  CG  TYR A 385      64.056  73.790  39.851  1.00 44.41           C  
ATOM   2982  CD1 TYR A 385      63.221  72.680  39.756  1.00 46.01           C  
ATOM   2983  CD2 TYR A 385      64.520  74.360  38.658  1.00 44.93           C  
ATOM   2984  CE1 TYR A 385      62.862  72.126  38.523  1.00 45.71           C  
ATOM   2985  CE2 TYR A 385      64.164  73.807  37.404  1.00 46.38           C  
ATOM   2986  CZ  TYR A 385      63.332  72.679  37.359  1.00 46.42           C  
ATOM   2987  OH  TYR A 385      62.992  72.068  36.167  1.00 47.82           O  
ATOM   2988  N   ALA A 386      65.384  77.634  40.059  1.00 41.59           N  
ATOM   2989  CA  ALA A 386      66.344  78.327  39.206  1.00 45.67           C  
ATOM   2990  C   ALA A 386      67.690  78.618  39.889  1.00 49.81           C  
ATOM   2991  O   ALA A 386      68.708  78.737  39.210  1.00 52.25           O  
ATOM   2992  CB  ALA A 386      65.736  79.620  38.692  1.00 44.26           C  
ATOM   2993  N   ALA A 387      67.704  78.710  41.220  1.00 51.16           N  
ATOM   2994  CA  ALA A 387      68.941  79.008  41.955  1.00 52.08           C  
ATOM   2995  C   ALA A 387      69.845  77.808  42.159  1.00 54.31           C  
ATOM   2996  O   ALA A 387      70.994  77.949  42.595  1.00 57.25           O  
ATOM   2997  CB  ALA A 387      68.611  79.615  43.304  1.00 51.77           C  
ATOM   2998  N   GLN A 388      69.334  76.620  41.874  1.00 52.05           N  
ATOM   2999  CA  GLN A 388      70.142  75.413  42.034  1.00 49.91           C  
ATOM   3000  C   GLN A 388      71.190  75.373  40.927  1.00 49.59           C  
ATOM   3001  O   GLN A 388      71.031  76.018  39.901  1.00 52.59           O  
ATOM   3002  CB  GLN A 388      69.243  74.173  41.910  1.00 49.98           C  
ATOM   3003  CG  GLN A 388      68.204  74.019  43.010  1.00 48.72           C  
ATOM   3004  CD  GLN A 388      68.807  73.588  44.333  1.00 48.68           C  
ATOM   3005  OE1 GLN A 388      69.839  72.924  44.364  1.00 50.29           O  
ATOM   3006  NE2 GLN A 388      68.144  73.936  45.436  1.00 49.44           N  
ATOM   3007  N   PRO A 389      72.303  74.660  41.132  1.00 49.11           N  
ATOM   3008  CA  PRO A 389      73.233  74.660  40.001  1.00 48.59           C  
ATOM   3009  C   PRO A 389      72.576  73.973  38.778  1.00 50.73           C  
ATOM   3010  O   PRO A 389      71.689  73.127  38.919  1.00 46.30           O  
ATOM   3011  CB  PRO A 389      74.436  73.877  40.527  1.00 45.84           C  
ATOM   3012  CG  PRO A 389      73.882  73.096  41.695  1.00 49.32           C  
ATOM   3013  CD  PRO A 389      72.911  74.043  42.320  1.00 47.40           C  
ATOM   3014  N   PHE A 390      73.032  74.361  37.591  1.00 49.55           N  
ATOM   3015  CA  PHE A 390      72.538  73.852  36.320  1.00 50.31           C  
ATOM   3016  C   PHE A 390      72.077  72.395  36.286  1.00 48.30           C  
ATOM   3017  O   PHE A 390      70.942  72.103  35.899  1.00 43.65           O  
ATOM   3018  CB  PHE A 390      73.614  74.038  35.252  1.00 51.05           C  
ATOM   3019  CG  PHE A 390      73.152  73.697  33.879  1.00 50.39           C  
ATOM   3020  CD1 PHE A 390      72.534  74.648  33.093  1.00 52.81           C  
ATOM   3021  CD2 PHE A 390      73.297  72.410  33.388  1.00 49.69           C  
ATOM   3022  CE1 PHE A 390      72.059  74.318  31.829  1.00 56.80           C  
ATOM   3023  CE2 PHE A 390      72.827  72.071  32.135  1.00 53.17           C  
ATOM   3024  CZ  PHE A 390      72.206  73.024  31.351  1.00 55.11           C  
ATOM   3025  N   LEU A 391      72.973  71.488  36.663  1.00 48.73           N  
ATOM   3026  CA  LEU A 391      72.682  70.055  36.653  1.00 48.44           C  
ATOM   3027  C   LEU A 391      71.623  69.581  37.642  1.00 49.16           C  
ATOM   3028  O   LEU A 391      71.117  68.459  37.512  1.00 52.08           O  
ATOM   3029  CB  LEU A 391      73.968  69.256  36.877  1.00 48.43           C  
ATOM   3030  CG  LEU A 391      74.922  69.227  35.686  1.00 50.85           C  
ATOM   3031  CD1 LEU A 391      76.318  68.784  36.125  1.00 44.60           C  
ATOM   3032  CD2 LEU A 391      74.344  68.308  34.612  1.00 41.24           C  
ATOM   3033  N   LEU A 392      71.273  70.415  38.619  1.00 44.35           N  
ATOM   3034  CA  LEU A 392      70.261  70.019  39.597  1.00 41.46           C  
ATOM   3035  C   LEU A 392      68.924  70.676  39.306  1.00 40.58           C  
ATOM   3036  O   LEU A 392      67.982  70.579  40.096  1.00 38.60           O  
ATOM   3037  CB  LEU A 392      70.714  70.391  41.013  1.00 45.43           C  
ATOM   3038  CG  LEU A 392      71.573  69.372  41.752  1.00 49.77           C  
ATOM   3039  CD1 LEU A 392      72.241  68.440  40.770  1.00 44.42           C  
ATOM   3040  CD2 LEU A 392      72.584  70.103  42.639  1.00 49.13           C  
ATOM   3041  N   ARG A 393      68.841  71.366  38.179  1.00 41.91           N  
ATOM   3042  CA  ARG A 393      67.596  72.018  37.822  1.00 44.80           C  
ATOM   3043  C   ARG A 393      66.684  71.084  37.025  1.00 45.56           C  
ATOM   3044  O   ARG A 393      66.710  71.072  35.794  1.00 42.93           O  
ATOM   3045  CB  ARG A 393      67.861  73.279  36.999  1.00 47.83           C  
ATOM   3046  CG  ARG A 393      68.545  74.393  37.740  1.00 50.77           C  
ATOM   3047  CD  ARG A 393      68.599  75.619  36.856  1.00 54.94           C  
ATOM   3048  NE  ARG A 393      69.808  76.385  37.103  1.00 59.28           N  
ATOM   3049  CZ  ARG A 393      70.351  77.222  36.229  1.00 62.41           C  
ATOM   3050  NH1 ARG A 393      69.792  77.404  35.039  1.00 58.97           N  
ATOM   3051  NH2 ARG A 393      71.462  77.872  36.549  1.00 65.62           N  
ATOM   3052  N   ASN A 394      65.891  70.296  37.739  1.00 47.29           N  
ATOM   3053  CA  ASN A 394      64.946  69.384  37.121  1.00 49.31           C  
ATOM   3054  C   ASN A 394      64.054  68.844  38.227  1.00 49.99           C  
ATOM   3055  O   ASN A 394      64.274  69.155  39.402  1.00 47.03           O  
ATOM   3056  CB  ASN A 394      65.680  68.253  36.415  1.00 52.55           C  
ATOM   3057  CG  ASN A 394      64.899  67.719  35.215  1.00 60.15           C  
ATOM   3058  OD1 ASN A 394      65.474  67.114  34.313  1.00 61.68           O  
ATOM   3059  ND2 ASN A 394      63.581  67.937  35.209  1.00 54.73           N  
ATOM   3060  N   GLY A 395      63.031  68.073  37.864  1.00 44.97           N  
ATOM   3061  CA  GLY A 395      62.156  67.512  38.883  1.00 45.31           C  
ATOM   3062  C   GLY A 395      62.916  66.511  39.749  1.00 42.29           C  
ATOM   3063  O   GLY A 395      63.913  65.960  39.287  1.00 39.51           O  
ATOM   3064  N   ALA A 396      62.453  66.276  40.983  1.00 42.63           N  
ATOM   3065  CA  ALA A 396      63.110  65.328  41.905  1.00 40.13           C  
ATOM   3066  C   ALA A 396      63.433  64.030  41.174  1.00 42.50           C  
ATOM   3067  O   ALA A 396      64.531  63.478  41.329  1.00 45.18           O  
ATOM   3068  CB  ALA A 396      62.231  65.077  43.133  1.00 37.31           C  
ATOM   3069  N   ASN A 397      62.471  63.507  40.409  1.00 41.92           N  
ATOM   3070  CA  ASN A 397      62.734  62.354  39.550  1.00 39.35           C  
ATOM   3071  C   ASN A 397      61.851  62.445  38.294  1.00 38.55           C  
ATOM   3072  O   ASN A 397      61.036  63.354  38.194  1.00 31.74           O  
ATOM   3073  CB  ASN A 397      62.614  60.994  40.292  1.00 42.73           C  
ATOM   3074  CG  ASN A 397      61.207  60.611  40.657  1.00 45.82           C  
ATOM   3075  OD1 ASN A 397      60.990  59.962  41.702  1.00 47.27           O  
ATOM   3076  ND2 ASN A 397      60.241  60.965  39.814  1.00 32.60           N  
ATOM   3077  N   GLU A 398      62.026  61.517  37.353  1.00 37.75           N  
ATOM   3078  CA  GLU A 398      61.305  61.533  36.079  1.00 39.11           C  
ATOM   3079  C   GLU A 398      59.816  61.791  36.160  1.00 42.81           C  
ATOM   3080  O   GLU A 398      59.232  62.389  35.256  1.00 47.15           O  
ATOM   3081  CB  GLU A 398      61.568  60.236  35.286  1.00 37.96           C  
ATOM   3082  CG  GLU A 398      61.142  58.941  35.985  1.00 38.30           C  
ATOM   3083  CD  GLU A 398      61.335  57.715  35.108  1.00 43.76           C  
ATOM   3084  OE1 GLU A 398      62.239  57.699  34.249  1.00 48.51           O  
ATOM   3085  OE2 GLU A 398      60.586  56.739  35.279  1.00 50.04           O  
ATOM   3086  N   GLY A 399      59.203  61.413  37.269  1.00 44.53           N  
ATOM   3087  CA  GLY A 399      57.775  61.600  37.394  1.00 37.37           C  
ATOM   3088  C   GLY A 399      57.223  62.780  38.153  1.00 38.12           C  
ATOM   3089  O   GLY A 399      56.010  62.845  38.284  1.00 37.72           O  
ATOM   3090  N   PHE A 400      58.053  63.707  38.645  1.00 38.07           N  
ATOM   3091  CA  PHE A 400      57.541  64.883  39.415  1.00 37.87           C  
ATOM   3092  C   PHE A 400      56.926  66.080  38.625  1.00 33.11           C  
ATOM   3093  O   PHE A 400      55.900  66.624  39.013  1.00 36.58           O  
ATOM   3094  CB  PHE A 400      58.670  65.464  40.303  1.00 42.26           C  
ATOM   3095  CG  PHE A 400      58.767  64.850  41.698  1.00 45.69           C  
ATOM   3096  CD1 PHE A 400      58.907  63.479  41.870  1.00 46.72           C  
ATOM   3097  CD2 PHE A 400      58.758  65.665  42.831  1.00 41.91           C  
ATOM   3098  CE1 PHE A 400      59.042  62.922  43.155  1.00 48.00           C  
ATOM   3099  CE2 PHE A 400      58.896  65.118  44.121  1.00 43.80           C  
ATOM   3100  CZ  PHE A 400      59.038  63.746  44.279  1.00 42.05           C  
ATOM   3101  N   HIS A 401      57.587  66.515  37.554  1.00 36.09           N  
ATOM   3102  CA  HIS A 401      57.139  67.662  36.754  1.00 38.52           C  
ATOM   3103  C   HIS A 401      55.695  67.511  36.251  1.00 38.30           C  
ATOM   3104  O   HIS A 401      54.862  68.399  36.467  1.00 39.97           O  
ATOM   3105  CB  HIS A 401      58.111  67.877  35.567  1.00 36.53           C  
ATOM   3106  CG  HIS A 401      58.824  69.196  35.597  1.00 38.15           C  
ATOM   3107  ND1 HIS A 401      58.164  70.401  35.472  1.00 37.42           N  
ATOM   3108  CD2 HIS A 401      60.134  69.502  35.769  1.00 35.60           C  
ATOM   3109  CE1 HIS A 401      59.033  71.392  35.567  1.00 40.17           C  
ATOM   3110  NE2 HIS A 401      60.235  70.873  35.748  1.00 42.09           N  
ATOM   3111  N   GLU A 402      55.383  66.391  35.602  1.00 34.92           N  
ATOM   3112  CA  GLU A 402      54.016  66.200  35.124  1.00 41.19           C  
ATOM   3113  C   GLU A 402      53.032  66.032  36.280  1.00 42.38           C  
ATOM   3114  O   GLU A 402      51.867  66.410  36.167  1.00 45.36           O  
ATOM   3115  CB  GLU A 402      53.942  65.006  34.156  1.00 42.14           C  
ATOM   3116  CG  GLU A 402      54.634  65.306  32.828  1.00 41.72           C  
ATOM   3117  CD  GLU A 402      53.997  66.484  32.102  1.00 45.80           C  
ATOM   3118  OE1 GLU A 402      54.697  67.175  31.330  1.00 45.82           O  
ATOM   3119  OE2 GLU A 402      52.783  66.719  32.287  1.00 47.88           O  
ATOM   3120  N   ALA A 403      53.474  65.471  37.401  1.00 41.82           N  
ATOM   3121  CA  ALA A 403      52.556  65.342  38.535  1.00 41.70           C  
ATOM   3122  C   ALA A 403      52.198  66.758  38.972  1.00 40.48           C  
ATOM   3123  O   ALA A 403      51.044  67.054  39.294  1.00 41.53           O  
ATOM   3124  CB  ALA A 403      53.225  64.584  39.705  1.00 43.61           C  
ATOM   3125  N   VAL A 404      53.202  67.637  38.988  1.00 40.08           N  
ATOM   3126  CA  VAL A 404      52.973  69.027  39.376  1.00 42.00           C  
ATOM   3127  C   VAL A 404      52.031  69.729  38.374  1.00 43.60           C  
ATOM   3128  O   VAL A 404      51.116  70.475  38.754  1.00 40.36           O  
ATOM   3129  CB  VAL A 404      54.317  69.790  39.472  1.00 43.92           C  
ATOM   3130  CG1 VAL A 404      54.060  71.306  39.575  1.00 41.40           C  
ATOM   3131  CG2 VAL A 404      55.111  69.279  40.706  1.00 43.53           C  
ATOM   3132  N   GLY A 405      52.254  69.477  37.090  1.00 43.96           N  
ATOM   3133  CA  GLY A 405      51.395  70.069  36.083  1.00 46.63           C  
ATOM   3134  C   GLY A 405      49.954  69.589  36.161  1.00 45.41           C  
ATOM   3135  O   GLY A 405      49.039  70.413  36.096  1.00 45.16           O  
ATOM   3136  N   GLU A 406      49.751  68.273  36.301  1.00 43.68           N  
ATOM   3137  CA  GLU A 406      48.406  67.675  36.384  1.00 45.08           C  
ATOM   3138  C   GLU A 406      47.616  68.175  37.587  1.00 47.62           C  
ATOM   3139  O   GLU A 406      46.386  68.303  37.559  1.00 47.05           O  
ATOM   3140  CB  GLU A 406      48.497  66.150  36.480  1.00 45.55           C  
ATOM   3141  CG  GLU A 406      49.011  65.450  35.238  1.00 50.52           C  
ATOM   3142  CD  GLU A 406      48.019  65.470  34.079  1.00 55.92           C  
ATOM   3143  OE1 GLU A 406      46.809  65.688  34.313  1.00 53.37           O  
ATOM   3144  OE2 GLU A 406      48.458  65.247  32.929  1.00 60.24           O  
ATOM   3145  N   ILE A 407      48.336  68.427  38.664  1.00 49.01           N  
ATOM   3146  CA  ILE A 407      47.737  68.918  39.889  1.00 51.71           C  
ATOM   3147  C   ILE A 407      47.029  70.255  39.666  1.00 51.14           C  
ATOM   3148  O   ILE A 407      45.992  70.525  40.258  1.00 52.59           O  
ATOM   3149  CB  ILE A 407      48.847  69.081  40.958  1.00 56.26           C  
ATOM   3150  CG1 ILE A 407      49.198  67.704  41.509  1.00 57.12           C  
ATOM   3151  CG2 ILE A 407      48.447  70.060  42.019  1.00 57.42           C  
ATOM   3152  CD1 ILE A 407      48.010  66.846  41.690  1.00 56.81           C  
ATOM   3153  N   MET A 408      47.590  71.100  38.812  1.00 48.90           N  
ATOM   3154  CA  MET A 408      46.995  72.399  38.578  1.00 47.72           C  
ATOM   3155  C   MET A 408      45.647  72.335  37.848  1.00 49.77           C  
ATOM   3156  O   MET A 408      44.725  73.069  38.204  1.00 51.58           O  
ATOM   3157  CB  MET A 408      47.989  73.294  37.827  1.00 48.63           C  
ATOM   3158  CG  MET A 408      49.327  73.453  38.528  1.00 46.03           C  
ATOM   3159  SD  MET A 408      49.147  73.611  40.318  1.00 57.77           S  
ATOM   3160  CE  MET A 408      50.766  73.120  40.879  1.00 51.69           C  
ATOM   3161  N   SER A 409      45.520  71.458  36.854  1.00 48.48           N  
ATOM   3162  CA  SER A 409      44.265  71.337  36.119  1.00 54.12           C  
ATOM   3163  C   SER A 409      43.181  70.803  37.028  1.00 55.88           C  
ATOM   3164  O   SER A 409      42.012  71.200  36.926  1.00 58.25           O  
ATOM   3165  CB  SER A 409      44.401  70.380  34.933  1.00 56.38           C  
ATOM   3166  OG  SER A 409      45.485  70.741  34.112  1.00 58.27           O  
ATOM   3167  N   LEU A 410      43.567  69.888  37.912  1.00 55.09           N  
ATOM   3168  CA  LEU A 410      42.620  69.296  38.842  1.00 53.52           C  
ATOM   3169  C   LEU A 410      41.870  70.405  39.583  1.00 54.67           C  
ATOM   3170  O   LEU A 410      40.648  70.467  39.527  1.00 59.15           O  
ATOM   3171  CB  LEU A 410      43.358  68.384  39.825  1.00 55.07           C  
ATOM   3172  CG  LEU A 410      42.855  66.941  39.947  1.00 58.22           C  
ATOM   3173  CD1 LEU A 410      42.712  66.302  38.565  1.00 49.75           C  
ATOM   3174  CD2 LEU A 410      43.813  66.153  40.825  1.00 56.96           C  
ATOM   3175  N   SER A 411      42.590  71.307  40.244  1.00 52.43           N  
ATOM   3176  CA  SER A 411      41.935  72.400  40.973  1.00 52.06           C  
ATOM   3177  C   SER A 411      41.155  73.379  40.083  1.00 50.75           C  
ATOM   3178  O   SER A 411      40.098  73.881  40.460  1.00 50.54           O  
ATOM   3179  CB  SER A 411      42.969  73.212  41.768  1.00 48.92           C  
ATOM   3180  OG  SER A 411      43.258  72.627  43.019  1.00 55.17           O  
ATOM   3181  N   ALA A 412      41.695  73.653  38.906  1.00 50.99           N  
ATOM   3182  CA  ALA A 412      41.100  74.613  37.989  1.00 50.95           C  
ATOM   3183  C   ALA A 412      39.801  74.161  37.318  1.00 51.23           C  
ATOM   3184  O   ALA A 412      38.972  74.993  36.961  1.00 47.09           O  
ATOM   3185  CB  ALA A 412      42.130  75.008  36.947  1.00 53.37           C  
ATOM   3186  N   ALA A 413      39.614  72.855  37.161  1.00 52.26           N  
ATOM   3187  CA  ALA A 413      38.390  72.338  36.543  1.00 54.48           C  
ATOM   3188  C   ALA A 413      37.222  72.143  37.521  1.00 56.05           C  
ATOM   3189  O   ALA A 413      36.070  72.010  37.103  1.00 55.80           O  
ATOM   3190  CB  ALA A 413      38.677  71.025  35.830  1.00 49.44           C  
ATOM   3191  N   THR A 414      37.499  72.121  38.821  1.00 56.18           N  
ATOM   3192  CA  THR A 414      36.418  71.918  39.783  1.00 55.42           C  
ATOM   3193  C   THR A 414      35.299  72.938  39.604  1.00 59.62           C  
ATOM   3194  O   THR A 414      35.547  74.111  39.314  1.00 60.51           O  
ATOM   3195  CB  THR A 414      36.918  72.035  41.237  1.00 51.85           C  
ATOM   3196  OG1 THR A 414      37.377  73.371  41.475  1.00 54.09           O  
ATOM   3197  CG2 THR A 414      38.043  71.054  41.500  1.00 46.72           C  
ATOM   3198  N   PRO A 415      34.046  72.508  39.791  1.00 62.18           N  
ATOM   3199  CA  PRO A 415      32.894  73.401  39.655  1.00 65.74           C  
ATOM   3200  C   PRO A 415      33.069  74.636  40.543  1.00 68.50           C  
ATOM   3201  O   PRO A 415      32.756  75.760  40.151  1.00 71.11           O  
ATOM   3202  CB  PRO A 415      31.736  72.528  40.122  1.00 65.81           C  
ATOM   3203  CG  PRO A 415      32.182  71.153  39.725  1.00 62.42           C  
ATOM   3204  CD  PRO A 415      33.612  71.152  40.158  1.00 63.52           C  
ATOM   3205  N   LYS A 416      33.592  74.410  41.741  1.00 70.11           N  
ATOM   3206  CA  LYS A 416      33.806  75.472  42.709  1.00 70.41           C  
ATOM   3207  C   LYS A 416      34.802  76.513  42.220  1.00 71.27           C  
ATOM   3208  O   LYS A 416      34.703  77.692  42.567  1.00 70.56           O  
ATOM   3209  CB  LYS A 416      34.286  74.858  44.021  1.00 74.79           C  
ATOM   3210  CG  LYS A 416      34.458  75.823  45.170  1.00 78.16           C  
ATOM   3211  CD  LYS A 416      34.724  75.047  46.450  1.00 81.31           C  
ATOM   3212  CE  LYS A 416      35.858  74.046  46.252  1.00 82.23           C  
ATOM   3213  NZ  LYS A 416      36.077  73.234  47.484  1.00 86.56           N  
ATOM   3214  N   HIS A 417      35.773  76.088  41.420  1.00 70.27           N  
ATOM   3215  CA  HIS A 417      36.744  77.043  40.924  1.00 67.36           C  
ATOM   3216  C   HIS A 417      36.127  77.854  39.793  1.00 68.25           C  
ATOM   3217  O   HIS A 417      36.253  79.081  39.765  1.00 65.91           O  
ATOM   3218  CB  HIS A 417      37.997  76.349  40.417  1.00 63.13           C  
ATOM   3219  CG  HIS A 417      39.093  77.301  40.068  1.00 60.36           C  
ATOM   3220  ND1 HIS A 417      39.808  77.991  41.025  1.00 62.06           N  
ATOM   3221  CD2 HIS A 417      39.544  77.742  38.870  1.00 57.69           C  
ATOM   3222  CE1 HIS A 417      40.650  78.818  40.430  1.00 59.71           C  
ATOM   3223  NE2 HIS A 417      40.508  78.688  39.122  1.00 58.04           N  
ATOM   3224  N   LEU A 418      35.465  77.165  38.863  1.00 69.29           N  
ATOM   3225  CA  LEU A 418      34.821  77.832  37.735  1.00 71.05           C  
ATOM   3226  C   LEU A 418      33.778  78.847  38.193  1.00 73.17           C  
ATOM   3227  O   LEU A 418      33.498  79.819  37.491  1.00 74.15           O  
ATOM   3228  CB  LEU A 418      34.162  76.818  36.794  1.00 70.93           C  
ATOM   3229  CG  LEU A 418      35.070  75.996  35.876  1.00 69.31           C  
ATOM   3230  CD1 LEU A 418      36.101  76.888  35.218  1.00 70.23           C  
ATOM   3231  CD2 LEU A 418      35.772  74.952  36.677  1.00 72.71           C  
ATOM   3232  N   LYS A 419      33.194  78.632  39.365  1.00 73.84           N  
ATOM   3233  CA  LYS A 419      32.211  79.584  39.857  1.00 76.06           C  
ATOM   3234  C   LYS A 419      32.904  80.853  40.340  1.00 77.50           C  
ATOM   3235  O   LYS A 419      32.656  81.940  39.823  1.00 78.90           O  
ATOM   3236  CB  LYS A 419      31.391  78.983  40.998  1.00 76.21           C  
ATOM   3237  CG  LYS A 419      30.450  77.863  40.577  1.00 78.31           C  
ATOM   3238  CD  LYS A 419      29.538  77.479  41.735  1.00 80.40           C  
ATOM   3239  CE  LYS A 419      30.343  77.237  43.011  1.00 81.17           C  
ATOM   3240  NZ  LYS A 419      29.479  76.943  44.187  1.00 82.31           N  
ATOM   3241  N   SER A 420      33.778  80.709  41.331  1.00 78.79           N  
ATOM   3242  CA  SER A 420      34.509  81.843  41.892  1.00 79.74           C  
ATOM   3243  C   SER A 420      35.191  82.706  40.834  1.00 79.53           C  
ATOM   3244  O   SER A 420      35.537  83.859  41.079  1.00 79.88           O  
ATOM   3245  CB  SER A 420      35.563  81.338  42.873  1.00 81.01           C  
ATOM   3246  OG  SER A 420      36.374  82.404  43.336  1.00 83.57           O  
ATOM   3247  N   ILE A 421      35.385  82.127  39.659  1.00 79.86           N  
ATOM   3248  CA  ILE A 421      36.039  82.801  38.551  1.00 78.87           C  
ATOM   3249  C   ILE A 421      35.003  83.484  37.650  1.00 79.49           C  
ATOM   3250  O   ILE A 421      35.343  84.330  36.818  1.00 78.57           O  
ATOM   3251  CB  ILE A 421      36.879  81.770  37.748  1.00 78.86           C  
ATOM   3252  CG1 ILE A 421      38.365  82.008  37.999  1.00 79.09           C  
ATOM   3253  CG2 ILE A 421      36.541  81.829  36.276  1.00 80.53           C  
ATOM   3254  CD1 ILE A 421      38.751  81.963  39.462  1.00 78.73           C  
ATOM   3255  N   GLY A 422      33.736  83.118  37.826  1.00 77.79           N  
ATOM   3256  CA  GLY A 422      32.679  83.712  37.029  1.00 76.56           C  
ATOM   3257  C   GLY A 422      32.473  83.066  35.671  1.00 76.64           C  
ATOM   3258  O   GLY A 422      31.813  83.632  34.806  1.00 75.94           O  
ATOM   3259  N   LEU A 423      33.041  81.885  35.468  1.00 76.96           N  
ATOM   3260  CA  LEU A 423      32.877  81.197  34.200  1.00 76.80           C  
ATOM   3261  C   LEU A 423      31.746  80.186  34.275  1.00 78.30           C  
ATOM   3262  O   LEU A 423      31.278  79.687  33.256  1.00 78.73           O  
ATOM   3263  CB  LEU A 423      34.175  80.518  33.794  1.00 74.87           C  
ATOM   3264  CG  LEU A 423      35.162  81.532  33.226  1.00 75.78           C  
ATOM   3265  CD1 LEU A 423      36.381  80.830  32.653  1.00 73.77           C  
ATOM   3266  CD2 LEU A 423      34.450  82.334  32.145  1.00 76.11           C  
ATOM   3267  N   LEU A 424      31.316  79.889  35.494  1.00 79.76           N  
ATOM   3268  CA  LEU A 424      30.214  78.971  35.723  1.00 82.17           C  
ATOM   3269  C   LEU A 424      29.311  79.666  36.730  1.00 84.34           C  
ATOM   3270  O   LEU A 424      29.769  80.119  37.784  1.00 82.48           O  
ATOM   3271  CB  LEU A 424      30.710  77.640  36.292  1.00 81.16           C  
ATOM   3272  CG  LEU A 424      29.637  76.573  36.540  1.00 80.31           C  
ATOM   3273  CD1 LEU A 424      29.013  76.141  35.225  1.00 78.02           C  
ATOM   3274  CD2 LEU A 424      30.267  75.380  37.232  1.00 82.18           C  
ATOM   3275  N   SER A 425      28.032  79.773  36.391  1.00 87.54           N  
ATOM   3276  CA  SER A 425      27.071  80.430  37.266  1.00 90.59           C  
ATOM   3277  C   SER A 425      26.749  79.548  38.452  1.00 92.89           C  
ATOM   3278  O   SER A 425      26.910  78.327  38.399  1.00 93.71           O  
ATOM   3279  CB  SER A 425      25.779  80.718  36.511  1.00 90.38           C  
ATOM   3280  OG  SER A 425      25.179  79.507  36.087  1.00 90.64           O  
ATOM   3281  N   PRO A 426      26.299  80.162  39.551  1.00 95.14           N  
ATOM   3282  CA  PRO A 426      25.945  79.412  40.759  1.00 97.25           C  
ATOM   3283  C   PRO A 426      24.604  78.704  40.554  1.00 98.58           C  
ATOM   3284  O   PRO A 426      23.986  78.223  41.504  1.00 98.70           O  
ATOM   3285  CB  PRO A 426      25.883  80.499  41.833  1.00 97.28           C  
ATOM   3286  CG  PRO A 426      25.444  81.715  41.056  1.00 96.55           C  
ATOM   3287  CD  PRO A 426      26.273  81.615  39.797  1.00 95.39           C  
ATOM   3288  N   ASP A 427      24.173  78.645  39.295  1.00101.18           N  
ATOM   3289  CA  ASP A 427      22.905  78.021  38.917  1.00102.64           C  
ATOM   3290  C   ASP A 427      23.103  76.581  38.428  1.00102.22           C  
ATOM   3291  O   ASP A 427      22.140  75.819  38.299  1.00101.34           O  
ATOM   3292  CB  ASP A 427      22.226  78.855  37.821  1.00105.33           C  
ATOM   3293  CG  ASP A 427      20.778  78.445  37.575  1.00108.58           C  
ATOM   3294  OD1 ASP A 427      20.135  79.026  36.670  1.00108.90           O  
ATOM   3295  OD2 ASP A 427      20.281  77.546  38.286  1.00110.63           O  
ATOM   3296  N   PHE A 428      24.348  76.209  38.151  1.00100.75           N  
ATOM   3297  CA  PHE A 428      24.629  74.857  37.690  1.00 99.66           C  
ATOM   3298  C   PHE A 428      24.719  73.937  38.901  1.00 99.30           C  
ATOM   3299  O   PHE A 428      25.752  73.877  39.567  1.00101.21           O  
ATOM   3300  CB  PHE A 428      25.939  74.820  36.898  1.00 98.13           C  
ATOM   3301  CG  PHE A 428      26.240  73.478  36.293  1.00 96.42           C  
ATOM   3302  CD1 PHE A 428      26.724  72.440  37.076  1.00 95.23           C  
ATOM   3303  CD2 PHE A 428      26.005  73.244  34.944  1.00 95.21           C  
ATOM   3304  CE1 PHE A 428      26.966  71.193  36.524  1.00 95.76           C  
ATOM   3305  CE2 PHE A 428      26.244  71.999  34.385  1.00 94.19           C  
ATOM   3306  CZ  PHE A 428      26.725  70.971  35.175  1.00 94.78           C  
ATOM   3307  N   GLN A 429      23.636  73.221  39.186  1.00 97.94           N  
ATOM   3308  CA  GLN A 429      23.614  72.327  40.333  1.00 95.99           C  
ATOM   3309  C   GLN A 429      24.430  71.067  40.087  1.00 93.30           C  
ATOM   3310  O   GLN A 429      24.352  70.451  39.025  1.00 91.86           O  
ATOM   3311  CB  GLN A 429      22.174  71.940  40.706  1.00 99.09           C  
ATOM   3312  CG  GLN A 429      21.545  70.833  39.857  1.00101.67           C  
ATOM   3313  CD  GLN A 429      20.189  70.376  40.396  1.00104.48           C  
ATOM   3314  OE1 GLN A 429      19.551  69.478  39.836  1.00104.89           O  
ATOM   3315  NE2 GLN A 429      19.747  70.994  41.489  1.00104.79           N  
ATOM   3316  N   GLU A 430      25.220  70.697  41.084  1.00 89.92           N  
ATOM   3317  CA  GLU A 430      26.050  69.513  41.003  1.00 86.70           C  
ATOM   3318  C   GLU A 430      25.250  68.372  41.626  1.00 84.88           C  
ATOM   3319  O   GLU A 430      24.784  68.488  42.755  1.00 83.89           O  
ATOM   3320  CB  GLU A 430      27.345  69.757  41.778  1.00 87.22           C  
ATOM   3321  CG  GLU A 430      27.996  71.099  41.455  1.00 86.41           C  
ATOM   3322  CD  GLU A 430      28.982  71.560  42.524  1.00 87.68           C  
ATOM   3323  OE1 GLU A 430      29.476  72.703  42.423  1.00 86.31           O  
ATOM   3324  OE2 GLU A 430      29.266  70.786  43.466  1.00 89.86           O  
ATOM   3325  N   ASP A 431      25.078  67.280  40.885  1.00 83.48           N  
ATOM   3326  CA  ASP A 431      24.323  66.124  41.375  1.00 82.59           C  
ATOM   3327  C   ASP A 431      25.272  65.007  41.784  1.00 79.86           C  
ATOM   3328  O   ASP A 431      26.476  65.091  41.567  1.00 80.92           O  
ATOM   3329  CB  ASP A 431      23.400  65.573  40.278  1.00 84.27           C  
ATOM   3330  CG  ASP A 431      22.565  66.647  39.618  1.00 88.05           C  
ATOM   3331  OD1 ASP A 431      21.779  67.313  40.323  1.00 91.64           O  
ATOM   3332  OD2 ASP A 431      22.692  66.827  38.388  1.00 90.86           O  
ATOM   3333  N   ASN A 432      24.730  63.954  42.379  1.00 75.71           N  
ATOM   3334  CA  ASN A 432      25.567  62.831  42.735  1.00 73.21           C  
ATOM   3335  C   ASN A 432      25.845  62.100  41.411  1.00 72.27           C  
ATOM   3336  O   ASN A 432      26.757  61.274  41.312  1.00 70.67           O  
ATOM   3337  CB  ASN A 432      24.865  61.925  43.774  1.00 72.28           C  
ATOM   3338  CG  ASN A 432      23.525  61.375  43.297  1.00 71.70           C  
ATOM   3339  OD1 ASN A 432      22.904  61.903  42.375  1.00 73.93           O  
ATOM   3340  ND2 ASN A 432      23.065  60.315  43.951  1.00 70.78           N  
ATOM   3341  N   GLU A 433      25.073  62.455  40.383  1.00 67.73           N  
ATOM   3342  CA  GLU A 433      25.213  61.858  39.061  1.00 66.25           C  
ATOM   3343  C   GLU A 433      26.237  62.569  38.177  1.00 65.08           C  
ATOM   3344  O   GLU A 433      26.956  61.926  37.411  1.00 63.19           O  
ATOM   3345  CB  GLU A 433      23.850  61.814  38.366  1.00 66.12           C  
ATOM   3346  CG  GLU A 433      23.049  60.575  38.707  1.00 67.52           C  
ATOM   3347  CD  GLU A 433      21.591  60.688  38.316  1.00 70.37           C  
ATOM   3348  OE1 GLU A 433      21.304  61.240  37.234  1.00 72.43           O  
ATOM   3349  OE2 GLU A 433      20.731  60.213  39.094  1.00 71.93           O  
ATOM   3350  N   THR A 434      26.291  63.894  38.267  1.00 64.08           N  
ATOM   3351  CA  THR A 434      27.259  64.658  37.497  1.00 64.36           C  
ATOM   3352  C   THR A 434      28.631  64.350  38.081  1.00 62.95           C  
ATOM   3353  O   THR A 434      29.645  64.518  37.422  1.00 63.54           O  
ATOM   3354  CB  THR A 434      26.995  66.171  37.598  1.00 68.59           C  
ATOM   3355  OG1 THR A 434      26.830  66.542  38.980  1.00 67.83           O  
ATOM   3356  CG2 THR A 434      25.739  66.546  36.796  1.00 66.90           C  
ATOM   3357  N   GLU A 435      28.635  63.882  39.325  1.00 62.94           N  
ATOM   3358  CA  GLU A 435      29.853  63.508  40.036  1.00 63.28           C  
ATOM   3359  C   GLU A 435      30.376  62.162  39.505  1.00 61.49           C  
ATOM   3360  O   GLU A 435      31.527  62.052  39.088  1.00 61.27           O  
ATOM   3361  CB  GLU A 435      29.561  63.376  41.536  1.00 65.64           C  
ATOM   3362  CG  GLU A 435      30.483  64.156  42.463  1.00 73.13           C  
ATOM   3363  CD  GLU A 435      30.154  65.649  42.542  1.00 76.16           C  
ATOM   3364  OE1 GLU A 435      30.387  66.384  41.556  1.00 80.64           O  
ATOM   3365  OE2 GLU A 435      29.662  66.089  43.602  1.00 77.75           O  
ATOM   3366  N   ILE A 436      29.530  61.137  39.528  1.00 58.89           N  
ATOM   3367  CA  ILE A 436      29.940  59.831  39.046  1.00 57.00           C  
ATOM   3368  C   ILE A 436      30.327  59.929  37.576  1.00 56.97           C  
ATOM   3369  O   ILE A 436      31.261  59.257  37.137  1.00 56.86           O  
ATOM   3370  CB  ILE A 436      28.822  58.791  39.246  1.00 59.26           C  
ATOM   3371  CG1 ILE A 436      29.153  57.915  40.454  1.00 62.78           C  
ATOM   3372  CG2 ILE A 436      28.706  57.897  38.037  1.00 59.45           C  
ATOM   3373  CD1 ILE A 436      29.489  58.679  41.688  1.00 57.32           C  
ATOM   3374  N   ASN A 437      29.623  60.782  36.826  1.00 52.24           N  
ATOM   3375  CA  ASN A 437      29.910  60.994  35.408  1.00 50.02           C  
ATOM   3376  C   ASN A 437      31.329  61.544  35.225  1.00 51.26           C  
ATOM   3377  O   ASN A 437      32.027  61.227  34.246  1.00 50.71           O  
ATOM   3378  CB  ASN A 437      28.940  62.020  34.819  1.00 50.45           C  
ATOM   3379  CG  ASN A 437      27.773  61.387  34.089  1.00 54.43           C  
ATOM   3380  OD1 ASN A 437      27.559  60.164  34.138  1.00 51.13           O  
ATOM   3381  ND2 ASN A 437      26.995  62.226  33.411  1.00 48.18           N  
ATOM   3382  N   PHE A 438      31.737  62.400  36.158  1.00 47.27           N  
ATOM   3383  CA  PHE A 438      33.048  63.020  36.097  1.00 48.20           C  
ATOM   3384  C   PHE A 438      34.153  62.046  36.521  1.00 46.48           C  
ATOM   3385  O   PHE A 438      35.202  61.973  35.889  1.00 45.92           O  
ATOM   3386  CB  PHE A 438      33.068  64.272  36.989  1.00 47.57           C  
ATOM   3387  CG  PHE A 438      34.430  64.893  37.127  1.00 49.17           C  
ATOM   3388  CD1 PHE A 438      35.043  65.497  36.042  1.00 49.40           C  
ATOM   3389  CD2 PHE A 438      35.118  64.822  38.326  1.00 48.66           C  
ATOM   3390  CE1 PHE A 438      36.328  66.017  36.143  1.00 48.53           C  
ATOM   3391  CE2 PHE A 438      36.392  65.337  38.436  1.00 51.53           C  
ATOM   3392  CZ  PHE A 438      37.001  65.934  37.344  1.00 50.78           C  
ATOM   3393  N   LEU A 439      33.901  61.312  37.600  1.00 46.04           N  
ATOM   3394  CA  LEU A 439      34.845  60.343  38.139  1.00 45.29           C  
ATOM   3395  C   LEU A 439      35.067  59.163  37.177  1.00 44.71           C  
ATOM   3396  O   LEU A 439      36.174  58.634  37.075  1.00 44.75           O  
ATOM   3397  CB  LEU A 439      34.327  59.850  39.498  1.00 47.48           C  
ATOM   3398  CG  LEU A 439      35.049  60.254  40.796  1.00 50.56           C  
ATOM   3399  CD1 LEU A 439      35.752  61.572  40.612  1.00 46.41           C  
ATOM   3400  CD2 LEU A 439      34.062  60.305  41.961  1.00 43.85           C  
ATOM   3401  N   LEU A 440      34.012  58.756  36.473  1.00 44.99           N  
ATOM   3402  CA  LEU A 440      34.094  57.654  35.521  1.00 42.88           C  
ATOM   3403  C   LEU A 440      34.933  58.172  34.367  1.00 41.88           C  
ATOM   3404  O   LEU A 440      35.846  57.497  33.897  1.00 42.94           O  
ATOM   3405  CB  LEU A 440      32.676  57.251  35.042  1.00 43.56           C  
ATOM   3406  CG  LEU A 440      32.435  56.165  33.972  1.00 40.54           C  
ATOM   3407  CD1 LEU A 440      32.845  56.688  32.586  1.00 39.65           C  
ATOM   3408  CD2 LEU A 440      33.219  54.919  34.310  1.00 39.08           C  
ATOM   3409  N   LYS A 441      34.648  59.391  33.920  1.00 41.64           N  
ATOM   3410  CA  LYS A 441      35.434  59.948  32.822  1.00 43.83           C  
ATOM   3411  C   LYS A 441      36.923  59.995  33.217  1.00 43.12           C  
ATOM   3412  O   LYS A 441      37.798  59.660  32.430  1.00 40.67           O  
ATOM   3413  CB  LYS A 441      34.954  61.360  32.469  1.00 44.90           C  
ATOM   3414  CG  LYS A 441      35.560  61.894  31.166  1.00 49.04           C  
ATOM   3415  CD  LYS A 441      35.280  63.378  30.981  1.00 55.46           C  
ATOM   3416  CE  LYS A 441      35.557  63.813  29.548  1.00 62.64           C  
ATOM   3417  NZ  LYS A 441      36.909  63.393  29.048  1.00 66.03           N  
ATOM   3418  N   GLN A 442      37.193  60.430  34.442  1.00 43.24           N  
ATOM   3419  CA  GLN A 442      38.560  60.514  34.962  1.00 41.68           C  
ATOM   3420  C   GLN A 442      39.220  59.145  35.030  1.00 39.93           C  
ATOM   3421  O   GLN A 442      40.378  58.990  34.660  1.00 38.10           O  
ATOM   3422  CB  GLN A 442      38.530  61.102  36.368  1.00 43.89           C  
ATOM   3423  CG  GLN A 442      38.221  62.570  36.395  1.00 43.00           C  
ATOM   3424  CD  GLN A 442      39.417  63.365  35.987  1.00 44.75           C  
ATOM   3425  OE1 GLN A 442      40.169  63.866  36.835  1.00 48.69           O  
ATOM   3426  NE2 GLN A 442      39.630  63.477  34.689  1.00 46.08           N  
ATOM   3427  N   ALA A 443      38.464  58.155  35.501  1.00 39.01           N  
ATOM   3428  CA  ALA A 443      38.979  56.800  35.664  1.00 37.84           C  
ATOM   3429  C   ALA A 443      39.329  56.100  34.339  1.00 38.77           C  
ATOM   3430  O   ALA A 443      40.295  55.318  34.277  1.00 32.27           O  
ATOM   3431  CB  ALA A 443      37.978  55.981  36.468  1.00 34.44           C  
ATOM   3432  N   LEU A 444      38.564  56.400  33.284  1.00 39.68           N  
ATOM   3433  CA  LEU A 444      38.805  55.807  31.959  1.00 43.76           C  
ATOM   3434  C   LEU A 444      40.207  56.159  31.472  1.00 45.51           C  
ATOM   3435  O   LEU A 444      40.870  55.370  30.783  1.00 44.47           O  
ATOM   3436  CB  LEU A 444      37.791  56.333  30.945  1.00 41.04           C  
ATOM   3437  CG  LEU A 444      36.607  55.487  30.481  1.00 45.01           C  
ATOM   3438  CD1 LEU A 444      36.405  54.272  31.325  1.00 41.06           C  
ATOM   3439  CD2 LEU A 444      35.387  56.380  30.445  1.00 40.57           C  
ATOM   3440  N   THR A 445      40.645  57.371  31.797  1.00 45.86           N  
ATOM   3441  CA  THR A 445      41.983  57.823  31.415  1.00 46.40           C  
ATOM   3442  C   THR A 445      43.017  57.422  32.482  1.00 45.96           C  
ATOM   3443  O   THR A 445      43.995  56.713  32.211  1.00 45.38           O  
ATOM   3444  CB  THR A 445      42.024  59.357  31.277  1.00 47.62           C  
ATOM   3445  OG1 THR A 445      41.034  59.763  30.330  1.00 54.34           O  
ATOM   3446  CG2 THR A 445      43.390  59.834  30.810  1.00 40.24           C  
ATOM   3447  N   ILE A 446      42.766  57.872  33.704  1.00 47.22           N  
ATOM   3448  CA  ILE A 446      43.669  57.635  34.828  1.00 47.12           C  
ATOM   3449  C   ILE A 446      43.811  56.205  35.338  1.00 43.90           C  
ATOM   3450  O   ILE A 446      44.925  55.706  35.419  1.00 46.31           O  
ATOM   3451  CB  ILE A 446      43.302  58.563  35.993  1.00 44.54           C  
ATOM   3452  CG1 ILE A 446      43.595  60.011  35.586  1.00 42.94           C  
ATOM   3453  CG2 ILE A 446      44.089  58.176  37.227  1.00 46.45           C  
ATOM   3454  CD1 ILE A 446      42.670  61.021  36.222  1.00 38.38           C  
ATOM   3455  N   VAL A 447      42.711  55.544  35.687  1.00 43.60           N  
ATOM   3456  CA  VAL A 447      42.805  54.168  36.168  1.00 44.64           C  
ATOM   3457  C   VAL A 447      43.026  53.164  35.023  1.00 46.71           C  
ATOM   3458  O   VAL A 447      43.838  52.250  35.144  1.00 48.15           O  
ATOM   3459  CB  VAL A 447      41.543  53.762  36.971  1.00 44.91           C  
ATOM   3460  CG1 VAL A 447      41.638  52.298  37.398  1.00 42.67           C  
ATOM   3461  CG2 VAL A 447      41.408  54.648  38.210  1.00 43.89           C  
ATOM   3462  N   GLY A 448      42.319  53.334  33.907  1.00 46.29           N  
ATOM   3463  CA  GLY A 448      42.475  52.405  32.799  1.00 39.54           C  
ATOM   3464  C   GLY A 448      43.901  52.237  32.296  1.00 41.41           C  
ATOM   3465  O   GLY A 448      44.294  51.160  31.857  1.00 41.88           O  
ATOM   3466  N   THR A 449      44.696  53.295  32.383  1.00 39.51           N  
ATOM   3467  CA  THR A 449      46.072  53.252  31.914  1.00 32.36           C  
ATOM   3468  C   THR A 449      47.082  52.637  32.888  1.00 34.40           C  
ATOM   3469  O   THR A 449      48.185  52.259  32.483  1.00 36.39           O  
ATOM   3470  CB  THR A 449      46.568  54.672  31.582  1.00 36.57           C  
ATOM   3471  OG1 THR A 449      47.686  54.587  30.699  1.00 37.71           O  
ATOM   3472  CG2 THR A 449      47.013  55.401  32.860  1.00 31.19           C  
ATOM   3473  N   LEU A 450      46.738  52.539  34.164  1.00 34.44           N  
ATOM   3474  CA  LEU A 450      47.696  51.983  35.124  1.00 37.98           C  
ATOM   3475  C   LEU A 450      48.081  50.529  34.838  1.00 36.55           C  
ATOM   3476  O   LEU A 450      49.252  50.204  34.754  1.00 38.42           O  
ATOM   3477  CB  LEU A 450      47.168  52.137  36.550  1.00 33.23           C  
ATOM   3478  CG  LEU A 450      47.238  53.603  36.972  1.00 38.12           C  
ATOM   3479  CD1 LEU A 450      46.638  53.784  38.363  1.00 40.35           C  
ATOM   3480  CD2 LEU A 450      48.701  54.049  36.924  1.00 35.50           C  
ATOM   3481  N   PRO A 451      47.100  49.648  34.648  1.00 38.72           N  
ATOM   3482  CA  PRO A 451      47.472  48.266  34.377  1.00 36.81           C  
ATOM   3483  C   PRO A 451      48.198  48.145  33.053  1.00 36.49           C  
ATOM   3484  O   PRO A 451      49.114  47.333  32.917  1.00 38.86           O  
ATOM   3485  CB  PRO A 451      46.119  47.545  34.367  1.00 39.41           C  
ATOM   3486  CG  PRO A 451      45.264  48.396  35.228  1.00 38.90           C  
ATOM   3487  CD  PRO A 451      45.639  49.770  34.747  1.00 40.67           C  
ATOM   3488  N   PHE A 452      47.793  48.958  32.073  1.00 37.33           N  
ATOM   3489  CA  PHE A 452      48.423  48.913  30.753  1.00 36.76           C  
ATOM   3490  C   PHE A 452      49.875  49.353  30.859  1.00 36.53           C  
ATOM   3491  O   PHE A 452      50.773  48.749  30.273  1.00 34.09           O  
ATOM   3492  CB  PHE A 452      47.650  49.809  29.753  1.00 38.42           C  
ATOM   3493  CG  PHE A 452      48.354  50.000  28.432  1.00 39.13           C  
ATOM   3494  CD1 PHE A 452      49.479  50.825  28.339  1.00 38.22           C  
ATOM   3495  CD2 PHE A 452      47.925  49.321  27.295  1.00 42.00           C  
ATOM   3496  CE1 PHE A 452      50.164  50.966  27.149  1.00 40.64           C  
ATOM   3497  CE2 PHE A 452      48.605  49.455  26.089  1.00 43.19           C  
ATOM   3498  CZ  PHE A 452      49.732  50.279  26.015  1.00 42.00           C  
ATOM   3499  N   THR A 453      50.106  50.404  31.636  1.00 39.07           N  
ATOM   3500  CA  THR A 453      51.450  50.928  31.812  1.00 37.70           C  
ATOM   3501  C   THR A 453      52.339  49.966  32.587  1.00 36.92           C  
ATOM   3502  O   THR A 453      53.463  49.685  32.171  1.00 37.02           O  
ATOM   3503  CB  THR A 453      51.399  52.286  32.541  1.00 42.80           C  
ATOM   3504  OG1 THR A 453      50.592  53.178  31.772  1.00 36.54           O  
ATOM   3505  CG2 THR A 453      52.822  52.862  32.758  1.00 34.78           C  
ATOM   3506  N   TYR A 454      51.849  49.454  33.708  1.00 37.97           N  
ATOM   3507  CA  TYR A 454      52.662  48.511  34.485  1.00 40.61           C  
ATOM   3508  C   TYR A 454      52.990  47.262  33.658  1.00 39.50           C  
ATOM   3509  O   TYR A 454      54.118  46.814  33.601  1.00 41.13           O  
ATOM   3510  CB  TYR A 454      51.928  48.095  35.765  1.00 41.64           C  
ATOM   3511  CG  TYR A 454      52.486  46.831  36.390  1.00 47.27           C  
ATOM   3512  CD1 TYR A 454      51.672  45.739  36.635  1.00 49.56           C  
ATOM   3513  CD2 TYR A 454      53.839  46.715  36.685  1.00 52.56           C  
ATOM   3514  CE1 TYR A 454      52.182  44.558  37.149  1.00 54.31           C  
ATOM   3515  CE2 TYR A 454      54.366  45.541  37.207  1.00 54.91           C  
ATOM   3516  CZ  TYR A 454      53.528  44.462  37.433  1.00 54.91           C  
ATOM   3517  OH  TYR A 454      54.046  43.287  37.923  1.00 56.50           O  
ATOM   3518  N   MET A 455      51.995  46.699  32.996  1.00 45.02           N  
ATOM   3519  CA  MET A 455      52.241  45.497  32.220  1.00 45.31           C  
ATOM   3520  C   MET A 455      53.249  45.713  31.099  1.00 45.47           C  
ATOM   3521  O   MET A 455      54.142  44.896  30.901  1.00 44.26           O  
ATOM   3522  CB  MET A 455      50.916  44.953  31.686  1.00 46.68           C  
ATOM   3523  CG  MET A 455      51.033  43.671  30.900  1.00 51.41           C  
ATOM   3524  SD  MET A 455      51.106  43.984  29.141  1.00 50.89           S  
ATOM   3525  CE  MET A 455      52.622  43.218  28.704  1.00 50.50           C  
ATOM   3526  N   LEU A 456      53.140  46.819  30.370  1.00 46.79           N  
ATOM   3527  CA  LEU A 456      54.098  47.079  29.292  1.00 43.24           C  
ATOM   3528  C   LEU A 456      55.534  47.157  29.846  1.00 39.22           C  
ATOM   3529  O   LEU A 456      56.437  46.491  29.340  1.00 40.49           O  
ATOM   3530  CB  LEU A 456      53.683  48.362  28.544  1.00 42.09           C  
ATOM   3531  CG  LEU A 456      54.517  49.343  27.690  1.00 43.03           C  
ATOM   3532  CD1 LEU A 456      55.945  48.945  27.593  1.00 38.07           C  
ATOM   3533  CD2 LEU A 456      53.871  49.481  26.285  1.00 41.28           C  
ATOM   3534  N   GLU A 457      55.768  47.965  30.865  1.00 40.94           N  
ATOM   3535  CA  GLU A 457      57.127  48.048  31.417  1.00 44.32           C  
ATOM   3536  C   GLU A 457      57.635  46.726  32.014  1.00 43.10           C  
ATOM   3537  O   GLU A 457      58.836  46.415  31.944  1.00 42.96           O  
ATOM   3538  CB  GLU A 457      57.211  49.139  32.477  1.00 43.72           C  
ATOM   3539  CG  GLU A 457      57.493  50.516  31.913  1.00 54.71           C  
ATOM   3540  CD  GLU A 457      58.913  50.681  31.346  1.00 49.01           C  
ATOM   3541  OE1 GLU A 457      59.643  51.560  31.842  1.00 46.41           O  
ATOM   3542  OE2 GLU A 457      59.287  49.952  30.404  1.00 50.04           O  
ATOM   3543  N   LYS A 458      56.729  45.956  32.605  1.00 44.86           N  
ATOM   3544  CA  LYS A 458      57.105  44.674  33.186  1.00 47.57           C  
ATOM   3545  C   LYS A 458      57.642  43.782  32.080  1.00 47.89           C  
ATOM   3546  O   LYS A 458      58.694  43.140  32.235  1.00 48.23           O  
ATOM   3547  CB  LYS A 458      55.902  44.005  33.841  1.00 52.29           C  
ATOM   3548  CG  LYS A 458      56.210  42.623  34.402  1.00 58.15           C  
ATOM   3549  CD  LYS A 458      57.205  42.695  35.555  1.00 61.05           C  
ATOM   3550  CE  LYS A 458      57.292  41.355  36.316  1.00 64.23           C  
ATOM   3551  NZ  LYS A 458      58.284  41.393  37.433  1.00 60.62           N  
ATOM   3552  N   TRP A 459      56.941  43.771  30.945  1.00 42.81           N  
ATOM   3553  CA  TRP A 459      57.376  42.964  29.830  1.00 42.85           C  
ATOM   3554  C   TRP A 459      58.777  43.375  29.373  1.00 45.86           C  
ATOM   3555  O   TRP A 459      59.623  42.517  29.102  1.00 46.73           O  
ATOM   3556  CB  TRP A 459      56.386  43.078  28.678  1.00 44.21           C  
ATOM   3557  CG  TRP A 459      56.739  42.226  27.496  1.00 38.68           C  
ATOM   3558  CD1 TRP A 459      56.360  40.935  27.276  1.00 41.71           C  
ATOM   3559  CD2 TRP A 459      57.514  42.616  26.358  1.00 38.64           C  
ATOM   3560  NE1 TRP A 459      56.843  40.495  26.065  1.00 41.33           N  
ATOM   3561  CE2 TRP A 459      57.553  41.508  25.480  1.00 37.34           C  
ATOM   3562  CE3 TRP A 459      58.177  43.794  25.992  1.00 38.87           C  
ATOM   3563  CZ2 TRP A 459      58.223  41.544  24.266  1.00 39.40           C  
ATOM   3564  CZ3 TRP A 459      58.844  43.835  24.789  1.00 35.26           C  
ATOM   3565  CH2 TRP A 459      58.863  42.717  23.933  1.00 45.15           C  
ATOM   3566  N   ARG A 460      59.038  44.678  29.294  1.00 45.73           N  
ATOM   3567  CA  ARG A 460      60.363  45.143  28.868  1.00 45.36           C  
ATOM   3568  C   ARG A 460      61.428  44.822  29.906  1.00 42.05           C  
ATOM   3569  O   ARG A 460      62.539  44.441  29.555  1.00 40.95           O  
ATOM   3570  CB  ARG A 460      60.384  46.651  28.649  1.00 47.67           C  
ATOM   3571  CG  ARG A 460      59.639  47.162  27.438  1.00 52.12           C  
ATOM   3572  CD  ARG A 460      59.322  48.617  27.735  1.00 50.58           C  
ATOM   3573  NE  ARG A 460      59.967  49.494  26.800  1.00 43.73           N  
ATOM   3574  CZ  ARG A 460      59.942  50.814  26.877  1.00 41.12           C  
ATOM   3575  NH1 ARG A 460      59.321  51.419  27.877  1.00 36.28           N  
ATOM   3576  NH2 ARG A 460      60.463  51.525  25.885  1.00 38.85           N  
ATOM   3577  N   TRP A 461      61.104  45.036  31.176  1.00 41.62           N  
ATOM   3578  CA  TRP A 461      62.054  44.725  32.247  1.00 44.44           C  
ATOM   3579  C   TRP A 461      62.502  43.268  32.137  1.00 43.25           C  
ATOM   3580  O   TRP A 461      63.694  42.963  32.213  1.00 43.58           O  
ATOM   3581  CB  TRP A 461      61.409  44.954  33.617  1.00 39.45           C  
ATOM   3582  CG  TRP A 461      61.314  46.406  33.971  1.00 38.07           C  
ATOM   3583  CD1 TRP A 461      62.043  47.429  33.429  1.00 34.51           C  
ATOM   3584  CD2 TRP A 461      60.506  46.984  34.996  1.00 36.33           C  
ATOM   3585  NE1 TRP A 461      61.741  48.606  34.064  1.00 37.41           N  
ATOM   3586  CE2 TRP A 461      60.798  48.360  35.029  1.00 37.95           C  
ATOM   3587  CE3 TRP A 461      59.559  46.472  35.889  1.00 41.65           C  
ATOM   3588  CZ2 TRP A 461      60.183  49.229  35.923  1.00 34.89           C  
ATOM   3589  CZ3 TRP A 461      58.947  47.329  36.772  1.00 41.80           C  
ATOM   3590  CH2 TRP A 461      59.260  48.700  36.783  1.00 40.29           C  
ATOM   3591  N   MET A 462      61.532  42.384  31.922  1.00 45.98           N  
ATOM   3592  CA  MET A 462      61.799  40.961  31.800  1.00 49.34           C  
ATOM   3593  C   MET A 462      62.562  40.616  30.533  1.00 51.27           C  
ATOM   3594  O   MET A 462      63.447  39.744  30.543  1.00 51.75           O  
ATOM   3595  CB  MET A 462      60.492  40.182  31.862  1.00 50.17           C  
ATOM   3596  CG  MET A 462      59.808  40.255  33.218  1.00 46.71           C  
ATOM   3597  SD  MET A 462      58.208  39.416  33.140  1.00 54.66           S  
ATOM   3598  CE  MET A 462      58.677  37.768  33.742  1.00 53.65           C  
ATOM   3599  N   VAL A 463      62.226  41.297  29.443  1.00 51.08           N  
ATOM   3600  CA  VAL A 463      62.913  41.084  28.181  1.00 46.17           C  
ATOM   3601  C   VAL A 463      64.376  41.485  28.369  1.00 51.44           C  
ATOM   3602  O   VAL A 463      65.280  40.736  28.002  1.00 50.89           O  
ATOM   3603  CB  VAL A 463      62.289  41.939  27.048  1.00 45.99           C  
ATOM   3604  CG1 VAL A 463      63.236  42.004  25.864  1.00 41.47           C  
ATOM   3605  CG2 VAL A 463      60.952  41.329  26.611  1.00 46.82           C  
ATOM   3606  N   PHE A 464      64.616  42.657  28.954  1.00 51.54           N  
ATOM   3607  CA  PHE A 464      65.995  43.119  29.154  1.00 56.23           C  
ATOM   3608  C   PHE A 464      66.783  42.189  30.101  1.00 57.73           C  
ATOM   3609  O   PHE A 464      67.999  41.998  29.933  1.00 57.08           O  
ATOM   3610  CB  PHE A 464      66.007  44.565  29.687  1.00 55.00           C  
ATOM   3611  CG  PHE A 464      65.452  45.577  28.713  1.00 56.80           C  
ATOM   3612  CD1 PHE A 464      64.622  46.591  29.143  1.00 56.71           C  
ATOM   3613  CD2 PHE A 464      65.748  45.500  27.369  1.00 60.24           C  
ATOM   3614  CE1 PHE A 464      64.103  47.500  28.248  1.00 58.16           C  
ATOM   3615  CE2 PHE A 464      65.230  46.408  26.472  1.00 59.52           C  
ATOM   3616  CZ  PHE A 464      64.409  47.406  26.913  1.00 58.42           C  
ATOM   3617  N   LYS A 465      66.094  41.618  31.091  1.00 57.30           N  
ATOM   3618  CA  LYS A 465      66.745  40.694  32.021  1.00 56.37           C  
ATOM   3619  C   LYS A 465      67.026  39.350  31.355  1.00 54.58           C  
ATOM   3620  O   LYS A 465      67.836  38.580  31.837  1.00 56.29           O  
ATOM   3621  CB  LYS A 465      65.878  40.462  33.255  1.00 52.43           C  
ATOM   3622  CG  LYS A 465      65.829  41.629  34.194  1.00 55.44           C  
ATOM   3623  CD  LYS A 465      64.910  41.344  35.368  1.00 57.64           C  
ATOM   3624  CE  LYS A 465      65.114  42.387  36.459  1.00 57.74           C  
ATOM   3625  NZ  LYS A 465      64.317  42.100  37.680  1.00 59.84           N  
ATOM   3626  N   GLY A 466      66.361  39.075  30.241  1.00 54.49           N  
ATOM   3627  CA  GLY A 466      66.566  37.808  29.562  1.00 54.99           C  
ATOM   3628  C   GLY A 466      65.671  36.683  30.079  1.00 55.74           C  
ATOM   3629  O   GLY A 466      65.979  35.515  29.885  1.00 58.07           O  
ATOM   3630  N   GLU A 467      64.570  37.023  30.738  1.00 55.69           N  
ATOM   3631  CA  GLU A 467      63.658  36.019  31.273  1.00 55.00           C  
ATOM   3632  C   GLU A 467      62.617  35.602  30.255  1.00 56.38           C  
ATOM   3633  O   GLU A 467      61.809  34.720  30.520  1.00 56.00           O  
ATOM   3634  CB  GLU A 467      62.956  36.549  32.506  1.00 55.20           C  
ATOM   3635  CG  GLU A 467      63.891  37.188  33.493  1.00 60.65           C  
ATOM   3636  CD  GLU A 467      63.154  37.729  34.687  1.00 65.89           C  
ATOM   3637  OE1 GLU A 467      62.160  38.458  34.483  1.00 69.84           O  
ATOM   3638  OE2 GLU A 467      63.561  37.431  35.831  1.00 69.08           O  
ATOM   3639  N   ILE A 468      62.617  36.247  29.095  1.00 56.58           N  
ATOM   3640  CA  ILE A 468      61.676  35.872  28.060  1.00 58.00           C  
ATOM   3641  C   ILE A 468      62.451  35.686  26.761  1.00 60.78           C  
ATOM   3642  O   ILE A 468      62.882  36.648  26.132  1.00 62.90           O  
ATOM   3643  CB  ILE A 468      60.589  36.932  27.835  1.00 55.23           C  
ATOM   3644  CG1 ILE A 468      59.855  37.248  29.134  1.00 53.90           C  
ATOM   3645  CG2 ILE A 468      59.596  36.412  26.819  1.00 54.33           C  
ATOM   3646  CD1 ILE A 468      58.972  38.490  29.028  1.00 48.47           C  
ATOM   3647  N   PRO A 469      62.646  34.432  26.352  1.00 62.64           N  
ATOM   3648  CA  PRO A 469      63.370  34.075  25.127  1.00 62.10           C  
ATOM   3649  C   PRO A 469      62.704  34.703  23.908  1.00 60.59           C  
ATOM   3650  O   PRO A 469      61.479  34.798  23.851  1.00 60.73           O  
ATOM   3651  CB  PRO A 469      63.266  32.549  25.096  1.00 63.43           C  
ATOM   3652  CG  PRO A 469      63.094  32.183  26.567  1.00 66.07           C  
ATOM   3653  CD  PRO A 469      62.137  33.235  27.044  1.00 61.61           C  
ATOM   3654  N   LYS A 470      63.505  35.120  22.935  1.00 59.49           N  
ATOM   3655  CA  LYS A 470      62.962  35.728  21.725  1.00 59.14           C  
ATOM   3656  C   LYS A 470      61.760  34.928  21.223  1.00 57.91           C  
ATOM   3657  O   LYS A 470      60.757  35.508  20.786  1.00 53.97           O  
ATOM   3658  CB  LYS A 470      64.021  35.780  20.614  1.00 59.14           C  
ATOM   3659  CG  LYS A 470      65.216  36.711  20.859  1.00 65.00           C  
ATOM   3660  CD  LYS A 470      66.226  36.622  19.698  1.00 66.46           C  
ATOM   3661  CE  LYS A 470      67.530  37.391  19.972  1.00 73.01           C  
ATOM   3662  NZ  LYS A 470      67.379  38.896  20.015  1.00 75.77           N  
ATOM   3663  N   ASP A 471      61.858  33.598  21.305  1.00 58.17           N  
ATOM   3664  CA  ASP A 471      60.785  32.721  20.823  1.00 57.18           C  
ATOM   3665  C   ASP A 471      59.505  32.716  21.639  1.00 53.35           C  
ATOM   3666  O   ASP A 471      58.535  32.080  21.251  1.00 52.97           O  
ATOM   3667  CB  ASP A 471      61.293  31.282  20.630  1.00 60.63           C  
ATOM   3668  CG  ASP A 471      61.954  30.709  21.873  1.00 65.40           C  
ATOM   3669  OD1 ASP A 471      61.250  30.418  22.872  1.00 63.29           O  
ATOM   3670  OD2 ASP A 471      63.195  30.549  21.846  1.00 70.97           O  
ATOM   3671  N   GLN A 472      59.495  33.436  22.759  1.00 52.97           N  
ATOM   3672  CA  GLN A 472      58.289  33.539  23.586  1.00 52.36           C  
ATOM   3673  C   GLN A 472      57.859  35.000  23.843  1.00 47.70           C  
ATOM   3674  O   GLN A 472      56.965  35.246  24.654  1.00 45.88           O  
ATOM   3675  CB  GLN A 472      58.500  32.867  24.939  1.00 53.68           C  
ATOM   3676  CG  GLN A 472      58.987  31.445  24.866  1.00 61.34           C  
ATOM   3677  CD  GLN A 472      58.549  30.660  26.078  1.00 65.61           C  
ATOM   3678  OE1 GLN A 472      58.907  30.992  27.219  1.00 65.46           O  
ATOM   3679  NE2 GLN A 472      57.748  29.621  25.846  1.00 65.94           N  
ATOM   3680  N   TRP A 473      58.493  35.955  23.167  1.00 46.84           N  
ATOM   3681  CA  TRP A 473      58.168  37.376  23.349  1.00 44.86           C  
ATOM   3682  C   TRP A 473      56.680  37.668  23.209  1.00 43.74           C  
ATOM   3683  O   TRP A 473      56.049  38.123  24.160  1.00 42.97           O  
ATOM   3684  CB  TRP A 473      58.924  38.235  22.344  1.00 46.46           C  
ATOM   3685  CG  TRP A 473      60.281  38.621  22.775  1.00 47.91           C  
ATOM   3686  CD1 TRP A 473      60.962  38.151  23.849  1.00 50.16           C  
ATOM   3687  CD2 TRP A 473      61.150  39.557  22.122  1.00 48.38           C  
ATOM   3688  NE1 TRP A 473      62.211  38.733  23.914  1.00 47.12           N  
ATOM   3689  CE2 TRP A 473      62.350  39.600  22.864  1.00 47.71           C  
ATOM   3690  CE3 TRP A 473      61.027  40.362  20.984  1.00 46.44           C  
ATOM   3691  CZ2 TRP A 473      63.423  40.415  22.507  1.00 48.24           C  
ATOM   3692  CZ3 TRP A 473      62.092  41.174  20.626  1.00 49.93           C  
ATOM   3693  CH2 TRP A 473      63.277  41.193  21.388  1.00 52.76           C  
ATOM   3694  N   MET A 474      56.122  37.437  22.021  1.00 41.76           N  
ATOM   3695  CA  MET A 474      54.704  37.692  21.826  1.00 41.62           C  
ATOM   3696  C   MET A 474      53.839  36.796  22.695  1.00 45.31           C  
ATOM   3697  O   MET A 474      52.816  37.242  23.231  1.00 46.30           O  
ATOM   3698  CB  MET A 474      54.298  37.505  20.356  1.00 42.63           C  
ATOM   3699  CG  MET A 474      54.854  38.558  19.417  1.00 44.79           C  
ATOM   3700  SD  MET A 474      54.754  40.197  20.167  1.00 49.04           S  
ATOM   3701  CE  MET A 474      53.080  40.397  20.209  1.00 48.00           C  
ATOM   3702  N   LYS A 475      54.233  35.531  22.836  1.00 46.17           N  
ATOM   3703  CA  LYS A 475      53.455  34.616  23.651  1.00 45.10           C  
ATOM   3704  C   LYS A 475      53.334  35.197  25.052  1.00 43.92           C  
ATOM   3705  O   LYS A 475      52.237  35.302  25.605  1.00 41.98           O  
ATOM   3706  CB  LYS A 475      54.124  33.234  23.728  1.00 47.28           C  
ATOM   3707  CG  LYS A 475      53.268  32.202  24.455  1.00 49.10           C  
ATOM   3708  CD  LYS A 475      54.124  31.153  25.131  1.00 57.34           C  
ATOM   3709  CE  LYS A 475      54.055  29.808  24.414  1.00 62.48           C  
ATOM   3710  NZ  LYS A 475      52.719  29.149  24.584  1.00 65.79           N  
ATOM   3711  N   LYS A 476      54.466  35.590  25.619  1.00 42.88           N  
ATOM   3712  CA  LYS A 476      54.456  36.149  26.959  1.00 45.69           C  
ATOM   3713  C   LYS A 476      53.724  37.490  26.991  1.00 47.26           C  
ATOM   3714  O   LYS A 476      53.031  37.801  27.966  1.00 48.37           O  
ATOM   3715  CB  LYS A 476      55.889  36.309  27.466  1.00 47.91           C  
ATOM   3716  CG  LYS A 476      56.169  35.564  28.761  1.00 53.67           C  
ATOM   3717  CD  LYS A 476      55.265  36.052  29.868  1.00 60.11           C  
ATOM   3718  CE  LYS A 476      55.669  35.474  31.216  1.00 66.49           C  
ATOM   3719  NZ  LYS A 476      55.607  33.969  31.228  1.00 72.96           N  
ATOM   3720  N   TRP A 477      53.862  38.279  25.925  1.00 44.35           N  
ATOM   3721  CA  TRP A 477      53.189  39.577  25.859  1.00 44.51           C  
ATOM   3722  C   TRP A 477      51.686  39.398  25.999  1.00 42.44           C  
ATOM   3723  O   TRP A 477      51.063  40.031  26.837  1.00 46.81           O  
ATOM   3724  CB  TRP A 477      53.510  40.284  24.533  1.00 42.92           C  
ATOM   3725  CG  TRP A 477      52.705  41.542  24.256  1.00 46.14           C  
ATOM   3726  CD1 TRP A 477      51.644  41.666  23.400  1.00 46.38           C  
ATOM   3727  CD2 TRP A 477      52.957  42.861  24.769  1.00 42.90           C  
ATOM   3728  NE1 TRP A 477      51.229  42.977  23.338  1.00 45.35           N  
ATOM   3729  CE2 TRP A 477      52.013  43.732  24.169  1.00 44.34           C  
ATOM   3730  CE3 TRP A 477      53.889  43.390  25.671  1.00 41.56           C  
ATOM   3731  CZ2 TRP A 477      51.971  45.113  24.445  1.00 41.17           C  
ATOM   3732  CZ3 TRP A 477      53.851  44.764  25.950  1.00 45.06           C  
ATOM   3733  CH2 TRP A 477      52.891  45.608  25.334  1.00 42.20           C  
ATOM   3734  N   TRP A 478      51.097  38.529  25.184  1.00 45.64           N  
ATOM   3735  CA  TRP A 478      49.658  38.308  25.245  1.00 42.65           C  
ATOM   3736  C   TRP A 478      49.219  37.511  26.465  1.00 45.60           C  
ATOM   3737  O   TRP A 478      48.081  37.634  26.909  1.00 48.15           O  
ATOM   3738  CB  TRP A 478      49.167  37.672  23.944  1.00 44.92           C  
ATOM   3739  CG  TRP A 478      49.126  38.726  22.868  1.00 44.30           C  
ATOM   3740  CD1 TRP A 478      50.004  38.892  21.837  1.00 40.98           C  
ATOM   3741  CD2 TRP A 478      48.304  39.898  22.888  1.00 37.65           C  
ATOM   3742  NE1 TRP A 478      49.791  40.110  21.231  1.00 41.74           N  
ATOM   3743  CE2 TRP A 478      48.751  40.743  21.863  1.00 38.54           C  
ATOM   3744  CE3 TRP A 478      47.241  40.317  23.692  1.00 37.73           C  
ATOM   3745  CZ2 TRP A 478      48.174  41.987  21.616  1.00 38.09           C  
ATOM   3746  CZ3 TRP A 478      46.669  41.557  23.449  1.00 39.88           C  
ATOM   3747  CH2 TRP A 478      47.142  42.375  22.420  1.00 37.05           C  
ATOM   3748  N   GLU A 479      50.119  36.730  27.043  1.00 45.68           N  
ATOM   3749  CA  GLU A 479      49.769  35.983  28.255  1.00 49.30           C  
ATOM   3750  C   GLU A 479      49.600  37.050  29.338  1.00 47.32           C  
ATOM   3751  O   GLU A 479      48.665  37.013  30.140  1.00 48.04           O  
ATOM   3752  CB  GLU A 479      50.914  35.037  28.631  1.00 52.45           C  
ATOM   3753  CG  GLU A 479      50.503  33.621  28.981  1.00 58.28           C  
ATOM   3754  CD  GLU A 479      51.468  32.578  28.409  1.00 63.63           C  
ATOM   3755  OE1 GLU A 479      52.659  32.567  28.812  1.00 62.00           O  
ATOM   3756  OE2 GLU A 479      51.028  31.774  27.551  1.00 65.54           O  
ATOM   3757  N   MET A 480      50.520  38.015  29.333  1.00 47.66           N  
ATOM   3758  CA  MET A 480      50.508  39.119  30.286  1.00 44.59           C  
ATOM   3759  C   MET A 480      49.366  40.125  30.044  1.00 45.90           C  
ATOM   3760  O   MET A 480      48.793  40.675  30.998  1.00 41.60           O  
ATOM   3761  CB  MET A 480      51.867  39.810  30.254  1.00 47.62           C  
ATOM   3762  CG  MET A 480      52.974  38.960  30.876  1.00 41.94           C  
ATOM   3763  SD  MET A 480      54.624  39.571  30.569  1.00 49.38           S  
ATOM   3764  CE  MET A 480      54.647  40.968  31.754  1.00 38.25           C  
ATOM   3765  N   LYS A 481      49.022  40.374  28.782  1.00 45.11           N  
ATOM   3766  CA  LYS A 481      47.906  41.280  28.519  1.00 47.33           C  
ATOM   3767  C   LYS A 481      46.633  40.683  29.145  1.00 47.81           C  
ATOM   3768  O   LYS A 481      45.880  41.379  29.834  1.00 48.37           O  
ATOM   3769  CB  LYS A 481      47.707  41.476  27.008  1.00 47.75           C  
ATOM   3770  CG  LYS A 481      48.584  42.550  26.374  1.00 52.87           C  
ATOM   3771  CD  LYS A 481      48.154  43.963  26.820  1.00 54.73           C  
ATOM   3772  CE  LYS A 481      48.661  45.046  25.861  1.00 55.02           C  
ATOM   3773  NZ  LYS A 481      48.128  46.411  26.220  1.00 55.49           N  
ATOM   3774  N   ARG A 482      46.410  39.386  28.902  1.00 49.99           N  
ATOM   3775  CA  ARG A 482      45.242  38.650  29.403  1.00 48.21           C  
ATOM   3776  C   ARG A 482      45.171  38.581  30.926  1.00 46.79           C  
ATOM   3777  O   ARG A 482      44.123  38.813  31.506  1.00 46.80           O  
ATOM   3778  CB  ARG A 482      45.230  37.216  28.856  1.00 52.31           C  
ATOM   3779  CG  ARG A 482      45.024  37.087  27.354  1.00 55.87           C  
ATOM   3780  CD  ARG A 482      45.177  35.633  26.899  1.00 58.06           C  
ATOM   3781  NE  ARG A 482      45.007  35.453  25.456  1.00 59.69           N  
ATOM   3782  CZ  ARG A 482      44.137  34.599  24.911  1.00 62.34           C  
ATOM   3783  NH1 ARG A 482      43.361  33.858  25.697  1.00 57.40           N  
ATOM   3784  NH2 ARG A 482      44.053  34.469  23.584  1.00 56.94           N  
ATOM   3785  N   GLU A 483      46.284  38.266  31.577  1.00 47.83           N  
ATOM   3786  CA  GLU A 483      46.296  38.167  33.037  1.00 49.47           C  
ATOM   3787  C   GLU A 483      46.234  39.477  33.833  1.00 45.97           C  
ATOM   3788  O   GLU A 483      45.418  39.628  34.737  1.00 46.21           O  
ATOM   3789  CB  GLU A 483      47.536  37.398  33.487  1.00 54.03           C  
ATOM   3790  CG  GLU A 483      47.364  35.908  33.457  1.00 69.52           C  
ATOM   3791  CD  GLU A 483      46.625  35.403  34.678  1.00 75.02           C  
ATOM   3792  OE1 GLU A 483      46.269  34.203  34.703  1.00 78.21           O  
ATOM   3793  OE2 GLU A 483      46.410  36.213  35.614  1.00 77.96           O  
ATOM   3794  N   ILE A 484      47.119  40.407  33.507  1.00 45.48           N  
ATOM   3795  CA  ILE A 484      47.222  41.685  34.217  1.00 43.02           C  
ATOM   3796  C   ILE A 484      46.239  42.758  33.785  1.00 41.08           C  
ATOM   3797  O   ILE A 484      45.611  43.407  34.616  1.00 39.94           O  
ATOM   3798  CB  ILE A 484      48.648  42.266  34.060  1.00 44.56           C  
ATOM   3799  CG1 ILE A 484      49.676  41.244  34.564  1.00 48.74           C  
ATOM   3800  CG2 ILE A 484      48.757  43.586  34.806  1.00 44.62           C  
ATOM   3801  CD1 ILE A 484      51.136  41.550  34.206  1.00 47.20           C  
ATOM   3802  N   VAL A 485      46.092  42.925  32.476  1.00 42.63           N  
ATOM   3803  CA  VAL A 485      45.228  43.964  31.931  1.00 41.22           C  
ATOM   3804  C   VAL A 485      43.807  43.502  31.655  1.00 40.94           C  
ATOM   3805  O   VAL A 485      42.882  44.308  31.621  1.00 40.27           O  
ATOM   3806  CB  VAL A 485      45.870  44.513  30.627  1.00 41.49           C  
ATOM   3807  CG1 VAL A 485      45.224  45.861  30.189  1.00 38.81           C  
ATOM   3808  CG2 VAL A 485      47.365  44.660  30.847  1.00 37.80           C  
ATOM   3809  N   GLY A 486      43.640  42.197  31.462  1.00 44.32           N  
ATOM   3810  CA  GLY A 486      42.329  41.651  31.165  1.00 39.96           C  
ATOM   3811  C   GLY A 486      41.921  42.072  29.763  1.00 41.67           C  
ATOM   3812  O   GLY A 486      40.785  42.499  29.536  1.00 45.19           O  
ATOM   3813  N   VAL A 487      42.850  41.949  28.825  1.00 39.48           N  
ATOM   3814  CA  VAL A 487      42.628  42.341  27.436  1.00 41.11           C  
ATOM   3815  C   VAL A 487      43.183  41.222  26.587  1.00 42.48           C  
ATOM   3816  O   VAL A 487      44.249  40.688  26.913  1.00 44.61           O  
ATOM   3817  CB  VAL A 487      43.397  43.662  27.109  1.00 44.27           C  
ATOM   3818  CG1 VAL A 487      43.376  43.954  25.612  1.00 45.09           C  
ATOM   3819  CG2 VAL A 487      42.768  44.830  27.870  1.00 43.62           C  
ATOM   3820  N   VAL A 488      42.470  40.857  25.518  1.00 41.49           N  
ATOM   3821  CA  VAL A 488      42.900  39.783  24.624  1.00 40.30           C  
ATOM   3822  C   VAL A 488      43.030  40.198  23.173  1.00 42.98           C  
ATOM   3823  O   VAL A 488      42.193  40.930  22.642  1.00 41.63           O  
ATOM   3824  CB  VAL A 488      41.909  38.570  24.574  1.00 44.87           C  
ATOM   3825  CG1 VAL A 488      42.351  37.480  25.503  1.00 49.07           C  
ATOM   3826  CG2 VAL A 488      40.512  39.024  24.853  1.00 37.53           C  
ATOM   3827  N   GLU A 489      44.054  39.658  22.526  1.00 42.34           N  
ATOM   3828  CA  GLU A 489      44.307  39.935  21.132  1.00 45.73           C  
ATOM   3829  C   GLU A 489      43.186  39.280  20.308  1.00 48.65           C  
ATOM   3830  O   GLU A 489      42.803  38.146  20.570  1.00 48.76           O  
ATOM   3831  CB  GLU A 489      45.670  39.372  20.738  1.00 43.84           C  
ATOM   3832  CG  GLU A 489      45.738  37.857  20.638  1.00 49.32           C  
ATOM   3833  CD  GLU A 489      45.809  37.141  21.981  1.00 54.88           C  
ATOM   3834  OE1 GLU A 489      46.090  35.929  21.972  1.00 56.73           O  
ATOM   3835  OE2 GLU A 489      45.583  37.767  23.038  1.00 57.25           O  
ATOM   3836  N   PRO A 490      42.650  40.002  19.311  1.00 48.90           N  
ATOM   3837  CA  PRO A 490      41.570  39.596  18.398  1.00 48.56           C  
ATOM   3838  C   PRO A 490      42.008  38.502  17.450  1.00 47.24           C  
ATOM   3839  O   PRO A 490      41.208  37.676  17.034  1.00 46.48           O  
ATOM   3840  CB  PRO A 490      41.240  40.881  17.629  1.00 50.82           C  
ATOM   3841  CG  PRO A 490      41.821  41.995  18.484  1.00 54.15           C  
ATOM   3842  CD  PRO A 490      43.079  41.383  19.037  1.00 50.97           C  
ATOM   3843  N   VAL A 491      43.292  38.527  17.116  1.00 48.89           N  
ATOM   3844  CA  VAL A 491      43.926  37.582  16.208  1.00 48.47           C  
ATOM   3845  C   VAL A 491      45.130  36.980  16.908  1.00 48.82           C  
ATOM   3846  O   VAL A 491      45.758  37.634  17.728  1.00 50.18           O  
ATOM   3847  CB  VAL A 491      44.446  38.303  14.962  1.00 48.08           C  
ATOM   3848  CG1 VAL A 491      45.117  37.327  14.057  1.00 55.79           C  
ATOM   3849  CG2 VAL A 491      43.308  39.003  14.246  1.00 52.55           C  
ATOM   3850  N   PRO A 492      45.469  35.721  16.610  1.00 48.56           N  
ATOM   3851  CA  PRO A 492      46.642  35.221  17.324  1.00 48.11           C  
ATOM   3852  C   PRO A 492      47.907  35.728  16.640  1.00 47.99           C  
ATOM   3853  O   PRO A 492      47.950  35.844  15.418  1.00 47.54           O  
ATOM   3854  CB  PRO A 492      46.466  33.701  17.257  1.00 47.29           C  
ATOM   3855  CG  PRO A 492      45.706  33.513  15.980  1.00 46.66           C  
ATOM   3856  CD  PRO A 492      44.707  34.618  16.002  1.00 45.16           C  
ATOM   3857  N   HIS A 493      48.927  36.038  17.435  1.00 47.45           N  
ATOM   3858  CA  HIS A 493      50.182  36.559  16.913  1.00 49.25           C  
ATOM   3859  C   HIS A 493      51.395  35.705  17.261  1.00 50.19           C  
ATOM   3860  O   HIS A 493      51.686  35.483  18.428  1.00 49.66           O  
ATOM   3861  CB  HIS A 493      50.427  37.972  17.453  1.00 47.76           C  
ATOM   3862  CG  HIS A 493      49.515  39.008  16.878  1.00 50.23           C  
ATOM   3863  ND1 HIS A 493      48.563  38.716  15.926  1.00 50.09           N  
ATOM   3864  CD2 HIS A 493      49.421  40.339  17.106  1.00 47.55           C  
ATOM   3865  CE1 HIS A 493      47.921  39.820  15.594  1.00 43.67           C  
ATOM   3866  NE2 HIS A 493      48.424  40.820  16.296  1.00 51.10           N  
ATOM   3867  N   ASP A 494      52.129  35.265  16.248  1.00 52.04           N  
ATOM   3868  CA  ASP A 494      53.317  34.460  16.496  1.00 53.92           C  
ATOM   3869  C   ASP A 494      54.539  35.371  16.716  1.00 54.55           C  
ATOM   3870  O   ASP A 494      54.396  36.592  16.811  1.00 53.23           O  
ATOM   3871  CB  ASP A 494      53.540  33.473  15.339  1.00 52.39           C  
ATOM   3872  CG  ASP A 494      53.826  34.159  14.025  1.00 55.10           C  
ATOM   3873  OD1 ASP A 494      53.901  33.453  13.005  1.00 60.68           O  
ATOM   3874  OD2 ASP A 494      53.988  35.397  13.999  1.00 61.11           O  
ATOM   3875  N   GLU A 495      55.733  34.787  16.792  1.00 53.82           N  
ATOM   3876  CA  GLU A 495      56.940  35.569  17.060  1.00 54.31           C  
ATOM   3877  C   GLU A 495      57.409  36.422  15.893  1.00 52.87           C  
ATOM   3878  O   GLU A 495      58.446  37.083  15.949  1.00 52.53           O  
ATOM   3879  CB  GLU A 495      58.053  34.645  17.539  1.00 51.73           C  
ATOM   3880  CG  GLU A 495      57.642  33.871  18.787  1.00 52.97           C  
ATOM   3881  CD  GLU A 495      57.235  34.777  19.922  1.00 54.96           C  
ATOM   3882  OE1 GLU A 495      56.387  34.376  20.756  1.00 55.39           O  
ATOM   3883  OE2 GLU A 495      57.779  35.894  19.991  1.00 57.82           O  
ATOM   3884  N   THR A 496      56.612  36.417  14.842  1.00 50.78           N  
ATOM   3885  CA  THR A 496      56.890  37.195  13.660  1.00 48.62           C  
ATOM   3886  C   THR A 496      56.485  38.670  13.904  1.00 46.72           C  
ATOM   3887  O   THR A 496      56.998  39.596  13.273  1.00 47.87           O  
ATOM   3888  CB  THR A 496      56.130  36.556  12.505  1.00 50.52           C  
ATOM   3889  OG1 THR A 496      57.062  35.842  11.668  1.00 49.86           O  
ATOM   3890  CG2 THR A 496      55.360  37.573  11.744  1.00 46.60           C  
ATOM   3891  N   TYR A 497      55.581  38.860  14.855  1.00 44.89           N  
ATOM   3892  CA  TYR A 497      55.071  40.168  15.255  1.00 45.03           C  
ATOM   3893  C   TYR A 497      55.923  40.788  16.370  1.00 45.82           C  
ATOM   3894  O   TYR A 497      56.748  40.119  16.987  1.00 47.91           O  
ATOM   3895  CB  TYR A 497      53.654  40.031  15.810  1.00 39.55           C  
ATOM   3896  CG  TYR A 497      52.567  39.713  14.814  1.00 43.98           C  
ATOM   3897  CD1 TYR A 497      51.713  40.705  14.346  1.00 39.83           C  
ATOM   3898  CD2 TYR A 497      52.345  38.409  14.395  1.00 45.82           C  
ATOM   3899  CE1 TYR A 497      50.669  40.409  13.503  1.00 42.28           C  
ATOM   3900  CE2 TYR A 497      51.304  38.102  13.555  1.00 43.52           C  
ATOM   3901  CZ  TYR A 497      50.464  39.101  13.117  1.00 48.08           C  
ATOM   3902  OH  TYR A 497      49.367  38.767  12.354  1.00 50.06           O  
ATOM   3903  N   CYS A 498      55.698  42.070  16.624  1.00 44.73           N  
ATOM   3904  CA  CYS A 498      56.370  42.781  17.702  1.00 46.62           C  
ATOM   3905  C   CYS A 498      55.380  43.825  18.146  1.00 47.06           C  
ATOM   3906  O   CYS A 498      55.588  45.024  17.957  1.00 49.10           O  
ATOM   3907  CB  CYS A 498      57.641  43.481  17.260  1.00 42.84           C  
ATOM   3908  SG  CYS A 498      58.637  43.873  18.739  1.00 54.61           S  
ATOM   3909  N   ASP A 499      54.294  43.360  18.741  1.00 45.03           N  
ATOM   3910  CA  ASP A 499      53.234  44.252  19.165  1.00 44.76           C  
ATOM   3911  C   ASP A 499      53.601  45.344  20.156  1.00 43.92           C  
ATOM   3912  O   ASP A 499      53.028  46.410  20.117  1.00 45.27           O  
ATOM   3913  CB  ASP A 499      52.068  43.410  19.644  1.00 45.21           C  
ATOM   3914  CG  ASP A 499      51.489  42.565  18.514  1.00 46.58           C  
ATOM   3915  OD1 ASP A 499      50.804  41.571  18.805  1.00 44.63           O  
ATOM   3916  OD2 ASP A 499      51.726  42.913  17.332  1.00 45.56           O  
ATOM   3917  N   PRO A 500      54.549  45.097  21.067  1.00 46.50           N  
ATOM   3918  CA  PRO A 500      54.837  46.226  21.963  1.00 44.07           C  
ATOM   3919  C   PRO A 500      55.510  47.385  21.214  1.00 42.42           C  
ATOM   3920  O   PRO A 500      55.285  48.560  21.521  1.00 39.86           O  
ATOM   3921  CB  PRO A 500      55.732  45.604  23.048  1.00 43.66           C  
ATOM   3922  CG  PRO A 500      56.274  44.366  22.417  1.00 47.31           C  
ATOM   3923  CD  PRO A 500      55.137  43.844  21.573  1.00 42.70           C  
ATOM   3924  N   ALA A 501      56.301  47.044  20.202  1.00 42.80           N  
ATOM   3925  CA  ALA A 501      57.014  48.040  19.405  1.00 42.38           C  
ATOM   3926  C   ALA A 501      56.102  48.895  18.518  1.00 42.81           C  
ATOM   3927  O   ALA A 501      56.541  49.914  17.967  1.00 43.48           O  
ATOM   3928  CB  ALA A 501      58.076  47.357  18.557  1.00 41.65           C  
ATOM   3929  N   SER A 502      54.842  48.494  18.379  1.00 42.50           N  
ATOM   3930  CA  SER A 502      53.912  49.260  17.560  1.00 45.00           C  
ATOM   3931  C   SER A 502      53.373  50.429  18.382  1.00 43.65           C  
ATOM   3932  O   SER A 502      52.423  51.102  17.991  1.00 41.43           O  
ATOM   3933  CB  SER A 502      52.748  48.386  17.094  1.00 43.80           C  
ATOM   3934  OG  SER A 502      51.754  48.306  18.099  1.00 45.30           O  
ATOM   3935  N   LEU A 503      53.975  50.633  19.545  1.00 44.76           N  
ATOM   3936  CA  LEU A 503      53.607  51.726  20.437  1.00 42.27           C  
ATOM   3937  C   LEU A 503      54.783  52.690  20.346  1.00 39.79           C  
ATOM   3938  O   LEU A 503      55.936  52.258  20.417  1.00 38.86           O  
ATOM   3939  CB  LEU A 503      53.491  51.222  21.881  1.00 44.89           C  
ATOM   3940  CG  LEU A 503      52.672  52.010  22.907  1.00 46.63           C  
ATOM   3941  CD1 LEU A 503      53.438  52.093  24.200  1.00 46.14           C  
ATOM   3942  CD2 LEU A 503      52.356  53.391  22.400  1.00 45.89           C  
ATOM   3943  N   PHE A 504      54.492  53.980  20.211  1.00 35.72           N  
ATOM   3944  CA  PHE A 504      55.523  55.013  20.124  1.00 38.39           C  
ATOM   3945  C   PHE A 504      56.699  54.904  21.126  1.00 37.05           C  
ATOM   3946  O   PHE A 504      57.863  54.851  20.727  1.00 40.03           O  
ATOM   3947  CB  PHE A 504      54.878  56.400  20.263  1.00 35.00           C  
ATOM   3948  CG  PHE A 504      55.875  57.532  20.325  1.00 36.80           C  
ATOM   3949  CD1 PHE A 504      56.446  58.030  19.175  1.00 35.35           C  
ATOM   3950  CD2 PHE A 504      56.248  58.077  21.538  1.00 36.01           C  
ATOM   3951  CE1 PHE A 504      57.374  59.054  19.222  1.00 37.60           C  
ATOM   3952  CE2 PHE A 504      57.173  59.096  21.600  1.00 38.55           C  
ATOM   3953  CZ  PHE A 504      57.741  59.590  20.443  1.00 39.72           C  
ATOM   3954  N   HIS A 505      56.407  54.850  22.415  1.00 39.20           N  
ATOM   3955  CA  HIS A 505      57.490  54.803  23.406  1.00 41.85           C  
ATOM   3956  C   HIS A 505      58.397  53.581  23.312  1.00 42.30           C  
ATOM   3957  O   HIS A 505      59.577  53.643  23.683  1.00 41.04           O  
ATOM   3958  CB  HIS A 505      56.898  54.909  24.803  1.00 39.50           C  
ATOM   3959  CG  HIS A 505      55.871  55.985  24.927  1.00 42.72           C  
ATOM   3960  ND1 HIS A 505      56.047  57.098  25.722  1.00 44.41           N  
ATOM   3961  CD2 HIS A 505      54.653  56.121  24.350  1.00 42.70           C  
ATOM   3962  CE1 HIS A 505      54.979  57.873  25.631  1.00 43.24           C  
ATOM   3963  NE2 HIS A 505      54.120  57.303  24.806  1.00 40.45           N  
ATOM   3964  N   VAL A 506      57.860  52.469  22.815  1.00 39.76           N  
ATOM   3965  CA  VAL A 506      58.682  51.277  22.687  1.00 38.89           C  
ATOM   3966  C   VAL A 506      59.644  51.419  21.512  1.00 40.99           C  
ATOM   3967  O   VAL A 506      60.856  51.334  21.684  1.00 40.80           O  
ATOM   3968  CB  VAL A 506      57.803  50.007  22.514  1.00 40.44           C  
ATOM   3969  CG1 VAL A 506      58.659  48.814  22.169  1.00 38.67           C  
ATOM   3970  CG2 VAL A 506      57.031  49.721  23.810  1.00 38.98           C  
ATOM   3971  N   SER A 507      59.124  51.646  20.307  1.00 41.14           N  
ATOM   3972  CA  SER A 507      60.020  51.785  19.165  1.00 40.74           C  
ATOM   3973  C   SER A 507      60.824  53.087  19.188  1.00 39.07           C  
ATOM   3974  O   SER A 507      61.781  53.223  18.437  1.00 41.53           O  
ATOM   3975  CB  SER A 507      59.235  51.682  17.845  1.00 41.10           C  
ATOM   3976  OG  SER A 507      58.132  52.556  17.875  1.00 48.70           O  
ATOM   3977  N   ASN A 508      60.448  54.046  20.032  1.00 39.91           N  
ATOM   3978  CA  ASN A 508      61.208  55.300  20.105  1.00 42.89           C  
ATOM   3979  C   ASN A 508      62.112  55.384  21.335  1.00 43.35           C  
ATOM   3980  O   ASN A 508      62.600  56.446  21.730  1.00 41.15           O  
ATOM   3981  CB  ASN A 508      60.256  56.509  19.974  1.00 41.76           C  
ATOM   3982  CG  ASN A 508      59.842  56.743  18.506  1.00 47.53           C  
ATOM   3983  OD1 ASN A 508      60.544  57.422  17.758  1.00 47.99           O  
ATOM   3984  ND2 ASN A 508      58.735  56.129  18.083  1.00 46.84           N  
ATOM   3985  N   ASP A 509      62.324  54.230  21.951  1.00 45.77           N  
ATOM   3986  CA  ASP A 509      63.246  54.115  23.068  1.00 42.33           C  
ATOM   3987  C   ASP A 509      63.078  55.046  24.284  1.00 44.17           C  
ATOM   3988  O   ASP A 509      64.059  55.644  24.753  1.00 45.42           O  
ATOM   3989  CB  ASP A 509      64.654  54.237  22.473  1.00 41.21           C  
ATOM   3990  CG  ASP A 509      65.751  54.021  23.495  1.00 46.72           C  
ATOM   3991  OD1 ASP A 509      65.651  53.044  24.265  1.00 41.75           O  
ATOM   3992  OD2 ASP A 509      66.718  54.820  23.512  1.00 45.75           O  
ATOM   3993  N   TYR A 510      61.851  55.160  24.800  1.00 42.60           N  
ATOM   3994  CA  TYR A 510      61.562  55.972  25.999  1.00 40.37           C  
ATOM   3995  C   TYR A 510      61.053  55.047  27.102  1.00 43.13           C  
ATOM   3996  O   TYR A 510      60.267  54.129  26.843  1.00 42.19           O  
ATOM   3997  CB  TYR A 510      60.464  57.012  25.732  1.00 40.19           C  
ATOM   3998  CG  TYR A 510      60.909  58.189  24.888  1.00 49.96           C  
ATOM   3999  CD1 TYR A 510      61.725  59.180  25.419  1.00 52.41           C  
ATOM   4000  CD2 TYR A 510      60.545  58.290  23.549  1.00 49.31           C  
ATOM   4001  CE1 TYR A 510      62.174  60.239  24.631  1.00 56.01           C  
ATOM   4002  CE2 TYR A 510      60.984  59.340  22.759  1.00 49.78           C  
ATOM   4003  CZ  TYR A 510      61.800  60.312  23.305  1.00 54.42           C  
ATOM   4004  OH  TYR A 510      62.237  61.366  22.533  1.00 54.12           O  
ATOM   4005  N   SER A 511      61.487  55.278  28.334  1.00 41.24           N  
ATOM   4006  CA  SER A 511      61.024  54.453  29.424  1.00 41.70           C  
ATOM   4007  C   SER A 511      59.564  54.820  29.633  1.00 40.59           C  
ATOM   4008  O   SER A 511      59.160  55.941  29.344  1.00 39.93           O  
ATOM   4009  CB  SER A 511      61.847  54.716  30.696  1.00 45.09           C  
ATOM   4010  OG  SER A 511      61.683  56.048  31.126  1.00 46.67           O  
ATOM   4011  N   PHE A 512      58.795  53.886  30.192  1.00 39.66           N  
ATOM   4012  CA  PHE A 512      57.369  54.053  30.384  1.00 36.56           C  
ATOM   4013  C   PHE A 512      56.859  54.088  31.823  1.00 40.07           C  
ATOM   4014  O   PHE A 512      55.796  54.654  32.079  1.00 38.88           O  
ATOM   4015  CB  PHE A 512      56.676  52.916  29.623  1.00 40.76           C  
ATOM   4016  CG  PHE A 512      55.340  53.282  29.025  1.00 41.44           C  
ATOM   4017  CD1 PHE A 512      54.168  52.679  29.486  1.00 39.88           C  
ATOM   4018  CD2 PHE A 512      55.258  54.177  27.969  1.00 38.07           C  
ATOM   4019  CE1 PHE A 512      52.920  52.961  28.893  1.00 39.99           C  
ATOM   4020  CE2 PHE A 512      54.028  54.464  27.370  1.00 39.91           C  
ATOM   4021  CZ  PHE A 512      52.853  53.852  27.834  1.00 40.25           C  
ATOM   4022  N   ILE A 513      57.600  53.523  32.778  1.00 39.77           N  
ATOM   4023  CA  ILE A 513      57.110  53.490  34.169  1.00 37.26           C  
ATOM   4024  C   ILE A 513      56.768  54.855  34.788  1.00 35.36           C  
ATOM   4025  O   ILE A 513      55.963  54.941  35.707  1.00 39.28           O  
ATOM   4026  CB  ILE A 513      58.117  52.736  35.097  1.00 39.05           C  
ATOM   4027  CG1 ILE A 513      57.394  52.257  36.354  1.00 39.02           C  
ATOM   4028  CG2 ILE A 513      59.266  53.663  35.511  1.00 32.84           C  
ATOM   4029  CD1 ILE A 513      56.231  51.298  36.091  1.00 41.72           C  
ATOM   4030  N   ARG A 514      57.359  55.924  34.268  1.00 38.86           N  
ATOM   4031  CA  ARG A 514      57.105  57.287  34.766  1.00 39.57           C  
ATOM   4032  C   ARG A 514      55.629  57.657  34.742  1.00 39.39           C  
ATOM   4033  O   ARG A 514      55.172  58.466  35.547  1.00 40.85           O  
ATOM   4034  CB  ARG A 514      57.894  58.302  33.916  1.00 43.18           C  
ATOM   4035  CG  ARG A 514      57.456  58.332  32.443  1.00 48.25           C  
ATOM   4036  CD  ARG A 514      58.491  58.986  31.565  1.00 50.32           C  
ATOM   4037  NE  ARG A 514      58.791  60.310  32.060  1.00 59.99           N  
ATOM   4038  CZ  ARG A 514      59.871  61.005  31.729  1.00 62.26           C  
ATOM   4039  NH1 ARG A 514      60.756  60.483  30.890  1.00 56.63           N  
ATOM   4040  NH2 ARG A 514      60.068  62.213  32.260  1.00 61.48           N  
ATOM   4041  N   TYR A 515      54.863  57.082  33.819  1.00 41.28           N  
ATOM   4042  CA  TYR A 515      53.431  57.412  33.772  1.00 39.66           C  
ATOM   4043  C   TYR A 515      52.717  56.743  34.936  1.00 37.54           C  
ATOM   4044  O   TYR A 515      51.676  57.209  35.406  1.00 39.54           O  
ATOM   4045  CB  TYR A 515      52.827  56.992  32.411  1.00 41.12           C  
ATOM   4046  CG  TYR A 515      53.477  57.726  31.240  1.00 36.42           C  
ATOM   4047  CD1 TYR A 515      53.257  59.069  31.036  1.00 37.67           C  
ATOM   4048  CD2 TYR A 515      54.379  57.085  30.405  1.00 38.02           C  
ATOM   4049  CE1 TYR A 515      53.920  59.764  30.032  1.00 38.05           C  
ATOM   4050  CE2 TYR A 515      55.048  57.767  29.419  1.00 36.83           C  
ATOM   4051  CZ  TYR A 515      54.806  59.114  29.235  1.00 38.40           C  
ATOM   4052  OH  TYR A 515      55.437  59.791  28.222  1.00 41.18           O  
ATOM   4053  N   TYR A 516      53.280  55.637  35.406  1.00 38.53           N  
ATOM   4054  CA  TYR A 516      52.713  54.936  36.555  1.00 38.16           C  
ATOM   4055  C   TYR A 516      53.030  55.759  37.810  1.00 36.03           C  
ATOM   4056  O   TYR A 516      52.125  56.165  38.526  1.00 41.12           O  
ATOM   4057  CB  TYR A 516      53.326  53.529  36.693  1.00 39.60           C  
ATOM   4058  CG  TYR A 516      52.713  52.723  37.817  1.00 36.95           C  
ATOM   4059  CD1 TYR A 516      51.573  51.955  37.606  1.00 36.95           C  
ATOM   4060  CD2 TYR A 516      53.225  52.805  39.112  1.00 40.16           C  
ATOM   4061  CE1 TYR A 516      50.946  51.300  38.653  1.00 40.63           C  
ATOM   4062  CE2 TYR A 516      52.616  52.153  40.166  1.00 39.55           C  
ATOM   4063  CZ  TYR A 516      51.477  51.406  39.938  1.00 43.00           C  
ATOM   4064  OH  TYR A 516      50.858  50.781  41.000  1.00 45.32           O  
ATOM   4065  N   THR A 517      54.306  56.059  38.047  1.00 36.62           N  
ATOM   4066  CA  THR A 517      54.670  56.813  39.251  1.00 39.96           C  
ATOM   4067  C   THR A 517      54.109  58.235  39.352  1.00 40.49           C  
ATOM   4068  O   THR A 517      53.679  58.673  40.424  1.00 38.52           O  
ATOM   4069  CB  THR A 517      56.196  56.879  39.430  1.00 38.19           C  
ATOM   4070  OG1 THR A 517      56.793  57.489  38.281  1.00 40.33           O  
ATOM   4071  CG2 THR A 517      56.767  55.461  39.624  1.00 38.02           C  
ATOM   4072  N   ARG A 518      54.102  58.955  38.236  1.00 44.50           N  
ATOM   4073  CA  ARG A 518      53.589  60.328  38.214  1.00 40.54           C  
ATOM   4074  C   ARG A 518      52.120  60.358  38.639  1.00 40.32           C  
ATOM   4075  O   ARG A 518      51.693  61.226  39.417  1.00 37.86           O  
ATOM   4076  CB  ARG A 518      53.796  60.890  36.814  1.00 46.56           C  
ATOM   4077  CG  ARG A 518      53.136  62.223  36.522  1.00 47.64           C  
ATOM   4078  CD  ARG A 518      52.414  62.094  35.201  1.00 57.39           C  
ATOM   4079  NE  ARG A 518      50.980  61.959  35.394  1.00 60.13           N  
ATOM   4080  CZ  ARG A 518      50.122  61.610  34.440  1.00 63.16           C  
ATOM   4081  NH1 ARG A 518      48.824  61.524  34.731  1.00 59.91           N  
ATOM   4082  NH2 ARG A 518      50.561  61.324  33.215  1.00 54.75           N  
ATOM   4083  N   THR A 519      51.358  59.373  38.159  1.00 40.55           N  
ATOM   4084  CA  THR A 519      49.947  59.236  38.502  1.00 40.62           C  
ATOM   4085  C   THR A 519      49.797  59.030  40.011  1.00 42.50           C  
ATOM   4086  O   THR A 519      48.955  59.661  40.653  1.00 42.60           O  
ATOM   4087  CB  THR A 519      49.286  58.009  37.823  1.00 43.38           C  
ATOM   4088  OG1 THR A 519      49.456  58.079  36.403  1.00 39.87           O  
ATOM   4089  CG2 THR A 519      47.814  57.960  38.183  1.00 38.13           C  
ATOM   4090  N   LEU A 520      50.571  58.121  40.591  1.00 42.65           N  
ATOM   4091  CA  LEU A 520      50.444  57.976  42.039  1.00 44.84           C  
ATOM   4092  C   LEU A 520      50.953  59.255  42.729  1.00 43.52           C  
ATOM   4093  O   LEU A 520      50.372  59.677  43.720  1.00 47.09           O  
ATOM   4094  CB  LEU A 520      51.182  56.728  42.573  1.00 38.33           C  
ATOM   4095  CG  LEU A 520      50.411  55.381  42.573  1.00 46.06           C  
ATOM   4096  CD1 LEU A 520      50.049  54.984  41.111  1.00 41.82           C  
ATOM   4097  CD2 LEU A 520      51.269  54.241  43.221  1.00 35.55           C  
ATOM   4098  N   TYR A 521      52.004  59.898  42.215  1.00 42.18           N  
ATOM   4099  CA  TYR A 521      52.472  61.122  42.893  1.00 41.29           C  
ATOM   4100  C   TYR A 521      51.443  62.229  42.857  1.00 40.35           C  
ATOM   4101  O   TYR A 521      51.172  62.869  43.882  1.00 42.14           O  
ATOM   4102  CB  TYR A 521      53.750  61.702  42.282  1.00 38.25           C  
ATOM   4103  CG  TYR A 521      54.940  60.817  42.304  1.00 40.64           C  
ATOM   4104  CD1 TYR A 521      55.102  59.848  43.292  1.00 39.73           C  
ATOM   4105  CD2 TYR A 521      55.934  60.956  41.344  1.00 38.69           C  
ATOM   4106  CE1 TYR A 521      56.222  59.054  43.312  1.00 38.25           C  
ATOM   4107  CE2 TYR A 521      57.044  60.165  41.366  1.00 39.22           C  
ATOM   4108  CZ  TYR A 521      57.187  59.220  42.352  1.00 39.14           C  
ATOM   4109  OH  TYR A 521      58.336  58.464  42.375  1.00 44.18           O  
ATOM   4110  N   GLN A 522      50.846  62.458  41.689  1.00 40.80           N  
ATOM   4111  CA  GLN A 522      49.875  63.537  41.602  1.00 40.88           C  
ATOM   4112  C   GLN A 522      48.774  63.465  42.642  1.00 41.57           C  
ATOM   4113  O   GLN A 522      48.336  64.495  43.170  1.00 43.32           O  
ATOM   4114  CB  GLN A 522      49.277  63.647  40.186  1.00 40.84           C  
ATOM   4115  CG  GLN A 522      48.144  62.722  39.814  1.00 44.84           C  
ATOM   4116  CD  GLN A 522      47.740  62.910  38.350  1.00 47.64           C  
ATOM   4117  OE1 GLN A 522      48.512  62.613  37.450  1.00 47.16           O  
ATOM   4118  NE2 GLN A 522      46.537  63.442  38.117  1.00 49.80           N  
ATOM   4119  N   PHE A 523      48.300  62.269  42.967  1.00 41.06           N  
ATOM   4120  CA  PHE A 523      47.238  62.239  43.960  1.00 42.57           C  
ATOM   4121  C   PHE A 523      47.765  62.382  45.390  1.00 39.24           C  
ATOM   4122  O   PHE A 523      47.051  62.857  46.268  1.00 38.83           O  
ATOM   4123  CB  PHE A 523      46.345  60.999  43.753  1.00 44.99           C  
ATOM   4124  CG  PHE A 523      45.503  61.081  42.491  1.00 43.08           C  
ATOM   4125  CD1 PHE A 523      44.504  62.034  42.376  1.00 41.33           C  
ATOM   4126  CD2 PHE A 523      45.756  60.249  41.405  1.00 45.92           C  
ATOM   4127  CE1 PHE A 523      43.763  62.172  41.197  1.00 43.92           C  
ATOM   4128  CE2 PHE A 523      45.020  60.379  40.222  1.00 49.12           C  
ATOM   4129  CZ  PHE A 523      44.017  61.352  40.126  1.00 44.02           C  
ATOM   4130  N   GLN A 524      49.021  62.012  45.610  1.00 41.76           N  
ATOM   4131  CA  GLN A 524      49.633  62.172  46.939  1.00 44.00           C  
ATOM   4132  C   GLN A 524      49.790  63.685  47.161  1.00 43.12           C  
ATOM   4133  O   GLN A 524      49.417  64.210  48.202  1.00 43.47           O  
ATOM   4134  CB  GLN A 524      51.001  61.467  46.996  1.00 42.14           C  
ATOM   4135  CG  GLN A 524      50.895  59.939  46.947  1.00 44.92           C  
ATOM   4136  CD  GLN A 524      52.243  59.245  47.060  1.00 48.60           C  
ATOM   4137  OE1 GLN A 524      52.935  59.372  48.070  1.00 53.07           O  
ATOM   4138  NE2 GLN A 524      52.622  58.511  46.026  1.00 41.42           N  
ATOM   4139  N   PHE A 525      50.312  64.378  46.149  1.00 44.61           N  
ATOM   4140  CA  PHE A 525      50.475  65.815  46.217  1.00 39.76           C  
ATOM   4141  C   PHE A 525      49.131  66.454  46.460  1.00 44.28           C  
ATOM   4142  O   PHE A 525      48.981  67.278  47.376  1.00 48.75           O  
ATOM   4143  CB  PHE A 525      51.012  66.403  44.906  1.00 39.24           C  
ATOM   4144  CG  PHE A 525      52.391  65.988  44.569  1.00 39.94           C  
ATOM   4145  CD1 PHE A 525      53.177  65.319  45.491  1.00 39.14           C  
ATOM   4146  CD2 PHE A 525      52.911  66.251  43.315  1.00 41.28           C  
ATOM   4147  CE1 PHE A 525      54.462  64.914  45.163  1.00 39.26           C  
ATOM   4148  CE2 PHE A 525      54.190  65.851  42.982  1.00 42.53           C  
ATOM   4149  CZ  PHE A 525      54.969  65.174  43.917  1.00 42.12           C  
ATOM   4150  N   GLN A 526      48.146  66.095  45.634  1.00 44.91           N  
ATOM   4151  CA  GLN A 526      46.818  66.704  45.757  1.00 42.43           C  
ATOM   4152  C   GLN A 526      46.150  66.434  47.091  1.00 39.51           C  
ATOM   4153  O   GLN A 526      45.497  67.328  47.641  1.00 40.89           O  
ATOM   4154  CB  GLN A 526      45.894  66.252  44.613  1.00 45.33           C  
ATOM   4155  CG  GLN A 526      44.534  66.977  44.559  1.00 43.44           C  
ATOM   4156  CD  GLN A 526      44.662  68.461  44.176  1.00 46.12           C  
ATOM   4157  OE1 GLN A 526      43.664  69.148  43.919  1.00 50.15           O  
ATOM   4158  NE2 GLN A 526      45.886  68.949  44.138  1.00 45.40           N  
ATOM   4159  N   GLU A 527      46.275  65.215  47.609  1.00 39.17           N  
ATOM   4160  CA  GLU A 527      45.665  64.933  48.911  1.00 42.57           C  
ATOM   4161  C   GLU A 527      46.388  65.804  49.951  1.00 44.49           C  
ATOM   4162  O   GLU A 527      45.749  66.449  50.787  1.00 46.60           O  
ATOM   4163  CB  GLU A 527      45.785  63.452  49.296  1.00 43.81           C  
ATOM   4164  CG  GLU A 527      44.940  63.097  50.523  1.00 48.81           C  
ATOM   4165  CD  GLU A 527      44.843  61.601  50.785  1.00 56.67           C  
ATOM   4166  OE1 GLU A 527      45.802  61.025  51.349  1.00 61.35           O  
ATOM   4167  OE2 GLU A 527      43.803  60.994  50.423  1.00 58.93           O  
ATOM   4168  N   ALA A 528      47.714  65.866  49.850  1.00 43.11           N  
ATOM   4169  CA  ALA A 528      48.501  66.667  50.777  1.00 46.06           C  
ATOM   4170  C   ALA A 528      48.151  68.149  50.722  1.00 47.90           C  
ATOM   4171  O   ALA A 528      47.879  68.770  51.752  1.00 49.98           O  
ATOM   4172  CB  ALA A 528      49.985  66.468  50.507  1.00 45.59           C  
ATOM   4173  N   LEU A 529      48.155  68.735  49.528  1.00 50.33           N  
ATOM   4174  CA  LEU A 529      47.835  70.151  49.410  1.00 48.41           C  
ATOM   4175  C   LEU A 529      46.434  70.464  49.879  1.00 47.07           C  
ATOM   4176  O   LEU A 529      46.206  71.477  50.512  1.00 50.21           O  
ATOM   4177  CB  LEU A 529      48.018  70.639  47.969  1.00 50.22           C  
ATOM   4178  CG  LEU A 529      49.445  71.001  47.529  1.00 51.23           C  
ATOM   4179  CD1 LEU A 529      50.414  70.925  48.708  1.00 50.84           C  
ATOM   4180  CD2 LEU A 529      49.889  70.062  46.441  1.00 52.81           C  
ATOM   4181  N   CYS A 530      45.485  69.592  49.578  1.00 51.62           N  
ATOM   4182  CA  CYS A 530      44.108  69.819  49.992  1.00 51.41           C  
ATOM   4183  C   CYS A 530      43.916  69.699  51.507  1.00 50.11           C  
ATOM   4184  O   CYS A 530      43.069  70.382  52.090  1.00 47.85           O  
ATOM   4185  CB  CYS A 530      43.185  68.864  49.228  1.00 55.57           C  
ATOM   4186  SG  CYS A 530      43.164  69.357  47.473  1.00 67.05           S  
ATOM   4187  N   GLN A 531      44.667  68.818  52.151  1.00 48.89           N  
ATOM   4188  CA  GLN A 531      44.547  68.734  53.594  1.00 54.61           C  
ATOM   4189  C   GLN A 531      45.114  70.043  54.140  1.00 57.14           C  
ATOM   4190  O   GLN A 531      44.587  70.593  55.100  1.00 57.27           O  
ATOM   4191  CB  GLN A 531      45.310  67.523  54.153  1.00 58.79           C  
ATOM   4192  CG  GLN A 531      44.616  66.185  53.805  1.00 70.39           C  
ATOM   4193  CD  GLN A 531      45.078  64.994  54.649  1.00 73.73           C  
ATOM   4194  OE1 GLN A 531      44.521  63.894  54.540  1.00 70.32           O  
ATOM   4195  NE2 GLN A 531      46.095  65.210  55.488  1.00 74.58           N  
ATOM   4196  N   ALA A 532      46.163  70.558  53.498  1.00 56.76           N  
ATOM   4197  CA  ALA A 532      46.780  71.804  53.928  1.00 57.48           C  
ATOM   4198  C   ALA A 532      45.901  72.983  53.592  1.00 59.00           C  
ATOM   4199  O   ALA A 532      46.151  74.096  54.052  1.00 62.93           O  
ATOM   4200  CB  ALA A 532      48.132  71.980  53.274  1.00 56.88           C  
ATOM   4201  N   ALA A 533      44.875  72.747  52.781  1.00 56.82           N  
ATOM   4202  CA  ALA A 533      43.964  73.813  52.403  1.00 54.81           C  
ATOM   4203  C   ALA A 533      42.667  73.702  53.200  1.00 55.22           C  
ATOM   4204  O   ALA A 533      41.714  74.460  52.990  1.00 53.49           O  
ATOM   4205  CB  ALA A 533      43.685  73.748  50.916  1.00 54.92           C  
ATOM   4206  N   LYS A 534      42.638  72.747  54.122  1.00 56.56           N  
ATOM   4207  CA  LYS A 534      41.465  72.525  54.964  1.00 57.72           C  
ATOM   4208  C   LYS A 534      40.233  72.160  54.117  1.00 58.05           C  
ATOM   4209  O   LYS A 534      39.111  72.577  54.430  1.00 53.36           O  
ATOM   4210  CB  LYS A 534      41.167  73.785  55.794  1.00 61.07           C  
ATOM   4211  CG  LYS A 534      42.398  74.640  56.131  1.00 66.38           C  
ATOM   4212  CD  LYS A 534      43.215  74.076  57.289  1.00 72.54           C  
ATOM   4213  CE  LYS A 534      42.679  74.559  58.640  1.00 76.04           C  
ATOM   4214  NZ  LYS A 534      41.251  74.183  58.886  1.00 79.30           N  
ATOM   4215  N   HIS A 535      40.442  71.393  53.043  1.00 56.61           N  
ATOM   4216  CA  HIS A 535      39.327  70.976  52.191  1.00 55.57           C  
ATOM   4217  C   HIS A 535      38.428  70.024  52.970  1.00 56.73           C  
ATOM   4218  O   HIS A 535      38.920  69.117  53.636  1.00 54.92           O  
ATOM   4219  CB  HIS A 535      39.832  70.265  50.939  1.00 54.43           C  
ATOM   4220  CG  HIS A 535      38.735  69.734  50.075  1.00 51.18           C  
ATOM   4221  ND1 HIS A 535      37.775  70.548  49.512  1.00 47.53           N  
ATOM   4222  CD2 HIS A 535      38.426  68.470  49.699  1.00 49.23           C  
ATOM   4223  CE1 HIS A 535      36.923  69.809  48.825  1.00 48.54           C  
ATOM   4224  NE2 HIS A 535      37.295  68.544  48.922  1.00 48.42           N  
ATOM   4225  N   GLU A 536      37.114  70.206  52.859  1.00 60.54           N  
ATOM   4226  CA  GLU A 536      36.177  69.375  53.609  1.00 63.97           C  
ATOM   4227  C   GLU A 536      35.621  68.094  52.979  1.00 64.96           C  
ATOM   4228  O   GLU A 536      35.797  67.003  53.537  1.00 68.89           O  
ATOM   4229  CB  GLU A 536      34.992  70.224  54.099  1.00 66.60           C  
ATOM   4230  CG  GLU A 536      35.376  71.459  54.909  1.00 74.65           C  
ATOM   4231  CD  GLU A 536      35.402  72.731  54.063  1.00 83.24           C  
ATOM   4232  OE1 GLU A 536      36.149  72.762  53.054  1.00 86.07           O  
ATOM   4233  OE2 GLU A 536      34.672  73.696  54.403  1.00 84.28           O  
ATOM   4234  N   GLY A 537      34.936  68.198  51.846  1.00 58.67           N  
ATOM   4235  CA  GLY A 537      34.361  66.988  51.273  1.00 57.68           C  
ATOM   4236  C   GLY A 537      35.285  66.042  50.516  1.00 55.35           C  
ATOM   4237  O   GLY A 537      36.480  65.953  50.803  1.00 55.05           O  
ATOM   4238  N   PRO A 538      34.742  65.321  49.527  1.00 51.36           N  
ATOM   4239  CA  PRO A 538      35.468  64.363  48.685  1.00 49.09           C  
ATOM   4240  C   PRO A 538      36.681  65.026  48.011  1.00 48.18           C  
ATOM   4241  O   PRO A 538      36.596  66.150  47.511  1.00 44.86           O  
ATOM   4242  CB  PRO A 538      34.412  63.935  47.659  1.00 50.54           C  
ATOM   4243  CG  PRO A 538      33.120  64.134  48.376  1.00 52.52           C  
ATOM   4244  CD  PRO A 538      33.337  65.438  49.099  1.00 52.45           C  
ATOM   4245  N   LEU A 539      37.802  64.320  47.986  1.00 44.65           N  
ATOM   4246  CA  LEU A 539      39.013  64.852  47.392  1.00 45.92           C  
ATOM   4247  C   LEU A 539      38.838  65.409  45.974  1.00 46.94           C  
ATOM   4248  O   LEU A 539      39.433  66.443  45.652  1.00 44.13           O  
ATOM   4249  CB  LEU A 539      40.107  63.774  47.408  1.00 42.31           C  
ATOM   4250  CG  LEU A 539      41.479  64.076  46.830  1.00 45.59           C  
ATOM   4251  CD1 LEU A 539      42.130  65.237  47.585  1.00 38.94           C  
ATOM   4252  CD2 LEU A 539      42.343  62.811  46.920  1.00 47.79           C  
ATOM   4253  N   HIS A 540      38.017  64.781  45.126  1.00 45.97           N  
ATOM   4254  CA  HIS A 540      37.904  65.298  43.752  1.00 47.16           C  
ATOM   4255  C   HIS A 540      37.279  66.670  43.588  1.00 46.49           C  
ATOM   4256  O   HIS A 540      37.349  67.240  42.509  1.00 52.46           O  
ATOM   4257  CB  HIS A 540      37.196  64.300  42.809  1.00 44.10           C  
ATOM   4258  CG  HIS A 540      35.709  64.279  42.931  1.00 43.40           C  
ATOM   4259  ND1 HIS A 540      35.047  63.595  43.933  1.00 45.98           N  
ATOM   4260  CD2 HIS A 540      34.748  64.845  42.163  1.00 44.25           C  
ATOM   4261  CE1 HIS A 540      33.743  63.740  43.773  1.00 45.42           C  
ATOM   4262  NE2 HIS A 540      33.535  64.494  42.707  1.00 45.90           N  
ATOM   4263  N   LYS A 541      36.703  67.220  44.650  1.00 48.51           N  
ATOM   4264  CA  LYS A 541      36.061  68.533  44.572  1.00 51.06           C  
ATOM   4265  C   LYS A 541      36.982  69.647  45.059  1.00 53.19           C  
ATOM   4266  O   LYS A 541      36.614  70.817  45.057  1.00 51.84           O  
ATOM   4267  CB  LYS A 541      34.797  68.544  45.434  1.00 51.24           C  
ATOM   4268  CG  LYS A 541      33.939  67.309  45.263  1.00 55.27           C  
ATOM   4269  CD  LYS A 541      32.536  67.666  44.853  1.00 59.38           C  
ATOM   4270  CE  LYS A 541      31.833  68.440  45.936  1.00 58.91           C  
ATOM   4271  NZ  LYS A 541      30.414  68.702  45.578  1.00 63.15           N  
ATOM   4272  N   CYS A 542      38.186  69.276  45.470  1.00 54.75           N  
ATOM   4273  CA  CYS A 542      39.117  70.245  46.014  1.00 56.00           C  
ATOM   4274  C   CYS A 542      39.697  71.277  45.058  1.00 57.58           C  
ATOM   4275  O   CYS A 542      39.944  71.018  43.876  1.00 56.52           O  
ATOM   4276  CB  CYS A 542      40.249  69.511  46.735  1.00 57.21           C  
ATOM   4277  SG  CYS A 542      41.567  70.603  47.348  1.00 61.18           S  
ATOM   4278  N   ASP A 543      39.910  72.465  45.603  1.00 55.45           N  
ATOM   4279  CA  ASP A 543      40.493  73.572  44.863  1.00 55.34           C  
ATOM   4280  C   ASP A 543      41.520  74.167  45.829  1.00 53.14           C  
ATOM   4281  O   ASP A 543      41.173  74.532  46.949  1.00 54.77           O  
ATOM   4282  CB  ASP A 543      39.405  74.589  44.526  1.00 55.00           C  
ATOM   4283  CG  ASP A 543      39.917  75.731  43.673  1.00 58.54           C  
ATOM   4284  OD1 ASP A 543      41.102  75.690  43.258  1.00 57.09           O  
ATOM   4285  OD2 ASP A 543      39.127  76.667  43.414  1.00 58.07           O  
ATOM   4286  N   ILE A 544      42.781  74.257  45.432  1.00 52.36           N  
ATOM   4287  CA  ILE A 544      43.761  74.794  46.367  1.00 54.83           C  
ATOM   4288  C   ILE A 544      43.934  76.308  46.379  1.00 57.08           C  
ATOM   4289  O   ILE A 544      44.799  76.812  47.104  1.00 58.00           O  
ATOM   4290  CB  ILE A 544      45.147  74.173  46.162  1.00 52.64           C  
ATOM   4291  CG1 ILE A 544      45.727  74.590  44.816  1.00 50.82           C  
ATOM   4292  CG2 ILE A 544      45.044  72.679  46.256  1.00 55.60           C  
ATOM   4293  CD1 ILE A 544      47.171  74.146  44.621  1.00 49.72           C  
ATOM   4294  N   SER A 545      43.120  77.023  45.596  1.00 56.05           N  
ATOM   4295  CA  SER A 545      43.185  78.487  45.514  1.00 57.98           C  
ATOM   4296  C   SER A 545      43.037  79.140  46.877  1.00 59.00           C  
ATOM   4297  O   SER A 545      42.267  78.671  47.696  1.00 57.95           O  
ATOM   4298  CB  SER A 545      42.072  79.027  44.616  1.00 55.89           C  
ATOM   4299  OG  SER A 545      42.162  78.504  43.312  1.00 56.83           O  
ATOM   4300  N   ASN A 546      43.762  80.236  47.094  1.00 62.68           N  
ATOM   4301  CA  ASN A 546      43.715  80.986  48.351  1.00 63.80           C  
ATOM   4302  C   ASN A 546      44.548  80.362  49.454  1.00 63.03           C  
ATOM   4303  O   ASN A 546      44.780  80.991  50.482  1.00 64.16           O  
ATOM   4304  CB  ASN A 546      42.295  81.087  48.902  1.00 68.62           C  
ATOM   4305  CG  ASN A 546      41.433  82.098  48.187  1.00 75.80           C  
ATOM   4306  OD1 ASN A 546      40.362  82.436  48.705  1.00 79.22           O  
ATOM   4307  ND2 ASN A 546      41.844  82.583  47.020  1.00 78.46           N  
ATOM   4308  N   SER A 547      44.983  79.126  49.277  1.00 58.68           N  
ATOM   4309  CA  SER A 547      45.749  78.502  50.340  1.00 57.77           C  
ATOM   4310  C   SER A 547      47.258  78.694  50.241  1.00 59.94           C  
ATOM   4311  O   SER A 547      47.931  77.972  49.507  1.00 62.23           O  
ATOM   4312  CB  SER A 547      45.421  77.013  50.412  1.00 54.33           C  
ATOM   4313  OG  SER A 547      46.085  76.395  51.493  1.00 52.33           O  
ATOM   4314  N   THR A 548      47.787  79.665  50.985  1.00 58.86           N  
ATOM   4315  CA  THR A 548      49.228  79.908  50.993  1.00 60.36           C  
ATOM   4316  C   THR A 548      49.880  78.767  51.776  1.00 60.38           C  
ATOM   4317  O   THR A 548      51.071  78.491  51.635  1.00 61.87           O  
ATOM   4318  CB  THR A 548      49.601  81.267  51.665  1.00 59.47           C  
ATOM   4319  OG1 THR A 548      49.018  81.332  52.963  1.00 60.16           O  
ATOM   4320  CG2 THR A 548      49.093  82.444  50.843  1.00 62.16           C  
ATOM   4321  N   GLU A 549      49.099  78.087  52.599  1.00 58.69           N  
ATOM   4322  CA  GLU A 549      49.663  76.978  53.344  1.00 62.33           C  
ATOM   4323  C   GLU A 549      49.932  75.836  52.350  1.00 60.39           C  
ATOM   4324  O   GLU A 549      50.895  75.082  52.487  1.00 59.03           O  
ATOM   4325  CB  GLU A 549      48.690  76.529  54.438  1.00 68.96           C  
ATOM   4326  CG  GLU A 549      49.390  75.917  55.637  1.00 79.45           C  
ATOM   4327  CD  GLU A 549      50.340  76.900  56.315  1.00 85.16           C  
ATOM   4328  OE1 GLU A 549      49.852  77.926  56.843  1.00 87.99           O  
ATOM   4329  OE2 GLU A 549      51.569  76.652  56.314  1.00 87.59           O  
ATOM   4330  N   ALA A 550      49.074  75.726  51.341  1.00 58.48           N  
ATOM   4331  CA  ALA A 550      49.223  74.699  50.321  1.00 57.12           C  
ATOM   4332  C   ALA A 550      50.406  75.058  49.437  1.00 54.87           C  
ATOM   4333  O   ALA A 550      51.285  74.230  49.187  1.00 55.90           O  
ATOM   4334  CB  ALA A 550      47.950  74.602  49.486  1.00 57.90           C  
ATOM   4335  N   GLY A 551      50.424  76.307  48.977  1.00 55.39           N  
ATOM   4336  CA  GLY A 551      51.504  76.787  48.130  1.00 51.72           C  
ATOM   4337  C   GLY A 551      52.867  76.750  48.807  1.00 53.96           C  
ATOM   4338  O   GLY A 551      53.896  76.630  48.138  1.00 54.08           O  
ATOM   4339  N   GLN A 552      52.892  76.854  50.132  1.00 52.93           N  
ATOM   4340  CA  GLN A 552      54.164  76.814  50.848  1.00 55.84           C  
ATOM   4341  C   GLN A 552      54.692  75.386  50.854  1.00 55.57           C  
ATOM   4342  O   GLN A 552      55.865  75.152  50.560  1.00 55.43           O  
ATOM   4343  CB  GLN A 552      54.006  77.297  52.291  1.00 56.12           C  
ATOM   4344  CG  GLN A 552      55.300  77.180  53.094  1.00 60.75           C  
ATOM   4345  CD  GLN A 552      56.421  78.053  52.535  1.00 64.43           C  
ATOM   4346  OE1 GLN A 552      56.290  79.280  52.472  1.00 67.54           O  
ATOM   4347  NE2 GLN A 552      57.526  77.425  52.123  1.00 61.23           N  
ATOM   4348  N   LYS A 553      53.821  74.437  51.202  1.00 55.80           N  
ATOM   4349  CA  LYS A 553      54.208  73.033  51.214  1.00 55.95           C  
ATOM   4350  C   LYS A 553      54.669  72.627  49.816  1.00 55.02           C  
ATOM   4351  O   LYS A 553      55.657  71.914  49.667  1.00 52.99           O  
ATOM   4352  CB  LYS A 553      53.034  72.142  51.644  1.00 59.84           C  
ATOM   4353  CG  LYS A 553      52.674  72.246  53.119  1.00 66.43           C  
ATOM   4354  CD  LYS A 553      51.879  71.032  53.556  1.00 68.82           C  
ATOM   4355  CE  LYS A 553      52.670  69.772  53.268  1.00 70.10           C  
ATOM   4356  NZ  LYS A 553      53.925  69.719  54.082  1.00 72.71           N  
ATOM   4357  N   LEU A 554      53.955  73.085  48.790  1.00 52.89           N  
ATOM   4358  CA  LEU A 554      54.321  72.749  47.424  1.00 53.02           C  
ATOM   4359  C   LEU A 554      55.709  73.311  47.122  1.00 51.95           C  
ATOM   4360  O   LEU A 554      56.601  72.602  46.639  1.00 51.27           O  
ATOM   4361  CB  LEU A 554      53.287  73.322  46.448  1.00 52.11           C  
ATOM   4362  CG  LEU A 554      53.443  73.047  44.948  1.00 54.18           C  
ATOM   4363  CD1 LEU A 554      53.624  71.569  44.668  1.00 48.68           C  
ATOM   4364  CD2 LEU A 554      52.216  73.555  44.243  1.00 52.00           C  
ATOM   4365  N   PHE A 555      55.896  74.584  47.438  1.00 51.50           N  
ATOM   4366  CA  PHE A 555      57.168  75.250  47.177  1.00 53.64           C  
ATOM   4367  C   PHE A 555      58.397  74.671  47.890  1.00 54.07           C  
ATOM   4368  O   PHE A 555      59.510  74.800  47.400  1.00 56.89           O  
ATOM   4369  CB  PHE A 555      57.038  76.743  47.490  1.00 53.16           C  
ATOM   4370  CG  PHE A 555      58.267  77.538  47.171  1.00 54.89           C  
ATOM   4371  CD1 PHE A 555      59.305  77.647  48.094  1.00 54.25           C  
ATOM   4372  CD2 PHE A 555      58.386  78.188  45.948  1.00 53.87           C  
ATOM   4373  CE1 PHE A 555      60.432  78.394  47.801  1.00 55.78           C  
ATOM   4374  CE2 PHE A 555      59.513  78.936  45.648  1.00 54.19           C  
ATOM   4375  CZ  PHE A 555      60.538  79.042  46.575  1.00 52.72           C  
ATOM   4376  N   ASN A 556      58.208  74.040  49.041  1.00 56.71           N  
ATOM   4377  CA  ASN A 556      59.340  73.462  49.767  1.00 56.23           C  
ATOM   4378  C   ASN A 556      60.015  72.353  48.972  1.00 54.88           C  
ATOM   4379  O   ASN A 556      61.221  72.136  49.107  1.00 55.83           O  
ATOM   4380  CB  ASN A 556      58.893  72.914  51.128  1.00 58.84           C  
ATOM   4381  CG  ASN A 556      58.552  74.017  52.118  1.00 63.17           C  
ATOM   4382  OD1 ASN A 556      57.989  73.758  53.194  1.00 61.68           O  
ATOM   4383  ND2 ASN A 556      58.896  75.258  51.763  1.00 59.08           N  
ATOM   4384  N   MET A 557      59.252  71.629  48.155  1.00 52.24           N  
ATOM   4385  CA  MET A 557      59.871  70.578  47.355  1.00 48.30           C  
ATOM   4386  C   MET A 557      60.223  71.104  45.965  1.00 44.96           C  
ATOM   4387  O   MET A 557      61.180  70.650  45.339  1.00 45.48           O  
ATOM   4388  CB  MET A 557      58.955  69.359  47.254  1.00 47.90           C  
ATOM   4389  CG  MET A 557      57.891  69.481  46.239  1.00 56.75           C  
ATOM   4390  SD  MET A 557      58.402  68.991  44.574  1.00 54.16           S  
ATOM   4391  CE  MET A 557      56.770  68.899  43.867  1.00 48.24           C  
ATOM   4392  N   LEU A 558      59.453  72.075  45.493  1.00 45.72           N  
ATOM   4393  CA  LEU A 558      59.672  72.681  44.183  1.00 45.76           C  
ATOM   4394  C   LEU A 558      61.078  73.336  44.059  1.00 47.96           C  
ATOM   4395  O   LEU A 558      61.806  73.112  43.082  1.00 42.81           O  
ATOM   4396  CB  LEU A 558      58.573  73.727  43.948  1.00 46.09           C  
ATOM   4397  CG  LEU A 558      57.546  73.625  42.815  1.00 47.84           C  
ATOM   4398  CD1 LEU A 558      56.950  72.244  42.715  1.00 43.83           C  
ATOM   4399  CD2 LEU A 558      56.455  74.627  43.048  1.00 43.68           C  
ATOM   4400  N   ARG A 559      61.476  74.128  45.056  1.00 49.09           N  
ATOM   4401  CA  ARG A 559      62.777  74.802  44.989  1.00 50.39           C  
ATOM   4402  C   ARG A 559      63.958  73.846  45.103  1.00 47.39           C  
ATOM   4403  O   ARG A 559      65.086  74.210  44.806  1.00 46.88           O  
ATOM   4404  CB  ARG A 559      62.886  75.899  46.063  1.00 53.66           C  
ATOM   4405  CG  ARG A 559      62.940  75.374  47.476  1.00 60.10           C  
ATOM   4406  CD  ARG A 559      63.543  76.391  48.449  1.00 64.36           C  
ATOM   4407  NE  ARG A 559      64.195  75.673  49.542  1.00 71.76           N  
ATOM   4408  CZ  ARG A 559      65.454  75.231  49.522  1.00 72.58           C  
ATOM   4409  NH1 ARG A 559      66.237  75.447  48.473  1.00 71.53           N  
ATOM   4410  NH2 ARG A 559      65.920  74.520  50.541  1.00 75.90           N  
ATOM   4411  N   LEU A 560      63.698  72.612  45.508  1.00 46.14           N  
ATOM   4412  CA  LEU A 560      64.761  71.621  45.641  1.00 44.69           C  
ATOM   4413  C   LEU A 560      65.329  71.171  44.293  1.00 46.07           C  
ATOM   4414  O   LEU A 560      66.509  70.776  44.186  1.00 46.07           O  
ATOM   4415  CB  LEU A 560      64.214  70.394  46.375  1.00 48.09           C  
ATOM   4416  CG  LEU A 560      64.383  70.192  47.898  1.00 54.69           C  
ATOM   4417  CD1 LEU A 560      64.996  71.414  48.590  1.00 49.53           C  
ATOM   4418  CD2 LEU A 560      63.044  69.842  48.476  1.00 48.80           C  
ATOM   4419  N   GLY A 561      64.498  71.219  43.253  1.00 39.45           N  
ATOM   4420  CA  GLY A 561      64.971  70.723  41.987  1.00 37.94           C  
ATOM   4421  C   GLY A 561      65.333  69.273  42.252  1.00 37.45           C  
ATOM   4422  O   GLY A 561      64.569  68.532  42.858  1.00 36.98           O  
ATOM   4423  N   LYS A 562      66.490  68.854  41.781  1.00 38.19           N  
ATOM   4424  CA  LYS A 562      66.941  67.495  42.017  1.00 44.34           C  
ATOM   4425  C   LYS A 562      68.141  67.499  43.002  1.00 42.75           C  
ATOM   4426  O   LYS A 562      68.981  66.608  42.950  1.00 41.94           O  
ATOM   4427  CB  LYS A 562      67.371  66.840  40.690  1.00 46.28           C  
ATOM   4428  CG  LYS A 562      66.774  65.461  40.480  1.00 54.51           C  
ATOM   4429  CD  LYS A 562      67.676  64.521  39.651  1.00 62.53           C  
ATOM   4430  CE  LYS A 562      68.064  65.121  38.309  1.00 64.31           C  
ATOM   4431  NZ  LYS A 562      68.938  66.313  38.475  1.00 61.62           N  
ATOM   4432  N   SER A 563      68.218  68.500  43.878  1.00 44.44           N  
ATOM   4433  CA  SER A 563      69.325  68.583  44.848  1.00 50.31           C  
ATOM   4434  C   SER A 563      69.152  67.634  46.043  1.00 52.33           C  
ATOM   4435  O   SER A 563      70.096  67.389  46.785  1.00 54.37           O  
ATOM   4436  CB  SER A 563      69.477  70.011  45.383  1.00 45.95           C  
ATOM   4437  OG  SER A 563      68.396  70.356  46.231  1.00 48.58           O  
ATOM   4438  N   GLU A 564      67.947  67.107  46.232  1.00 53.69           N  
ATOM   4439  CA  GLU A 564      67.689  66.190  47.330  1.00 54.39           C  
ATOM   4440  C   GLU A 564      67.147  64.883  46.786  1.00 55.43           C  
ATOM   4441  O   GLU A 564      66.742  64.812  45.636  1.00 57.97           O  
ATOM   4442  CB  GLU A 564      66.681  66.809  48.303  1.00 52.85           C  
ATOM   4443  CG  GLU A 564      67.224  68.027  49.046  1.00 58.57           C  
ATOM   4444  CD  GLU A 564      68.500  67.691  49.843  1.00 62.00           C  
ATOM   4445  OE1 GLU A 564      68.418  66.881  50.790  1.00 58.98           O  
ATOM   4446  OE2 GLU A 564      69.583  68.222  49.509  1.00 64.60           O  
ATOM   4447  N   PRO A 565      67.166  63.817  47.597  1.00 54.94           N  
ATOM   4448  CA  PRO A 565      66.638  62.542  47.107  1.00 50.19           C  
ATOM   4449  C   PRO A 565      65.157  62.793  46.840  1.00 47.21           C  
ATOM   4450  O   PRO A 565      64.525  63.575  47.565  1.00 42.02           O  
ATOM   4451  CB  PRO A 565      66.854  61.594  48.292  1.00 51.75           C  
ATOM   4452  CG  PRO A 565      68.063  62.178  48.979  1.00 54.61           C  
ATOM   4453  CD  PRO A 565      67.802  63.664  48.918  1.00 53.80           C  
ATOM   4454  N   TRP A 566      64.598  62.151  45.811  1.00 46.90           N  
ATOM   4455  CA  TRP A 566      63.181  62.362  45.498  1.00 42.32           C  
ATOM   4456  C   TRP A 566      62.342  61.915  46.693  1.00 43.44           C  
ATOM   4457  O   TRP A 566      61.276  62.483  46.976  1.00 43.55           O  
ATOM   4458  CB  TRP A 566      62.767  61.583  44.235  1.00 41.14           C  
ATOM   4459  CG  TRP A 566      62.838  60.090  44.356  1.00 30.89           C  
ATOM   4460  CD1 TRP A 566      63.866  59.297  43.980  1.00 30.32           C  
ATOM   4461  CD2 TRP A 566      61.811  59.219  44.858  1.00 27.06           C  
ATOM   4462  NE1 TRP A 566      63.549  57.978  44.211  1.00 35.74           N  
ATOM   4463  CE2 TRP A 566      62.289  57.908  44.747  1.00 32.96           C  
ATOM   4464  CE3 TRP A 566      60.537  59.428  45.388  1.00 33.45           C  
ATOM   4465  CZ2 TRP A 566      61.531  56.795  45.135  1.00 34.22           C  
ATOM   4466  CZ3 TRP A 566      59.784  58.319  45.779  1.00 35.95           C  
ATOM   4467  CH2 TRP A 566      60.289  57.024  45.647  1.00 33.51           C  
ATOM   4468  N   THR A 567      62.831  60.902  47.399  1.00 42.59           N  
ATOM   4469  CA  THR A 567      62.143  60.405  48.593  1.00 45.49           C  
ATOM   4470  C   THR A 567      61.969  61.517  49.641  1.00 44.88           C  
ATOM   4471  O   THR A 567      61.018  61.521  50.401  1.00 48.47           O  
ATOM   4472  CB  THR A 567      62.936  59.253  49.247  1.00 45.91           C  
ATOM   4473  OG1 THR A 567      64.284  59.682  49.499  1.00 49.11           O  
ATOM   4474  CG2 THR A 567      62.950  58.054  48.339  1.00 46.07           C  
ATOM   4475  N   LEU A 568      62.900  62.456  49.676  1.00 47.32           N  
ATOM   4476  CA  LEU A 568      62.828  63.565  50.615  1.00 47.97           C  
ATOM   4477  C   LEU A 568      61.940  64.683  50.054  1.00 47.88           C  
ATOM   4478  O   LEU A 568      61.179  65.317  50.795  1.00 48.40           O  
ATOM   4479  CB  LEU A 568      64.246  64.097  50.894  1.00 49.82           C  
ATOM   4480  CG  LEU A 568      64.416  65.125  52.019  1.00 54.93           C  
ATOM   4481  CD1 LEU A 568      65.911  65.277  52.328  1.00 55.24           C  
ATOM   4482  CD2 LEU A 568      63.805  66.471  51.616  1.00 53.63           C  
ATOM   4483  N   ALA A 569      62.051  64.948  48.751  1.00 47.27           N  
ATOM   4484  CA  ALA A 569      61.211  65.977  48.135  1.00 43.99           C  
ATOM   4485  C   ALA A 569      59.760  65.569  48.313  1.00 39.35           C  
ATOM   4486  O   ALA A 569      58.915  66.380  48.618  1.00 41.07           O  
ATOM   4487  CB  ALA A 569      61.547  66.123  46.663  1.00 46.66           C  
ATOM   4488  N   LEU A 570      59.463  64.292  48.136  1.00 43.24           N  
ATOM   4489  CA  LEU A 570      58.091  63.812  48.327  1.00 43.46           C  
ATOM   4490  C   LEU A 570      57.677  64.094  49.763  1.00 45.23           C  
ATOM   4491  O   LEU A 570      56.610  64.672  50.040  1.00 43.74           O  
ATOM   4492  CB  LEU A 570      58.034  62.296  48.112  1.00 44.70           C  
ATOM   4493  CG  LEU A 570      56.842  61.659  47.403  1.00 46.03           C  
ATOM   4494  CD1 LEU A 570      56.776  60.207  47.819  1.00 45.12           C  
ATOM   4495  CD2 LEU A 570      55.565  62.376  47.727  1.00 43.25           C  
ATOM   4496  N   GLU A 571      58.530  63.648  50.686  1.00 48.36           N  
ATOM   4497  CA  GLU A 571      58.272  63.822  52.117  1.00 52.89           C  
ATOM   4498  C   GLU A 571      57.994  65.271  52.475  1.00 50.30           C  
ATOM   4499  O   GLU A 571      57.086  65.558  53.242  1.00 50.92           O  
ATOM   4500  CB  GLU A 571      59.452  63.305  52.955  1.00 56.16           C  
ATOM   4501  CG  GLU A 571      59.181  63.332  54.468  1.00 61.98           C  
ATOM   4502  CD  GLU A 571      60.382  62.880  55.290  1.00 63.85           C  
ATOM   4503  OE1 GLU A 571      61.405  63.598  55.309  1.00 63.45           O  
ATOM   4504  OE2 GLU A 571      60.305  61.797  55.906  1.00 65.65           O  
ATOM   4505  N   ASN A 572      58.766  66.192  51.913  1.00 53.64           N  
ATOM   4506  CA  ASN A 572      58.541  67.598  52.209  1.00 56.41           C  
ATOM   4507  C   ASN A 572      57.120  68.023  51.859  1.00 57.68           C  
ATOM   4508  O   ASN A 572      56.606  68.998  52.405  1.00 60.58           O  
ATOM   4509  CB  ASN A 572      59.540  68.459  51.446  1.00 61.19           C  
ATOM   4510  CG  ASN A 572      60.958  68.277  51.947  1.00 62.06           C  
ATOM   4511  OD1 ASN A 572      61.228  67.396  52.763  1.00 65.65           O  
ATOM   4512  ND2 ASN A 572      61.872  69.107  51.461  1.00 61.56           N  
ATOM   4513  N   VAL A 573      56.479  67.291  50.953  1.00 57.01           N  
ATOM   4514  CA  VAL A 573      55.118  67.627  50.546  1.00 54.87           C  
ATOM   4515  C   VAL A 573      54.025  66.750  51.141  1.00 52.74           C  
ATOM   4516  O   VAL A 573      53.011  67.255  51.611  1.00 50.66           O  
ATOM   4517  CB  VAL A 573      54.966  67.584  48.999  1.00 54.92           C  
ATOM   4518  CG1 VAL A 573      53.497  67.671  48.600  1.00 54.11           C  
ATOM   4519  CG2 VAL A 573      55.699  68.727  48.400  1.00 55.65           C  
ATOM   4520  N   VAL A 574      54.211  65.439  51.126  1.00 52.58           N  
ATOM   4521  CA  VAL A 574      53.145  64.597  51.637  1.00 54.02           C  
ATOM   4522  C   VAL A 574      53.348  63.975  53.010  1.00 57.87           C  
ATOM   4523  O   VAL A 574      52.441  63.312  53.513  1.00 56.67           O  
ATOM   4524  CB  VAL A 574      52.790  63.479  50.614  1.00 52.34           C  
ATOM   4525  CG1 VAL A 574      52.546  64.105  49.236  1.00 51.03           C  
ATOM   4526  CG2 VAL A 574      53.889  62.448  50.557  1.00 38.84           C  
ATOM   4527  N   GLY A 575      54.526  64.185  53.610  1.00 61.44           N  
ATOM   4528  CA  GLY A 575      54.805  63.644  54.936  1.00 60.57           C  
ATOM   4529  C   GLY A 575      55.196  62.174  54.974  1.00 62.14           C  
ATOM   4530  O   GLY A 575      55.123  61.535  56.020  1.00 64.05           O  
ATOM   4531  N   ALA A 576      55.614  61.634  53.837  1.00 61.36           N  
ATOM   4532  CA  ALA A 576      56.014  60.238  53.747  1.00 57.12           C  
ATOM   4533  C   ALA A 576      57.082  60.160  52.673  1.00 56.99           C  
ATOM   4534  O   ALA A 576      57.119  60.995  51.774  1.00 52.79           O  
ATOM   4535  CB  ALA A 576      54.825  59.375  53.377  1.00 59.19           C  
ATOM   4536  N   LYS A 577      57.947  59.157  52.754  1.00 56.22           N  
ATOM   4537  CA  LYS A 577      59.025  59.047  51.790  1.00 56.04           C  
ATOM   4538  C   LYS A 577      58.790  58.057  50.668  1.00 54.79           C  
ATOM   4539  O   LYS A 577      59.694  57.768  49.885  1.00 52.18           O  
ATOM   4540  CB  LYS A 577      60.338  58.725  52.507  1.00 56.08           C  
ATOM   4541  CG  LYS A 577      60.346  57.432  53.267  1.00 60.69           C  
ATOM   4542  CD  LYS A 577      61.603  57.328  54.151  1.00 65.56           C  
ATOM   4543  CE  LYS A 577      61.686  58.491  55.144  1.00 68.69           C  
ATOM   4544  NZ  LYS A 577      62.769  58.307  56.160  1.00 70.17           N  
ATOM   4545  N   ASN A 578      57.596  57.501  50.579  1.00 52.84           N  
ATOM   4546  CA  ASN A 578      57.409  56.610  49.467  1.00 54.20           C  
ATOM   4547  C   ASN A 578      56.126  56.770  48.684  1.00 49.29           C  
ATOM   4548  O   ASN A 578      55.185  57.449  49.101  1.00 47.69           O  
ATOM   4549  CB  ASN A 578      57.577  55.156  49.882  1.00 58.45           C  
ATOM   4550  CG  ASN A 578      58.305  54.347  48.811  1.00 66.98           C  
ATOM   4551  OD1 ASN A 578      58.189  54.634  47.608  1.00 61.54           O  
ATOM   4552  ND2 ASN A 578      59.059  53.334  49.240  1.00 71.58           N  
ATOM   4553  N   MET A 579      56.141  56.165  47.507  1.00 49.23           N  
ATOM   4554  CA  MET A 579      55.011  56.162  46.605  1.00 49.39           C  
ATOM   4555  C   MET A 579      53.924  55.360  47.315  1.00 50.77           C  
ATOM   4556  O   MET A 579      54.165  54.263  47.814  1.00 52.36           O  
ATOM   4557  CB  MET A 579      55.419  55.500  45.286  1.00 48.72           C  
ATOM   4558  CG  MET A 579      54.307  55.381  44.249  1.00 52.03           C  
ATOM   4559  SD  MET A 579      54.911  54.746  42.650  1.00 51.48           S  
ATOM   4560  CE  MET A 579      55.497  53.078  43.119  1.00 49.10           C  
ATOM   4561  N   ASN A 580      52.733  55.935  47.369  1.00 51.36           N  
ATOM   4562  CA  ASN A 580      51.597  55.325  48.018  1.00 48.50           C  
ATOM   4563  C   ASN A 580      50.352  55.485  47.132  1.00 48.29           C  
ATOM   4564  O   ASN A 580      50.100  56.566  46.590  1.00 46.05           O  
ATOM   4565  CB  ASN A 580      51.378  56.012  49.360  1.00 52.01           C  
ATOM   4566  CG  ASN A 580      50.165  55.506  50.070  1.00 53.79           C  
ATOM   4567  OD1 ASN A 580      49.530  56.235  50.839  1.00 64.88           O  
ATOM   4568  ND2 ASN A 580      49.825  54.247  49.828  1.00 57.27           N  
ATOM   4569  N   VAL A 581      49.558  54.423  47.016  1.00 46.80           N  
ATOM   4570  CA  VAL A 581      48.366  54.450  46.186  1.00 46.64           C  
ATOM   4571  C   VAL A 581      47.076  54.844  46.878  1.00 47.75           C  
ATOM   4572  O   VAL A 581      46.067  55.065  46.207  1.00 47.29           O  
ATOM   4573  CB  VAL A 581      48.153  53.076  45.484  1.00 52.13           C  
ATOM   4574  CG1 VAL A 581      47.515  52.090  46.451  1.00 52.75           C  
ATOM   4575  CG2 VAL A 581      47.309  53.251  44.216  1.00 50.24           C  
ATOM   4576  N   ARG A 582      47.086  54.962  48.203  1.00 49.20           N  
ATOM   4577  CA  ARG A 582      45.857  55.317  48.916  1.00 51.87           C  
ATOM   4578  C   ARG A 582      45.169  56.591  48.445  1.00 47.48           C  
ATOM   4579  O   ARG A 582      43.945  56.651  48.357  1.00 47.28           O  
ATOM   4580  CB  ARG A 582      46.107  55.421  50.432  1.00 56.84           C  
ATOM   4581  CG  ARG A 582      45.829  54.117  51.189  1.00 68.59           C  
ATOM   4582  CD  ARG A 582      47.069  53.591  51.924  1.00 72.52           C  
ATOM   4583  NE  ARG A 582      47.517  54.516  52.965  1.00 77.65           N  
ATOM   4584  CZ  ARG A 582      48.683  54.418  53.596  1.00 80.09           C  
ATOM   4585  NH1 ARG A 582      49.519  53.430  53.293  1.00 79.69           N  
ATOM   4586  NH2 ARG A 582      49.021  55.314  54.519  1.00 81.14           N  
ATOM   4587  N   PRO A 583      45.942  57.646  48.176  1.00 46.74           N  
ATOM   4588  CA  PRO A 583      45.307  58.886  47.719  1.00 43.67           C  
ATOM   4589  C   PRO A 583      44.593  58.732  46.379  1.00 42.45           C  
ATOM   4590  O   PRO A 583      43.546  59.347  46.173  1.00 44.57           O  
ATOM   4591  CB  PRO A 583      46.475  59.855  47.647  1.00 41.91           C  
ATOM   4592  CG  PRO A 583      47.346  59.370  48.797  1.00 43.59           C  
ATOM   4593  CD  PRO A 583      47.347  57.886  48.543  1.00 45.54           C  
ATOM   4594  N   LEU A 584      45.153  57.929  45.468  1.00 43.11           N  
ATOM   4595  CA  LEU A 584      44.512  57.723  44.166  1.00 44.47           C  
ATOM   4596  C   LEU A 584      43.161  57.088  44.468  1.00 45.87           C  
ATOM   4597  O   LEU A 584      42.124  57.534  43.978  1.00 44.16           O  
ATOM   4598  CB  LEU A 584      45.361  56.807  43.265  1.00 44.69           C  
ATOM   4599  CG  LEU A 584      44.717  56.333  41.952  1.00 52.51           C  
ATOM   4600  CD1 LEU A 584      45.757  56.104  40.870  1.00 55.57           C  
ATOM   4601  CD2 LEU A 584      43.952  55.042  42.208  1.00 56.29           C  
ATOM   4602  N   LEU A 585      43.186  56.073  45.323  1.00 46.35           N  
ATOM   4603  CA  LEU A 585      41.987  55.352  45.734  1.00 47.24           C  
ATOM   4604  C   LEU A 585      40.987  56.260  46.437  1.00 47.94           C  
ATOM   4605  O   LEU A 585      39.771  56.117  46.266  1.00 48.83           O  
ATOM   4606  CB  LEU A 585      42.369  54.209  46.675  1.00 46.70           C  
ATOM   4607  CG  LEU A 585      42.577  52.802  46.133  1.00 51.04           C  
ATOM   4608  CD1 LEU A 585      42.900  52.839  44.623  1.00 48.67           C  
ATOM   4609  CD2 LEU A 585      43.671  52.119  46.953  1.00 47.08           C  
ATOM   4610  N   ASN A 586      41.482  57.180  47.257  1.00 47.04           N  
ATOM   4611  CA  ASN A 586      40.558  58.067  47.951  1.00 48.42           C  
ATOM   4612  C   ASN A 586      39.859  58.936  46.927  1.00 42.11           C  
ATOM   4613  O   ASN A 586      38.680  59.216  47.051  1.00 45.81           O  
ATOM   4614  CB  ASN A 586      41.286  58.967  48.958  1.00 51.20           C  
ATOM   4615  CG  ASN A 586      41.832  58.200  50.154  1.00 61.01           C  
ATOM   4616  OD1 ASN A 586      42.783  58.650  50.810  1.00 66.15           O  
ATOM   4617  ND2 ASN A 586      41.229  57.050  50.458  1.00 58.61           N  
ATOM   4618  N   TYR A 587      40.602  59.375  45.923  1.00 44.56           N  
ATOM   4619  CA  TYR A 587      40.046  60.235  44.878  1.00 44.77           C  
ATOM   4620  C   TYR A 587      38.847  59.562  44.238  1.00 45.46           C  
ATOM   4621  O   TYR A 587      37.782  60.176  44.079  1.00 44.41           O  
ATOM   4622  CB  TYR A 587      41.100  60.508  43.796  1.00 44.28           C  
ATOM   4623  CG  TYR A 587      40.696  61.519  42.744  1.00 45.63           C  
ATOM   4624  CD1 TYR A 587      40.836  62.883  42.965  1.00 45.23           C  
ATOM   4625  CD2 TYR A 587      40.187  61.105  41.513  1.00 47.35           C  
ATOM   4626  CE1 TYR A 587      40.486  63.791  41.998  1.00 43.84           C  
ATOM   4627  CE2 TYR A 587      39.834  62.012  40.541  1.00 43.70           C  
ATOM   4628  CZ  TYR A 587      39.982  63.348  40.785  1.00 45.21           C  
ATOM   4629  OH  TYR A 587      39.614  64.241  39.804  1.00 42.86           O  
ATOM   4630  N   PHE A 588      39.018  58.283  43.916  1.00 45.77           N  
ATOM   4631  CA  PHE A 588      37.990  57.509  43.229  1.00 46.21           C  
ATOM   4632  C   PHE A 588      36.987  56.745  44.077  1.00 48.31           C  
ATOM   4633  O   PHE A 588      36.085  56.090  43.532  1.00 47.49           O  
ATOM   4634  CB  PHE A 588      38.662  56.546  42.240  1.00 44.11           C  
ATOM   4635  CG  PHE A 588      39.258  57.229  41.043  1.00 40.37           C  
ATOM   4636  CD1 PHE A 588      40.633  57.326  40.886  1.00 39.19           C  
ATOM   4637  CD2 PHE A 588      38.429  57.784  40.065  1.00 43.52           C  
ATOM   4638  CE1 PHE A 588      41.183  57.966  39.772  1.00 43.04           C  
ATOM   4639  CE2 PHE A 588      38.962  58.426  38.948  1.00 38.63           C  
ATOM   4640  CZ  PHE A 588      40.337  58.521  38.795  1.00 39.75           C  
ATOM   4641  N   GLU A 589      37.121  56.825  45.398  1.00 49.35           N  
ATOM   4642  CA  GLU A 589      36.200  56.116  46.281  1.00 51.43           C  
ATOM   4643  C   GLU A 589      34.713  56.262  45.949  1.00 50.63           C  
ATOM   4644  O   GLU A 589      33.971  55.289  46.000  1.00 48.09           O  
ATOM   4645  CB  GLU A 589      36.436  56.515  47.735  1.00 54.95           C  
ATOM   4646  CG  GLU A 589      37.500  55.664  48.386  1.00 64.62           C  
ATOM   4647  CD  GLU A 589      37.096  54.191  48.478  1.00 69.57           C  
ATOM   4648  OE1 GLU A 589      37.878  53.326  48.027  1.00 69.37           O  
ATOM   4649  OE2 GLU A 589      36.000  53.897  49.007  1.00 70.52           O  
ATOM   4650  N   PRO A 590      34.253  57.485  45.639  1.00 50.07           N  
ATOM   4651  CA  PRO A 590      32.829  57.650  45.314  1.00 47.14           C  
ATOM   4652  C   PRO A 590      32.407  56.779  44.120  1.00 48.97           C  
ATOM   4653  O   PRO A 590      31.328  56.177  44.130  1.00 48.02           O  
ATOM   4654  CB  PRO A 590      32.721  59.135  45.011  1.00 46.33           C  
ATOM   4655  CG  PRO A 590      33.801  59.743  45.915  1.00 46.88           C  
ATOM   4656  CD  PRO A 590      34.943  58.788  45.720  1.00 46.99           C  
ATOM   4657  N   LEU A 591      33.264  56.717  43.100  1.00 47.70           N  
ATOM   4658  CA  LEU A 591      32.994  55.925  41.911  1.00 48.31           C  
ATOM   4659  C   LEU A 591      33.138  54.438  42.233  1.00 51.55           C  
ATOM   4660  O   LEU A 591      32.416  53.597  41.700  1.00 53.05           O  
ATOM   4661  CB  LEU A 591      33.970  56.293  40.791  1.00 44.76           C  
ATOM   4662  CG  LEU A 591      33.874  55.395  39.547  1.00 46.05           C  
ATOM   4663  CD1 LEU A 591      32.563  55.674  38.836  1.00 39.19           C  
ATOM   4664  CD2 LEU A 591      35.028  55.635  38.594  1.00 37.33           C  
ATOM   4665  N   PHE A 592      34.066  54.124  43.126  1.00 53.21           N  
ATOM   4666  CA  PHE A 592      34.328  52.748  43.496  1.00 54.19           C  
ATOM   4667  C   PHE A 592      33.154  52.087  44.196  1.00 57.73           C  
ATOM   4668  O   PHE A 592      32.885  50.899  43.987  1.00 58.68           O  
ATOM   4669  CB  PHE A 592      35.568  52.680  44.379  1.00 53.52           C  
ATOM   4670  CG  PHE A 592      35.954  51.293  44.768  1.00 49.50           C  
ATOM   4671  CD1 PHE A 592      36.017  50.293  43.826  1.00 53.22           C  
ATOM   4672  CD2 PHE A 592      36.287  50.995  46.073  1.00 51.79           C  
ATOM   4673  CE1 PHE A 592      36.411  49.015  44.177  1.00 54.52           C  
ATOM   4674  CE2 PHE A 592      36.682  49.725  46.432  1.00 51.06           C  
ATOM   4675  CZ  PHE A 592      36.744  48.732  45.479  1.00 51.82           C  
ATOM   4676  N   THR A 593      32.446  52.844  45.021  1.00 58.06           N  
ATOM   4677  CA  THR A 593      31.299  52.290  45.733  1.00 61.51           C  
ATOM   4678  C   THR A 593      30.103  52.152  44.787  1.00 59.60           C  
ATOM   4679  O   THR A 593      29.299  51.233  44.906  1.00 59.66           O  
ATOM   4680  CB  THR A 593      30.927  53.176  46.928  1.00 63.01           C  
ATOM   4681  OG1 THR A 593      30.663  54.507  46.464  1.00 67.77           O  
ATOM   4682  CG2 THR A 593      32.078  53.215  47.923  1.00 60.36           C  
ATOM   4683  N   TRP A 594      30.004  53.073  43.841  1.00 58.06           N  
ATOM   4684  CA  TRP A 594      28.940  53.047  42.851  1.00 58.01           C  
ATOM   4685  C   TRP A 594      29.180  51.858  41.920  1.00 59.56           C  
ATOM   4686  O   TRP A 594      28.256  51.123  41.579  1.00 61.22           O  
ATOM   4687  CB  TRP A 594      28.973  54.328  42.036  1.00 52.55           C  
ATOM   4688  CG  TRP A 594      27.906  54.414  41.009  1.00 52.93           C  
ATOM   4689  CD1 TRP A 594      26.619  54.809  41.204  1.00 52.17           C  
ATOM   4690  CD2 TRP A 594      28.047  54.186  39.601  1.00 51.09           C  
ATOM   4691  NE1 TRP A 594      25.948  54.855  40.009  1.00 50.28           N  
ATOM   4692  CE2 TRP A 594      26.801  54.475  39.006  1.00 53.14           C  
ATOM   4693  CE3 TRP A 594      29.104  53.773  38.788  1.00 50.48           C  
ATOM   4694  CZ2 TRP A 594      26.580  54.365  37.628  1.00 51.04           C  
ATOM   4695  CZ3 TRP A 594      28.888  53.665  37.420  1.00 54.19           C  
ATOM   4696  CH2 TRP A 594      27.631  53.963  36.853  1.00 53.98           C  
ATOM   4697  N   LEU A 595      30.433  51.687  41.509  1.00 58.33           N  
ATOM   4698  CA  LEU A 595      30.812  50.595  40.618  1.00 58.15           C  
ATOM   4699  C   LEU A 595      30.423  49.239  41.232  1.00 58.39           C  
ATOM   4700  O   LEU A 595      29.738  48.439  40.593  1.00 58.13           O  
ATOM   4701  CB  LEU A 595      32.320  50.661  40.337  1.00 54.49           C  
ATOM   4702  CG  LEU A 595      32.803  51.072  38.936  1.00 58.25           C  
ATOM   4703  CD1 LEU A 595      31.783  51.942  38.259  1.00 56.97           C  
ATOM   4704  CD2 LEU A 595      34.152  51.789  39.034  1.00 51.54           C  
ATOM   4705  N   LYS A 596      30.853  48.990  42.469  1.00 58.15           N  
ATOM   4706  CA  LYS A 596      30.529  47.747  43.165  1.00 57.20           C  
ATOM   4707  C   LYS A 596      29.036  47.440  43.087  1.00 58.98           C  
ATOM   4708  O   LYS A 596      28.646  46.334  42.712  1.00 58.31           O  
ATOM   4709  CB  LYS A 596      30.972  47.835  44.625  1.00 56.77           C  
ATOM   4710  CG  LYS A 596      32.442  47.485  44.836  1.00 59.18           C  
ATOM   4711  CD  LYS A 596      33.096  48.304  45.956  1.00 62.91           C  
ATOM   4712  CE  LYS A 596      32.327  48.238  47.268  1.00 66.40           C  
ATOM   4713  NZ  LYS A 596      33.180  48.682  48.422  1.00 68.19           N  
ATOM   4714  N   ASP A 597      28.207  48.425  43.428  1.00 58.82           N  
ATOM   4715  CA  ASP A 597      26.753  48.273  43.383  1.00 62.50           C  
ATOM   4716  C   ASP A 597      26.252  48.014  41.949  1.00 61.62           C  
ATOM   4717  O   ASP A 597      25.291  47.272  41.746  1.00 60.93           O  
ATOM   4718  CB  ASP A 597      26.070  49.527  43.958  1.00 64.10           C  
ATOM   4719  CG  ASP A 597      24.551  49.407  43.988  1.00 67.03           C  
ATOM   4720  OD1 ASP A 597      24.040  48.487  44.665  1.00 70.69           O  
ATOM   4721  OD2 ASP A 597      23.866  50.231  43.340  1.00 67.90           O  
ATOM   4722  N   GLN A 598      26.890  48.634  40.962  1.00 59.82           N  
ATOM   4723  CA  GLN A 598      26.508  48.420  39.570  1.00 59.59           C  
ATOM   4724  C   GLN A 598      26.857  46.995  39.149  1.00 59.27           C  
ATOM   4725  O   GLN A 598      26.159  46.390  38.344  1.00 58.64           O  
ATOM   4726  CB  GLN A 598      27.246  49.388  38.643  1.00 60.78           C  
ATOM   4727  CG  GLN A 598      26.710  50.820  38.616  1.00 64.55           C  
ATOM   4728  CD  GLN A 598      25.314  50.917  38.020  1.00 64.45           C  
ATOM   4729  OE1 GLN A 598      25.037  50.354  36.961  1.00 62.42           O  
ATOM   4730  NE2 GLN A 598      24.434  51.642  38.697  1.00 63.52           N  
ATOM   4731  N   ASN A 599      27.948  46.470  39.693  1.00 58.76           N  
ATOM   4732  CA  ASN A 599      28.407  45.128  39.368  1.00 58.21           C  
ATOM   4733  C   ASN A 599      27.818  44.081  40.322  1.00 61.25           C  
ATOM   4734  O   ASN A 599      28.326  42.959  40.413  1.00 60.45           O  
ATOM   4735  CB  ASN A 599      29.933  45.070  39.463  1.00 55.30           C  
ATOM   4736  CG  ASN A 599      30.627  45.974  38.464  1.00 52.29           C  
ATOM   4737  OD1 ASN A 599      31.837  46.187  38.556  1.00 55.83           O  
ATOM   4738  ND2 ASN A 599      29.883  46.494  37.503  1.00 43.47           N  
ATOM   4739  N   LYS A 600      26.755  44.451  41.027  1.00 63.06           N  
ATOM   4740  CA  LYS A 600      26.119  43.562  42.003  1.00 67.91           C  
ATOM   4741  C   LYS A 600      25.808  42.189  41.414  1.00 68.58           C  
ATOM   4742  O   LYS A 600      25.999  41.154  42.058  1.00 67.97           O  
ATOM   4743  CB  LYS A 600      24.824  44.209  42.515  1.00 73.40           C  
ATOM   4744  CG  LYS A 600      24.299  43.669  43.842  1.00 78.19           C  
ATOM   4745  CD  LYS A 600      25.193  44.057  45.026  1.00 82.63           C  
ATOM   4746  CE  LYS A 600      24.647  43.495  46.345  1.00 82.24           C  
ATOM   4747  NZ  LYS A 600      25.452  43.904  47.534  1.00 82.48           N  
ATOM   4748  N   ASN A 601      25.352  42.192  40.172  1.00 69.07           N  
ATOM   4749  CA  ASN A 601      24.984  40.967  39.482  1.00 71.54           C  
ATOM   4750  C   ASN A 601      25.971  40.532  38.391  1.00 71.21           C  
ATOM   4751  O   ASN A 601      25.807  39.461  37.793  1.00 74.46           O  
ATOM   4752  CB  ASN A 601      23.607  41.175  38.862  1.00 74.84           C  
ATOM   4753  CG  ASN A 601      23.582  42.371  37.919  1.00 79.14           C  
ATOM   4754  OD1 ASN A 601      24.352  43.335  38.091  1.00 76.22           O  
ATOM   4755  ND2 ASN A 601      22.694  42.324  36.923  1.00 79.09           N  
ATOM   4756  N   SER A 602      26.986  41.350  38.122  1.00 67.58           N  
ATOM   4757  CA  SER A 602      27.959  41.027  37.079  1.00 61.75           C  
ATOM   4758  C   SER A 602      29.099  40.138  37.538  1.00 59.39           C  
ATOM   4759  O   SER A 602      29.279  39.903  38.728  1.00 59.07           O  
ATOM   4760  CB  SER A 602      28.556  42.313  36.504  1.00 60.16           C  
ATOM   4761  OG  SER A 602      27.583  43.070  35.814  1.00 59.30           O  
ATOM   4762  N   PHE A 603      29.861  39.626  36.578  1.00 57.60           N  
ATOM   4763  CA  PHE A 603      31.027  38.821  36.903  1.00 58.44           C  
ATOM   4764  C   PHE A 603      32.155  39.845  37.012  1.00 58.13           C  
ATOM   4765  O   PHE A 603      32.364  40.640  36.097  1.00 58.12           O  
ATOM   4766  CB  PHE A 603      31.344  37.809  35.794  1.00 57.35           C  
ATOM   4767  CG  PHE A 603      32.518  36.897  36.111  1.00 55.59           C  
ATOM   4768  CD1 PHE A 603      33.797  37.203  35.674  1.00 53.93           C  
ATOM   4769  CD2 PHE A 603      32.338  35.752  36.864  1.00 55.69           C  
ATOM   4770  CE1 PHE A 603      34.879  36.386  35.983  1.00 50.09           C  
ATOM   4771  CE2 PHE A 603      33.411  34.927  37.179  1.00 55.82           C  
ATOM   4772  CZ  PHE A 603      34.686  35.249  36.736  1.00 55.39           C  
ATOM   4773  N   VAL A 604      32.844  39.858  38.145  1.00 56.64           N  
ATOM   4774  CA  VAL A 604      33.942  40.786  38.343  1.00 56.35           C  
ATOM   4775  C   VAL A 604      35.256  40.034  38.136  1.00 57.51           C  
ATOM   4776  O   VAL A 604      35.566  39.078  38.863  1.00 57.19           O  
ATOM   4777  CB  VAL A 604      33.910  41.402  39.761  1.00 57.11           C  
ATOM   4778  CG1 VAL A 604      34.977  42.498  39.877  1.00 55.27           C  
ATOM   4779  CG2 VAL A 604      32.526  41.965  40.046  1.00 54.15           C  
ATOM   4780  N   GLY A 605      36.026  40.462  37.137  1.00 53.73           N  
ATOM   4781  CA  GLY A 605      37.281  39.794  36.854  1.00 50.80           C  
ATOM   4782  C   GLY A 605      37.193  39.145  35.487  1.00 49.56           C  
ATOM   4783  O   GLY A 605      36.258  39.394  34.739  1.00 47.41           O  
ATOM   4784  N   TRP A 606      38.134  38.282  35.149  1.00 48.37           N  
ATOM   4785  CA  TRP A 606      38.081  37.699  33.828  1.00 51.52           C  
ATOM   4786  C   TRP A 606      38.762  36.369  33.720  1.00 51.66           C  
ATOM   4787  O   TRP A 606      39.607  36.024  34.536  1.00 49.34           O  
ATOM   4788  CB  TRP A 606      38.721  38.672  32.831  1.00 51.03           C  
ATOM   4789  CG  TRP A 606      40.098  39.125  33.267  1.00 49.26           C  
ATOM   4790  CD1 TRP A 606      41.282  38.458  33.087  1.00 49.47           C  
ATOM   4791  CD2 TRP A 606      40.422  40.327  33.973  1.00 44.98           C  
ATOM   4792  NE1 TRP A 606      42.314  39.173  33.631  1.00 45.64           N  
ATOM   4793  CE2 TRP A 606      41.816  40.324  34.184  1.00 46.19           C  
ATOM   4794  CE3 TRP A 606      39.670  41.405  34.445  1.00 45.15           C  
ATOM   4795  CZ2 TRP A 606      42.477  41.364  34.848  1.00 43.44           C  
ATOM   4796  CZ3 TRP A 606      40.328  42.438  35.102  1.00 43.42           C  
ATOM   4797  CH2 TRP A 606      41.715  42.410  35.296  1.00 39.43           C  
ATOM   4798  N   SER A 607      38.384  35.631  32.685  1.00 55.74           N  
ATOM   4799  CA  SER A 607      38.970  34.324  32.391  1.00 56.90           C  
ATOM   4800  C   SER A 607      39.984  34.589  31.292  1.00 53.61           C  
ATOM   4801  O   SER A 607      39.690  35.338  30.367  1.00 54.10           O  
ATOM   4802  CB  SER A 607      37.882  33.369  31.882  1.00 61.82           C  
ATOM   4803  OG  SER A 607      38.402  32.425  30.955  1.00 66.09           O  
ATOM   4804  N   THR A 608      41.169  33.994  31.376  1.00 53.83           N  
ATOM   4805  CA  THR A 608      42.176  34.226  30.346  1.00 56.90           C  
ATOM   4806  C   THR A 608      42.088  33.250  29.168  1.00 59.18           C  
ATOM   4807  O   THR A 608      42.886  33.317  28.234  1.00 59.67           O  
ATOM   4808  CB  THR A 608      43.595  34.164  30.933  1.00 59.61           C  
ATOM   4809  OG1 THR A 608      43.874  32.836  31.407  1.00 54.94           O  
ATOM   4810  CG2 THR A 608      43.729  35.167  32.074  1.00 57.30           C  
ATOM   4811  N   ASP A 609      41.100  32.361  29.205  1.00 61.41           N  
ATOM   4812  CA  ASP A 609      40.920  31.357  28.160  1.00 60.66           C  
ATOM   4813  C   ASP A 609      40.170  31.879  26.956  1.00 58.50           C  
ATOM   4814  O   ASP A 609      40.520  31.581  25.817  1.00 60.39           O  
ATOM   4815  CB  ASP A 609      40.152  30.155  28.706  1.00 63.79           C  
ATOM   4816  CG  ASP A 609      40.897  29.435  29.802  1.00 68.98           C  
ATOM   4817  OD1 ASP A 609      40.285  28.548  30.434  1.00 74.57           O  
ATOM   4818  OD2 ASP A 609      42.088  29.743  30.031  1.00 70.74           O  
ATOM   4819  N   TRP A 610      39.131  32.657  27.205  1.00 55.66           N  
ATOM   4820  CA  TRP A 610      38.327  33.166  26.115  1.00 56.39           C  
ATOM   4821  C   TRP A 610      39.074  34.065  25.133  1.00 58.39           C  
ATOM   4822  O   TRP A 610      39.997  34.802  25.505  1.00 57.97           O  
ATOM   4823  CB  TRP A 610      37.122  33.920  26.668  1.00 53.55           C  
ATOM   4824  CG  TRP A 610      36.201  34.380  25.587  1.00 55.11           C  
ATOM   4825  CD1 TRP A 610      35.225  33.650  24.981  1.00 51.97           C  
ATOM   4826  CD2 TRP A 610      36.189  35.676  24.956  1.00 52.68           C  
ATOM   4827  NE1 TRP A 610      34.604  34.407  24.013  1.00 53.21           N  
ATOM   4828  CE2 TRP A 610      35.175  35.653  23.979  1.00 51.97           C  
ATOM   4829  CE3 TRP A 610      36.938  36.846  25.123  1.00 53.63           C  
ATOM   4830  CZ2 TRP A 610      34.884  36.759  23.174  1.00 51.45           C  
ATOM   4831  CZ3 TRP A 610      36.648  37.952  24.314  1.00 49.12           C  
ATOM   4832  CH2 TRP A 610      35.633  37.896  23.360  1.00 52.56           C  
ATOM   4833  N   SER A 611      38.679  33.979  23.867  1.00 58.19           N  
ATOM   4834  CA  SER A 611      39.261  34.813  22.825  1.00 60.20           C  
ATOM   4835  C   SER A 611      38.226  34.922  21.722  1.00 60.17           C  
ATOM   4836  O   SER A 611      37.387  34.038  21.562  1.00 61.37           O  
ATOM   4837  CB  SER A 611      40.570  34.213  22.287  1.00 58.84           C  
ATOM   4838  OG  SER A 611      40.351  32.980  21.641  1.00 58.77           O  
ATOM   4839  N   PRO A 612      38.262  36.019  20.954  1.00 60.45           N  
ATOM   4840  CA  PRO A 612      37.324  36.267  19.856  1.00 59.12           C  
ATOM   4841  C   PRO A 612      37.290  35.137  18.825  1.00 59.65           C  
ATOM   4842  O   PRO A 612      36.270  34.899  18.174  1.00 58.08           O  
ATOM   4843  CB  PRO A 612      37.844  37.579  19.249  1.00 53.90           C  
ATOM   4844  CG  PRO A 612      38.479  38.259  20.408  1.00 57.17           C  
ATOM   4845  CD  PRO A 612      39.224  37.127  21.072  1.00 58.47           C  
ATOM   4846  N   TYR A 613      38.408  34.438  18.687  1.00 60.58           N  
ATOM   4847  CA  TYR A 613      38.516  33.370  17.700  1.00 63.69           C  
ATOM   4848  C   TYR A 613      38.443  31.942  18.251  1.00 66.93           C  
ATOM   4849  O   TYR A 613      38.584  30.982  17.498  1.00 64.80           O  
ATOM   4850  CB  TYR A 613      39.829  33.559  16.927  1.00 59.71           C  
ATOM   4851  CG  TYR A 613      41.059  33.619  17.817  1.00 57.04           C  
ATOM   4852  CD1 TYR A 613      41.692  32.459  18.244  1.00 53.28           C  
ATOM   4853  CD2 TYR A 613      41.568  34.843  18.265  1.00 56.90           C  
ATOM   4854  CE1 TYR A 613      42.792  32.509  19.089  1.00 53.24           C  
ATOM   4855  CE2 TYR A 613      42.676  34.898  19.122  1.00 48.81           C  
ATOM   4856  CZ  TYR A 613      43.277  33.732  19.524  1.00 51.41           C  
ATOM   4857  OH  TYR A 613      44.375  33.772  20.356  1.00 57.07           O  
ATOM   4858  N   ALA A 614      38.222  31.800  19.553  1.00 70.32           N  
ATOM   4859  CA  ALA A 614      38.167  30.478  20.167  1.00 75.58           C  
ATOM   4860  C   ALA A 614      37.195  29.530  19.464  1.00 79.72           C  
ATOM   4861  O   ALA A 614      37.281  28.309  19.629  1.00 78.60           O  
ATOM   4862  CB  ALA A 614      37.803  30.601  21.643  1.00 76.48           C  
ATOM   4863  N   ASP A 615      36.279  30.091  18.678  1.00 83.14           N  
ATOM   4864  CA  ASP A 615      35.298  29.286  17.954  1.00 86.68           C  
ATOM   4865  C   ASP A 615      35.267  29.560  16.436  1.00 88.09           C  
ATOM   4866  O   ASP A 615      34.267  30.121  15.930  1.00 88.57           O  
ATOM   4867  CB  ASP A 615      33.907  29.487  18.575  1.00 87.40           C  
ATOM   4868  CG  ASP A 615      33.457  30.934  18.554  1.00 88.22           C  
ATOM   4869  OD1 ASP A 615      32.381  31.227  19.121  1.00 88.15           O  
ATOM   4870  OD2 ASP A 615      34.171  31.777  17.969  1.00 89.57           O  
ATOM   4871  OXT ASP A 615      36.257  29.204  15.756  1.00 89.04           O  
TER    4872      ASP A 615                                                      
ATOM   4873  N   UNK B 901      37.483  27.352  14.778  1.00 67.99           N  
ATOM   4874  CA  UNK B 901      38.856  26.820  14.989  1.00 71.22           C  
ATOM   4875  C   UNK B 901      38.853  25.310  15.274  1.00 72.26           C  
ATOM   4876  O   UNK B 901      38.080  24.834  16.103  1.00 74.09           O  
ATOM   4877  CB  UNK B 901      39.537  27.581  16.143  1.00 68.58           C  
ATOM   4878  N   UNK B 902      39.711  24.567  14.574  1.00 73.73           N  
ATOM   4879  CA  UNK B 902      39.831  23.117  14.749  1.00 74.30           C  
ATOM   4880  C   UNK B 902      41.186  22.845  15.405  1.00 75.13           C  
ATOM   4881  O   UNK B 902      42.184  23.452  15.030  1.00 75.79           O  
ATOM   4882  CB  UNK B 902      39.737  22.418  13.390  1.00 74.12           C  
ATOM   4883  N   UNK B 903      41.232  21.939  16.376  1.00 77.47           N  
ATOM   4884  CA  UNK B 903      42.482  21.664  17.086  1.00 79.68           C  
ATOM   4885  C   UNK B 903      43.408  20.611  16.458  1.00 82.33           C  
ATOM   4886  O   UNK B 903      43.046  19.943  15.485  1.00 81.30           O  
ATOM   4887  CB  UNK B 903      42.173  21.297  18.536  1.00 78.88           C  
ATOM   4888  N   UNK B 904      44.612  20.490  17.022  1.00 82.61           N  
ATOM   4889  CA  UNK B 904      45.621  19.540  16.551  1.00 84.52           C  
ATOM   4890  C   UNK B 904      46.739  19.423  17.589  1.00 86.88           C  
ATOM   4891  O   UNK B 904      47.181  20.428  18.150  1.00 88.47           O  
ATOM   4892  CB  UNK B 904      46.196  19.999  15.214  1.00 81.41           C  
ATOM   4893  N   UNK B 905      47.198  18.199  17.841  1.00 89.33           N  
ATOM   4894  CA  UNK B 905      48.255  17.970  18.831  1.00 91.58           C  
ATOM   4895  C   UNK B 905      49.671  18.111  18.262  1.00 92.32           C  
ATOM   4896  O   UNK B 905      49.991  19.111  17.617  1.00 92.54           O  
ATOM   4897  CB  UNK B 905      48.080  16.584  19.481  1.00 90.31           C  
ATOM   4898  N   UNK B 906      50.512  17.108  18.513  1.00 92.71           N  
ATOM   4899  CA  UNK B 906      51.896  17.122  18.050  1.00 92.94           C  
ATOM   4900  C   UNK B 906      52.694  18.177  18.819  1.00 91.28           C  
ATOM   4901  O   UNK B 906      53.783  17.843  19.318  1.00 90.44           O  
ATOM   4902  CB  UNK B 906      51.953  17.400  16.540  1.00 93.51           C  
ATOM   4903  OXT UNK B 906      52.222  19.328  18.915  1.00 91.49           O  
TER    4904      UNK B 906                                                      
ATOM   4905  N   UNK C 907      50.376  21.063  20.432  1.00 99.98           N  
ATOM   4906  CA  UNK C 907      49.084  21.807  20.330  1.00100.13           C  
ATOM   4907  C   UNK C 907      49.081  22.705  19.097  1.00 98.97           C  
ATOM   4908  O   UNK C 907      50.132  23.184  18.675  1.00 99.51           O  
ATOM   4909  CB  UNK C 907      48.864  22.650  21.587  1.00 99.23           C  
ATOM   4910  N   UNK C 908      47.900  22.927  18.525  1.00 96.97           N  
ATOM   4911  CA  UNK C 908      47.771  23.779  17.349  1.00 95.76           C  
ATOM   4912  C   UNK C 908      46.314  23.983  16.939  1.00 94.78           C  
ATOM   4913  O   UNK C 908      45.631  23.038  16.533  1.00 94.56           O  
ATOM   4914  CB  UNK C 908      48.570  23.193  16.175  1.00 95.52           C  
ATOM   4915  N   UNK C 909      45.848  25.226  17.052  1.00 91.88           N  
ATOM   4916  CA  UNK C 909      44.484  25.588  16.676  1.00 87.19           C  
ATOM   4917  C   UNK C 909      44.595  26.431  15.408  1.00 84.04           C  
ATOM   4918  O   UNK C 909      45.649  27.014  15.157  1.00 82.90           O  
ATOM   4919  CB  UNK C 909      43.828  26.391  17.796  1.00 86.63           C  
ATOM   4920  N   UNK C 910      43.525  26.499  14.615  1.00 80.08           N  
ATOM   4921  CA  UNK C 910      43.558  27.276  13.375  1.00 77.81           C  
ATOM   4922  C   UNK C 910      42.198  27.823  12.904  1.00 75.71           C  
ATOM   4923  O   UNK C 910      41.150  27.409  13.388  1.00 76.87           O  
ATOM   4924  CB  UNK C 910      44.191  26.430  12.261  1.00 78.50           C  
ATOM   4925  N   UNK C 911      42.237  28.756  11.952  1.00 72.39           N  
ATOM   4926  CA  UNK C 911      41.036  29.370  11.380  1.00 68.60           C  
ATOM   4927  C   UNK C 911      41.415  29.916  10.004  1.00 67.68           C  
ATOM   4928  O   UNK C 911      42.582  29.857   9.626  1.00 67.39           O  
ATOM   4929  CB  UNK C 911      40.529  30.500  12.287  1.00 70.84           C  
ATOM   4930  N   UNK C 912      40.452  30.452   9.258  1.00 65.66           N  
ATOM   4931  CA  UNK C 912      40.746  30.974   7.922  1.00 67.45           C  
ATOM   4932  C   UNK C 912      40.033  32.289   7.643  1.00 66.75           C  
ATOM   4933  O   UNK C 912      38.931  32.500   8.110  1.00 67.79           O  
ATOM   4934  CB  UNK C 912      40.371  29.928   6.854  1.00 64.96           C  
ATOM   4935  N   UNK C 913      40.655  33.162   6.858  1.00 67.90           N  
ATOM   4936  CA  UNK C 913      40.076  34.460   6.563  1.00 71.25           C  
ATOM   4937  C   UNK C 913      39.729  34.601   5.083  1.00 74.36           C  
ATOM   4938  O   UNK C 913      38.909  33.844   4.578  1.00 76.18           O  
ATOM   4939  CB  UNK C 913      41.049  35.577   7.010  1.00 70.01           C  
ATOM   4940  N   UNK C 914      40.339  35.561   4.386  1.00 77.67           N  
ATOM   4941  CA  UNK C 914      40.043  35.744   2.965  1.00 80.41           C  
ATOM   4942  C   UNK C 914      40.822  36.865   2.299  1.00 82.83           C  
ATOM   4943  O   UNK C 914      40.453  37.310   1.219  1.00 83.73           O  
ATOM   4944  CB  UNK C 914      38.558  36.003   2.786  1.00 80.55           C  
ATOM   4945  N   UNK C 915      41.900  37.315   2.921  1.00 85.02           N  
ATOM   4946  CA  UNK C 915      42.666  38.417   2.354  1.00 87.50           C  
ATOM   4947  C   UNK C 915      41.787  39.648   2.536  1.00 90.19           C  
ATOM   4948  O   UNK C 915      41.761  40.550   1.696  1.00 89.41           O  
ATOM   4949  CB  UNK C 915      42.934  38.175   0.887  1.00 88.01           C  
ATOM   4950  N   UNK C 916      41.054  39.636   3.650  1.00 91.86           N  
ATOM   4951  CA  UNK C 916      40.135  40.691   4.069  1.00 92.24           C  
ATOM   4952  C   UNK C 916      39.705  40.296   5.489  1.00 93.58           C  
ATOM   4953  O   UNK C 916      38.534  40.016   5.752  1.00 93.58           O  
ATOM   4954  CB  UNK C 916      38.930  40.748   3.143  1.00 93.79           C  
ATOM   4955  N   UNK C 917      40.703  40.278   6.375  1.00 94.15           N  
ATOM   4956  CA  UNK C 917      40.628  39.922   7.799  1.00 93.87           C  
ATOM   4957  C   UNK C 917      39.302  39.900   8.562  1.00 94.96           C  
ATOM   4958  O   UNK C 917      39.276  39.458   9.714  1.00 92.77           O  
ATOM   4959  CB  UNK C 917      41.632  40.770   8.573  1.00 93.51           C  
ATOM   4960  N   UNK C 918      38.217  40.370   7.948  1.00 95.91           N  
ATOM   4961  CA  UNK C 918      36.898  40.379   8.584  1.00 94.64           C  
ATOM   4962  C   UNK C 918      36.633  39.092   9.376  1.00 94.04           C  
ATOM   4963  O   UNK C 918      36.472  39.134  10.595  1.00 92.54           O  
ATOM   4964  CB  UNK C 918      35.818  40.569   7.520  1.00 97.06           C  
ATOM   4965  N   UNK C 919      36.589  37.960   8.669  1.00 93.46           N  
ATOM   4966  CA  UNK C 919      36.354  36.634   9.262  1.00 92.65           C  
ATOM   4967  C   UNK C 919      36.079  35.640   8.133  1.00 91.55           C  
ATOM   4968  O   UNK C 919      36.385  35.933   6.980  1.00 90.51           O  
ATOM   4969  CB  UNK C 919      35.164  36.683  10.216  1.00 93.51           C  
ATOM   4970  N   UNK C 920      35.510  34.478   8.459  1.00 91.96           N  
ATOM   4971  CA  UNK C 920      35.178  33.467   7.441  1.00 93.03           C  
ATOM   4972  C   UNK C 920      34.564  32.194   8.016  1.00 93.57           C  
ATOM   4973  O   UNK C 920      35.254  31.423   8.683  1.00 92.80           O  
ATOM   4974  CB  UNK C 920      36.409  33.108   6.633  1.00 93.76           C  
ATOM   4975  N   UNK C 921      33.279  31.972   7.721  1.00 94.47           N  
ATOM   4976  CA  UNK C 921      32.516  30.806   8.200  1.00 94.89           C  
ATOM   4977  C   UNK C 921      33.368  29.635   8.698  1.00 95.29           C  
ATOM   4978  O   UNK C 921      34.288  29.185   8.013  1.00 95.98           O  
ATOM   4979  CB  UNK C 921      31.563  30.329   7.112  1.00 92.96           C  
ATOM   4980  N   UNK C 922      33.043  29.146   9.893  1.00 96.69           N  
ATOM   4981  CA  UNK C 922      33.770  28.043  10.527  1.00 97.45           C  
ATOM   4982  C   UNK C 922      33.380  26.674   9.995  1.00 98.21           C  
ATOM   4983  O   UNK C 922      32.990  26.534   8.836  1.00 97.21           O  
ATOM   4984  CB  UNK C 922      33.559  28.080  12.038  1.00 97.85           C  
ATOM   4985  N   UNK C 923      33.482  25.669  10.862  1.00100.21           N  
ATOM   4986  CA  UNK C 923      33.157  24.291  10.495  1.00102.48           C  
ATOM   4987  C   UNK C 923      33.940  23.924   9.239  1.00103.99           C  
ATOM   4988  O   UNK C 923      35.103  23.520   9.325  1.00104.38           O  
ATOM   4989  CB  UNK C 923      31.652  24.143  10.245  1.00102.11           C  
ATOM   4990  N   UNK C 924      33.298  24.083   8.080  1.00104.24           N  
ATOM   4991  CA  UNK C 924      33.915  23.787   6.792  1.00103.41           C  
ATOM   4992  C   UNK C 924      35.101  22.850   6.956  1.00104.02           C  
ATOM   4993  O   UNK C 924      36.235  23.206   6.641  1.00101.35           O  
ATOM   4994  CB  UNK C 924      34.356  25.078   6.114  1.00101.55           C  
ATOM   4995  N   UNK C 925      34.827  21.660   7.483  1.00106.85           N  
ATOM   4996  CA  UNK C 925      35.855  20.646   7.687  1.00109.27           C  
ATOM   4997  C   UNK C 925      35.914  19.829   6.404  1.00110.85           C  
ATOM   4998  O   UNK C 925      36.900  19.144   6.124  1.00111.39           O  
ATOM   4999  CB  UNK C 925      35.494  19.753   8.875  1.00107.44           C  
ATOM   5000  N   UNK C 926      34.842  19.927   5.624  1.00113.20           N  
ATOM   5001  CA  UNK C 926      34.735  19.227   4.351  1.00115.53           C  
ATOM   5002  C   UNK C 926      35.884  19.640   3.433  1.00116.81           C  
ATOM   5003  O   UNK C 926      36.588  18.735   2.931  1.00117.85           O  
ATOM   5004  CB  UNK C 926      33.390  19.545   3.691  1.00115.52           C  
ATOM   5005  OXT UNK C 926      36.066  20.861   3.226  1.00116.85           O  
TER    5006      UNK C 926                                                      
ATOM   5007  N   UNK D 927      59.698  24.750  11.451  1.00 82.60           N  
ATOM   5008  CA  UNK D 927      58.839  25.869  10.946  1.00 84.82           C  
ATOM   5009  C   UNK D 927      58.432  25.674   9.478  1.00 84.55           C  
ATOM   5010  O   UNK D 927      57.341  26.077   9.075  1.00 84.97           O  
ATOM   5011  CB  UNK D 927      59.562  27.208  11.118  1.00 82.35           C  
ATOM   5012  N   UNK D 928      59.299  25.055   8.681  1.00 84.53           N  
ATOM   5013  CA  UNK D 928      58.982  24.821   7.277  1.00 84.78           C  
ATOM   5014  C   UNK D 928      57.858  23.790   7.163  1.00 85.53           C  
ATOM   5015  O   UNK D 928      57.224  23.653   6.113  1.00 86.31           O  
ATOM   5016  CB  UNK D 928      60.227  24.348   6.518  1.00 84.86           C  
ATOM   5017  N   UNK D 929      57.616  23.059   8.247  1.00 85.64           N  
ATOM   5018  CA  UNK D 929      56.548  22.063   8.264  1.00 84.00           C  
ATOM   5019  C   UNK D 929      55.228  22.827   8.404  1.00 83.41           C  
ATOM   5020  O   UNK D 929      54.207  22.464   7.803  1.00 83.13           O  
ATOM   5021  CB  UNK D 929      56.742  21.103   9.437  1.00 84.92           C  
ATOM   5022  N   UNK D 930      55.268  23.900   9.192  1.00 81.54           N  
ATOM   5023  CA  UNK D 930      54.103  24.752   9.402  1.00 80.04           C  
ATOM   5024  C   UNK D 930      53.631  25.316   8.065  1.00 78.71           C  
ATOM   5025  O   UNK D 930      52.457  25.187   7.717  1.00 77.32           O  
ATOM   5026  CB  UNK D 930      54.452  25.894  10.353  1.00 81.36           C  
ATOM   5027  N   UNK D 931      54.552  25.933   7.321  1.00 76.51           N  
ATOM   5028  CA  UNK D 931      54.228  26.519   6.019  1.00 76.19           C  
ATOM   5029  C   UNK D 931      53.492  25.500   5.181  1.00 76.40           C  
ATOM   5030  O   UNK D 931      52.507  25.827   4.508  1.00 76.82           O  
ATOM   5031  CB  UNK D 931      55.506  26.974   5.283  1.00 73.50           C  
ATOM   5032  N   UNK D 932      53.982  24.262   5.235  1.00 76.77           N  
ATOM   5033  CA  UNK D 932      53.402  23.153   4.487  1.00 75.21           C  
ATOM   5034  C   UNK D 932      51.957  22.937   4.909  1.00 73.83           C  
ATOM   5035  O   UNK D 932      51.034  22.961   4.080  1.00 72.16           O  
ATOM   5036  CB  UNK D 932      54.219  21.885   4.724  1.00 76.29           C  
ATOM   5037  N   UNK D 933      51.758  22.730   6.205  1.00 72.12           N  
ATOM   5038  CA  UNK D 933      50.409  22.517   6.710  1.00 73.31           C  
ATOM   5039  C   UNK D 933      49.507  23.654   6.258  1.00 73.38           C  
ATOM   5040  O   UNK D 933      48.476  23.418   5.629  1.00 73.75           O  
ATOM   5041  CB  UNK D 933      50.414  22.429   8.236  1.00 72.46           C  
ATOM   5042  N   UNK D 934      49.911  24.887   6.569  1.00 72.02           N  
ATOM   5043  CA  UNK D 934      49.124  26.064   6.216  1.00 69.67           C  
ATOM   5044  C   UNK D 934      48.923  26.154   4.721  1.00 68.49           C  
ATOM   5045  O   UNK D 934      47.840  26.509   4.255  1.00 67.72           O  
ATOM   5046  CB  UNK D 934      49.800  27.337   6.737  1.00 70.29           C  
ATOM   5047  N   UNK D 935      49.967  25.828   3.967  1.00 68.60           N  
ATOM   5048  CA  UNK D 935      49.882  25.881   2.512  1.00 70.57           C  
ATOM   5049  C   UNK D 935      48.903  24.827   1.995  1.00 71.14           C  
ATOM   5050  O   UNK D 935      48.180  25.064   1.027  1.00 70.39           O  
ATOM   5051  CB  UNK D 935      51.259  25.679   1.897  1.00 67.16           C  
ATOM   5052  N   UNK D 936      48.877  23.667   2.648  1.00 74.13           N  
ATOM   5053  CA  UNK D 936      47.973  22.584   2.254  1.00 77.37           C  
ATOM   5054  C   UNK D 936      46.537  22.881   2.698  1.00 79.21           C  
ATOM   5055  O   UNK D 936      45.602  22.804   1.889  1.00 80.68           O  
ATOM   5056  CB  UNK D 936      48.442  21.265   2.853  1.00 78.68           C  
ATOM   5057  N   UNK D 937      46.361  23.216   3.978  1.00 78.33           N  
ATOM   5058  CA  UNK D 937      45.034  23.540   4.501  1.00 78.34           C  
ATOM   5059  C   UNK D 937      44.452  24.604   3.590  1.00 78.18           C  
ATOM   5060  O   UNK D 937      43.275  24.565   3.244  1.00 78.82           O  
ATOM   5061  CB  UNK D 937      45.129  24.067   5.932  1.00 79.11           C  
ATOM   5062  N   UNK D 938      45.297  25.549   3.191  1.00 78.46           N  
ATOM   5063  CA  UNK D 938      44.878  26.619   2.298  1.00 78.08           C  
ATOM   5064  C   UNK D 938      44.435  25.999   0.984  1.00 79.57           C  
ATOM   5065  O   UNK D 938      43.433  26.413   0.399  1.00 78.05           O  
ATOM   5066  CB  UNK D 938      46.025  27.580   2.063  1.00 75.23           C  
ATOM   5067  N   UNK D 939      45.194  25.007   0.519  1.00 82.90           N  
ATOM   5068  CA  UNK D 939      44.864  24.315  -0.723  1.00 83.98           C  
ATOM   5069  C   UNK D 939      43.409  23.885  -0.611  1.00 85.16           C  
ATOM   5070  O   UNK D 939      42.598  24.129  -1.512  1.00 84.70           O  
ATOM   5071  CB  UNK D 939      45.766  23.097  -0.906  1.00 84.12           C  
ATOM   5072  N   UNK D 940      43.078  23.265   0.518  1.00 85.77           N  
ATOM   5073  CA  UNK D 940      41.715  22.811   0.757  1.00 87.17           C  
ATOM   5074  C   UNK D 940      40.724  23.960   0.580  1.00 88.61           C  
ATOM   5075  O   UNK D 940      39.749  23.842  -0.163  1.00 91.19           O  
ATOM   5076  CB  UNK D 940      41.599  22.230   2.153  1.00 85.13           C  
ATOM   5077  N   UNK D 941      40.977  25.077   1.252  1.00 88.63           N  
ATOM   5078  CA  UNK D 941      40.081  26.219   1.153  1.00 88.94           C  
ATOM   5079  C   UNK D 941      39.730  26.503  -0.299  1.00 88.81           C  
ATOM   5080  O   UNK D 941      38.560  26.464  -0.678  1.00 88.37           O  
ATOM   5081  CB  UNK D 941      40.717  27.449   1.792  1.00 88.32           C  
ATOM   5082  N   UNK D 942      40.748  26.779  -1.110  1.00 90.14           N  
ATOM   5083  CA  UNK D 942      40.546  27.082  -2.525  1.00 91.10           C  
ATOM   5084  C   UNK D 942      39.773  25.964  -3.226  1.00 92.33           C  
ATOM   5085  O   UNK D 942      39.028  26.218  -4.177  1.00 91.35           O  
ATOM   5086  CB  UNK D 942      41.894  27.307  -3.211  1.00 89.85           C  
ATOM   5087  N   UNK D 943      39.951  24.734  -2.744  1.00 92.61           N  
ATOM   5088  CA  UNK D 943      39.272  23.567  -3.311  1.00 95.01           C  
ATOM   5089  C   UNK D 943      37.809  23.507  -2.854  1.00 95.39           C  
ATOM   5090  O   UNK D 943      37.378  22.528  -2.234  1.00 94.88           O  
ATOM   5091  CB  UNK D 943      40.005  22.286  -2.898  1.00 94.56           C  
ATOM   5092  N   UNK D 944      37.057  24.560  -3.167  1.00 93.90           N  
ATOM   5093  CA  UNK D 944      35.653  24.661  -2.789  1.00 92.96           C  
ATOM   5094  C   UNK D 944      35.060  25.877  -3.477  1.00 92.93           C  
ATOM   5095  O   UNK D 944      34.830  26.880  -2.779  1.00 93.95           O  
ATOM   5096  CB  UNK D 944      35.518  24.801  -1.270  1.00 90.78           C  
ATOM   5097  OXT UNK D 944      34.855  25.825  -4.705  1.00 95.03           O  
TER    5098      UNK D 944                                                      
ATOM   5099  N   UNK E 945      36.533  31.112  -6.771  1.00 90.48           N  
ATOM   5100  CA  UNK E 945      37.522  32.204  -7.026  1.00 90.75           C  
ATOM   5101  C   UNK E 945      38.328  32.557  -5.774  1.00 89.53           C  
ATOM   5102  O   UNK E 945      39.419  33.120  -5.872  1.00 90.07           O  
ATOM   5103  CB  UNK E 945      36.803  33.455  -7.549  1.00 91.31           C  
ATOM   5104  N   UNK E 946      37.790  32.225  -4.602  1.00 87.54           N  
ATOM   5105  CA  UNK E 946      38.462  32.516  -3.333  1.00 85.03           C  
ATOM   5106  C   UNK E 946      39.888  31.955  -3.298  1.00 81.81           C  
ATOM   5107  O   UNK E 946      40.094  30.750  -3.137  1.00 79.58           O  
ATOM   5108  CB  UNK E 946      37.641  31.959  -2.155  1.00 83.55           C  
ATOM   5109  N   UNK E 947      40.866  32.847  -3.438  1.00 77.79           N  
ATOM   5110  CA  UNK E 947      42.274  32.468  -3.439  1.00 74.24           C  
ATOM   5111  C   UNK E 947      42.915  32.454  -2.040  1.00 72.16           C  
ATOM   5112  O   UNK E 947      43.781  33.268  -1.741  1.00 69.88           O  
ATOM   5113  CB  UNK E 947      43.045  33.408  -4.365  1.00 72.30           C  
ATOM   5114  N   UNK E 948      42.492  31.522  -1.192  1.00 70.53           N  
ATOM   5115  CA  UNK E 948      43.036  31.413   0.156  1.00 70.89           C  
ATOM   5116  C   UNK E 948      44.560  31.309   0.086  1.00 72.38           C  
ATOM   5117  O   UNK E 948      45.130  31.182  -1.003  1.00 74.78           O  
ATOM   5118  CB  UNK E 948      42.450  30.192   0.857  1.00 71.12           C  
ATOM   5119  N   UNK E 949      45.224  31.359   1.237  1.00 69.01           N  
ATOM   5120  CA  UNK E 949      46.676  31.276   1.249  1.00 66.97           C  
ATOM   5121  C   UNK E 949      47.254  30.936   2.617  1.00 66.91           C  
ATOM   5122  O   UNK E 949      46.556  30.961   3.626  1.00 68.70           O  
ATOM   5123  CB  UNK E 949      47.247  32.568   0.753  1.00 70.69           C  
ATOM   5124  N   UNK E 950      48.535  30.603   2.644  1.00 66.15           N  
ATOM   5125  CA  UNK E 950      49.203  30.253   3.893  1.00 68.76           C  
ATOM   5126  C   UNK E 950      48.985  31.343   4.948  1.00 67.02           C  
ATOM   5127  O   UNK E 950      48.725  31.059   6.122  1.00 64.89           O  
ATOM   5128  CB  UNK E 950      50.711  30.055   3.644  1.00 69.50           C  
ATOM   5129  N   UNK E 951      49.093  32.592   4.509  1.00 67.00           N  
ATOM   5130  CA  UNK E 951      48.928  33.741   5.388  1.00 68.25           C  
ATOM   5131  C   UNK E 951      47.469  33.943   5.773  1.00 66.65           C  
ATOM   5132  O   UNK E 951      47.165  34.692   6.698  1.00 66.83           O  
ATOM   5133  CB  UNK E 951      49.486  35.005   4.710  1.00 69.00           C  
ATOM   5134  N   UNK E 952      46.565  33.275   5.065  1.00 67.00           N  
ATOM   5135  CA  UNK E 952      45.142  33.392   5.372  1.00 65.90           C  
ATOM   5136  C   UNK E 952      44.684  32.256   6.293  1.00 65.75           C  
ATOM   5137  O   UNK E 952      43.496  32.102   6.555  1.00 65.77           O  
ATOM   5138  CB  UNK E 952      44.321  33.411   4.087  1.00 63.51           C  
ATOM   5139  N   UNK E 953      45.641  31.469   6.783  1.00 67.42           N  
ATOM   5140  CA  UNK E 953      45.370  30.355   7.701  1.00 68.23           C  
ATOM   5141  C   UNK E 953      46.118  30.668   8.993  1.00 67.32           C  
ATOM   5142  O   UNK E 953      47.333  30.521   9.064  1.00 68.39           O  
ATOM   5143  CB  UNK E 953      45.864  29.011   7.095  1.00 65.90           C  
ATOM   5144  N   UNK E 954      45.380  31.085  10.017  1.00 69.33           N  
ATOM   5145  CA  UNK E 954      45.963  31.491  11.295  1.00 68.74           C  
ATOM   5146  C   UNK E 954      46.068  30.433  12.387  1.00 69.58           C  
ATOM   5147  O   UNK E 954      45.060  29.941  12.885  1.00 69.95           O  
ATOM   5148  CB  UNK E 954      45.195  32.710  11.822  1.00 67.26           C  
ATOM   5149  N   UNK E 955      47.301  30.118  12.780  1.00 71.26           N  
ATOM   5150  CA  UNK E 955      47.571  29.119  13.813  1.00 72.29           C  
ATOM   5151  C   UNK E 955      47.803  29.749  15.187  1.00 73.85           C  
ATOM   5152  O   UNK E 955      48.558  30.703  15.316  1.00 75.73           O  
ATOM   5153  CB  UNK E 955      48.785  28.275  13.411  1.00 68.28           C  
ATOM   5154  N   UNK E 956      47.156  29.204  16.214  1.00 77.16           N  
ATOM   5155  CA  UNK E 956      47.291  29.717  17.576  1.00 79.64           C  
ATOM   5156  C   UNK E 956      47.730  28.616  18.544  1.00 82.78           C  
ATOM   5157  O   UNK E 956      47.971  27.478  18.133  1.00 83.20           O  
ATOM   5158  CB  UNK E 956      45.968  30.320  18.037  1.00 78.39           C  
ATOM   5159  N   UNK E 957      47.815  28.957  19.829  1.00 85.48           N  
ATOM   5160  CA  UNK E 957      48.237  28.003  20.855  1.00 88.38           C  
ATOM   5161  C   UNK E 957      49.596  27.448  20.437  1.00 91.05           C  
ATOM   5162  O   UNK E 957      50.442  28.197  19.943  1.00 94.05           O  
ATOM   5163  CB  UNK E 957      47.217  26.880  20.987  1.00 86.24           C  
ATOM   5164  N   UNK E 958      49.817  26.151  20.630  1.00 90.93           N  
ATOM   5165  CA  UNK E 958      51.090  25.542  20.242  1.00 91.66           C  
ATOM   5166  C   UNK E 958      52.277  26.076  21.052  1.00 92.07           C  
ATOM   5167  O   UNK E 958      52.072  26.979  21.889  1.00 93.64           O  
ATOM   5168  CB  UNK E 958      51.337  25.770  18.746  1.00 89.41           C  
ATOM   5169  OXT UNK E 958      53.408  25.588  20.836  1.00 91.33           O  
TER    5170      UNK E 958                                                      
HETATM 5171  C1  NAG A 800      78.943  71.316  49.196  1.00 90.12           C  
HETATM 5172  C2  NAG A 800      78.474  71.698  50.620  1.00 92.58           C  
HETATM 5173  C3  NAG A 800      77.751  73.065  50.645  1.00 91.62           C  
HETATM 5174  C4  NAG A 800      78.564  74.122  49.918  1.00 90.73           C  
HETATM 5175  C5  NAG A 800      78.848  73.625  48.506  1.00 91.32           C  
HETATM 5176  C6  NAG A 800      79.629  74.628  47.682  1.00 90.42           C  
HETATM 5177  C7  NAG A 800      77.684  70.198  52.347  1.00 95.56           C  
HETATM 5178  C8  NAG A 800      76.774  70.809  53.404  1.00 96.16           C  
HETATM 5179  N2  NAG A 800      77.573  70.667  51.107  1.00 95.17           N  
HETATM 5180  O3  NAG A 800      77.541  73.485  51.985  1.00 91.12           O  
HETATM 5181  O4  NAG A 800      77.841  75.343  49.879  1.00 90.70           O  
HETATM 5182  O5  NAG A 800      79.634  72.411  48.568  1.00 91.35           O  
HETATM 5183  O6  NAG A 800      80.677  73.992  46.967  1.00 91.24           O  
HETATM 5184  O7  NAG A 800      78.474  69.304  52.656  1.00 95.15           O  
HETATM 5185  C1  NAG A 801      83.514  55.932  30.937  1.00 88.71           C  
HETATM 5186  C2  NAG A 801      83.685  55.430  32.377  1.00 89.54           C  
HETATM 5187  C3  NAG A 801      85.132  55.644  32.848  1.00 89.73           C  
HETATM 5188  C4  NAG A 801      86.134  55.083  31.825  1.00 89.86           C  
HETATM 5189  C5  NAG A 801      85.828  55.629  30.427  1.00 88.99           C  
HETATM 5190  C6  NAG A 801      86.742  55.055  29.358  1.00 88.49           C  
HETATM 5191  C7  NAG A 801      82.206  55.542  34.284  1.00 89.64           C  
HETATM 5192  C8  NAG A 801      82.777  55.837  35.661  1.00 89.22           C  
HETATM 5193  N2  NAG A 801      82.772  56.151  33.247  1.00 89.80           N  
HETATM 5194  O3  NAG A 801      85.320  54.997  34.096  1.00 88.45           O  
HETATM 5195  O4  NAG A 801      87.460  55.436  32.197  1.00 90.73           O  
HETATM 5196  O5  NAG A 801      84.466  55.305  30.063  1.00 89.07           O  
HETATM 5197  O6  NAG A 801      86.058  54.130  28.528  1.00 88.59           O  
HETATM 5198  O7  NAG A 801      81.254  54.769  34.169  1.00 91.19           O  
HETATM 5199  C1  NAG A 802      41.035  83.603  46.375  1.00 84.59           C  
HETATM 5200  C2  NAG A 802      39.562  83.151  46.358  1.00 85.39           C  
HETATM 5201  C3  NAG A 802      38.677  84.242  45.754  1.00 87.96           C  
HETATM 5202  C4  NAG A 802      38.860  85.530  46.562  1.00 88.16           C  
HETATM 5203  C5  NAG A 802      40.350  85.919  46.549  1.00 89.39           C  
HETATM 5204  C6  NAG A 802      40.660  87.167  47.363  1.00 88.39           C  
HETATM 5205  C7  NAG A 802      38.588  80.966  46.090  1.00 85.51           C  
HETATM 5206  C8  NAG A 802      37.467  80.519  45.176  1.00 85.61           C  
HETATM 5207  N2  NAG A 802      39.409  81.906  45.627  1.00 86.30           N  
HETATM 5208  O3  NAG A 802      37.313  83.835  45.774  1.00 88.19           O  
HETATM 5209  O4  NAG A 802      38.074  86.571  45.997  1.00 87.85           O  
HETATM 5210  O5  NAG A 802      41.157  84.846  47.097  1.00 88.31           O  
HETATM 5211  O6  NAG A 802      39.627  87.446  48.299  1.00 88.55           O  
HETATM 5212  O7  NAG A 802      38.697  80.467  47.212  1.00 83.01           O  
HETATM 5213 CL    CL A 803      49.529  45.396  21.465  1.00 44.38          CL  
HETATM 5214 ZN    ZN A 804      53.141  68.638  31.204  1.00 53.98          ZN  
HETATM 5215  O   HOH A 805      46.427  59.279   7.270  1.00 29.12           O  
HETATM 5216  O   HOH A 806      45.583  47.126  26.107  1.00 37.45           O  
HETATM 5217  O   HOH A 807      53.516  43.492  15.547  1.00 42.05           O  
HETATM 5218  O   HOH A 808      39.191  66.754  40.315  1.00 45.84           O  
HETATM 5219  O   HOH A 809      57.485  64.702  34.642  1.00 44.94           O  
HETATM 5220  O   HOH A 810      49.129  35.309  20.824  1.00 53.86           O  
HETATM 5221  O   HOH A 811      38.406  72.879  48.630  1.00 53.87           O  
HETATM 5222  O   HOH A 812      65.187  44.876  33.767  1.00 41.67           O  
HETATM 5223  O   HOH A 813      61.712  51.520  33.680  1.00 45.00           O  
HETATM 5224  O   HOH A 814      44.150  48.447  28.184  1.00 36.84           O  
HETATM 5225  O   HOH A 815      52.053  57.417  18.687  1.00 48.28           O  
HETATM 5226  O   HOH A 816      46.811  57.042  23.060  1.00 45.86           O  
HETATM 5227  O   HOH A 817      67.709  76.273  33.108  1.00 49.87           O  
HETATM 5228  O   HOH A 818      62.401  54.471  34.646  1.00 63.30           O  
HETATM 5229  O   HOH A 819      65.285  76.813  36.259  1.00 46.22           O  
HETATM 5230  O   HOH A 820      39.400  36.056  27.899  1.00 50.50           O  
HETATM 5231  O   HOH A 821      50.030  55.414  30.198  1.00 43.81           O  
HETATM 5232  O   HOH A 822      64.037  56.271  33.062  1.00 46.66           O  
HETATM 5233  O   HOH A 823      53.968  69.268  28.974  1.00 54.00           O  
HETATM 5234  O   HOH A 824      40.763  55.766  24.298  1.00 42.41           O  
HETATM 5235  O   HOH A 825      58.529  57.509  15.421  1.00 48.49           O  
HETATM 5236  O   HOH A 826      60.252  65.397  36.463  1.00 42.00           O  
HETATM 5237  O   HOH A 827      61.675  50.228  24.063  1.00 36.17           O  
HETATM 5238  O   HOH A 828      61.619  47.525   6.969  1.00 45.54           O  
HETATM 5239  O   HOH A 829      39.076  68.346  38.399  1.00 41.27           O  
HETATM 5240  O   HOH A 830      48.410  57.940  45.028  1.00 43.84           O  
HETATM 5241  O   HOH A 831      60.795  42.215  36.550  1.00 48.19           O  
HETATM 5242  O   HOH A 832      51.146  60.031  50.728  1.00 49.84           O  
HETATM 5243  O   HOH A 833      45.493  55.535  18.816  1.00 46.43           O  
HETATM 5244  O   HOH A 834      62.739  73.451  50.996  1.00 59.25           O  
HETATM 5245  O   HOH A 835      46.054  46.484  21.897  1.00 47.01           O  
HETATM 5246  O   HOH A 836      72.503  42.511  29.970  1.00 49.04           O  
HETATM 5247  O   HOH A 837      36.361  42.670  35.606  1.00 48.78           O  
HETATM 5248  O   HOH A 838      52.680  74.632  55.180  1.00 68.93           O  
HETATM 5249  O   HOH A 839      67.553  43.946  36.128  1.00 58.00           O  
HETATM 5250  O   HOH A 840      49.415  57.242  23.284  1.00 46.80           O  
HETATM 5251  O   HOH A 841      37.085  62.030  45.451  1.00 45.44           O  
HETATM 5252  O   HOH A 842      29.670  41.237  41.389  1.00 65.76           O  
HETATM 5253  O   HOH A 843      50.978  43.111  41.925  1.00 60.71           O  
HETATM 5254  O   HOH A 844      43.332  56.801  18.673  1.00 50.85           O  
HETATM 5255  O   HOH A 845      49.381  62.019  50.474  1.00 52.61           O  
HETATM 5256  O   HOH A 846      63.742  57.328  28.457  1.00 45.04           O  
HETATM 5257  O   HOH A 847      66.623  61.400  43.610  1.00 44.20           O  
HETATM 5258  O   HOH A 848      45.188  43.363  37.331  1.00 56.92           O  
HETATM 5259  O   HOH A 849      57.677  79.123  41.446  1.00 48.60           O  
HETATM 5260  O   HOH A 850      41.602  49.493  20.769  1.00 43.00           O  
HETATM 5261  O   HOH A 851      31.108  62.223  24.659  1.00 63.18           O  
HETATM 5262  O   HOH A 852      55.958  49.154  49.452  1.00 63.09           O  
HETATM 5263  O   HOH A 853      51.992  90.121  43.237  1.00 67.71           O  
HETATM 5264  O   HOH A 854      58.061  55.853  42.823  1.00 41.26           O  
HETATM 5265  O   HOH A 855      27.203  50.846  25.687  1.00 55.12           O  
HETATM 5266  O   HOH A 856      65.292  67.117  45.484  1.00 39.40           O  
HETATM 5267  O   HOH A 857      77.976  73.460  41.335  1.00 59.05           O  
HETATM 5268  O   HOH A 858      32.465  67.418  39.268  1.00 64.57           O  
HETATM 5269  O   HOH A 859      62.948  46.804  48.244  1.00 64.08           O  
HETATM 5270  O   HOH A 860      58.964  40.174  11.606  1.00 47.52           O  
HETATM 5271  O   HOH A 861      51.025  64.806  31.954  1.00 64.71           O  
HETATM 5272  O   HOH A 862      71.028  84.058  40.600  1.00 69.62           O  
HETATM 5273  O   HOH A 863      57.818  33.879  32.426  1.00 61.41           O  
HETATM 5274  O   HOH A 864      79.336  83.044  24.661  1.00 58.27           O  
HETATM 5275  O   HOH A 865      72.083  57.975  14.125  1.00 70.42           O  
HETATM 5276  O   HOH A 866      73.599  42.076  25.339  1.00 51.32           O  
HETATM 5277  O   HOH A 867      47.432  39.740   9.535  1.00 50.94           O  
HETATM 5278  O   HOH A 868      35.253  48.180   0.779  1.00 67.94           O  
HETATM 5279  O   HOH A 869      69.840  46.496  40.474  1.00 53.11           O  
HETATM 5280  O   HOH A 870      57.624  83.246  34.377  1.00 49.23           O  
HETATM 5281  O   HOH A 871      52.131  62.704  30.718  1.00 59.71           O  
HETATM 5282  O   HOH A 872      42.981  85.434  22.253  1.00 56.29           O  
HETATM 5283  O   HOH A 873      62.473  45.978   9.035  1.00 52.63           O  
HETATM 5284  O   HOH A 874      40.477  57.432   9.124  1.00 52.59           O  
HETATM 5285  O   HOH A 875      65.482  56.557  26.918  1.00 66.55           O  
HETATM 5286  O   HOH A 876      86.652  72.650  26.529  1.00 66.76           O  
HETATM 5287  O   HOH A 877      62.406  88.484  33.068  1.00 49.37           O  
HETATM 5288  O   HOH A 878      68.760  73.523  48.231  1.00 68.54           O  
HETATM 5289  O   HOH A 879      29.151  41.288  23.217  1.00 61.04           O  
HETATM 5290  O   HOH A 880      52.680  30.782  11.827  1.00 69.35           O  
HETATM 5291  O   HOH A 881      38.005  52.171   6.725  1.00 60.85           O  
HETATM 5292  O   HOH A 882      76.259  64.586  23.858  1.00 63.19           O  
HETATM 5293  O   HOH A 883      43.563  61.775  15.725  1.00 83.88           O  
HETATM 5294  O   HOH A 884      53.653  48.167   4.815  1.00 65.85           O  
HETATM 5295  O   HOH A 885      31.158  38.245  40.124  1.00 69.85           O  
HETATM 5296  O   HOH A 886      51.949  83.443  38.965  1.00 53.29           O  
HETATM 5297  O   HOH A 887      70.218  41.427  33.670  1.00 56.13           O  
HETATM 5298  O   HOH A 888      74.471  76.831  37.665  1.00 57.92           O  
HETATM 5299  O   HOH A 889      36.973  61.058  47.983  1.00 55.75           O  
HETATM 5300  O   HOH A 890      52.538  60.414  26.557  1.00 44.86           O  
HETATM 5301  O   HOH A 891      52.702  55.777  10.540  1.00 36.15           O  
HETATM 5302  O   HOH A 892      67.025  74.478  31.778  1.00 64.60           O  
HETATM 5303  O   HOH A 893      46.243  36.749  10.372  1.00 60.58           O  
HETATM 5304  O   HOH A 894      58.317  70.388  30.873  1.00 58.51           O  
HETATM 5305  O   HOH A 895      51.910  58.349  11.624  1.00 46.20           O  
HETATM 5306  O   HOH A 896      59.920  56.034  32.851  1.00 49.23           O  
HETATM 5307  O   HOH A 897      49.262  47.591  23.856  1.00 47.06           O  
HETATM 5308  O   HOH A 898      62.048  84.702  17.709  1.00 73.85           O  
HETATM 5309  O   HOH A 899      43.430  60.483  26.645  1.00 50.72           O  
HETATM 5310  O   HOH A 900      58.455  61.188  25.253  1.00 59.98           O  
HETATM 5311  O   HOH A 901      52.160  67.110  28.748  1.00 62.27           O  
HETATM 5312  O   HOH A 902      55.998  71.225  28.760  1.00 50.79           O  
HETATM 5313  O   HOH A 903      49.153  32.812  21.106  1.00 70.17           O  
HETATM 5314  O   HOH A 904      20.792  59.881  45.093  1.00 66.78           O  
HETATM 5315  O   HOH A 905      63.308  49.737   6.585  1.00 59.98           O  
HETATM 5316  O   HOH A 906      46.334  57.977  20.531  1.00 51.38           O  
HETATM 5317  O   HOH A 907      56.192  61.841  24.819  1.00 78.39           O  
HETATM 5318  O   HOH A 908      45.873  61.154  27.726  1.00 56.76           O  
HETATM 5319  O   HOH A 909      89.776  54.411  31.431  1.00 77.25           O  
HETATM 5320  O   HOH A 910      39.472  53.665   5.468  1.00 68.41           O  
HETATM 5321  O   HOH A 911      60.819  85.485  19.603  1.00 77.71           O  
HETATM 5322  O   HOH A 912      53.070  81.486  40.542  1.00 94.34           O  
HETATM 5323  O   HOH A 913      47.443  34.694  25.223  1.00 67.12           O  
HETATM 5324  O   HOH A 914      61.413  85.298  29.320  1.00 54.36           O  
HETATM 5325  O   HOH A 915      34.374  40.506  34.854  1.00 56.45           O  
HETATM 5326  O   HOH A 916      62.160  69.102  43.440  1.00 45.80           O  
HETATM 5327  O   HOH A 917      60.988  48.139  48.614  1.00 63.47           O  
HETATM 5328  O   HOH A 918      27.944  74.665  28.338  1.00 65.44           O  
HETATM 5329  O   HOH A 919      67.062  59.347  41.996  1.00 45.92           O  
HETATM 5330  O   HOH A 920     101.681  64.857  50.865  1.00 57.67           O  
HETATM 5331  O   HOH A 921      47.006  35.588  12.691  1.00 54.45           O  
HETATM 5332  O   HOH A 922      46.380  59.651  23.546  1.00 55.32           O  
HETATM 5333  O   HOH A 923      70.374  58.821  15.622  1.00 74.26           O  
HETATM 5334  O   HOH A 924      63.939  54.956  18.200  1.00 45.43           O  
HETATM 5335  O   HOH A 925      23.515  50.555  29.935  1.00 66.43           O  
HETATM 5336  O   HOH A 926      70.276  49.629  43.232  1.00 63.19           O  
HETATM 5337  O   HOH A 927      63.379  79.614  44.454  1.00 68.49           O  
HETATM 5338  O   HOH A 928      69.633  61.684  44.279  1.00 49.19           O  
HETATM 5339  O   HOH A 929      74.750  75.811  21.949  1.00 57.62           O  
HETATM 5340  O   HOH A 930      67.380  79.082  15.149  1.00 68.72           O  
HETATM 5341  O   HOH A 931      28.421  37.672  42.947  1.00 79.87           O  
HETATM 5342  O   HOH A 932      46.337  63.565  31.344  1.00 63.68           O  
HETATM 5343  O   HOH A 933      70.409  40.525  31.062  1.00 58.87           O  
HETATM 5344  O   HOH A 934      27.759  78.087  33.557  1.00 73.66           O  
HETATM 5345  O   HOH A 935      81.845  46.767  16.779  1.00 65.82           O  
HETATM 5346  O   HOH A 936      84.988  58.177  38.671  1.00 74.50           O  
HETATM 5347  O   HOH A 937      62.773  36.041  15.905  1.00 59.46           O  
HETATM 5348  O   HOH A 938      70.344  52.169  47.319  1.00 49.65           O  
HETATM 5349  O   HOH A 939      41.857  79.849  37.071  1.00 49.80           O  
HETATM 5350  O   HOH A 940      24.994  57.929  43.441  1.00 60.80           O  
HETATM 5351  O   HOH A 941      50.113  60.220  53.016  1.00 63.07           O  
HETATM 5352  O   HOH A 942      46.239  56.972   0.492  1.00 59.99           O  
HETATM 5353  O   HOH A 943      39.879  55.067  49.704  1.00 73.28           O  
HETATM 5354  O   HOH A 944      26.111  54.449  28.752  1.00 57.03           O  
HETATM 5355  O   HOH A 945      54.775  56.967   4.340  1.00 61.74           O  
HETATM 5356  O   HOH A 946      72.153  60.342  46.275  1.00 66.08           O  
HETATM 5357  O   HOH A 947      53.134  57.736  13.991  1.00 48.19           O  
HETATM 5358  O   HOH A 948      49.555  68.790  53.922  1.00 72.55           O  
HETATM 5359  O   HOH A 949      51.739  88.259  26.259  1.00 79.98           O  
HETATM 5360  O   HOH A 950      52.213  34.081  31.430  1.00 63.84           O  
HETATM 5361  O   HOH A 951      65.844  48.256   7.346  1.00 71.09           O  
HETATM 5362  O   HOH A 952      64.863  75.198  26.799  1.00 66.85           O  
HETATM 5363  O   HOH A 953      31.492  53.903  13.012  1.00 58.28           O  
HETATM 5364  O   HOH A 954      24.461  50.613  27.207  1.00 59.76           O  
HETATM 5365  O   HOH A 955      27.007  77.806  43.094  1.00 70.99           O  
HETATM 5366  O   HOH A 956      41.868  53.284  -6.602  1.00 57.98           O  
HETATM 5367  O   HOH A 957      58.040  62.627  23.195  1.00 64.39           O  
HETATM 5368  O   HOH A 958      65.016  46.682   9.036  1.00 66.25           O  
HETATM 5369  O   HOH A 959      70.529  59.644  43.463  1.00 53.55           O  
HETATM 5370  O   HOH A 960      71.269  40.701  25.519  1.00 59.46           O  
HETATM 5371  O   HOH A 961      49.902  34.171  24.421  1.00 61.07           O  
HETATM 5372  O   HOH A 962      50.667  60.933  28.224  1.00 78.35           O  
HETATM 5373  O   HOH A 963      51.329  57.974  21.458  1.00 70.98           O  
HETATM 5374  O   HOH A 964      52.486  60.730  10.855  1.00 61.69           O  
HETATM 5375  O   HOH A 965      64.842  45.025  47.712  1.00 65.36           O  
HETATM 5376  O   HOH A 966      59.347  68.279  31.632  1.00 84.08           O  
HETATM 5377  O   HOH A 967      61.101  65.479  33.734  1.00 61.87           O  
HETATM 5378  O   HOH A 968      65.074  57.108  19.054  1.00 50.02           O  
HETATM 5379  O   HOH A 969      78.228  85.212  23.471  1.00 69.92           O  
HETATM 5380  O   HOH A 970      30.920  42.782  33.024  1.00 54.44           O  
HETATM 5381  O   HOH A 971      77.831  77.058  47.710  1.00 58.48           O  
HETATM 5382  O   HOH A 972      44.478  40.324  37.445  1.00 85.49           O  
HETATM 5383  O   HOH A 973      32.451  68.440  37.089  1.00 72.35           O  
HETATM 5384  O   HOH A 974      21.636  58.266  43.064  1.00 73.94           O  
HETATM 5385  O   HOH A 975      73.304  58.653  44.870  1.00 54.41           O  
HETATM 5386  O   HOH A 976      44.331  48.636  30.917  1.00 46.41           O  
HETATM 5387  O   HOH A 977      68.246  73.633  33.453  1.00 61.30           O  
HETATM 5388  O   HOH A 978      64.697  57.922  30.829  1.00 55.82           O  
HETATM 5389  O   HOH A 979      69.129  64.105  42.774  1.00 59.06           O  
HETATM 5390  O   HOH A 980      30.144  68.298  39.068  1.00 91.36           O  
HETATM 5391  O   HOH A 981      65.973  50.540   4.905  1.00 83.51           O  
HETATM 5392  O   HOH A 982      63.255  82.147  39.889  1.00 58.93           O  
HETATM 5393  O   HOH A 983      45.550  58.314  51.691  1.00 74.27           O  
HETATM 5394  O   HOH A 984      62.018  85.619  11.305  1.00 71.76           O  
HETATM 5395  O   HOH A 985      54.690  55.423   2.307  1.00 66.27           O  
HETATM 5396  O   HOH A 986      60.357  86.512  12.731  1.00 62.54           O  
HETATM 5397  O   HOH A 987      24.308  77.573  34.760  1.00 72.86           O  
HETATM 5398  O   HOH A 988      64.856  58.312  22.698  1.00 57.82           O  
HETATM 5399  O   HOH A 989      36.595  69.273  38.401  1.00 59.92           O  
HETATM 5400  O   HOH A 990      65.220  35.544  15.787  1.00 65.55           O  
HETATM 5401  O   HOH A 991      87.132  75.793  27.808  1.00 66.73           O  
HETATM 5402  O   HOH A 992      61.720  64.570  31.403  1.00 75.12           O  
HETATM 5403  O   HOH A 993      47.724  58.952   3.967  1.00 59.78           O  
HETATM 5404  O   HOH A 994      77.652  78.309  50.014  1.00 59.28           O  
HETATM 5405  O   HOH A 995      56.347  62.044  27.559  1.00 73.36           O  
HETATM 5406  O   HOH A 996      60.842  36.174  14.318  1.00 65.60           O  
HETATM 5407  O   HOH A 997      41.877  82.798  38.557  1.00 61.93           O  
HETATM 5408  O   HOH A 998      59.302  34.198  30.587  1.00 63.04           O  
HETATM 5409  O   HOH A 999      66.796  61.022  39.326  1.00 60.57           O  
HETATM 5410  O   HOH A1000      34.923  60.352  49.350  1.00 55.44           O  
HETATM 5411  O   HOH A1001      63.501  86.884  30.694  1.00 63.55           O  
HETATM 5412  O   HOH A1002      81.083  81.037  40.126  1.00 67.67           O  
HETATM 5413  O   HOH A1003      41.382  49.075  44.316  1.00 49.22           O  
HETATM 5414  O   HOH A1004      40.145  68.938  42.405  1.00 54.35           O  
HETATM 5415  O   HOH A1005      35.042  51.223  21.065  1.00 50.47           O  
HETATM 5416  O   HOH A1006      20.849  50.902  29.218  1.00 68.64           O  
HETATM 5417  O   HOH A1007      88.516  74.027  26.129  1.00 69.15           O  
HETATM 5418  O   HOH A1008      70.171  39.507  28.876  1.00 83.15           O  
HETATM 5419  O   HOH A1009      56.158  68.918  55.561  1.00 74.77           O  
HETATM 5420  O   HOH A1010      58.619  53.560  44.474  1.00 46.94           O  
HETATM 5421  O   HOH A1011      71.140  80.911  19.205  1.00 68.19           O  
HETATM 5422  O   HOH A1012      71.171  54.774  22.374  1.00 56.66           O  
HETATM 5423  O   HOH A1013      51.139  66.969  54.223  1.00 62.23           O  
HETATM 5424  O   HOH A1014      82.385  45.940  19.910  1.00 87.37           O  
HETATM 5425  O   HOH A1015      67.018  71.043  51.645  1.00 61.76           O  
HETATM 5426  O   HOH A1016      84.537  72.320  33.393  1.00 54.10           O  
HETATM 5427  O   HOH A1017      39.903  74.318  50.458  1.00 64.07           O  
HETATM 5428  O   HOH A1018      75.016  77.437  12.620  1.00 79.40           O  
HETATM 5429  O   HOH A1019      80.554  47.024  22.859  1.00 78.45           O  
HETATM 5430  O   HOH A1020      47.108  34.476  30.620  1.00 54.70           O  
HETATM 5431  O   HOH A1021      22.781  50.543  24.772  1.00 79.88           O  
HETATM 5432  O   HOH A1022      42.967  83.252  20.945  1.00 61.38           O  
HETATM 5433  O   HOH A1023      48.562  46.622   4.328  1.00 69.07           O  
HETATM 5434  O   HOH A1024      49.981  62.811   8.853  1.00 56.61           O  
HETATM 5435  O   HOH A1025      29.783  62.538  22.483  1.00 69.69           O  
HETATM 5436  O   HOH A1026      28.143  73.750  31.414  1.00 73.32           O  
HETATM 5437  O   HOH A1027      78.514  55.246  33.641  1.00 67.88           O  
HETATM 5438  O   HOH A1028      63.429  81.933  43.894  1.00 65.22           O  
HETATM 5439  O   HOH A1029      75.608  59.657  56.377  1.00 76.63           O  
HETATM 5440  O   HOH A1030      64.173  64.504  36.464  1.00 61.39           O  
HETATM 5441  O   HOH A1031      19.073  58.176  45.922  1.00 70.24           O  
HETATM 5442  O   HOH A1032      58.371  63.971  30.280  1.00 86.31           O  
HETATM 5443  O   HOH A1033      35.715  53.902  20.984  1.00 60.42           O  
HETATM 5444  O   HOH A1034      69.183  60.973  38.327  1.00 77.79           O  
HETATM 5445  O   HOH A1035      47.458  62.001  22.855  1.00 88.67           O  
HETATM 5446  O   HOH A1036      49.002  62.021  20.498  1.00 91.95           O  
HETATM 5447  O   HOH A1037      54.957  69.157  26.880  1.00 63.39           O  
HETATM 5448  O   HOH A1038      25.831  51.234  22.921  1.00 63.71           O  
HETATM 5449  O   HOH A1039      52.549  60.220  22.824  1.00 67.65           O  
HETATM 5450  O   HOH A1040      64.801  70.333  52.358  1.00 64.23           O  
HETATM 5451  O   HOH A1041      47.884  58.791  52.640  1.00 72.12           O  
HETATM 5452  O   HOH A1042      41.553  66.796  42.894  1.00 69.79           O  
HETATM 5453  O   HOH A1043      48.262  69.620  19.906  1.00 71.58           O  
HETATM 5454  O   HOH A1044      65.495  59.414  20.419  1.00 63.83           O  
HETATM 5455  O   HOH A1045      34.117  72.078  43.698  1.00 67.02           O  
HETATM 5456  O   HOH A1046      46.696  60.619  32.537  1.00 62.80           O  
HETATM 5457  O   HOH A1047      21.286  57.008  45.217  1.00 68.21           O  
HETATM 5458  O   HOH A1048      24.370  78.200  32.372  1.00 78.20           O  
HETATM 5459  O   HOH A1049      53.711  57.598   0.794  1.00 75.91           O  
HETATM 5460  O   HOH A1050      64.086  73.105  33.867  1.00 50.83           O  
HETATM 5461  O   HOH A1051      85.750  74.011  30.997  1.00 69.81           O  
HETATM 5462  O   HOH A1052      50.130  65.143  28.336  1.00 68.61           O  
HETATM 5463  O   HOH A1053      41.236  61.511  50.158  1.00 71.44           O  
HETATM 5464  O   HOH A1054      71.331  40.191  35.590  1.00 76.34           O  
HETATM 5465  O   HOH A1055      81.522  77.949  48.219  1.00 74.22           O  
HETATM 5466  O   HOH A1056      34.219  69.586  29.172  1.00 76.89           O  
HETATM 5467  O   HOH A1057      44.864  45.598   4.876  1.00 75.13           O  
HETATM 5468  O   HOH A1058      62.114  28.853  25.134  1.00 59.96           O  
HETATM 5469  O   HOH A1059      67.043  56.948  21.619  1.00 56.99           O  
HETATM 5470  O   HOH A1060      22.894  60.015  46.558  1.00 85.20           O  
HETATM 5471  O   HOH A1061      58.168  40.495  40.929  1.00 71.80           O  
HETATM 5472  O   HOH A1062      86.152  56.882  37.006  1.00 91.54           O  
HETATM 5473  O   HOH A1063      73.783  60.244  58.948  1.00 77.11           O  
HETATM 5474  O   HOH A1064      74.313  77.417  15.187  1.00 82.96           O  
HETATM 5475  O   HOH A1065      89.774  55.526  29.276  1.00 95.40           O  
HETATM 5476  O   HOH A1066      27.048  38.360  40.328  1.00 97.41           O  
HETATM 5477  O   HOH A1067      37.715  75.020  52.876  1.00 61.94           O  
HETATM 5478  O   HOH A1068      47.137  32.593  28.242  1.00 55.58           O  
HETATM 5479  O   HOH A1069      91.698  56.387  31.226  1.00 82.40           O  
HETATM 5480  O   HOH A1070      49.749  58.028  31.237  1.00 60.93           O  
HETATM 5481  O   HOH A1071      61.513  83.215  41.395  1.00 72.30           O  
HETATM 5482  O   HOH A1072      78.126  45.325  34.785  1.00 67.08           O  
HETATM 5483  O   HOH A1073      27.958  75.478  40.160  1.00 71.91           O  
HETATM 5484  O   HOH A1074      74.742  37.924  28.056  1.00 90.85           O  
HETATM 5485  O   HOH A1075      45.212  66.670  35.828  1.00 59.73           O  
HETATM 5486  O   HOH A1076      91.840  69.250  38.497  1.00 82.85           O  
HETATM 5487  O   HOH A1077      28.026  41.803  32.921  1.00 64.18           O  
HETATM 5488  O   HOH A1078      73.866  80.525  18.321  1.00 81.88           O  
HETATM 5489  O   HOH A1079      92.440  53.890  29.601  1.00 96.77           O  
HETATM 5490  O   HOH A1080      39.065  53.570  -6.937  1.00 72.48           O  
HETATM 5491  O   HOH A1081      66.406  34.773  23.663  1.00 65.76           O  
HETATM 5492  O   HOH A1082      58.708  65.814  32.551  1.00 66.63           O  
HETATM 5493  O   HOH A1083      30.692  64.896  27.635  1.00 70.58           O  
HETATM 5494  O   HOH A1084      62.005  85.371  32.028  1.00 64.44           O  
HETATM 5495  O   HOH A1085      54.002  61.200  20.847  1.00 74.90           O  
HETATM 5496  O   HOH A1086      37.897  63.660  33.066  1.00 58.39           O  
HETATM 5497  O   HOH A1087      44.860  39.542  40.569  1.00 68.12           O  
HETATM 5498  O   HOH A1088      72.057  51.503  45.856  1.00 66.96           O  
HETATM 5499  O   HOH A1089      77.930  72.951  43.817  1.00 64.03           O  
HETATM 5500  O   HOH A1090      29.775  39.843  33.490  1.00 63.01           O  
HETATM 5501  O   HOH A1091      73.124  53.371  49.495  1.00 62.82           O  
HETATM 5502  O   HOH A1092      36.787  65.792  55.265  1.00 67.90           O  
HETATM 5503  O   HOH A1093      66.448  64.080  43.072  1.00 66.62           O  
HETATM 5504  O   HOH A1094      32.890  39.996  12.704  1.00 63.72           O  
HETATM 5505  O   HOH A1095      45.812  71.489  42.965  1.00 61.37           O  
HETATM 5506  O   HOH A1096      66.114  77.327  44.428  1.00 53.30           O  
HETATM 5507  O   HOH A1097      35.899  55.129  10.026  1.00 68.52           O  
HETATM 5508  O   HOH A1098      43.008  54.626  50.894  1.00 65.05           O  
HETATM 5509  O   HOH A1099      46.778  68.598  33.536  1.00 73.55           O  
HETATM 5510  O   HOH A1100      30.015  43.919  42.999  1.00 65.14           O  
HETATM 5511  O   HOH A1101      33.606  59.134  23.909  1.00 63.25           O  
HETATM 5512  O   HOH A1102      63.331  55.574  51.305  1.00 65.39           O  
HETATM 5513  O   HOH C 288      34.040  35.595   5.900  1.00 59.04           O  
HETATM 5514  O   HOH E 112      45.335  30.577  -3.627  1.00 70.66           O  
HETATM 5515  O   HOH E 190      50.009  31.161   0.595  1.00 77.36           O  
HETATM 5516  O   HOH E 235      49.599  33.863   1.879  1.00 65.45           O  
CONECT  592 5171                                                                
CONECT  696 5185                                                                
CONECT  919  981                                                                
CONECT  981  919                                                                
CONECT 2653 2789                                                                
CONECT 2789 2653                                                                
CONECT 2894 5214                                                                
CONECT 2925 5214                                                                
CONECT 3118 5214                                                                
CONECT 3119 5214                                                                
CONECT 4186 4277                                                                
CONECT 4277 4186                                                                
CONECT 4307 5199                                                                
CONECT 5171  592 5172 5182                                                      
CONECT 5172 5171 5173 5179                                                      
CONECT 5173 5172 5174 5180                                                      
CONECT 5174 5173 5175 5181                                                      
CONECT 5175 5174 5176 5182                                                      
CONECT 5176 5175 5183                                                           
CONECT 5177 5178 5179 5184                                                      
CONECT 5178 5177                                                                
CONECT 5179 5172 5177                                                           
CONECT 5180 5173                                                                
CONECT 5181 5174                                                                
CONECT 5182 5171 5175                                                           
CONECT 5183 5176                                                                
CONECT 5184 5177                                                                
CONECT 5185  696 5186 5196                                                      
CONECT 5186 5185 5187 5193                                                      
CONECT 5187 5186 5188 5194                                                      
CONECT 5188 5187 5189 5195                                                      
CONECT 5189 5188 5190 5196                                                      
CONECT 5190 5189 5197                                                           
CONECT 5191 5192 5193 5198                                                      
CONECT 5192 5191                                                                
CONECT 5193 5186 5191                                                           
CONECT 5194 5187                                                                
CONECT 5195 5188                                                                
CONECT 5196 5185 5189                                                           
CONECT 5197 5190                                                                
CONECT 5198 5191                                                                
CONECT 5199 4307 5200 5210                                                      
CONECT 5200 5199 5201 5207                                                      
CONECT 5201 5200 5202 5208                                                      
CONECT 5202 5201 5203 5209                                                      
CONECT 5203 5202 5204 5210                                                      
CONECT 5204 5203 5211                                                           
CONECT 5205 5206 5207 5212                                                      
CONECT 5206 5205                                                                
CONECT 5207 5200 5205                                                           
CONECT 5208 5201                                                                
CONECT 5209 5202                                                                
CONECT 5210 5199 5203                                                           
CONECT 5211 5204                                                                
CONECT 5212 5205                                                                
CONECT 5214 2894 2925 3118 3119                                                 
CONECT 5214 5233                                                                
CONECT 5233 5214                                                                
MASTER      434    0    5   33    8    0    7    6 5511    5   58   55          
END                                                                             


A second structure was input as follows:


HEADER    IMMUNE SYSTEM                           30-APR-04   1T4Q              
TITLE     INTERLEUKIN 1 BETA F101W                                              
COMPND    MOL_ID: 1;                                                            
COMPND   2 MOLECULE: INTERLEUKIN-1 BETA;                                        
COMPND   3 CHAIN: A;                                                            
COMPND   4 SYNONYM: IL-1 BETA, CATABOLIN;                                       
COMPND   5 ENGINEERED: YES;                                                     
COMPND   6 MUTATION: YES                                                        
SOURCE    MOL_ID: 1;                                                            
SOURCE   2 ORGANISM_SCIENTIFIC: HOMO SAPIENS;                                   
SOURCE   3 ORGANISM_COMMON: HUMAN;                                              
SOURCE   4 ORGANISM_TAXID: 9606;                                                
SOURCE   5 GENE: IL1B;                                                          
SOURCE   6 EXPRESSION_SYSTEM: ESCHERICHIA COLI BL21(DE3);                       
SOURCE   7 EXPRESSION_SYSTEM_TAXID: 469008;                                     
SOURCE   8 EXPRESSION_SYSTEM_STRAIN: BL-21(DE3);                                
SOURCE   9 EXPRESSION_SYSTEM_VECTOR_TYPE: PLASMID;                              
SOURCE  10 EXPRESSION_SYSTEM_PLASMID: PET 21A(+)                                
KEYWDS    HYDRATION CAVITY, IL1B, IL-1B, IMMUNE SYSTEM                          
EXPDTA    X-RAY DIFFRACTION                                                     
AUTHOR    D.H.ADAMEK,L.GUERRERO,D.L.CASPAR                                      
REVDAT   3   24-FEB-09 1T4Q    1       VERSN                                    
REVDAT   2   01-MAR-05 1T4Q    1       JRNL                                     
REVDAT   1   07-DEC-04 1T4Q    0                                                
JRNL        AUTH   D.H.ADAMEK,L.GUERRERO,M.BLABER,D.L.CASPAR                    
JRNL        TITL   STRUCTURAL AND ENERGETIC CONSEQUENCES OF MUTATIONS           
JRNL        TITL 2 IN A SOLVATED HYDROPHOBIC CAVITY.                            
JRNL        REF    J.MOL.BIOL.                   V. 346   307 2005              
JRNL        REFN                   ISSN 0022-2836                               
JRNL        PMID   15663946                                                     
JRNL        DOI    10.1016/J.JMB.2004.11.046                                    
REMARK   1                                                                      
REMARK   2                                                                      
REMARK   2 RESOLUTION.    2.10 ANGSTROMS.                                       
REMARK   3                                                                      
REMARK   3 REFINEMENT.                                                          
REMARK   3   PROGRAM     : CNS 1.0                                              
REMARK   3   AUTHORS     : BRUNGER,ADAMS,CLORE,DELANO,GROS,GROSSE-              
REMARK   3               : KUNSTLEVE,JIANG,KUSZEWSKI,NILGES, PANNU,             
REMARK   3               : READ,RICE,SIMONSON,WARREN                            
REMARK   3                                                                      
REMARK   3  REFINEMENT TARGET : ENGH & HUBER                                    
REMARK   3                                                                      
REMARK   3  DATA USED IN REFINEMENT.                                            
REMARK   3   RESOLUTION RANGE HIGH (ANGSTROMS) : 2.10                           
REMARK   3   RESOLUTION RANGE LOW  (ANGSTROMS) : 55.11                          
REMARK   3   DATA CUTOFF            (SIGMA(F)) : 2.000                          
REMARK   3   DATA CUTOFF HIGH         (ABS(F)) : NULL                           
REMARK   3   DATA CUTOFF LOW          (ABS(F)) : NULL                           
REMARK   3   COMPLETENESS (WORKING+TEST)   (%) : 99.9                           
REMARK   3   NUMBER OF REFLECTIONS             : 13419                          
REMARK   3                                                                      
REMARK   3  FIT TO DATA USED IN REFINEMENT.                                     
REMARK   3   CROSS-VALIDATION METHOD          : NULL                            
REMARK   3   FREE R VALUE TEST SET SELECTION  : RANDOM                          
REMARK   3   R VALUE            (WORKING SET) : 0.182                           
REMARK   3   FREE R VALUE                     : 0.209                           
REMARK   3   FREE R VALUE TEST SET SIZE   (%) : NULL                            
REMARK   3   FREE R VALUE TEST SET COUNT      : 664                             
REMARK   3   ESTIMATED ERROR OF FREE R VALUE  : NULL                            
REMARK   3                                                                      
REMARK   3  FIT IN THE HIGHEST RESOLUTION BIN.                                  
REMARK   3   TOTAL NUMBER OF BINS USED           : NULL                         
REMARK   3   BIN RESOLUTION RANGE HIGH       (A) : NULL                         
REMARK   3   BIN RESOLUTION RANGE LOW        (A) : NULL                         
REMARK   3   BIN COMPLETENESS (WORKING+TEST) (%) : NULL                         
REMARK   3   REFLECTIONS IN BIN    (WORKING SET) : NULL                         
REMARK   3   BIN R VALUE           (WORKING SET) : NULL                         
REMARK   3   BIN FREE R VALUE                    : NULL                         
REMARK   3   BIN FREE R VALUE TEST SET SIZE  (%) : NULL                         
REMARK   3   BIN FREE R VALUE TEST SET COUNT     : NULL                         
REMARK   3   ESTIMATED ERROR OF BIN FREE R VALUE : NULL                         
REMARK   3                                                                      
REMARK   3  NUMBER OF NON-HYDROGEN ATOMS USED IN REFINEMENT.                    
REMARK   3   PROTEIN ATOMS            : 1222                                    
REMARK   3   NUCLEIC ACID ATOMS       : 0                                       
REMARK   3   HETEROGEN ATOMS          : 0                                       
REMARK   3   SOLVENT ATOMS            : 92                                      
REMARK   3                                                                      
REMARK   3  B VALUES.                                                           
REMARK   3   FROM WILSON PLOT           (A**2) : NULL                           
REMARK   3   MEAN B VALUE      (OVERALL, A**2) : NULL                           
REMARK   3   OVERALL ANISOTROPIC B VALUE.                                       
REMARK   3    B11 (A**2) : NULL                                                 
REMARK   3    B22 (A**2) : NULL                                                 
REMARK   3    B33 (A**2) : NULL                                                 
REMARK   3    B12 (A**2) : NULL                                                 
REMARK   3    B13 (A**2) : NULL                                                 
REMARK   3    B23 (A**2) : NULL                                                 
REMARK   3                                                                      
REMARK   3  ESTIMATED COORDINATE ERROR.                                         
REMARK   3   ESD FROM LUZZATI PLOT        (A) : NULL                            
REMARK   3   ESD FROM SIGMAA              (A) : NULL                            
REMARK   3   LOW RESOLUTION CUTOFF        (A) : NULL                            
REMARK   3                                                                      
REMARK   3  CROSS-VALIDATED ESTIMATED COORDINATE ERROR.                         
REMARK   3   ESD FROM C-V LUZZATI PLOT    (A) : NULL                            
REMARK   3   ESD FROM C-V SIGMAA          (A) : NULL                            
REMARK   3                                                                      
REMARK   3  RMS DEVIATIONS FROM IDEAL VALUES.                                   
REMARK   3   BOND LENGTHS                 (A) : NULL                            
REMARK   3   BOND ANGLES            (DEGREES) : NULL                            
REMARK   3   DIHEDRAL ANGLES        (DEGREES) : NULL                            
REMARK   3   IMPROPER ANGLES        (DEGREES) : NULL                            
REMARK   3                                                                      
REMARK   3  ISOTROPIC THERMAL MODEL : NULL                                      
REMARK   3                                                                      
REMARK   3  ISOTROPIC THERMAL FACTOR RESTRAINTS.    RMS    SIGMA                
REMARK   3   MAIN-CHAIN BOND              (A**2) : NULL  ; NULL                 
REMARK   3   MAIN-CHAIN ANGLE             (A**2) : NULL  ; NULL                 
REMARK   3   SIDE-CHAIN BOND              (A**2) : NULL  ; NULL                 
REMARK   3   SIDE-CHAIN ANGLE             (A**2) : NULL  ; NULL                 
REMARK   3                                                                      
REMARK   3  BULK SOLVENT MODELING.                                              
REMARK   3   METHOD USED : NULL                                                 
REMARK   3   KSOL        : NULL                                                 
REMARK   3   BSOL        : NULL                                                 
REMARK   3                                                                      
REMARK   3  NCS MODEL : NULL                                                    
REMARK   3                                                                      
REMARK   3  NCS RESTRAINTS.                         RMS   SIGMA/WEIGHT          
REMARK   3   GROUP  1  POSITIONAL            (A) : NULL  ; NULL                 
REMARK   3   GROUP  1  B-FACTOR           (A**2) : NULL  ; NULL                 
REMARK   3                                                                      
REMARK   3  PARAMETER FILE  1  : NULL                                           
REMARK   3  TOPOLOGY FILE  1   : NULL                                           
REMARK   3                                                                      
REMARK   3  OTHER REFINEMENT REMARKS: NULL                                      
REMARK   4                                                                      
REMARK   4 1T4Q COMPLIES WITH FORMAT V. 3.15, 01-DEC-08                         
REMARK 100                                                                      
REMARK 100 THIS ENTRY HAS BEEN PROCESSED BY RCSB ON 04-MAY-04.                  
REMARK 100 THE RCSB ID CODE IS RCSB022309.                                      
REMARK 200                                                                      
REMARK 200 EXPERIMENTAL DETAILS                                                 
REMARK 200  EXPERIMENT TYPE                : X-RAY DIFFRACTION                  
REMARK 200  DATE OF DATA COLLECTION        : 01-FEB-00                          
REMARK 200  TEMPERATURE           (KELVIN) : 298                                
REMARK 200  PH                             : 7.4                                
REMARK 200  NUMBER OF CRYSTALS USED        : NULL                               
REMARK 200                                                                      
REMARK 200  SYNCHROTRON              (Y/N) : N                                  
REMARK 200  RADIATION SOURCE               : ROTATING ANODE                     
REMARK 200  BEAMLINE                       : NULL                               
REMARK 200  X-RAY GENERATOR MODEL          : RIGAKU                             
REMARK 200  MONOCHROMATIC OR LAUE    (M/L) : M                                  
REMARK 200  WAVELENGTH OR RANGE        (A) : 1.5418                             
REMARK 200  MONOCHROMATOR                  : NULL                               
REMARK 200  OPTICS                         : NULL                               
REMARK 200                                                                      
REMARK 200  DETECTOR TYPE                  : IMAGE PLATE                        
REMARK 200  DETECTOR MANUFACTURER          : RIGAKU RAXIS II                    
REMARK 200  INTENSITY-INTEGRATION SOFTWARE : DENZO                              
REMARK 200  DATA SCALING SOFTWARE          : SCALEPACK                          
REMARK 200                                                                      
REMARK 200  NUMBER OF UNIQUE REFLECTIONS   : 13419                              
REMARK 200  RESOLUTION RANGE HIGH      (A) : 2.100                              
REMARK 200  RESOLUTION RANGE LOW       (A) : 55.110                             
REMARK 200  REJECTION CRITERIA  (SIGMA(I)) : 2.000                              
REMARK 200                                                                      
REMARK 200 OVERALL.                                                             
REMARK 200  COMPLETENESS FOR RANGE     (%) : 99.9                               
REMARK 200  DATA REDUNDANCY                : NULL                               
REMARK 200  R MERGE                    (I) : NULL                               
REMARK 200  R SYM                      (I) : NULL                               
REMARK 200   FOR THE DATA SET  : NULL                               
REMARK 200                                                                      
REMARK 200 IN THE HIGHEST RESOLUTION SHELL.                                     
REMARK 200  HIGHEST RESOLUTION SHELL, RANGE HIGH (A) : NULL                     
REMARK 200  HIGHEST RESOLUTION SHELL, RANGE LOW  (A) : NULL                     
REMARK 200  COMPLETENESS FOR SHELL     (%) : NULL                               
REMARK 200  DATA REDUNDANCY IN SHELL       : NULL                               
REMARK 200  R MERGE FOR SHELL          (I) : NULL                               
REMARK 200  R SYM FOR SHELL            (I) : NULL                               
REMARK 200   FOR SHELL         : NULL                               
REMARK 200                                                                      
REMARK 200 DIFFRACTION PROTOCOL: SINGLE WAVELENGTH                              
REMARK 200 METHOD USED TO DETERMINE THE STRUCTURE: MOLECULAR REPLACEMENT        
REMARK 200 SOFTWARE USED: CNS                                                   
REMARK 200 STARTING MODEL: NULL                                                 
REMARK 200                                                                      
REMARK 200 REMARK: NULL                                                         
REMARK 280                                                                      
REMARK 280 CRYSTAL                                                              
REMARK 280 SOLVENT CONTENT, VS   (%): 63.19                                     
REMARK 280 MATTHEWS COEFFICIENT, VM (ANGSTROMS**3/DA): 3.35                     
REMARK 280                                                                      
REMARK 280 CRYSTALLIZATION CONDITIONS: 29% AMMONIUM SULFATE W/V, 100 MM,        
REMARK 280  PH 7.4, VAPOR DIFFUSION, HANGING DROP, TEMPERATURE 298K             
REMARK 290                                                                      
REMARK 290 CRYSTALLOGRAPHIC SYMMETRY                                            
REMARK 290 SYMMETRY OPERATORS FOR SPACE GROUP: P 43                             
REMARK 290                                                                      
REMARK 290      SYMOP   SYMMETRY                                                
REMARK 290     NNNMMM   OPERATOR                                                
REMARK 290       1555   X,Y,Z                                                   
REMARK 290       2555   -X,-Y,Z+1/2                                             
REMARK 290       3555   -Y,X,Z+3/4                                              
REMARK 290       4555   Y,-X,Z+1/4                                              
REMARK 290                                                                      
REMARK 290     WHERE NNN -> OPERATOR NUMBER                                     
REMARK 290           MMM -> TRANSLATION VECTOR                                  
REMARK 290                                                                      
REMARK 290 CRYSTALLOGRAPHIC SYMMETRY TRANSFORMATIONS                            
REMARK 290 THE FOLLOWING TRANSFORMATIONS OPERATE ON THE ATOM/HETATM             
REMARK 290 RECORDS IN THIS ENTRY TO PRODUCE CRYSTALLOGRAPHICALLY                
REMARK 290 RELATED MOLECULES.                                                   
REMARK 290   SMTRY1   1  1.000000  0.000000  0.000000        0.00000            
REMARK 290   SMTRY2   1  0.000000  1.000000  0.000000        0.00000            
REMARK 290   SMTRY3   1  0.000000  0.000000  1.000000        0.00000            
REMARK 290   SMTRY1   2 -1.000000  0.000000  0.000000        0.00000            
REMARK 290   SMTRY2   2  0.000000 -1.000000  0.000000        0.00000            
REMARK 290   SMTRY3   2  0.000000  0.000000  1.000000       38.36000            
REMARK 290   SMTRY1   3  0.000000 -1.000000  0.000000        0.00000            
REMARK 290   SMTRY2   3  1.000000  0.000000  0.000000        0.00000            
REMARK 290   SMTRY3   3  0.000000  0.000000  1.000000       57.54000            
REMARK 290   SMTRY1   4  0.000000  1.000000  0.000000        0.00000            
REMARK 290   SMTRY2   4 -1.000000  0.000000  0.000000        0.00000            
REMARK 290   SMTRY3   4  0.000000  0.000000  1.000000       19.18000            
REMARK 290                                                                      
REMARK 290 REMARK: NULL                                                         
REMARK 300                                                                      
REMARK 300 BIOMOLECULE: 1                                                       
REMARK 300 SEE REMARK 350 FOR THE AUTHOR PROVIDED AND/OR PROGRAM                
REMARK 300 GENERATED ASSEMBLY INFORMATION FOR THE STRUCTURE IN                  
REMARK 300 THIS ENTRY. THE REMARK MAY ALSO PROVIDE INFORMATION ON               
REMARK 300 BURIED SURFACE AREA.                                                 
REMARK 350                                                                      
REMARK 350 COORDINATES FOR A COMPLETE MULTIMER REPRESENTING THE KNOWN           
REMARK 350 BIOLOGICALLY SIGNIFICANT OLIGOMERIZATION STATE OF THE                
REMARK 350 MOLECULE CAN BE GENERATED BY APPLYING BIOMT TRANSFORMATIONS          
REMARK 350 GIVEN BELOW.  BOTH NON-CRYSTALLOGRAPHIC AND                          
REMARK 350 CRYSTALLOGRAPHIC OPERATIONS ARE GIVEN.                               
REMARK 350                                                                      
REMARK 350 BIOMOLECULE: 1                                                       
REMARK 350 AUTHOR DETERMINED BIOLOGICAL UNIT: MONOMERIC                         
REMARK 350 APPLY THE FOLLOWING TO CHAINS: A                                     
REMARK 350   BIOMT1   1  1.000000  0.000000  0.000000        0.00000            
REMARK 350   BIOMT2   1  0.000000  1.000000  0.000000        0.00000            
REMARK 350   BIOMT3   1  0.000000  0.000000  1.000000        0.00000            
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: TORSION ANGLES                                             
REMARK 500                                                                      
REMARK 500 TORSION ANGLES OUTSIDE THE EXPECTED RAMACHANDRAN REGIONS:            
REMARK 500 (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN IDENTIFIER;               
REMARK 500 SSEQ=SEQUENCE NUMBER; I=INSERTION CODE).                             
REMARK 500                                                                      
REMARK 500 STANDARD TABLE:                                                      
REMARK 500 FORMAT:(10X,I3,1X,A3,1X,A1,I4,A1,4X,F7.2,3X,F7.2)                    
REMARK 500                                                                      
REMARK 500 EXPECTED VALUES: GJ KLEYWEGT AND TA JONES (1996). PHI/PSI-           
REMARK 500 CHOLOGY: RAMACHANDRAN REVISITED. STRUCTURE 4, 1395 - 1400            
REMARK 500                                                                      
REMARK 500  M RES CSSEQI        PSI       PHI                                   
REMARK 500    SER A  21      -88.39    -85.25                                   
REMARK 500    ILE A 106     -135.28   -113.80                                   
REMARK 500    ASN A 107      -83.05    -28.20                                   
REMARK 500    SER A 152      -13.34    -41.14                                   
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 900                                                                      
REMARK 900 RELATED ENTRIES                                                      
REMARK 900 RELATED ID: 1S0L   RELATED DB: PDB                                   
REMARK 900 SAME PROTEIN, DIFFERENT MUTATION                                     
REMARK 900 RELATED ID: 9ILB   RELATED DB: PDB                                   
REMARK 900 USED AS STARTING MODEL                                               
DBREF  1T4Q A    1   153  UNP    P01584   IL1B_HUMAN     117    269             
SEQADV 1T4Q TRP A  101  UNP  P01584    PHE   217 ENGINEERED                     
SEQRES   1 A  153  ALA PRO VAL ARG SER LEU ASN CYS THR LEU ARG ASP SER          
SEQRES   2 A  153  GLN GLN LYS SER LEU VAL MET SER GLY PRO TYR GLU LEU          
SEQRES   3 A  153  LYS ALA LEU HIS LEU GLN GLY GLN ASP MET GLU GLN GLN          
SEQRES   4 A  153  VAL VAL PHE SER MET SER PHE VAL GLN GLY GLU GLU SER          
SEQRES   5 A  153  ASN ASP LYS ILE PRO VAL ALA LEU GLY LEU LYS GLU LYS          
SEQRES   6 A  153  ASN LEU TYR LEU SER CYS VAL LEU LYS ASP ASP LYS PRO          
SEQRES   7 A  153  THR LEU GLN LEU GLU SER VAL ASP PRO LYS ASN TYR PRO          
SEQRES   8 A  153  LYS LYS LYS MET GLU LYS ARG PHE VAL TRP ASN LYS ILE          
SEQRES   9 A  153  GLU ILE ASN ASN LYS LEU GLU PHE GLU SER ALA GLN PHE          
SEQRES  10 A  153  PRO ASN TRP TYR ILE SER THR SER GLN ALA GLU ASN MET          
SEQRES  11 A  153  PRO VAL PHE LEU GLY GLY THR LYS GLY GLY GLN ASP ILE          
SEQRES  12 A  153  THR ASP PHE THR MET GLN PHE VAL SER SER                      
FORMUL   2  HOH   *92(H2 O)                                                     
HELIX    1   1 GLN A   32  GLN A   39  5                                   8    
HELIX    2   2 GLU A   96  PHE A   99  5                                   4    
SHEET    1   A 7 SER A   5  ASP A  12  0                                        
SHEET    2   A 7 PHE A  42  PHE A  46 -1  O  PHE A  42   N  CYS A   8           
SHEET    3   A 7 LYS A  55  LEU A  62 -1  O  GLY A  61   N  SER A  43           
SHEET    4   A 7 TRP A 101  GLU A 105 -1  O  LYS A 103   N  ILE A  56           
SHEET    5   A 7 LEU A 110  SER A 114 -1  O  GLU A 113   N  ASN A 102           
SHEET    6   A 7 PHE A 146  PHE A 150 -1  O  PHE A 146   N  LEU A 110           
SHEET    7   A 7 SER A   5  ASP A  12 -1  N  THR A   9   O  GLN A 149           
SHEET    1   B 3 SER A  17  MET A  20  0                                        
SHEET    2   B 3 LEU A  26  LEU A  29 -1  O  LYS A  27   N  VAL A  19           
SHEET    3   B 3 MET A 130  PRO A 131 -1  O  MET A 130   N  ALA A  28           
SHEET    1   C 2 LEU A  67  LEU A  73  0                                        
SHEET    2   C 2 PRO A  78  SER A  84 -1  O  GLN A  81   N  SER A  70           
SHEET    1   D 2 TYR A 121  SER A 123  0                                        
SHEET    2   D 2 PHE A 133  GLY A 135 -1  O  PHE A 133   N  SER A 123           
CISPEP   1 TYR A   90    PRO A   91          0        -0.12                     
CRYST1   55.110   55.110   76.720  90.00  90.00  90.00 P 43          4          
ORIGX1      1.000000  0.000000  0.000000        0.00000                         
ORIGX2      0.000000  1.000000  0.000000        0.00000                         
ORIGX3      0.000000  0.000000  1.000000        0.00000                         
SCALE1      0.018146  0.000000  0.000000        0.00000                         
SCALE2      0.000000  0.018146  0.000000        0.00000                         
SCALE3      0.000000  0.000000  0.013034        0.00000                         
ATOM      1  N   ALA A   1     -19.364  20.175 -23.254  1.00129.34           N  
ATOM      2  CA  ALA A   1     -19.665  18.768 -22.861  1.00130.04           C  
ATOM      3  C   ALA A   1     -20.960  18.713 -22.057  1.00128.32           C  
ATOM      4  O   ALA A   1     -21.276  19.642 -21.314  1.00130.87           O  
ATOM      5  CB  ALA A   1     -18.511  18.202 -22.036  1.00 84.67           C  
ATOM      6  N   PRO A   2     -21.733  17.621 -22.203  1.00108.15           N  
ATOM      7  CA  PRO A   2     -22.998  17.462 -21.477  1.00103.24           C  
ATOM      8  C   PRO A   2     -22.833  17.867 -20.016  1.00 96.97           C  
ATOM      9  O   PRO A   2     -23.463  18.816 -19.549  1.00 97.76           O  
ATOM     10  CB  PRO A   2     -23.299  15.978 -21.645  1.00 90.56           C  
ATOM     11  CG  PRO A   2     -22.778  15.706 -23.022  1.00 92.72           C  
ATOM     12  CD  PRO A   2     -21.445  16.429 -23.021  1.00 93.43           C  
ATOM     13  N   VAL A   3     -21.981  17.142 -19.299  1.00 52.64           N  
ATOM     14  CA  VAL A   3     -21.714  17.454 -17.901  1.00 44.36           C  
ATOM     15  C   VAL A   3     -20.264  17.906 -17.807  1.00 38.54           C  
ATOM     16  O   VAL A   3     -19.378  17.280 -18.381  1.00 35.08           O  
ATOM     17  CB  VAL A   3     -21.936  16.226 -16.978  1.00 40.50           C  
ATOM     18  CG1 VAL A   3     -21.009  15.091 -17.366  1.00 40.37           C  
ATOM     19  CG2 VAL A   3     -21.713  16.625 -15.529  1.00 40.92           C  
ATOM     20  N   ARG A   4     -20.025  19.006 -17.104  1.00 36.71           N  
ATOM     21  CA  ARG A   4     -18.670  19.515 -16.958  1.00 34.11           C  
ATOM     22  C   ARG A   4     -18.004  18.942 -15.717  1.00 31.74           C  
ATOM     23  O   ARG A   4     -18.613  18.864 -14.649  1.00 29.39           O  
ATOM     24  CB  ARG A   4     -18.672  21.045 -16.890  1.00 36.00           C  
ATOM     25  CG  ARG A   4     -18.994  21.709 -18.225  1.00 39.69           C  
ATOM     26  CD  ARG A   4     -18.684  23.201 -18.199  1.00 39.01           C  
ATOM     27  NE  ARG A   4     -19.593  23.931 -17.326  1.00 36.10           N  
ATOM     28  CZ  ARG A   4     -19.422  25.196 -16.952  1.00 36.16           C  
ATOM     29  NH1 ARG A   4     -18.364  25.886 -17.370  1.00 24.16           N  
ATOM     30  NH2 ARG A   4     -20.316  25.772 -16.159  1.00 37.71           N  
ATOM     31  N   SER A   5     -16.750  18.537 -15.870  1.00 33.17           N  
ATOM     32  CA  SER A   5     -16.000  17.958 -14.767  1.00 33.90           C  
ATOM     33  C   SER A   5     -14.602  18.550 -14.704  1.00 33.29           C  
ATOM     34  O   SER A   5     -14.120  19.138 -15.670  1.00 33.53           O  
ATOM     35  CB  SER A   5     -15.885  16.442 -14.948  1.00 36.81           C  
ATOM     36  OG  SER A   5     -17.160  15.845 -15.128  1.00 41.53           O  
ATOM     37  N   LEU A   6     -13.959  18.397 -13.554  1.00 33.97           N  
ATOM     38  CA  LEU A   6     -12.596  18.869 -13.378  1.00 32.64           C  
ATOM     39  C   LEU A   6     -11.922  17.925 -12.395  1.00 32.14           C  
ATOM     40  O   LEU A   6     -12.570  17.387 -11.494  1.00 30.81           O  
ATOM     41  CB  LEU A   6     -12.581  20.317 -12.873  1.00 36.63           C  
ATOM     42  CG  LEU A   6     -13.239  20.704 -11.550  1.00 39.49           C  
ATOM     43  CD1 LEU A   6     -12.390  20.224 -10.380  1.00 40.54           C  
ATOM     44  CD2 LEU A   6     -13.382  22.221 -11.505  1.00 40.61           C  
ATOM     45  N   ASN A   7     -10.631  17.692 -12.588  1.00 28.83           N  
ATOM     46  CA  ASN A   7      -9.905  16.795 -11.712  1.00 27.98           C  
ATOM     47  C   ASN A   7      -9.303  17.561 -10.552  1.00 27.36           C  
ATOM     48  O   ASN A   7      -8.827  18.682 -10.716  1.00 26.18           O  
ATOM     49  CB  ASN A   7      -8.821  16.058 -12.494  1.00 36.16           C  
ATOM     50  CG  ASN A   7      -9.392  15.229 -13.625  1.00 43.99           C  
ATOM     51  OD1 ASN A   7     -10.403  14.546 -13.458  1.00 42.89           O  
ATOM     52  ND2 ASN A   7      -8.743  15.275 -14.781  1.00 46.53           N  
ATOM     53  N   CYS A   8      -9.322  16.945  -9.377  1.00 24.55           N  
ATOM     54  CA  CYS A   8      -8.797  17.597  -8.190  1.00 25.21           C  
ATOM     55  C   CYS A   8      -8.443  16.601  -7.104  1.00 24.67           C  
ATOM     56  O   CYS A   8      -8.800  15.428  -7.172  1.00 24.69           O  
ATOM     57  CB  CYS A   8      -9.847  18.559  -7.635  1.00 26.52           C  
ATOM     58  SG  CYS A   8     -11.376  17.723  -7.083  1.00 29.40           S  
ATOM     59  N   THR A   9      -7.723  17.085  -6.103  1.00 24.02           N  
ATOM     60  CA  THR A   9      -7.370  16.275  -4.959  1.00 23.03           C  
ATOM     61  C   THR A   9      -7.926  17.070  -3.795  1.00 23.95           C  
ATOM     62  O   THR A   9      -8.183  18.268  -3.928  1.00 22.78           O  
ATOM     63  CB  THR A   9      -5.848  16.119  -4.795  1.00 21.94           C  
ATOM     64  OG1 THR A   9      -5.240  17.411  -4.693  1.00 23.36           O  
ATOM     65  CG2 THR A   9      -5.267  15.365  -5.984  1.00 23.72           C  
ATOM     66  N   LEU A  10      -8.138  16.399  -2.670  1.00 22.96           N  
ATOM     67  CA  LEU A  10      -8.665  17.049  -1.480  1.00 24.78           C  
ATOM     68  C   LEU A  10      -7.752  16.727  -0.313  1.00 24.96           C  
ATOM     69  O   LEU A  10      -7.135  15.667  -0.275  1.00 22.42           O  
ATOM     70  CB  LEU A  10     -10.073  16.534  -1.161  1.00 28.20           C  
ATOM     71  CG  LEU A  10     -11.175  16.733  -2.204  1.00 30.27           C  
ATOM     72  CD1 LEU A  10     -12.421  15.986  -1.762  1.00 28.19           C  
ATOM     73  CD2 LEU A  10     -11.472  18.215  -2.378  1.00 30.09           C  
ATOM     74  N   ARG A  11      -7.664  17.656   0.625  1.00 24.42           N  
ATOM     75  CA  ARG A  11      -6.869  17.475   1.827  1.00 27.45           C  
ATOM     76  C   ARG A  11      -7.724  18.043   2.952  1.00 24.94           C  
ATOM     77  O   ARG A  11      -8.341  19.089   2.772  1.00 26.35           O  
ATOM     78  CB  ARG A  11      -5.549  18.244   1.727  1.00 31.09           C  
ATOM     79  CG  ARG A  11      -4.342  17.349   1.492  1.00 38.56           C  
ATOM     80  CD  ARG A  11      -3.038  18.060   1.827  1.00 39.27           C  
ATOM     81  NE  ARG A  11      -2.633  19.013   0.800  1.00 41.38           N  
ATOM     82  CZ  ARG A  11      -2.301  18.670  -0.440  1.00 42.89           C  
ATOM     83  NH1 ARG A  11      -2.326  17.396  -0.809  1.00 43.38           N  
ATOM     84  NH2 ARG A  11      -1.940  19.600  -1.309  1.00 40.13           N  
ATOM     85  N   ASP A  12      -7.788  17.366   4.096  1.00 21.69           N  
ATOM     86  CA  ASP A  12      -8.600  17.902   5.178  1.00 23.00           C  
ATOM     87  C   ASP A  12      -7.872  19.056   5.857  1.00 23.28           C  
ATOM     88  O   ASP A  12      -6.724  19.347   5.529  1.00 22.96           O  
ATOM     89  CB  ASP A  12      -9.019  16.813   6.187  1.00 21.00           C  
ATOM     90  CG  ASP A  12      -7.861  16.250   7.000  1.00 23.53           C  
ATOM     91  OD1 ASP A  12      -6.804  16.904   7.144  1.00 20.86           O  
ATOM     92  OD2 ASP A  12      -8.038  15.134   7.531  1.00 21.94           O  
ATOM     93  N   SER A  13      -8.546  19.727   6.783  1.00 29.14           N  
ATOM     94  CA  SER A  13      -7.964  20.885   7.454  1.00 30.64           C  
ATOM     95  C   SER A  13      -6.716  20.588   8.272  1.00 30.98           C  
ATOM     96  O   SER A  13      -6.031  21.507   8.711  1.00 30.65           O  
ATOM     97  CB  SER A  13      -9.016  21.557   8.338  1.00 28.75           C  
ATOM     98  OG  SER A  13      -9.539  20.628   9.264  1.00 34.40           O  
ATOM     99  N   GLN A  14      -6.427  19.310   8.491  1.00 29.91           N  
ATOM    100  CA  GLN A  14      -5.237  18.929   9.240  1.00 30.14           C  
ATOM    101  C   GLN A  14      -4.156  18.519   8.260  1.00 28.29           C  
ATOM    102  O   GLN A  14      -3.153  17.915   8.641  1.00 27.87           O  
ATOM    103  CB  GLN A  14      -5.539  17.775  10.195  1.00 47.81           C  
ATOM    104  CG  GLN A  14      -6.368  18.186  11.386  1.00 56.29           C  
ATOM    105  CD  GLN A  14      -5.759  19.354  12.129  1.00 66.20           C  
ATOM    106  OE1 GLN A  14      -4.597  19.307  12.539  1.00 69.61           O  
ATOM    107  NE2 GLN A  14      -6.539  20.414  12.305  1.00 71.27           N  
ATOM    108  N   GLN A  15      -4.387  18.837   6.988  1.00 27.36           N  
ATOM    109  CA  GLN A  15      -3.442  18.543   5.918  1.00 28.88           C  
ATOM    110  C   GLN A  15      -3.239  17.060   5.618  1.00 27.84           C  
ATOM    111  O   GLN A  15      -2.187  16.663   5.114  1.00 28.25           O  
ATOM    112  CB  GLN A  15      -2.094  19.196   6.236  1.00 37.63           C  
ATOM    113  CG  GLN A  15      -2.184  20.694   6.418  1.00 42.73           C  
ATOM    114  CD  GLN A  15      -2.371  21.424   5.105  1.00 49.20           C  
ATOM    115  OE1 GLN A  15      -3.169  21.017   4.260  1.00 51.21           O  
ATOM    116  NE2 GLN A  15      -1.636  22.517   4.928  1.00 51.55           N  
ATOM    117  N   LYS A  16      -4.230  16.235   5.934  1.00 26.76           N  
ATOM    118  CA  LYS A  16      -4.122  14.814   5.633  1.00 26.43           C  
ATOM    119  C   LYS A  16      -4.632  14.579   4.209  1.00 26.94           C  
ATOM    120  O   LYS A  16      -5.604  15.207   3.770  1.00 26.66           O  
ATOM    121  CB  LYS A  16      -4.936  13.967   6.619  1.00 25.43           C  
ATOM    122  CG  LYS A  16      -4.447  14.028   8.070  1.00 22.92           C  
ATOM    123  CD  LYS A  16      -4.870  12.792   8.871  1.00 23.02           C  
ATOM    124  CE  LYS A  16      -6.389  12.654   8.961  1.00 21.86           C  
ATOM    125  NZ  LYS A  16      -7.029  13.785   9.703  1.00 18.26           N  
ATOM    126  N   SER A  17      -3.962  13.687   3.488  1.00 24.29           N  
ATOM    127  CA  SER A  17      -4.348  13.358   2.125  1.00 25.39           C  
ATOM    128  C   SER A  17      -5.232  12.114   2.125  1.00 22.59           C  
ATOM    129  O   SER A  17      -5.274  11.380   3.105  1.00 21.23           O  
ATOM    130  CB  SER A  17      -3.098  13.123   1.275  1.00 24.62           C  
ATOM    131  OG  SER A  17      -2.348  14.320   1.179  1.00 26.75           O  
ATOM    132  N   LEU A  18      -5.940  11.883   1.025  1.00 20.84           N  
ATOM    133  CA  LEU A  18      -6.832  10.733   0.918  1.00 23.89           C  
ATOM    134  C   LEU A  18      -6.256   9.686  -0.028  1.00 23.72           C  
ATOM    135  O   LEU A  18      -5.730  10.025  -1.086  1.00 23.54           O  
ATOM    136  CB  LEU A  18      -8.211  11.185   0.411  1.00 21.72           C  
ATOM    137  CG  LEU A  18      -8.881  12.325   1.189  1.00 22.74           C  
ATOM    138  CD1 LEU A  18     -10.240  12.660   0.567  1.00 23.53           C  
ATOM    139  CD2 LEU A  18      -9.049  11.919   2.641  1.00 21.82           C  
ATOM    140  N   VAL A  19      -6.354   8.419   0.361  1.00 22.98           N  
ATOM    141  CA  VAL A  19      -5.853   7.308  -0.452  1.00 25.76           C  
ATOM    142  C   VAL A  19      -6.860   6.163  -0.405  1.00 29.12           C  
ATOM    143  O   VAL A  19      -7.663   6.077   0.520  1.00 26.70           O  
ATOM    144  CB  VAL A  19      -4.496   6.763   0.076  1.00 31.30           C  
ATOM    145  CG1 VAL A  19      -3.464   7.874   0.130  1.00 30.81           C  
ATOM    146  CG2 VAL A  19      -4.681   6.140   1.452  1.00 30.84           C  
ATOM    147  N   MET A  20      -6.820   5.282  -1.397  1.00 36.88           N  
ATOM    148  CA  MET A  20      -7.734   4.148  -1.406  1.00 42.14           C  
ATOM    149  C   MET A  20      -7.257   3.045  -0.474  1.00 44.85           C  
ATOM    150  O   MET A  20      -6.102   2.641  -0.523  1.00 46.87           O  
ATOM    151  CB  MET A  20      -7.885   3.572  -2.815  1.00 53.01           C  
ATOM    152  CG  MET A  20      -8.881   4.303  -3.689  1.00 56.41           C  
ATOM    153  SD  MET A  20      -9.562   3.203  -4.947  1.00 64.70           S  
ATOM    154  CE  MET A  20      -8.296   3.300  -6.211  1.00 61.12           C  
ATOM    155  N   SER A  21      -8.150   2.573   0.386  1.00 51.49           N  
ATOM    156  CA  SER A  21      -7.820   1.492   1.305  1.00 54.54           C  
ATOM    157  C   SER A  21      -8.056   0.208   0.519  1.00 55.86           C  
ATOM    158  O   SER A  21      -7.149  -0.320  -0.125  1.00 58.41           O  
ATOM    159  CB  SER A  21      -8.736   1.537   2.529  1.00 68.81           C  
ATOM    160  OG  SER A  21      -8.476   0.450   3.397  1.00 72.38           O  
ATOM    161  N   GLY A  22      -9.284  -0.289   0.569  1.00 52.80           N  
ATOM    162  CA  GLY A  22      -9.612  -1.482  -0.181  1.00 52.75           C  
ATOM    163  C   GLY A  22     -10.159  -0.993  -1.505  1.00 52.64           C  
ATOM    164  O   GLY A  22      -9.865   0.133  -1.904  1.00 52.47           O  
ATOM    165  N   PRO A  23     -10.952  -1.801  -2.215  1.00 54.79           N  
ATOM    166  CA  PRO A  23     -11.495  -1.345  -3.495  1.00 54.78           C  
ATOM    167  C   PRO A  23     -12.682  -0.399  -3.313  1.00 53.87           C  
ATOM    168  O   PRO A  23     -13.026   0.358  -4.221  1.00 54.07           O  
ATOM    169  CB  PRO A  23     -11.899  -2.649  -4.171  1.00 48.74           C  
ATOM    170  CG  PRO A  23     -12.341  -3.483  -3.014  1.00 48.05           C  
ATOM    171  CD  PRO A  23     -11.255  -3.227  -1.994  1.00 48.42           C  
ATOM    172  N   TYR A  24     -13.293  -0.440  -2.132  1.00 39.52           N  
ATOM    173  CA  TYR A  24     -14.454   0.391  -1.839  1.00 39.19           C  
ATOM    174  C   TYR A  24     -14.306   1.226  -0.570  1.00 36.31           C  
ATOM    175  O   TYR A  24     -15.280   1.464   0.141  1.00 35.46           O  
ATOM    176  CB  TYR A  24     -15.698  -0.496  -1.725  1.00 43.88           C  
ATOM    177  CG  TYR A  24     -16.017  -1.235  -3.006  1.00 49.49           C  
ATOM    178  CD1 TYR A  24     -16.455  -0.545  -4.139  1.00 49.68           C  
ATOM    179  CD2 TYR A  24     -15.841  -2.615  -3.102  1.00 50.51           C  
ATOM    180  CE1 TYR A  24     -16.707  -1.209  -5.337  1.00 52.11           C  
ATOM    181  CE2 TYR A  24     -16.090  -3.291  -4.299  1.00 52.65           C  
ATOM    182  CZ  TYR A  24     -16.521  -2.579  -5.411  1.00 53.64           C  
ATOM    183  OH  TYR A  24     -16.759  -3.231  -6.600  1.00 54.30           O  
ATOM    184  N   GLU A  25     -13.097   1.683  -0.284  1.00 33.58           N  
ATOM    185  CA  GLU A  25     -12.901   2.476   0.917  1.00 31.95           C  
ATOM    186  C   GLU A  25     -11.769   3.474   0.748  1.00 28.30           C  
ATOM    187  O   GLU A  25     -10.798   3.201   0.042  1.00 25.11           O  
ATOM    188  CB  GLU A  25     -12.613   1.548   2.102  1.00 48.33           C  
ATOM    189  CG  GLU A  25     -12.590   2.238   3.453  1.00 53.91           C  
ATOM    190  CD  GLU A  25     -12.460   1.257   4.606  1.00 55.54           C  
ATOM    191  OE1 GLU A  25     -11.421   0.568   4.693  1.00 54.64           O  
ATOM    192  OE2 GLU A  25     -13.401   1.175   5.423  1.00 56.08           O  
ATOM    193  N   LEU A  26     -11.913   4.634   1.389  1.00 25.26           N  
ATOM    194  CA  LEU A  26     -10.897   5.681   1.352  1.00 23.81           C  
ATOM    195  C   LEU A  26     -10.379   5.899   2.769  1.00 23.12           C  
ATOM    196  O   LEU A  26     -11.126   5.754   3.734  1.00 20.98           O  
ATOM    197  CB  LEU A  26     -11.484   7.000   0.845  1.00 28.03           C  
ATOM    198  CG  LEU A  26     -12.034   7.083  -0.577  1.00 29.87           C  
ATOM    199  CD1 LEU A  26     -12.534   8.504  -0.836  1.00 30.94           C  
ATOM    200  CD2 LEU A  26     -10.955   6.706  -1.573  1.00 31.22           C  
ATOM    201  N   LYS A  27      -9.100   6.238   2.891  1.00 25.49           N  
ATOM    202  CA  LYS A  27      -8.494   6.503   4.194  1.00 27.47           C  
ATOM    203  C   LYS A  27      -7.754   7.825   4.124  1.00 26.07           C  
ATOM    204  O   LYS A  27      -7.348   8.257   3.047  1.00 26.14           O  
ATOM    205  CB  LYS A  27      -7.503   5.403   4.586  1.00 41.00           C  
ATOM    206  CG  LYS A  27      -8.129   4.054   4.895  1.00 49.52           C  
ATOM    207  CD  LYS A  27      -7.073   3.077   5.394  1.00 56.66           C  
ATOM    208  CE  LYS A  27      -5.914   2.964   4.402  1.00 63.03           C  
ATOM    209  NZ  LYS A  27      -4.771   2.154   4.920  1.00 65.85           N  
ATOM    210  N   ALA A  28      -7.574   8.459   5.274  1.00 26.80           N  
ATOM    211  CA  ALA A  28      -6.880   9.736   5.330  1.00 26.78           C  
ATOM    212  C   ALA A  28      -5.626   9.624   6.191  1.00 26.11           C  
ATOM    213  O   ALA A  28      -5.655   9.045   7.274  1.00 23.67           O  
ATOM    214  CB  ALA A  28      -7.811  10.808   5.895  1.00 17.44           C  
ATOM    215  N   LEU A  29      -4.525  10.176   5.702  1.00 21.95           N  
ATOM    216  CA  LEU A  29      -3.280  10.140   6.449  1.00 25.25           C  
ATOM    217  C   LEU A  29      -2.343  11.248   6.015  1.00 24.06           C  
ATOM    218  O   LEU A  29      -2.442  11.756   4.895  1.00 22.61           O  
ATOM    219  CB  LEU A  29      -2.592   8.780   6.273  1.00 41.92           C  
ATOM    220  CG  LEU A  29      -2.517   8.181   4.866  1.00 45.44           C  
ATOM    221  CD1 LEU A  29      -1.744   9.090   3.936  1.00 49.72           C  
ATOM    222  CD2 LEU A  29      -1.849   6.819   4.944  1.00 49.04           C  
ATOM    223  N   HIS A  30      -1.449  11.635   6.917  1.00 27.04           N  
ATOM    224  CA  HIS A  30      -0.465  12.663   6.624  1.00 28.32           C  
ATOM    225  C   HIS A  30       0.523  12.060   5.652  1.00 30.73           C  
ATOM    226  O   HIS A  30       1.180  11.068   5.955  1.00 33.31           O  
ATOM    227  CB  HIS A  30       0.245  13.107   7.902  1.00 24.80           C  
ATOM    228  CG  HIS A  30      -0.586  14.006   8.759  1.00 23.02           C  
ATOM    229  ND1 HIS A  30      -1.282  13.555   9.858  1.00 23.03           N  
ATOM    230  CD2 HIS A  30      -0.874  15.323   8.645  1.00 21.76           C  
ATOM    231  CE1 HIS A  30      -1.964  14.557  10.386  1.00 23.74           C  
ATOM    232  NE2 HIS A  30      -1.734  15.640   9.667  1.00 23.33           N  
ATOM    233  N   LEU A  31       0.614  12.662   4.477  1.00 31.24           N  
ATOM    234  CA  LEU A  31       1.491  12.168   3.430  1.00 34.04           C  
ATOM    235  C   LEU A  31       2.380  13.303   2.944  1.00 35.81           C  
ATOM    236  O   LEU A  31       1.986  14.466   2.990  1.00 34.37           O  
ATOM    237  CB  LEU A  31       0.631  11.644   2.281  1.00 51.24           C  
ATOM    238  CG  LEU A  31       1.065  10.392   1.526  1.00 55.35           C  
ATOM    239  CD1 LEU A  31       1.311   9.251   2.503  1.00 55.28           C  
ATOM    240  CD2 LEU A  31      -0.024  10.018   0.533  1.00 54.20           C  
ATOM    241  N   GLN A  32       3.579  12.966   2.480  1.00 37.68           N  
ATOM    242  CA  GLN A  32       4.507  13.972   1.979  1.00 40.72           C  
ATOM    243  C   GLN A  32       5.543  13.338   1.060  1.00 42.98           C  
ATOM    244  O   GLN A  32       5.835  12.146   1.161  1.00 43.38           O  
ATOM    245  CB  GLN A  32       5.219  14.660   3.148  1.00 52.71           C  
ATOM    246  CG  GLN A  32       5.981  15.919   2.767  1.00 55.50           C  
ATOM    247  CD  GLN A  32       6.690  16.551   3.952  1.00 59.77           C  
ATOM    248  OE1 GLN A  32       7.108  17.705   3.896  1.00 61.09           O  
ATOM    249  NE2 GLN A  32       6.835  15.790   5.032  1.00 64.44           N  
ATOM    250  N   GLY A  33       6.092  14.145   0.161  1.00 51.97           N  
ATOM    251  CA  GLY A  33       7.103  13.659  -0.757  1.00 55.18           C  
ATOM    252  C   GLY A  33       6.624  12.641  -1.772  1.00 57.26           C  
ATOM    253  O   GLY A  33       5.538  12.762  -2.335  1.00 57.37           O  
ATOM    254  N   GLN A  34       7.457  11.631  -2.000  1.00 60.11           N  
ATOM    255  CA  GLN A  34       7.173  10.571  -2.957  1.00 63.04           C  
ATOM    256  C   GLN A  34       5.806   9.911  -2.796  1.00 62.73           C  
ATOM    257  O   GLN A  34       5.092   9.716  -3.780  1.00 62.66           O  
ATOM    258  CB  GLN A  34       8.270   9.502  -2.884  1.00104.18           C  
ATOM    259  CG  GLN A  34       8.563   8.994  -1.475  1.00105.96           C  
ATOM    260  CD  GLN A  34       9.349   9.989  -0.630  1.00108.58           C  
ATOM    261  OE1 GLN A  34       9.522   9.796   0.573  1.00108.79           O  
ATOM    262  NE2 GLN A  34       9.836  11.052  -1.260  1.00109.54           N  
ATOM    263  N   ASP A  35       5.440   9.565  -1.565  1.00 62.19           N  
ATOM    264  CA  ASP A  35       4.158   8.912  -1.323  1.00 62.22           C  
ATOM    265  C   ASP A  35       2.952   9.741  -1.759  1.00 61.31           C  
ATOM    266  O   ASP A  35       1.829   9.238  -1.791  1.00 59.82           O  
ATOM    267  CB  ASP A  35       4.017   8.543   0.154  1.00 71.18           C  
ATOM    268  CG  ASP A  35       5.040   7.521   0.595  1.00 73.16           C  
ATOM    269  OD1 ASP A  35       5.348   6.605  -0.196  1.00 74.53           O  
ATOM    270  OD2 ASP A  35       5.528   7.623   1.738  1.00 75.07           O  
ATOM    271  N   MET A  36       3.192  11.003  -2.100  1.00 60.38           N  
ATOM    272  CA  MET A  36       2.133  11.908  -2.533  1.00 59.80           C  
ATOM    273  C   MET A  36       1.343  11.302  -3.694  1.00 58.69           C  
ATOM    274  O   MET A  36       0.124  11.435  -3.763  1.00 59.49           O  
ATOM    275  CB  MET A  36       2.739  13.241  -2.979  1.00 66.73           C  
ATOM    276  CG  MET A  36       1.805  14.431  -2.885  1.00 68.17           C  
ATOM    277  SD  MET A  36       1.790  15.159  -1.231  1.00 68.37           S  
ATOM    278  CE  MET A  36       0.617  14.094  -0.398  1.00 68.69           C  
ATOM    279  N   GLU A  37       2.051  10.637  -4.602  1.00 49.62           N  
ATOM    280  CA  GLU A  37       1.436  10.017  -5.773  1.00 48.28           C  
ATOM    281  C   GLU A  37       0.406   8.952  -5.430  1.00 45.31           C  
ATOM    282  O   GLU A  37      -0.341   8.508  -6.298  1.00 43.63           O  
ATOM    283  CB  GLU A  37       2.514   9.409  -6.675  1.00133.62           C  
ATOM    284  CG  GLU A  37       3.166  10.396  -7.637  1.00138.82           C  
ATOM    285  CD  GLU A  37       3.681  11.645  -6.948  1.00142.58           C  
ATOM    286  OE1 GLU A  37       2.853  12.441  -6.455  1.00143.74           O  
ATOM    287  OE2 GLU A  37       4.915  11.832  -6.900  1.00145.03           O  
ATOM    288  N   GLN A  38       0.368   8.537  -4.169  1.00 45.05           N  
ATOM    289  CA  GLN A  38      -0.592   7.530  -3.737  1.00 41.89           C  
ATOM    290  C   GLN A  38      -1.977   8.143  -3.558  1.00 38.80           C  
ATOM    291  O   GLN A  38      -2.979   7.428  -3.547  1.00 37.42           O  
ATOM    292  CB  GLN A  38      -0.170   6.915  -2.400  1.00 60.47           C  
ATOM    293  CG  GLN A  38       1.114   6.114  -2.421  1.00 66.70           C  
ATOM    294  CD  GLN A  38       1.446   5.546  -1.054  1.00 69.92           C  
ATOM    295  OE1 GLN A  38       0.653   4.808  -0.467  1.00 69.12           O  
ATOM    296  NE2 GLN A  38       2.620   5.890  -0.538  1.00 73.84           N  
ATOM    297  N   GLN A  39      -2.033   9.464  -3.418  1.00 35.67           N  
ATOM    298  CA  GLN A  39      -3.310  10.129  -3.195  1.00 32.09           C  
ATOM    299  C   GLN A  39      -4.312   9.969  -4.333  1.00 31.02           C  
ATOM    300  O   GLN A  39      -3.958   9.907  -5.514  1.00 27.62           O  
ATOM    301  CB  GLN A  39      -3.097  11.614  -2.878  1.00 34.56           C  
ATOM    302  CG  GLN A  39      -2.916  12.521  -4.068  1.00 34.86           C  
ATOM    303  CD  GLN A  39      -2.596  13.949  -3.648  1.00 35.42           C  
ATOM    304  OE1 GLN A  39      -3.165  14.473  -2.685  1.00 33.31           O  
ATOM    305  NE2 GLN A  39      -1.692  14.587  -4.376  1.00 35.28           N  
ATOM    306  N   VAL A  40      -5.578   9.894  -3.949  1.00 29.53           N  
ATOM    307  CA  VAL A  40      -6.661   9.732  -4.900  1.00 28.51           C  
ATOM    308  C   VAL A  40      -6.930  11.031  -5.637  1.00 25.71           C  
ATOM    309  O   VAL A  40      -6.887  12.105  -5.051  1.00 25.57           O  
ATOM    310  CB  VAL A  40      -7.964   9.311  -4.184  1.00 36.58           C  
ATOM    311  CG1 VAL A  40      -9.068   9.090  -5.200  1.00 37.24           C  
ATOM    312  CG2 VAL A  40      -7.728   8.058  -3.373  1.00 39.24           C  
ATOM    313  N   VAL A  41      -7.194  10.921  -6.931  1.00 22.91           N  
ATOM    314  CA  VAL A  41      -7.528  12.074  -7.744  1.00 23.01           C  
ATOM    315  C   VAL A  41      -9.008  11.918  -8.081  1.00 22.51           C  
ATOM    316  O   VAL A  41      -9.436  10.882  -8.592  1.00 23.87           O  
ATOM    317  CB  VAL A  41      -6.706  12.114  -9.044  1.00 24.78           C  
ATOM    318  CG1 VAL A  41      -7.184  13.262  -9.927  1.00 24.01           C  
ATOM    319  CG2 VAL A  41      -5.224  12.283  -8.706  1.00 26.69           C  
ATOM    320  N   PHE A  42      -9.789  12.943  -7.765  1.00 21.60           N  
ATOM    321  CA  PHE A  42     -11.219  12.918  -8.023  1.00 22.59           C  
ATOM    322  C   PHE A  42     -11.585  13.615  -9.311  1.00 25.20           C  
ATOM    323  O   PHE A  42     -10.867  14.493  -9.798  1.00 24.29           O  
ATOM    324  CB  PHE A  42     -11.986  13.635  -6.905  1.00 21.42           C  
ATOM    325  CG  PHE A  42     -11.922  12.944  -5.580  1.00 23.61           C  
ATOM    326  CD1 PHE A  42     -12.792  11.900  -5.285  1.00 22.31           C  
ATOM    327  CD2 PHE A  42     -11.002  13.347  -4.620  1.00 23.23           C  
ATOM    328  CE1 PHE A  42     -12.750  11.266  -4.044  1.00 23.48           C  
ATOM    329  CE2 PHE A  42     -10.950  12.721  -3.379  1.00 23.53           C  
ATOM    330  CZ  PHE A  42     -11.828  11.676  -3.089  1.00 22.94           C  
ATOM    331  N   SER A  43     -12.720  13.207  -9.856  1.00 23.85           N  
ATOM    332  CA  SER A  43     -13.269  13.844 -11.030  1.00 25.36           C  
ATOM    333  C   SER A  43     -14.557  14.419 -10.461  1.00 26.14           C  
ATOM    334  O   SER A  43     -15.508  13.684 -10.178  1.00 27.52           O  
ATOM    335  CB  SER A  43     -13.585  12.834 -12.127  1.00 33.28           C  
ATOM    336  OG  SER A  43     -14.244  13.493 -13.191  1.00 38.24           O  
ATOM    337  N   MET A  44     -14.565  15.729 -10.245  1.00 23.94           N  
ATOM    338  CA  MET A  44     -15.725  16.406  -9.690  1.00 24.21           C  
ATOM    339  C   MET A  44     -16.637  16.898 -10.805  1.00 24.07           C  
ATOM    340  O   MET A  44     -16.224  17.696 -11.644  1.00 23.78           O  
ATOM    341  CB  MET A  44     -15.271  17.589  -8.827  1.00 24.12           C  
ATOM    342  CG  MET A  44     -16.404  18.373  -8.182  1.00 27.57           C  
ATOM    343  SD  MET A  44     -15.796  19.806  -7.245  1.00 30.45           S  
ATOM    344  CE  MET A  44     -15.002  19.008  -5.861  1.00 31.52           C  
ATOM    345  N   SER A  45     -17.880  16.425 -10.805  1.00 24.16           N  
ATOM    346  CA  SER A  45     -18.847  16.820 -11.822  1.00 26.19           C  
ATOM    347  C   SER A  45     -19.907  17.764 -11.276  1.00 26.32           C  
ATOM    348  O   SER A  45     -20.414  17.584 -10.165  1.00 25.94           O  
ATOM    349  CB  SER A  45     -19.528  15.587 -12.418  1.00 33.16           C  
ATOM    350  OG  SER A  45     -18.600  14.806 -13.151  1.00 35.69           O  
ATOM    351  N   PHE A  46     -20.244  18.773 -12.070  1.00 28.34           N  
ATOM    352  CA  PHE A  46     -21.253  19.741 -11.673  1.00 29.71           C  
ATOM    353  C   PHE A  46     -22.589  19.305 -12.246  1.00 31.76           C  
ATOM    354  O   PHE A  46     -22.878  19.486 -13.428  1.00 32.80           O  
ATOM    355  CB  PHE A  46     -20.839  21.133 -12.146  1.00 27.74           C  
ATOM    356  CG  PHE A  46     -19.543  21.589 -11.546  1.00 27.35           C  
ATOM    357  CD1 PHE A  46     -18.333  21.121 -12.040  1.00 28.73           C  
ATOM    358  CD2 PHE A  46     -19.535  22.403 -10.423  1.00 28.23           C  
ATOM    359  CE1 PHE A  46     -17.135  21.452 -11.418  1.00 28.62           C  
ATOM    360  CE2 PHE A  46     -18.345  22.740  -9.793  1.00 28.61           C  
ATOM    361  CZ  PHE A  46     -17.141  22.264 -10.289  1.00 28.61           C  
ATOM    362  N   VAL A  47     -23.396  18.713 -11.374  1.00 28.54           N  
ATOM    363  CA  VAL A  47     -24.690  18.171 -11.741  1.00 30.61           C  
ATOM    364  C   VAL A  47     -25.866  19.088 -11.434  1.00 34.05           C  
ATOM    365  O   VAL A  47     -25.693  20.200 -10.932  1.00 32.43           O  
ATOM    366  CB  VAL A  47     -24.911  16.820 -11.025  1.00 31.23           C  
ATOM    367  CG1 VAL A  47     -23.833  15.833 -11.445  1.00 31.27           C  
ATOM    368  CG2 VAL A  47     -24.852  17.015  -9.516  1.00 28.69           C  
ATOM    369  N   GLN A  48     -27.062  18.600 -11.753  1.00 38.58           N  
ATOM    370  CA  GLN A  48     -28.304  19.332 -11.527  1.00 43.10           C  
ATOM    371  C   GLN A  48     -28.701  19.247 -10.059  1.00 44.17           C  
ATOM    372  O   GLN A  48     -28.471  18.231  -9.404  1.00 42.43           O  
ATOM    373  CB  GLN A  48     -29.428  18.741 -12.382  1.00103.66           C  
ATOM    374  CG  GLN A  48     -29.177  18.790 -13.877  1.00111.97           C  
ATOM    375  CD  GLN A  48     -29.119  20.207 -14.410  1.00116.51           C  
ATOM    376  OE1 GLN A  48     -30.076  20.971 -14.279  1.00120.64           O  
ATOM    377  NE2 GLN A  48     -27.993  20.566 -15.017  1.00118.96           N  
ATOM    378  N   GLY A  49     -29.309  20.314  -9.552  1.00 45.37           N  
ATOM    379  CA  GLY A  49     -29.736  20.330  -8.166  1.00 49.40           C  
ATOM    380  C   GLY A  49     -29.909  21.740  -7.642  1.00 53.02           C  
ATOM    381  O   GLY A  49     -29.593  22.705  -8.337  1.00 52.98           O  
ATOM    382  N   GLU A  50     -30.418  21.859  -6.419  1.00 61.60           N  
ATOM    383  CA  GLU A  50     -30.620  23.163  -5.800  1.00 64.66           C  
ATOM    384  C   GLU A  50     -29.255  23.846  -5.739  1.00 65.70           C  
ATOM    385  O   GLU A  50     -28.289  23.267  -5.243  1.00 67.34           O  
ATOM    386  CB  GLU A  50     -31.193  22.991  -4.390  1.00129.76           C  
ATOM    387  CG  GLU A  50     -31.683  24.277  -3.738  1.00133.47           C  
ATOM    388  CD  GLU A  50     -30.576  25.293  -3.524  1.00136.74           C  
ATOM    389  OE1 GLU A  50     -29.595  24.972  -2.820  1.00137.65           O  
ATOM    390  OE2 GLU A  50     -30.690  26.416  -4.061  1.00137.46           O  
ATOM    391  N   GLU A  51     -29.176  25.073  -6.243  1.00 59.23           N  
ATOM    392  CA  GLU A  51     -27.912  25.797  -6.252  1.00 59.89           C  
ATOM    393  C   GLU A  51     -27.972  27.155  -5.554  1.00 60.86           C  
ATOM    394  O   GLU A  51     -29.011  27.811  -5.519  1.00 60.50           O  
ATOM    395  CB  GLU A  51     -27.437  25.980  -7.695  1.00 73.32           C  
ATOM    396  CG  GLU A  51     -26.031  26.531  -7.821  1.00 76.08           C  
ATOM    397  CD  GLU A  51     -25.590  26.667  -9.263  1.00 79.30           C  
ATOM    398  OE1 GLU A  51     -25.665  25.665 -10.006  1.00 78.82           O  
ATOM    399  OE2 GLU A  51     -25.166  27.776  -9.654  1.00 86.01           O  
ATOM    400  N   SER A  52     -26.837  27.564  -4.999  1.00 51.84           N  
ATOM    401  CA  SER A  52     -26.717  28.838  -4.301  1.00 53.02           C  
ATOM    402  C   SER A  52     -25.353  29.439  -4.624  1.00 54.02           C  
ATOM    403  O   SER A  52     -24.521  28.797  -5.265  1.00 54.89           O  
ATOM    404  CB  SER A  52     -26.849  28.625  -2.791  1.00 66.06           C  
ATOM    405  OG  SER A  52     -26.665  29.838  -2.087  1.00 65.81           O  
ATOM    406  N   ASN A  53     -25.121  30.670  -4.184  1.00 78.05           N  
ATOM    407  CA  ASN A  53     -23.847  31.328  -4.443  1.00 78.90           C  
ATOM    408  C   ASN A  53     -22.717  30.676  -3.649  1.00 78.42           C  
ATOM    409  O   ASN A  53     -21.543  30.817  -3.992  1.00 79.52           O  
ATOM    410  CB  ASN A  53     -23.942  32.816  -4.094  1.00115.84           C  
ATOM    411  CG  ASN A  53     -24.414  33.052  -2.673  1.00116.36           C  
ATOM    412  OD1 ASN A  53     -23.754  32.654  -1.713  1.00117.82           O  
ATOM    413  ND2 ASN A  53     -25.566  33.701  -2.532  1.00117.78           N  
ATOM    414  N   ASP A  54     -23.078  29.955  -2.593  1.00 63.86           N  
ATOM    415  CA  ASP A  54     -22.090  29.292  -1.751  1.00 61.05           C  
ATOM    416  C   ASP A  54     -22.342  27.788  -1.620  1.00 56.19           C  
ATOM    417  O   ASP A  54     -21.614  27.091  -0.911  1.00 54.53           O  
ATOM    418  CB  ASP A  54     -22.074  29.943  -0.365  1.00 97.68           C  
ATOM    419  CG  ASP A  54     -23.432  29.908   0.312  1.00102.36           C  
ATOM    420  OD1 ASP A  54     -24.420  30.361  -0.304  1.00103.10           O  
ATOM    421  OD2 ASP A  54     -23.512  29.431   1.464  1.00105.02           O  
ATOM    422  N   LYS A  55     -23.369  27.296  -2.310  1.00 48.71           N  
ATOM    423  CA  LYS A  55     -23.715  25.877  -2.276  1.00 43.10           C  
ATOM    424  C   LYS A  55     -23.893  25.330  -3.693  1.00 38.09           C  
ATOM    425  O   LYS A  55     -24.873  25.643  -4.371  1.00 36.27           O  
ATOM    426  CB  LYS A  55     -24.995  25.671  -1.461  1.00 48.57           C  
ATOM    427  CG  LYS A  55     -25.470  24.230  -1.416  1.00 51.12           C  
ATOM    428  CD  LYS A  55     -26.554  24.012  -0.362  1.00 54.07           C  
ATOM    429  CE  LYS A  55     -25.994  24.109   1.052  1.00 56.80           C  
ATOM    430  NZ  LYS A  55     -26.965  23.637   2.089  1.00 58.57           N  
ATOM    431  N   ILE A  56     -22.943  24.503  -4.127  1.00 31.40           N  
ATOM    432  CA  ILE A  56     -22.960  23.929  -5.473  1.00 28.82           C  
ATOM    433  C   ILE A  56     -23.046  22.403  -5.446  1.00 26.49           C  
ATOM    434  O   ILE A  56     -22.207  21.738  -4.836  1.00 22.38           O  
ATOM    435  CB  ILE A  56     -21.677  24.321  -6.249  1.00 38.88           C  
ATOM    436  CG1 ILE A  56     -21.448  25.834  -6.154  1.00 40.76           C  
ATOM    437  CG2 ILE A  56     -21.780  23.872  -7.700  1.00 37.32           C  
ATOM    438  CD1 ILE A  56     -22.579  26.671  -6.710  1.00 41.77           C  
ATOM    439  N   PRO A  57     -24.061  21.829  -6.111  1.00 30.02           N  
ATOM    440  CA  PRO A  57     -24.208  20.371  -6.133  1.00 28.09           C  
ATOM    441  C   PRO A  57     -23.196  19.730  -7.075  1.00 27.01           C  
ATOM    442  O   PRO A  57     -23.059  20.146  -8.228  1.00 24.02           O  
ATOM    443  CB  PRO A  57     -25.649  20.179  -6.604  1.00 35.04           C  
ATOM    444  CG  PRO A  57     -25.846  21.341  -7.527  1.00 35.79           C  
ATOM    445  CD  PRO A  57     -25.203  22.486  -6.775  1.00 35.03           C  
ATOM    446  N   VAL A  58     -22.474  18.731  -6.574  1.00 25.83           N  
ATOM    447  CA  VAL A  58     -21.481  18.035  -7.382  1.00 23.18           C  
ATOM    448  C   VAL A  58     -21.553  16.540  -7.146  1.00 23.36           C  
ATOM    449  O   VAL A  58     -22.191  16.079  -6.201  1.00 22.35           O  
ATOM    450  CB  VAL A  58     -20.033  18.479  -7.045  1.00 21.37           C  
ATOM    451  CG1 VAL A  58     -19.865  19.969  -7.284  1.00 21.40           C  
ATOM    452  CG2 VAL A  58     -19.698  18.121  -5.596  1.00 20.43           C  
ATOM    453  N   ALA A  59     -20.912  15.791  -8.035  1.00 22.78           N  
ATOM    454  CA  ALA A  59     -20.814  14.344  -7.911  1.00 23.28           C  
ATOM    455  C   ALA A  59     -19.311  14.139  -7.776  1.00 24.01           C  
ATOM    456  O   ALA A  59     -18.528  14.868  -8.389  1.00 23.70           O  
ATOM    457  CB  ALA A  59     -21.328  13.650  -9.163  1.00 23.74           C  
ATOM    458  N   LEU A  60     -18.907  13.170  -6.965  1.00 21.52           N  
ATOM    459  CA  LEU A  60     -17.494  12.898  -6.765  1.00 21.46           C  
ATOM    460  C   LEU A  60     -17.165  11.474  -7.171  1.00 21.79           C  
ATOM    461  O   LEU A  60     -17.558  10.519  -6.499  1.00 20.27           O  
ATOM    462  CB  LEU A  60     -17.110  13.113  -5.298  1.00 23.56           C  
ATOM    463  CG  LEU A  60     -17.201  14.549  -4.771  1.00 25.71           C  
ATOM    464  CD1 LEU A  60     -17.067  14.551  -3.253  1.00 25.50           C  
ATOM    465  CD2 LEU A  60     -16.110  15.405  -5.419  1.00 26.06           C  
ATOM    466  N   GLY A  61     -16.450  11.346  -8.283  1.00 22.69           N  
ATOM    467  CA  GLY A  61     -16.037  10.045  -8.764  1.00 23.92           C  
ATOM    468  C   GLY A  61     -14.522  10.003  -8.766  1.00 25.23           C  
ATOM    469  O   GLY A  61     -13.871  11.037  -8.620  1.00 26.39           O  
ATOM    470  N   LEU A  62     -13.950   8.814  -8.899  1.00 23.78           N  
ATOM    471  CA  LEU A  62     -12.502   8.693  -8.940  1.00 23.53           C  
ATOM    472  C   LEU A  62     -12.099   8.862 -10.397  1.00 24.19           C  
ATOM    473  O   LEU A  62     -12.745   8.305 -11.288  1.00 22.87           O  
ATOM    474  CB  LEU A  62     -12.062   7.324  -8.411  1.00 27.54           C  
ATOM    475  CG  LEU A  62     -11.995   7.190  -6.885  1.00 32.17           C  
ATOM    476  CD1 LEU A  62     -13.305   7.612  -6.261  1.00 32.20           C  
ATOM    477  CD2 LEU A  62     -11.666   5.755  -6.511  1.00 33.31           C  
ATOM    478  N   LYS A  63     -11.040   9.624 -10.648  1.00 22.05           N  
ATOM    479  CA  LYS A  63     -10.613   9.856 -12.024  1.00 26.69           C  
ATOM    480  C   LYS A  63     -10.363   8.567 -12.796  1.00 26.79           C  
ATOM    481  O   LYS A  63      -9.632   7.693 -12.341  1.00 23.93           O  
ATOM    482  CB  LYS A  63      -9.345  10.713 -12.076  1.00 38.41           C  
ATOM    483  CG  LYS A  63      -9.063  11.233 -13.486  1.00 40.75           C  
ATOM    484  CD  LYS A  63      -7.700  11.887 -13.630  1.00 47.21           C  
ATOM    485  CE  LYS A  63      -6.586  10.857 -13.604  1.00 51.97           C  
ATOM    486  NZ  LYS A  63      -5.304  11.430 -14.100  1.00 57.49           N  
ATOM    487  N   GLU A  64     -10.981   8.466 -13.967  1.00 30.67           N  
ATOM    488  CA  GLU A  64     -10.841   7.307 -14.847  1.00 36.80           C  
ATOM    489  C   GLU A  64     -11.292   5.968 -14.266  1.00 35.40           C  
ATOM    490  O   GLU A  64     -10.869   4.909 -14.728  1.00 35.19           O  
ATOM    491  CB  GLU A  64      -9.393   7.196 -15.333  1.00 59.17           C  
ATOM    492  CG  GLU A  64      -8.908   8.428 -16.080  1.00 70.27           C  
ATOM    493  CD  GLU A  64      -7.502   8.271 -16.626  1.00 77.81           C  
ATOM    494  OE1 GLU A  64      -6.578   7.985 -15.834  1.00 76.37           O  
ATOM    495  OE2 GLU A  64      -7.319   8.437 -17.850  1.00 88.35           O  
ATOM    496  N   LYS A  65     -12.149   6.010 -13.254  1.00 38.12           N  
ATOM    497  CA  LYS A  65     -12.667   4.788 -12.652  1.00 34.80           C  
ATOM    498  C   LYS A  65     -14.160   4.943 -12.457  1.00 33.97           C  
ATOM    499  O   LYS A  65     -14.626   6.004 -12.040  1.00 34.75           O  
ATOM    500  CB  LYS A  65     -12.000   4.509 -11.307  1.00 37.59           C  
ATOM    501  CG  LYS A  65     -10.572   4.019 -11.422  1.00 39.27           C  
ATOM    502  CD  LYS A  65     -10.041   3.545 -10.083  1.00 43.35           C  
ATOM    503  CE  LYS A  65      -8.653   2.935 -10.228  1.00 47.34           C  
ATOM    504  NZ  LYS A  65      -8.656   1.766 -11.162  1.00 52.62           N  
ATOM    505  N   ASN A  66     -14.918   3.898 -12.772  1.00 26.97           N  
ATOM    506  CA  ASN A  66     -16.364   3.963 -12.610  1.00 24.63           C  
ATOM    507  C   ASN A  66     -16.749   3.688 -11.162  1.00 23.81           C  
ATOM    508  O   ASN A  66     -17.451   2.717 -10.858  1.00 22.66           O  
ATOM    509  CB  ASN A  66     -17.072   2.977 -13.551  1.00 27.18           C  
ATOM    510  CG  ASN A  66     -16.589   1.542 -13.389  1.00 28.80           C  
ATOM    511  OD1 ASN A  66     -17.379   0.600 -13.497  1.00 31.32           O  
ATOM    512  ND2 ASN A  66     -15.299   1.366 -13.151  1.00 27.94           N  
ATOM    513  N   LEU A  67     -16.271   4.561 -10.279  1.00 25.11           N  
ATOM    514  CA  LEU A  67     -16.531   4.482  -8.844  1.00 26.42           C  
ATOM    515  C   LEU A  67     -16.884   5.888  -8.342  1.00 23.86           C  
ATOM    516  O   LEU A  67     -16.135   6.845  -8.575  1.00 23.55           O  
ATOM    517  CB  LEU A  67     -15.293   3.961  -8.106  1.00 22.37           C  
ATOM    518  CG  LEU A  67     -14.929   2.477  -8.249  1.00 26.02           C  
ATOM    519  CD1 LEU A  67     -13.528   2.240  -7.691  1.00 24.24           C  
ATOM    520  CD2 LEU A  67     -15.959   1.614  -7.509  1.00 23.17           C  
ATOM    521  N   TYR A  68     -18.021   5.999  -7.663  1.00 20.52           N  
ATOM    522  CA  TYR A  68     -18.505   7.275  -7.138  1.00 22.02           C  
ATOM    523  C   TYR A  68     -18.836   7.216  -5.658  1.00 21.80           C  
ATOM    524  O   TYR A  68     -19.268   6.177  -5.159  1.00 23.60           O  
ATOM    525  CB  TYR A  68     -19.767   7.701  -7.894  1.00 20.68           C  
ATOM    526  CG  TYR A  68     -19.490   8.149  -9.304  1.00 24.78           C  
ATOM    527  CD1 TYR A  68     -19.347   9.500  -9.610  1.00 27.12           C  
ATOM    528  CD2 TYR A  68     -19.332   7.220 -10.329  1.00 26.87           C  
ATOM    529  CE1 TYR A  68     -19.051   9.916 -10.906  1.00 29.35           C  
ATOM    530  CE2 TYR A  68     -19.035   7.624 -11.626  1.00 29.26           C  
ATOM    531  CZ  TYR A  68     -18.898   8.972 -11.905  1.00 30.27           C  
ATOM    532  OH  TYR A  68     -18.616   9.374 -13.186  1.00 32.90           O  
ATOM    533  N   LEU A  69     -18.631   8.331  -4.959  1.00 20.67           N  
ATOM    534  CA  LEU A  69     -18.964   8.405  -3.541  1.00 23.53           C  
ATOM    535  C   LEU A  69     -20.481   8.495  -3.474  1.00 23.47           C  
ATOM    536  O   LEU A  69     -21.094   9.329  -4.149  1.00 21.81           O  
ATOM    537  CB  LEU A  69     -18.336   9.637  -2.889  1.00 25.69           C  
ATOM    538  CG  LEU A  69     -16.833   9.549  -2.612  1.00 28.09           C  
ATOM    539  CD1 LEU A  69     -16.350  10.827  -1.936  1.00 29.59           C  
ATOM    540  CD2 LEU A  69     -16.566   8.358  -1.715  1.00 31.35           C  
ATOM    541  N   SER A  70     -21.078   7.640  -2.653  1.00 23.38           N  
ATOM    542  CA  SER A  70     -22.524   7.581  -2.523  1.00 26.00           C  
ATOM    543  C   SER A  70     -22.956   7.530  -1.056  1.00 24.68           C  
ATOM    544  O   SER A  70     -22.179   7.139  -0.193  1.00 22.95           O  
ATOM    545  CB  SER A  70     -23.022   6.324  -3.249  1.00 29.38           C  
ATOM    546  OG  SER A  70     -24.421   6.215  -3.182  1.00 38.82           O  
ATOM    547  N   CYS A  71     -24.195   7.929  -0.787  1.00 23.50           N  
ATOM    548  CA  CYS A  71     -24.751   7.902   0.568  1.00 27.88           C  
ATOM    549  C   CYS A  71     -25.927   6.945   0.616  1.00 27.26           C  
ATOM    550  O   CYS A  71     -26.867   7.082  -0.163  1.00 25.85           O  
ATOM    551  CB  CYS A  71     -25.260   9.277   0.983  1.00 45.17           C  
ATOM    552  SG  CYS A  71     -23.981  10.451   1.298  1.00 52.84           S  
ATOM    553  N   VAL A  72     -25.881   5.989   1.533  1.00 27.08           N  
ATOM    554  CA  VAL A  72     -26.962   5.027   1.676  1.00 31.49           C  
ATOM    555  C   VAL A  72     -27.215   4.738   3.151  1.00 33.68           C  
ATOM    556  O   VAL A  72     -26.337   4.937   3.990  1.00 33.46           O  
ATOM    557  CB  VAL A  72     -26.625   3.699   0.967  1.00 36.08           C  
ATOM    558  CG1 VAL A  72     -26.465   3.933  -0.529  1.00 38.94           C  
ATOM    559  CG2 VAL A  72     -25.354   3.108   1.549  1.00 35.18           C  
ATOM    560  N   LEU A  73     -28.423   4.283   3.465  1.00 34.77           N  
ATOM    561  CA  LEU A  73     -28.760   3.946   4.840  1.00 38.77           C  
ATOM    562  C   LEU A  73     -28.232   2.554   5.147  1.00 42.73           C  
ATOM    563  O   LEU A  73     -28.427   1.625   4.368  1.00 43.48           O  
ATOM    564  CB  LEU A  73     -30.275   3.970   5.053  1.00 41.70           C  
ATOM    565  CG  LEU A  73     -30.941   5.342   5.109  1.00 42.47           C  
ATOM    566  CD1 LEU A  73     -32.448   5.168   5.240  1.00 42.85           C  
ATOM    567  CD2 LEU A  73     -30.388   6.132   6.290  1.00 42.85           C  
ATOM    568  N   LYS A  74     -27.558   2.422   6.281  1.00 55.26           N  
ATOM    569  CA  LYS A  74     -27.008   1.146   6.709  1.00 62.53           C  
ATOM    570  C   LYS A  74     -27.173   1.097   8.224  1.00 66.95           C  
ATOM    571  O   LYS A  74     -26.585   1.901   8.948  1.00 67.77           O  
ATOM    572  CB  LYS A  74     -25.532   1.054   6.320  1.00 98.54           C  
ATOM    573  CG  LYS A  74     -24.976  -0.358   6.297  1.00100.33           C  
ATOM    574  CD  LYS A  74     -23.588  -0.381   5.671  1.00101.71           C  
ATOM    575  CE  LYS A  74     -23.052  -1.798   5.543  1.00102.29           C  
ATOM    576  NZ  LYS A  74     -22.924  -2.465   6.867  1.00103.73           N  
ATOM    577  N   ASP A  75     -27.992   0.161   8.695  1.00 75.35           N  
ATOM    578  CA  ASP A  75     -28.262   0.024  10.120  1.00 77.50           C  
ATOM    579  C   ASP A  75     -28.964   1.270  10.646  1.00 76.40           C  
ATOM    580  O   ASP A  75     -28.663   1.760  11.734  1.00 74.27           O  
ATOM    581  CB  ASP A  75     -26.967  -0.222  10.899  1.00110.47           C  
ATOM    582  CG  ASP A  75     -26.546  -1.678  10.880  1.00117.67           C  
ATOM    583  OD1 ASP A  75     -26.335  -2.226   9.778  1.00120.76           O  
ATOM    584  OD2 ASP A  75     -26.430  -2.276  11.970  1.00119.54           O  
ATOM    585  N   ASP A  76     -29.896   1.782   9.847  1.00 55.35           N  
ATOM    586  CA  ASP A  76     -30.679   2.958  10.206  1.00 53.47           C  
ATOM    587  C   ASP A  76     -29.843   4.222  10.373  1.00 49.11           C  
ATOM    588  O   ASP A  76     -30.229   5.138  11.102  1.00 49.82           O  
ATOM    589  CB  ASP A  76     -31.457   2.683  11.496  1.00102.13           C  
ATOM    590  CG  ASP A  76     -32.250   1.393  11.434  1.00107.09           C  
ATOM    591  OD1 ASP A  76     -33.116   1.266  10.544  1.00108.24           O  
ATOM    592  OD2 ASP A  76     -32.004   0.503  12.276  1.00108.70           O  
ATOM    593  N   LYS A  77     -28.703   4.277   9.692  1.00 49.32           N  
ATOM    594  CA  LYS A  77     -27.829   5.443   9.779  1.00 43.46           C  
ATOM    595  C   LYS A  77     -27.186   5.777   8.432  1.00 36.71           C  
ATOM    596  O   LYS A  77     -26.721   4.886   7.721  1.00 33.88           O  
ATOM    597  CB  LYS A  77     -26.734   5.198  10.822  1.00 85.26           C  
ATOM    598  CG  LYS A  77     -25.760   6.352  10.983  1.00 87.30           C  
ATOM    599  CD  LYS A  77     -24.720   6.056  12.053  1.00 89.61           C  
ATOM    600  CE  LYS A  77     -23.761   7.225  12.224  1.00 90.22           C  
ATOM    601  NZ  LYS A  77     -22.758   6.974  13.296  1.00 91.81           N  
ATOM    602  N   PRO A  78     -27.158   7.069   8.065  1.00 36.63           N  
ATOM    603  CA  PRO A  78     -26.554   7.473   6.791  1.00 34.05           C  
ATOM    604  C   PRO A  78     -25.114   6.978   6.762  1.00 30.58           C  
ATOM    605  O   PRO A  78     -24.382   7.140   7.737  1.00 30.85           O  
ATOM    606  CB  PRO A  78     -26.638   8.996   6.838  1.00 38.26           C  
ATOM    607  CG  PRO A  78     -27.854   9.240   7.677  1.00 38.28           C  
ATOM    608  CD  PRO A  78     -27.685   8.239   8.787  1.00 39.29           C  
ATOM    609  N   THR A  79     -24.707   6.380   5.650  1.00 29.75           N  
ATOM    610  CA  THR A  79     -23.354   5.853   5.538  1.00 29.68           C  
ATOM    611  C   THR A  79     -22.711   6.163   4.190  1.00 27.80           C  
ATOM    612  O   THR A  79     -23.379   6.148   3.151  1.00 25.94           O  
ATOM    613  CB  THR A  79     -23.352   4.328   5.742  1.00 38.06           C  
ATOM    614  OG1 THR A  79     -23.966   4.017   6.999  1.00 43.80           O  
ATOM    615  CG2 THR A  79     -21.937   3.789   5.734  1.00 41.68           C  
ATOM    616  N   LEU A  80     -21.410   6.436   4.215  1.00 24.96           N  
ATOM    617  CA  LEU A  80     -20.669   6.736   2.999  1.00 27.10           C  
ATOM    618  C   LEU A  80     -20.185   5.442   2.356  1.00 26.20           C  
ATOM    619  O   LEU A  80     -19.791   4.507   3.045  1.00 26.47           O  
ATOM    620  CB  LEU A  80     -19.455   7.615   3.314  1.00 27.04           C  
ATOM    621  CG  LEU A  80     -18.502   7.882   2.141  1.00 29.63           C  
ATOM    622  CD1 LEU A  80     -19.148   8.861   1.176  1.00 29.22           C  
ATOM    623  CD2 LEU A  80     -17.188   8.449   2.651  1.00 28.99           C  
ATOM    624  N   GLN A  81     -20.222   5.381   1.033  1.00 29.04           N  
ATOM    625  CA  GLN A  81     -19.724   4.201   0.343  1.00 29.66           C  
ATOM    626  C   GLN A  81     -19.263   4.534  -1.063  1.00 26.99           C  
ATOM    627  O   GLN A  81     -19.701   5.527  -1.652  1.00 26.79           O  
ATOM    628  CB  GLN A  81     -20.790   3.109   0.264  1.00 38.70           C  
ATOM    629  CG  GLN A  81     -22.003   3.464  -0.562  1.00 44.62           C  
ATOM    630  CD  GLN A  81     -22.767   2.231  -1.014  1.00 52.11           C  
ATOM    631  OE1 GLN A  81     -22.924   1.271  -0.258  1.00 55.48           O  
ATOM    632  NE2 GLN A  81     -23.254   2.257  -2.249  1.00 52.01           N  
ATOM    633  N   LEU A  82     -18.359   3.707  -1.580  1.00 24.23           N  
ATOM    634  CA  LEU A  82     -17.862   3.858  -2.940  1.00 25.98           C  
ATOM    635  C   LEU A  82     -18.714   2.884  -3.730  1.00 25.51           C  
ATOM    636  O   LEU A  82     -18.754   1.697  -3.413  1.00 26.65           O  
ATOM    637  CB  LEU A  82     -16.392   3.462  -3.037  1.00 33.29           C  
ATOM    638  CG  LEU A  82     -15.365   4.552  -2.736  1.00 37.94           C  
ATOM    639  CD1 LEU A  82     -15.529   5.684  -3.740  1.00 40.60           C  
ATOM    640  CD2 LEU A  82     -15.547   5.060  -1.313  1.00 42.03           C  
ATOM    641  N   GLU A  83     -19.391   3.384  -4.756  1.00 24.49           N  
ATOM    642  CA  GLU A  83     -20.286   2.559  -5.557  1.00 26.97           C  
ATOM    643  C   GLU A  83     -19.837   2.443  -7.007  1.00 24.91           C  
ATOM    644  O   GLU A  83     -19.403   3.425  -7.606  1.00 24.86           O  
ATOM    645  CB  GLU A  83     -21.697   3.164  -5.501  1.00 30.30           C  
ATOM    646  CG  GLU A  83     -22.805   2.278  -6.039  1.00 34.86           C  
ATOM    647  CD  GLU A  83     -24.173   2.948  -5.972  1.00 36.26           C  
ATOM    648  OE1 GLU A  83     -24.446   3.670  -4.990  1.00 37.60           O  
ATOM    649  OE2 GLU A  83     -24.982   2.741  -6.897  1.00 37.92           O  
ATOM    650  N   SER A  84     -19.951   1.238  -7.561  1.00 24.16           N  
ATOM    651  CA  SER A  84     -19.586   0.966  -8.955  1.00 25.62           C  
ATOM    652  C   SER A  84     -20.786   1.307  -9.832  1.00 24.51           C  
ATOM    653  O   SER A  84     -21.917   1.047  -9.442  1.00 24.16           O  
ATOM    654  CB  SER A  84     -19.264  -0.522  -9.150  1.00 34.84           C  
ATOM    655  OG  SER A  84     -18.171  -0.940  -8.353  1.00 41.28           O  
ATOM    656  N   VAL A  85     -20.540   1.874 -11.011  1.00 24.30           N  
ATOM    657  CA  VAL A  85     -21.617   2.223 -11.936  1.00 23.98           C  
ATOM    658  C   VAL A  85     -21.262   1.779 -13.353  1.00 24.85           C  
ATOM    659  O   VAL A  85     -20.106   1.468 -13.646  1.00 23.38           O  
ATOM    660  CB  VAL A  85     -21.886   3.754 -11.969  1.00 24.76           C  
ATOM    661  CG1 VAL A  85     -22.223   4.260 -10.576  1.00 24.19           C  
ATOM    662  CG2 VAL A  85     -20.671   4.490 -12.529  1.00 21.49           C  
ATOM    663  N   ASP A  86     -22.262   1.746 -14.228  1.00 29.37           N  
ATOM    664  CA  ASP A  86     -22.044   1.366 -15.619  1.00 31.76           C  
ATOM    665  C   ASP A  86     -21.100   2.418 -16.199  1.00 32.03           C  
ATOM    666  O   ASP A  86     -21.450   3.593 -16.291  1.00 32.93           O  
ATOM    667  CB  ASP A  86     -23.370   1.370 -16.378  1.00 44.79           C  
ATOM    668  CG  ASP A  86     -23.243   0.787 -17.766  1.00 48.31           C  
ATOM    669  OD1 ASP A  86     -22.377   1.260 -18.529  1.00 48.33           O  
ATOM    670  OD2 ASP A  86     -24.009  -0.143 -18.092  1.00 52.48           O  
ATOM    671  N   PRO A  87     -19.891   2.007 -16.610  1.00 28.38           N  
ATOM    672  CA  PRO A  87     -18.920   2.953 -17.164  1.00 30.67           C  
ATOM    673  C   PRO A  87     -19.373   3.730 -18.394  1.00 32.71           C  
ATOM    674  O   PRO A  87     -18.775   4.747 -18.743  1.00 34.97           O  
ATOM    675  CB  PRO A  87     -17.707   2.071 -17.444  1.00 32.97           C  
ATOM    676  CG  PRO A  87     -18.326   0.767 -17.806  1.00 32.53           C  
ATOM    677  CD  PRO A  87     -19.417   0.620 -16.767  1.00 32.25           C  
ATOM    678  N   LYS A  88     -20.440   3.269 -19.033  1.00 40.43           N  
ATOM    679  CA  LYS A  88     -20.944   3.922 -20.231  1.00 44.35           C  
ATOM    680  C   LYS A  88     -22.009   4.987 -19.977  1.00 44.20           C  
ATOM    681  O   LYS A  88     -22.205   5.871 -20.807  1.00 46.30           O  
ATOM    682  CB  LYS A  88     -21.498   2.866 -21.195  1.00 90.37           C  
ATOM    683  CG  LYS A  88     -22.096   3.412 -22.490  1.00 95.37           C  
ATOM    684  CD  LYS A  88     -21.060   3.659 -23.590  1.00 98.89           C  
ATOM    685  CE  LYS A  88     -20.159   4.857 -23.314  1.00100.40           C  
ATOM    686  NZ  LYS A  88     -19.123   4.584 -22.284  1.00103.74           N  
ATOM    687  N   ASN A  89     -22.685   4.920 -18.834  1.00 41.01           N  
ATOM    688  CA  ASN A  89     -23.741   5.883 -18.537  1.00 40.99           C  
ATOM    689  C   ASN A  89     -23.350   7.022 -17.594  1.00 39.94           C  
ATOM    690  O   ASN A  89     -24.165   7.902 -17.306  1.00 40.05           O  
ATOM    691  CB  ASN A  89     -24.959   5.154 -17.967  1.00 53.68           C  
ATOM    692  CG  ASN A  89     -25.433   4.032 -18.867  1.00 59.34           C  
ATOM    693  OD1 ASN A  89     -25.510   4.193 -20.084  1.00 60.88           O  
ATOM    694  ND2 ASN A  89     -25.763   2.889 -18.272  1.00 59.66           N  
ATOM    695  N   TYR A  90     -22.109   7.012 -17.120  1.00 37.24           N  
ATOM    696  CA  TYR A  90     -21.646   8.047 -16.204  1.00 35.61           C  
ATOM    697  C   TYR A  90     -20.356   8.707 -16.662  1.00 35.54           C  
ATOM    698  O   TYR A  90     -19.558   8.102 -17.371  1.00 35.95           O  
ATOM    699  CB  TYR A  90     -21.443   7.461 -14.805  1.00 32.25           C  
ATOM    700  CG  TYR A  90     -22.727   7.047 -14.132  1.00 31.96           C  
ATOM    701  CD1 TYR A  90     -23.388   5.872 -14.494  1.00 31.66           C  
ATOM    702  CD2 TYR A  90     -23.301   7.852 -13.149  1.00 32.17           C  
ATOM    703  CE1 TYR A  90     -24.595   5.511 -13.892  1.00 31.48           C  
ATOM    704  CE2 TYR A  90     -24.500   7.504 -12.544  1.00 32.36           C  
ATOM    705  CZ  TYR A  90     -25.142   6.336 -12.918  1.00 33.81           C  
ATOM    706  OH  TYR A  90     -26.334   6.014 -12.316  1.00 33.27           O  
ATOM    707  N   PRO A  91     -20.140   9.970 -16.260  1.00 37.77           N  
ATOM    708  CA  PRO A  91     -21.072  10.729 -15.419  1.00 39.19           C  
ATOM    709  C   PRO A  91     -22.203  11.306 -16.262  1.00 39.88           C  
ATOM    710  O   PRO A  91     -22.182  11.211 -17.488  1.00 40.35           O  
ATOM    711  CB  PRO A  91     -20.185  11.818 -14.831  1.00 35.93           C  
ATOM    712  CG  PRO A  91     -19.267  12.121 -15.973  1.00 35.58           C  
ATOM    713  CD  PRO A  91     -18.896  10.732 -16.474  1.00 35.13           C  
ATOM    714  N   LYS A  92     -23.191  11.895 -15.600  1.00 37.47           N  
ATOM    715  CA  LYS A  92     -24.314  12.500 -16.300  1.00 38.93           C  
ATOM    716  C   LYS A  92     -24.825  13.699 -15.518  1.00 38.90           C  
ATOM    717  O   LYS A  92     -24.672  13.762 -14.299  1.00 37.77           O  
ATOM    718  CB  LYS A  92     -25.431  11.473 -16.516  1.00 43.65           C  
ATOM    719  CG  LYS A  92     -25.898  10.756 -15.266  1.00 43.58           C  
ATOM    720  CD  LYS A  92     -26.887   9.654 -15.627  1.00 44.06           C  
ATOM    721  CE  LYS A  92     -27.372   8.918 -14.396  1.00 46.97           C  
ATOM    722  NZ  LYS A  92     -28.294   7.804 -14.751  1.00 50.61           N  
ATOM    723  N   LYS A  93     -25.425  14.648 -16.229  1.00 35.43           N  
ATOM    724  CA  LYS A  93     -25.943  15.865 -15.612  1.00 38.83           C  
ATOM    725  C   LYS A  93     -26.938  15.600 -14.495  1.00 39.19           C  
ATOM    726  O   LYS A  93     -26.910  16.269 -13.461  1.00 38.50           O  
ATOM    727  CB  LYS A  93     -26.593  16.763 -16.668  1.00 95.93           C  
ATOM    728  CG  LYS A  93     -25.623  17.294 -17.710  1.00101.72           C  
ATOM    729  CD  LYS A  93     -26.303  18.254 -18.677  1.00104.72           C  
ATOM    730  CE  LYS A  93     -26.765  19.522 -17.973  1.00105.55           C  
ATOM    731  NZ  LYS A  93     -27.415  20.477 -18.915  1.00106.88           N  
ATOM    732  N   LYS A  94     -27.825  14.635 -14.700  1.00 39.26           N  
ATOM    733  CA  LYS A  94     -28.809  14.321 -13.678  1.00 41.71           C  
ATOM    734  C   LYS A  94     -28.447  13.015 -12.985  1.00 37.68           C  
ATOM    735  O   LYS A  94     -28.849  11.936 -13.412  1.00 36.96           O  
ATOM    736  CB  LYS A  94     -30.208  14.236 -14.293  1.00 71.86           C  
ATOM    737  CG  LYS A  94     -31.333  14.250 -13.265  1.00 84.66           C  
ATOM    738  CD  LYS A  94     -31.137  15.368 -12.239  1.00 92.00           C  
ATOM    739  CE  LYS A  94     -32.325  16.321 -12.183  1.00 96.56           C  
ATOM    740  NZ  LYS A  94     -32.468  17.123 -13.431  1.00 94.30           N  
ATOM    741  N   MET A  95     -27.664  13.136 -11.918  1.00 37.56           N  
ATOM    742  CA  MET A  95     -27.213  11.997 -11.128  1.00 35.27           C  
ATOM    743  C   MET A  95     -28.262  11.632 -10.088  1.00 34.43           C  
ATOM    744  O   MET A  95     -28.981  12.505  -9.596  1.00 34.01           O  
ATOM    745  CB  MET A  95     -25.923  12.354 -10.386  1.00 39.07           C  
ATOM    746  CG  MET A  95     -24.719  12.656 -11.254  1.00 38.33           C  
ATOM    747  SD  MET A  95     -23.973  11.182 -11.950  1.00 35.97           S  
ATOM    748  CE  MET A  95     -23.114  10.505 -10.534  1.00 33.64           C  
ATOM    749  N   GLU A  96     -28.347  10.351  -9.745  1.00 31.53           N  
ATOM    750  CA  GLU A  96     -29.289   9.919  -8.716  1.00 31.76           C  
ATOM    751  C   GLU A  96     -28.916  10.711  -7.463  1.00 31.10           C  
ATOM    752  O   GLU A  96     -27.749  11.045  -7.264  1.00 30.23           O  
ATOM    753  CB  GLU A  96     -29.151   8.420  -8.441  1.00 41.90           C  
ATOM    754  CG  GLU A  96     -29.593   7.506  -9.578  1.00 46.05           C  
ATOM    755  CD  GLU A  96     -28.809   7.718 -10.861  1.00 49.90           C  
ATOM    756  OE1 GLU A  96     -27.569   7.860 -10.802  1.00 52.95           O  
ATOM    757  OE2 GLU A  96     -29.436   7.728 -11.939  1.00 52.52           O  
ATOM    758  N   LYS A  97     -29.905  11.000  -6.625  1.00 30.33           N  
ATOM    759  CA  LYS A  97     -29.712  11.783  -5.407  1.00 30.70           C  
ATOM    760  C   LYS A  97     -28.642  11.272  -4.438  1.00 27.62           C  
ATOM    761  O   LYS A  97     -27.948  12.067  -3.799  1.00 27.77           O  
ATOM    762  CB  LYS A  97     -31.047  11.903  -4.668  1.00 55.11           C  
ATOM    763  CG  LYS A  97     -31.052  12.899  -3.522  1.00 64.34           C  
ATOM    764  CD  LYS A  97     -30.994  14.333  -4.020  1.00 73.41           C  
ATOM    765  CE  LYS A  97     -31.128  15.314  -2.862  1.00 81.39           C  
ATOM    766  NZ  LYS A  97     -31.066  16.736  -3.305  1.00 89.00           N  
ATOM    767  N   ARG A  98     -28.509   9.955  -4.316  1.00 27.62           N  
ATOM    768  CA  ARG A  98     -27.523   9.386  -3.401  1.00 26.87           C  
ATOM    769  C   ARG A  98     -26.085   9.755  -3.781  1.00 24.61           C  
ATOM    770  O   ARG A  98     -25.185   9.701  -2.943  1.00 22.23           O  
ATOM    771  CB  ARG A  98     -27.676   7.857  -3.333  1.00 31.06           C  
ATOM    772  CG  ARG A  98     -27.345   7.095  -4.621  1.00 32.70           C  
ATOM    773  CD  ARG A  98     -27.421   5.580  -4.379  1.00 33.06           C  
ATOM    774  NE  ARG A  98     -27.022   4.786  -5.541  1.00 34.55           N  
ATOM    775  CZ  ARG A  98     -27.782   4.574  -6.612  1.00 37.17           C  
ATOM    776  NH1 ARG A  98     -29.001   5.094  -6.684  1.00 34.56           N  
ATOM    777  NH2 ARG A  98     -27.320   3.841  -7.618  1.00 32.68           N  
ATOM    778  N   PHE A  99     -25.883  10.137  -5.040  1.00 23.30           N  
ATOM    779  CA  PHE A  99     -24.561  10.511  -5.556  1.00 25.11           C  
ATOM    780  C   PHE A  99     -24.289  12.010  -5.446  1.00 24.75           C  
ATOM    781  O   PHE A  99     -23.179  12.464  -5.733  1.00 23.85           O  
ATOM    782  CB  PHE A  99     -24.442  10.154  -7.045  1.00 23.38           C  
ATOM    783  CG  PHE A  99     -24.415   8.680  -7.332  1.00 26.63           C  
ATOM    784  CD1 PHE A  99     -23.379   7.880  -6.855  1.00 25.22           C  
ATOM    785  CD2 PHE A  99     -25.409   8.097  -8.113  1.00 25.58           C  
ATOM    786  CE1 PHE A  99     -23.332   6.521  -7.153  1.00 26.32           C  
ATOM    787  CE2 PHE A  99     -25.374   6.735  -8.420  1.00 26.37           C  
ATOM    788  CZ  PHE A  99     -24.336   5.945  -7.940  1.00 25.85           C  
ATOM    789  N   VAL A 100     -25.294  12.782  -5.048  1.00 26.01           N  
ATOM    790  CA  VAL A 100     -25.130  14.226  -4.990  1.00 20.81           C  
ATOM    791  C   VAL A 100     -24.651  14.811  -3.673  1.00 23.16           C  
ATOM    792  O   VAL A 100     -25.156  14.482  -2.599  1.00 20.37           O  
ATOM    793  CB  VAL A 100     -26.439  14.933  -5.407  1.00 23.39           C  
ATOM    794  CG1 VAL A 100     -26.243  16.440  -5.408  1.00 22.35           C  
ATOM    795  CG2 VAL A 100     -26.853  14.462  -6.796  1.00 22.23           C  
ATOM    796  N   TRP A 101     -23.668  15.700  -3.781  1.00 18.75           N  
ATOM    797  CA  TRP A 101     -23.098  16.371  -2.624  1.00 19.11           C  
ATOM    798  C   TRP A 101     -23.191  17.873  -2.795  1.00 22.22           C  
ATOM    799  O   TRP A 101     -22.960  18.400  -3.882  1.00 21.90           O  
ATOM    800  CB  TRP A 101     -21.619  16.009  -2.457  1.00 22.96           C  
ATOM    801  CG  TRP A 101     -21.386  14.561  -2.322  1.00 23.39           C  
ATOM    802  CD1 TRP A 101     -21.175  13.668  -3.325  1.00 23.17           C  
ATOM    803  CD2 TRP A 101     -21.416  13.808  -1.107  1.00 22.91           C  
ATOM    804  NE1 TRP A 101     -21.074  12.397  -2.812  1.00 25.38           N  
ATOM    805  CE2 TRP A 101     -21.219  12.455  -1.452  1.00 24.45           C  
ATOM    806  CE3 TRP A 101     -21.595  14.147   0.240  1.00 24.26           C  
ATOM    807  CZ2 TRP A 101     -21.194  11.436  -0.498  1.00 23.66           C  
ATOM    808  CZ3 TRP A 101     -21.573  13.133   1.191  1.00 24.41           C  
ATOM    809  CH2 TRP A 101     -21.372  11.794   0.815  1.00 25.60           C  
ATOM    810  N   ASN A 102     -23.524  18.562  -1.714  1.00 20.86           N  
ATOM    811  CA  ASN A 102     -23.585  20.006  -1.744  1.00 22.65           C  
ATOM    812  C   ASN A 102     -22.205  20.504  -1.344  1.00 23.35           C  
ATOM    813  O   ASN A 102     -21.795  20.328  -0.195  1.00 20.02           O  
ATOM    814  CB  ASN A 102     -24.617  20.515  -0.741  1.00 23.64           C  
ATOM    815  CG  ASN A 102     -26.031  20.236  -1.180  1.00 28.41           C  
ATOM    816  OD1 ASN A 102     -26.922  20.023  -0.355  1.00 28.17           O  
ATOM    817  ND2 ASN A 102     -26.250  20.245  -2.485  1.00 24.39           N  
ATOM    818  N   LYS A 103     -21.483  21.095  -2.292  1.00 23.72           N  
ATOM    819  CA  LYS A 103     -20.161  21.638  -2.010  1.00 24.43           C  
ATOM    820  C   LYS A 103     -20.381  23.031  -1.435  1.00 27.07           C  
ATOM    821  O   LYS A 103     -20.874  23.925  -2.122  1.00 27.00           O  
ATOM    822  CB  LYS A 103     -19.319  21.732  -3.284  1.00 23.72           C  
ATOM    823  CG  LYS A 103     -17.933  22.330  -3.042  1.00 24.21           C  
ATOM    824  CD  LYS A 103     -17.030  22.209  -4.267  1.00 23.34           C  
ATOM    825  CE  LYS A 103     -17.496  23.104  -5.415  1.00 23.29           C  
ATOM    826  NZ  LYS A 103     -17.337  24.549  -5.078  1.00 26.81           N  
ATOM    827  N   ILE A 104     -20.023  23.198  -0.168  1.00 24.78           N  
ATOM    828  CA  ILE A 104     -20.199  24.458   0.542  1.00 29.69           C  
ATOM    829  C   ILE A 104     -18.871  25.153   0.821  1.00 32.36           C  
ATOM    830  O   ILE A 104     -17.947  24.551   1.372  1.00 29.12           O  
ATOM    831  CB  ILE A 104     -20.897  24.218   1.894  1.00 31.18           C  
ATOM    832  CG1 ILE A 104     -22.211  23.469   1.671  1.00 30.69           C  
ATOM    833  CG2 ILE A 104     -21.126  25.546   2.609  1.00 32.56           C  
ATOM    834  CD1 ILE A 104     -22.785  22.875   2.941  1.00 31.16           C  
ATOM    835  N   GLU A 105     -18.787  26.423   0.449  1.00 32.15           N  
ATOM    836  CA  GLU A 105     -17.580  27.207   0.676  1.00 41.40           C  
ATOM    837  C   GLU A 105     -17.756  28.057   1.925  1.00 44.40           C  
ATOM    838  O   GLU A 105     -18.662  28.888   1.992  1.00 45.02           O  
ATOM    839  CB  GLU A 105     -17.298  28.127  -0.512  1.00 67.14           C  
ATOM    840  CG  GLU A 105     -17.036  27.407  -1.818  1.00 78.64           C  
ATOM    841  CD  GLU A 105     -16.678  28.363  -2.939  1.00 86.40           C  
ATOM    842  OE1 GLU A 105     -17.500  29.253  -3.247  1.00 90.74           O  
ATOM    843  OE2 GLU A 105     -15.576  28.228  -3.511  1.00 91.71           O  
ATOM    844  N   ILE A 106     -16.899  27.843   2.917  1.00 66.86           N  
ATOM    845  CA  ILE A 106     -16.967  28.613   4.153  1.00 70.29           C  
ATOM    846  C   ILE A 106     -15.714  29.478   4.269  1.00 72.78           C  
ATOM    847  O   ILE A 106     -15.311  30.114   3.295  1.00 75.25           O  
ATOM    848  CB  ILE A 106     -17.079  27.690   5.387  1.00 88.25           C  
ATOM    849  CG1 ILE A 106     -15.878  26.744   5.452  1.00 89.91           C  
ATOM    850  CG2 ILE A 106     -18.374  26.894   5.321  1.00 86.58           C  
ATOM    851  CD1 ILE A 106     -15.843  25.893   6.704  1.00 92.66           C  
ATOM    852  N   ASN A 107     -15.113  29.506   5.457  1.00 84.61           N  
ATOM    853  CA  ASN A 107     -13.898  30.282   5.704  1.00 85.26           C  
ATOM    854  C   ASN A 107     -13.111  30.408   4.403  1.00 84.16           C  
ATOM    855  O   ASN A 107     -13.210  31.407   3.691  1.00 87.23           O  
ATOM    856  CB  ASN A 107     -13.046  29.578   6.766  1.00121.40           C  
ATOM    857  CG  ASN A 107     -11.778  30.340   7.107  1.00119.23           C  
ATOM    858  OD1 ASN A 107     -10.941  30.596   6.242  1.00120.72           O  
ATOM    859  ND2 ASN A 107     -11.628  30.702   8.376  1.00118.77           N  
ATOM    860  N   ASN A 108     -12.332  29.378   4.106  1.00 68.56           N  
ATOM    861  CA  ASN A 108     -11.535  29.313   2.888  1.00 65.88           C  
ATOM    862  C   ASN A 108     -11.511  27.830   2.569  1.00 61.47           C  
ATOM    863  O   ASN A 108     -10.827  27.377   1.653  1.00 63.04           O  
ATOM    864  CB  ASN A 108     -10.110  29.817   3.142  1.00135.75           C  
ATOM    865  CG  ASN A 108      -9.299  28.872   4.016  1.00135.85           C  
ATOM    866  OD1 ASN A 108      -9.009  27.739   3.627  1.00137.89           O  
ATOM    867  ND2 ASN A 108      -8.928  29.337   5.203  1.00137.46           N  
ATOM    868  N   LYS A 109     -12.284  27.086   3.354  1.00 47.20           N  
ATOM    869  CA  LYS A 109     -12.375  25.641   3.224  1.00 41.84           C  
ATOM    870  C   LYS A 109     -13.653  25.211   2.518  1.00 37.24           C  
ATOM    871  O   LYS A 109     -14.525  26.025   2.200  1.00 34.62           O  
ATOM    872  CB  LYS A 109     -12.346  24.992   4.611  1.00 57.94           C  
ATOM    873  CG  LYS A 109     -11.228  25.462   5.530  1.00 61.58           C  
ATOM    874  CD  LYS A 109      -9.868  24.998   5.056  1.00 65.73           C  
ATOM    875  CE  LYS A 109      -8.806  25.279   6.106  1.00 69.10           C  
ATOM    876  NZ  LYS A 109      -8.757  26.721   6.464  1.00 70.32           N  
ATOM    877  N   LEU A 110     -13.761  23.907   2.305  1.00 33.51           N  
ATOM    878  CA  LEU A 110     -14.918  23.326   1.656  1.00 29.26           C  
ATOM    879  C   LEU A 110     -15.498  22.235   2.542  1.00 27.31           C  
ATOM    880  O   LEU A 110     -14.763  21.538   3.251  1.00 26.42           O  
ATOM    881  CB  LEU A 110     -14.516  22.698   0.321  1.00 28.22           C  
ATOM    882  CG  LEU A 110     -13.942  23.582  -0.784  1.00 30.02           C  
ATOM    883  CD1 LEU A 110     -13.488  22.700  -1.941  1.00 30.47           C  
ATOM    884  CD2 LEU A 110     -14.998  24.573  -1.250  1.00 29.84           C  
ATOM    885  N   GLU A 111     -16.816  22.100   2.505  1.00 24.92           N  
ATOM    886  CA  GLU A 111     -17.503  21.054   3.245  1.00 25.32           C  
ATOM    887  C   GLU A 111     -18.371  20.377   2.207  1.00 22.47           C  
ATOM    888  O   GLU A 111     -18.823  21.015   1.254  1.00 23.08           O  
ATOM    889  CB  GLU A 111     -18.377  21.626   4.363  1.00 25.66           C  
ATOM    890  CG  GLU A 111     -17.617  22.499   5.348  1.00 29.61           C  
ATOM    891  CD  GLU A 111     -18.459  22.882   6.552  1.00 35.52           C  
ATOM    892  OE1 GLU A 111     -19.683  23.067   6.380  1.00 34.57           O  
ATOM    893  OE2 GLU A 111     -17.898  23.008   7.665  1.00 36.82           O  
ATOM    894  N   PHE A 112     -18.587  19.082   2.369  1.00 21.73           N  
ATOM    895  CA  PHE A 112     -19.404  18.342   1.421  1.00 21.80           C  
ATOM    896  C   PHE A 112     -20.554  17.714   2.181  1.00 21.49           C  
ATOM    897  O   PHE A 112     -20.371  16.749   2.921  1.00 19.87           O  
ATOM    898  CB  PHE A 112     -18.560  17.271   0.722  1.00 21.41           C  
ATOM    899  CG  PHE A 112     -17.492  17.837  -0.173  1.00 21.54           C  
ATOM    900  CD1 PHE A 112     -17.786  18.212  -1.482  1.00 22.84           C  
ATOM    901  CD2 PHE A 112     -16.207  18.049   0.309  1.00 23.41           C  
ATOM    902  CE1 PHE A 112     -16.811  18.796  -2.300  1.00 23.42           C  
ATOM    903  CE2 PHE A 112     -15.229  18.629  -0.499  1.00 24.97           C  
ATOM    904  CZ  PHE A 112     -15.532  19.004  -1.803  1.00 22.67           C  
ATOM    905  N   GLU A 113     -21.735  18.296   2.003  1.00 20.75           N  
ATOM    906  CA  GLU A 113     -22.933  17.824   2.665  1.00 22.01           C  
ATOM    907  C   GLU A 113     -23.716  16.906   1.742  1.00 22.13           C  
ATOM    908  O   GLU A 113     -23.859  17.176   0.547  1.00 24.21           O  
ATOM    909  CB  GLU A 113     -23.827  19.004   3.069  1.00 24.49           C  
ATOM    910  CG  GLU A 113     -25.140  18.566   3.712  1.00 25.83           C  
ATOM    911  CD  GLU A 113     -26.232  19.621   3.637  1.00 28.66           C  
ATOM    912  OE1 GLU A 113     -26.373  20.254   2.577  1.00 25.78           O  
ATOM    913  OE2 GLU A 113     -26.967  19.799   4.629  1.00 26.52           O  
ATOM    914  N   SER A 114     -24.209  15.808   2.300  1.00 23.52           N  
ATOM    915  CA  SER A 114     -25.016  14.866   1.538  1.00 25.45           C  
ATOM    916  C   SER A 114     -26.287  15.595   1.100  1.00 26.17           C  
ATOM    917  O   SER A 114     -26.935  16.256   1.908  1.00 26.87           O  
ATOM    918  CB  SER A 114     -25.395  13.679   2.423  1.00 25.35           C  
ATOM    919  OG  SER A 114     -26.444  12.925   1.846  1.00 25.38           O  
ATOM    920  N   ALA A 115     -26.639  15.492  -0.174  1.00 26.86           N  
ATOM    921  CA  ALA A 115     -27.855  16.142  -0.653  1.00 29.74           C  
ATOM    922  C   ALA A 115     -29.046  15.365  -0.099  1.00 32.02           C  
ATOM    923  O   ALA A 115     -30.081  15.938   0.235  1.00 34.13           O  
ATOM    924  CB  ALA A 115     -27.894  16.137  -2.178  1.00 26.53           C  
ATOM    925  N   GLN A 116     -28.867  14.055   0.007  1.00 33.24           N  
ATOM    926  CA  GLN A 116     -29.887  13.134   0.498  1.00 35.32           C  
ATOM    927  C   GLN A 116     -30.151  13.265   2.000  1.00 34.97           C  
ATOM    928  O   GLN A 116     -31.301  13.248   2.439  1.00 35.43           O  
ATOM    929  CB  GLN A 116     -29.452  11.699   0.187  1.00 58.90           C  
ATOM    930  CG  GLN A 116     -30.481  10.629   0.489  1.00 66.97           C  
ATOM    931  CD  GLN A 116     -31.164  10.121  -0.763  1.00 70.20           C  
ATOM    932  OE1 GLN A 116     -31.867  10.863  -1.446  1.00 73.69           O  
ATOM    933  NE2 GLN A 116     -30.953   8.850  -1.075  1.00 73.24           N  
ATOM    934  N   PHE A 117     -29.083  13.386   2.784  1.00 31.31           N  
ATOM    935  CA  PHE A 117     -29.201  13.493   4.238  1.00 30.83           C  
ATOM    936  C   PHE A 117     -28.661  14.824   4.746  1.00 29.44           C  
ATOM    937  O   PHE A 117     -27.465  14.965   5.021  1.00 28.15           O  
ATOM    938  CB  PHE A 117     -28.454  12.333   4.898  1.00 35.18           C  
ATOM    939  CG  PHE A 117     -28.931  10.981   4.448  1.00 37.90           C  
ATOM    940  CD1 PHE A 117     -30.167  10.494   4.859  1.00 37.82           C  
ATOM    941  CD2 PHE A 117     -28.164  10.213   3.576  1.00 39.82           C  
ATOM    942  CE1 PHE A 117     -30.636   9.259   4.406  1.00 40.72           C  
ATOM    943  CE2 PHE A 117     -28.622   8.977   3.116  1.00 40.74           C  
ATOM    944  CZ  PHE A 117     -29.862   8.500   3.532  1.00 39.86           C  
ATOM    945  N   PRO A 118     -29.550  15.818   4.895  1.00 29.31           N  
ATOM    946  CA  PRO A 118     -29.186  17.156   5.367  1.00 28.83           C  
ATOM    947  C   PRO A 118     -28.336  17.127   6.628  1.00 27.51           C  
ATOM    948  O   PRO A 118     -28.610  16.371   7.558  1.00 27.15           O  
ATOM    949  CB  PRO A 118     -30.542  17.820   5.610  1.00 33.68           C  
ATOM    950  CG  PRO A 118     -31.432  17.144   4.609  1.00 34.85           C  
ATOM    951  CD  PRO A 118     -31.010  15.701   4.726  1.00 33.48           C  
ATOM    952  N   ASN A 119     -27.298  17.956   6.637  1.00 24.94           N  
ATOM    953  CA  ASN A 119     -26.397  18.075   7.773  1.00 26.41           C  
ATOM    954  C   ASN A 119     -25.526  16.862   8.093  1.00 25.55           C  
ATOM    955  O   ASN A 119     -25.104  16.681   9.238  1.00 24.63           O  
ATOM    956  CB  ASN A 119     -27.190  18.509   9.013  1.00 36.60           C  
ATOM    957  CG  ASN A 119     -27.957  19.797   8.778  1.00 37.49           C  
ATOM    958  OD1 ASN A 119     -29.180  19.833   8.882  1.00 40.41           O  
ATOM    959  ND2 ASN A 119     -27.236  20.861   8.446  1.00 39.96           N  
ATOM    960  N   TRP A 120     -25.289  16.021   7.090  1.00 24.86           N  
ATOM    961  CA  TRP A 120     -24.387  14.880   7.234  1.00 24.52           C  
ATOM    962  C   TRP A 120     -23.265  15.219   6.252  1.00 23.35           C  
ATOM    963  O   TRP A 120     -23.524  15.512   5.084  1.00 23.29           O  
ATOM    964  CB  TRP A 120     -25.074  13.561   6.876  1.00 26.38           C  
ATOM    965  CG  TRP A 120     -25.897  13.049   8.015  1.00 27.37           C  
ATOM    966  CD1 TRP A 120     -27.121  13.512   8.419  1.00 28.23           C  
ATOM    967  CD2 TRP A 120     -25.515  12.045   8.964  1.00 28.02           C  
ATOM    968  NE1 TRP A 120     -27.520  12.860   9.563  1.00 26.92           N  
ATOM    969  CE2 TRP A 120     -26.555  11.956   9.920  1.00 29.13           C  
ATOM    970  CE3 TRP A 120     -24.394  11.214   9.102  1.00 29.59           C  
ATOM    971  CZ2 TRP A 120     -26.507  11.068  11.000  1.00 28.36           C  
ATOM    972  CZ3 TRP A 120     -24.345  10.330  10.180  1.00 32.05           C  
ATOM    973  CH2 TRP A 120     -25.397  10.266  11.115  1.00 29.76           C  
ATOM    974  N   TYR A 121     -22.026  15.185   6.733  1.00 25.13           N  
ATOM    975  CA  TYR A 121     -20.871  15.573   5.929  1.00 23.63           C  
ATOM    976  C   TYR A 121     -19.771  14.534   5.770  1.00 24.18           C  
ATOM    977  O   TYR A 121     -19.586  13.667   6.625  1.00 20.92           O  
ATOM    978  CB  TYR A 121     -20.225  16.811   6.557  1.00 24.05           C  
ATOM    979  CG  TYR A 121     -21.152  17.986   6.750  1.00 25.60           C  
ATOM    980  CD1 TYR A 121     -21.250  18.982   5.783  1.00 27.87           C  
ATOM    981  CD2 TYR A 121     -21.937  18.100   7.897  1.00 27.31           C  
ATOM    982  CE1 TYR A 121     -22.105  20.064   5.948  1.00 29.66           C  
ATOM    983  CE2 TYR A 121     -22.803  19.184   8.073  1.00 27.72           C  
ATOM    984  CZ  TYR A 121     -22.879  20.157   7.096  1.00 31.61           C  
ATOM    985  OH  TYR A 121     -23.729  21.226   7.245  1.00 32.49           O  
ATOM    986  N   ILE A 122     -19.026  14.647   4.673  1.00 22.81           N  
ATOM    987  CA  ILE A 122     -17.889  13.764   4.452  1.00 22.80           C  
ATOM    988  C   ILE A 122     -16.931  14.205   5.557  1.00 24.06           C  
ATOM    989  O   ILE A 122     -16.654  15.400   5.706  1.00 21.08           O  
ATOM    990  CB  ILE A 122     -17.237  14.000   3.070  1.00 23.23           C  
ATOM    991  CG1 ILE A 122     -18.197  13.545   1.967  1.00 21.42           C  
ATOM    992  CG2 ILE A 122     -15.906  13.249   2.989  1.00 22.91           C  
ATOM    993  CD1 ILE A 122     -17.664  13.724   0.563  1.00 21.20           C  
ATOM    994  N   SER A 123     -16.438  13.251   6.337  1.00 23.16           N  
ATOM    995  CA  SER A 123     -15.556  13.584   7.445  1.00 23.72           C  
ATOM    996  C   SER A 123     -14.347  12.659   7.554  1.00 24.40           C  
ATOM    997  O   SER A 123     -14.342  11.557   7.000  1.00 23.03           O  
ATOM    998  CB  SER A 123     -16.338  13.494   8.762  1.00 21.77           C  
ATOM    999  OG  SER A 123     -17.611  14.103   8.662  1.00 21.67           O  
ATOM   1000  N   THR A 124     -13.323  13.125   8.269  1.00 22.39           N  
ATOM   1001  CA  THR A 124     -12.137  12.317   8.524  1.00 24.99           C  
ATOM   1002  C   THR A 124     -11.909  12.352  10.027  1.00 25.69           C  
ATOM   1003  O   THR A 124     -12.432  13.225  10.726  1.00 25.96           O  
ATOM   1004  CB  THR A 124     -10.859  12.865   7.855  1.00 24.23           C  
ATOM   1005  OG1 THR A 124     -10.590  14.183   8.343  1.00 27.06           O  
ATOM   1006  CG2 THR A 124     -11.003  12.882   6.346  1.00 24.78           C  
ATOM   1007  N   SER A 125     -11.133  11.398  10.520  1.00 27.10           N  
ATOM   1008  CA  SER A 125     -10.821  11.338  11.938  1.00 30.49           C  
ATOM   1009  C   SER A 125      -9.523  12.104  12.187  1.00 30.55           C  
ATOM   1010  O   SER A 125      -8.752  12.359  11.258  1.00 28.18           O  
ATOM   1011  CB  SER A 125     -10.655   9.878  12.369  1.00 39.71           C  
ATOM   1012  OG  SER A 125     -10.165   9.791  13.694  1.00 47.69           O  
ATOM   1013  N   GLN A 126      -9.298  12.488  13.439  1.00 30.36           N  
ATOM   1014  CA  GLN A 126      -8.078  13.189  13.810  1.00 31.92           C  
ATOM   1015  C   GLN A 126      -6.954  12.168  13.708  1.00 31.65           C  
ATOM   1016  O   GLN A 126      -5.830  12.495  13.331  1.00 32.25           O  
ATOM   1017  CB  GLN A 126      -8.167  13.694  15.251  1.00 46.04           C  
ATOM   1018  CG  GLN A 126      -9.172  14.811  15.480  1.00 56.54           C  
ATOM   1019  CD  GLN A 126      -8.568  16.191  15.297  1.00 62.73           C  
ATOM   1020  OE1 GLN A 126      -7.601  16.550  15.971  1.00 66.08           O  
ATOM   1021  NE2 GLN A 126      -9.138  16.975  14.388  1.00 66.20           N  
ATOM   1022  N   ALA A 127      -7.279  10.923  14.044  1.00 32.39           N  
ATOM   1023  CA  ALA A 127      -6.309   9.836  14.012  1.00 32.92           C  
ATOM   1024  C   ALA A 127      -5.804   9.551  12.613  1.00 34.88           C  
ATOM   1025  O   ALA A 127      -6.461   9.845  11.612  1.00 34.04           O  
ATOM   1026  CB  ALA A 127      -6.910   8.570  14.609  1.00 35.34           C  
ATOM   1027  N   GLU A 128      -4.631   8.942  12.569  1.00 30.48           N  
ATOM   1028  CA  GLU A 128      -3.960   8.599  11.332  1.00 31.32           C  
ATOM   1029  C   GLU A 128      -4.512   7.314  10.712  1.00 31.90           C  
ATOM   1030  O   GLU A 128      -4.976   6.415  11.420  1.00 31.84           O  
ATOM   1031  CB  GLU A 128      -2.468   8.430  11.639  1.00 41.94           C  
ATOM   1032  CG  GLU A 128      -1.528   8.544  10.470  1.00 48.20           C  
ATOM   1033  CD  GLU A 128      -1.463   9.949   9.913  1.00 46.73           C  
ATOM   1034  OE1 GLU A 128      -1.566  10.915  10.696  1.00 45.87           O  
ATOM   1035  OE2 GLU A 128      -1.293  10.083   8.690  1.00 50.96           O  
ATOM   1036  N   ASN A 129      -4.487   7.252   9.384  1.00 33.39           N  
ATOM   1037  CA  ASN A 129      -4.903   6.067   8.643  1.00 33.75           C  
ATOM   1038  C   ASN A 129      -6.289   5.488   8.947  1.00 33.56           C  
ATOM   1039  O   ASN A 129      -6.463   4.271   8.945  1.00 33.58           O  
ATOM   1040  CB  ASN A 129      -3.841   4.979   8.843  1.00 44.42           C  
ATOM   1041  CG  ASN A 129      -3.828   3.957   7.727  1.00 53.18           C  
ATOM   1042  OD1 ASN A 129      -3.599   4.294   6.566  1.00 54.81           O  
ATOM   1043  ND2 ASN A 129      -4.066   2.697   8.074  1.00 55.39           N  
ATOM   1044  N   MET A 130      -7.272   6.345   9.203  1.00 32.00           N  
ATOM   1045  CA  MET A 130      -8.632   5.880   9.474  1.00 30.17           C  
ATOM   1046  C   MET A 130      -9.495   6.120   8.233  1.00 28.86           C  
ATOM   1047  O   MET A 130      -9.191   6.988   7.415  1.00 26.67           O  
ATOM   1048  CB  MET A 130      -9.229   6.618  10.676  1.00 39.31           C  
ATOM   1049  CG  MET A 130      -8.585   6.264  12.014  1.00 44.74           C  
ATOM   1050  SD  MET A 130      -8.764   4.514  12.431  1.00 50.25           S  
ATOM   1051  CE  MET A 130     -10.470   4.484  13.005  1.00 49.43           C  
ATOM   1052  N   PRO A 131     -10.585   5.356   8.083  1.00 30.15           N  
ATOM   1053  CA  PRO A 131     -11.483   5.492   6.932  1.00 29.77           C  
ATOM   1054  C   PRO A 131     -12.184   6.843   6.865  1.00 26.94           C  
ATOM   1055  O   PRO A 131     -12.438   7.472   7.892  1.00 25.73           O  
ATOM   1056  CB  PRO A 131     -12.500   4.364   7.141  1.00 31.19           C  
ATOM   1057  CG  PRO A 131     -11.798   3.398   8.062  1.00 32.55           C  
ATOM   1058  CD  PRO A 131     -11.074   4.314   9.002  1.00 31.27           C  
ATOM   1059  N   VAL A 132     -12.488   7.288   5.651  1.00 25.23           N  
ATOM   1060  CA  VAL A 132     -13.228   8.533   5.469  1.00 23.72           C  
ATOM   1061  C   VAL A 132     -14.663   8.068   5.704  1.00 24.03           C  
ATOM   1062  O   VAL A 132     -15.029   6.966   5.289  1.00 19.66           O  
ATOM   1063  CB  VAL A 132     -13.068   9.070   4.032  1.00 23.80           C  
ATOM   1064  CG1 VAL A 132     -14.009  10.253   3.797  1.00 23.16           C  
ATOM   1065  CG2 VAL A 132     -11.618   9.499   3.814  1.00 22.77           C  
ATOM   1066  N   PHE A 133     -15.471   8.880   6.376  1.00 22.41           N  
ATOM   1067  CA  PHE A 133     -16.840   8.473   6.662  1.00 23.60           C  
ATOM   1068  C   PHE A 133     -17.830   9.624   6.594  1.00 23.10           C  
ATOM   1069  O   PHE A 133     -17.462  10.776   6.353  1.00 21.80           O  
ATOM   1070  CB  PHE A 133     -16.915   7.832   8.053  1.00 28.43           C  
ATOM   1071  CG  PHE A 133     -16.468   8.746   9.165  1.00 30.77           C  
ATOM   1072  CD1 PHE A 133     -15.117   9.018   9.362  1.00 31.41           C  
ATOM   1073  CD2 PHE A 133     -17.405   9.373   9.987  1.00 31.78           C  
ATOM   1074  CE1 PHE A 133     -14.703   9.901  10.358  1.00 32.51           C  
ATOM   1075  CE2 PHE A 133     -17.003  10.258  10.985  1.00 30.66           C  
ATOM   1076  CZ  PHE A 133     -15.648  10.524  11.172  1.00 32.66           C  
ATOM   1077  N   LEU A 134     -19.099   9.295   6.798  1.00 22.15           N  
ATOM   1078  CA  LEU A 134     -20.152  10.295   6.781  1.00 24.53           C  
ATOM   1079  C   LEU A 134     -20.474  10.622   8.236  1.00 26.75           C  
ATOM   1080  O   LEU A 134     -20.886   9.745   8.993  1.00 27.89           O  
ATOM   1081  CB  LEU A 134     -21.383   9.737   6.069  1.00 23.84           C  
ATOM   1082  CG  LEU A 134     -22.452  10.751   5.665  1.00 26.58           C  
ATOM   1083  CD1 LEU A 134     -21.858  11.768   4.703  1.00 26.27           C  
ATOM   1084  CD2 LEU A 134     -23.625  10.023   5.017  1.00 26.71           C  
ATOM   1085  N   GLY A 135     -20.267  11.878   8.624  1.00 26.62           N  
ATOM   1086  CA  GLY A 135     -20.529  12.288   9.994  1.00 30.44           C  
ATOM   1087  C   GLY A 135     -21.689  13.259  10.092  1.00 36.22           C  
ATOM   1088  O   GLY A 135     -21.904  14.069   9.191  1.00 36.93           O  
ATOM   1089  N   GLY A 136     -22.435  13.187  11.191  1.00 38.84           N  
ATOM   1090  CA  GLY A 136     -23.577  14.068  11.360  1.00 45.18           C  
ATOM   1091  C   GLY A 136     -23.362  15.207  12.337  1.00 49.21           C  
ATOM   1092  O   GLY A 136     -24.322  15.719  12.917  1.00 49.61           O  
ATOM   1093  N   THR A 137     -22.110  15.616  12.519  1.00 59.68           N  
ATOM   1094  CA  THR A 137     -21.800  16.703  13.439  1.00 63.71           C  
ATOM   1095  C   THR A 137     -20.645  17.575  12.954  1.00 66.67           C  
ATOM   1096  O   THR A 137     -19.689  17.083  12.355  1.00 66.86           O  
ATOM   1097  CB  THR A 137     -21.442  16.159  14.838  1.00 76.67           C  
ATOM   1098  OG1 THR A 137     -20.357  15.231  14.725  1.00 78.28           O  
ATOM   1099  CG2 THR A 137     -22.639  15.457  15.462  1.00 77.90           C  
ATOM   1100  N   LYS A 138     -20.748  18.875  13.218  1.00 66.72           N  
ATOM   1101  CA  LYS A 138     -19.717  19.837  12.838  1.00 69.60           C  
ATOM   1102  C   LYS A 138     -19.114  20.454  14.095  1.00 72.39           C  
ATOM   1103  O   LYS A 138     -19.725  20.423  15.163  1.00 72.30           O  
ATOM   1104  CB  LYS A 138     -20.308  20.946  11.967  1.00 65.97           C  
ATOM   1105  CG  LYS A 138     -20.689  20.513  10.565  1.00 66.69           C  
ATOM   1106  CD  LYS A 138     -21.341  21.656   9.798  1.00 68.32           C  
ATOM   1107  CE  LYS A 138     -20.412  22.850   9.659  1.00 70.12           C  
ATOM   1108  NZ  LYS A 138     -21.065  23.967   8.922  1.00 71.22           N  
ATOM   1109  N   GLY A 139     -17.917  21.018  13.964  1.00100.62           N  
ATOM   1110  CA  GLY A 139     -17.265  21.630  15.107  1.00103.38           C  
ATOM   1111  C   GLY A 139     -17.082  20.654  16.253  1.00104.11           C  
ATOM   1112  O   GLY A 139     -17.067  21.046  17.421  1.00106.74           O  
ATOM   1113  N   GLY A 140     -16.948  19.375  15.917  1.00 80.44           N  
ATOM   1114  CA  GLY A 140     -16.762  18.356  16.933  1.00 78.08           C  
ATOM   1115  C   GLY A 140     -15.340  17.832  16.938  1.00 76.61           C  
ATOM   1116  O   GLY A 140     -14.395  18.573  16.665  1.00 76.58           O  
ATOM   1117  N   GLN A 141     -15.188  16.548  17.241  1.00 63.82           N  
ATOM   1118  CA  GLN A 141     -13.873  15.919  17.283  1.00 60.97           C  
ATOM   1119  C   GLN A 141     -13.434  15.510  15.879  1.00 55.28           C  
ATOM   1120  O   GLN A 141     -12.246  15.335  15.615  1.00 55.47           O  
ATOM   1121  CB  GLN A 141     -13.907  14.680  18.184  1.00 92.84           C  
ATOM   1122  CG  GLN A 141     -14.537  14.904  19.554  1.00103.43           C  
ATOM   1123  CD  GLN A 141     -16.040  15.125  19.484  1.00108.33           C  
ATOM   1124  OE1 GLN A 141     -16.781  14.274  18.992  1.00112.75           O  
ATOM   1125  NE2 GLN A 141     -16.495  16.269  19.980  1.00111.64           N  
ATOM   1126  N   ASP A 142     -14.405  15.362  14.984  1.00 48.02           N  
ATOM   1127  CA  ASP A 142     -14.128  14.961  13.610  1.00 40.94           C  
ATOM   1128  C   ASP A 142     -13.927  16.155  12.677  1.00 35.95           C  
ATOM   1129  O   ASP A 142     -14.420  17.251  12.937  1.00 36.16           O  
ATOM   1130  CB  ASP A 142     -15.262  14.068  13.103  1.00 44.45           C  
ATOM   1131  CG  ASP A 142     -15.476  12.853  13.985  1.00 43.48           C  
ATOM   1132  OD1 ASP A 142     -14.477  12.187  14.336  1.00 42.40           O  
ATOM   1133  OD2 ASP A 142     -16.639  12.556  14.326  1.00 42.73           O  
ATOM   1134  N   ILE A 143     -13.202  15.930  11.587  1.00 34.46           N  
ATOM   1135  CA  ILE A 143     -12.901  16.985  10.626  1.00 28.91           C  
ATOM   1136  C   ILE A 143     -13.867  16.959   9.445  1.00 27.22           C  
ATOM   1137  O   ILE A 143     -14.093  15.910   8.841  1.00 26.76           O  
ATOM   1138  CB  ILE A 143     -11.450  16.842  10.122  1.00 31.71           C  
ATOM   1139  CG1 ILE A 143     -10.504  16.760  11.325  1.00 31.31           C  
ATOM   1140  CG2 ILE A 143     -11.073  18.029   9.240  1.00 27.96           C  
ATOM   1141  CD1 ILE A 143      -9.077  16.382  10.967  1.00 33.05           C  
ATOM   1142  N   THR A 144     -14.434  18.117   9.116  1.00 27.29           N  
ATOM   1143  CA  THR A 144     -15.389  18.209   8.018  1.00 26.21           C  
ATOM   1144  C   THR A 144     -14.990  19.259   6.992  1.00 24.99           C  
ATOM   1145  O   THR A 144     -15.693  19.466   6.007  1.00 24.20           O  
ATOM   1146  CB  THR A 144     -16.807  18.547   8.548  1.00 28.59           C  
ATOM   1147  OG1 THR A 144     -16.773  19.793   9.256  1.00 30.58           O  
ATOM   1148  CG2 THR A 144     -17.294  17.463   9.495  1.00 30.03           C  
ATOM   1149  N   ASP A 145     -13.861  19.918   7.222  1.00 22.17           N  
ATOM   1150  CA  ASP A 145     -13.375  20.960   6.322  1.00 24.14           C  
ATOM   1151  C   ASP A 145     -12.201  20.476   5.475  1.00 21.53           C  
ATOM   1152  O   ASP A 145     -11.309  19.789   5.975  1.00 21.75           O  
ATOM   1153  CB  ASP A 145     -12.945  22.186   7.133  1.00 47.64           C  
ATOM   1154  CG  ASP A 145     -14.103  22.840   7.855  1.00 55.23           C  
ATOM   1155  OD1 ASP A 145     -13.855  23.688   8.732  1.00 61.23           O  
ATOM   1156  OD2 ASP A 145     -15.265  22.514   7.542  1.00 54.08           O  
ATOM   1157  N   PHE A 146     -12.208  20.843   4.198  1.00 21.69           N  
ATOM   1158  CA  PHE A 146     -11.152  20.454   3.266  1.00 22.01           C  
ATOM   1159  C   PHE A 146     -10.725  21.628   2.394  1.00 20.88           C  
ATOM   1160  O   PHE A 146     -11.384  22.667   2.358  1.00 22.61           O  
ATOM   1161  CB  PHE A 146     -11.641  19.362   2.304  1.00 22.25           C  
ATOM   1162  CG  PHE A 146     -12.138  18.121   2.980  1.00 25.10           C  
ATOM   1163  CD1 PHE A 146     -13.388  18.096   3.585  1.00 27.31           C  
ATOM   1164  CD2 PHE A 146     -11.350  16.975   3.011  1.00 24.56           C  
ATOM   1165  CE1 PHE A 146     -13.849  16.942   4.214  1.00 27.11           C  
ATOM   1166  CE2 PHE A 146     -11.797  15.819   3.635  1.00 24.85           C  
ATOM   1167  CZ  PHE A 146     -13.051  15.799   4.241  1.00 25.76           C  
ATOM   1168  N   THR A 147      -9.611  21.446   1.693  1.00 23.99           N  
ATOM   1169  CA  THR A 147      -9.147  22.426   0.724  1.00 24.42           C  
ATOM   1170  C   THR A 147      -9.048  21.584  -0.538  1.00 24.42           C  
ATOM   1171  O   THR A 147      -8.898  20.356  -0.468  1.00 22.59           O  
ATOM   1172  CB  THR A 147      -7.768  23.023   1.057  1.00 31.93           C  
ATOM   1173  OG1 THR A 147      -6.802  21.976   1.173  1.00 30.58           O  
ATOM   1174  CG2 THR A 147      -7.837  23.821   2.347  1.00 33.96           C  
ATOM   1175  N   MET A 148      -9.140  22.232  -1.688  1.00 23.84           N  
ATOM   1176  CA  MET A 148      -9.095  21.527  -2.956  1.00 26.95           C  
ATOM   1177  C   MET A 148      -7.950  22.006  -3.829  1.00 28.13           C  
ATOM   1178  O   MET A 148      -7.650  23.195  -3.877  1.00 29.35           O  
ATOM   1179  CB  MET A 148     -10.431  21.728  -3.671  1.00 29.01           C  
ATOM   1180  CG  MET A 148     -10.438  21.471  -5.164  1.00 36.44           C  
ATOM   1181  SD  MET A 148     -12.113  21.733  -5.821  1.00 41.57           S  
ATOM   1182  CE  MET A 148     -12.425  23.417  -5.311  1.00 43.88           C  
ATOM   1183  N   GLN A 149      -7.303  21.064  -4.507  1.00 25.16           N  
ATOM   1184  CA  GLN A 149      -6.202  21.382  -5.404  1.00 27.40           C  
ATOM   1185  C   GLN A 149      -6.608  20.930  -6.798  1.00 29.09           C  
ATOM   1186  O   GLN A 149      -7.040  19.790  -6.977  1.00 26.20           O  
ATOM   1187  CB  GLN A 149      -4.919  20.648  -4.980  1.00 28.57           C  
ATOM   1188  CG  GLN A 149      -4.391  21.033  -3.605  1.00 29.49           C  
ATOM   1189  CD  GLN A 149      -5.166  20.398  -2.461  1.00 32.47           C  
ATOM   1190  OE1 GLN A 149      -5.389  21.028  -1.423  1.00 31.49           O  
ATOM   1191  NE2 GLN A 149      -5.565  19.142  -2.635  1.00 29.97           N  
ATOM   1192  N   PHE A 150      -6.494  21.821  -7.778  1.00 32.87           N  
ATOM   1193  CA  PHE A 150      -6.835  21.466  -9.152  1.00 37.81           C  
ATOM   1194  C   PHE A 150      -5.619  20.804  -9.784  1.00 41.64           C  
ATOM   1195  O   PHE A 150      -4.495  21.258  -9.593  1.00 43.23           O  
ATOM   1196  CB  PHE A 150      -7.210  22.703  -9.971  1.00 39.80           C  
ATOM   1197  CG  PHE A 150      -8.433  23.414  -9.480  1.00 40.24           C  
ATOM   1198  CD1 PHE A 150      -8.370  24.256  -8.375  1.00 42.45           C  
ATOM   1199  CD2 PHE A 150      -9.654  23.248 -10.126  1.00 42.62           C  
ATOM   1200  CE1 PHE A 150      -9.505  24.923  -7.920  1.00 41.50           C  
ATOM   1201  CE2 PHE A 150     -10.797  23.911  -9.679  1.00 42.80           C  
ATOM   1202  CZ  PHE A 150     -10.721  24.750  -8.573  1.00 42.99           C  
ATOM   1203  N   VAL A 151      -5.841  19.727 -10.529  1.00 32.38           N  
ATOM   1204  CA  VAL A 151      -4.741  19.029 -11.184  1.00 38.58           C  
ATOM   1205  C   VAL A 151      -4.877  19.205 -12.694  1.00 44.92           C  
ATOM   1206  O   VAL A 151      -5.987  19.207 -13.226  1.00 43.33           O  
ATOM   1207  CB  VAL A 151      -4.730  17.524 -10.827  1.00 50.18           C  
ATOM   1208  CG1 VAL A 151      -4.652  17.349  -9.320  1.00 50.46           C  
ATOM   1209  CG2 VAL A 151      -5.963  16.851 -11.369  1.00 49.52           C  
ATOM   1210  N   SER A 152      -3.740  19.359 -13.367  1.00 89.49           N  
ATOM   1211  CA  SER A 152      -3.678  19.573 -14.814  1.00 95.46           C  
ATOM   1212  C   SER A 152      -4.629  18.745 -15.676  1.00 99.60           C  
ATOM   1213  O   SER A 152      -4.801  19.036 -16.861  1.00101.49           O  
ATOM   1214  CB  SER A 152      -2.244  19.360 -15.309  1.00 88.43           C  
ATOM   1215  OG  SER A 152      -1.823  18.025 -15.096  1.00 91.65           O  
ATOM   1216  N   SER A 153      -5.237  17.715 -15.096  1.00 97.50           N  
ATOM   1217  CA  SER A 153      -6.166  16.865 -15.835  1.00103.97           C  
ATOM   1218  C   SER A 153      -5.449  16.109 -16.951  1.00106.02           C  
ATOM   1219  O   SER A 153      -4.222  16.287 -17.093  1.00110.06           O  
ATOM   1220  CB  SER A 153      -7.298  17.711 -16.429  1.00 97.03           C  
ATOM   1221  OG  SER A 153      -8.150  16.933 -17.252  1.00 96.87           O  
ATOM   1222  OXT SER A 153      -6.124  15.343 -17.671  1.00102.81           O  
TER    1223      SER A 153                                                      
HETATM 1224  O   HOH A 154     -17.362  17.865   4.522  1.00 23.78           O  
HETATM 1225  O   HOH A 155     -20.828  11.303  -6.088  1.00 24.36           O  
HETATM 1226  O   HOH A 156      -5.422  13.925  -1.174  1.00 31.86           O  
HETATM 1227  O   HOH A 157      -7.652  13.507  -2.906  1.00 24.67           O  
HETATM 1228  O   HOH A 158     -14.734  -5.296  -7.292  1.00 36.12           O  
HETATM 1229  O   HOH A 159      -7.539   9.066   9.150  1.00 30.61           O  
HETATM 1230  O   HOH A 160     -19.903   6.453   6.857  1.00 27.88           O  
HETATM 1231  O   HOH A 161     -19.204  25.696  -3.261  1.00 38.79           O  
HETATM 1232  O   HOH A 162      -6.094  21.604   3.804  1.00 36.17           O  
HETATM 1233  O   HOH A 163     -17.552  12.937 -11.628  1.00 31.01           O  
HETATM 1234  O   HOH A 164      -0.839  14.957   3.395  1.00 31.81           O  
HETATM 1235  O   HOH A 165     -23.517  22.074 -10.159  1.00 32.32           O  
HETATM 1236  O   HOH A 166     -10.285   9.461   8.647  1.00 33.59           O  
HETATM 1237  O   HOH A 167     -26.243  12.463  -1.193  1.00 41.33           O  
HETATM 1238  O   HOH A 168     -17.786   1.569   0.324  1.00 36.40           O  
HETATM 1239  O   HOH A 169      -9.706  24.787  -1.664  1.00 35.06           O  
HETATM 1240  O   HOH A 170     -30.566   7.494  -5.230  1.00 39.73           O  
HETATM 1241  O   HOH A 171     -21.960   7.116   8.796  1.00 45.76           O  
HETATM 1242  O   HOH A 172     -29.456   6.721  -0.482  1.00 40.58           O  
HETATM 1243  O   HOH A 173     -22.112  20.361 -15.900  1.00 44.20           O  
HETATM 1244  O   HOH A 174     -13.408  20.632  10.666  1.00 39.26           O  
HETATM 1245  O   HOH A 175     -18.681  14.688  11.303  1.00 42.30           O  
HETATM 1246  O   HOH A 176     -18.748  12.991  13.176  1.00 42.22           O  
HETATM 1247  O   HOH A 177     -14.423   5.554   2.726  1.00 37.18           O  
HETATM 1248  O   HOH A 178     -11.495  12.552  15.319  1.00 49.99           O  
HETATM 1249  O   HOH A 179     -14.979   8.844 -12.332  1.00 43.86           O  
HETATM 1250  O   HOH A 180     -28.277  15.523 -10.261  1.00 55.38           O  
HETATM 1251  O   HOH A 181     -28.449  20.068  -4.150  1.00 50.66           O  
HETATM 1252  O   HOH A 182     -33.852  14.714   1.767  1.00 50.16           O  
HETATM 1253  O   HOH A 183     -25.000   1.838 -13.155  1.00 43.44           O  
HETATM 1254  O   HOH A 184     -20.744  -1.149  -5.941  1.00 40.73           O  
HETATM 1255  O   HOH A 185     -12.739   6.603  10.499  1.00 48.54           O  
HETATM 1256  O   HOH A 186      -1.984  10.502  -7.246  1.00 42.95           O  
HETATM 1257  O   HOH A 187     -30.837   4.499  13.516  1.00 60.76           O  
HETATM 1258  O   HOH A 188      -3.055   8.119  14.860  1.00 43.28           O  
HETATM 1259  O   HOH A 189      -9.325  19.231 -14.573  1.00 49.18           O  
HETATM 1260  O   HOH A 190     -28.025  22.025   5.726  1.00 43.33           O  
HETATM 1261  O   HOH A 191     -16.453   4.863   5.914  1.00 44.44           O  
HETATM 1262  O   HOH A 192     -16.746  10.994 -13.141  1.00 55.11           O  
HETATM 1263  O   HOH A 193     -24.034  18.478  11.617  1.00 56.63           O  
HETATM 1264  O   HOH A 194     -26.090  28.367   0.824  1.00 88.86           O  
HETATM 1265  O   HOH A 195     -30.404  22.617   8.256  1.00 53.82           O  
HETATM 1266  O   HOH A 196     -13.236  -1.732   0.194  1.00 51.85           O  
HETATM 1267  O   HOH A 197     -28.655  13.258 -17.316  1.00 52.49           O  
HETATM 1268  O   HOH A 198     -30.475   4.379   1.513  1.00 48.75           O  
HETATM 1269  O   HOH A 199      -4.640   5.511  -3.248  1.00 48.07           O  
HETATM 1270  O   HOH A 200     -19.918  28.424  -3.964  1.00 64.54           O  
HETATM 1271  O   HOH A 201      -5.361  -0.188   5.359  1.00 56.47           O  
HETATM 1272  O   HOH A 202     -21.123   1.311   2.489  1.00 71.85           O  
HETATM 1273  O   HOH A 203     -30.780   0.633   7.559  1.00 58.19           O  
HETATM 1274  O   HOH A 204     -12.746  10.304 -14.781  1.00 53.18           O  
HETATM 1275  O   HOH A 205     -17.623  25.666  -7.673  1.00 45.87           O  
HETATM 1276  O   HOH A 206     -29.519  19.710  -1.744  1.00 50.57           O  
HETATM 1277  O   HOH A 207     -15.723   2.087   4.947  1.00 62.58           O  
HETATM 1278  O   HOH A 208      -2.310  17.843  -5.354  1.00 54.90           O  
HETATM 1279  O   HOH A 209     -11.491  23.493  10.398  1.00 56.95           O  
HETATM 1280  O   HOH A 210     -31.923   1.693  14.867  1.00 64.90           O  
HETATM 1281  O   HOH A 211      -8.458   3.851 -14.090  1.00 59.27           O  
HETATM 1282  O   HOH A 212      -3.878   7.869  -7.133  1.00 65.36           O  
HETATM 1283  O   HOH A 213     -22.135  11.392  13.348  1.00 61.37           O  
HETATM 1284  O   HOH A 214     -26.842  15.827  11.575  1.00 45.67           O  
HETATM 1285  O   HOH A 215     -16.523  -6.257  -5.558  1.00 74.64           O  
HETATM 1286  O   HOH A 216      -5.899  23.729   5.432  1.00 48.70           O  
HETATM 1287  O   HOH A 217      -0.621  13.155  -6.660  1.00 64.04           O  
HETATM 1288  O   HOH A 218     -29.846  16.829  -7.583  1.00 53.49           O  
HETATM 1289  O   HOH A 219      -5.902   8.394  -8.650  1.00 51.50           O  
HETATM 1290  O   HOH A 220     -23.195  19.193 -23.960  1.00 94.85           O  
HETATM 1291  O   HOH A 221     -15.372  25.189  -9.228  1.00 63.84           O  
HETATM 1292  O   HOH A 222     -19.714  -0.504  -2.647  1.00 55.69           O  
HETATM 1293  O   HOH A 223     -18.798   4.013   5.713  1.00 91.52           O  
HETATM 1294  O   HOH A 224       5.725  16.506  -0.804  1.00 50.30           O  
HETATM 1295  O   HOH A 225     -17.196  15.473 -17.874  1.00 54.22           O  
HETATM 1296  O   HOH A 226     -25.415  19.270 -15.169  1.00 78.55           O  
HETATM 1297  O   HOH A 227     -27.276  22.711 -10.294  1.00 53.05           O  
HETATM 1298  O   HOH A 228     -16.117   3.688   8.935  1.00 56.76           O  
HETATM 1299  O   HOH A 229      -0.259   8.374  14.775  1.00 69.89           O  
HETATM 1300  O   HOH A 230      -6.690  18.202 -19.428  1.00 87.47           O  
HETATM 1301  O   HOH A 231     -14.871  25.447  -4.688  1.00 85.34           O  
HETATM 1302  O   HOH A 232      -1.552  18.619 -11.860  1.00 52.92           O  
HETATM 1303  O   HOH A 233     -28.597  -2.124   7.475  1.00 74.49           O  
HETATM 1304  O   HOH A 234     -22.198  23.962 -14.382  1.00 60.54           O  
HETATM 1305  O   HOH A 235     -30.662  14.281  -8.120  1.00 57.84           O  
HETATM 1306  O   HOH A 236     -29.772  22.090 -11.646  1.00 73.52           O  
HETATM 1307  O   HOH A 237     -20.185   7.650 -20.052  1.00 60.19           O  
HETATM 1308  O   HOH A 238     -12.489  15.435 -14.744  1.00 61.76           O  
HETATM 1309  O   HOH A 239      -3.220  12.375  12.001  1.00 77.69           O  
HETATM 1310  O   HOH A 240     -24.630   5.996 -22.045  1.00 73.87           O  
HETATM 1311  O   HOH A 241      -1.176  20.278  -5.737  1.00 56.99           O  
HETATM 1312  O   HOH A 242     -36.668  15.556   0.624  1.00 58.05           O  
HETATM 1313  O   HOH A 243     -16.681   3.655   2.537  1.00 62.08           O  
HETATM 1314  O   HOH A 244      -6.470   2.807 -15.522  1.00 56.66           O  
HETATM 1315  O   HOH A 245     -25.942  -0.780 -13.113  1.00 67.58           O  
MASTER      236    0    0    2   14    0    0    6 1314    1    0   12          
END                                                                             



If you find results from this site helpful for your research, please cite one of our papers:

elNémo is maintained by Yves-Henri Sanejouand.
It was developed by Karsten Suhre.
Between 2003 and 2014, it was hosted by IGS (Marseille).
Last modification: October 18th, 2018.