CNRS Nantes University UFIP UFIP
home |  start a new run |  job status |  references&downloads |  examples |  help  

Should you encounter any unexpected behaviour,
please let us know.


***    ***

elNémo ID: 20020920221983803

Job options:

ID        	=	 20020920221983803
JOBID     	=	 
USERID    	=	 unknown
PRIVAT    	=	 0

NMODES    	=	 5
DQMIN     	=	 -100
DQMAX     	=	 100
DQSTEP    	=	 20
DOGRAPHS  	=	 on

DOPROJMODS	=	 0
DORMSD    	=	 0

NRBL      	=	 0
CUTOFF    	=	 0
CAONLY    	=	 0


Input data for this run:


data_2CME
# 
_entry.id   2CME 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2CME         
PDBE  EBI-28665    
WWPDB D_1290028665 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2CME 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2006-05-06 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Meier, C.'       1 
'Aricescu, A.R.'  2 
'Assenberg, R.'   3 
'Aplin, R.T.'     4 
'Gilbert, R.J.C.' 5 
'Grimes, J.M.'    6 
'Stuart, D.I.'    7 
# 
_citation.id                        primary 
_citation.title                     'The Crystal Structure of Orf-9B, a Lipid Binding Protein from the Sars Coronavirus.' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            14 
_citation.page_first                1157 
_citation.page_last                 ? 
_citation.year                      2006 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16843897 
_citation.pdbx_database_id_DOI      10.1016/J.STR.2006.05.012 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Meier, C.'       1 
primary 'Aricescu, A.R.'  2 
primary 'Assenberg, R.'   3 
primary 'Aplin, R.T.'     4 
primary 'Gilbert, R.J.C.' 5 
primary 'Grimes, J.M.'    6 
primary 'Stuart, D.I.'    7 
# 
_cell.entry_id           2CME 
_cell.length_a           140.028 
_cell.length_b           140.028 
_cell.length_c           45.146 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2CME 
_symmetry.space_group_name_H-M             'P 42' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                77 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'HYPOTHETICAL PROTEIN 5' 8591.003 1 ? ? ? ?                                                                
2 polymer     man 'HYPOTHETICAL PROTEIN 5' 8748.196 1 ? ? ? 'CONTAINS LIPID MOLECULE (MODELLED AS DECANE, RESIDUE NAME D10)' 
3 polymer     man 'HYPOTHETICAL PROTEIN 5' 8420.795 4 ? ? ? 'CONTAINS LIPID MOLECULE (MODELLED AS DECANE, RESIDUE NAME D10)' 
4 polymer     man 'HYPOTHETICAL PROTEIN 5' 8519.924 2 ? ? ? ?                                                                
5 non-polymer syn DECANE                   142.282  4 ? ? ? ?                                                                
6 water       nat water                    18.015   7 ? ? ? ?                                                                
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'ORF-9B, ORF13' 
2 'ORF-9B, ORF13' 
3 'ORF-9B, ORF13' 
4 'ORF-9B, ORF13' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no VPPALHLVDPQIQLTITADPKVYPIILRLGSNLSLSMARRNLDSLEARAFQSTPIVVQMTKLATTEELPDEFVVVTAK  
VPPALHLVDPQIQLTITADPKVYPIILRLGSNLSLSMARRNLDSLEARAFQSTPIVVQMTKLATTEELPDEFVVVTAK  A       ? 
2 'polypeptide(L)' no no VPPALHLVDPQIQLTITRADPKVYPIILRLGSNLSLSMARRNLDSLEARAFQSTPIVVQMTKLATTEELPDEFVVVTAK 
VPPALHLVDPQIQLTITRADPKVYPIILRLGSNLSLSMARRNLDSLEARAFQSTPIVVQMTKLATTEELPDEFVVVTAK B       ? 
3 'polypeptide(L)' no no PPALHLVDPQIQLTITDPKVYPIILRLGSNLSLSMARRNLDSLEARAFQSTPIVVQMTKLATTEELPDEFVVVTAK    
PPALHLVDPQIQLTITDPKVYPIILRLGSNLSLSMARRNLDSLEARAFQSTPIVVQMTKLATTEELPDEFVVVTAK    C,D,F,H ? 
4 'polypeptide(L)' no no VPPALHLVDPQIQLTITDPKVYPIILRLGSNLSLSMARRNLDSLEARAFQSTPIVVQMTKLATTEELPDEFVVVTAK   
VPPALHLVDPQIQLTITDPKVYPIILRLGSNLSLSMARRNLDSLEARAFQSTPIVVQMTKLATTEELPDEFVVVTAK   E,G     ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  VAL n 
1 2  PRO n 
1 3  PRO n 
1 4  ALA n 
1 5  LEU n 
1 6  HIS n 
1 7  LEU n 
1 8  VAL n 
1 9  ASP n 
1 10 PRO n 
1 11 GLN n 
1 12 ILE n 
1 13 GLN n 
1 14 LEU n 
1 15 THR n 
1 16 ILE n 
1 17 THR n 
1 18 ALA n 
1 19 ASP n 
1 20 PRO n 
1 21 LYS n 
1 22 VAL n 
1 23 TYR n 
1 24 PRO n 
1 25 ILE n 
1 26 ILE n 
1 27 LEU n 
1 28 ARG n 
1 29 LEU n 
1 30 GLY n 
1 31 SER n 
1 32 ASN n 
1 33 LEU n 
1 34 SER n 
1 35 LEU n 
1 36 SER n 
1 37 MET n 
1 38 ALA n 
1 39 ARG n 
1 40 ARG n 
1 41 ASN n 
1 42 LEU n 
1 43 ASP n 
1 44 SER n 
1 45 LEU n 
1 46 GLU n 
1 47 ALA n 
1 48 ARG n 
1 49 ALA n 
1 50 PHE n 
1 51 GLN n 
1 52 SER n 
1 53 THR n 
1 54 PRO n 
1 55 ILE n 
1 56 VAL n 
1 57 VAL n 
1 58 GLN n 
1 59 MET n 
1 60 THR n 
1 61 LYS n 
1 62 LEU n 
1 63 ALA n 
1 64 THR n 
1 65 THR n 
1 66 GLU n 
1 67 GLU n 
1 68 LEU n 
1 69 PRO n 
1 70 ASP n 
1 71 GLU n 
1 72 PHE n 
1 73 VAL n 
1 74 VAL n 
1 75 VAL n 
1 76 THR n 
1 77 ALA n 
1 78 LYS n 
2 1  VAL n 
2 2  PRO n 
2 3  PRO n 
2 4  ALA n 
2 5  LEU n 
2 6  HIS n 
2 7  LEU n 
2 8  VAL n 
2 9  ASP n 
2 10 PRO n 
2 11 GLN n 
2 12 ILE n 
2 13 GLN n 
2 14 LEU n 
2 15 THR n 
2 16 ILE n 
2 17 THR n 
2 18 ARG n 
2 19 ALA n 
2 20 ASP n 
2 21 PRO n 
2 22 LYS n 
2 23 VAL n 
2 24 TYR n 
2 25 PRO n 
2 26 ILE n 
2 27 ILE n 
2 28 LEU n 
2 29 ARG n 
2 30 LEU n 
2 31 GLY n 
2 32 SER n 
2 33 ASN n 
2 34 LEU n 
2 35 SER n 
2 36 LEU n 
2 37 SER n 
2 38 MET n 
2 39 ALA n 
2 40 ARG n 
2 41 ARG n 
2 42 ASN n 
2 43 LEU n 
2 44 ASP n 
2 45 SER n 
2 46 LEU n 
2 47 GLU n 
2 48 ALA n 
2 49 ARG n 
2 50 ALA n 
2 51 PHE n 
2 52 GLN n 
2 53 SER n 
2 54 THR n 
2 55 PRO n 
2 56 ILE n 
2 57 VAL n 
2 58 VAL n 
2 59 GLN n 
2 60 MET n 
2 61 THR n 
2 62 LYS n 
2 63 LEU n 
2 64 ALA n 
2 65 THR n 
2 66 THR n 
2 67 GLU n 
2 68 GLU n 
2 69 LEU n 
2 70 PRO n 
2 71 ASP n 
2 72 GLU n 
2 73 PHE n 
2 74 VAL n 
2 75 VAL n 
2 76 VAL n 
2 77 THR n 
2 78 ALA n 
2 79 LYS n 
3 1  PRO n 
3 2  PRO n 
3 3  ALA n 
3 4  LEU n 
3 5  HIS n 
3 6  LEU n 
3 7  VAL n 
3 8  ASP n 
3 9  PRO n 
3 10 GLN n 
3 11 ILE n 
3 12 GLN n 
3 13 LEU n 
3 14 THR n 
3 15 ILE n 
3 16 THR n 
3 17 ASP n 
3 18 PRO n 
3 19 LYS n 
3 20 VAL n 
3 21 TYR n 
3 22 PRO n 
3 23 ILE n 
3 24 ILE n 
3 25 LEU n 
3 26 ARG n 
3 27 LEU n 
3 28 GLY n 
3 29 SER n 
3 30 ASN n 
3 31 LEU n 
3 32 SER n 
3 33 LEU n 
3 34 SER n 
3 35 MET n 
3 36 ALA n 
3 37 ARG n 
3 38 ARG n 
3 39 ASN n 
3 40 LEU n 
3 41 ASP n 
3 42 SER n 
3 43 LEU n 
3 44 GLU n 
3 45 ALA n 
3 46 ARG n 
3 47 ALA n 
3 48 PHE n 
3 49 GLN n 
3 50 SER n 
3 51 THR n 
3 52 PRO n 
3 53 ILE n 
3 54 VAL n 
3 55 VAL n 
3 56 GLN n 
3 57 MET n 
3 58 THR n 
3 59 LYS n 
3 60 LEU n 
3 61 ALA n 
3 62 THR n 
3 63 THR n 
3 64 GLU n 
3 65 GLU n 
3 66 LEU n 
3 67 PRO n 
3 68 ASP n 
3 69 GLU n 
3 70 PHE n 
3 71 VAL n 
3 72 VAL n 
3 73 VAL n 
3 74 THR n 
3 75 ALA n 
3 76 LYS n 
4 1  VAL n 
4 2  PRO n 
4 3  PRO n 
4 4  ALA n 
4 5  LEU n 
4 6  HIS n 
4 7  LEU n 
4 8  VAL n 
4 9  ASP n 
4 10 PRO n 
4 11 GLN n 
4 12 ILE n 
4 13 GLN n 
4 14 LEU n 
4 15 THR n 
4 16 ILE n 
4 17 THR n 
4 18 ASP n 
4 19 PRO n 
4 20 LYS n 
4 21 VAL n 
4 22 TYR n 
4 23 PRO n 
4 24 ILE n 
4 25 ILE n 
4 26 LEU n 
4 27 ARG n 
4 28 LEU n 
4 29 GLY n 
4 30 SER n 
4 31 ASN n 
4 32 LEU n 
4 33 SER n 
4 34 LEU n 
4 35 SER n 
4 36 MET n 
4 37 ALA n 
4 38 ARG n 
4 39 ARG n 
4 40 ASN n 
4 41 LEU n 
4 42 ASP n 
4 43 SER n 
4 44 LEU n 
4 45 GLU n 
4 46 ALA n 
4 47 ARG n 
4 48 ALA n 
4 49 PHE n 
4 50 GLN n 
4 51 SER n 
4 52 THR n 
4 53 PRO n 
4 54 ILE n 
4 55 VAL n 
4 56 VAL n 
4 57 GLN n 
4 58 MET n 
4 59 THR n 
4 60 LYS n 
4 61 LEU n 
4 62 ALA n 
4 63 THR n 
4 64 THR n 
4 65 GLU n 
4 66 GLU n 
4 67 LEU n 
4 68 PRO n 
4 69 ASP n 
4 70 GLU n 
4 71 PHE n 
4 72 VAL n 
4 73 VAL n 
4 74 VAL n 
4 75 THR n 
4 76 ALA n 
4 77 LYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? SARS ? ? ? HKU-39849 ? ? ? ? 'HUMAN SARS CORONAVIRUS' 227859 ? 'VERO E6' ? ? ? ? ? ? 'ESCHERICHIA COLI' 562 ? ? ? 
? ? ? 'ROSETTA PLYSS' ? ? ? ? ? ? ? ? PDEST-14 ? ? GATEWAY ? ? 
2 1 sample ? ? ? SARS ? ? ? HKU-39849 ? ? ? ? 'HUMAN SARS CORONAVIRUS' 227859 ? 'VERO E6' ? ? ? ? ? ? 'ESCHERICHIA COLI' 562 ? ? ? 
? ? ? 'ROSETTA PLYSS' ? ? ? ? ? ? ? ? PDEST-14 ? ? GATEWAY ? ? 
3 1 sample ? ? ? SARS ? ? ? HKU-39849 ? ? ? ? 'HUMAN SARS CORONAVIRUS' 227859 ? 'VERO E6' ? ? ? ? ? ? 'ESCHERICHIA COLI' 562 ? ? ? 
? ? ? 'ROSETTA PLYSS' ? ? ? ? ? ? ? ? PDEST-14 ? ? GATEWAY ? ? 
4 1 sample ? ? ? SARS ? ? ? HKU-39849 ? ? ? ? 'HUMAN SARS CORONAVIRUS' 227859 ? 'VERO E6' ? ? ? ? ? ? 'ESCHERICHIA COLI' 562 ? ? ? 
? ? ? 'ROSETTA PLYSS' ? ? ? ? ? ? ? ? PDEST-14 ? ? GATEWAY ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP Y5_CVHSA 1 ? ? P59636 ? 
2 UNP Y5_CVHSA 2 ? ? P59636 ? 
3 UNP Y5_CVHSA 3 ? ? P59636 ? 
4 UNP Y5_CVHSA 4 ? ? P59636 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 2CME A 1  ? 17 ? P59636 9  ? 25 ? 9  25 
2  1 2CME A 18 ? 78 ? P59636 38 ? 98 ? 38 98 
3  2 2CME B 1  ? 18 ? P59636 9  ? 26 ? 9  26 
4  2 2CME B 19 ? 79 ? P59636 38 ? 98 ? 38 98 
5  3 2CME C 1  ? 16 ? P59636 10 ? 25 ? 10 25 
6  3 2CME C 17 ? 76 ? P59636 39 ? 98 ? 39 98 
7  3 2CME D 1  ? 16 ? P59636 10 ? 25 ? 10 25 
8  3 2CME D 17 ? 76 ? P59636 39 ? 98 ? 39 98 
9  4 2CME E 1  ? 17 ? P59636 9  ? 25 ? 9  25 
10 4 2CME E 18 ? 77 ? P59636 39 ? 98 ? 39 98 
11 3 2CME F 1  ? 16 ? P59636 10 ? 25 ? 10 25 
12 3 2CME F 17 ? 76 ? P59636 39 ? 98 ? 39 98 
13 4 2CME G 1  ? 17 ? P59636 9  ? 25 ? 9  25 
14 4 2CME G 18 ? 77 ? P59636 39 ? 98 ? 39 98 
15 3 2CME H 1  ? 16 ? P59636 10 ? 25 ? 10 25 
16 3 2CME H 17 ? 76 ? P59636 39 ? 98 ? 39 98 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  2CME ASN A 32 ? UNP P59636 GLN 52 conflict 52 1 
3  2CME ASN B 33 ? UNP P59636 GLN 52 conflict 52 2 
5  2CME ASN C 30 ? UNP P59636 GLN 52 conflict 52 3 
7  2CME ASN D 30 ? UNP P59636 GLN 52 conflict 52 4 
9  2CME ASN E 31 ? UNP P59636 GLN 52 conflict 52 5 
11 2CME ASN F 30 ? UNP P59636 GLN 52 conflict 52 6 
13 2CME ASN G 31 ? UNP P59636 GLN 52 conflict 52 7 
15 2CME ASN H 30 ? UNP P59636 GLN 52 conflict 52 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
D10 non-polymer         . DECANE          ? 'C10 H22'        142.282 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2CME 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.38 
_exptl_crystal.density_percent_sol   48 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.20 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '32% PEG3350, 200MM MGCL2, 100MM TRIS-HCL PH8.2, pH 8.20' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2004-11-09 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SILICON 111' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97903 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE BM14' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   BM14 
_diffrn_source.pdbx_wavelength             0.97903 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2CME 
_reflns.observed_criterion_sigma_I   -3.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             19.900 
_reflns.d_resolution_high            2.800 
_reflns.number_obs                   22040 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.8 
_reflns.pdbx_Rmerge_I_obs            0.11000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        22.8000 
_reflns.B_iso_Wilson_estimate        84 
_reflns.pdbx_redundancy              14.900 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.80 
_reflns_shell.d_res_low              2.90 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.300 
_reflns_shell.pdbx_redundancy        15.10 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2CME 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     22028 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               10000 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             19.9 
_refine.ls_d_res_high                            2.8 
_refine.ls_percent_reflns_obs                    99.8 
_refine.ls_R_factor_obs                          0.2660 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2660 
_refine.ls_R_factor_R_free                       0.2890 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 8.0 
_refine.ls_number_reflns_R_free                  1763 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            4.441 
_refine.aniso_B[2][2]                            4.441 
_refine.aniso_B[3][3]                            -8.881 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.33 
_refine.solvent_model_param_bsol                 80 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          SAD 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       RESIDUAL 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4777 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         40 
_refine_hist.number_atoms_solvent             7 
_refine_hist.number_atoms_total               4824 
_refine_hist.d_res_high                       2.8 
_refine_hist.d_res_low                        19.9 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.009  ?   ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?      ?   ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?      ?   ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?      ?   ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?      ?   ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?      ?   ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.8    ?   ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?      ?   ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?      ?   ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      ?      ?   ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?      ?   ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?      ?   ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      ?      ?   ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?      ?   ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?      ?   ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             5.887  4   ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            10.190 6   ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             7.939  5.0 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            12.762 10  ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_restr_ncs.pdbx_refine_id      'X-RAY DIFFRACTION' 
_refine_ls_restr_ncs.dom_id              1 
_refine_ls_restr_ncs.ncs_model_details   ? 
_refine_ls_restr_ncs.rms_dev_position    0.2136 
_refine_ls_restr_ncs.weight_position     40 
_refine_ls_restr_ncs.rms_dev_B_iso       0.2722 
_refine_ls_restr_ncs.weight_B_iso        3 
_refine_ls_restr_ncs.pdbx_ordinal        1 
_refine_ls_restr_ncs.pdbx_type           . 
_refine_ls_restr_ncs.pdbx_auth_asym_id   . 
_refine_ls_restr_ncs.pdbx_ens_id         1 
_refine_ls_restr_ncs.pdbx_number         ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   8 
_refine_ls_shell.d_res_high                       2.8 
_refine_ls_shell.d_res_low                        2.9 
_refine_ls_shell.number_reflns_R_work             2715 
_refine_ls_shell.R_factor_R_work                  0.404 
_refine_ls_shell.percent_reflns_obs               100 
_refine_ls_shell.R_factor_R_free                  0.432 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            8.0 
_refine_ls_shell.number_reflns_R_free             ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.pdbx_refine_id 
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
'X-RAY DIFFRACTION' 1 PROTEIN_REP.PARAM PROTEIN_REP.TOP 
'X-RAY DIFFRACTION' 2 WATER_REP.PARAM   WATER_REP.TOP   
'X-RAY DIFFRACTION' 3 DECANE.PARAM      DECANE.TOP      
# 
_struct_ncs_oper.id             1 
_struct_ncs_oper.code           given 
_struct_ncs_oper.details        ? 
_struct_ncs_oper.matrix[1][1]   -0.342490 
_struct_ncs_oper.matrix[1][2]   -0.555370 
_struct_ncs_oper.matrix[1][3]   0.757800 
_struct_ncs_oper.matrix[2][1]   -0.591350 
_struct_ncs_oper.matrix[2][2]   -0.499340 
_struct_ncs_oper.matrix[2][3]   -0.633210 
_struct_ncs_oper.matrix[3][1]   0.730070 
_struct_ncs_oper.matrix[3][2]   -0.665000 
_struct_ncs_oper.matrix[3][3]   -0.157400 
_struct_ncs_oper.vector[1]      68.82370 
_struct_ncs_oper.vector[2]      72.19500 
_struct_ncs_oper.vector[3]      -4.64970 
# 
_struct_ncs_dom.id            1 
_struct_ncs_dom.details       ? 
_struct_ncs_dom.pdbx_ens_id   1 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  2CME 
_struct.title                     'The crystal structure of SARS coronavirus ORF-9b protein' 
_struct.pdbx_descriptor           'HYPOTHETICAL PROTEIN 5' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2CME 
_struct_keywords.pdbx_keywords   'HYPOTHETICAL PROTEIN' 
_struct_keywords.text            'ALTERNATIVE OPEN READING FRAME, LIPID-BINDING, VIRUS ASSEMBLY, HYPOTHETICAL PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 4 ? 
F N N 3 ? 
G N N 4 ? 
H N N 3 ? 
I N N 5 ? 
J N N 5 ? 
K N N 5 ? 
L N N 5 ? 
M N N 6 ? 
N N N 6 ? 
O N N 6 ? 
P N N 6 ? 
Q N N 6 ? 
R N N 6 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 THR A 64 ? LEU A 68 ? THR A 84 LEU A 88 5 ? 5 
HELX_P HELX_P2 2 THR B 65 ? LEU B 69 ? THR B 84 LEU B 88 5 ? 5 
HELX_P HELX_P3 3 THR D 62 ? LEU D 66 ? THR D 84 LEU D 88 5 ? 5 
HELX_P HELX_P4 4 THR E 63 ? LEU E 67 ? THR E 84 LEU E 88 5 ? 5 
HELX_P HELX_P5 5 THR F 62 ? LEU F 66 ? THR F 84 LEU F 88 5 ? 5 
HELX_P HELX_P6 6 THR H 62 ? LEU H 66 ? THR H 84 LEU H 88 5 ? 5 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PRO 2 A . ? PRO 10 A PRO 3 A ? PRO 11 A 1 -1.39 
2 PRO 1 F . ? PRO 10 F PRO 2 F ? PRO 11 F 1 0.09  
3 PRO 1 H . ? PRO 10 H PRO 2 H ? PRO 11 H 1 -0.42 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 6  ? 
AB ? 6  ? 
CA ? 6  ? 
CB ? 4  ? 
CC ? 6  ? 
EA ? 6  ? 
EB ? 4  ? 
EC ? 6  ? 
GA ? 10 ? 
GB ? 6  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2  ? anti-parallel 
AA 2 3  ? anti-parallel 
AA 3 4  ? parallel      
AA 4 5  ? anti-parallel 
AA 5 6  ? anti-parallel 
AB 1 2  ? anti-parallel 
AB 2 3  ? anti-parallel 
AB 3 4  ? parallel      
AB 4 5  ? anti-parallel 
AB 5 6  ? anti-parallel 
CA 1 2  ? anti-parallel 
CA 2 3  ? anti-parallel 
CA 3 4  ? parallel      
CA 4 5  ? anti-parallel 
CA 5 6  ? anti-parallel 
CB 1 2  ? anti-parallel 
CB 2 3  ? anti-parallel 
CB 3 4  ? anti-parallel 
CC 1 2  ? anti-parallel 
CC 2 3  ? anti-parallel 
CC 3 4  ? parallel      
CC 4 5  ? anti-parallel 
CC 5 6  ? anti-parallel 
EA 1 2  ? anti-parallel 
EA 2 3  ? anti-parallel 
EA 3 4  ? parallel      
EA 4 5  ? anti-parallel 
EA 5 6  ? anti-parallel 
EB 1 2  ? anti-parallel 
EB 2 3  ? anti-parallel 
EB 3 4  ? anti-parallel 
EC 1 2  ? anti-parallel 
EC 2 3  ? anti-parallel 
EC 3 4  ? parallel      
EC 4 5  ? anti-parallel 
EC 5 6  ? anti-parallel 
GA 1 2  ? anti-parallel 
GA 3 4  ? anti-parallel 
GA 4 5  ? anti-parallel 
GA 6 7  ? anti-parallel 
GA 7 8  ? anti-parallel 
GA 8 9  ? parallel      
GA 9 10 ? anti-parallel 
GB 1 2  ? anti-parallel 
GB 2 3  ? anti-parallel 
GB 3 4  ? parallel      
GB 4 5  ? anti-parallel 
GB 5 6  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1  THR A 53 ? PRO A 54 ? THR A 73 PRO A 74 
AA 2  SER A 34 ? ARG A 39 ? SER A 54 ARG A 59 
AA 3  GLU B 72 ? THR B 77 ? GLU B 91 THR B 96 
AA 4  VAL B 23 ? LEU B 28 ? VAL B 42 LEU B 47 
AA 5  HIS B 6  ? ILE B 16 ? HIS B 14 ILE B 24 
AA 6  HIS A 6  ? THR A 15 ? HIS A 14 THR A 23 
AB 1  THR A 53 ? PRO A 54 ? THR A 73 PRO A 74 
AB 2  SER A 34 ? ARG A 39 ? SER A 54 ARG A 59 
AB 3  GLU B 72 ? THR B 77 ? GLU B 91 THR B 96 
AB 4  VAL B 23 ? LEU B 28 ? VAL B 42 LEU B 47 
AB 5  HIS B 6  ? ILE B 16 ? HIS B 14 ILE B 24 
AB 6  THR B 61 ? LYS B 62 ? THR B 80 LYS B 81 
CA 1  THR C 58 ? LYS C 59 ? THR C 80 LYS C 81 
CA 2  HIS C 5  ? ILE C 15 ? HIS C 14 ILE C 24 
CA 3  VAL C 20 ? LEU C 25 ? VAL C 42 LEU C 47 
CA 4  GLU C 69 ? THR C 74 ? GLU C 91 THR C 96 
CA 5  SER D 32 ? ARG D 38 ? SER D 54 ARG D 60 
CA 6  PHE D 48 ? PRO D 52 ? PHE D 70 PRO D 74 
CB 1  THR C 58 ? LYS C 59 ? THR C 80 LYS C 81 
CB 2  HIS C 5  ? ILE C 15 ? HIS C 14 ILE C 24 
CB 3  ILE D 11 ? ILE D 15 ? ILE D 20 ILE D 24 
CB 4  VAL D 20 ? TYR D 21 ? VAL D 42 TYR D 43 
CC 1  PHE C 48 ? PRO C 52 ? PHE C 70 PRO C 74 
CC 2  SER C 32 ? ARG C 38 ? SER C 54 ARG C 60 
CC 3  GLU D 69 ? THR D 74 ? GLU D 91 THR D 96 
CC 4  ILE D 23 ? LEU D 25 ? ILE D 45 LEU D 47 
CC 5  HIS D 5  ? VAL D 7  ? HIS D 14 VAL D 16 
CC 6  THR D 58 ? LYS D 59 ? THR D 80 LYS D 81 
EA 1  THR E 59 ? LYS E 60 ? THR E 80 LYS E 81 
EA 2  HIS E 6  ? ILE E 16 ? HIS E 14 ILE E 24 
EA 3  VAL E 21 ? LEU E 26 ? VAL E 42 LEU E 47 
EA 4  GLU E 70 ? THR E 75 ? GLU E 91 THR E 96 
EA 5  SER F 32 ? ARG F 38 ? SER F 54 ARG F 60 
EA 6  PHE F 48 ? PRO F 52 ? PHE F 70 PRO F 74 
EB 1  THR E 59 ? LYS E 60 ? THR E 80 LYS E 81 
EB 2  HIS E 6  ? ILE E 16 ? HIS E 14 ILE E 24 
EB 3  ILE F 11 ? ILE F 15 ? ILE F 20 ILE F 24 
EB 4  VAL F 20 ? TYR F 21 ? VAL F 42 TYR F 43 
EC 1  THR E 52 ? PRO E 53 ? THR E 73 PRO E 74 
EC 2  SER E 33 ? ARG E 38 ? SER E 54 ARG E 59 
EC 3  GLU F 69 ? THR F 74 ? GLU F 91 THR F 96 
EC 4  ILE F 23 ? LEU F 25 ? ILE F 45 LEU F 47 
EC 5  HIS F 5  ? VAL F 7  ? HIS F 14 VAL F 16 
EC 6  THR F 58 ? LYS F 59 ? THR F 80 LYS F 81 
GA 1  THR G 59 ? LYS G 60 ? THR G 80 LYS G 81 
GA 2  HIS G 6  ? ILE G 16 ? HIS G 14 ILE G 24 
GA 3  LYS H 19 ? TYR H 21 ? LYS H 41 TYR H 43 
GA 4  ILE H 11 ? ILE H 15 ? ILE H 20 ILE H 24 
GA 5  HIS G 6  ? ILE G 16 ? HIS G 14 ILE G 24 
GA 6  PHE H 48 ? PRO H 52 ? PHE H 70 PRO H 74 
GA 7  SER H 32 ? ARG H 38 ? SER H 54 ARG H 60 
GA 8  GLU G 70 ? THR G 75 ? GLU G 91 THR G 96 
GA 9  VAL G 21 ? LEU G 26 ? VAL G 42 LEU G 47 
GA 10 HIS G 6  ? ILE G 16 ? HIS G 14 ILE G 24 
GB 1  THR G 52 ? PRO G 53 ? THR G 73 PRO G 74 
GB 2  SER G 33 ? ARG G 38 ? SER G 54 ARG G 59 
GB 3  GLU H 69 ? THR H 74 ? GLU H 91 THR H 96 
GB 4  ILE H 23 ? LEU H 25 ? ILE H 45 LEU H 47 
GB 5  HIS H 5  ? VAL H 7  ? HIS H 14 VAL H 16 
GB 6  THR H 58 ? LYS H 59 ? THR H 80 LYS H 81 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2  N THR A 53 ? N THR A 73 O MET A 37 ? O MET A 57 
AA 2 3  N ALA A 38 ? N ALA A 58 O PHE B 73 ? O PHE B 92 
AA 3 4  N VAL B 74 ? N VAL B 93 O PRO B 25 ? O PRO B 44 
AA 4 5  N LEU B 28 ? N LEU B 47 O HIS B 6  ? O HIS B 14 
AA 5 6  N THR B 15 ? N THR B 23 O GLN A 13 ? O GLN A 21 
AB 1 2  N THR A 53 ? N THR A 73 O MET A 37 ? O MET A 57 
AB 2 3  N ALA A 38 ? N ALA A 58 O PHE B 73 ? O PHE B 92 
AB 3 4  N VAL B 74 ? N VAL B 93 O PRO B 25 ? O PRO B 44 
AB 4 5  N LEU B 28 ? N LEU B 47 O HIS B 6  ? O HIS B 14 
AB 5 6  N LEU B 7  ? N LEU B 15 O THR B 61 ? O THR B 80 
CA 1 2  N THR C 58 ? N THR C 80 O LEU C 6  ? O LEU C 15 
CA 2 3  N LEU C 13 ? N LEU C 22 O TYR C 21 ? O TYR C 43 
CA 3 4  N ILE C 24 ? N ILE C 46 O VAL C 71 ? O VAL C 93 
CA 4 5  N THR C 74 ? N THR C 96 O SER D 32 ? O SER D 54 
CA 5 6  N ARG D 37 ? N ARG D 59 O GLN D 49 ? O GLN D 71 
CB 1 2  N THR C 58 ? N THR C 80 O LEU C 6  ? O LEU C 15 
CB 2 3  N THR C 14 ? N THR C 23 O GLN D 12 ? O GLN D 21 
CB 3 4  N LEU D 13 ? N LEU D 22 O TYR D 21 ? O TYR D 43 
CC 1 2  N THR C 51 ? N THR C 73 O MET C 35 ? O MET C 57 
CC 2 3  N ALA C 36 ? N ALA C 58 O PHE D 70 ? O PHE D 92 
CC 3 4  N VAL D 73 ? N VAL D 95 O ILE D 24 ? O ILE D 46 
CC 4 5  N LEU D 25 ? N LEU D 47 O HIS D 5  ? O HIS D 14 
CC 5 6  N LEU D 6  ? N LEU D 15 O THR D 58 ? O THR D 80 
EA 1 2  N THR E 59 ? N THR E 80 O LEU E 7  ? O LEU E 15 
EA 2 3  N LEU E 14 ? N LEU E 22 O TYR E 22 ? O TYR E 43 
EA 3 4  N ILE E 25 ? N ILE E 46 O VAL E 72 ? O VAL E 93 
EA 4 5  N THR E 75 ? N THR E 96 O SER F 32 ? O SER F 54 
EA 5 6  O ARG F 37 ? O ARG F 59 N GLN F 49 ? N GLN F 71 
EB 1 2  N THR E 59 ? N THR E 80 O LEU E 7  ? O LEU E 15 
EB 2 3  N THR E 15 ? N THR E 23 O GLN F 12 ? O GLN F 21 
EB 3 4  N LEU F 13 ? N LEU F 22 O TYR F 21 ? O TYR F 43 
EC 1 2  N THR E 52 ? N THR E 73 O MET E 36 ? O MET E 57 
EC 2 3  N ALA E 37 ? N ALA E 58 O PHE F 70 ? O PHE F 92 
EC 3 4  N VAL F 73 ? N VAL F 95 O ILE F 24 ? O ILE F 46 
EC 4 5  N LEU F 25 ? N LEU F 47 O HIS F 5  ? O HIS F 14 
EC 5 6  N LEU F 6  ? N LEU F 15 O THR F 58 ? O THR F 80 
GA 1 2  N THR G 59 ? N THR G 80 O LEU G 7  ? O LEU G 15 
GA 3 4  N TYR H 21 ? N TYR H 43 O LEU H 13 ? O LEU H 22 
GA 4 5  N THR H 14 ? N THR H 23 O GLN G 13 ? O GLN G 21 
GA 6 7  N THR H 51 ? N THR H 73 O MET H 35 ? O MET H 57 
GA 7 8  N ALA H 36 ? N ALA H 58 O PHE G 71 ? O PHE G 92 
GA 8 9  N VAL G 72 ? N VAL G 93 O PRO G 23 ? O PRO G 44 
GA 9 10 N LEU G 26 ? N LEU G 47 O HIS G 6  ? O HIS G 14 
GB 1 2  N THR G 52 ? N THR G 73 O MET G 36 ? O MET G 57 
GB 2 3  N ALA G 37 ? N ALA G 58 O PHE H 70 ? O PHE H 92 
GB 3 4  N VAL H 73 ? N VAL H 95 O ILE H 24 ? O ILE H 46 
GB 4 5  N LEU H 25 ? N LEU H 47 O HIS H 5  ? O HIS H 14 
GB 5 6  N LEU H 6  ? N LEU H 15 O THR H 58 ? O THR H 80 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE D10 B1099' 
AC2 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE D10 F1099' 
AC3 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE D10 H1099' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 2 LEU B 34 ? LEU B 53 . ? 1_555 ? 
2 AC1 2 VAL B 58 ? VAL B 77 . ? 1_555 ? 
3 AC2 2 VAL E 74 ? VAL E 95 . ? 1_555 ? 
4 AC2 2 VAL F 55 ? VAL F 77 . ? 1_555 ? 
5 AC3 1 LEU H 31 ? LEU H 53 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2CME 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2CME 
_atom_sites.fract_transf_matrix[1][1]   0.007141 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007141 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.022150 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . VAL A 1 1  ? 46.953  43.346 7.406   1.00 126.30 ? 9    VAL A N   1 
ATOM   2    C CA  . VAL A 1 1  ? 46.508  42.086 8.074   1.00 125.34 ? 9    VAL A CA  1 
ATOM   3    C C   . VAL A 1 1  ? 47.688  41.139 8.357   1.00 127.76 ? 9    VAL A C   1 
ATOM   4    O O   . VAL A 1 1  ? 48.284  40.590 7.428   1.00 125.12 ? 9    VAL A O   1 
ATOM   5    C CB  . VAL A 1 1  ? 45.437  41.346 7.212   1.00 118.07 ? 9    VAL A CB  1 
ATOM   6    C CG1 . VAL A 1 1  ? 44.057  41.980 7.417   1.00 111.21 ? 9    VAL A CG1 1 
ATOM   7    C CG2 . VAL A 1 1  ? 45.817  41.412 5.744   1.00 110.57 ? 9    VAL A CG2 1 
ATOM   8    N N   . PRO A 1 2  ? 48.018  40.930 9.656   1.00 127.86 ? 10   PRO A N   1 
ATOM   9    C CA  . PRO A 1 2  ? 49.064  40.109 10.293  1.00 128.09 ? 10   PRO A CA  1 
ATOM   10   C C   . PRO A 1 2  ? 50.075  39.316 9.413   1.00 129.59 ? 10   PRO A C   1 
ATOM   11   O O   . PRO A 1 2  ? 50.360  39.731 8.290   1.00 134.48 ? 10   PRO A O   1 
ATOM   12   C CB  . PRO A 1 2  ? 48.243  39.258 11.239  1.00 126.25 ? 10   PRO A CB  1 
ATOM   13   C CG  . PRO A 1 2  ? 47.325  40.315 11.830  1.00 125.87 ? 10   PRO A CG  1 
ATOM   14   C CD  . PRO A 1 2  ? 46.963  41.227 10.648  1.00 124.07 ? 10   PRO A CD  1 
ATOM   15   N N   . PRO A 1 3  ? 50.642  38.176 9.908   1.00 127.36 ? 11   PRO A N   1 
ATOM   16   C CA  . PRO A 1 3  ? 50.574  37.426 11.175  1.00 125.51 ? 11   PRO A CA  1 
ATOM   17   C C   . PRO A 1 3  ? 51.602  37.806 12.242  1.00 127.50 ? 11   PRO A C   1 
ATOM   18   O O   . PRO A 1 3  ? 52.742  38.170 11.938  1.00 124.69 ? 11   PRO A O   1 
ATOM   19   C CB  . PRO A 1 3  ? 50.768  35.966 10.728  1.00 121.37 ? 11   PRO A CB  1 
ATOM   20   C CG  . PRO A 1 3  ? 51.012  36.026 9.209   1.00 120.71 ? 11   PRO A CG  1 
ATOM   21   C CD  . PRO A 1 3  ? 51.473  37.426 8.957   1.00 122.82 ? 11   PRO A CD  1 
ATOM   22   N N   . ALA A 1 4  ? 51.183  37.703 13.499  1.00 127.83 ? 12   ALA A N   1 
ATOM   23   C CA  . ALA A 1 4  ? 52.048  38.008 14.631  1.00 125.48 ? 12   ALA A CA  1 
ATOM   24   C C   . ALA A 1 4  ? 52.629  36.693 15.121  1.00 120.05 ? 12   ALA A C   1 
ATOM   25   O O   . ALA A 1 4  ? 52.139  35.621 14.768  1.00 124.54 ? 12   ALA A O   1 
ATOM   26   C CB  . ALA A 1 4  ? 51.244  38.669 15.739  1.00 130.16 ? 12   ALA A CB  1 
ATOM   27   N N   . LEU A 1 5  ? 53.674  36.769 15.932  1.00 108.69 ? 13   LEU A N   1 
ATOM   28   C CA  . LEU A 1 5  ? 54.287  35.557 16.448  1.00 99.09  ? 13   LEU A CA  1 
ATOM   29   C C   . LEU A 1 5  ? 53.647  35.147 17.755  1.00 93.09  ? 13   LEU A C   1 
ATOM   30   O O   . LEU A 1 5  ? 53.485  35.967 18.659  1.00 93.27  ? 13   LEU A O   1 
ATOM   31   C CB  . LEU A 1 5  ? 55.779  35.772 16.663  1.00 101.17 ? 13   LEU A CB  1 
ATOM   32   C CG  . LEU A 1 5  ? 56.547  36.097 15.390  1.00 98.31  ? 13   LEU A CG  1 
ATOM   33   C CD1 . LEU A 1 5  ? 58.036  36.037 15.677  1.00 86.15  ? 13   LEU A CD1 1 
ATOM   34   C CD2 . LEU A 1 5  ? 56.162  35.101 14.305  1.00 99.86  ? 13   LEU A CD2 1 
ATOM   35   N N   . HIS A 1 6  ? 53.286  33.875 17.858  1.00 83.68  ? 14   HIS A N   1 
ATOM   36   C CA  . HIS A 1 6  ? 52.668  33.389 19.075  1.00 80.65  ? 14   HIS A CA  1 
ATOM   37   C C   . HIS A 1 6  ? 53.465  32.242 19.660  1.00 76.91  ? 14   HIS A C   1 
ATOM   38   O O   . HIS A 1 6  ? 53.659  31.207 19.015  1.00 77.94  ? 14   HIS A O   1 
ATOM   39   C CB  . HIS A 1 6  ? 51.233  32.952 18.794  1.00 96.29  ? 14   HIS A CB  1 
ATOM   40   C CG  . HIS A 1 6  ? 50.321  34.080 18.418  1.00 104.45 ? 14   HIS A CG  1 
ATOM   41   N ND1 . HIS A 1 6  ? 49.912  35.043 19.316  1.00 102.13 ? 14   HIS A ND1 1 
ATOM   42   C CD2 . HIS A 1 6  ? 49.746  34.402 17.234  1.00 106.85 ? 14   HIS A CD2 1 
ATOM   43   C CE1 . HIS A 1 6  ? 49.126  35.909 18.703  1.00 106.72 ? 14   HIS A CE1 1 
ATOM   44   N NE2 . HIS A 1 6  ? 49.011  35.543 17.439  1.00 110.64 ? 14   HIS A NE2 1 
ATOM   45   N N   . LEU A 1 7  ? 53.940  32.444 20.883  1.00 72.89  ? 15   LEU A N   1 
ATOM   46   C CA  . LEU A 1 7  ? 54.707  31.428 21.572  1.00 82.15  ? 15   LEU A CA  1 
ATOM   47   C C   . LEU A 1 7  ? 53.816  30.446 22.337  1.00 89.76  ? 15   LEU A C   1 
ATOM   48   O O   . LEU A 1 7  ? 53.114  30.807 23.287  1.00 91.77  ? 15   LEU A O   1 
ATOM   49   C CB  . LEU A 1 7  ? 55.703  32.082 22.535  1.00 79.39  ? 15   LEU A CB  1 
ATOM   50   C CG  . LEU A 1 7  ? 56.569  31.181 23.443  1.00 82.72  ? 15   LEU A CG  1 
ATOM   51   C CD1 . LEU A 1 7  ? 55.749  30.676 24.645  1.00 88.54  ? 15   LEU A CD1 1 
ATOM   52   C CD2 . LEU A 1 7  ? 57.155  30.014 22.628  1.00 77.73  ? 15   LEU A CD2 1 
ATOM   53   N N   . VAL A 1 8  ? 53.842  29.194 21.909  1.00 90.73  ? 16   VAL A N   1 
ATOM   54   C CA  . VAL A 1 8  ? 53.071  28.184 22.593  1.00 88.68  ? 16   VAL A CA  1 
ATOM   55   C C   . VAL A 1 8  ? 53.943  27.699 23.733  1.00 93.90  ? 16   VAL A C   1 
ATOM   56   O O   . VAL A 1 8  ? 55.013  27.110 23.521  1.00 95.25  ? 16   VAL A O   1 
ATOM   57   C CB  . VAL A 1 8  ? 52.747  27.023 21.676  1.00 84.01  ? 16   VAL A CB  1 
ATOM   58   C CG1 . VAL A 1 8  ? 51.961  25.959 22.448  1.00 84.08  ? 16   VAL A CG1 1 
ATOM   59   C CG2 . VAL A 1 8  ? 51.968  27.538 20.478  1.00 72.42  ? 16   VAL A CG2 1 
ATOM   60   N N   . ASP A 1 9  ? 53.477  27.982 24.941  1.00 94.32  ? 17   ASP A N   1 
ATOM   61   C CA  . ASP A 1 9  ? 54.149  27.627 26.185  1.00 100.51 ? 17   ASP A CA  1 
ATOM   62   C C   . ASP A 1 9  ? 54.913  26.315 26.181  1.00 107.74 ? 17   ASP A C   1 
ATOM   63   O O   . ASP A 1 9  ? 54.771  25.496 25.279  1.00 113.74 ? 17   ASP A O   1 
ATOM   64   C CB  . ASP A 1 9  ? 53.114  27.577 27.277  1.00 94.32  ? 17   ASP A CB  1 
ATOM   65   C CG  . ASP A 1 9  ? 51.967  28.465 26.980  1.00 101.66 ? 17   ASP A CG  1 
ATOM   66   O OD1 . ASP A 1 9  ? 51.381  28.310 25.884  1.00 96.09  ? 17   ASP A OD1 1 
ATOM   67   O OD2 . ASP A 1 9  ? 51.660  29.319 27.832  1.00 115.24 ? 17   ASP A OD2 1 
ATOM   68   N N   . PRO A 1 10 ? 55.738  26.101 27.214  1.00 112.07 ? 18   PRO A N   1 
ATOM   69   C CA  . PRO A 1 10 ? 56.550  24.894 27.382  1.00 116.24 ? 18   PRO A CA  1 
ATOM   70   C C   . PRO A 1 10 ? 55.635  23.681 27.506  1.00 119.28 ? 18   PRO A C   1 
ATOM   71   O O   . PRO A 1 10 ? 55.936  22.594 27.007  1.00 126.40 ? 18   PRO A O   1 
ATOM   72   C CB  . PRO A 1 10 ? 57.296  25.165 28.680  1.00 118.04 ? 18   PRO A CB  1 
ATOM   73   C CG  . PRO A 1 10 ? 57.373  26.658 28.729  1.00 118.56 ? 18   PRO A CG  1 
ATOM   74   C CD  . PRO A 1 10 ? 56.008  27.066 28.292  1.00 114.83 ? 18   PRO A CD  1 
ATOM   75   N N   . GLN A 1 11 ? 54.526  23.889 28.205  1.00 114.60 ? 19   GLN A N   1 
ATOM   76   C CA  . GLN A 1 11 ? 53.496  22.876 28.421  1.00 105.80 ? 19   GLN A CA  1 
ATOM   77   C C   . GLN A 1 11 ? 53.355  22.001 27.175  1.00 100.10 ? 19   GLN A C   1 
ATOM   78   O O   . GLN A 1 11 ? 53.279  20.777 27.249  1.00 100.46 ? 19   GLN A O   1 
ATOM   79   C CB  . GLN A 1 11 ? 52.173  23.593 28.669  1.00 105.81 ? 19   GLN A CB  1 
ATOM   80   C CG  . GLN A 1 11 ? 51.773  24.464 27.472  1.00 105.47 ? 19   GLN A CG  1 
ATOM   81   C CD  . GLN A 1 11 ? 50.706  25.484 27.784  1.00 110.85 ? 19   GLN A CD  1 
ATOM   82   O OE1 . GLN A 1 11 ? 50.190  26.146 26.882  1.00 112.27 ? 19   GLN A OE1 1 
ATOM   83   N NE2 . GLN A 1 11 ? 50.377  25.632 29.061  1.00 116.01 ? 19   GLN A NE2 1 
ATOM   84   N N   . ILE A 1 12 ? 53.331  22.665 26.027  1.00 96.05  ? 20   ILE A N   1 
ATOM   85   C CA  . ILE A 1 12 ? 53.173  22.025 24.734  1.00 81.94  ? 20   ILE A CA  1 
ATOM   86   C C   . ILE A 1 12 ? 54.385  22.265 23.829  1.00 69.22  ? 20   ILE A C   1 
ATOM   87   O O   . ILE A 1 12 ? 54.791  23.403 23.575  1.00 67.07  ? 20   ILE A O   1 
ATOM   88   C CB  . ILE A 1 12 ? 51.946  22.589 24.042  1.00 86.79  ? 20   ILE A CB  1 
ATOM   89   C CG1 . ILE A 1 12 ? 50.762  22.598 25.014  1.00 82.96  ? 20   ILE A CG1 1 
ATOM   90   C CG2 . ILE A 1 12 ? 51.649  21.776 22.812  1.00 99.31  ? 20   ILE A CG2 1 
ATOM   91   C CD1 . ILE A 1 12 ? 49.659  23.590 24.642  1.00 72.10  ? 20   ILE A CD1 1 
ATOM   92   N N   . GLN A 1 13 ? 54.962  21.195 23.321  1.00 63.47  ? 21   GLN A N   1 
ATOM   93   C CA  . GLN A 1 13 ? 56.115  21.357 22.463  1.00 65.74  ? 21   GLN A CA  1 
ATOM   94   C C   . GLN A 1 13 ? 56.251  20.198 21.506  1.00 68.66  ? 21   GLN A C   1 
ATOM   95   O O   . GLN A 1 13 ? 55.775  19.099 21.778  1.00 76.41  ? 21   GLN A O   1 
ATOM   96   C CB  . GLN A 1 13 ? 57.367  21.456 23.310  1.00 76.54  ? 21   GLN A CB  1 
ATOM   97   C CG  . GLN A 1 13 ? 57.507  22.729 24.102  1.00 92.12  ? 21   GLN A CG  1 
ATOM   98   C CD  . GLN A 1 13 ? 58.832  22.783 24.842  1.00 96.28  ? 21   GLN A CD  1 
ATOM   99   O OE1 . GLN A 1 13 ? 59.878  22.415 24.298  1.00 99.75  ? 21   GLN A OE1 1 
ATOM   100  N NE2 . GLN A 1 13 ? 58.798  23.255 26.082  1.00 87.61  ? 21   GLN A NE2 1 
ATOM   101  N N   . LEU A 1 14 ? 56.914  20.430 20.385  1.00 62.36  ? 22   LEU A N   1 
ATOM   102  C CA  . LEU A 1 14 ? 57.071  19.359 19.429  1.00 68.04  ? 22   LEU A CA  1 
ATOM   103  C C   . LEU A 1 14 ? 58.222  18.435 19.821  1.00 73.94  ? 22   LEU A C   1 
ATOM   104  O O   . LEU A 1 14 ? 58.969  18.746 20.733  1.00 75.57  ? 22   LEU A O   1 
ATOM   105  C CB  . LEU A 1 14 ? 57.282  19.941 18.050  1.00 71.61  ? 22   LEU A CB  1 
ATOM   106  C CG  . LEU A 1 14 ? 56.417  19.258 16.992  1.00 77.24  ? 22   LEU A CG  1 
ATOM   107  C CD1 . LEU A 1 14 ? 54.939  19.320 17.375  1.00 79.80  ? 22   LEU A CD1 1 
ATOM   108  C CD2 . LEU A 1 14 ? 56.654  19.938 15.664  1.00 81.77  ? 22   LEU A CD2 1 
ATOM   109  N N   . THR A 1 15 ? 58.382  17.302 19.139  1.00 81.37  ? 23   THR A N   1 
ATOM   110  C CA  . THR A 1 15 ? 59.444  16.361 19.515  1.00 82.25  ? 23   THR A CA  1 
ATOM   111  C C   . THR A 1 15 ? 60.036  15.503 18.400  1.00 91.22  ? 23   THR A C   1 
ATOM   112  O O   . THR A 1 15 ? 59.344  15.157 17.414  1.00 91.45  ? 23   THR A O   1 
ATOM   113  C CB  . THR A 1 15 ? 58.937  15.394 20.591  1.00 79.96  ? 23   THR A CB  1 
ATOM   114  O OG1 . THR A 1 15 ? 58.407  16.149 21.686  1.00 73.74  ? 23   THR A OG1 1 
ATOM   115  C CG2 . THR A 1 15 ? 60.059  14.511 21.068  1.00 81.69  ? 23   THR A CG2 1 
ATOM   116  N N   . ILE A 1 16 ? 61.310  15.137 18.605  1.00 104.71 ? 24   ILE A N   1 
ATOM   117  C CA  . ILE A 1 16 ? 62.081  14.270 17.704  1.00 120.72 ? 24   ILE A CA  1 
ATOM   118  C C   . ILE A 1 16 ? 62.875  13.164 18.474  1.00 140.14 ? 24   ILE A C   1 
ATOM   119  O O   . ILE A 1 16 ? 63.351  13.330 19.606  1.00 144.13 ? 24   ILE A O   1 
ATOM   120  C CB  . ILE A 1 16 ? 63.043  15.070 16.810  1.00 111.11 ? 24   ILE A CB  1 
ATOM   121  C CG1 . ILE A 1 16 ? 62.565  16.513 16.663  1.00 108.85 ? 24   ILE A CG1 1 
ATOM   122  C CG2 . ILE A 1 16 ? 63.078  14.422 15.418  1.00 104.88 ? 24   ILE A CG2 1 
ATOM   123  C CD1 . ILE A 1 16 ? 61.351  16.713 15.759  1.00 100.92 ? 24   ILE A CD1 1 
ATOM   124  N N   . THR A 1 17 ? 63.047  12.048 17.771  1.00 154.63 ? 25   THR A N   1 
ATOM   125  C CA  . THR A 1 17 ? 63.651  10.740 18.191  1.00 169.02 ? 25   THR A CA  1 
ATOM   126  C C   . THR A 1 17 ? 64.927  10.169 18.909  1.00 176.86 ? 25   THR A C   1 
ATOM   127  O O   . THR A 1 17 ? 66.002  10.224 18.292  1.00 179.59 ? 25   THR A O   1 
ATOM   128  C CB  . THR A 1 17 ? 63.605  9.779  16.951  1.00 169.96 ? 25   THR A CB  1 
ATOM   129  O OG1 . THR A 1 17 ? 64.272  10.363 15.807  1.00 170.07 ? 25   THR A OG1 1 
ATOM   130  C CG2 . THR A 1 17 ? 62.152  9.419  16.578  1.00 168.11 ? 25   THR A CG2 1 
ATOM   131  N N   . ALA A 1 18 ? 64.789  9.507  20.097  1.00 182.02 ? 38   ALA A N   1 
ATOM   132  C CA  . ALA A 1 18 ? 65.850  8.715  20.844  1.00 183.12 ? 38   ALA A CA  1 
ATOM   133  C C   . ALA A 1 18 ? 66.786  9.061  22.072  1.00 182.09 ? 38   ALA A C   1 
ATOM   134  O O   . ALA A 1 18 ? 67.038  8.250  22.961  1.00 180.63 ? 38   ALA A O   1 
ATOM   135  C CB  . ALA A 1 18 ? 66.657  7.996  19.804  1.00 183.52 ? 38   ALA A CB  1 
ATOM   136  N N   . ASP A 1 19 ? 67.226  10.296 22.097  1.00 181.36 ? 39   ASP A N   1 
ATOM   137  C CA  . ASP A 1 19 ? 68.076  10.905 23.083  1.00 179.74 ? 39   ASP A CA  1 
ATOM   138  C C   . ASP A 1 19 ? 67.548  12.282 22.769  1.00 180.39 ? 39   ASP A C   1 
ATOM   139  O O   . ASP A 1 19 ? 67.503  13.167 23.639  1.00 183.77 ? 39   ASP A O   1 
ATOM   140  C CB  . ASP A 1 19 ? 69.559  10.787 22.688  1.00 176.36 ? 39   ASP A CB  1 
ATOM   141  C CG  . ASP A 1 19 ? 70.449  11.741 23.479  1.00 173.35 ? 39   ASP A CG  1 
ATOM   142  O OD1 . ASP A 1 19 ? 71.484  11.289 24.032  1.00 176.05 ? 39   ASP A OD1 1 
ATOM   143  O OD2 . ASP A 1 19 ? 70.106  12.940 23.540  1.00 164.73 ? 39   ASP A OD2 1 
ATOM   144  N N   . PRO A 1 20 ? 67.175  12.474 21.479  1.00 176.72 ? 40   PRO A N   1 
ATOM   145  C CA  . PRO A 1 20 ? 66.625  13.701 20.919  1.00 168.87 ? 40   PRO A CA  1 
ATOM   146  C C   . PRO A 1 20 ? 65.723  14.538 21.810  1.00 158.01 ? 40   PRO A C   1 
ATOM   147  O O   . PRO A 1 20 ? 65.259  14.079 22.853  1.00 157.95 ? 40   PRO A O   1 
ATOM   148  C CB  . PRO A 1 20 ? 65.972  13.210 19.638  1.00 170.47 ? 40   PRO A CB  1 
ATOM   149  C CG  . PRO A 1 20 ? 67.081  12.356 19.112  1.00 173.71 ? 40   PRO A CG  1 
ATOM   150  C CD  . PRO A 1 20 ? 67.604  11.603 20.359  1.00 176.36 ? 40   PRO A CD  1 
ATOM   151  N N   . LYS A 1 21 ? 65.479  15.768 21.362  1.00 143.90 ? 41   LYS A N   1 
ATOM   152  C CA  . LYS A 1 21 ? 64.727  16.766 22.107  1.00 126.27 ? 41   LYS A CA  1 
ATOM   153  C C   . LYS A 1 21 ? 63.392  17.278 21.588  1.00 119.93 ? 41   LYS A C   1 
ATOM   154  O O   . LYS A 1 21 ? 62.814  16.815 20.595  1.00 114.28 ? 41   LYS A O   1 
ATOM   155  C CB  . LYS A 1 21 ? 65.627  17.968 22.331  1.00 114.17 ? 41   LYS A CB  1 
ATOM   156  C CG  . LYS A 1 21 ? 65.963  18.685 21.031  1.00 100.49 ? 41   LYS A CG  1 
ATOM   157  C CD  . LYS A 1 21 ? 66.467  17.715 19.943  1.00 88.68  ? 41   LYS A CD  1 
ATOM   158  C CE  . LYS A 1 21 ? 65.348  17.214 19.012  1.00 86.26  ? 41   LYS A CE  1 
ATOM   159  N NZ  . LYS A 1 21 ? 65.812  16.101 18.123  1.00 74.27  ? 41   LYS A NZ  1 
ATOM   160  N N   . VAL A 1 22 ? 62.952  18.300 22.303  1.00 115.76 ? 42   VAL A N   1 
ATOM   161  C CA  . VAL A 1 22 ? 61.692  18.964 22.094  1.00 113.69 ? 42   VAL A CA  1 
ATOM   162  C C   . VAL A 1 22 ? 61.947  20.422 21.722  1.00 105.62 ? 42   VAL A C   1 
ATOM   163  O O   . VAL A 1 22 ? 62.966  20.988 22.095  1.00 109.47 ? 42   VAL A O   1 
ATOM   164  C CB  . VAL A 1 22 ? 60.888  18.888 23.409  1.00 119.72 ? 42   VAL A CB  1 
ATOM   165  C CG1 . VAL A 1 22 ? 59.500  19.428 23.207  1.00 125.67 ? 42   VAL A CG1 1 
ATOM   166  C CG2 . VAL A 1 22 ? 60.839  17.444 23.912  1.00 115.31 ? 42   VAL A CG2 1 
ATOM   167  N N   . TYR A 1 23 ? 61.027  21.018 20.975  1.00 97.45  ? 43   TYR A N   1 
ATOM   168  C CA  . TYR A 1 23 ? 61.157  22.409 20.579  1.00 89.41  ? 43   TYR A CA  1 
ATOM   169  C C   . TYR A 1 23 ? 59.832  23.082 20.846  1.00 77.27  ? 43   TYR A C   1 
ATOM   170  O O   . TYR A 1 23 ? 58.782  22.544 20.496  1.00 73.99  ? 43   TYR A O   1 
ATOM   171  C CB  . TYR A 1 23 ? 61.472  22.548 19.081  1.00 100.04 ? 43   TYR A CB  1 
ATOM   172  C CG  . TYR A 1 23 ? 62.673  21.767 18.589  1.00 108.18 ? 43   TYR A CG  1 
ATOM   173  C CD1 . TYR A 1 23 ? 62.585  20.393 18.350  1.00 108.11 ? 43   TYR A CD1 1 
ATOM   174  C CD2 . TYR A 1 23 ? 63.895  22.407 18.341  1.00 102.16 ? 43   TYR A CD2 1 
ATOM   175  C CE1 . TYR A 1 23 ? 63.674  19.675 17.872  1.00 104.55 ? 43   TYR A CE1 1 
ATOM   176  C CE2 . TYR A 1 23 ? 64.991  21.699 17.867  1.00 98.55  ? 43   TYR A CE2 1 
ATOM   177  C CZ  . TYR A 1 23 ? 64.872  20.334 17.630  1.00 102.76 ? 43   TYR A CZ  1 
ATOM   178  O OH  . TYR A 1 23 ? 65.941  19.635 17.119  1.00 106.71 ? 43   TYR A OH  1 
ATOM   179  N N   . PRO A 1 24 ? 59.856  24.271 21.474  1.00 78.15  ? 44   PRO A N   1 
ATOM   180  C CA  . PRO A 1 24 ? 58.623  25.018 21.774  1.00 73.97  ? 44   PRO A CA  1 
ATOM   181  C C   . PRO A 1 24 ? 57.991  25.388 20.451  1.00 62.07  ? 44   PRO A C   1 
ATOM   182  O O   . PRO A 1 24 ? 58.617  25.231 19.396  1.00 65.92  ? 44   PRO A O   1 
ATOM   183  C CB  . PRO A 1 24 ? 59.120  26.237 22.546  1.00 81.57  ? 44   PRO A CB  1 
ATOM   184  C CG  . PRO A 1 24 ? 60.490  26.449 21.970  1.00 93.89  ? 44   PRO A CG  1 
ATOM   185  C CD  . PRO A 1 24 ? 61.044  25.038 21.883  1.00 87.28  ? 44   PRO A CD  1 
ATOM   186  N N   . ILE A 1 25 ? 56.777  25.908 20.475  1.00 46.50  ? 45   ILE A N   1 
ATOM   187  C CA  . ILE A 1 25 ? 56.163  26.187 19.195  1.00 48.06  ? 45   ILE A CA  1 
ATOM   188  C C   . ILE A 1 25 ? 55.768  27.632 18.940  1.00 54.20  ? 45   ILE A C   1 
ATOM   189  O O   . ILE A 1 25 ? 55.295  28.336 19.832  1.00 57.78  ? 45   ILE A O   1 
ATOM   190  C CB  . ILE A 1 25 ? 54.954  25.233 19.001  1.00 49.78  ? 45   ILE A CB  1 
ATOM   191  C CG1 . ILE A 1 25 ? 55.432  23.777 19.169  1.00 41.67  ? 45   ILE A CG1 1 
ATOM   192  C CG2 . ILE A 1 25 ? 54.323  25.444 17.626  1.00 45.77  ? 45   ILE A CG2 1 
ATOM   193  C CD1 . ILE A 1 25 ? 54.327  22.772 19.469  1.00 38.01  ? 45   ILE A CD1 1 
ATOM   194  N N   . ILE A 1 26 ? 55.983  28.064 17.703  1.00 60.07  ? 46   ILE A N   1 
ATOM   195  C CA  . ILE A 1 26 ? 55.653  29.420 17.293  1.00 61.90  ? 46   ILE A CA  1 
ATOM   196  C C   . ILE A 1 26 ? 54.657  29.390 16.155  1.00 64.01  ? 46   ILE A C   1 
ATOM   197  O O   . ILE A 1 26 ? 54.841  28.665 15.175  1.00 66.04  ? 46   ILE A O   1 
ATOM   198  C CB  . ILE A 1 26 ? 56.886  30.188 16.817  1.00 55.93  ? 46   ILE A CB  1 
ATOM   199  C CG1 . ILE A 1 26 ? 57.933  30.239 17.937  1.00 51.31  ? 46   ILE A CG1 1 
ATOM   200  C CG2 . ILE A 1 26 ? 56.465  31.578 16.368  1.00 39.20  ? 46   ILE A CG2 1 
ATOM   201  C CD1 . ILE A 1 26 ? 57.410  30.779 19.248  1.00 39.81  ? 46   ILE A CD1 1 
ATOM   202  N N   . LEU A 1 27 ? 53.623  30.212 16.267  1.00 68.20  ? 47   LEU A N   1 
ATOM   203  C CA  . LEU A 1 27 ? 52.594  30.216 15.253  1.00 75.19  ? 47   LEU A CA  1 
ATOM   204  C C   . LEU A 1 27 ? 52.490  31.456 14.419  1.00 89.69  ? 47   LEU A C   1 
ATOM   205  O O   . LEU A 1 27 ? 52.443  32.570 14.931  1.00 89.89  ? 47   LEU A O   1 
ATOM   206  C CB  . LEU A 1 27 ? 51.245  29.938 15.897  1.00 58.18  ? 47   LEU A CB  1 
ATOM   207  C CG  . LEU A 1 27 ? 51.397  28.779 16.886  1.00 64.28  ? 47   LEU A CG  1 
ATOM   208  C CD1 . LEU A 1 27 ? 50.089  28.589 17.630  1.00 67.98  ? 47   LEU A CD1 1 
ATOM   209  C CD2 . LEU A 1 27 ? 51.838  27.494 16.159  1.00 48.63  ? 47   LEU A CD2 1 
ATOM   210  N N   . ARG A 1 28 ? 52.468  31.226 13.112  1.00 107.15 ? 48   ARG A N   1 
ATOM   211  C CA  . ARG A 1 28 ? 52.314  32.268 12.115  1.00 120.41 ? 48   ARG A CA  1 
ATOM   212  C C   . ARG A 1 28 ? 50.891  32.034 11.657  1.00 123.95 ? 48   ARG A C   1 
ATOM   213  O O   . ARG A 1 28 ? 50.592  32.046 10.460  1.00 125.17 ? 48   ARG A O   1 
ATOM   214  C CB  . ARG A 1 28 ? 53.259  32.039 10.943  1.00 127.68 ? 48   ARG A CB  1 
ATOM   215  C CG  . ARG A 1 28 ? 54.712  32.226 11.279  1.00 134.36 ? 48   ARG A CG  1 
ATOM   216  C CD  . ARG A 1 28 ? 55.393  32.934 10.128  1.00 147.55 ? 48   ARG A CD  1 
ATOM   217  N NE  . ARG A 1 28 ? 56.057  34.168 10.550  1.00 164.01 ? 48   ARG A NE  1 
ATOM   218  C CZ  . ARG A 1 28 ? 55.469  35.168 11.205  1.00 170.90 ? 48   ARG A CZ  1 
ATOM   219  N NH1 . ARG A 1 28 ? 54.184  35.098 11.532  1.00 175.51 ? 48   ARG A NH1 1 
ATOM   220  N NH2 . ARG A 1 28 ? 56.172  36.248 11.532  1.00 169.39 ? 48   ARG A NH2 1 
ATOM   221  N N   . LEU A 1 29 ? 50.028  31.793 12.639  1.00 127.79 ? 49   LEU A N   1 
ATOM   222  C CA  . LEU A 1 29 ? 48.624  31.511 12.395  1.00 129.75 ? 49   LEU A CA  1 
ATOM   223  C C   . LEU A 1 29 ? 47.990  32.442 11.379  1.00 130.90 ? 49   LEU A C   1 
ATOM   224  O O   . LEU A 1 29 ? 48.054  33.665 11.506  1.00 127.41 ? 49   LEU A O   1 
ATOM   225  C CB  . LEU A 1 29 ? 47.830  31.538 13.717  1.00 128.25 ? 49   LEU A CB  1 
ATOM   226  C CG  . LEU A 1 29 ? 47.354  32.833 14.394  1.00 118.90 ? 49   LEU A CG  1 
ATOM   227  C CD1 . LEU A 1 29 ? 48.445  33.892 14.304  1.00 114.92 ? 49   LEU A CD1 1 
ATOM   228  C CD2 . LEU A 1 29 ? 46.063  33.320 13.741  1.00 109.80 ? 49   LEU A CD2 1 
ATOM   229  N N   . GLY A 1 30 ? 47.416  31.837 10.344  1.00 133.28 ? 50   GLY A N   1 
ATOM   230  C CA  . GLY A 1 30 ? 46.724  32.589 9.317   1.00 135.50 ? 50   GLY A CA  1 
ATOM   231  C C   . GLY A 1 30 ? 45.293  32.351 9.728   1.00 137.04 ? 50   GLY A C   1 
ATOM   232  O O   . GLY A 1 30 ? 44.482  33.264 9.866   1.00 136.67 ? 50   GLY A O   1 
ATOM   233  N N   . SER A 1 31 ? 45.001  31.079 9.942   1.00 140.31 ? 51   SER A N   1 
ATOM   234  C CA  . SER A 1 31 ? 43.699  30.652 10.399  1.00 143.75 ? 51   SER A CA  1 
ATOM   235  C C   . SER A 1 31 ? 43.976  30.301 11.851  1.00 143.90 ? 51   SER A C   1 
ATOM   236  O O   . SER A 1 31 ? 45.076  29.859 12.176  1.00 146.39 ? 51   SER A O   1 
ATOM   237  C CB  . SER A 1 31 ? 43.254  29.417 9.616   1.00 145.63 ? 51   SER A CB  1 
ATOM   238  O OG  . SER A 1 31 ? 44.348  28.847 8.916   1.00 147.50 ? 51   SER A OG  1 
ATOM   239  N N   . ASN A 1 32 ? 43.015  30.528 12.734  1.00 141.18 ? 52   ASN A N   1 
ATOM   240  C CA  . ASN A 1 32 ? 43.239  30.189 14.130  1.00 140.34 ? 52   ASN A CA  1 
ATOM   241  C C   . ASN A 1 32 ? 42.936  28.699 14.310  1.00 137.22 ? 52   ASN A C   1 
ATOM   242  O O   . ASN A 1 32 ? 41.784  28.275 14.239  1.00 144.75 ? 52   ASN A O   1 
ATOM   243  C CB  . ASN A 1 32 ? 42.355  31.048 15.044  1.00 138.82 ? 52   ASN A CB  1 
ATOM   244  C CG  . ASN A 1 32 ? 43.169  31.956 15.961  1.00 128.97 ? 52   ASN A CG  1 
ATOM   245  O OD1 . ASN A 1 32 ? 43.887  31.491 16.853  1.00 115.67 ? 52   ASN A OD1 1 
ATOM   246  N ND2 . ASN A 1 32 ? 43.061  33.257 15.740  1.00 127.89 ? 52   ASN A ND2 1 
ATOM   247  N N   . LEU A 1 33 ? 43.989  27.914 14.533  1.00 125.57 ? 53   LEU A N   1 
ATOM   248  C CA  . LEU A 1 33 ? 43.891  26.464 14.709  1.00 108.08 ? 53   LEU A CA  1 
ATOM   249  C C   . LEU A 1 33 ? 43.297  25.928 16.010  1.00 97.65  ? 53   LEU A C   1 
ATOM   250  O O   . LEU A 1 33 ? 43.458  26.498 17.095  1.00 92.08  ? 53   LEU A O   1 
ATOM   251  C CB  . LEU A 1 33 ? 45.272  25.826 14.527  1.00 104.31 ? 53   LEU A CB  1 
ATOM   252  C CG  . LEU A 1 33 ? 45.660  25.206 13.183  1.00 92.75  ? 53   LEU A CG  1 
ATOM   253  C CD1 . LEU A 1 33 ? 45.549  26.224 12.047  1.00 97.44  ? 53   LEU A CD1 1 
ATOM   254  C CD2 . LEU A 1 33 ? 47.080  24.675 13.313  1.00 68.24  ? 53   LEU A CD2 1 
ATOM   255  N N   . SER A 1 34 ? 42.623  24.795 15.882  1.00 89.03  ? 54   SER A N   1 
ATOM   256  C CA  . SER A 1 34 ? 42.038  24.147 17.025  1.00 87.32  ? 54   SER A CA  1 
ATOM   257  C C   . SER A 1 34 ? 42.820  22.865 17.279  1.00 87.39  ? 54   SER A C   1 
ATOM   258  O O   . SER A 1 34 ? 43.320  22.216 16.355  1.00 86.78  ? 54   SER A O   1 
ATOM   259  C CB  . SER A 1 34 ? 40.572  23.828 16.752  1.00 95.20  ? 54   SER A CB  1 
ATOM   260  O OG  . SER A 1 34 ? 40.000  23.119 17.839  1.00 107.51 ? 54   SER A OG  1 
ATOM   261  N N   . LEU A 1 35 ? 42.949  22.514 18.545  1.00 85.94  ? 55   LEU A N   1 
ATOM   262  C CA  . LEU A 1 35 ? 43.640  21.302 18.904  1.00 81.40  ? 55   LEU A CA  1 
ATOM   263  C C   . LEU A 1 35 ? 42.763  20.485 19.846  1.00 87.57  ? 55   LEU A C   1 
ATOM   264  O O   . LEU A 1 35 ? 42.055  21.041 20.685  1.00 90.45  ? 55   LEU A O   1 
ATOM   265  C CB  . LEU A 1 35 ? 44.949  21.628 19.593  1.00 71.36  ? 55   LEU A CB  1 
ATOM   266  C CG  . LEU A 1 35 ? 45.531  20.327 20.152  1.00 77.50  ? 55   LEU A CG  1 
ATOM   267  C CD1 . LEU A 1 35 ? 45.705  19.292 19.025  1.00 83.29  ? 55   LEU A CD1 1 
ATOM   268  C CD2 . LEU A 1 35 ? 46.845  20.615 20.833  1.00 66.51  ? 55   LEU A CD2 1 
ATOM   269  N N   . SER A 1 36 ? 42.802  19.167 19.708  1.00 88.84  ? 56   SER A N   1 
ATOM   270  C CA  . SER A 1 36 ? 42.008  18.321 20.574  1.00 83.16  ? 56   SER A CA  1 
ATOM   271  C C   . SER A 1 36 ? 42.647  16.961 20.834  1.00 79.92  ? 56   SER A C   1 
ATOM   272  O O   . SER A 1 36 ? 43.391  16.425 20.015  1.00 75.60  ? 56   SER A O   1 
ATOM   273  C CB  . SER A 1 36 ? 40.593  18.159 19.999  1.00 83.81  ? 56   SER A CB  1 
ATOM   274  O OG  . SER A 1 36 ? 40.545  18.524 18.629  1.00 83.47  ? 56   SER A OG  1 
ATOM   275  N N   . MET A 1 37 ? 42.365  16.426 22.010  1.00 78.69  ? 57   MET A N   1 
ATOM   276  C CA  . MET A 1 37 ? 42.878  15.133 22.415  1.00 80.85  ? 57   MET A CA  1 
ATOM   277  C C   . MET A 1 37 ? 41.776  14.108 22.170  1.00 86.36  ? 57   MET A C   1 
ATOM   278  O O   . MET A 1 37 ? 40.616  14.322 22.536  1.00 83.42  ? 57   MET A O   1 
ATOM   279  C CB  . MET A 1 37 ? 43.238  15.169 23.897  1.00 71.82  ? 57   MET A CB  1 
ATOM   280  C CG  . MET A 1 37 ? 43.478  13.812 24.527  1.00 74.81  ? 57   MET A CG  1 
ATOM   281  S SD  . MET A 1 37 ? 45.093  13.123 24.165  1.00 79.90  ? 57   MET A SD  1 
ATOM   282  C CE  . MET A 1 37 ? 46.085  14.094 25.244  1.00 64.02  ? 57   MET A CE  1 
ATOM   283  N N   . ALA A 1 38 ? 42.138  12.994 21.550  1.00 90.17  ? 58   ALA A N   1 
ATOM   284  C CA  . ALA A 1 38 ? 41.164  11.952 21.265  1.00 92.40  ? 58   ALA A CA  1 
ATOM   285  C C   . ALA A 1 38 ? 41.519  10.609 21.922  1.00 95.19  ? 58   ALA A C   1 
ATOM   286  O O   . ALA A 1 38 ? 42.689  10.317 22.194  1.00 87.35  ? 58   ALA A O   1 
ATOM   287  C CB  . ALA A 1 38 ? 41.025  11.787 19.758  1.00 86.67  ? 58   ALA A CB  1 
ATOM   288  N N   . ARG A 1 39 ? 40.491  9.803  22.181  1.00 99.64  ? 59   ARG A N   1 
ATOM   289  C CA  . ARG A 1 39 ? 40.666  8.494  22.800  1.00 102.38 ? 59   ARG A CA  1 
ATOM   290  C C   . ARG A 1 39 ? 39.609  7.509  22.307  1.00 102.90 ? 59   ARG A C   1 
ATOM   291  O O   . ARG A 1 39 ? 38.458  7.875  22.099  1.00 100.84 ? 59   ARG A O   1 
ATOM   292  C CB  . ARG A 1 39 ? 40.559  8.612  24.317  1.00 106.90 ? 59   ARG A CB  1 
ATOM   293  C CG  . ARG A 1 39 ? 41.392  9.719  24.905  1.00 117.60 ? 59   ARG A CG  1 
ATOM   294  C CD  . ARG A 1 39 ? 40.696  10.334 26.103  1.00 129.63 ? 59   ARG A CD  1 
ATOM   295  N NE  . ARG A 1 39 ? 41.434  11.488 26.593  1.00 137.58 ? 59   ARG A NE  1 
ATOM   296  C CZ  . ARG A 1 39 ? 42.645  11.414 27.132  1.00 138.50 ? 59   ARG A CZ  1 
ATOM   297  N NH1 . ARG A 1 39 ? 43.242  10.240 27.253  1.00 134.50 ? 59   ARG A NH1 1 
ATOM   298  N NH2 . ARG A 1 39 ? 43.266  12.513 27.535  1.00 143.98 ? 59   ARG A NH2 1 
ATOM   299  N N   . ARG A 1 40 ? 40.003  6.254  22.126  1.00 104.60 ? 60   ARG A N   1 
ATOM   300  C CA  . ARG A 1 40 ? 39.070  5.225  21.677  1.00 106.19 ? 60   ARG A CA  1 
ATOM   301  C C   . ARG A 1 40 ? 37.993  4.981  22.729  1.00 107.37 ? 60   ARG A C   1 
ATOM   302  O O   . ARG A 1 40 ? 38.236  5.124  23.925  1.00 115.98 ? 60   ARG A O   1 
ATOM   303  C CB  . ARG A 1 40 ? 39.806  3.906  21.417  1.00 99.40  ? 60   ARG A CB  1 
ATOM   304  C CG  . ARG A 1 40 ? 40.511  3.824  20.093  1.00 89.69  ? 60   ARG A CG  1 
ATOM   305  C CD  . ARG A 1 40 ? 39.862  2.773  19.229  1.00 86.37  ? 60   ARG A CD  1 
ATOM   306  N NE  . ARG A 1 40 ? 40.455  2.717  17.895  1.00 93.35  ? 60   ARG A NE  1 
ATOM   307  C CZ  . ARG A 1 40 ? 41.728  2.412  17.651  1.00 89.36  ? 60   ARG A CZ  1 
ATOM   308  N NH1 . ARG A 1 40 ? 42.552  2.136  18.654  1.00 89.62  ? 60   ARG A NH1 1 
ATOM   309  N NH2 . ARG A 1 40 ? 42.176  2.374  16.403  1.00 82.53  ? 60   ARG A NH2 1 
ATOM   310  N N   . ASN A 1 41 ? 36.804  4.609  22.277  1.00 101.03 ? 61   ASN A N   1 
ATOM   311  C CA  . ASN A 1 41 ? 35.696  4.316  23.171  1.00 91.87  ? 61   ASN A CA  1 
ATOM   312  C C   . ASN A 1 41 ? 35.604  2.792  23.254  1.00 89.68  ? 61   ASN A C   1 
ATOM   313  O O   . ASN A 1 41 ? 34.794  2.170  22.565  1.00 88.99  ? 61   ASN A O   1 
ATOM   314  C CB  . ASN A 1 41 ? 34.419  4.927  22.591  1.00 95.17  ? 61   ASN A CB  1 
ATOM   315  C CG  . ASN A 1 41 ? 33.172  4.443  23.282  1.00 93.65  ? 61   ASN A CG  1 
ATOM   316  O OD1 . ASN A 1 41 ? 33.175  4.184  24.487  1.00 100.18 ? 61   ASN A OD1 1 
ATOM   317  N ND2 . ASN A 1 41 ? 32.083  4.335  22.525  1.00 85.73  ? 61   ASN A ND2 1 
ATOM   318  N N   . LEU A 1 42 ? 36.454  2.205  24.098  1.00 88.83  ? 62   LEU A N   1 
ATOM   319  C CA  . LEU A 1 42 ? 36.543  0.746  24.281  1.00 90.38  ? 62   LEU A CA  1 
ATOM   320  C C   . LEU A 1 42 ? 35.648  0.117  25.350  1.00 93.98  ? 62   LEU A C   1 
ATOM   321  O O   . LEU A 1 42 ? 35.847  -1.038 25.731  1.00 91.38  ? 62   LEU A O   1 
ATOM   322  C CB  . LEU A 1 42 ? 37.978  0.345  24.622  1.00 87.85  ? 62   LEU A CB  1 
ATOM   323  C CG  . LEU A 1 42 ? 39.115  0.650  23.663  1.00 87.33  ? 62   LEU A CG  1 
ATOM   324  C CD1 . LEU A 1 42 ? 40.382  0.063  24.249  1.00 73.51  ? 62   LEU A CD1 1 
ATOM   325  C CD2 . LEU A 1 42 ? 38.825  0.062  22.292  1.00 94.66  ? 62   LEU A CD2 1 
ATOM   326  N N   . ASP A 1 43 ? 34.678  0.861  25.850  1.00 98.56  ? 63   ASP A N   1 
ATOM   327  C CA  . ASP A 1 43 ? 33.814  0.325  26.883  1.00 103.98 ? 63   ASP A CA  1 
ATOM   328  C C   . ASP A 1 43 ? 32.375  0.485  26.460  1.00 106.13 ? 63   ASP A C   1 
ATOM   329  O O   . ASP A 1 43 ? 31.469  0.053  27.163  1.00 112.69 ? 63   ASP A O   1 
ATOM   330  C CB  . ASP A 1 43 ? 34.056  1.074  28.202  1.00 113.28 ? 63   ASP A CB  1 
ATOM   331  C CG  . ASP A 1 43 ? 34.134  2.593  28.014  1.00 125.23 ? 63   ASP A CG  1 
ATOM   332  O OD1 . ASP A 1 43 ? 33.179  3.187  27.462  1.00 122.90 ? 63   ASP A OD1 1 
ATOM   333  O OD2 . ASP A 1 43 ? 35.156  3.193  28.421  1.00 133.32 ? 63   ASP A OD2 1 
ATOM   334  N N   . SER A 1 44 ? 32.175  1.090  25.296  1.00 106.06 ? 64   SER A N   1 
ATOM   335  C CA  . SER A 1 44 ? 30.833  1.365  24.800  1.00 104.46 ? 64   SER A CA  1 
ATOM   336  C C   . SER A 1 44 ? 30.677  1.103  23.296  1.00 102.98 ? 64   SER A C   1 
ATOM   337  O O   . SER A 1 44 ? 31.553  0.488  22.676  1.00 97.32  ? 64   SER A O   1 
ATOM   338  C CB  . SER A 1 44 ? 30.494  2.828  25.137  1.00 104.62 ? 64   SER A CB  1 
ATOM   339  O OG  . SER A 1 44 ? 29.285  3.257  24.539  1.00 112.69 ? 64   SER A OG  1 
ATOM   340  N N   . LEU A 1 45 ? 29.559  1.573  22.729  1.00 102.82 ? 65   LEU A N   1 
ATOM   341  C CA  . LEU A 1 45 ? 29.256  1.417  21.301  1.00 97.06  ? 65   LEU A CA  1 
ATOM   342  C C   . LEU A 1 45 ? 28.198  2.396  20.766  1.00 101.89 ? 65   LEU A C   1 
ATOM   343  O O   . LEU A 1 45 ? 27.865  2.356  19.578  1.00 104.87 ? 65   LEU A O   1 
ATOM   344  C CB  . LEU A 1 45 ? 28.773  0.000  21.011  1.00 84.00  ? 65   LEU A CB  1 
ATOM   345  C CG  . LEU A 1 45 ? 27.424  -0.306 21.655  1.00 76.06  ? 65   LEU A CG  1 
ATOM   346  C CD1 . LEU A 1 45 ? 26.665  -1.299 20.803  1.00 77.50  ? 65   LEU A CD1 1 
ATOM   347  C CD2 . LEU A 1 45 ? 27.641  -0.818 23.071  1.00 67.52  ? 65   LEU A CD2 1 
ATOM   348  N N   . GLU A 1 46 ? 27.661  3.257  21.630  1.00 103.23 ? 66   GLU A N   1 
ATOM   349  C CA  . GLU A 1 46 ? 26.645  4.224  21.207  1.00 103.71 ? 66   GLU A CA  1 
ATOM   350  C C   . GLU A 1 46 ? 27.114  5.679  21.271  1.00 97.46  ? 66   GLU A C   1 
ATOM   351  O O   . GLU A 1 46 ? 26.410  6.585  20.820  1.00 87.04  ? 66   GLU A O   1 
ATOM   352  C CB  . GLU A 1 46 ? 25.363  4.054  22.034  1.00 118.86 ? 66   GLU A CB  1 
ATOM   353  C CG  . GLU A 1 46 ? 25.585  3.702  23.504  1.00 139.21 ? 66   GLU A CG  1 
ATOM   354  C CD  . GLU A 1 46 ? 25.778  2.206  23.742  1.00 152.21 ? 66   GLU A CD  1 
ATOM   355  O OE1 . GLU A 1 46 ? 24.799  1.438  23.619  1.00 153.21 ? 66   GLU A OE1 1 
ATOM   356  O OE2 . GLU A 1 46 ? 26.915  1.796  24.051  1.00 159.71 ? 66   GLU A OE2 1 
ATOM   357  N N   . ALA A 1 47 ? 28.302  5.893  21.833  1.00 99.75  ? 67   ALA A N   1 
ATOM   358  C CA  . ALA A 1 47 ? 28.887  7.229  21.939  1.00 104.71 ? 67   ALA A CA  1 
ATOM   359  C C   . ALA A 1 47 ? 30.230  7.237  21.219  1.00 107.96 ? 67   ALA A C   1 
ATOM   360  O O   . ALA A 1 47 ? 31.060  6.347  21.436  1.00 105.04 ? 67   ALA A O   1 
ATOM   361  C CB  . ALA A 1 47 ? 29.080  7.610  23.391  1.00 107.22 ? 67   ALA A CB  1 
ATOM   362  N N   . ARG A 1 48 ? 30.423  8.248  20.372  1.00 108.13 ? 68   ARG A N   1 
ATOM   363  C CA  . ARG A 1 48 ? 31.636  8.432  19.567  1.00 107.18 ? 68   ARG A CA  1 
ATOM   364  C C   . ARG A 1 48 ? 32.792  7.456  19.771  1.00 99.80  ? 68   ARG A C   1 
ATOM   365  O O   . ARG A 1 48 ? 33.293  7.275  20.889  1.00 93.40  ? 68   ARG A O   1 
ATOM   366  C CB  . ARG A 1 48 ? 32.173  9.837  19.756  1.00 122.16 ? 68   ARG A CB  1 
ATOM   367  C CG  . ARG A 1 48 ? 31.176  10.920 19.490  1.00 139.73 ? 68   ARG A CG  1 
ATOM   368  C CD  . ARG A 1 48 ? 31.939  12.199 19.282  1.00 162.73 ? 68   ARG A CD  1 
ATOM   369  N NE  . ARG A 1 48 ? 31.064  13.348 19.132  1.00 178.09 ? 68   ARG A NE  1 
ATOM   370  C CZ  . ARG A 1 48 ? 31.501  14.567 18.850  1.00 186.45 ? 68   ARG A CZ  1 
ATOM   371  N NH1 . ARG A 1 48 ? 32.801  14.783 18.685  1.00 184.21 ? 68   ARG A NH1 1 
ATOM   372  N NH2 . ARG A 1 48 ? 30.641  15.569 18.741  1.00 194.49 ? 68   ARG A NH2 1 
ATOM   373  N N   . ALA A 1 49 ? 33.234  6.859  18.667  1.00 97.11  ? 69   ALA A N   1 
ATOM   374  C CA  . ALA A 1 49 ? 34.324  5.894  18.702  1.00 96.49  ? 69   ALA A CA  1 
ATOM   375  C C   . ALA A 1 49 ? 35.510  6.476  19.449  1.00 100.99 ? 69   ALA A C   1 
ATOM   376  O O   . ALA A 1 49 ? 36.345  5.736  19.979  1.00 97.51  ? 69   ALA A O   1 
ATOM   377  C CB  . ALA A 1 49 ? 34.739  5.513  17.285  1.00 85.80  ? 69   ALA A CB  1 
ATOM   378  N N   . PHE A 1 50 ? 35.579  7.808  19.483  1.00 109.37 ? 70   PHE A N   1 
ATOM   379  C CA  . PHE A 1 50 ? 36.678  8.507  20.145  1.00 110.66 ? 70   PHE A CA  1 
ATOM   380  C C   . PHE A 1 50 ? 36.291  9.722  21.010  1.00 104.95 ? 70   PHE A C   1 
ATOM   381  O O   . PHE A 1 50 ? 35.372  10.497 20.699  1.00 91.23  ? 70   PHE A O   1 
ATOM   382  C CB  . PHE A 1 50 ? 37.735  8.931  19.108  1.00 120.89 ? 70   PHE A CB  1 
ATOM   383  C CG  . PHE A 1 50 ? 38.475  7.774  18.465  1.00 133.58 ? 70   PHE A CG  1 
ATOM   384  C CD1 . PHE A 1 50 ? 37.802  6.837  17.685  1.00 145.14 ? 70   PHE A CD1 1 
ATOM   385  C CD2 . PHE A 1 50 ? 39.848  7.631  18.632  1.00 135.87 ? 70   PHE A CD2 1 
ATOM   386  C CE1 . PHE A 1 50 ? 38.480  5.780  17.081  1.00 148.21 ? 70   PHE A CE1 1 
ATOM   387  C CE2 . PHE A 1 50 ? 40.536  6.578  18.032  1.00 137.70 ? 70   PHE A CE2 1 
ATOM   388  C CZ  . PHE A 1 50 ? 39.849  5.651  17.257  1.00 143.95 ? 70   PHE A CZ  1 
ATOM   389  N N   . GLN A 1 51 ? 37.045  9.864  22.096  1.00 105.85 ? 71   GLN A N   1 
ATOM   390  C CA  . GLN A 1 51 ? 36.901  10.918 23.092  1.00 101.09 ? 71   GLN A CA  1 
ATOM   391  C C   . GLN A 1 51 ? 37.575  12.219 22.681  1.00 96.94  ? 71   GLN A C   1 
ATOM   392  O O   . GLN A 1 51 ? 38.728  12.456 23.062  1.00 89.08  ? 71   GLN A O   1 
ATOM   393  C CB  . GLN A 1 51 ? 37.535  10.448 24.405  1.00 102.85 ? 71   GLN A CB  1 
ATOM   394  C CG  . GLN A 1 51 ? 36.562  10.014 25.476  1.00 105.47 ? 71   GLN A CG  1 
ATOM   395  C CD  . GLN A 1 51 ? 35.949  11.193 26.189  1.00 114.00 ? 71   GLN A CD  1 
ATOM   396  O OE1 . GLN A 1 51 ? 35.305  12.043 25.566  1.00 111.14 ? 71   GLN A OE1 1 
ATOM   397  N NE2 . GLN A 1 51 ? 36.149  11.260 27.505  1.00 120.14 ? 71   GLN A NE2 1 
ATOM   398  N N   . SER A 1 52 ? 36.886  13.066 21.919  1.00 97.00  ? 72   SER A N   1 
ATOM   399  C CA  . SER A 1 52 ? 37.506  14.333 21.543  1.00 102.37 ? 72   SER A CA  1 
ATOM   400  C C   . SER A 1 52 ? 37.310  15.365 22.629  1.00 100.10 ? 72   SER A C   1 
ATOM   401  O O   . SER A 1 52 ? 36.208  15.870 22.853  1.00 97.60  ? 72   SER A O   1 
ATOM   402  C CB  . SER A 1 52 ? 36.948  14.901 20.246  1.00 107.92 ? 72   SER A CB  1 
ATOM   403  O OG  . SER A 1 52 ? 37.551  16.169 20.005  1.00 101.49 ? 72   SER A OG  1 
ATOM   404  N N   . THR A 1 53 ? 38.402  15.681 23.298  1.00 98.78  ? 73   THR A N   1 
ATOM   405  C CA  . THR A 1 53 ? 38.370  16.642 24.371  1.00 102.71 ? 73   THR A CA  1 
ATOM   406  C C   . THR A 1 53 ? 39.170  17.840 23.906  1.00 111.59 ? 73   THR A C   1 
ATOM   407  O O   . THR A 1 53 ? 40.397  17.807 23.942  1.00 113.96 ? 73   THR A O   1 
ATOM   408  C CB  . THR A 1 53 ? 39.035  16.062 25.617  1.00 101.40 ? 73   THR A CB  1 
ATOM   409  O OG1 . THR A 1 53 ? 38.585  14.714 25.816  1.00 98.66  ? 73   THR A OG1 1 
ATOM   410  C CG2 . THR A 1 53 ? 38.698  16.902 26.831  1.00 103.80 ? 73   THR A CG2 1 
ATOM   411  N N   . PRO A 1 54 ? 38.493  18.907 23.440  1.00 119.37 ? 74   PRO A N   1 
ATOM   412  C CA  . PRO A 1 54 ? 39.231  20.090 22.982  1.00 122.64 ? 74   PRO A CA  1 
ATOM   413  C C   . PRO A 1 54 ? 40.329  20.451 23.993  1.00 123.95 ? 74   PRO A C   1 
ATOM   414  O O   . PRO A 1 54 ? 40.096  20.414 25.204  1.00 121.92 ? 74   PRO A O   1 
ATOM   415  C CB  . PRO A 1 54 ? 38.136  21.144 22.871  1.00 122.58 ? 74   PRO A CB  1 
ATOM   416  C CG  . PRO A 1 54 ? 36.968  20.327 22.387  1.00 122.90 ? 74   PRO A CG  1 
ATOM   417  C CD  . PRO A 1 54 ? 37.039  19.105 23.292  1.00 123.62 ? 74   PRO A CD  1 
ATOM   418  N N   . ILE A 1 55 ? 41.520  20.784 23.487  1.00 124.50 ? 75   ILE A N   1 
ATOM   419  C CA  . ILE A 1 55 ? 42.685  21.107 24.325  1.00 115.74 ? 75   ILE A CA  1 
ATOM   420  C C   . ILE A 1 55 ? 43.024  22.599 24.436  1.00 114.25 ? 75   ILE A C   1 
ATOM   421  O O   . ILE A 1 55 ? 43.081  23.306 23.429  1.00 115.05 ? 75   ILE A O   1 
ATOM   422  C CB  . ILE A 1 55 ? 43.937  20.372 23.805  1.00 107.51 ? 75   ILE A CB  1 
ATOM   423  C CG1 . ILE A 1 55 ? 43.676  18.859 23.751  1.00 107.06 ? 75   ILE A CG1 1 
ATOM   424  C CG2 . ILE A 1 55 ? 45.114  20.696 24.695  1.00 95.72  ? 75   ILE A CG2 1 
ATOM   425  C CD1 . ILE A 1 55 ? 44.721  18.051 22.993  1.00 98.30  ? 75   ILE A CD1 1 
ATOM   426  N N   . VAL A 1 56 ? 43.285  23.055 25.662  1.00 111.47 ? 76   VAL A N   1 
ATOM   427  C CA  . VAL A 1 56 ? 43.601  24.462 25.934  1.00 110.24 ? 76   VAL A CA  1 
ATOM   428  C C   . VAL A 1 56 ? 45.038  24.872 25.647  1.00 114.68 ? 76   VAL A C   1 
ATOM   429  O O   . VAL A 1 56 ? 45.967  24.430 26.329  1.00 115.61 ? 76   VAL A O   1 
ATOM   430  C CB  . VAL A 1 56 ? 43.302  24.828 27.408  1.00 103.19 ? 76   VAL A CB  1 
ATOM   431  C CG1 . VAL A 1 56 ? 44.004  23.843 28.334  1.00 102.59 ? 76   VAL A CG1 1 
ATOM   432  C CG2 . VAL A 1 56 ? 43.747  26.270 27.700  1.00 86.55  ? 76   VAL A CG2 1 
ATOM   433  N N   . VAL A 1 57 ? 45.212  25.734 24.647  1.00 116.95 ? 77   VAL A N   1 
ATOM   434  C CA  . VAL A 1 57 ? 46.537  26.220 24.282  1.00 116.47 ? 77   VAL A CA  1 
ATOM   435  C C   . VAL A 1 57 ? 46.729  27.611 24.865  1.00 117.73 ? 77   VAL A C   1 
ATOM   436  O O   . VAL A 1 57 ? 46.053  28.572 24.476  1.00 106.85 ? 77   VAL A O   1 
ATOM   437  C CB  . VAL A 1 57 ? 46.729  26.297 22.763  1.00 113.68 ? 77   VAL A CB  1 
ATOM   438  C CG1 . VAL A 1 57 ? 48.192  26.578 22.452  1.00 109.43 ? 77   VAL A CG1 1 
ATOM   439  C CG2 . VAL A 1 57 ? 46.281  25.000 22.115  1.00 112.89 ? 77   VAL A CG2 1 
ATOM   440  N N   . GLN A 1 58 ? 47.670  27.701 25.797  1.00 124.17 ? 78   GLN A N   1 
ATOM   441  C CA  . GLN A 1 58 ? 47.962  28.944 26.481  1.00 130.75 ? 78   GLN A CA  1 
ATOM   442  C C   . GLN A 1 58 ? 49.054  29.756 25.789  1.00 129.12 ? 78   GLN A C   1 
ATOM   443  O O   . GLN A 1 58 ? 49.838  30.437 26.444  1.00 134.21 ? 78   GLN A O   1 
ATOM   444  C CB  . GLN A 1 58 ? 48.365  28.638 27.926  1.00 140.78 ? 78   GLN A CB  1 
ATOM   445  C CG  . GLN A 1 58 ? 47.916  29.696 28.897  1.00 158.13 ? 78   GLN A CG  1 
ATOM   446  C CD  . GLN A 1 58 ? 46.465  30.067 28.674  1.00 170.76 ? 78   GLN A CD  1 
ATOM   447  O OE1 . GLN A 1 58 ? 45.582  29.211 28.727  1.00 174.38 ? 78   GLN A OE1 1 
ATOM   448  N NE2 . GLN A 1 58 ? 46.212  31.346 28.414  1.00 175.90 ? 78   GLN A NE2 1 
ATOM   449  N N   . MET A 1 59 ? 49.100  29.689 24.465  1.00 122.80 ? 79   MET A N   1 
ATOM   450  C CA  . MET A 1 59 ? 50.103  30.422 23.701  1.00 115.09 ? 79   MET A CA  1 
ATOM   451  C C   . MET A 1 59 ? 50.111  31.921 24.010  1.00 116.32 ? 79   MET A C   1 
ATOM   452  O O   . MET A 1 59 ? 49.077  32.509 24.344  1.00 116.94 ? 79   MET A O   1 
ATOM   453  C CB  . MET A 1 59 ? 49.853  30.234 22.216  1.00 109.09 ? 79   MET A CB  1 
ATOM   454  C CG  . MET A 1 59 ? 48.455  30.638 21.822  1.00 103.99 ? 79   MET A CG  1 
ATOM   455  S SD  . MET A 1 59 ? 48.340  31.074 20.092  1.00 104.02 ? 79   MET A SD  1 
ATOM   456  C CE  . MET A 1 59 ? 47.865  32.833 20.205  1.00 104.10 ? 79   MET A CE  1 
ATOM   457  N N   . THR A 1 60 ? 51.287  32.532 23.868  1.00 115.13 ? 80   THR A N   1 
ATOM   458  C CA  . THR A 1 60 ? 51.481  33.960 24.130  1.00 108.80 ? 80   THR A CA  1 
ATOM   459  C C   . THR A 1 60 ? 51.803  34.741 22.867  1.00 106.84 ? 80   THR A C   1 
ATOM   460  O O   . THR A 1 60 ? 52.523  34.252 21.996  1.00 109.43 ? 80   THR A O   1 
ATOM   461  C CB  . THR A 1 60 ? 52.660  34.206 25.069  1.00 102.79 ? 80   THR A CB  1 
ATOM   462  O OG1 . THR A 1 60 ? 52.578  33.323 26.190  1.00 109.70 ? 80   THR A OG1 1 
ATOM   463  C CG2 . THR A 1 60 ? 52.653  35.645 25.544  1.00 92.59  ? 80   THR A CG2 1 
ATOM   464  N N   . LYS A 1 61 ? 51.293  35.964 22.777  1.00 99.69  ? 81   LYS A N   1 
ATOM   465  C CA  . LYS A 1 61 ? 51.572  36.793 21.614  1.00 95.61  ? 81   LYS A CA  1 
ATOM   466  C C   . LYS A 1 61 ? 52.857  37.547 21.914  1.00 95.39  ? 81   LYS A C   1 
ATOM   467  O O   . LYS A 1 61 ? 53.009  38.139 22.987  1.00 92.50  ? 81   LYS A O   1 
ATOM   468  C CB  . LYS A 1 61 ? 50.426  37.767 21.358  1.00 99.01  ? 81   LYS A CB  1 
ATOM   469  C CG  . LYS A 1 61 ? 50.488  38.476 20.015  1.00 108.84 ? 81   LYS A CG  1 
ATOM   470  C CD  . LYS A 1 61 ? 51.439  39.654 20.026  1.00 125.95 ? 81   LYS A CD  1 
ATOM   471  C CE  . LYS A 1 61 ? 51.282  40.471 18.752  1.00 136.63 ? 81   LYS A CE  1 
ATOM   472  N NZ  . LYS A 1 61 ? 52.032  41.758 18.795  1.00 142.85 ? 81   LYS A NZ  1 
ATOM   473  N N   . LEU A 1 62 ? 53.786  37.513 20.964  1.00 96.66  ? 82   LEU A N   1 
ATOM   474  C CA  . LEU A 1 62 ? 55.077  38.164 21.143  1.00 90.94  ? 82   LEU A CA  1 
ATOM   475  C C   . LEU A 1 62 ? 55.195  39.555 20.578  1.00 87.62  ? 82   LEU A C   1 
ATOM   476  O O   . LEU A 1 62 ? 54.659  39.860 19.506  1.00 83.38  ? 82   LEU A O   1 
ATOM   477  C CB  . LEU A 1 62 ? 56.205  37.313 20.547  1.00 82.31  ? 82   LEU A CB  1 
ATOM   478  C CG  . LEU A 1 62 ? 56.688  36.098 21.342  1.00 74.99  ? 82   LEU A CG  1 
ATOM   479  C CD1 . LEU A 1 62 ? 58.004  35.660 20.772  1.00 66.38  ? 82   LEU A CD1 1 
ATOM   480  C CD2 . LEU A 1 62 ? 56.874  36.441 22.813  1.00 77.93  ? 82   LEU A CD2 1 
ATOM   481  N N   . ALA A 1 63 ? 55.929  40.381 21.317  1.00 84.84  ? 83   ALA A N   1 
ATOM   482  C CA  . ALA A 1 63 ? 56.198  41.756 20.942  1.00 86.15  ? 83   ALA A CA  1 
ATOM   483  C C   . ALA A 1 63 ? 57.607  41.796 20.350  1.00 90.80  ? 83   ALA A C   1 
ATOM   484  O O   . ALA A 1 63 ? 57.795  42.229 19.210  1.00 92.19  ? 83   ALA A O   1 
ATOM   485  C CB  . ALA A 1 63 ? 56.113  42.645 22.166  1.00 86.01  ? 83   ALA A CB  1 
ATOM   486  N N   . THR A 1 64 ? 58.584  41.322 21.128  1.00 92.25  ? 84   THR A N   1 
ATOM   487  C CA  . THR A 1 64 ? 59.985  41.292 20.705  1.00 87.98  ? 84   THR A CA  1 
ATOM   488  C C   . THR A 1 64 ? 60.495  39.913 20.345  1.00 84.83  ? 84   THR A C   1 
ATOM   489  O O   . THR A 1 64 ? 60.115  38.903 20.934  1.00 85.07  ? 84   THR A O   1 
ATOM   490  C CB  . THR A 1 64 ? 60.956  41.847 21.786  1.00 89.86  ? 84   THR A CB  1 
ATOM   491  O OG1 . THR A 1 64 ? 62.307  41.676 21.339  1.00 89.09  ? 84   THR A OG1 1 
ATOM   492  C CG2 . THR A 1 64 ? 60.800  41.106 23.104  1.00 92.78  ? 84   THR A CG2 1 
ATOM   493  N N   . THR A 1 65 ? 61.395  39.896 19.379  1.00 83.10  ? 85   THR A N   1 
ATOM   494  C CA  . THR A 1 65 ? 61.998  38.666 18.913  1.00 82.43  ? 85   THR A CA  1 
ATOM   495  C C   . THR A 1 65 ? 63.045  38.212 19.942  1.00 80.34  ? 85   THR A C   1 
ATOM   496  O O   . THR A 1 65 ? 63.577  37.101 19.875  1.00 74.10  ? 85   THR A O   1 
ATOM   497  C CB  . THR A 1 65 ? 62.648  38.908 17.517  1.00 83.86  ? 85   THR A CB  1 
ATOM   498  O OG1 . THR A 1 65 ? 62.401  37.778 16.673  1.00 84.44  ? 85   THR A OG1 1 
ATOM   499  C CG2 . THR A 1 65 ? 64.162  39.137 17.639  1.00 92.77  ? 85   THR A CG2 1 
ATOM   500  N N   . GLU A 1 66 ? 63.330  39.077 20.908  1.00 87.59  ? 86   GLU A N   1 
ATOM   501  C CA  . GLU A 1 66 ? 64.326  38.755 21.918  1.00 96.59  ? 86   GLU A CA  1 
ATOM   502  C C   . GLU A 1 66 ? 63.788  37.749 22.932  1.00 93.45  ? 86   GLU A C   1 
ATOM   503  O O   . GLU A 1 66 ? 64.568  37.074 23.614  1.00 83.55  ? 86   GLU A O   1 
ATOM   504  C CB  . GLU A 1 66 ? 64.802  40.040 22.629  1.00 109.27 ? 86   GLU A CB  1 
ATOM   505  C CG  . GLU A 1 66 ? 66.082  39.867 23.470  1.00 116.91 ? 86   GLU A CG  1 
ATOM   506  C CD  . GLU A 1 66 ? 66.754  41.187 23.828  1.00 121.99 ? 86   GLU A CD  1 
ATOM   507  O OE1 . GLU A 1 66 ? 66.094  42.033 24.467  1.00 125.74 ? 86   GLU A OE1 1 
ATOM   508  O OE2 . GLU A 1 66 ? 67.943  41.374 23.473  1.00 123.95 ? 86   GLU A OE2 1 
ATOM   509  N N   . GLU A 1 67 ? 62.461  37.632 23.012  1.00 99.00  ? 87   GLU A N   1 
ATOM   510  C CA  . GLU A 1 67 ? 61.811  36.711 23.953  1.00 102.41 ? 87   GLU A CA  1 
ATOM   511  C C   . GLU A 1 67 ? 61.932  35.243 23.541  1.00 95.21  ? 87   GLU A C   1 
ATOM   512  O O   . GLU A 1 67 ? 61.685  34.338 24.335  1.00 90.69  ? 87   GLU A O   1 
ATOM   513  C CB  . GLU A 1 67 ? 60.329  37.070 24.103  1.00 109.59 ? 87   GLU A CB  1 
ATOM   514  C CG  . GLU A 1 67 ? 60.076  38.446 24.693  1.00 120.24 ? 87   GLU A CG  1 
ATOM   515  C CD  . GLU A 1 67 ? 58.609  38.830 24.656  1.00 135.09 ? 87   GLU A CD  1 
ATOM   516  O OE1 . GLU A 1 67 ? 57.792  38.090 25.240  1.00 143.39 ? 87   GLU A OE1 1 
ATOM   517  O OE2 . GLU A 1 67 ? 58.271  39.867 24.045  1.00 138.67 ? 87   GLU A OE2 1 
ATOM   518  N N   . LEU A 1 68 ? 62.339  35.020 22.299  1.00 91.24  ? 88   LEU A N   1 
ATOM   519  C CA  . LEU A 1 68 ? 62.472  33.679 21.752  1.00 81.23  ? 88   LEU A CA  1 
ATOM   520  C C   . LEU A 1 68 ? 63.674  32.847 22.167  1.00 83.69  ? 88   LEU A C   1 
ATOM   521  O O   . LEU A 1 68 ? 64.725  33.370 22.514  1.00 96.62  ? 88   LEU A O   1 
ATOM   522  C CB  . LEU A 1 68 ? 62.429  33.766 20.239  1.00 70.79  ? 88   LEU A CB  1 
ATOM   523  C CG  . LEU A 1 68 ? 61.076  34.316 19.796  1.00 70.25  ? 88   LEU A CG  1 
ATOM   524  C CD1 . LEU A 1 68 ? 61.121  34.668 18.327  1.00 71.29  ? 88   LEU A CD1 1 
ATOM   525  C CD2 . LEU A 1 68 ? 59.985  33.286 20.095  1.00 70.70  ? 88   LEU A CD2 1 
ATOM   526  N N   . PRO A 1 69 ? 63.516  31.518 22.137  1.00 77.34  ? 89   PRO A N   1 
ATOM   527  C CA  . PRO A 1 69 ? 64.542  30.535 22.492  1.00 66.28  ? 89   PRO A CA  1 
ATOM   528  C C   . PRO A 1 69 ? 65.573  30.528 21.387  1.00 62.45  ? 89   PRO A C   1 
ATOM   529  O O   . PRO A 1 69 ? 65.331  31.078 20.310  1.00 60.56  ? 89   PRO A O   1 
ATOM   530  C CB  . PRO A 1 69 ? 63.768  29.223 22.530  1.00 66.32  ? 89   PRO A CB  1 
ATOM   531  C CG  . PRO A 1 69 ? 62.318  29.668 22.741  1.00 67.57  ? 89   PRO A CG  1 
ATOM   532  C CD  . PRO A 1 69 ? 62.238  30.849 21.848  1.00 74.90  ? 89   PRO A CD  1 
ATOM   533  N N   . ASP A 1 70 ? 66.713  29.901 21.625  1.00 60.21  ? 90   ASP A N   1 
ATOM   534  C CA  . ASP A 1 70 ? 67.709  29.885 20.579  1.00 65.04  ? 90   ASP A CA  1 
ATOM   535  C C   . ASP A 1 70 ? 67.234  29.051 19.402  1.00 59.18  ? 90   ASP A C   1 
ATOM   536  O O   . ASP A 1 70 ? 67.417  29.441 18.247  1.00 48.80  ? 90   ASP A O   1 
ATOM   537  C CB  . ASP A 1 70 ? 69.032  29.372 21.127  1.00 79.96  ? 90   ASP A CB  1 
ATOM   538  C CG  . ASP A 1 70 ? 70.100  30.453 21.150  1.00 83.47  ? 90   ASP A CG  1 
ATOM   539  O OD1 . ASP A 1 70 ? 69.749  31.655 21.241  1.00 74.40  ? 90   ASP A OD1 1 
ATOM   540  O OD2 . ASP A 1 70 ? 71.292  30.098 21.086  1.00 87.60  ? 90   ASP A OD2 1 
ATOM   541  N N   . GLU A 1 71 ? 66.605  27.920 19.713  1.00 65.97  ? 91   GLU A N   1 
ATOM   542  C CA  . GLU A 1 71 ? 66.064  26.987 18.722  1.00 66.42  ? 91   GLU A CA  1 
ATOM   543  C C   . GLU A 1 71 ? 64.568  26.850 18.933  1.00 62.55  ? 91   GLU A C   1 
ATOM   544  O O   . GLU A 1 71 ? 64.092  27.036 20.050  1.00 67.41  ? 91   GLU A O   1 
ATOM   545  C CB  . GLU A 1 71 ? 66.664  25.609 18.924  1.00 74.47  ? 91   GLU A CB  1 
ATOM   546  C CG  . GLU A 1 71 ? 67.672  25.177 17.903  1.00 90.13  ? 91   GLU A CG  1 
ATOM   547  C CD  . GLU A 1 71 ? 67.878  23.681 17.976  1.00 105.89 ? 91   GLU A CD  1 
ATOM   548  O OE1 . GLU A 1 71 ? 68.039  23.175 19.105  1.00 117.18 ? 91   GLU A OE1 1 
ATOM   549  O OE2 . GLU A 1 71 ? 67.870  23.008 16.923  1.00 108.59 ? 91   GLU A OE2 1 
ATOM   550  N N   . PHE A 1 72 ? 63.830  26.503 17.882  1.00 62.29  ? 92   PHE A N   1 
ATOM   551  C CA  . PHE A 1 72 ? 62.372  26.316 17.992  1.00 68.79  ? 92   PHE A CA  1 
ATOM   552  C C   . PHE A 1 72 ? 61.712  26.095 16.637  1.00 73.55  ? 92   PHE A C   1 
ATOM   553  O O   . PHE A 1 72 ? 62.282  26.443 15.596  1.00 74.49  ? 92   PHE A O   1 
ATOM   554  C CB  . PHE A 1 72 ? 61.703  27.517 18.675  1.00 67.86  ? 92   PHE A CB  1 
ATOM   555  C CG  . PHE A 1 72 ? 61.890  28.792 17.939  1.00 63.51  ? 92   PHE A CG  1 
ATOM   556  C CD1 . PHE A 1 72 ? 61.088  29.100 16.845  1.00 67.13  ? 92   PHE A CD1 1 
ATOM   557  C CD2 . PHE A 1 72 ? 62.932  29.644 18.280  1.00 65.84  ? 92   PHE A CD2 1 
ATOM   558  C CE1 . PHE A 1 72 ? 61.321  30.231 16.097  1.00 76.65  ? 92   PHE A CE1 1 
ATOM   559  C CE2 . PHE A 1 72 ? 63.180  30.779 17.541  1.00 76.70  ? 92   PHE A CE2 1 
ATOM   560  C CZ  . PHE A 1 72 ? 62.375  31.077 16.443  1.00 84.46  ? 92   PHE A CZ  1 
ATOM   561  N N   . VAL A 1 73 ? 60.496  25.544 16.662  1.00 66.15  ? 93   VAL A N   1 
ATOM   562  C CA  . VAL A 1 73 ? 59.766  25.250 15.436  1.00 54.19  ? 93   VAL A CA  1 
ATOM   563  C C   . VAL A 1 73 ? 58.632  26.217 15.186  1.00 53.55  ? 93   VAL A C   1 
ATOM   564  O O   . VAL A 1 73 ? 57.868  26.551 16.087  1.00 55.49  ? 93   VAL A O   1 
ATOM   565  C CB  . VAL A 1 73 ? 59.197  23.837 15.478  1.00 47.89  ? 93   VAL A CB  1 
ATOM   566  C CG1 . VAL A 1 73 ? 60.321  22.840 15.801  1.00 43.29  ? 93   VAL A CG1 1 
ATOM   567  C CG2 . VAL A 1 73 ? 58.095  23.763 16.519  1.00 56.07  ? 93   VAL A CG2 1 
ATOM   568  N N   . VAL A 1 74 ? 58.509  26.661 13.947  1.00 52.81  ? 94   VAL A N   1 
ATOM   569  C CA  . VAL A 1 74 ? 57.465  27.604 13.614  1.00 51.54  ? 94   VAL A CA  1 
ATOM   570  C C   . VAL A 1 74 ? 56.419  26.963 12.756  1.00 60.71  ? 94   VAL A C   1 
ATOM   571  O O   . VAL A 1 74 ? 56.720  26.423 11.693  1.00 62.20  ? 94   VAL A O   1 
ATOM   572  C CB  . VAL A 1 74 ? 58.010  28.767 12.826  1.00 47.64  ? 94   VAL A CB  1 
ATOM   573  C CG1 . VAL A 1 74 ? 56.920  29.820 12.675  1.00 49.14  ? 94   VAL A CG1 1 
ATOM   574  C CG2 . VAL A 1 74 ? 59.259  29.309 13.509  1.00 54.94  ? 94   VAL A CG2 1 
ATOM   575  N N   . VAL A 1 75 ? 55.179  27.035 13.209  1.00 73.09  ? 95   VAL A N   1 
ATOM   576  C CA  . VAL A 1 75 ? 54.085  26.465 12.448  1.00 80.88  ? 95   VAL A CA  1 
ATOM   577  C C   . VAL A 1 75 ? 53.487  27.592 11.602  1.00 85.53  ? 95   VAL A C   1 
ATOM   578  O O   . VAL A 1 75 ? 52.635  28.343 12.074  1.00 83.02  ? 95   VAL A O   1 
ATOM   579  C CB  . VAL A 1 75 ? 52.996  25.852 13.388  1.00 76.67  ? 95   VAL A CB  1 
ATOM   580  C CG1 . VAL A 1 75 ? 51.902  25.205 12.558  1.00 78.94  ? 95   VAL A CG1 1 
ATOM   581  C CG2 . VAL A 1 75 ? 53.620  24.806 14.328  1.00 50.10  ? 95   VAL A CG2 1 
ATOM   582  N N   . THR A 1 76 ? 53.968  27.732 10.367  1.00 96.04  ? 96   THR A N   1 
ATOM   583  C CA  . THR A 1 76 ? 53.458  28.767 9.467   1.00 102.88 ? 96   THR A CA  1 
ATOM   584  C C   . THR A 1 76 ? 52.040  28.338 9.143   1.00 108.12 ? 96   THR A C   1 
ATOM   585  O O   . THR A 1 76 ? 51.812  27.450 8.315   1.00 103.24 ? 96   THR A O   1 
ATOM   586  C CB  . THR A 1 76 ? 54.277  28.862 8.152   1.00 102.30 ? 96   THR A CB  1 
ATOM   587  O OG1 . THR A 1 76 ? 55.670  29.036 8.459   1.00 99.09  ? 96   THR A OG1 1 
ATOM   588  C CG2 . THR A 1 76 ? 53.784  30.045 7.298   1.00 96.72  ? 96   THR A CG2 1 
ATOM   589  N N   . ALA A 1 77 ? 51.085  28.965 9.815   1.00 116.21 ? 97   ALA A N   1 
ATOM   590  C CA  . ALA A 1 77 ? 49.686  28.619 9.629   1.00 125.28 ? 97   ALA A CA  1 
ATOM   591  C C   . ALA A 1 77 ? 49.013  29.253 8.417   1.00 132.36 ? 97   ALA A C   1 
ATOM   592  O O   . ALA A 1 77 ? 48.400  30.311 8.525   1.00 134.66 ? 97   ALA A O   1 
ATOM   593  C CB  . ALA A 1 77 ? 48.904  28.953 10.892  1.00 120.66 ? 97   ALA A CB  1 
ATOM   594  N N   . LYS A 1 78 ? 49.120  28.595 7.266   1.00 138.31 ? 98   LYS A N   1 
ATOM   595  C CA  . LYS A 1 78 ? 48.482  29.093 6.053   1.00 140.52 ? 98   LYS A CA  1 
ATOM   596  C C   . LYS A 1 78 ? 46.973  29.154 6.290   1.00 147.85 ? 98   LYS A C   1 
ATOM   597  O O   . LYS A 1 78 ? 46.368  30.224 6.069   1.00 150.86 ? 98   LYS A O   1 
ATOM   598  C CB  . LYS A 1 78 ? 48.761  28.163 4.871   1.00 128.01 ? 98   LYS A CB  1 
ATOM   599  C CG  . LYS A 1 78 ? 50.209  28.107 4.420   1.00 115.01 ? 98   LYS A CG  1 
ATOM   600  C CD  . LYS A 1 78 ? 51.025  27.093 5.203   1.00 101.10 ? 98   LYS A CD  1 
ATOM   601  C CE  . LYS A 1 78 ? 52.148  26.564 4.325   1.00 95.96  ? 98   LYS A CE  1 
ATOM   602  N NZ  . LYS A 1 78 ? 51.628  25.975 3.057   1.00 86.59  ? 98   LYS A NZ  1 
ATOM   603  O OXT . LYS A 1 78 ? 46.412  28.116 6.697   1.00 153.82 ? 98   LYS A OXT 1 
ATOM   604  N N   . VAL B 2 1  ? 34.022  18.246 0.881   1.00 129.47 ? 9    VAL B N   1 
ATOM   605  C CA  . VAL B 2 1  ? 34.703  16.986 1.310   1.00 126.40 ? 9    VAL B CA  1 
ATOM   606  C C   . VAL B 2 1  ? 35.387  17.183 2.671   1.00 129.11 ? 9    VAL B C   1 
ATOM   607  O O   . VAL B 2 1  ? 36.177  18.112 2.848   1.00 131.79 ? 9    VAL B O   1 
ATOM   608  C CB  . VAL B 2 1  ? 35.739  16.528 0.232   1.00 118.85 ? 9    VAL B CB  1 
ATOM   609  C CG1 . VAL B 2 1  ? 37.157  16.562 0.784   1.00 108.49 ? 9    VAL B CG1 1 
ATOM   610  C CG2 . VAL B 2 1  ? 35.392  15.132 -0.252  1.00 114.88 ? 9    VAL B CG2 1 
ATOM   611  N N   . PRO B 2 2  ? 35.080  16.312 3.652   1.00 127.89 ? 10   PRO B N   1 
ATOM   612  C CA  . PRO B 2 2  ? 35.654  16.381 5.001   1.00 125.49 ? 10   PRO B CA  1 
ATOM   613  C C   . PRO B 2 2  ? 37.143  16.030 5.070   1.00 126.88 ? 10   PRO B C   1 
ATOM   614  O O   . PRO B 2 2  ? 37.536  14.891 4.803   1.00 124.01 ? 10   PRO B O   1 
ATOM   615  C CB  . PRO B 2 2  ? 34.790  15.402 5.791   1.00 122.76 ? 10   PRO B CB  1 
ATOM   616  C CG  . PRO B 2 2  ? 34.490  14.356 4.780   1.00 129.04 ? 10   PRO B CG  1 
ATOM   617  C CD  . PRO B 2 2  ? 34.138  15.182 3.552   1.00 128.79 ? 10   PRO B CD  1 
ATOM   618  N N   . PRO B 2 3  ? 37.983  17.014 5.451   1.00 128.88 ? 11   PRO B N   1 
ATOM   619  C CA  . PRO B 2 3  ? 39.443  16.933 5.592   1.00 126.33 ? 11   PRO B CA  1 
ATOM   620  C C   . PRO B 2 3  ? 39.989  15.615 6.141   1.00 121.22 ? 11   PRO B C   1 
ATOM   621  O O   . PRO B 2 3  ? 40.286  15.511 7.332   1.00 122.79 ? 11   PRO B O   1 
ATOM   622  C CB  . PRO B 2 3  ? 39.756  18.113 6.509   1.00 129.60 ? 11   PRO B CB  1 
ATOM   623  C CG  . PRO B 2 3  ? 38.794  19.139 6.028   1.00 128.08 ? 11   PRO B CG  1 
ATOM   624  C CD  . PRO B 2 3  ? 37.504  18.340 5.889   1.00 130.67 ? 11   PRO B CD  1 
ATOM   625  N N   . ALA B 2 4  ? 40.135  14.625 5.262   1.00 117.09 ? 12   ALA B N   1 
ATOM   626  C CA  . ALA B 2 4  ? 40.649  13.309 5.638   1.00 112.46 ? 12   ALA B CA  1 
ATOM   627  C C   . ALA B 2 4  ? 41.688  13.409 6.741   1.00 111.11 ? 12   ALA B C   1 
ATOM   628  O O   . ALA B 2 4  ? 42.488  14.346 6.793   1.00 114.08 ? 12   ALA B O   1 
ATOM   629  C CB  . ALA B 2 4  ? 41.244  12.608 4.431   1.00 108.27 ? 12   ALA B CB  1 
ATOM   630  N N   . LEU B 2 5  ? 41.663  12.425 7.626   1.00 109.13 ? 13   LEU B N   1 
ATOM   631  C CA  . LEU B 2 5  ? 42.574  12.383 8.755   1.00 103.53 ? 13   LEU B CA  1 
ATOM   632  C C   . LEU B 2 5  ? 43.984  12.011 8.361   1.00 97.70  ? 13   LEU B C   1 
ATOM   633  O O   . LEU B 2 5  ? 44.197  11.037 7.639   1.00 101.16 ? 13   LEU B O   1 
ATOM   634  C CB  . LEU B 2 5  ? 42.076  11.379 9.793   1.00 103.95 ? 13   LEU B CB  1 
ATOM   635  C CG  . LEU B 2 5  ? 40.724  11.675 10.451  1.00 103.03 ? 13   LEU B CG  1 
ATOM   636  C CD1 . LEU B 2 5  ? 40.535  10.682 11.599  1.00 97.63  ? 13   LEU B CD1 1 
ATOM   637  C CD2 . LEU B 2 5  ? 40.661  13.136 10.961  1.00 92.28  ? 13   LEU B CD2 1 
ATOM   638  N N   . HIS B 2 6  ? 44.951  12.776 8.849   1.00 86.63  ? 14   HIS B N   1 
ATOM   639  C CA  . HIS B 2 6  ? 46.328  12.472 8.531   1.00 81.76  ? 14   HIS B CA  1 
ATOM   640  C C   . HIS B 2 6  ? 47.124  12.142 9.766   1.00 79.20  ? 14   HIS B C   1 
ATOM   641  O O   . HIS B 2 6  ? 47.068  12.843 10.782  1.00 72.59  ? 14   HIS B O   1 
ATOM   642  C CB  . HIS B 2 6  ? 46.960  13.630 7.771   1.00 86.81  ? 14   HIS B CB  1 
ATOM   643  C CG  . HIS B 2 6  ? 46.311  13.882 6.453   1.00 88.55  ? 14   HIS B CG  1 
ATOM   644  N ND1 . HIS B 2 6  ? 46.465  13.034 5.376   1.00 77.01  ? 14   HIS B ND1 1 
ATOM   645  C CD2 . HIS B 2 6  ? 45.427  14.828 6.067   1.00 96.63  ? 14   HIS B CD2 1 
ATOM   646  C CE1 . HIS B 2 6  ? 45.697  13.448 4.385   1.00 85.35  ? 14   HIS B CE1 1 
ATOM   647  N NE2 . HIS B 2 6  ? 45.056  14.534 4.777   1.00 94.31  ? 14   HIS B NE2 1 
ATOM   648  N N   . LEU B 2 7  ? 47.857  11.043 9.662   1.00 83.52  ? 15   LEU B N   1 
ATOM   649  C CA  . LEU B 2 7  ? 48.688  10.567 10.744  1.00 87.53  ? 15   LEU B CA  1 
ATOM   650  C C   . LEU B 2 7  ? 50.121  11.069 10.616  1.00 91.22  ? 15   LEU B C   1 
ATOM   651  O O   . LEU B 2 7  ? 50.848  10.730 9.682   1.00 95.20  ? 15   LEU B O   1 
ATOM   652  C CB  . LEU B 2 7  ? 48.670  9.038  10.782  1.00 86.56  ? 15   LEU B CB  1 
ATOM   653  C CG  . LEU B 2 7  ? 49.516  8.387  11.879  1.00 89.46  ? 15   LEU B CG  1 
ATOM   654  C CD1 . LEU B 2 7  ? 51.005  8.483  11.534  1.00 94.98  ? 15   LEU B CD1 1 
ATOM   655  C CD2 . LEU B 2 7  ? 49.215  9.055  13.214  1.00 88.09  ? 15   LEU B CD2 1 
ATOM   656  N N   . VAL B 2 8  ? 50.525  11.884 11.572  1.00 90.14  ? 16   VAL B N   1 
ATOM   657  C CA  . VAL B 2 8  ? 51.866  12.398 11.570  1.00 87.62  ? 16   VAL B CA  1 
ATOM   658  C C   . VAL B 2 8  ? 52.749  11.408 12.325  1.00 91.37  ? 16   VAL B C   1 
ATOM   659  O O   . VAL B 2 8  ? 52.619  11.223 13.547  1.00 87.41  ? 16   VAL B O   1 
ATOM   660  C CB  . VAL B 2 8  ? 51.897  13.753 12.230  1.00 86.10  ? 16   VAL B CB  1 
ATOM   661  C CG1 . VAL B 2 8  ? 53.309  14.271 12.232  1.00 92.74  ? 16   VAL B CG1 1 
ATOM   662  C CG2 . VAL B 2 8  ? 50.949  14.701 11.492  1.00 70.62  ? 16   VAL B CG2 1 
ATOM   663  N N   . ASP B 2 9  ? 53.630  10.768 11.563  1.00 95.81  ? 17   ASP B N   1 
ATOM   664  C CA  . ASP B 2 9  ? 54.567  9.760  12.050  1.00 104.89 ? 17   ASP B CA  1 
ATOM   665  C C   . ASP B 2 9  ? 55.061  9.983  13.468  1.00 107.46 ? 17   ASP B C   1 
ATOM   666  O O   . ASP B 2 9  ? 55.135  11.116 13.933  1.00 108.41 ? 17   ASP B O   1 
ATOM   667  C CB  . ASP B 2 9  ? 55.769  9.696  11.120  1.00 111.87 ? 17   ASP B CB  1 
ATOM   668  C CG  . ASP B 2 9  ? 55.407  10.009 9.693   1.00 126.91 ? 17   ASP B CG  1 
ATOM   669  O OD1 . ASP B 2 9  ? 54.805  11.081 9.458   1.00 132.65 ? 17   ASP B OD1 1 
ATOM   670  O OD2 . ASP B 2 9  ? 55.728  9.189  8.810   1.00 132.82 ? 17   ASP B OD2 1 
ATOM   671  N N   . PRO B 2 10 ? 55.433  8.893  14.164  1.00 111.23 ? 18   PRO B N   1 
ATOM   672  C CA  . PRO B 2 10 ? 55.934  8.921  15.545  1.00 111.86 ? 18   PRO B CA  1 
ATOM   673  C C   . PRO B 2 10 ? 57.185  9.777  15.630  1.00 112.68 ? 18   PRO B C   1 
ATOM   674  O O   . PRO B 2 10 ? 57.570  10.252 16.704  1.00 107.79 ? 18   PRO B O   1 
ATOM   675  C CB  . PRO B 2 10 ? 56.218  7.452  15.835  1.00 111.19 ? 18   PRO B CB  1 
ATOM   676  C CG  . PRO B 2 10 ? 56.651  6.940  14.494  1.00 110.02 ? 18   PRO B CG  1 
ATOM   677  C CD  . PRO B 2 10 ? 55.619  7.553  13.577  1.00 109.28 ? 18   PRO B CD  1 
ATOM   678  N N   . GLN B 2 11 ? 57.812  9.946  14.469  1.00 115.08 ? 19   GLN B N   1 
ATOM   679  C CA  . GLN B 2 11 ? 59.015  10.749 14.311  1.00 113.69 ? 19   GLN B CA  1 
ATOM   680  C C   . GLN B 2 11 ? 58.761  12.104 14.981  1.00 110.11 ? 19   GLN B C   1 
ATOM   681  O O   . GLN B 2 11 ? 59.600  12.633 15.720  1.00 103.84 ? 19   GLN B O   1 
ATOM   682  C CB  . GLN B 2 11 ? 59.274  10.939 12.812  1.00 117.38 ? 19   GLN B CB  1 
ATOM   683  C CG  . GLN B 2 11 ? 58.099  11.607 12.085  1.00 126.34 ? 19   GLN B CG  1 
ATOM   684  C CD  . GLN B 2 11 ? 58.138  11.453 10.575  1.00 135.18 ? 19   GLN B CD  1 
ATOM   685  O OE1 . GLN B 2 11 ? 57.342  12.065 9.858   1.00 133.72 ? 19   GLN B OE1 1 
ATOM   686  N NE2 . GLN B 2 11 ? 59.052  10.625 10.086  1.00 142.14 ? 19   GLN B NE2 1 
ATOM   687  N N   . ILE B 2 12 ? 57.571  12.635 14.714  1.00 107.48 ? 20   ILE B N   1 
ATOM   688  C CA  . ILE B 2 12 ? 57.129  13.922 15.228  1.00 97.27  ? 20   ILE B CA  1 
ATOM   689  C C   . ILE B 2 12 ? 55.872  13.747 16.067  1.00 89.60  ? 20   ILE B C   1 
ATOM   690  O O   . ILE B 2 12 ? 54.834  13.285 15.573  1.00 85.95  ? 20   ILE B O   1 
ATOM   691  C CB  . ILE B 2 12 ? 56.754  14.877 14.085  1.00 101.01 ? 20   ILE B CB  1 
ATOM   692  C CG1 . ILE B 2 12 ? 57.787  14.793 12.956  1.00 98.80  ? 20   ILE B CG1 1 
ATOM   693  C CG2 . ILE B 2 12 ? 56.638  16.285 14.628  1.00 101.90 ? 20   ILE B CG2 1 
ATOM   694  C CD1 . ILE B 2 12 ? 57.282  15.296 11.599  1.00 89.33  ? 20   ILE B CD1 1 
ATOM   695  N N   . GLN B 2 13 ? 55.950  14.124 17.333  1.00 81.05  ? 21   GLN B N   1 
ATOM   696  C CA  . GLN B 2 13 ? 54.783  14.002 18.181  1.00 80.84  ? 21   GLN B CA  1 
ATOM   697  C C   . GLN B 2 13 ? 54.769  15.146 19.163  1.00 75.56  ? 21   GLN B C   1 
ATOM   698  O O   . GLN B 2 13 ? 55.788  15.800 19.365  1.00 80.18  ? 21   GLN B O   1 
ATOM   699  C CB  . GLN B 2 13 ? 54.794  12.666 18.921  1.00 95.25  ? 21   GLN B CB  1 
ATOM   700  C CG  . GLN B 2 13 ? 55.026  11.470 18.012  1.00 113.20 ? 21   GLN B CG  1 
ATOM   701  C CD  . GLN B 2 13 ? 54.538  10.179 18.622  1.00 124.29 ? 21   GLN B CD  1 
ATOM   702  O OE1 . GLN B 2 13 ? 54.525  10.027 19.841  1.00 135.65 ? 21   GLN B OE1 1 
ATOM   703  N NE2 . GLN B 2 13 ? 54.143  9.235  17.777  1.00 119.39 ? 21   GLN B NE2 1 
ATOM   704  N N   . LEU B 2 14 ? 53.612  15.393 19.761  1.00 73.10  ? 22   LEU B N   1 
ATOM   705  C CA  . LEU B 2 14 ? 53.470  16.470 20.726  1.00 75.05  ? 22   LEU B CA  1 
ATOM   706  C C   . LEU B 2 14 ? 53.904  16.016 22.109  1.00 81.16  ? 22   LEU B C   1 
ATOM   707  O O   . LEU B 2 14 ? 54.001  14.817 22.369  1.00 79.15  ? 22   LEU B O   1 
ATOM   708  C CB  . LEU B 2 14 ? 52.021  16.930 20.791  1.00 61.03  ? 22   LEU B CB  1 
ATOM   709  C CG  . LEU B 2 14 ? 51.889  18.431 20.617  1.00 56.05  ? 22   LEU B CG  1 
ATOM   710  C CD1 . LEU B 2 14 ? 52.375  18.815 19.232  1.00 51.72  ? 22   LEU B CD1 1 
ATOM   711  C CD2 . LEU B 2 14 ? 50.454  18.829 20.796  1.00 56.22  ? 22   LEU B CD2 1 
ATOM   712  N N   . THR B 2 15 ? 54.184  16.977 22.984  1.00 86.24  ? 23   THR B N   1 
ATOM   713  C CA  . THR B 2 15 ? 54.581  16.674 24.352  1.00 90.78  ? 23   THR B CA  1 
ATOM   714  C C   . THR B 2 15 ? 53.893  17.688 25.252  1.00 98.26  ? 23   THR B C   1 
ATOM   715  O O   . THR B 2 15 ? 54.179  18.886 25.223  1.00 95.98  ? 23   THR B O   1 
ATOM   716  C CB  . THR B 2 15 ? 56.131  16.731 24.564  1.00 84.76  ? 23   THR B CB  1 
ATOM   717  O OG1 . THR B 2 15 ? 56.774  15.824 23.662  1.00 79.15  ? 23   THR B OG1 1 
ATOM   718  C CG2 . THR B 2 15 ? 56.505  16.300 25.986  1.00 78.89  ? 23   THR B CG2 1 
ATOM   719  N N   . ILE B 2 16 ? 52.942  17.188 26.021  1.00 108.22 ? 24   ILE B N   1 
ATOM   720  C CA  . ILE B 2 16 ? 52.197  18.005 26.948  1.00 118.09 ? 24   ILE B CA  1 
ATOM   721  C C   . ILE B 2 16 ? 52.791  17.650 28.288  1.00 127.48 ? 24   ILE B C   1 
ATOM   722  O O   . ILE B 2 16 ? 53.062  16.480 28.561  1.00 126.77 ? 24   ILE B O   1 
ATOM   723  C CB  . ILE B 2 16 ? 50.728  17.656 26.908  1.00 116.89 ? 24   ILE B CB  1 
ATOM   724  C CG1 . ILE B 2 16 ? 50.485  16.528 25.894  1.00 111.47 ? 24   ILE B CG1 1 
ATOM   725  C CG2 . ILE B 2 16 ? 49.943  18.899 26.559  1.00 121.54 ? 24   ILE B CG2 1 
ATOM   726  C CD1 . ILE B 2 16 ? 50.791  16.878 24.437  1.00 105.49 ? 24   ILE B CD1 1 
ATOM   727  N N   . THR B 2 17 ? 52.978  18.643 29.142  1.00 137.94 ? 25   THR B N   1 
ATOM   728  C CA  . THR B 2 17 ? 53.643  18.351 30.387  1.00 145.77 ? 25   THR B CA  1 
ATOM   729  C C   . THR B 2 17 ? 53.069  18.734 31.740  1.00 157.89 ? 25   THR B C   1 
ATOM   730  O O   . THR B 2 17 ? 52.424  19.771 31.913  1.00 159.18 ? 25   THR B O   1 
ATOM   731  C CB  . THR B 2 17 ? 55.065  18.876 30.293  1.00 138.22 ? 25   THR B CB  1 
ATOM   732  O OG1 . THR B 2 17 ? 55.048  20.180 29.694  1.00 132.53 ? 25   THR B OG1 1 
ATOM   733  C CG2 . THR B 2 17 ? 55.902  17.942 29.437  1.00 133.67 ? 25   THR B CG2 1 
ATOM   734  N N   . ARG B 2 18 ? 53.353  17.842 32.685  1.00 167.12 ? 26   ARG B N   1 
ATOM   735  C CA  . ARG B 2 18 ? 52.982  17.907 34.097  1.00 174.12 ? 26   ARG B CA  1 
ATOM   736  C C   . ARG B 2 18 ? 53.522  16.572 34.599  1.00 179.68 ? 26   ARG B C   1 
ATOM   737  O O   . ARG B 2 18 ? 53.244  15.531 34.002  1.00 181.20 ? 26   ARG B O   1 
ATOM   738  C CB  . ARG B 2 18 ? 51.466  17.940 34.292  1.00 174.92 ? 26   ARG B CB  1 
ATOM   739  C CG  . ARG B 2 18 ? 51.013  18.319 35.710  1.00 177.19 ? 26   ARG B CG  1 
ATOM   740  C CD  . ARG B 2 18 ? 51.937  17.787 36.801  1.00 181.13 ? 26   ARG B CD  1 
ATOM   741  N NE  . ARG B 2 18 ? 53.108  18.643 36.971  1.00 189.15 ? 26   ARG B NE  1 
ATOM   742  C CZ  . ARG B 2 18 ? 53.067  19.851 37.525  1.00 197.63 ? 26   ARG B CZ  1 
ATOM   743  N NH1 . ARG B 2 18 ? 51.914  20.336 37.966  1.00 200.00 ? 26   ARG B NH1 1 
ATOM   744  N NH2 . ARG B 2 18 ? 54.172  20.578 37.631  1.00 200.00 ? 26   ARG B NH2 1 
ATOM   745  N N   . ALA B 2 19 ? 54.286  16.604 35.686  1.00 184.58 ? 38   ALA B N   1 
ATOM   746  C CA  . ALA B 2 19 ? 54.901  15.399 36.239  1.00 187.14 ? 38   ALA B CA  1 
ATOM   747  C C   . ALA B 2 19 ? 56.111  15.083 35.357  1.00 187.32 ? 38   ALA B C   1 
ATOM   748  O O   . ALA B 2 19 ? 57.234  15.002 35.861  1.00 190.45 ? 38   ALA B O   1 
ATOM   749  C CB  . ALA B 2 19 ? 53.910  14.231 36.242  1.00 188.09 ? 38   ALA B CB  1 
ATOM   750  N N   . ASP B 2 20 ? 55.866  14.920 34.050  1.00 182.88 ? 39   ASP B N   1 
ATOM   751  C CA  . ASP B 2 20 ? 56.898  14.647 33.033  1.00 173.36 ? 39   ASP B CA  1 
ATOM   752  C C   . ASP B 2 20 ? 56.491  13.893 31.746  1.00 166.56 ? 39   ASP B C   1 
ATOM   753  O O   . ASP B 2 20 ? 57.072  14.127 30.681  1.00 163.14 ? 39   ASP B O   1 
ATOM   754  C CB  . ASP B 2 20 ? 58.128  13.945 33.661  1.00 172.45 ? 39   ASP B CB  1 
ATOM   755  C CG  . ASP B 2 20 ? 57.756  12.804 34.616  1.00 168.82 ? 39   ASP B CG  1 
ATOM   756  O OD1 . ASP B 2 20 ? 58.415  12.677 35.673  1.00 163.39 ? 39   ASP B OD1 1 
ATOM   757  O OD2 . ASP B 2 20 ? 56.825  12.030 34.319  1.00 167.06 ? 39   ASP B OD2 1 
ATOM   758  N N   . PRO B 2 21 ? 55.467  13.016 31.815  1.00 161.06 ? 40   PRO B N   1 
ATOM   759  C CA  . PRO B 2 21 ? 54.998  12.224 30.670  1.00 154.98 ? 40   PRO B CA  1 
ATOM   760  C C   . PRO B 2 21 ? 54.286  12.944 29.538  1.00 148.66 ? 40   PRO B C   1 
ATOM   761  O O   . PRO B 2 21 ? 54.438  14.149 29.327  1.00 149.89 ? 40   PRO B O   1 
ATOM   762  C CB  . PRO B 2 21 ? 54.053  11.198 31.312  1.00 158.59 ? 40   PRO B CB  1 
ATOM   763  C CG  . PRO B 2 21 ? 54.271  11.337 32.805  1.00 162.05 ? 40   PRO B CG  1 
ATOM   764  C CD  . PRO B 2 21 ? 54.584  12.784 32.967  1.00 162.67 ? 40   PRO B CD  1 
ATOM   765  N N   . LYS B 2 22 ? 53.520  12.138 28.805  1.00 140.65 ? 41   LYS B N   1 
ATOM   766  C CA  . LYS B 2 22 ? 52.680  12.569 27.700  1.00 127.51 ? 41   LYS B CA  1 
ATOM   767  C C   . LYS B 2 22 ? 53.295  12.958 26.352  1.00 119.99 ? 41   LYS B C   1 
ATOM   768  O O   . LYS B 2 22 ? 53.722  14.093 26.152  1.00 121.39 ? 41   LYS B O   1 
ATOM   769  C CB  . LYS B 2 22 ? 51.765  13.678 28.217  1.00 120.24 ? 41   LYS B CB  1 
ATOM   770  C CG  . LYS B 2 22 ? 50.835  13.184 29.320  1.00 112.88 ? 41   LYS B CG  1 
ATOM   771  C CD  . LYS B 2 22 ? 50.556  14.260 30.339  1.00 111.30 ? 41   LYS B CD  1 
ATOM   772  C CE  . LYS B 2 22 ? 51.822  14.614 31.097  1.00 117.72 ? 41   LYS B CE  1 
ATOM   773  N NZ  . LYS B 2 22 ? 51.566  15.625 32.151  1.00 118.46 ? 41   LYS B NZ  1 
ATOM   774  N N   . VAL B 2 23 ? 53.327  11.986 25.439  1.00 112.36 ? 42   VAL B N   1 
ATOM   775  C CA  . VAL B 2 23 ? 53.813  12.155 24.062  1.00 102.71 ? 42   VAL B CA  1 
ATOM   776  C C   . VAL B 2 23 ? 52.754  11.505 23.161  1.00 98.38  ? 42   VAL B C   1 
ATOM   777  O O   . VAL B 2 23 ? 52.648  10.280 23.088  1.00 95.09  ? 42   VAL B O   1 
ATOM   778  C CB  . VAL B 2 23 ? 55.174  11.459 23.820  1.00 94.32  ? 42   VAL B CB  1 
ATOM   779  C CG1 . VAL B 2 23 ? 55.559  11.569 22.343  1.00 83.44  ? 42   VAL B CG1 1 
ATOM   780  C CG2 . VAL B 2 23 ? 56.243  12.095 24.700  1.00 90.53  ? 42   VAL B CG2 1 
ATOM   781  N N   . TYR B 2 24 ? 51.977  12.333 22.473  1.00 90.63  ? 43   TYR B N   1 
ATOM   782  C CA  . TYR B 2 24 ? 50.902  11.837 21.626  1.00 83.56  ? 43   TYR B CA  1 
ATOM   783  C C   . TYR B 2 24 ? 51.153  12.037 20.146  1.00 81.64  ? 43   TYR B C   1 
ATOM   784  O O   . TYR B 2 24 ? 51.503  13.127 19.719  1.00 84.59  ? 43   TYR B O   1 
ATOM   785  C CB  . TYR B 2 24 ? 49.592  12.535 22.011  1.00 86.44  ? 43   TYR B CB  1 
ATOM   786  C CG  . TYR B 2 24 ? 49.360  12.576 23.509  1.00 99.49  ? 43   TYR B CG  1 
ATOM   787  C CD1 . TYR B 2 24 ? 50.184  13.335 24.340  1.00 103.04 ? 43   TYR B CD1 1 
ATOM   788  C CD2 . TYR B 2 24 ? 48.346  11.819 24.103  1.00 106.42 ? 43   TYR B CD2 1 
ATOM   789  C CE1 . TYR B 2 24 ? 50.007  13.333 25.721  1.00 116.33 ? 43   TYR B CE1 1 
ATOM   790  C CE2 . TYR B 2 24 ? 48.163  11.810 25.489  1.00 110.21 ? 43   TYR B CE2 1 
ATOM   791  C CZ  . TYR B 2 24 ? 48.996  12.570 26.290  1.00 117.56 ? 43   TYR B CZ  1 
ATOM   792  O OH  . TYR B 2 24 ? 48.808  12.566 27.655  1.00 118.48 ? 43   TYR B OH  1 
ATOM   793  N N   . PRO B 2 25 ? 50.981  10.981 19.338  1.00 83.92  ? 44   PRO B N   1 
ATOM   794  C CA  . PRO B 2 25 ? 51.212  11.168 17.905  1.00 80.18  ? 44   PRO B CA  1 
ATOM   795  C C   . PRO B 2 25 ? 50.271  12.273 17.444  1.00 72.86  ? 44   PRO B C   1 
ATOM   796  O O   . PRO B 2 25 ? 49.389  12.720 18.208  1.00 61.04  ? 44   PRO B O   1 
ATOM   797  C CB  . PRO B 2 25 ? 50.862  9.807  17.319  1.00 90.77  ? 44   PRO B CB  1 
ATOM   798  C CG  . PRO B 2 25 ? 49.814  9.286  18.284  1.00 93.04  ? 44   PRO B CG  1 
ATOM   799  C CD  . PRO B 2 25 ? 50.420  9.647  19.613  1.00 91.64  ? 44   PRO B CD  1 
ATOM   800  N N   . ILE B 2 26 ? 50.424  12.709 16.202  1.00 66.58  ? 45   ILE B N   1 
ATOM   801  C CA  . ILE B 2 26 ? 49.581  13.804 15.761  1.00 70.67  ? 45   ILE B CA  1 
ATOM   802  C C   . ILE B 2 26 ? 48.639  13.551 14.601  1.00 67.79  ? 45   ILE B C   1 
ATOM   803  O O   . ILE B 2 26 ? 49.023  13.010 13.566  1.00 71.31  ? 45   ILE B O   1 
ATOM   804  C CB  . ILE B 2 26 ? 50.444  15.036 15.421  1.00 74.98  ? 45   ILE B CB  1 
ATOM   805  C CG1 . ILE B 2 26 ? 51.331  15.399 16.618  1.00 67.06  ? 45   ILE B CG1 1 
ATOM   806  C CG2 . ILE B 2 26 ? 49.545  16.212 15.048  1.00 69.20  ? 45   ILE B CG2 1 
ATOM   807  C CD1 . ILE B 2 26 ? 52.459  16.371 16.283  1.00 54.33  ? 45   ILE B CD1 1 
ATOM   808  N N   . ILE B 2 27 ? 47.402  13.986 14.785  1.00 64.14  ? 46   ILE B N   1 
ATOM   809  C CA  . ILE B 2 27 ? 46.398  13.833 13.755  1.00 69.82  ? 46   ILE B CA  1 
ATOM   810  C C   . ILE B 2 27 ? 45.974  15.173 13.190  1.00 77.03  ? 46   ILE B C   1 
ATOM   811  O O   . ILE B 2 27 ? 45.732  16.127 13.936  1.00 81.46  ? 46   ILE B O   1 
ATOM   812  C CB  . ILE B 2 27 ? 45.160  13.149 14.286  1.00 63.97  ? 46   ILE B CB  1 
ATOM   813  C CG1 . ILE B 2 27 ? 45.529  11.765 14.818  1.00 47.34  ? 46   ILE B CG1 1 
ATOM   814  C CG2 . ILE B 2 27 ? 44.118  13.094 13.180  1.00 52.87  ? 46   ILE B CG2 1 
ATOM   815  C CD1 . ILE B 2 27 ? 46.377  10.960 13.851  1.00 42.01  ? 46   ILE B CD1 1 
ATOM   816  N N   . LEU B 2 28 ? 45.835  15.228 11.869  1.00 79.62  ? 47   LEU B N   1 
ATOM   817  C CA  . LEU B 2 28 ? 45.480  16.475 11.216  1.00 82.14  ? 47   LEU B CA  1 
ATOM   818  C C   . LEU B 2 28 ? 44.138  16.536 10.499  1.00 82.47  ? 47   LEU B C   1 
ATOM   819  O O   . LEU B 2 28 ? 43.789  15.696 9.650   1.00 65.21  ? 47   LEU B O   1 
ATOM   820  C CB  . LEU B 2 28 ? 46.611  16.869 10.261  1.00 90.27  ? 47   LEU B CB  1 
ATOM   821  C CG  . LEU B 2 28 ? 47.985  16.571 10.884  1.00 96.13  ? 47   LEU B CG  1 
ATOM   822  C CD1 . LEU B 2 28 ? 49.091  16.872 9.902   1.00 88.94  ? 47   LEU B CD1 1 
ATOM   823  C CD2 . LEU B 2 28 ? 48.159  17.382 12.153  1.00 100.53 ? 47   LEU B CD2 1 
ATOM   824  N N   . ARG B 2 29 ? 43.398  17.567 10.879  1.00 93.62  ? 48   ARG B N   1 
ATOM   825  C CA  . ARG B 2 29 ? 42.095  17.867 10.331  1.00 112.08 ? 48   ARG B CA  1 
ATOM   826  C C   . ARG B 2 29 ? 42.383  18.985 9.357   1.00 118.34 ? 48   ARG B C   1 
ATOM   827  O O   . ARG B 2 29 ? 41.634  19.959 9.260   1.00 116.86 ? 48   ARG B O   1 
ATOM   828  C CB  . ARG B 2 29 ? 41.190  18.382 11.435  1.00 124.35 ? 48   ARG B CB  1 
ATOM   829  C CG  . ARG B 2 29 ? 41.154  17.487 12.644  1.00 136.50 ? 48   ARG B CG  1 
ATOM   830  C CD  . ARG B 2 29 ? 39.723  17.221 13.062  1.00 146.82 ? 48   ARG B CD  1 
ATOM   831  N NE  . ARG B 2 29 ? 39.098  16.118 12.323  1.00 150.20 ? 48   ARG B NE  1 
ATOM   832  C CZ  . ARG B 2 29 ? 38.800  16.121 11.023  1.00 144.38 ? 48   ARG B CZ  1 
ATOM   833  N NH1 . ARG B 2 29 ? 39.065  17.178 10.264  1.00 143.16 ? 48   ARG B NH1 1 
ATOM   834  N NH2 . ARG B 2 29 ? 38.214  15.060 10.483  1.00 137.23 ? 48   ARG B NH2 1 
ATOM   835  N N   . LEU B 2 30 ? 43.490  18.833 8.641   1.00 126.65 ? 49   LEU B N   1 
ATOM   836  C CA  . LEU B 2 30 ? 43.935  19.832 7.688   1.00 131.89 ? 49   LEU B CA  1 
ATOM   837  C C   . LEU B 2 30 ? 42.876  20.326 6.717   1.00 135.78 ? 49   LEU B C   1 
ATOM   838  O O   . LEU B 2 30 ? 42.397  19.591 5.862   1.00 139.76 ? 49   LEU B O   1 
ATOM   839  C CB  . LEU B 2 30 ? 45.160  19.318 6.909   1.00 130.63 ? 49   LEU B CB  1 
ATOM   840  C CG  . LEU B 2 30 ? 45.051  18.431 5.661   1.00 125.89 ? 49   LEU B CG  1 
ATOM   841  C CD1 . LEU B 2 30 ? 43.952  17.407 5.881   1.00 122.70 ? 49   LEU B CD1 1 
ATOM   842  C CD2 . LEU B 2 30 ? 44.768  19.286 4.413   1.00 125.32 ? 49   LEU B CD2 1 
ATOM   843  N N   . GLY B 2 31 ? 42.476  21.575 6.891   1.00 136.59 ? 50   GLY B N   1 
ATOM   844  C CA  . GLY B 2 31 ? 41.538  22.167 5.963   1.00 138.17 ? 50   GLY B CA  1 
ATOM   845  C C   . GLY B 2 31 ? 42.569  22.906 5.144   1.00 140.42 ? 50   GLY B C   1 
ATOM   846  O O   . GLY B 2 31 ? 42.922  22.516 4.026   1.00 134.38 ? 50   GLY B O   1 
ATOM   847  N N   . SER B 2 32 ? 43.082  23.968 5.755   1.00 145.61 ? 51   SER B N   1 
ATOM   848  C CA  . SER B 2 32 ? 44.136  24.774 5.170   1.00 146.33 ? 51   SER B CA  1 
ATOM   849  C C   . SER B 2 32 ? 45.372  23.918 5.437   1.00 144.68 ? 51   SER B C   1 
ATOM   850  O O   . SER B 2 32 ? 45.400  23.151 6.405   1.00 147.59 ? 51   SER B O   1 
ATOM   851  C CB  . SER B 2 32 ? 44.261  26.108 5.916   1.00 147.06 ? 51   SER B CB  1 
ATOM   852  O OG  . SER B 2 32 ? 44.688  25.906 7.258   1.00 147.98 ? 51   SER B OG  1 
ATOM   853  N N   . ASN B 2 33 ? 46.385  24.028 4.589   1.00 137.66 ? 52   ASN B N   1 
ATOM   854  C CA  . ASN B 2 33 ? 47.587  23.243 4.798   1.00 128.74 ? 52   ASN B CA  1 
ATOM   855  C C   . ASN B 2 33 ? 48.556  24.007 5.695   1.00 121.87 ? 52   ASN B C   1 
ATOM   856  O O   . ASN B 2 33 ? 48.690  25.228 5.596   1.00 121.28 ? 52   ASN B O   1 
ATOM   857  C CB  . ASN B 2 33 ? 48.252  22.916 3.464   1.00 135.16 ? 52   ASN B CB  1 
ATOM   858  C CG  . ASN B 2 33 ? 49.218  21.757 3.573   1.00 148.16 ? 52   ASN B CG  1 
ATOM   859  O OD1 . ASN B 2 33 ? 50.106  21.752 4.426   1.00 157.05 ? 52   ASN B OD1 1 
ATOM   860  N ND2 . ASN B 2 33 ? 49.049  20.763 2.709   1.00 155.16 ? 52   ASN B ND2 1 
ATOM   861  N N   . LEU B 2 34 ? 49.229  23.275 6.574   1.00 115.40 ? 53   LEU B N   1 
ATOM   862  C CA  . LEU B 2 34 ? 50.177  23.864 7.506   1.00 108.39 ? 53   LEU B CA  1 
ATOM   863  C C   . LEU B 2 34 ? 51.620  23.677 7.111   1.00 111.19 ? 53   LEU B C   1 
ATOM   864  O O   . LEU B 2 34 ? 52.000  22.626 6.590   1.00 115.16 ? 53   LEU B O   1 
ATOM   865  C CB  . LEU B 2 34 ? 50.000  23.248 8.880   1.00 92.97  ? 53   LEU B CB  1 
ATOM   866  C CG  . LEU B 2 34 ? 49.102  23.989 9.854   1.00 83.05  ? 53   LEU B CG  1 
ATOM   867  C CD1 . LEU B 2 34 ? 47.711  24.267 9.252   1.00 75.04  ? 53   LEU B CD1 1 
ATOM   868  C CD2 . LEU B 2 34 ? 49.032  23.137 11.111  1.00 76.74  ? 53   LEU B CD2 1 
ATOM   869  N N   . SER B 2 35 ? 52.428  24.695 7.385   1.00 110.13 ? 54   SER B N   1 
ATOM   870  C CA  . SER B 2 35 ? 53.853  24.624 7.094   1.00 111.25 ? 54   SER B CA  1 
ATOM   871  C C   . SER B 2 35 ? 54.619  24.577 8.406   1.00 106.09 ? 54   SER B C   1 
ATOM   872  O O   . SER B 2 35 ? 54.245  25.234 9.379   1.00 109.95 ? 54   SER B O   1 
ATOM   873  C CB  . SER B 2 35 ? 54.313  25.844 6.296   1.00 116.02 ? 54   SER B CB  1 
ATOM   874  O OG  . SER B 2 35 ? 55.708  25.787 6.039   1.00 123.03 ? 54   SER B OG  1 
ATOM   875  N N   . LEU B 2 36 ? 55.686  23.791 8.439   1.00 96.15  ? 55   LEU B N   1 
ATOM   876  C CA  . LEU B 2 36 ? 56.486  23.705 9.643   1.00 87.73  ? 55   LEU B CA  1 
ATOM   877  C C   . LEU B 2 36 ? 57.954  23.920 9.324   1.00 88.90  ? 55   LEU B C   1 
ATOM   878  O O   . LEU B 2 36 ? 58.463  23.407 8.327   1.00 94.58  ? 55   LEU B O   1 
ATOM   879  C CB  . LEU B 2 36 ? 56.294  22.357 10.321  1.00 72.71  ? 55   LEU B CB  1 
ATOM   880  C CG  . LEU B 2 36 ? 57.126  22.234 11.598  1.00 73.27  ? 55   LEU B CG  1 
ATOM   881  C CD1 . LEU B 2 36 ? 56.829  23.384 12.578  1.00 74.22  ? 55   LEU B CD1 1 
ATOM   882  C CD2 . LEU B 2 36 ? 56.802  20.917 12.231  1.00 79.19  ? 55   LEU B CD2 1 
ATOM   883  N N   . SER B 2 37 ? 58.627  24.683 10.178  1.00 84.00  ? 56   SER B N   1 
ATOM   884  C CA  . SER B 2 37 ? 60.039  24.983 9.987   1.00 75.70  ? 56   SER B CA  1 
ATOM   885  C C   . SER B 2 37 ? 60.822  24.997 11.293  1.00 68.81  ? 56   SER B C   1 
ATOM   886  O O   . SER B 2 37 ? 60.242  25.119 12.374  1.00 69.37  ? 56   SER B O   1 
ATOM   887  C CB  . SER B 2 37 ? 60.187  26.337 9.281   1.00 70.08  ? 56   SER B CB  1 
ATOM   888  O OG  . SER B 2 37 ? 58.939  27.007 9.199   1.00 65.70  ? 56   SER B OG  1 
ATOM   889  N N   . MET B 2 38 ? 62.139  24.846 11.184  1.00 65.34  ? 57   MET B N   1 
ATOM   890  C CA  . MET B 2 38 ? 63.018  24.878 12.349  1.00 73.32  ? 57   MET B CA  1 
ATOM   891  C C   . MET B 2 38 ? 63.736  26.220 12.313  1.00 76.61  ? 57   MET B C   1 
ATOM   892  O O   . MET B 2 38 ? 64.162  26.671 11.250  1.00 73.67  ? 57   MET B O   1 
ATOM   893  C CB  . MET B 2 38 ? 64.056  23.752 12.305  1.00 74.94  ? 57   MET B CB  1 
ATOM   894  C CG  . MET B 2 38 ? 65.098  23.826 13.428  1.00 68.12  ? 57   MET B CG  1 
ATOM   895  S SD  . MET B 2 38 ? 64.402  23.571 15.077  1.00 58.83  ? 57   MET B SD  1 
ATOM   896  C CE  . MET B 2 38 ? 64.025  21.840 14.938  1.00 59.33  ? 57   MET B CE  1 
ATOM   897  N N   . ALA B 2 39 ? 63.863  26.858 13.472  1.00 82.07  ? 58   ALA B N   1 
ATOM   898  C CA  . ALA B 2 39 ? 64.524  28.150 13.542  1.00 79.26  ? 58   ALA B CA  1 
ATOM   899  C C   . ALA B 2 39 ? 65.623  28.167 14.585  1.00 75.67  ? 58   ALA B C   1 
ATOM   900  O O   . ALA B 2 39 ? 65.549  27.494 15.620  1.00 71.59  ? 58   ALA B O   1 
ATOM   901  C CB  . ALA B 2 39 ? 63.510  29.239 13.833  1.00 74.69  ? 58   ALA B CB  1 
ATOM   902  N N   . ARG B 2 40 ? 66.652  28.947 14.292  1.00 76.45  ? 59   ARG B N   1 
ATOM   903  C CA  . ARG B 2 40 ? 67.783  29.073 15.186  1.00 82.08  ? 59   ARG B CA  1 
ATOM   904  C C   . ARG B 2 40 ? 68.452  30.440 15.060  1.00 75.73  ? 59   ARG B C   1 
ATOM   905  O O   . ARG B 2 40 ? 68.662  30.949 13.948  1.00 70.38  ? 59   ARG B O   1 
ATOM   906  C CB  . ARG B 2 40 ? 68.808  27.988 14.873  1.00 99.11  ? 59   ARG B CB  1 
ATOM   907  C CG  . ARG B 2 40 ? 68.207  26.631 14.604  1.00 104.89 ? 59   ARG B CG  1 
ATOM   908  C CD  . ARG B 2 40 ? 68.790  26.062 13.332  1.00 114.63 ? 59   ARG B CD  1 
ATOM   909  N NE  . ARG B 2 40 ? 68.249  24.742 13.028  1.00 122.81 ? 59   ARG B NE  1 
ATOM   910  C CZ  . ARG B 2 40 ? 68.393  23.677 13.810  1.00 124.92 ? 59   ARG B CZ  1 
ATOM   911  N NH1 . ARG B 2 40 ? 69.064  23.778 14.953  1.00 123.30 ? 59   ARG B NH1 1 
ATOM   912  N NH2 . ARG B 2 40 ? 67.871  22.511 13.449  1.00 121.41 ? 59   ARG B NH2 1 
ATOM   913  N N   . ARG B 2 41 ? 68.785  31.014 16.214  1.00 72.15  ? 60   ARG B N   1 
ATOM   914  C CA  . ARG B 2 41 ? 69.461  32.306 16.309  1.00 71.89  ? 60   ARG B CA  1 
ATOM   915  C C   . ARG B 2 41 ? 70.713  32.394 15.447  1.00 77.58  ? 60   ARG B C   1 
ATOM   916  O O   . ARG B 2 41 ? 71.475  31.426 15.340  1.00 78.66  ? 60   ARG B O   1 
ATOM   917  C CB  . ARG B 2 41 ? 69.882  32.549 17.748  1.00 69.83  ? 60   ARG B CB  1 
ATOM   918  C CG  . ARG B 2 41 ? 68.764  32.903 18.653  1.00 70.79  ? 60   ARG B CG  1 
ATOM   919  C CD  . ARG B 2 41 ? 68.693  34.393 18.792  1.00 77.97  ? 60   ARG B CD  1 
ATOM   920  N NE  . ARG B 2 41 ? 67.491  34.801 19.506  1.00 94.96  ? 60   ARG B NE  1 
ATOM   921  C CZ  . ARG B 2 41 ? 67.127  34.355 20.705  1.00 92.30  ? 60   ARG B CZ  1 
ATOM   922  N NH1 . ARG B 2 41 ? 67.872  33.465 21.356  1.00 85.53  ? 60   ARG B NH1 1 
ATOM   923  N NH2 . ARG B 2 41 ? 66.009  34.813 21.255  1.00 88.34  ? 60   ARG B NH2 1 
ATOM   924  N N   . ASN B 2 42 ? 70.931  33.563 14.850  1.00 82.89  ? 61   ASN B N   1 
ATOM   925  C CA  . ASN B 2 42 ? 72.117  33.804 14.029  1.00 90.61  ? 61   ASN B CA  1 
ATOM   926  C C   . ASN B 2 42 ? 73.159  34.437 14.958  1.00 90.51  ? 61   ASN B C   1 
ATOM   927  O O   . ASN B 2 42 ? 73.268  35.662 15.043  1.00 93.03  ? 61   ASN B O   1 
ATOM   928  C CB  . ASN B 2 42 ? 71.765  34.740 12.863  1.00 95.44  ? 61   ASN B CB  1 
ATOM   929  C CG  . ASN B 2 42 ? 72.979  35.134 12.026  1.00 104.58 ? 61   ASN B CG  1 
ATOM   930  O OD1 . ASN B 2 42 ? 73.898  34.336 11.817  1.00 111.91 ? 61   ASN B OD1 1 
ATOM   931  N ND2 . ASN B 2 42 ? 72.972  36.371 11.523  1.00 97.95  ? 61   ASN B ND2 1 
ATOM   932  N N   . LEU B 2 43 ? 73.914  33.587 15.655  1.00 88.98  ? 62   LEU B N   1 
ATOM   933  C CA  . LEU B 2 43 ? 74.923  34.038 16.615  1.00 85.18  ? 62   LEU B CA  1 
ATOM   934  C C   . LEU B 2 43 ? 76.348  34.097 16.095  1.00 87.50  ? 62   LEU B C   1 
ATOM   935  O O   . LEU B 2 43 ? 77.291  34.085 16.897  1.00 84.18  ? 62   LEU B O   1 
ATOM   936  C CB  . LEU B 2 43 ? 74.933  33.131 17.843  1.00 71.38  ? 62   LEU B CB  1 
ATOM   937  C CG  . LEU B 2 43 ? 73.682  32.982 18.688  1.00 56.43  ? 62   LEU B CG  1 
ATOM   938  C CD1 . LEU B 2 43 ? 73.981  32.001 19.793  1.00 69.31  ? 62   LEU B CD1 1 
ATOM   939  C CD2 . LEU B 2 43 ? 73.269  34.311 19.265  1.00 63.68  ? 62   LEU B CD2 1 
ATOM   940  N N   . ASP B 2 44 ? 76.520  34.156 14.778  1.00 85.85  ? 63   ASP B N   1 
ATOM   941  C CA  . ASP B 2 44 ? 77.867  34.201 14.223  1.00 82.22  ? 63   ASP B CA  1 
ATOM   942  C C   . ASP B 2 44 ? 78.032  35.252 13.145  1.00 73.77  ? 63   ASP B C   1 
ATOM   943  O O   . ASP B 2 44 ? 79.092  35.341 12.531  1.00 67.21  ? 63   ASP B O   1 
ATOM   944  C CB  . ASP B 2 44 ? 78.255  32.826 13.681  1.00 92.88  ? 63   ASP B CB  1 
ATOM   945  C CG  . ASP B 2 44 ? 77.262  32.305 12.667  1.00 111.56 ? 63   ASP B CG  1 
ATOM   946  O OD1 . ASP B 2 44 ? 77.207  32.865 11.551  1.00 116.74 ? 63   ASP B OD1 1 
ATOM   947  O OD2 . ASP B 2 44 ? 76.530  31.342 12.992  1.00 118.87 ? 63   ASP B OD2 1 
ATOM   948  N N   . SER B 2 45 ? 76.984  36.040 12.920  1.00 76.16  ? 64   SER B N   1 
ATOM   949  C CA  . SER B 2 45 ? 77.014  37.120 11.924  1.00 81.41  ? 64   SER B CA  1 
ATOM   950  C C   . SER B 2 45 ? 75.989  38.197 12.300  1.00 82.29  ? 64   SER B C   1 
ATOM   951  O O   . SER B 2 45 ? 75.239  38.033 13.268  1.00 85.09  ? 64   SER B O   1 
ATOM   952  C CB  . SER B 2 45 ? 76.727  36.575 10.506  1.00 78.20  ? 64   SER B CB  1 
ATOM   953  O OG  . SER B 2 45 ? 75.355  36.660 10.130  1.00 59.85  ? 64   SER B OG  1 
ATOM   954  N N   . LEU B 2 46 ? 75.957  39.300 11.554  1.00 80.74  ? 65   LEU B N   1 
ATOM   955  C CA  . LEU B 2 46 ? 74.999  40.365 11.846  1.00 86.56  ? 65   LEU B CA  1 
ATOM   956  C C   . LEU B 2 46 ? 74.381  41.013 10.607  1.00 85.51  ? 65   LEU B C   1 
ATOM   957  O O   . LEU B 2 46 ? 73.783  42.088 10.681  1.00 78.85  ? 65   LEU B O   1 
ATOM   958  C CB  . LEU B 2 46 ? 75.632  41.429 12.765  1.00 91.42  ? 65   LEU B CB  1 
ATOM   959  C CG  . LEU B 2 46 ? 76.903  42.238 12.463  1.00 77.06  ? 65   LEU B CG  1 
ATOM   960  C CD1 . LEU B 2 46 ? 77.335  42.993 13.743  1.00 48.13  ? 65   LEU B CD1 1 
ATOM   961  C CD2 . LEU B 2 46 ? 78.020  41.311 11.997  1.00 65.57  ? 65   LEU B CD2 1 
ATOM   962  N N   . GLU B 2 47 ? 74.526  40.336 9.473   1.00 93.19  ? 66   GLU B N   1 
ATOM   963  C CA  . GLU B 2 47 ? 73.967  40.784 8.194   1.00 102.56 ? 66   GLU B CA  1 
ATOM   964  C C   . GLU B 2 47 ? 73.124  39.621 7.671   1.00 98.63  ? 66   GLU B C   1 
ATOM   965  O O   . GLU B 2 47 ? 72.367  39.744 6.698   1.00 98.67  ? 66   GLU B O   1 
ATOM   966  C CB  . GLU B 2 47 ? 75.084  41.118 7.198   1.00 107.77 ? 66   GLU B CB  1 
ATOM   967  C CG  . GLU B 2 47 ? 76.178  40.068 7.125   1.00 116.68 ? 66   GLU B CG  1 
ATOM   968  C CD  . GLU B 2 47 ? 77.114  40.116 8.323   1.00 123.03 ? 66   GLU B CD  1 
ATOM   969  O OE1 . GLU B 2 47 ? 77.941  41.050 8.396   1.00 123.57 ? 66   GLU B OE1 1 
ATOM   970  O OE2 . GLU B 2 47 ? 77.017  39.226 9.194   1.00 126.13 ? 66   GLU B OE2 1 
ATOM   971  N N   . ALA B 2 48 ? 73.280  38.486 8.344   1.00 89.89  ? 67   ALA B N   1 
ATOM   972  C CA  . ALA B 2 48 ? 72.551  37.286 8.011   1.00 80.24  ? 67   ALA B CA  1 
ATOM   973  C C   . ALA B 2 48 ? 71.248  37.378 8.791   1.00 86.36  ? 67   ALA B C   1 
ATOM   974  O O   . ALA B 2 48 ? 71.153  38.167 9.737   1.00 83.88  ? 67   ALA B O   1 
ATOM   975  C CB  . ALA B 2 48 ? 73.346  36.072 8.440   1.00 50.80  ? 67   ALA B CB  1 
ATOM   976  N N   . ARG B 2 49 ? 70.255  36.584 8.378   1.00 91.12  ? 68   ARG B N   1 
ATOM   977  C CA  . ARG B 2 49 ? 68.931  36.533 9.014   1.00 81.67  ? 68   ARG B CA  1 
ATOM   978  C C   . ARG B 2 49 ? 69.049  36.464 10.516  1.00 79.34  ? 68   ARG B C   1 
ATOM   979  O O   . ARG B 2 49 ? 69.925  35.777 11.039  1.00 78.74  ? 68   ARG B O   1 
ATOM   980  C CB  . ARG B 2 49 ? 68.144  35.290 8.579   1.00 85.03  ? 68   ARG B CB  1 
ATOM   981  C CG  . ARG B 2 49 ? 67.521  35.342 7.206   1.00 93.34  ? 68   ARG B CG  1 
ATOM   982  C CD  . ARG B 2 49 ? 66.516  34.211 7.016   1.00 96.71  ? 68   ARG B CD  1 
ATOM   983  N NE  . ARG B 2 49 ? 65.422  34.278 7.985   1.00 98.54  ? 68   ARG B NE  1 
ATOM   984  C CZ  . ARG B 2 49 ? 64.212  33.759 7.784   1.00 91.93  ? 68   ARG B CZ  1 
ATOM   985  N NH1 . ARG B 2 49 ? 63.939  33.137 6.643   1.00 90.02  ? 68   ARG B NH1 1 
ATOM   986  N NH2 . ARG B 2 49 ? 63.274  33.857 8.721   1.00 82.58  ? 68   ARG B NH2 1 
ATOM   987  N N   . ALA B 2 50 ? 68.155  37.159 11.210  1.00 75.79  ? 69   ALA B N   1 
ATOM   988  C CA  . ALA B 2 50 ? 68.166  37.133 12.664  1.00 75.72  ? 69   ALA B CA  1 
ATOM   989  C C   . ALA B 2 50 ? 68.091  35.667 13.081  1.00 79.17  ? 69   ALA B C   1 
ATOM   990  O O   . ALA B 2 50 ? 68.889  35.198 13.898  1.00 78.60  ? 69   ALA B O   1 
ATOM   991  C CB  . ALA B 2 50 ? 66.976  37.901 13.206  1.00 80.27  ? 69   ALA B CB  1 
ATOM   992  N N   . PHE B 2 51 ? 67.124  34.952 12.506  1.00 84.86  ? 70   PHE B N   1 
ATOM   993  C CA  . PHE B 2 51 ? 66.937  33.528 12.772  1.00 83.11  ? 70   PHE B CA  1 
ATOM   994  C C   . PHE B 2 51 ? 67.066  32.730 11.484  1.00 84.15  ? 70   PHE B C   1 
ATOM   995  O O   . PHE B 2 51 ? 66.696  33.198 10.407  1.00 89.07  ? 70   PHE B O   1 
ATOM   996  C CB  . PHE B 2 51 ? 65.563  33.254 13.384  1.00 76.74  ? 70   PHE B CB  1 
ATOM   997  C CG  . PHE B 2 51 ? 65.486  33.534 14.855  1.00 73.26  ? 70   PHE B CG  1 
ATOM   998  C CD1 . PHE B 2 51 ? 64.915  34.715 15.324  1.00 65.17  ? 70   PHE B CD1 1 
ATOM   999  C CD2 . PHE B 2 51 ? 65.976  32.605 15.780  1.00 76.03  ? 70   PHE B CD2 1 
ATOM   1000 C CE1 . PHE B 2 51 ? 64.824  34.971 16.700  1.00 55.49  ? 70   PHE B CE1 1 
ATOM   1001 C CE2 . PHE B 2 51 ? 65.895  32.843 17.159  1.00 66.22  ? 70   PHE B CE2 1 
ATOM   1002 C CZ  . PHE B 2 51 ? 65.318  34.027 17.620  1.00 61.76  ? 70   PHE B CZ  1 
ATOM   1003 N N   . GLN B 2 52 ? 67.591  31.520 11.609  1.00 81.97  ? 71   GLN B N   1 
ATOM   1004 C CA  . GLN B 2 52 ? 67.769  30.647 10.465  1.00 85.36  ? 71   GLN B CA  1 
ATOM   1005 C C   . GLN B 2 52 ? 66.578  29.684 10.372  1.00 85.98  ? 71   GLN B C   1 
ATOM   1006 O O   . GLN B 2 52 ? 66.368  28.841 11.250  1.00 83.30  ? 71   GLN B O   1 
ATOM   1007 C CB  . GLN B 2 52 ? 69.082  29.888 10.626  1.00 90.09  ? 71   GLN B CB  1 
ATOM   1008 C CG  . GLN B 2 52 ? 69.401  28.947 9.500   1.00 104.91 ? 71   GLN B CG  1 
ATOM   1009 C CD  . GLN B 2 52 ? 69.588  27.536 10.001  1.00 118.01 ? 71   GLN B CD  1 
ATOM   1010 O OE1 . GLN B 2 52 ? 68.639  26.905 10.473  1.00 126.80 ? 71   GLN B OE1 1 
ATOM   1011 N NE2 . GLN B 2 52 ? 70.816  27.033 9.916   1.00 110.80 ? 71   GLN B NE2 1 
ATOM   1012 N N   . SER B 2 53 ? 65.799  29.829 9.304   1.00 85.94  ? 72   SER B N   1 
ATOM   1013 C CA  . SER B 2 53 ? 64.615  29.008 9.083   1.00 87.84  ? 72   SER B CA  1 
ATOM   1014 C C   . SER B 2 53 ? 64.887  27.860 8.114   1.00 88.24  ? 72   SER B C   1 
ATOM   1015 O O   . SER B 2 53 ? 65.223  28.074 6.951   1.00 79.17  ? 72   SER B O   1 
ATOM   1016 C CB  . SER B 2 53 ? 63.473  29.882 8.552   1.00 92.81  ? 72   SER B CB  1 
ATOM   1017 O OG  . SER B 2 53 ? 62.269  29.145 8.410   1.00 99.56  ? 72   SER B OG  1 
ATOM   1018 N N   . THR B 2 54 ? 64.728  26.641 8.622   1.00 96.61  ? 73   THR B N   1 
ATOM   1019 C CA  . THR B 2 54 ? 64.942  25.411 7.863   1.00 100.23 ? 73   THR B CA  1 
ATOM   1020 C C   . THR B 2 54 ? 63.609  24.666 7.807   1.00 98.46  ? 73   THR B C   1 
ATOM   1021 O O   . THR B 2 54 ? 63.261  23.964 8.751   1.00 100.52 ? 73   THR B O   1 
ATOM   1022 C CB  . THR B 2 54 ? 65.964  24.497 8.585   1.00 104.29 ? 73   THR B CB  1 
ATOM   1023 O OG1 . THR B 2 54 ? 67.105  25.270 8.976   1.00 101.47 ? 73   THR B OG1 1 
ATOM   1024 C CG2 . THR B 2 54 ? 66.404  23.354 7.678   1.00 103.55 ? 73   THR B CG2 1 
ATOM   1025 N N   . PRO B 2 55 ? 62.843  24.815 6.710   1.00 97.15  ? 74   PRO B N   1 
ATOM   1026 C CA  . PRO B 2 55 ? 61.548  24.130 6.586   1.00 96.43  ? 74   PRO B CA  1 
ATOM   1027 C C   . PRO B 2 55 ? 61.664  22.669 6.976   1.00 101.97 ? 74   PRO B C   1 
ATOM   1028 O O   . PRO B 2 55 ? 62.668  22.024 6.677   1.00 104.24 ? 74   PRO B O   1 
ATOM   1029 C CB  . PRO B 2 55 ? 61.199  24.323 5.121   1.00 88.13  ? 74   PRO B CB  1 
ATOM   1030 C CG  . PRO B 2 55 ? 61.735  25.684 4.855   1.00 97.94  ? 74   PRO B CG  1 
ATOM   1031 C CD  . PRO B 2 55 ? 63.109  25.630 5.514   1.00 100.66 ? 74   PRO B CD  1 
ATOM   1032 N N   . ILE B 2 56 ? 60.638  22.148 7.645   1.00 106.62 ? 75   ILE B N   1 
ATOM   1033 C CA  . ILE B 2 56 ? 60.664  20.763 8.106   1.00 107.79 ? 75   ILE B CA  1 
ATOM   1034 C C   . ILE B 2 56 ? 59.736  19.802 7.352   1.00 112.41 ? 75   ILE B C   1 
ATOM   1035 O O   . ILE B 2 56 ? 58.555  20.091 7.125   1.00 107.20 ? 75   ILE B O   1 
ATOM   1036 C CB  . ILE B 2 56 ? 60.350  20.685 9.618   1.00 99.54  ? 75   ILE B CB  1 
ATOM   1037 C CG1 . ILE B 2 56 ? 61.249  21.654 10.394  1.00 100.40 ? 75   ILE B CG1 1 
ATOM   1038 C CG2 . ILE B 2 56 ? 60.620  19.283 10.115  1.00 94.93  ? 75   ILE B CG2 1 
ATOM   1039 C CD1 . ILE B 2 56 ? 60.878  21.839 11.852  1.00 96.26  ? 75   ILE B CD1 1 
ATOM   1040 N N   . VAL B 2 57 ? 60.302  18.652 6.978   1.00 117.12 ? 76   VAL B N   1 
ATOM   1041 C CA  . VAL B 2 57 ? 59.598  17.603 6.240   1.00 116.13 ? 76   VAL B CA  1 
ATOM   1042 C C   . VAL B 2 57 ? 58.682  16.742 7.111   1.00 117.35 ? 76   VAL B C   1 
ATOM   1043 O O   . VAL B 2 57 ? 59.139  15.937 7.929   1.00 116.57 ? 76   VAL B O   1 
ATOM   1044 C CB  . VAL B 2 57 ? 60.601  16.669 5.516   1.00 110.85 ? 76   VAL B CB  1 
ATOM   1045 C CG1 . VAL B 2 57 ? 61.633  16.141 6.508   1.00 107.48 ? 76   VAL B CG1 1 
ATOM   1046 C CG2 . VAL B 2 57 ? 59.857  15.511 4.859   1.00 106.07 ? 76   VAL B CG2 1 
ATOM   1047 N N   . VAL B 2 58 ? 57.383  16.919 6.917   1.00 117.86 ? 77   VAL B N   1 
ATOM   1048 C CA  . VAL B 2 58 ? 56.383  16.168 7.656   1.00 118.07 ? 77   VAL B CA  1 
ATOM   1049 C C   . VAL B 2 58 ? 55.993  14.967 6.811   1.00 122.88 ? 77   VAL B C   1 
ATOM   1050 O O   . VAL B 2 58 ? 55.387  15.121 5.750   1.00 120.33 ? 77   VAL B O   1 
ATOM   1051 C CB  . VAL B 2 58 ? 55.127  17.005 7.886   1.00 114.78 ? 77   VAL B CB  1 
ATOM   1052 C CG1 . VAL B 2 58 ? 54.161  16.238 8.755   1.00 114.61 ? 77   VAL B CG1 1 
ATOM   1053 C CG2 . VAL B 2 58 ? 55.494  18.332 8.511   1.00 110.76 ? 77   VAL B CG2 1 
ATOM   1054 N N   . GLN B 2 59 ? 56.330  13.771 7.280   1.00 127.63 ? 78   GLN B N   1 
ATOM   1055 C CA  . GLN B 2 59 ? 56.012  12.567 6.525   1.00 131.48 ? 78   GLN B CA  1 
ATOM   1056 C C   . GLN B 2 59 ? 54.658  11.968 6.923   1.00 127.73 ? 78   GLN B C   1 
ATOM   1057 O O   . GLN B 2 59 ? 54.481  10.750 6.934   1.00 132.85 ? 78   GLN B O   1 
ATOM   1058 C CB  . GLN B 2 59 ? 57.134  11.535 6.701   1.00 134.94 ? 78   GLN B CB  1 
ATOM   1059 C CG  . GLN B 2 59 ? 57.209  10.506 5.581   1.00 143.89 ? 78   GLN B CG  1 
ATOM   1060 C CD  . GLN B 2 59 ? 57.354  11.147 4.210   1.00 150.55 ? 78   GLN B CD  1 
ATOM   1061 O OE1 . GLN B 2 59 ? 58.253  11.959 3.984   1.00 152.12 ? 78   GLN B OE1 1 
ATOM   1062 N NE2 . GLN B 2 59 ? 56.467  10.783 3.285   1.00 152.22 ? 78   GLN B NE2 1 
ATOM   1063 N N   . MET B 2 60 ? 53.701  12.835 7.237   1.00 118.67 ? 79   MET B N   1 
ATOM   1064 C CA  . MET B 2 60 ? 52.367  12.399 7.631   1.00 111.00 ? 79   MET B CA  1 
ATOM   1065 C C   . MET B 2 60 ? 51.747  11.427 6.631   1.00 114.35 ? 79   MET B C   1 
ATOM   1066 O O   . MET B 2 60 ? 52.043  11.459 5.432   1.00 116.27 ? 79   MET B O   1 
ATOM   1067 C CB  . MET B 2 60 ? 51.443  13.597 7.758   1.00 101.40 ? 79   MET B CB  1 
ATOM   1068 C CG  . MET B 2 60 ? 51.367  14.375 6.469   1.00 97.55  ? 79   MET B CG  1 
ATOM   1069 S SD  . MET B 2 60 ? 49.903  15.377 6.311   1.00 90.22  ? 79   MET B SD  1 
ATOM   1070 C CE  . MET B 2 60 ? 49.174  14.651 4.857   1.00 104.57 ? 79   MET B CE  1 
ATOM   1071 N N   . THR B 2 61 ? 50.854  10.588 7.149   1.00 118.06 ? 80   THR B N   1 
ATOM   1072 C CA  . THR B 2 61 ? 50.148  9.572  6.372   1.00 116.11 ? 80   THR B CA  1 
ATOM   1073 C C   . THR B 2 61 ? 48.652  9.828  6.328   1.00 117.06 ? 80   THR B C   1 
ATOM   1074 O O   . THR B 2 61 ? 48.058  10.226 7.325   1.00 116.78 ? 80   THR B O   1 
ATOM   1075 C CB  . THR B 2 61 ? 50.315  8.183  6.992   1.00 107.39 ? 80   THR B CB  1 
ATOM   1076 O OG1 . THR B 2 61 ? 51.705  7.854  7.057   1.00 106.49 ? 80   THR B OG1 1 
ATOM   1077 C CG2 . THR B 2 61 ? 49.576  7.144  6.169   1.00 101.35 ? 80   THR B CG2 1 
ATOM   1078 N N   . LYS B 2 62 ? 48.042  9.584  5.176   1.00 117.57 ? 81   LYS B N   1 
ATOM   1079 C CA  . LYS B 2 62 ? 46.604  9.764  5.055   1.00 115.43 ? 81   LYS B CA  1 
ATOM   1080 C C   . LYS B 2 62 ? 45.984  8.443  5.498   1.00 111.12 ? 81   LYS B C   1 
ATOM   1081 O O   . LYS B 2 62 ? 46.524  7.373  5.213   1.00 108.12 ? 81   LYS B O   1 
ATOM   1082 C CB  . LYS B 2 62 ? 46.215  10.092 3.610   1.00 114.05 ? 81   LYS B CB  1 
ATOM   1083 C CG  . LYS B 2 62 ? 44.770  10.586 3.432   1.00 119.37 ? 81   LYS B CG  1 
ATOM   1084 C CD  . LYS B 2 62 ? 43.739  9.460  3.433   1.00 123.87 ? 81   LYS B CD  1 
ATOM   1085 C CE  . LYS B 2 62 ? 42.361  9.988  3.051   1.00 123.25 ? 81   LYS B CE  1 
ATOM   1086 N NZ  . LYS B 2 62 ? 41.360  8.911  2.859   1.00 120.13 ? 81   LYS B NZ  1 
ATOM   1087 N N   . LEU B 2 63 ? 44.860  8.521  6.203   1.00 109.80 ? 82   LEU B N   1 
ATOM   1088 C CA  . LEU B 2 63 ? 44.196  7.323  6.701   1.00 107.23 ? 82   LEU B CA  1 
ATOM   1089 C C   . LEU B 2 63 ? 42.834  7.018  6.074   1.00 104.92 ? 82   LEU B C   1 
ATOM   1090 O O   . LEU B 2 63 ? 42.095  7.924  5.673   1.00 101.64 ? 82   LEU B O   1 
ATOM   1091 C CB  . LEU B 2 63 ? 44.047  7.410  8.229   1.00 104.84 ? 82   LEU B CB  1 
ATOM   1092 C CG  . LEU B 2 63 ? 45.314  7.427  9.098   1.00 94.48  ? 82   LEU B CG  1 
ATOM   1093 C CD1 . LEU B 2 63 ? 44.929  7.303  10.562  1.00 84.02  ? 82   LEU B CD1 1 
ATOM   1094 C CD2 . LEU B 2 63 ? 46.225  6.270  8.723   1.00 92.76  ? 82   LEU B CD2 1 
ATOM   1095 N N   . ALA B 2 64 ? 42.519  5.723  6.009   1.00 103.42 ? 83   ALA B N   1 
ATOM   1096 C CA  . ALA B 2 64 ? 41.259  5.227  5.457   1.00 100.99 ? 83   ALA B CA  1 
ATOM   1097 C C   . ALA B 2 64 ? 40.392  4.616  6.564   1.00 98.60  ? 83   ALA B C   1 
ATOM   1098 O O   . ALA B 2 64 ? 39.181  4.851  6.619   1.00 99.01  ? 83   ALA B O   1 
ATOM   1099 C CB  . ALA B 2 64 ? 41.533  4.181  4.373   1.00 101.81 ? 83   ALA B CB  1 
ATOM   1100 N N   . THR B 2 65 ? 41.013  3.830  7.442   1.00 94.22  ? 84   THR B N   1 
ATOM   1101 C CA  . THR B 2 65 ? 40.282  3.205  8.535   1.00 93.27  ? 84   THR B CA  1 
ATOM   1102 C C   . THR B 2 65 ? 40.735  3.699  9.909   1.00 93.39  ? 84   THR B C   1 
ATOM   1103 O O   . THR B 2 65 ? 41.929  3.801  10.190  1.00 91.96  ? 84   THR B O   1 
ATOM   1104 C CB  . THR B 2 65 ? 40.393  1.663  8.480   1.00 97.77  ? 84   THR B CB  1 
ATOM   1105 O OG1 . THR B 2 65 ? 39.685  1.089  9.591   1.00 104.41 ? 84   THR B OG1 1 
ATOM   1106 C CG2 . THR B 2 65 ? 41.851  1.224  8.509   1.00 89.68  ? 84   THR B CG2 1 
ATOM   1107 N N   . THR B 2 66 ? 39.759  3.995  10.762  1.00 96.07  ? 85   THR B N   1 
ATOM   1108 C CA  . THR B 2 66 ? 40.006  4.501  12.108  1.00 97.89  ? 85   THR B CA  1 
ATOM   1109 C C   . THR B 2 66 ? 40.681  3.473  13.017  1.00 94.57  ? 85   THR B C   1 
ATOM   1110 O O   . THR B 2 66 ? 41.087  3.792  14.127  1.00 88.28  ? 85   THR B O   1 
ATOM   1111 C CB  . THR B 2 66 ? 38.666  4.970  12.758  1.00 101.86 ? 85   THR B CB  1 
ATOM   1112 O OG1 . THR B 2 66 ? 38.918  6.062  13.648  1.00 102.00 ? 85   THR B OG1 1 
ATOM   1113 C CG2 . THR B 2 66 ? 38.018  3.840  13.552  1.00 102.62 ? 85   THR B CG2 1 
ATOM   1114 N N   . GLU B 2 67 ? 40.803  2.242  12.537  1.00 103.34 ? 86   GLU B N   1 
ATOM   1115 C CA  . GLU B 2 67 ? 41.405  1.161  13.313  1.00 113.57 ? 86   GLU B CA  1 
ATOM   1116 C C   . GLU B 2 67 ? 42.926  1.227  13.319  1.00 112.40 ? 86   GLU B C   1 
ATOM   1117 O O   . GLU B 2 67 ? 43.602  0.498  14.050  1.00 110.19 ? 86   GLU B O   1 
ATOM   1118 C CB  . GLU B 2 67 ? 40.948  -0.182 12.750  1.00 126.02 ? 86   GLU B CB  1 
ATOM   1119 C CG  . GLU B 2 67 ? 41.372  -1.380 13.565  1.00 142.30 ? 86   GLU B CG  1 
ATOM   1120 C CD  . GLU B 2 67 ? 40.672  -2.635 13.110  1.00 156.10 ? 86   GLU B CD  1 
ATOM   1121 O OE1 . GLU B 2 67 ? 40.805  -2.986 11.916  1.00 164.13 ? 86   GLU B OE1 1 
ATOM   1122 O OE2 . GLU B 2 67 ? 39.986  -3.263 13.944  1.00 159.84 ? 86   GLU B OE2 1 
ATOM   1123 N N   . GLU B 2 68 ? 43.456  2.113  12.494  1.00 115.77 ? 87   GLU B N   1 
ATOM   1124 C CA  . GLU B 2 68 ? 44.892  2.292  12.388  1.00 124.93 ? 87   GLU B CA  1 
ATOM   1125 C C   . GLU B 2 68 ? 45.413  3.191  13.506  1.00 124.21 ? 87   GLU B C   1 
ATOM   1126 O O   . GLU B 2 68 ? 46.618  3.270  13.750  1.00 128.60 ? 87   GLU B O   1 
ATOM   1127 C CB  . GLU B 2 68 ? 45.219  2.924  11.039  1.00 134.64 ? 87   GLU B CB  1 
ATOM   1128 C CG  . GLU B 2 68 ? 44.706  2.134  9.853   1.00 142.36 ? 87   GLU B CG  1 
ATOM   1129 C CD  . GLU B 2 68 ? 44.885  2.879  8.547   1.00 148.23 ? 87   GLU B CD  1 
ATOM   1130 O OE1 . GLU B 2 68 ? 46.025  3.298  8.254   1.00 154.97 ? 87   GLU B OE1 1 
ATOM   1131 O OE2 . GLU B 2 68 ? 43.886  3.046  7.815   1.00 146.35 ? 87   GLU B OE2 1 
ATOM   1132 N N   . LEU B 2 69 ? 44.495  3.864  14.188  1.00 117.13 ? 88   LEU B N   1 
ATOM   1133 C CA  . LEU B 2 69 ? 44.849  4.787  15.260  1.00 107.13 ? 88   LEU B CA  1 
ATOM   1134 C C   . LEU B 2 69 ? 45.086  4.173  16.631  1.00 110.35 ? 88   LEU B C   1 
ATOM   1135 O O   . LEU B 2 69 ? 44.682  3.038  16.895  1.00 113.57 ? 88   LEU B O   1 
ATOM   1136 C CB  . LEU B 2 69 ? 43.751  5.836  15.421  1.00 94.67  ? 88   LEU B CB  1 
ATOM   1137 C CG  . LEU B 2 69 ? 43.473  6.779  14.260  1.00 85.30  ? 88   LEU B CG  1 
ATOM   1138 C CD1 . LEU B 2 69 ? 42.421  7.819  14.682  1.00 78.81  ? 88   LEU B CD1 1 
ATOM   1139 C CD2 . LEU B 2 69 ? 44.778  7.448  13.851  1.00 81.64  ? 88   LEU B CD2 1 
ATOM   1140 N N   . PRO B 2 70 ? 45.778  4.922  17.515  1.00 112.12 ? 89   PRO B N   1 
ATOM   1141 C CA  . PRO B 2 70 ? 46.073  4.495  18.887  1.00 110.14 ? 89   PRO B CA  1 
ATOM   1142 C C   . PRO B 2 70 ? 44.905  4.969  19.780  1.00 113.44 ? 89   PRO B C   1 
ATOM   1143 O O   . PRO B 2 70 ? 44.045  5.734  19.330  1.00 114.61 ? 89   PRO B O   1 
ATOM   1144 C CB  . PRO B 2 70 ? 47.399  5.198  19.193  1.00 98.32  ? 89   PRO B CB  1 
ATOM   1145 C CG  . PRO B 2 70 ? 47.286  6.465  18.425  1.00 96.53  ? 89   PRO B CG  1 
ATOM   1146 C CD  . PRO B 2 70 ? 46.694  6.007  17.106  1.00 106.30 ? 89   PRO B CD  1 
ATOM   1147 N N   . ASP B 2 71 ? 44.864  4.517  21.030  1.00 114.16 ? 90   ASP B N   1 
ATOM   1148 C CA  . ASP B 2 71 ? 43.780  4.890  21.941  1.00 115.48 ? 90   ASP B CA  1 
ATOM   1149 C C   . ASP B 2 71 ? 43.732  6.363  22.327  1.00 110.10 ? 90   ASP B C   1 
ATOM   1150 O O   . ASP B 2 71 ? 42.663  6.908  22.603  1.00 101.42 ? 90   ASP B O   1 
ATOM   1151 C CB  . ASP B 2 71 ? 43.849  4.041  23.211  1.00 128.34 ? 90   ASP B CB  1 
ATOM   1152 C CG  . ASP B 2 71 ? 43.317  2.641  23.001  1.00 135.98 ? 90   ASP B CG  1 
ATOM   1153 O OD1 . ASP B 2 71 ? 43.827  1.940  22.101  1.00 140.13 ? 90   ASP B OD1 1 
ATOM   1154 O OD2 . ASP B 2 71 ? 42.387  2.246  23.738  1.00 138.89 ? 90   ASP B OD2 1 
ATOM   1155 N N   . GLU B 2 72 ? 44.899  6.994  22.367  1.00 107.34 ? 91   GLU B N   1 
ATOM   1156 C CA  . GLU B 2 72 ? 45.006  8.403  22.709  1.00 99.07  ? 91   GLU B CA  1 
ATOM   1157 C C   . GLU B 2 72 ? 46.001  9.045  21.768  1.00 89.09  ? 91   GLU B C   1 
ATOM   1158 O O   . GLU B 2 72 ? 47.034  8.462  21.438  1.00 86.01  ? 91   GLU B O   1 
ATOM   1159 C CB  . GLU B 2 72 ? 45.500  8.583  24.140  1.00 110.56 ? 91   GLU B CB  1 
ATOM   1160 C CG  . GLU B 2 72 ? 44.553  8.114  25.223  1.00 120.39 ? 91   GLU B CG  1 
ATOM   1161 C CD  . GLU B 2 72 ? 45.207  8.180  26.589  1.00 125.75 ? 91   GLU B CD  1 
ATOM   1162 O OE1 . GLU B 2 72 ? 45.613  9.292  26.997  1.00 128.99 ? 91   GLU B OE1 1 
ATOM   1163 O OE2 . GLU B 2 72 ? 45.328  7.122  27.248  1.00 124.99 ? 91   GLU B OE2 1 
ATOM   1164 N N   . PHE B 2 73 ? 45.680  10.258 21.349  1.00 80.73  ? 92   PHE B N   1 
ATOM   1165 C CA  . PHE B 2 73 ? 46.523  11.009 20.440  1.00 70.35  ? 92   PHE B CA  1 
ATOM   1166 C C   . PHE B 2 73 ? 45.927  12.401 20.355  1.00 74.38  ? 92   PHE B C   1 
ATOM   1167 O O   . PHE B 2 73 ? 44.782  12.630 20.764  1.00 74.61  ? 92   PHE B O   1 
ATOM   1168 C CB  . PHE B 2 73 ? 46.517  10.336 19.073  1.00 60.81  ? 92   PHE B CB  1 
ATOM   1169 C CG  . PHE B 2 73 ? 45.128  10.046 18.543  1.00 61.21  ? 92   PHE B CG  1 
ATOM   1170 C CD1 . PHE B 2 73 ? 44.360  11.056 17.963  1.00 65.27  ? 92   PHE B CD1 1 
ATOM   1171 C CD2 . PHE B 2 73 ? 44.581  8.763  18.639  1.00 56.69  ? 92   PHE B CD2 1 
ATOM   1172 C CE1 . PHE B 2 73 ? 43.070  10.793 17.489  1.00 64.94  ? 92   PHE B CE1 1 
ATOM   1173 C CE2 . PHE B 2 73 ? 43.285  8.487  18.166  1.00 56.10  ? 92   PHE B CE2 1 
ATOM   1174 C CZ  . PHE B 2 73 ? 42.532  9.502  17.590  1.00 59.18  ? 92   PHE B CZ  1 
ATOM   1175 N N   . VAL B 2 74 ? 46.691  13.342 19.827  1.00 72.52  ? 93   VAL B N   1 
ATOM   1176 C CA  . VAL B 2 74 ? 46.171  14.689 19.732  1.00 70.90  ? 93   VAL B CA  1 
ATOM   1177 C C   . VAL B 2 74 ? 45.664  14.959 18.340  1.00 65.99  ? 93   VAL B C   1 
ATOM   1178 O O   . VAL B 2 74 ? 46.197  14.443 17.350  1.00 60.27  ? 93   VAL B O   1 
ATOM   1179 C CB  . VAL B 2 74 ? 47.247  15.708 20.058  1.00 74.91  ? 93   VAL B CB  1 
ATOM   1180 C CG1 . VAL B 2 74 ? 47.822  15.412 21.435  1.00 81.65  ? 93   VAL B CG1 1 
ATOM   1181 C CG2 . VAL B 2 74 ? 48.337  15.657 18.991  1.00 71.44  ? 93   VAL B CG2 1 
ATOM   1182 N N   . VAL B 2 75 ? 44.635  15.782 18.264  1.00 61.92  ? 94   VAL B N   1 
ATOM   1183 C CA  . VAL B 2 75 ? 44.087  16.109 16.977  1.00 65.23  ? 94   VAL B CA  1 
ATOM   1184 C C   . VAL B 2 75 ? 44.114  17.567 16.643  1.00 67.25  ? 94   VAL B C   1 
ATOM   1185 O O   . VAL B 2 75 ? 43.383  18.385 17.210  1.00 66.42  ? 94   VAL B O   1 
ATOM   1186 C CB  . VAL B 2 75 ? 42.671  15.666 16.847  1.00 69.21  ? 94   VAL B CB  1 
ATOM   1187 C CG1 . VAL B 2 75 ? 42.159  16.032 15.437  1.00 58.41  ? 94   VAL B CG1 1 
ATOM   1188 C CG2 . VAL B 2 75 ? 42.593  14.177 17.145  1.00 73.25  ? 94   VAL B CG2 1 
ATOM   1189 N N   . VAL B 2 76 ? 44.952  17.880 15.678  1.00 70.96  ? 95   VAL B N   1 
ATOM   1190 C CA  . VAL B 2 76 ? 45.063  19.238 15.246  1.00 77.83  ? 95   VAL B CA  1 
ATOM   1191 C C   . VAL B 2 76 ? 43.923  19.524 14.314  1.00 81.60  ? 95   VAL B C   1 
ATOM   1192 O O   . VAL B 2 76 ? 44.006  19.259 13.114  1.00 76.57  ? 95   VAL B O   1 
ATOM   1193 C CB  . VAL B 2 76 ? 46.340  19.471 14.492  1.00 76.84  ? 95   VAL B CB  1 
ATOM   1194 C CG1 . VAL B 2 76 ? 46.537  20.968 14.298  1.00 79.62  ? 95   VAL B CG1 1 
ATOM   1195 C CG2 . VAL B 2 76 ? 47.491  18.825 15.237  1.00 77.79  ? 95   VAL B CG2 1 
ATOM   1196 N N   . THR B 2 77 ? 42.836  20.026 14.875  1.00 90.01  ? 96   THR B N   1 
ATOM   1197 C CA  . THR B 2 77 ? 41.708  20.388 14.050  1.00 93.18  ? 96   THR B CA  1 
ATOM   1198 C C   . THR B 2 77 ? 42.304  21.564 13.287  1.00 98.07  ? 96   THR B C   1 
ATOM   1199 O O   . THR B 2 77 ? 42.516  22.629 13.866  1.00 92.54  ? 96   THR B O   1 
ATOM   1200 C CB  . THR B 2 77 ? 40.523  20.871 14.906  1.00 88.74  ? 96   THR B CB  1 
ATOM   1201 O OG1 . THR B 2 77 ? 40.287  19.927 15.963  1.00 83.75  ? 96   THR B OG1 1 
ATOM   1202 C CG2 . THR B 2 77 ? 39.257  21.030 14.038  1.00 79.66  ? 96   THR B CG2 1 
ATOM   1203 N N   . ALA B 2 78 ? 42.621  21.359 12.010  1.00 104.86 ? 97   ALA B N   1 
ATOM   1204 C CA  . ALA B 2 78 ? 43.207  22.427 11.202  1.00 113.78 ? 97   ALA B CA  1 
ATOM   1205 C C   . ALA B 2 78 ? 42.190  23.540 10.962  1.00 124.28 ? 97   ALA B C   1 
ATOM   1206 O O   . ALA B 2 78 ? 41.912  23.908 9.815   1.00 128.17 ? 97   ALA B O   1 
ATOM   1207 C CB  . ALA B 2 78 ? 43.697  21.877 9.878   1.00 107.50 ? 97   ALA B CB  1 
ATOM   1208 N N   . LYS B 2 79 ? 41.652  24.067 12.063  1.00 128.66 ? 98   LYS B N   1 
ATOM   1209 C CA  . LYS B 2 79 ? 40.652  25.134 12.051  1.00 130.09 ? 98   LYS B CA  1 
ATOM   1210 C C   . LYS B 2 79 ? 41.278  26.536 12.122  1.00 134.38 ? 98   LYS B C   1 
ATOM   1211 O O   . LYS B 2 79 ? 40.539  27.530 11.936  1.00 138.29 ? 98   LYS B O   1 
ATOM   1212 C CB  . LYS B 2 79 ? 39.672  24.911 13.216  1.00 126.50 ? 98   LYS B CB  1 
ATOM   1213 C CG  . LYS B 2 79 ? 38.695  26.049 13.482  1.00 128.33 ? 98   LYS B CG  1 
ATOM   1214 C CD  . LYS B 2 79 ? 39.134  26.876 14.691  1.00 136.01 ? 98   LYS B CD  1 
ATOM   1215 C CE  . LYS B 2 79 ? 38.212  28.072 14.931  1.00 140.58 ? 98   LYS B CE  1 
ATOM   1216 N NZ  . LYS B 2 79 ? 38.566  28.839 16.166  1.00 142.00 ? 98   LYS B NZ  1 
ATOM   1217 O OXT . LYS B 2 79 ? 42.504  26.629 12.355  1.00 131.76 ? 98   LYS B OXT 1 
ATOM   1218 N N   . PRO C 3 1  ? 58.719  37.226 30.417  1.00 139.68 ? 10   PRO C N   1 
ATOM   1219 C CA  . PRO C 3 1  ? 59.830  37.156 29.435  1.00 136.97 ? 10   PRO C CA  1 
ATOM   1220 C C   . PRO C 3 1  ? 60.582  38.485 29.219  1.00 133.37 ? 10   PRO C C   1 
ATOM   1221 O O   . PRO C 3 1  ? 61.805  38.544 29.394  1.00 126.61 ? 10   PRO C O   1 
ATOM   1222 C CB  . PRO C 3 1  ? 59.223  36.656 28.128  1.00 137.11 ? 10   PRO C CB  1 
ATOM   1223 C CG  . PRO C 3 1  ? 58.014  35.868 28.636  1.00 134.01 ? 10   PRO C CG  1 
ATOM   1224 C CD  . PRO C 3 1  ? 57.483  36.682 29.823  1.00 132.73 ? 10   PRO C CD  1 
ATOM   1225 N N   . PRO C 3 2  ? 59.854  39.568 28.863  1.00 133.73 ? 11   PRO C N   1 
ATOM   1226 C CA  . PRO C 3 2  ? 60.409  40.904 28.610  1.00 130.32 ? 11   PRO C CA  1 
ATOM   1227 C C   . PRO C 3 2  ? 61.783  41.214 29.200  1.00 124.15 ? 11   PRO C C   1 
ATOM   1228 O O   . PRO C 3 2  ? 62.138  40.752 30.289  1.00 122.38 ? 11   PRO C O   1 
ATOM   1229 C CB  . PRO C 3 2  ? 59.324  41.821 29.152  1.00 131.68 ? 11   PRO C CB  1 
ATOM   1230 C CG  . PRO C 3 2  ? 58.095  41.119 28.714  1.00 132.64 ? 11   PRO C CG  1 
ATOM   1231 C CD  . PRO C 3 2  ? 58.388  39.661 29.030  1.00 136.46 ? 11   PRO C CD  1 
ATOM   1232 N N   . ALA C 3 3  ? 62.552  42.007 28.463  1.00 117.42 ? 12   ALA C N   1 
ATOM   1233 C CA  . ALA C 3 3  ? 63.887  42.392 28.898  1.00 107.49 ? 12   ALA C CA  1 
ATOM   1234 C C   . ALA C 3 3  ? 63.770  43.114 30.217  1.00 97.96  ? 12   ALA C C   1 
ATOM   1235 O O   . ALA C 3 3  ? 62.671  43.429 30.675  1.00 96.39  ? 12   ALA C O   1 
ATOM   1236 C CB  . ALA C 3 3  ? 64.542  43.308 27.864  1.00 109.36 ? 12   ALA C CB  1 
ATOM   1237 N N   . LEU C 3 4  ? 64.910  43.370 30.832  1.00 93.39  ? 13   LEU C N   1 
ATOM   1238 C CA  . LEU C 3 4  ? 64.915  44.080 32.090  1.00 94.01  ? 13   LEU C CA  1 
ATOM   1239 C C   . LEU C 3 4  ? 65.246  45.531 31.811  1.00 93.70  ? 13   LEU C C   1 
ATOM   1240 O O   . LEU C 3 4  ? 66.283  45.842 31.217  1.00 90.17  ? 13   LEU C O   1 
ATOM   1241 C CB  . LEU C 3 4  ? 65.946  43.486 33.048  1.00 95.86  ? 13   LEU C CB  1 
ATOM   1242 C CG  . LEU C 3 4  ? 65.706  42.038 33.468  1.00 94.89  ? 13   LEU C CG  1 
ATOM   1243 C CD1 . LEU C 3 4  ? 66.643  41.680 34.608  1.00 92.37  ? 13   LEU C CD1 1 
ATOM   1244 C CD2 . LEU C 3 4  ? 64.260  41.860 33.896  1.00 96.33  ? 13   LEU C CD2 1 
ATOM   1245 N N   . HIS C 3 5  ? 64.349  46.414 32.231  1.00 93.08  ? 14   HIS C N   1 
ATOM   1246 C CA  . HIS C 3 5  ? 64.546  47.839 32.041  1.00 88.31  ? 14   HIS C CA  1 
ATOM   1247 C C   . HIS C 3 5  ? 64.684  48.559 33.362  1.00 88.34  ? 14   HIS C C   1 
ATOM   1248 O O   . HIS C 3 5  ? 63.745  48.619 34.165  1.00 84.68  ? 14   HIS C O   1 
ATOM   1249 C CB  . HIS C 3 5  ? 63.394  48.431 31.255  1.00 83.56  ? 14   HIS C CB  1 
ATOM   1250 C CG  . HIS C 3 5  ? 63.328  47.928 29.858  1.00 82.33  ? 14   HIS C CG  1 
ATOM   1251 N ND1 . HIS C 3 5  ? 64.268  48.259 28.908  1.00 82.12  ? 14   HIS C ND1 1 
ATOM   1252 C CD2 . HIS C 3 5  ? 62.468  47.071 29.262  1.00 88.05  ? 14   HIS C CD2 1 
ATOM   1253 C CE1 . HIS C 3 5  ? 63.988  47.625 27.784  1.00 93.46  ? 14   HIS C CE1 1 
ATOM   1254 N NE2 . HIS C 3 5  ? 62.902  46.897 27.973  1.00 96.96  ? 14   HIS C NE2 1 
ATOM   1255 N N   . LEU C 3 6  ? 65.875  49.109 33.565  1.00 88.00  ? 15   LEU C N   1 
ATOM   1256 C CA  . LEU C 3 6  ? 66.199  49.841 34.773  1.00 84.44  ? 15   LEU C CA  1 
ATOM   1257 C C   . LEU C 3 6  ? 65.772  51.311 34.731  1.00 84.64  ? 15   LEU C C   1 
ATOM   1258 O O   . LEU C 3 6  ? 66.389  52.152 34.062  1.00 83.24  ? 15   LEU C O   1 
ATOM   1259 C CB  . LEU C 3 6  ? 67.703  49.739 35.040  1.00 77.55  ? 15   LEU C CB  1 
ATOM   1260 C CG  . LEU C 3 6  ? 68.247  50.477 36.267  1.00 70.41  ? 15   LEU C CG  1 
ATOM   1261 C CD1 . LEU C 3 6  ? 68.343  51.988 35.996  1.00 74.18  ? 15   LEU C CD1 1 
ATOM   1262 C CD2 . LEU C 3 6  ? 67.348  50.170 37.467  1.00 69.64  ? 15   LEU C CD2 1 
ATOM   1263 N N   . VAL C 3 7  ? 64.704  51.619 35.449  1.00 79.73  ? 16   VAL C N   1 
ATOM   1264 C CA  . VAL C 3 7  ? 64.248  52.984 35.512  1.00 76.96  ? 16   VAL C CA  1 
ATOM   1265 C C   . VAL C 3 7  ? 65.216  53.735 36.412  1.00 89.56  ? 16   VAL C C   1 
ATOM   1266 O O   . VAL C 3 7  ? 65.320  53.471 37.612  1.00 90.25  ? 16   VAL C O   1 
ATOM   1267 C CB  . VAL C 3 7  ? 62.846  53.058 36.072  1.00 68.65  ? 16   VAL C CB  1 
ATOM   1268 C CG1 . VAL C 3 7  ? 62.480  54.503 36.349  1.00 69.45  ? 16   VAL C CG1 1 
ATOM   1269 C CG2 . VAL C 3 7  ? 61.888  52.432 35.074  1.00 60.70  ? 16   VAL C CG2 1 
ATOM   1270 N N   . ASP C 3 8  ? 65.943  54.657 35.803  1.00 97.70  ? 17   ASP C N   1 
ATOM   1271 C CA  . ASP C 3 8  ? 66.931  55.469 36.489  1.00 109.71 ? 17   ASP C CA  1 
ATOM   1272 C C   . ASP C 3 8  ? 66.517  55.878 37.886  1.00 119.96 ? 17   ASP C C   1 
ATOM   1273 O O   . ASP C 3 8  ? 65.341  55.815 38.246  1.00 124.39 ? 17   ASP C O   1 
ATOM   1274 C CB  . ASP C 3 8  ? 67.200  56.716 35.672  1.00 113.96 ? 17   ASP C CB  1 
ATOM   1275 C CG  . ASP C 3 8  ? 66.929  56.498 34.218  1.00 127.94 ? 17   ASP C CG  1 
ATOM   1276 O OD1 . ASP C 3 8  ? 65.775  56.140 33.892  1.00 131.63 ? 17   ASP C OD1 1 
ATOM   1277 O OD2 . ASP C 3 8  ? 67.864  56.676 33.409  1.00 133.25 ? 17   ASP C OD2 1 
ATOM   1278 N N   . PRO C 3 9  ? 67.494  56.325 38.690  1.00 128.22 ? 18   PRO C N   1 
ATOM   1279 C CA  . PRO C 3 9  ? 67.301  56.769 40.074  1.00 132.57 ? 18   PRO C CA  1 
ATOM   1280 C C   . PRO C 3 9  ? 66.281  57.900 40.097  1.00 129.24 ? 18   PRO C C   1 
ATOM   1281 O O   . PRO C 3 9  ? 65.422  57.978 40.982  1.00 128.41 ? 18   PRO C O   1 
ATOM   1282 C CB  . PRO C 3 9  ? 68.695  57.253 40.481  1.00 136.67 ? 18   PRO C CB  1 
ATOM   1283 C CG  . PRO C 3 9  ? 69.615  56.462 39.600  1.00 137.55 ? 18   PRO C CG  1 
ATOM   1284 C CD  . PRO C 3 9  ? 68.899  56.496 38.281  1.00 132.44 ? 18   PRO C CD  1 
ATOM   1285 N N   . GLN C 3 10 ? 66.411  58.774 39.107  1.00 122.84 ? 19   GLN C N   1 
ATOM   1286 C CA  . GLN C 3 10 ? 65.533  59.913 38.928  1.00 116.98 ? 19   GLN C CA  1 
ATOM   1287 C C   . GLN C 3 10 ? 64.129  59.561 39.418  1.00 111.39 ? 19   GLN C C   1 
ATOM   1288 O O   . GLN C 3 10 ? 63.482  60.363 40.083  1.00 116.08 ? 19   GLN C O   1 
ATOM   1289 C CB  . GLN C 3 10 ? 65.489  60.260 37.448  1.00 123.16 ? 19   GLN C CB  1 
ATOM   1290 C CG  . GLN C 3 10 ? 64.975  59.087 36.615  1.00 137.58 ? 19   GLN C CG  1 
ATOM   1291 C CD  . GLN C 3 10 ? 65.085  59.308 35.121  1.00 143.56 ? 19   GLN C CD  1 
ATOM   1292 O OE1 . GLN C 3 10 ? 64.535  58.538 34.323  1.00 137.37 ? 19   GLN C OE1 1 
ATOM   1293 N NE2 . GLN C 3 10 ? 65.805  60.356 34.730  1.00 146.96 ? 19   GLN C NE2 1 
ATOM   1294 N N   . ILE C 3 11 ? 63.673  58.355 39.083  1.00 100.00 ? 20   ILE C N   1 
ATOM   1295 C CA  . ILE C 3 11 ? 62.348  57.874 39.474  1.00 80.19  ? 20   ILE C CA  1 
ATOM   1296 C C   . ILE C 3 11 ? 62.476  56.592 40.270  1.00 74.85  ? 20   ILE C C   1 
ATOM   1297 O O   . ILE C 3 11 ? 63.030  55.607 39.787  1.00 73.64  ? 20   ILE C O   1 
ATOM   1298 C CB  . ILE C 3 11 ? 61.495  57.539 38.266  1.00 71.09  ? 20   ILE C CB  1 
ATOM   1299 C CG1 . ILE C 3 11 ? 61.462  58.727 37.314  1.00 67.31  ? 20   ILE C CG1 1 
ATOM   1300 C CG2 . ILE C 3 11 ? 60.107  57.117 38.722  1.00 41.12  ? 20   ILE C CG2 1 
ATOM   1301 C CD1 . ILE C 3 11 ? 61.440  58.296 35.853  1.00 72.76  ? 20   ILE C CD1 1 
ATOM   1302 N N   . GLN C 3 12 ? 61.928  56.594 41.474  1.00 68.94  ? 21   GLN C N   1 
ATOM   1303 C CA  . GLN C 3 12 ? 62.012  55.423 42.322  1.00 59.54  ? 21   GLN C CA  1 
ATOM   1304 C C   . GLN C 3 12 ? 60.787  55.257 43.195  1.00 51.27  ? 21   GLN C C   1 
ATOM   1305 O O   . GLN C 3 12 ? 60.100  56.231 43.505  1.00 57.35  ? 21   GLN C O   1 
ATOM   1306 C CB  . GLN C 3 12 ? 63.240  55.534 43.205  1.00 70.49  ? 21   GLN C CB  1 
ATOM   1307 C CG  . GLN C 3 12 ? 64.544  55.323 42.481  1.00 88.16  ? 21   GLN C CG  1 
ATOM   1308 C CD  . GLN C 3 12 ? 65.715  55.187 43.439  1.00 103.60 ? 21   GLN C CD  1 
ATOM   1309 O OE1 . GLN C 3 12 ? 65.615  54.536 44.487  1.00 108.11 ? 21   GLN C OE1 1 
ATOM   1310 N NE2 . GLN C 3 12 ? 66.838  55.787 43.077  1.00 107.75 ? 21   GLN C NE2 1 
ATOM   1311 N N   . LEU C 3 13 ? 60.511  54.023 43.601  1.00 48.41  ? 22   LEU C N   1 
ATOM   1312 C CA  . LEU C 3 13 ? 59.350  53.775 44.451  1.00 57.50  ? 22   LEU C CA  1 
ATOM   1313 C C   . LEU C 3 13 ? 59.704  54.018 45.921  1.00 64.85  ? 22   LEU C C   1 
ATOM   1314 O O   . LEU C 3 13 ? 60.876  54.010 46.306  1.00 61.52  ? 22   LEU C O   1 
ATOM   1315 C CB  . LEU C 3 13 ? 58.827  52.345 44.262  1.00 48.28  ? 22   LEU C CB  1 
ATOM   1316 C CG  . LEU C 3 13 ? 57.304  52.223 44.097  1.00 50.15  ? 22   LEU C CG  1 
ATOM   1317 C CD1 . LEU C 3 13 ? 56.811  52.947 42.831  1.00 42.79  ? 22   LEU C CD1 1 
ATOM   1318 C CD2 . LEU C 3 13 ? 56.954  50.771 44.002  1.00 51.45  ? 22   LEU C CD2 1 
ATOM   1319 N N   . THR C 3 14 ? 58.685  54.246 46.738  1.00 74.99  ? 23   THR C N   1 
ATOM   1320 C CA  . THR C 3 14 ? 58.897  54.518 48.148  1.00 78.32  ? 23   THR C CA  1 
ATOM   1321 C C   . THR C 3 14 ? 57.790  53.842 48.928  1.00 81.12  ? 23   THR C C   1 
ATOM   1322 O O   . THR C 3 14 ? 56.630  53.823 48.498  1.00 78.22  ? 23   THR C O   1 
ATOM   1323 C CB  . THR C 3 14 ? 58.871  56.036 48.415  1.00 79.89  ? 23   THR C CB  1 
ATOM   1324 O OG1 . THR C 3 14 ? 59.860  56.670 47.600  1.00 82.55  ? 23   THR C OG1 1 
ATOM   1325 C CG2 . THR C 3 14 ? 59.174  56.339 49.872  1.00 79.25  ? 23   THR C CG2 1 
ATOM   1326 N N   . ILE C 3 15 ? 58.150  53.262 50.070  1.00 84.25  ? 24   ILE C N   1 
ATOM   1327 C CA  . ILE C 3 15 ? 57.169  52.577 50.900  1.00 78.64  ? 24   ILE C CA  1 
ATOM   1328 C C   . ILE C 3 15 ? 57.226  52.969 52.356  1.00 89.78  ? 24   ILE C C   1 
ATOM   1329 O O   . ILE C 3 15 ? 58.312  53.079 52.926  1.00 89.26  ? 24   ILE C O   1 
ATOM   1330 C CB  . ILE C 3 15 ? 57.340  51.073 50.862  1.00 61.41  ? 24   ILE C CB  1 
ATOM   1331 C CG1 . ILE C 3 15 ? 58.367  50.679 49.793  1.00 69.47  ? 24   ILE C CG1 1 
ATOM   1332 C CG2 . ILE C 3 15 ? 55.970  50.441 50.665  1.00 44.81  ? 24   ILE C CG2 1 
ATOM   1333 C CD1 . ILE C 3 15 ? 57.951  51.009 48.351  1.00 85.25  ? 24   ILE C CD1 1 
ATOM   1334 N N   . THR C 3 16 ? 56.043  53.147 52.945  1.00 105.21 ? 25   THR C N   1 
ATOM   1335 C CA  . THR C 3 16 ? 55.878  53.523 54.351  1.00 120.39 ? 25   THR C CA  1 
ATOM   1336 C C   . THR C 3 16 ? 57.183  53.519 55.147  1.00 132.03 ? 25   THR C C   1 
ATOM   1337 O O   . THR C 3 16 ? 57.502  52.538 55.829  1.00 138.08 ? 25   THR C O   1 
ATOM   1338 C CB  . THR C 3 16 ? 54.859  52.591 55.067  1.00 121.09 ? 25   THR C CB  1 
ATOM   1339 O OG1 . THR C 3 16 ? 55.254  51.223 54.906  1.00 112.34 ? 25   THR C OG1 1 
ATOM   1340 C CG2 . THR C 3 16 ? 53.461  52.784 54.495  1.00 121.14 ? 25   THR C CG2 1 
ATOM   1341 N N   . ASP C 3 17 ? 57.910  54.634 55.044  1.00 135.47 ? 39   ASP C N   1 
ATOM   1342 C CA  . ASP C 3 17 ? 59.202  54.877 55.697  1.00 131.65 ? 39   ASP C CA  1 
ATOM   1343 C C   . ASP C 3 17 ? 60.224  55.176 54.606  1.00 121.85 ? 39   ASP C C   1 
ATOM   1344 O O   . ASP C 3 17 ? 60.248  54.509 53.573  1.00 112.74 ? 39   ASP C O   1 
ATOM   1345 C CB  . ASP C 3 17 ? 59.667  53.667 56.522  1.00 138.64 ? 39   ASP C CB  1 
ATOM   1346 C CG  . ASP C 3 17 ? 60.934  53.949 57.310  1.00 141.76 ? 39   ASP C CG  1 
ATOM   1347 O OD1 . ASP C 3 17 ? 60.935  54.896 58.131  1.00 147.50 ? 39   ASP C OD1 1 
ATOM   1348 O OD2 . ASP C 3 17 ? 61.927  53.219 57.108  1.00 139.40 ? 39   ASP C OD2 1 
ATOM   1349 N N   . PRO C 3 18 ? 61.081  56.187 54.829  1.00 119.20 ? 40   PRO C N   1 
ATOM   1350 C CA  . PRO C 3 18 ? 62.130  56.635 53.906  1.00 117.68 ? 40   PRO C CA  1 
ATOM   1351 C C   . PRO C 3 18 ? 62.825  55.611 52.997  1.00 115.02 ? 40   PRO C C   1 
ATOM   1352 O O   . PRO C 3 18 ? 63.902  55.897 52.474  1.00 116.94 ? 40   PRO C O   1 
ATOM   1353 C CB  . PRO C 3 18 ? 63.122  57.367 54.831  1.00 118.37 ? 40   PRO C CB  1 
ATOM   1354 C CG  . PRO C 3 18 ? 62.686  56.994 56.258  1.00 117.24 ? 40   PRO C CG  1 
ATOM   1355 C CD  . PRO C 3 18 ? 61.202  56.901 56.112  1.00 118.64 ? 40   PRO C CD  1 
ATOM   1356 N N   . LYS C 3 19 ? 62.223  54.440 52.790  1.00 106.80 ? 41   LYS C N   1 
ATOM   1357 C CA  . LYS C 3 19 ? 62.821  53.425 51.925  1.00 98.44  ? 41   LYS C CA  1 
ATOM   1358 C C   . LYS C 3 19 ? 62.409  53.594 50.463  1.00 92.81  ? 41   LYS C C   1 
ATOM   1359 O O   . LYS C 3 19 ? 61.220  53.599 50.118  1.00 81.87  ? 41   LYS C O   1 
ATOM   1360 C CB  . LYS C 3 19 ? 62.468  52.023 52.411  1.00 95.72  ? 41   LYS C CB  1 
ATOM   1361 C CG  . LYS C 3 19 ? 61.000  51.784 52.607  1.00 89.00  ? 41   LYS C CG  1 
ATOM   1362 C CD  . LYS C 3 19 ? 60.758  50.325 52.894  1.00 84.45  ? 41   LYS C CD  1 
ATOM   1363 C CE  . LYS C 3 19 ? 59.454  50.147 53.620  1.00 97.77  ? 41   LYS C CE  1 
ATOM   1364 N NZ  . LYS C 3 19 ? 59.481  50.916 54.898  1.00 99.53  ? 41   LYS C NZ  1 
ATOM   1365 N N   . VAL C 3 20 ? 63.419  53.736 49.612  1.00 97.39  ? 42   VAL C N   1 
ATOM   1366 C CA  . VAL C 3 20 ? 63.225  53.939 48.185  1.00 101.47 ? 42   VAL C CA  1 
ATOM   1367 C C   . VAL C 3 20 ? 63.968  52.872 47.390  1.00 100.69 ? 42   VAL C C   1 
ATOM   1368 O O   . VAL C 3 20 ? 65.160  52.642 47.596  1.00 106.99 ? 42   VAL C O   1 
ATOM   1369 C CB  . VAL C 3 20 ? 63.744  55.333 47.765  1.00 103.04 ? 42   VAL C CB  1 
ATOM   1370 C CG1 . VAL C 3 20 ? 63.413  55.608 46.324  1.00 107.23 ? 42   VAL C CG1 1 
ATOM   1371 C CG2 . VAL C 3 20 ? 63.128  56.388 48.640  1.00 103.58 ? 42   VAL C CG2 1 
ATOM   1372 N N   . TYR C 3 21 ? 63.258  52.232 46.471  1.00 94.77  ? 43   TYR C N   1 
ATOM   1373 C CA  . TYR C 3 21 ? 63.846  51.185 45.651  1.00 89.71  ? 43   TYR C CA  1 
ATOM   1374 C C   . TYR C 3 21 ? 63.751  51.509 44.173  1.00 89.26  ? 43   TYR C C   1 
ATOM   1375 O O   . TYR C 3 21 ? 62.705  51.940 43.693  1.00 91.76  ? 43   TYR C O   1 
ATOM   1376 C CB  . TYR C 3 21 ? 63.125  49.863 45.886  1.00 90.11  ? 43   TYR C CB  1 
ATOM   1377 C CG  . TYR C 3 21 ? 62.927  49.514 47.336  1.00 89.73  ? 43   TYR C CG  1 
ATOM   1378 C CD1 . TYR C 3 21 ? 62.007  50.207 48.117  1.00 90.51  ? 43   TYR C CD1 1 
ATOM   1379 C CD2 . TYR C 3 21 ? 63.657  48.483 47.928  1.00 97.38  ? 43   TYR C CD2 1 
ATOM   1380 C CE1 . TYR C 3 21 ? 61.813  49.886 49.447  1.00 98.67  ? 43   TYR C CE1 1 
ATOM   1381 C CE2 . TYR C 3 21 ? 63.476  48.153 49.259  1.00 104.72 ? 43   TYR C CE2 1 
ATOM   1382 C CZ  . TYR C 3 21 ? 62.550  48.859 50.014  1.00 108.23 ? 43   TYR C CZ  1 
ATOM   1383 O OH  . TYR C 3 21 ? 62.353  48.535 51.336  1.00 118.19 ? 43   TYR C OH  1 
ATOM   1384 N N   . PRO C 3 22 ? 64.842  51.299 43.425  1.00 92.46  ? 44   PRO C N   1 
ATOM   1385 C CA  . PRO C 3 22 ? 64.817  51.581 41.988  1.00 92.17  ? 44   PRO C CA  1 
ATOM   1386 C C   . PRO C 3 22 ? 63.799  50.661 41.322  1.00 83.51  ? 44   PRO C C   1 
ATOM   1387 O O   . PRO C 3 22 ? 63.450  49.610 41.870  1.00 71.03  ? 44   PRO C O   1 
ATOM   1388 C CB  . PRO C 3 22 ? 66.249  51.298 41.554  1.00 103.42 ? 44   PRO C CB  1 
ATOM   1389 C CG  . PRO C 3 22 ? 66.682  50.230 42.525  1.00 106.17 ? 44   PRO C CG  1 
ATOM   1390 C CD  . PRO C 3 22 ? 66.146  50.754 43.833  1.00 100.88 ? 44   PRO C CD  1 
ATOM   1391 N N   . ILE C 3 23 ? 63.339  51.046 40.139  1.00 81.20  ? 45   ILE C N   1 
ATOM   1392 C CA  . ILE C 3 23 ? 62.318  50.276 39.449  1.00 77.84  ? 45   ILE C CA  1 
ATOM   1393 C C   . ILE C 3 23 ? 62.805  49.485 38.233  1.00 77.83  ? 45   ILE C C   1 
ATOM   1394 O O   . ILE C 3 23 ? 63.572  49.991 37.406  1.00 81.92  ? 45   ILE C O   1 
ATOM   1395 C CB  . ILE C 3 23 ? 61.156  51.219 39.028  1.00 72.66  ? 45   ILE C CB  1 
ATOM   1396 C CG1 . ILE C 3 23 ? 60.820  52.173 40.189  1.00 62.66  ? 45   ILE C CG1 1 
ATOM   1397 C CG2 . ILE C 3 23 ? 59.928  50.396 38.641  1.00 59.66  ? 45   ILE C CG2 1 
ATOM   1398 C CD1 . ILE C 3 23 ? 60.025  53.415 39.796  1.00 51.75  ? 45   ILE C CD1 1 
ATOM   1399 N N   . ILE C 3 24 ? 62.352  48.235 38.148  1.00 73.91  ? 46   ILE C N   1 
ATOM   1400 C CA  . ILE C 3 24 ? 62.689  47.339 37.042  1.00 78.48  ? 46   ILE C CA  1 
ATOM   1401 C C   . ILE C 3 24 ? 61.380  46.956 36.339  1.00 83.02  ? 46   ILE C C   1 
ATOM   1402 O O   . ILE C 3 24 ? 60.378  46.645 36.997  1.00 89.87  ? 46   ILE C O   1 
ATOM   1403 C CB  . ILE C 3 24 ? 63.413  46.068 37.555  1.00 75.24  ? 46   ILE C CB  1 
ATOM   1404 C CG1 . ILE C 3 24 ? 64.648  46.470 38.361  1.00 72.79  ? 46   ILE C CG1 1 
ATOM   1405 C CG2 . ILE C 3 24 ? 63.839  45.190 36.379  1.00 59.77  ? 46   ILE C CG2 1 
ATOM   1406 C CD1 . ILE C 3 24 ? 65.612  47.361 37.587  1.00 70.20  ? 46   ILE C CD1 1 
ATOM   1407 N N   . LEU C 3 25 ? 61.387  46.958 35.007  1.00 79.93  ? 47   LEU C N   1 
ATOM   1408 C CA  . LEU C 3 25 ? 60.164  46.672 34.266  1.00 78.54  ? 47   LEU C CA  1 
ATOM   1409 C C   . LEU C 3 25 ? 60.180  45.445 33.360  1.00 73.07  ? 47   LEU C C   1 
ATOM   1410 O O   . LEU C 3 25 ? 61.032  45.311 32.485  1.00 66.43  ? 47   LEU C O   1 
ATOM   1411 C CB  . LEU C 3 25 ? 59.800  47.918 33.462  1.00 81.74  ? 47   LEU C CB  1 
ATOM   1412 C CG  . LEU C 3 25 ? 60.124  49.200 34.252  1.00 73.91  ? 47   LEU C CG  1 
ATOM   1413 C CD1 . LEU C 3 25 ? 60.062  50.411 33.348  1.00 74.87  ? 47   LEU C CD1 1 
ATOM   1414 C CD2 . LEU C 3 25 ? 59.163  49.339 35.428  1.00 64.94  ? 47   LEU C CD2 1 
ATOM   1415 N N   . ARG C 3 26 ? 59.213  44.561 33.581  1.00 80.35  ? 48   ARG C N   1 
ATOM   1416 C CA  . ARG C 3 26 ? 59.066  43.328 32.804  1.00 98.69  ? 48   ARG C CA  1 
ATOM   1417 C C   . ARG C 3 26 ? 58.088  43.642 31.704  1.00 105.62 ? 48   ARG C C   1 
ATOM   1418 O O   . ARG C 3 26 ? 57.330  42.775 31.250  1.00 102.75 ? 48   ARG C O   1 
ATOM   1419 C CB  . ARG C 3 26 ? 58.468  42.223 33.665  1.00 115.13 ? 48   ARG C CB  1 
ATOM   1420 C CG  . ARG C 3 26 ? 59.030  42.189 35.060  1.00 131.56 ? 48   ARG C CG  1 
ATOM   1421 C CD  . ARG C 3 26 ? 59.404  40.779 35.459  1.00 140.75 ? 48   ARG C CD  1 
ATOM   1422 N NE  . ARG C 3 26 ? 60.209  40.083 34.448  1.00 143.57 ? 48   ARG C NE  1 
ATOM   1423 C CZ  . ARG C 3 26 ? 61.171  40.635 33.707  1.00 139.69 ? 48   ARG C CZ  1 
ATOM   1424 N NH1 . ARG C 3 26 ? 61.473  41.920 33.835  1.00 136.45 ? 48   ARG C NH1 1 
ATOM   1425 N NH2 . ARG C 3 26 ? 61.852  39.890 32.844  1.00 136.12 ? 48   ARG C NH2 1 
ATOM   1426 N N   . LEU C 3 27 ? 58.113  44.907 31.305  1.00 114.77 ? 49   LEU C N   1 
ATOM   1427 C CA  . LEU C 3 27 ? 57.235  45.439 30.283  1.00 124.14 ? 49   LEU C CA  1 
ATOM   1428 C C   . LEU C 3 27 ? 56.721  44.429 29.256  1.00 133.08 ? 49   LEU C C   1 
ATOM   1429 O O   . LEU C 3 27 ? 57.457  43.963 28.384  1.00 137.75 ? 49   LEU C O   1 
ATOM   1430 C CB  . LEU C 3 27 ? 57.917  46.631 29.589  1.00 115.81 ? 49   LEU C CB  1 
ATOM   1431 C CG  . LEU C 3 27 ? 59.123  46.443 28.666  1.00 111.21 ? 49   LEU C CG  1 
ATOM   1432 C CD1 . LEU C 3 27 ? 59.928  45.187 29.037  1.00 100.82 ? 49   LEU C CD1 1 
ATOM   1433 C CD2 . LEU C 3 27 ? 58.607  46.355 27.237  1.00 112.91 ? 49   LEU C CD2 1 
ATOM   1434 N N   . GLY C 3 28 ? 55.449  44.070 29.413  1.00 138.56 ? 50   GLY C N   1 
ATOM   1435 C CA  . GLY C 3 28 ? 54.786  43.171 28.487  1.00 138.60 ? 50   GLY C CA  1 
ATOM   1436 C C   . GLY C 3 28 ? 54.043  44.151 27.599  1.00 139.32 ? 50   GLY C C   1 
ATOM   1437 O O   . GLY C 3 28 ? 53.628  43.841 26.481  1.00 137.75 ? 50   GLY C O   1 
ATOM   1438 N N   . SER C 3 29 ? 53.900  45.361 28.143  1.00 139.30 ? 51   SER C N   1 
ATOM   1439 C CA  . SER C 3 29 ? 53.248  46.498 27.495  1.00 135.76 ? 51   SER C CA  1 
ATOM   1440 C C   . SER C 3 29 ? 54.244  47.657 27.588  1.00 140.34 ? 51   SER C C   1 
ATOM   1441 O O   . SER C 3 29 ? 55.319  47.506 28.177  1.00 146.06 ? 51   SER C O   1 
ATOM   1442 C CB  . SER C 3 29 ? 51.977  46.890 28.252  1.00 123.92 ? 51   SER C CB  1 
ATOM   1443 O OG  . SER C 3 29 ? 51.550  45.844 29.102  1.00 116.46 ? 51   SER C OG  1 
ATOM   1444 N N   . ASN C 3 30 ? 53.905  48.805 27.009  1.00 138.35 ? 52   ASN C N   1 
ATOM   1445 C CA  . ASN C 3 30 ? 54.798  49.953 27.097  1.00 134.36 ? 52   ASN C CA  1 
ATOM   1446 C C   . ASN C 3 30 ? 54.091  51.059 27.857  1.00 128.48 ? 52   ASN C C   1 
ATOM   1447 O O   . ASN C 3 30 ? 53.579  52.013 27.276  1.00 134.42 ? 52   ASN C O   1 
ATOM   1448 C CB  . ASN C 3 30 ? 55.222  50.450 25.716  1.00 138.81 ? 52   ASN C CB  1 
ATOM   1449 C CG  . ASN C 3 30 ? 56.444  51.349 25.783  1.00 145.49 ? 52   ASN C CG  1 
ATOM   1450 O OD1 . ASN C 3 30 ? 56.426  52.382 26.455  1.00 144.41 ? 52   ASN C OD1 1 
ATOM   1451 N ND2 . ASN C 3 30 ? 57.519  50.953 25.100  1.00 150.20 ? 52   ASN C ND2 1 
ATOM   1452 N N   . LEU C 3 31 ? 54.069  50.899 29.174  1.00 119.12 ? 53   LEU C N   1 
ATOM   1453 C CA  . LEU C 3 31 ? 53.432  51.836 30.082  1.00 106.58 ? 53   LEU C CA  1 
ATOM   1454 C C   . LEU C 3 31 ? 53.719  53.303 29.825  1.00 99.81  ? 53   LEU C C   1 
ATOM   1455 O O   . LEU C 3 31 ? 54.813  53.690 29.409  1.00 97.98  ? 53   LEU C O   1 
ATOM   1456 C CB  . LEU C 3 31 ? 53.811  51.494 31.521  1.00 102.78 ? 53   LEU C CB  1 
ATOM   1457 C CG  . LEU C 3 31 ? 52.843  50.629 32.330  1.00 96.42  ? 53   LEU C CG  1 
ATOM   1458 C CD1 . LEU C 3 31 ? 52.471  49.360 31.586  1.00 91.17  ? 53   LEU C CD1 1 
ATOM   1459 C CD2 . LEU C 3 31 ? 53.499  50.313 33.658  1.00 89.62  ? 53   LEU C CD2 1 
ATOM   1460 N N   . SER C 3 32 ? 52.705  54.112 30.087  1.00 92.38  ? 54   SER C N   1 
ATOM   1461 C CA  . SER C 3 32 ? 52.799  55.545 29.924  1.00 84.88  ? 54   SER C CA  1 
ATOM   1462 C C   . SER C 3 32 ? 52.692  56.160 31.317  1.00 75.88  ? 54   SER C C   1 
ATOM   1463 O O   . SER C 3 32 ? 51.977  55.653 32.186  1.00 75.75  ? 54   SER C O   1 
ATOM   1464 C CB  . SER C 3 32 ? 51.653  56.035 29.032  1.00 95.94  ? 54   SER C CB  1 
ATOM   1465 O OG  . SER C 3 32 ? 51.551  57.448 29.033  1.00 105.89 ? 54   SER C OG  1 
ATOM   1466 N N   . LEU C 3 33 ? 53.422  57.240 31.540  1.00 71.28  ? 55   LEU C N   1 
ATOM   1467 C CA  . LEU C 3 33 ? 53.359  57.911 32.826  1.00 74.08  ? 55   LEU C CA  1 
ATOM   1468 C C   . LEU C 3 33 ? 53.139  59.412 32.638  1.00 75.38  ? 55   LEU C C   1 
ATOM   1469 O O   . LEU C 3 33 ? 53.774  60.041 31.782  1.00 85.56  ? 55   LEU C O   1 
ATOM   1470 C CB  . LEU C 3 33 ? 54.640  57.660 33.614  1.00 68.64  ? 55   LEU C CB  1 
ATOM   1471 C CG  . LEU C 3 33 ? 54.654  58.294 35.007  1.00 69.55  ? 55   LEU C CG  1 
ATOM   1472 C CD1 . LEU C 3 33 ? 53.390  57.929 35.805  1.00 69.60  ? 55   LEU C CD1 1 
ATOM   1473 C CD2 . LEU C 3 33 ? 55.900  57.820 35.719  1.00 52.05  ? 55   LEU C CD2 1 
ATOM   1474 N N   . SER C 3 34 ? 52.233  59.983 33.430  1.00 66.86  ? 56   SER C N   1 
ATOM   1475 C CA  . SER C 3 34 ? 51.939  61.405 33.320  1.00 59.64  ? 56   SER C CA  1 
ATOM   1476 C C   . SER C 3 34 ? 51.640  62.047 34.658  1.00 53.00  ? 56   SER C C   1 
ATOM   1477 O O   . SER C 3 34 ? 50.988  61.458 35.518  1.00 52.75  ? 56   SER C O   1 
ATOM   1478 C CB  . SER C 3 34 ? 50.758  61.622 32.360  1.00 58.97  ? 56   SER C CB  1 
ATOM   1479 O OG  . SER C 3 34 ? 49.718  60.679 32.610  1.00 63.85  ? 56   SER C OG  1 
ATOM   1480 N N   . MET C 3 35 ? 52.133  63.264 34.824  1.00 45.32  ? 57   MET C N   1 
ATOM   1481 C CA  . MET C 3 35 ? 51.915  64.017 36.045  1.00 55.59  ? 57   MET C CA  1 
ATOM   1482 C C   . MET C 3 35 ? 50.611  64.792 35.906  1.00 56.00  ? 57   MET C C   1 
ATOM   1483 O O   . MET C 3 35 ? 50.414  65.483 34.902  1.00 41.30  ? 57   MET C O   1 
ATOM   1484 C CB  . MET C 3 35 ? 53.057  65.014 36.257  1.00 65.61  ? 57   MET C CB  1 
ATOM   1485 C CG  . MET C 3 35 ? 52.847  65.975 37.426  1.00 63.82  ? 57   MET C CG  1 
ATOM   1486 S SD  . MET C 3 35 ? 52.989  65.122 38.990  1.00 57.71  ? 57   MET C SD  1 
ATOM   1487 C CE  . MET C 3 35 ? 54.791  64.980 39.043  1.00 40.87  ? 57   MET C CE  1 
ATOM   1488 N N   . ALA C 3 36 ? 49.732  64.685 36.902  1.00 60.84  ? 58   ALA C N   1 
ATOM   1489 C CA  . ALA C 3 36 ? 48.473  65.421 36.872  1.00 64.99  ? 58   ALA C CA  1 
ATOM   1490 C C   . ALA C 3 36 ? 48.461  66.499 37.971  1.00 67.82  ? 58   ALA C C   1 
ATOM   1491 O O   . ALA C 3 36 ? 49.139  66.360 38.997  1.00 62.23  ? 58   ALA C O   1 
ATOM   1492 C CB  . ALA C 3 36 ? 47.303  64.467 37.042  1.00 55.72  ? 58   ALA C CB  1 
ATOM   1493 N N   . ARG C 3 37 ? 47.701  67.574 37.730  1.00 74.92  ? 59   ARG C N   1 
ATOM   1494 C CA  . ARG C 3 37 ? 47.564  68.713 38.658  1.00 75.86  ? 59   ARG C CA  1 
ATOM   1495 C C   . ARG C 3 37 ? 46.209  69.400 38.503  1.00 72.01  ? 59   ARG C C   1 
ATOM   1496 O O   . ARG C 3 37 ? 45.720  69.580 37.383  1.00 72.64  ? 59   ARG C O   1 
ATOM   1497 C CB  . ARG C 3 37 ? 48.636  69.764 38.390  1.00 81.07  ? 59   ARG C CB  1 
ATOM   1498 C CG  . ARG C 3 37 ? 50.030  69.219 38.321  1.00 100.43 ? 59   ARG C CG  1 
ATOM   1499 C CD  . ARG C 3 37 ? 50.912  70.131 37.491  1.00 118.74 ? 59   ARG C CD  1 
ATOM   1500 N NE  . ARG C 3 37 ? 52.211  69.518 37.235  1.00 131.24 ? 59   ARG C NE  1 
ATOM   1501 C CZ  . ARG C 3 37 ? 53.217  69.512 38.101  1.00 135.65 ? 59   ARG C CZ  1 
ATOM   1502 N NH1 . ARG C 3 37 ? 53.078  70.096 39.282  1.00 141.34 ? 59   ARG C NH1 1 
ATOM   1503 N NH2 . ARG C 3 37 ? 54.356  68.910 37.792  1.00 135.84 ? 59   ARG C NH2 1 
ATOM   1504 N N   . ARG C 3 38 ? 45.619  69.810 39.623  1.00 69.70  ? 60   ARG C N   1 
ATOM   1505 C CA  . ARG C 3 38 ? 44.329  70.482 39.573  1.00 65.91  ? 60   ARG C CA  1 
ATOM   1506 C C   . ARG C 3 38 ? 44.415  71.819 38.896  1.00 72.88  ? 60   ARG C C   1 
ATOM   1507 O O   . ARG C 3 38 ? 45.392  72.553 39.038  1.00 73.12  ? 60   ARG C O   1 
ATOM   1508 C CB  . ARG C 3 38 ? 43.748  70.699 40.968  1.00 51.18  ? 60   ARG C CB  1 
ATOM   1509 C CG  . ARG C 3 38 ? 43.141  69.462 41.546  1.00 49.70  ? 60   ARG C CG  1 
ATOM   1510 C CD  . ARG C 3 38 ? 41.711  69.704 41.953  1.00 48.76  ? 60   ARG C CD  1 
ATOM   1511 N NE  . ARG C 3 38 ? 41.090  68.467 42.424  1.00 58.03  ? 60   ARG C NE  1 
ATOM   1512 C CZ  . ARG C 3 38 ? 41.489  67.791 43.503  1.00 66.13  ? 60   ARG C CZ  1 
ATOM   1513 N NH1 . ARG C 3 38 ? 42.514  68.236 44.232  1.00 62.28  ? 60   ARG C NH1 1 
ATOM   1514 N NH2 . ARG C 3 38 ? 40.867  66.667 43.854  1.00 75.48  ? 60   ARG C NH2 1 
ATOM   1515 N N   . ASN C 3 39 ? 43.372  72.119 38.144  1.00 80.96  ? 61   ASN C N   1 
ATOM   1516 C CA  . ASN C 3 39 ? 43.265  73.382 37.454  1.00 83.87  ? 61   ASN C CA  1 
ATOM   1517 C C   . ASN C 3 39 ? 42.495  74.238 38.445  1.00 77.86  ? 61   ASN C C   1 
ATOM   1518 O O   . ASN C 3 39 ? 41.262  74.278 38.420  1.00 73.05  ? 61   ASN C O   1 
ATOM   1519 C CB  . ASN C 3 39 ? 42.473  73.188 36.168  1.00 97.67  ? 61   ASN C CB  1 
ATOM   1520 C CG  . ASN C 3 39 ? 42.087  74.494 35.526  1.00 109.58 ? 61   ASN C CG  1 
ATOM   1521 O OD1 . ASN C 3 39 ? 42.908  75.399 35.397  1.00 119.52 ? 61   ASN C OD1 1 
ATOM   1522 N ND2 . ASN C 3 39 ? 40.830  74.600 35.108  1.00 110.27 ? 61   ASN C ND2 1 
ATOM   1523 N N   . LEU C 3 40 ? 43.228  74.902 39.334  1.00 76.15  ? 62   LEU C N   1 
ATOM   1524 C CA  . LEU C 3 40 ? 42.614  75.729 40.373  1.00 81.24  ? 62   LEU C CA  1 
ATOM   1525 C C   . LEU C 3 40 ? 42.518  77.222 40.056  1.00 86.86  ? 62   LEU C C   1 
ATOM   1526 O O   . LEU C 3 40 ? 42.307  78.038 40.953  1.00 89.51  ? 62   LEU C O   1 
ATOM   1527 C CB  . LEU C 3 40 ? 43.375  75.550 41.692  1.00 76.36  ? 62   LEU C CB  1 
ATOM   1528 C CG  . LEU C 3 40 ? 43.362  74.158 42.333  1.00 77.56  ? 62   LEU C CG  1 
ATOM   1529 C CD1 . LEU C 3 40 ? 44.078  74.225 43.663  1.00 82.29  ? 62   LEU C CD1 1 
ATOM   1530 C CD2 . LEU C 3 40 ? 41.932  73.675 42.538  1.00 76.33  ? 62   LEU C CD2 1 
ATOM   1531 N N   . ASP C 3 41 ? 42.637  77.577 38.783  1.00 91.15  ? 63   ASP C N   1 
ATOM   1532 C CA  . ASP C 3 41 ? 42.605  78.981 38.383  1.00 93.85  ? 63   ASP C CA  1 
ATOM   1533 C C   . ASP C 3 41 ? 41.687  79.329 37.204  1.00 93.05  ? 63   ASP C C   1 
ATOM   1534 O O   . ASP C 3 41 ? 41.541  80.502 36.841  1.00 98.29  ? 63   ASP C O   1 
ATOM   1535 C CB  . ASP C 3 41 ? 44.029  79.412 38.055  1.00 102.42 ? 63   ASP C CB  1 
ATOM   1536 C CG  . ASP C 3 41 ? 44.800  78.324 37.339  1.00 111.40 ? 63   ASP C CG  1 
ATOM   1537 O OD1 . ASP C 3 41 ? 44.347  77.890 36.259  1.00 119.10 ? 63   ASP C OD1 1 
ATOM   1538 O OD2 . ASP C 3 41 ? 45.850  77.894 37.859  1.00 118.55 ? 63   ASP C OD2 1 
ATOM   1539 N N   . SER C 3 42 ? 41.076  78.312 36.605  1.00 86.61  ? 64   SER C N   1 
ATOM   1540 C CA  . SER C 3 42 ? 40.184  78.507 35.467  1.00 70.74  ? 64   SER C CA  1 
ATOM   1541 C C   . SER C 3 42 ? 39.043  77.499 35.526  1.00 59.29  ? 64   SER C C   1 
ATOM   1542 O O   . SER C 3 42 ? 39.054  76.572 36.342  1.00 47.23  ? 64   SER C O   1 
ATOM   1543 C CB  . SER C 3 42 ? 40.966  78.330 34.159  1.00 75.13  ? 64   SER C CB  1 
ATOM   1544 O OG  . SER C 3 42 ? 40.102  78.267 33.038  1.00 88.03  ? 64   SER C OG  1 
ATOM   1545 N N   . LEU C 3 43 ? 38.052  77.678 34.670  1.00 49.11  ? 65   LEU C N   1 
ATOM   1546 C CA  . LEU C 3 43 ? 36.948  76.743 34.653  1.00 51.22  ? 65   LEU C CA  1 
ATOM   1547 C C   . LEU C 3 43 ? 36.624  76.352 33.222  1.00 59.20  ? 65   LEU C C   1 
ATOM   1548 O O   . LEU C 3 43 ? 35.590  75.731 32.938  1.00 61.25  ? 65   LEU C O   1 
ATOM   1549 C CB  . LEU C 3 43 ? 35.736  77.336 35.363  1.00 45.46  ? 65   LEU C CB  1 
ATOM   1550 C CG  . LEU C 3 43 ? 35.090  78.635 34.893  1.00 43.62  ? 65   LEU C CG  1 
ATOM   1551 C CD1 . LEU C 3 43 ? 33.992  78.961 35.927  1.00 18.73  ? 65   LEU C CD1 1 
ATOM   1552 C CD2 . LEU C 3 43 ? 36.107  79.785 34.777  1.00 49.63  ? 65   LEU C CD2 1 
ATOM   1553 N N   . GLU C 3 44 ? 37.534  76.725 32.327  1.00 62.48  ? 66   GLU C N   1 
ATOM   1554 C CA  . GLU C 3 44 ? 37.417  76.395 30.916  1.00 70.73  ? 66   GLU C CA  1 
ATOM   1555 C C   . GLU C 3 44 ? 38.463  75.325 30.618  1.00 71.04  ? 66   GLU C C   1 
ATOM   1556 O O   . GLU C 3 44 ? 38.227  74.418 29.815  1.00 74.25  ? 66   GLU C O   1 
ATOM   1557 C CB  . GLU C 3 44 ? 37.658  77.625 30.024  1.00 78.63  ? 66   GLU C CB  1 
ATOM   1558 C CG  . GLU C 3 44 ? 38.393  78.792 30.662  1.00 94.42  ? 66   GLU C CG  1 
ATOM   1559 C CD  . GLU C 3 44 ? 37.507  79.583 31.603  1.00 111.37 ? 66   GLU C CD  1 
ATOM   1560 O OE1 . GLU C 3 44 ? 36.327  79.801 31.254  1.00 119.12 ? 66   GLU C OE1 1 
ATOM   1561 O OE2 . GLU C 3 44 ? 37.987  79.996 32.682  1.00 115.77 ? 66   GLU C OE2 1 
ATOM   1562 N N   . ALA C 3 45 ? 39.608  75.434 31.289  1.00 69.68  ? 67   ALA C N   1 
ATOM   1563 C CA  . ALA C 3 45 ? 40.714  74.497 31.120  1.00 63.29  ? 67   ALA C CA  1 
ATOM   1564 C C   . ALA C 3 45 ? 40.405  73.131 31.729  1.00 59.27  ? 67   ALA C C   1 
ATOM   1565 O O   . ALA C 3 45 ? 39.446  72.987 32.488  1.00 51.36  ? 67   ALA C O   1 
ATOM   1566 C CB  . ALA C 3 45 ? 41.988  75.079 31.743  1.00 63.96  ? 67   ALA C CB  1 
ATOM   1567 N N   . ARG C 3 46 ? 41.235  72.142 31.385  1.00 69.03  ? 68   ARG C N   1 
ATOM   1568 C CA  . ARG C 3 46 ? 41.097  70.756 31.850  1.00 69.00  ? 68   ARG C CA  1 
ATOM   1569 C C   . ARG C 3 46 ? 41.054  70.597 33.375  1.00 64.30  ? 68   ARG C C   1 
ATOM   1570 O O   . ARG C 3 46 ? 41.786  71.281 34.104  1.00 58.75  ? 68   ARG C O   1 
ATOM   1571 C CB  . ARG C 3 46 ? 42.239  69.906 31.279  1.00 76.14  ? 68   ARG C CB  1 
ATOM   1572 C CG  . ARG C 3 46 ? 42.199  69.713 29.766  1.00 105.62 ? 68   ARG C CG  1 
ATOM   1573 C CD  . ARG C 3 46 ? 43.303  68.767 29.317  1.00 135.82 ? 68   ARG C CD  1 
ATOM   1574 N NE  . ARG C 3 46 ? 43.414  67.618 30.216  1.00 163.95 ? 68   ARG C NE  1 
ATOM   1575 C CZ  . ARG C 3 46 ? 44.195  66.562 30.004  1.00 179.80 ? 68   ARG C CZ  1 
ATOM   1576 N NH1 . ARG C 3 46 ? 44.945  66.495 28.913  1.00 186.65 ? 68   ARG C NH1 1 
ATOM   1577 N NH2 . ARG C 3 46 ? 44.232  65.572 30.889  1.00 184.13 ? 68   ARG C NH2 1 
ATOM   1578 N N   . ALA C 3 47 ? 40.200  69.685 33.848  1.00 54.45  ? 69   ALA C N   1 
ATOM   1579 C CA  . ALA C 3 47 ? 40.040  69.424 35.284  1.00 54.48  ? 69   ALA C CA  1 
ATOM   1580 C C   . ALA C 3 47 ? 41.404  69.298 35.986  1.00 61.26  ? 69   ALA C C   1 
ATOM   1581 O O   . ALA C 3 47 ? 41.647  69.911 37.035  1.00 53.06  ? 69   ALA C O   1 
ATOM   1582 C CB  . ALA C 3 47 ? 39.210  68.153 35.487  1.00 46.76  ? 69   ALA C CB  1 
ATOM   1583 N N   . PHE C 3 48 ? 42.274  68.480 35.395  1.00 69.03  ? 70   PHE C N   1 
ATOM   1584 C CA  . PHE C 3 48 ? 43.637  68.259 35.866  1.00 60.60  ? 70   PHE C CA  1 
ATOM   1585 C C   . PHE C 3 48 ? 44.517  68.387 34.645  1.00 62.22  ? 70   PHE C C   1 
ATOM   1586 O O   . PHE C 3 48 ? 44.198  67.869 33.568  1.00 59.63  ? 70   PHE C O   1 
ATOM   1587 C CB  . PHE C 3 48 ? 43.832  66.854 36.434  1.00 55.71  ? 70   PHE C CB  1 
ATOM   1588 C CG  . PHE C 3 48 ? 43.129  66.627 37.718  1.00 56.64  ? 70   PHE C CG  1 
ATOM   1589 C CD1 . PHE C 3 48 ? 41.741  66.533 37.758  1.00 63.65  ? 70   PHE C CD1 1 
ATOM   1590 C CD2 . PHE C 3 48 ? 43.847  66.534 38.901  1.00 57.42  ? 70   PHE C CD2 1 
ATOM   1591 C CE1 . PHE C 3 48 ? 41.073  66.345 38.963  1.00 64.78  ? 70   PHE C CE1 1 
ATOM   1592 C CE2 . PHE C 3 48 ? 43.194  66.349 40.121  1.00 55.16  ? 70   PHE C CE2 1 
ATOM   1593 C CZ  . PHE C 3 48 ? 41.801  66.254 40.151  1.00 62.18  ? 70   PHE C CZ  1 
ATOM   1594 N N   . GLN C 3 49 ? 45.621  69.087 34.799  1.00 60.18  ? 71   GLN C N   1 
ATOM   1595 C CA  . GLN C 3 49 ? 46.533  69.223 33.693  1.00 64.48  ? 71   GLN C CA  1 
ATOM   1596 C C   . GLN C 3 49 ? 47.431  67.971 33.703  1.00 65.66  ? 71   GLN C C   1 
ATOM   1597 O O   . GLN C 3 49 ? 48.066  67.661 34.713  1.00 56.38  ? 71   GLN C O   1 
ATOM   1598 C CB  . GLN C 3 49 ? 47.321  70.519 33.882  1.00 77.47  ? 71   GLN C CB  1 
ATOM   1599 C CG  . GLN C 3 49 ? 48.555  70.685 33.033  1.00 93.89  ? 71   GLN C CG  1 
ATOM   1600 C CD  . GLN C 3 49 ? 49.807  70.635 33.881  1.00 111.73 ? 71   GLN C CD  1 
ATOM   1601 O OE1 . GLN C 3 49 ? 50.243  69.561 34.306  1.00 125.24 ? 71   GLN C OE1 1 
ATOM   1602 N NE2 . GLN C 3 49 ? 50.382  71.801 34.157  1.00 112.20 ? 71   GLN C NE2 1 
ATOM   1603 N N   . SER C 3 50 ? 47.438  67.219 32.602  1.00 71.71  ? 72   SER C N   1 
ATOM   1604 C CA  . SER C 3 50 ? 48.284  66.031 32.518  1.00 74.13  ? 72   SER C CA  1 
ATOM   1605 C C   . SER C 3 50 ? 49.523  66.298 31.676  1.00 75.16  ? 72   SER C C   1 
ATOM   1606 O O   . SER C 3 50 ? 49.448  66.617 30.486  1.00 66.63  ? 72   SER C O   1 
ATOM   1607 C CB  . SER C 3 50 ? 47.539  64.838 31.925  1.00 69.59  ? 72   SER C CB  1 
ATOM   1608 O OG  . SER C 3 50 ? 48.451  63.761 31.731  1.00 69.74  ? 72   SER C OG  1 
ATOM   1609 N N   . THR C 3 51 ? 50.672  66.159 32.313  1.00 82.06  ? 73   THR C N   1 
ATOM   1610 C CA  . THR C 3 51 ? 51.926  66.383 31.640  1.00 89.11  ? 73   THR C CA  1 
ATOM   1611 C C   . THR C 3 51 ? 52.616  65.046 31.508  1.00 93.58  ? 73   THR C C   1 
ATOM   1612 O O   . THR C 3 51 ? 53.153  64.529 32.479  1.00 102.37 ? 73   THR C O   1 
ATOM   1613 C CB  . THR C 3 51 ? 52.835  67.298 32.465  1.00 95.10  ? 73   THR C CB  1 
ATOM   1614 O OG1 . THR C 3 51 ? 52.080  68.409 32.955  1.00 101.01 ? 73   THR C OG1 1 
ATOM   1615 C CG2 . THR C 3 51 ? 53.981  67.803 31.613  1.00 95.66  ? 73   THR C CG2 1 
ATOM   1616 N N   . PRO C 3 52 ? 52.583  64.447 30.315  1.00 94.92  ? 74   PRO C N   1 
ATOM   1617 C CA  . PRO C 3 52 ? 53.251  63.155 30.154  1.00 92.42  ? 74   PRO C CA  1 
ATOM   1618 C C   . PRO C 3 52 ? 54.673  63.278 30.678  1.00 88.08  ? 74   PRO C C   1 
ATOM   1619 O O   . PRO C 3 52 ? 55.333  64.292 30.458  1.00 82.21  ? 74   PRO C O   1 
ATOM   1620 C CB  . PRO C 3 52 ? 53.177  62.930 28.661  1.00 95.87  ? 74   PRO C CB  1 
ATOM   1621 C CG  . PRO C 3 52 ? 51.799  63.472 28.357  1.00 104.54 ? 74   PRO C CG  1 
ATOM   1622 C CD  . PRO C 3 52 ? 51.795  64.785 29.119  1.00 101.80 ? 74   PRO C CD  1 
ATOM   1623 N N   . ILE C 3 53 ? 55.130  62.246 31.382  1.00 94.17  ? 75   ILE C N   1 
ATOM   1624 C CA  . ILE C 3 53 ? 56.459  62.233 32.002  1.00 98.82  ? 75   ILE C CA  1 
ATOM   1625 C C   . ILE C 3 53 ? 57.501  61.322 31.327  1.00 103.87 ? 75   ILE C C   1 
ATOM   1626 O O   . ILE C 3 53 ? 57.247  60.136 31.076  1.00 102.51 ? 75   ILE C O   1 
ATOM   1627 C CB  . ILE C 3 53 ? 56.339  61.832 33.500  1.00 98.21  ? 75   ILE C CB  1 
ATOM   1628 C CG1 . ILE C 3 53 ? 55.431  62.831 34.238  1.00 106.59 ? 75   ILE C CG1 1 
ATOM   1629 C CG2 . ILE C 3 53 ? 57.713  61.767 34.139  1.00 84.93  ? 75   ILE C CG2 1 
ATOM   1630 C CD1 . ILE C 3 53 ? 54.994  62.395 35.641  1.00 106.95 ? 75   ILE C CD1 1 
ATOM   1631 N N   . VAL C 3 54 ? 58.679  61.892 31.068  1.00 107.32 ? 76   VAL C N   1 
ATOM   1632 C CA  . VAL C 3 54 ? 59.794  61.198 30.415  1.00 107.47 ? 76   VAL C CA  1 
ATOM   1633 C C   . VAL C 3 54 ? 60.584  60.236 31.313  1.00 107.41 ? 76   VAL C C   1 
ATOM   1634 O O   . VAL C 3 54 ? 61.357  60.662 32.175  1.00 108.71 ? 76   VAL C O   1 
ATOM   1635 C CB  . VAL C 3 54 ? 60.783  62.223 29.814  1.00 107.82 ? 76   VAL C CB  1 
ATOM   1636 C CG1 . VAL C 3 54 ? 61.148  63.267 30.867  1.00 105.95 ? 76   VAL C CG1 1 
ATOM   1637 C CG2 . VAL C 3 54 ? 62.033  61.510 29.301  1.00 106.99 ? 76   VAL C CG2 1 
ATOM   1638 N N   . VAL C 3 55 ? 60.402  58.937 31.097  1.00 104.78 ? 77   VAL C N   1 
ATOM   1639 C CA  . VAL C 3 55 ? 61.108  57.940 31.891  1.00 101.44 ? 77   VAL C CA  1 
ATOM   1640 C C   . VAL C 3 55 ? 62.369  57.534 31.138  1.00 108.94 ? 77   VAL C C   1 
ATOM   1641 O O   . VAL C 3 55 ? 62.301  56.946 30.051  1.00 107.58 ? 77   VAL C O   1 
ATOM   1642 C CB  . VAL C 3 55 ? 60.228  56.708 32.132  1.00 89.87  ? 77   VAL C CB  1 
ATOM   1643 C CG1 . VAL C 3 55 ? 60.863  55.827 33.177  1.00 92.02  ? 77   VAL C CG1 1 
ATOM   1644 C CG2 . VAL C 3 55 ? 58.845  57.137 32.577  1.00 71.97  ? 77   VAL C CG2 1 
ATOM   1645 N N   . GLN C 3 56 ? 63.522  57.840 31.721  1.00 114.07 ? 78   GLN C N   1 
ATOM   1646 C CA  . GLN C 3 56 ? 64.788  57.538 31.070  1.00 125.10 ? 78   GLN C CA  1 
ATOM   1647 C C   . GLN C 3 56 ? 65.327  56.127 31.335  1.00 121.87 ? 78   GLN C C   1 
ATOM   1648 O O   . GLN C 3 56 ? 66.527  55.936 31.526  1.00 128.32 ? 78   GLN C O   1 
ATOM   1649 C CB  . GLN C 3 56 ? 65.824  58.589 31.478  1.00 136.59 ? 78   GLN C CB  1 
ATOM   1650 C CG  . GLN C 3 56 ? 66.857  58.877 30.403  1.00 154.35 ? 78   GLN C CG  1 
ATOM   1651 C CD  . GLN C 3 56 ? 66.214  59.126 29.051  1.00 168.13 ? 78   GLN C CD  1 
ATOM   1652 O OE1 . GLN C 3 56 ? 65.359  60.002 28.908  1.00 170.35 ? 78   GLN C OE1 1 
ATOM   1653 N NE2 . GLN C 3 56 ? 66.619  58.349 28.050  1.00 174.87 ? 78   GLN C NE2 1 
ATOM   1654 N N   . MET C 3 57 ? 64.448  55.135 31.314  1.00 112.54 ? 79   MET C N   1 
ATOM   1655 C CA  . MET C 3 57 ? 64.856  53.759 31.574  1.00 99.47  ? 79   MET C CA  1 
ATOM   1656 C C   . MET C 3 57 ? 65.898  53.180 30.615  1.00 94.81  ? 79   MET C C   1 
ATOM   1657 O O   . MET C 3 57 ? 65.945  53.519 29.430  1.00 93.71  ? 79   MET C O   1 
ATOM   1658 C CB  . MET C 3 57 ? 63.628  52.852 31.603  1.00 89.79  ? 79   MET C CB  1 
ATOM   1659 C CG  . MET C 3 57 ? 62.660  53.120 30.496  1.00 78.99  ? 79   MET C CG  1 
ATOM   1660 S SD  . MET C 3 57 ? 61.634  51.712 30.320  1.00 82.08  ? 79   MET C SD  1 
ATOM   1661 C CE  . MET C 3 57 ? 62.506  50.884 28.974  1.00 101.46 ? 79   MET C CE  1 
ATOM   1662 N N   . THR C 3 58 ? 66.717  52.282 31.159  1.00 92.74  ? 80   THR C N   1 
ATOM   1663 C CA  . THR C 3 58 ? 67.796  51.603 30.439  1.00 83.63  ? 80   THR C CA  1 
ATOM   1664 C C   . THR C 3 58 ? 67.543  50.111 30.240  1.00 84.65  ? 80   THR C C   1 
ATOM   1665 O O   . THR C 3 58 ? 67.075  49.431 31.151  1.00 93.46  ? 80   THR C O   1 
ATOM   1666 C CB  . THR C 3 58 ? 69.092  51.690 31.217  1.00 72.47  ? 80   THR C CB  1 
ATOM   1667 O OG1 . THR C 3 58 ? 69.371  53.060 31.522  1.00 83.47  ? 80   THR C OG1 1 
ATOM   1668 C CG2 . THR C 3 58 ? 70.221  51.081 30.416  1.00 64.82  ? 80   THR C CG2 1 
ATOM   1669 N N   . LYS C 3 59 ? 67.880  49.585 29.069  1.00 80.02  ? 81   LYS C N   1 
ATOM   1670 C CA  . LYS C 3 59 ? 67.676  48.162 28.851  1.00 83.23  ? 81   LYS C CA  1 
ATOM   1671 C C   . LYS C 3 59 ? 68.915  47.424 29.335  1.00 85.13  ? 81   LYS C C   1 
ATOM   1672 O O   . LYS C 3 59 ? 70.032  47.770 28.963  1.00 84.50  ? 81   LYS C O   1 
ATOM   1673 C CB  . LYS C 3 59 ? 67.429  47.880 27.379  1.00 82.20  ? 81   LYS C CB  1 
ATOM   1674 C CG  . LYS C 3 59 ? 66.945  46.462 27.088  1.00 78.78  ? 81   LYS C CG  1 
ATOM   1675 C CD  . LYS C 3 59 ? 68.099  45.499 26.962  1.00 94.57  ? 81   LYS C CD  1 
ATOM   1676 C CE  . LYS C 3 59 ? 67.661  44.188 26.317  1.00 105.57 ? 81   LYS C CE  1 
ATOM   1677 N NZ  . LYS C 3 59 ? 68.814  43.247 26.119  1.00 109.37 ? 81   LYS C NZ  1 
ATOM   1678 N N   . LEU C 3 60 ? 68.711  46.411 30.172  1.00 87.52  ? 82   LEU C N   1 
ATOM   1679 C CA  . LEU C 3 60 ? 69.816  45.644 30.740  1.00 85.77  ? 82   LEU C CA  1 
ATOM   1680 C C   . LEU C 3 60 ? 70.287  44.430 29.968  1.00 89.46  ? 82   LEU C C   1 
ATOM   1681 O O   . LEU C 3 60 ? 69.497  43.708 29.362  1.00 94.82  ? 82   LEU C O   1 
ATOM   1682 C CB  . LEU C 3 60 ? 69.471  45.191 32.153  1.00 74.19  ? 82   LEU C CB  1 
ATOM   1683 C CG  . LEU C 3 60 ? 69.537  46.267 33.220  1.00 59.37  ? 82   LEU C CG  1 
ATOM   1684 C CD1 . LEU C 3 60 ? 69.568  45.599 34.569  1.00 54.37  ? 82   LEU C CD1 1 
ATOM   1685 C CD2 . LEU C 3 60 ? 70.799  47.092 33.029  1.00 65.71  ? 82   LEU C CD2 1 
ATOM   1686 N N   . ALA C 3 61 ? 71.593  44.199 30.025  1.00 90.28  ? 83   ALA C N   1 
ATOM   1687 C CA  . ALA C 3 61 ? 72.203  43.062 29.353  1.00 93.96  ? 83   ALA C CA  1 
ATOM   1688 C C   . ALA C 3 61 ? 72.590  42.012 30.397  1.00 97.59  ? 83   ALA C C   1 
ATOM   1689 O O   . ALA C 3 61 ? 72.351  40.808 30.219  1.00 92.02  ? 83   ALA C O   1 
ATOM   1690 C CB  . ALA C 3 61 ? 73.434  43.518 28.581  1.00 96.83  ? 83   ALA C CB  1 
ATOM   1691 N N   . THR C 3 62 ? 73.186  42.484 31.491  1.00 105.19 ? 84   THR C N   1 
ATOM   1692 C CA  . THR C 3 62 ? 73.613  41.605 32.576  1.00 106.84 ? 84   THR C CA  1 
ATOM   1693 C C   . THR C 3 62 ? 72.911  41.882 33.912  1.00 100.89 ? 84   THR C C   1 
ATOM   1694 O O   . THR C 3 62 ? 72.566  43.026 34.238  1.00 97.60  ? 84   THR C O   1 
ATOM   1695 C CB  . THR C 3 62 ? 75.139  41.687 32.791  1.00 115.72 ? 84   THR C CB  1 
ATOM   1696 O OG1 . THR C 3 62 ? 75.517  40.840 33.887  1.00 125.57 ? 84   THR C OG1 1 
ATOM   1697 C CG2 . THR C 3 62 ? 75.563  43.128 33.068  1.00 108.78 ? 84   THR C CG2 1 
ATOM   1698 N N   . THR C 3 63 ? 72.719  40.810 34.677  1.00 95.64  ? 85   THR C N   1 
ATOM   1699 C CA  . THR C 3 63 ? 72.053  40.850 35.975  1.00 86.58  ? 85   THR C CA  1 
ATOM   1700 C C   . THR C 3 63 ? 72.962  41.415 37.062  1.00 80.79  ? 85   THR C C   1 
ATOM   1701 O O   . THR C 3 63 ? 72.545  41.613 38.198  1.00 70.53  ? 85   THR C O   1 
ATOM   1702 C CB  . THR C 3 63 ? 71.585  39.413 36.371  1.00 86.84  ? 85   THR C CB  1 
ATOM   1703 O OG1 . THR C 3 63 ? 70.225  39.458 36.811  1.00 97.81  ? 85   THR C OG1 1 
ATOM   1704 C CG2 . THR C 3 63 ? 72.457  38.825 37.484  1.00 79.67  ? 85   THR C CG2 1 
ATOM   1705 N N   . GLU C 3 64 ? 74.206  41.677 36.690  1.00 91.79  ? 86   GLU C N   1 
ATOM   1706 C CA  . GLU C 3 64 ? 75.201  42.189 37.616  1.00 108.60 ? 86   GLU C CA  1 
ATOM   1707 C C   . GLU C 3 64 ? 75.193  43.708 37.711  1.00 110.23 ? 86   GLU C C   1 
ATOM   1708 O O   . GLU C 3 64 ? 75.833  44.284 38.592  1.00 107.10 ? 86   GLU C O   1 
ATOM   1709 C CB  . GLU C 3 64 ? 76.582  41.697 37.188  1.00 125.08 ? 86   GLU C CB  1 
ATOM   1710 C CG  . GLU C 3 64 ? 77.682  41.916 38.209  1.00 146.20 ? 86   GLU C CG  1 
ATOM   1711 C CD  . GLU C 3 64 ? 78.958  41.181 37.839  1.00 161.90 ? 86   GLU C CD  1 
ATOM   1712 O OE1 . GLU C 3 64 ? 79.530  41.485 36.772  1.00 173.11 ? 86   GLU C OE1 1 
ATOM   1713 O OE2 . GLU C 3 64 ? 79.386  40.294 38.610  1.00 163.00 ? 86   GLU C OE2 1 
ATOM   1714 N N   . GLU C 3 65 ? 74.475  44.351 36.796  1.00 115.99 ? 87   GLU C N   1 
ATOM   1715 C CA  . GLU C 3 65 ? 74.363  45.808 36.784  1.00 118.52 ? 87   GLU C CA  1 
ATOM   1716 C C   . GLU C 3 65 ? 73.384  46.198 37.899  1.00 116.83 ? 87   GLU C C   1 
ATOM   1717 O O   . GLU C 3 65 ? 73.360  47.341 38.362  1.00 114.03 ? 87   GLU C O   1 
ATOM   1718 C CB  . GLU C 3 65 ? 73.836  46.289 35.414  1.00 126.65 ? 87   GLU C CB  1 
ATOM   1719 C CG  . GLU C 3 65 ? 74.775  46.015 34.216  1.00 129.13 ? 87   GLU C CG  1 
ATOM   1720 C CD  . GLU C 3 65 ? 74.150  46.333 32.848  1.00 131.58 ? 87   GLU C CD  1 
ATOM   1721 O OE1 . GLU C 3 65 ? 73.682  47.474 32.642  1.00 136.72 ? 87   GLU C OE1 1 
ATOM   1722 O OE2 . GLU C 3 65 ? 74.138  45.443 31.970  1.00 125.99 ? 87   GLU C OE2 1 
ATOM   1723 N N   . LEU C 3 66 ? 72.603  45.209 38.331  1.00 115.81 ? 88   LEU C N   1 
ATOM   1724 C CA  . LEU C 3 66 ? 71.583  45.355 39.366  1.00 107.45 ? 88   LEU C CA  1 
ATOM   1725 C C   . LEU C 3 66 ? 72.088  45.428 40.799  1.00 110.70 ? 88   LEU C C   1 
ATOM   1726 O O   . LEU C 3 66 ? 73.267  45.214 41.071  1.00 114.30 ? 88   LEU C O   1 
ATOM   1727 C CB  . LEU C 3 66 ? 70.602  44.191 39.279  1.00 89.22  ? 88   LEU C CB  1 
ATOM   1728 C CG  . LEU C 3 66 ? 69.867  44.049 37.956  1.00 84.99  ? 88   LEU C CG  1 
ATOM   1729 C CD1 . LEU C 3 66 ? 68.907  42.877 38.028  1.00 87.45  ? 88   LEU C CD1 1 
ATOM   1730 C CD2 . LEU C 3 66 ? 69.117  45.334 37.671  1.00 92.50  ? 88   LEU C CD2 1 
ATOM   1731 N N   . PRO C 3 67 ? 71.181  45.740 41.741  1.00 115.53 ? 89   PRO C N   1 
ATOM   1732 C CA  . PRO C 3 67 ? 71.522  45.836 43.161  1.00 112.53 ? 89   PRO C CA  1 
ATOM   1733 C C   . PRO C 3 67 ? 70.944  44.649 43.936  1.00 106.39 ? 89   PRO C C   1 
ATOM   1734 O O   . PRO C 3 67 ? 70.275  43.770 43.365  1.00 94.96  ? 89   PRO C O   1 
ATOM   1735 C CB  . PRO C 3 67 ? 70.873  47.146 43.564  1.00 116.38 ? 89   PRO C CB  1 
ATOM   1736 C CG  . PRO C 3 67 ? 69.553  47.047 42.841  1.00 121.03 ? 89   PRO C CG  1 
ATOM   1737 C CD  . PRO C 3 67 ? 69.925  46.470 41.469  1.00 119.18 ? 89   PRO C CD  1 
ATOM   1738 N N   . ASP C 3 68 ? 71.201  44.638 45.241  1.00 102.50 ? 90   ASP C N   1 
ATOM   1739 C CA  . ASP C 3 68 ? 70.716  43.574 46.106  1.00 101.57 ? 90   ASP C CA  1 
ATOM   1740 C C   . ASP C 3 68 ? 69.199  43.636 46.237  1.00 95.68  ? 90   ASP C C   1 
ATOM   1741 O O   . ASP C 3 68 ? 68.519  42.628 46.067  1.00 86.76  ? 90   ASP C O   1 
ATOM   1742 C CB  . ASP C 3 68 ? 71.377  43.677 47.489  1.00 109.96 ? 90   ASP C CB  1 
ATOM   1743 C CG  . ASP C 3 68 ? 72.780  43.060 47.524  1.00 109.49 ? 90   ASP C CG  1 
ATOM   1744 O OD1 . ASP C 3 68 ? 73.489  43.094 46.488  1.00 105.66 ? 90   ASP C OD1 1 
ATOM   1745 O OD2 . ASP C 3 68 ? 73.176  42.551 48.601  1.00 103.62 ? 90   ASP C OD2 1 
ATOM   1746 N N   . GLU C 3 69 ? 68.672  44.822 46.525  1.00 93.71  ? 91   GLU C N   1 
ATOM   1747 C CA  . GLU C 3 69 ? 67.229  45.001 46.673  1.00 84.81  ? 91   GLU C CA  1 
ATOM   1748 C C   . GLU C 3 69 ? 66.652  46.027 45.698  1.00 72.74  ? 91   GLU C C   1 
ATOM   1749 O O   . GLU C 3 69 ? 67.232  47.098 45.497  1.00 60.52  ? 91   GLU C O   1 
ATOM   1750 C CB  . GLU C 3 69 ? 66.905  45.396 48.117  1.00 94.21  ? 91   GLU C CB  1 
ATOM   1751 C CG  . GLU C 3 69 ? 66.967  44.216 49.079  1.00 103.63 ? 91   GLU C CG  1 
ATOM   1752 C CD  . GLU C 3 69 ? 66.798  44.618 50.525  1.00 107.06 ? 91   GLU C CD  1 
ATOM   1753 O OE1 . GLU C 3 69 ? 65.909  45.450 50.814  1.00 103.98 ? 91   GLU C OE1 1 
ATOM   1754 O OE2 . GLU C 3 69 ? 67.550  44.088 51.373  1.00 110.06 ? 91   GLU C OE2 1 
ATOM   1755 N N   . PHE C 3 70 ? 65.516  45.684 45.088  1.00 70.45  ? 92   PHE C N   1 
ATOM   1756 C CA  . PHE C 3 70 ? 64.832  46.563 44.131  1.00 65.99  ? 92   PHE C CA  1 
ATOM   1757 C C   . PHE C 3 70 ? 63.454  45.997 43.803  1.00 63.66  ? 92   PHE C C   1 
ATOM   1758 O O   . PHE C 3 70 ? 63.222  44.795 43.967  1.00 59.58  ? 92   PHE C O   1 
ATOM   1759 C CB  . PHE C 3 70 ? 65.654  46.698 42.851  1.00 62.69  ? 92   PHE C CB  1 
ATOM   1760 C CG  . PHE C 3 70 ? 65.911  45.397 42.174  1.00 66.55  ? 92   PHE C CG  1 
ATOM   1761 C CD1 . PHE C 3 70 ? 64.953  44.829 41.340  1.00 65.96  ? 92   PHE C CD1 1 
ATOM   1762 C CD2 . PHE C 3 70 ? 67.087  44.701 42.424  1.00 73.61  ? 92   PHE C CD2 1 
ATOM   1763 C CE1 . PHE C 3 70 ? 65.156  43.577 40.768  1.00 64.11  ? 92   PHE C CE1 1 
ATOM   1764 C CE2 . PHE C 3 70 ? 67.304  43.452 41.863  1.00 77.04  ? 92   PHE C CE2 1 
ATOM   1765 C CZ  . PHE C 3 70 ? 66.333  42.887 41.029  1.00 73.83  ? 92   PHE C CZ  1 
ATOM   1766 N N   . VAL C 3 71 ? 62.545  46.862 43.344  1.00 64.50  ? 93   VAL C N   1 
ATOM   1767 C CA  . VAL C 3 71 ? 61.182  46.441 43.004  1.00 64.81  ? 93   VAL C CA  1 
ATOM   1768 C C   . VAL C 3 71 ? 61.030  46.172 41.515  1.00 59.01  ? 93   VAL C C   1 
ATOM   1769 O O   . VAL C 3 71 ? 61.646  46.856 40.670  1.00 47.81  ? 93   VAL C O   1 
ATOM   1770 C CB  . VAL C 3 71 ? 60.130  47.498 43.414  1.00 75.73  ? 93   VAL C CB  1 
ATOM   1771 C CG1 . VAL C 3 71 ? 60.353  47.908 44.862  1.00 80.11  ? 93   VAL C CG1 1 
ATOM   1772 C CG2 . VAL C 3 71 ? 60.203  48.708 42.489  1.00 82.46  ? 93   VAL C CG2 1 
ATOM   1773 N N   . VAL C 3 72 ? 60.198  45.181 41.203  1.00 53.44  ? 94   VAL C N   1 
ATOM   1774 C CA  . VAL C 3 72 ? 59.969  44.795 39.822  1.00 49.45  ? 94   VAL C CA  1 
ATOM   1775 C C   . VAL C 3 72 ? 58.525  44.834 39.367  1.00 57.11  ? 94   VAL C C   1 
ATOM   1776 O O   . VAL C 3 72 ? 57.702  43.945 39.700  1.00 45.11  ? 94   VAL C O   1 
ATOM   1777 C CB  . VAL C 3 72 ? 60.472  43.394 39.551  1.00 39.72  ? 94   VAL C CB  1 
ATOM   1778 C CG1 . VAL C 3 72 ? 60.234  43.044 38.078  1.00 40.39  ? 94   VAL C CG1 1 
ATOM   1779 C CG2 . VAL C 3 72 ? 61.944  43.305 39.924  1.00 59.41  ? 94   VAL C CG2 1 
ATOM   1780 N N   . VAL C 3 73 ? 58.239  45.857 38.569  1.00 65.01  ? 95   VAL C N   1 
ATOM   1781 C CA  . VAL C 3 73 ? 56.918  46.047 38.024  1.00 71.16  ? 95   VAL C CA  1 
ATOM   1782 C C   . VAL C 3 73 ? 56.758  45.086 36.870  1.00 75.07  ? 95   VAL C C   1 
ATOM   1783 O O   . VAL C 3 73 ? 57.165  45.369 35.737  1.00 70.81  ? 95   VAL C O   1 
ATOM   1784 C CB  . VAL C 3 73 ? 56.730  47.454 37.494  1.00 70.65  ? 95   VAL C CB  1 
ATOM   1785 C CG1 . VAL C 3 73 ? 55.249  47.712 37.280  1.00 76.37  ? 95   VAL C CG1 1 
ATOM   1786 C CG2 . VAL C 3 73 ? 57.332  48.447 38.451  1.00 48.58  ? 95   VAL C CG2 1 
ATOM   1787 N N   . THR C 3 74 ? 56.190  43.932 37.180  1.00 81.59  ? 96   THR C N   1 
ATOM   1788 C CA  . THR C 3 74 ? 55.945  42.922 36.176  1.00 85.18  ? 96   THR C CA  1 
ATOM   1789 C C   . THR C 3 74 ? 54.800  43.486 35.343  1.00 87.72  ? 96   THR C C   1 
ATOM   1790 O O   . THR C 3 74 ? 53.619  43.366 35.693  1.00 77.70  ? 96   THR C O   1 
ATOM   1791 C CB  . THR C 3 74 ? 55.557  41.607 36.847  1.00 86.89  ? 96   THR C CB  1 
ATOM   1792 O OG1 . THR C 3 74 ? 56.545  41.284 37.839  1.00 81.50  ? 96   THR C OG1 1 
ATOM   1793 C CG2 . THR C 3 74 ? 55.477  40.490 35.819  1.00 91.72  ? 96   THR C CG2 1 
ATOM   1794 N N   . ALA C 3 75 ? 55.169  44.145 34.251  1.00 96.64  ? 97   ALA C N   1 
ATOM   1795 C CA  . ALA C 3 75 ? 54.192  44.761 33.369  1.00 105.08 ? 97   ALA C CA  1 
ATOM   1796 C C   . ALA C 3 75 ? 53.363  43.713 32.664  1.00 112.71 ? 97   ALA C C   1 
ATOM   1797 O O   . ALA C 3 75 ? 53.254  43.706 31.436  1.00 113.62 ? 97   ALA C O   1 
ATOM   1798 C CB  . ALA C 3 75 ? 54.889  45.646 32.354  1.00 101.43 ? 97   ALA C CB  1 
ATOM   1799 N N   . LYS C 3 76 ? 52.785  42.813 33.446  1.00 119.24 ? 98   LYS C N   1 
ATOM   1800 C CA  . LYS C 3 76 ? 51.956  41.775 32.871  1.00 127.66 ? 98   LYS C CA  1 
ATOM   1801 C C   . LYS C 3 76 ? 50.609  42.404 32.531  1.00 134.22 ? 98   LYS C C   1 
ATOM   1802 O O   . LYS C 3 76 ? 50.284  42.484 31.322  1.00 137.82 ? 98   LYS C O   1 
ATOM   1803 C CB  . LYS C 3 76 ? 51.781  40.614 33.859  1.00 123.32 ? 98   LYS C CB  1 
ATOM   1804 C CG  . LYS C 3 76 ? 51.218  41.015 35.204  1.00 120.14 ? 98   LYS C CG  1 
ATOM   1805 C CD  . LYS C 3 76 ? 50.459  39.867 35.833  1.00 114.67 ? 98   LYS C CD  1 
ATOM   1806 C CE  . LYS C 3 76 ? 49.649  40.348 37.020  1.00 115.93 ? 98   LYS C CE  1 
ATOM   1807 N NZ  . LYS C 3 76 ? 48.184  40.161 36.803  1.00 114.00 ? 98   LYS C NZ  1 
ATOM   1808 O OXT . LYS C 3 76 ? 49.908  42.832 33.475  1.00 140.18 ? 98   LYS C OXT 1 
ATOM   1809 N N   . PRO D 3 1  ? 37.398  51.967 28.445  1.00 118.90 ? 10   PRO D N   1 
ATOM   1810 C CA  . PRO D 3 1  ? 38.289  52.756 29.317  1.00 121.79 ? 10   PRO D CA  1 
ATOM   1811 C C   . PRO D 3 1  ? 38.480  52.138 30.697  1.00 124.53 ? 10   PRO D C   1 
ATOM   1812 O O   . PRO D 3 1  ? 37.740  51.239 31.100  1.00 124.22 ? 10   PRO D O   1 
ATOM   1813 C CB  . PRO D 3 1  ? 37.676  54.143 29.412  1.00 119.80 ? 10   PRO D CB  1 
ATOM   1814 C CG  . PRO D 3 1  ? 37.020  54.243 28.055  1.00 112.54 ? 10   PRO D CG  1 
ATOM   1815 C CD  . PRO D 3 1  ? 36.396  52.860 27.835  1.00 113.59 ? 10   PRO D CD  1 
ATOM   1816 N N   . PRO D 3 2  ? 39.490  52.617 31.440  1.00 126.63 ? 11   PRO D N   1 
ATOM   1817 C CA  . PRO D 3 2  ? 39.759  52.086 32.774  1.00 127.83 ? 11   PRO D CA  1 
ATOM   1818 C C   . PRO D 3 2  ? 39.166  52.910 33.910  1.00 129.72 ? 11   PRO D C   1 
ATOM   1819 O O   . PRO D 3 2  ? 38.731  54.050 33.716  1.00 131.11 ? 11   PRO D O   1 
ATOM   1820 C CB  . PRO D 3 2  ? 41.273  52.071 32.810  1.00 125.23 ? 11   PRO D CB  1 
ATOM   1821 C CG  . PRO D 3 2  ? 41.596  53.367 32.144  1.00 119.98 ? 11   PRO D CG  1 
ATOM   1822 C CD  . PRO D 3 2  ? 40.633  53.420 30.964  1.00 122.06 ? 11   PRO D CD  1 
ATOM   1823 N N   . ALA D 3 3  ? 39.155  52.311 35.096  1.00 129.50 ? 12   ALA D N   1 
ATOM   1824 C CA  . ALA D 3 3  ? 38.641  52.962 36.295  1.00 126.59 ? 12   ALA D CA  1 
ATOM   1825 C C   . ALA D 3 3  ? 39.843  53.485 37.060  1.00 119.99 ? 12   ALA D C   1 
ATOM   1826 O O   . ALA D 3 3  ? 40.860  52.802 37.156  1.00 125.60 ? 12   ALA D O   1 
ATOM   1827 C CB  . ALA D 3 3  ? 37.874  51.959 37.151  1.00 128.55 ? 12   ALA D CB  1 
ATOM   1828 N N   . LEU D 3 4  ? 39.741  54.691 37.601  1.00 106.27 ? 13   LEU D N   1 
ATOM   1829 C CA  . LEU D 3 4  ? 40.865  55.225 38.341  1.00 99.68  ? 13   LEU D CA  1 
ATOM   1830 C C   . LEU D 3 4  ? 41.057  54.491 39.647  1.00 93.83  ? 13   LEU D C   1 
ATOM   1831 O O   . LEU D 3 4  ? 40.106  54.255 40.397  1.00 90.18  ? 13   LEU D O   1 
ATOM   1832 C CB  . LEU D 3 4  ? 40.697  56.720 38.603  1.00 103.92 ? 13   LEU D CB  1 
ATOM   1833 C CG  . LEU D 3 4  ? 40.859  57.602 37.363  1.00 106.22 ? 13   LEU D CG  1 
ATOM   1834 C CD1 . LEU D 3 4  ? 41.036  59.053 37.793  1.00 103.35 ? 13   LEU D CD1 1 
ATOM   1835 C CD2 . LEU D 3 4  ? 42.068  57.142 36.558  1.00 108.01 ? 13   LEU D CD2 1 
ATOM   1836 N N   . HIS D 3 5  ? 42.306  54.136 39.910  1.00 89.46  ? 14   HIS D N   1 
ATOM   1837 C CA  . HIS D 3 5  ? 42.651  53.416 41.112  1.00 80.98  ? 14   HIS D CA  1 
ATOM   1838 C C   . HIS D 3 5  ? 43.745  54.130 41.869  1.00 79.60  ? 14   HIS D C   1 
ATOM   1839 O O   . HIS D 3 5  ? 44.819  54.409 41.339  1.00 82.46  ? 14   HIS D O   1 
ATOM   1840 C CB  . HIS D 3 5  ? 43.078  52.006 40.742  1.00 86.45  ? 14   HIS D CB  1 
ATOM   1841 C CG  . HIS D 3 5  ? 41.989  51.214 40.092  1.00 102.16 ? 14   HIS D CG  1 
ATOM   1842 N ND1 . HIS D 3 5  ? 40.837  50.851 40.757  1.00 102.94 ? 14   HIS D ND1 1 
ATOM   1843 C CD2 . HIS D 3 5  ? 41.856  50.749 38.826  1.00 105.96 ? 14   HIS D CD2 1 
ATOM   1844 C CE1 . HIS D 3 5  ? 40.042  50.199 39.928  1.00 103.97 ? 14   HIS D CE1 1 
ATOM   1845 N NE2 . HIS D 3 5  ? 40.636  50.124 38.750  1.00 102.67 ? 14   HIS D NE2 1 
ATOM   1846 N N   . LEU D 3 6  ? 43.452  54.434 43.121  1.00 80.02  ? 15   LEU D N   1 
ATOM   1847 C CA  . LEU D 3 6  ? 44.399  55.120 43.966  1.00 84.15  ? 15   LEU D CA  1 
ATOM   1848 C C   . LEU D 3 6  ? 45.305  54.144 44.708  1.00 89.28  ? 15   LEU D C   1 
ATOM   1849 O O   . LEU D 3 6  ? 44.852  53.294 45.474  1.00 95.25  ? 15   LEU D O   1 
ATOM   1850 C CB  . LEU D 3 6  ? 43.650  56.006 44.961  1.00 75.22  ? 15   LEU D CB  1 
ATOM   1851 C CG  . LEU D 3 6  ? 44.470  56.800 45.984  1.00 74.84  ? 15   LEU D CG  1 
ATOM   1852 C CD1 . LEU D 3 6  ? 44.872  55.906 47.157  1.00 81.22  ? 15   LEU D CD1 1 
ATOM   1853 C CD2 . LEU D 3 6  ? 45.686  57.419 45.298  1.00 65.16  ? 15   LEU D CD2 1 
ATOM   1854 N N   . VAL D 3 7  ? 46.597  54.263 44.468  1.00 83.02  ? 16   VAL D N   1 
ATOM   1855 C CA  . VAL D 3 7  ? 47.535  53.418 45.153  1.00 83.73  ? 16   VAL D CA  1 
ATOM   1856 C C   . VAL D 3 7  ? 47.888  54.133 46.450  1.00 86.01  ? 16   VAL D C   1 
ATOM   1857 O O   . VAL D 3 7  ? 48.560  55.173 46.442  1.00 86.07  ? 16   VAL D O   1 
ATOM   1858 C CB  . VAL D 3 7  ? 48.780  53.220 44.311  1.00 91.65  ? 16   VAL D CB  1 
ATOM   1859 C CG1 . VAL D 3 7  ? 49.815  52.436 45.094  1.00 102.66 ? 16   VAL D CG1 1 
ATOM   1860 C CG2 . VAL D 3 7  ? 48.410  52.499 43.033  1.00 86.54  ? 16   VAL D CG2 1 
ATOM   1861 N N   . ASP D 3 8  ? 47.411  53.569 47.556  1.00 86.06  ? 17   ASP D N   1 
ATOM   1862 C CA  . ASP D 3 8  ? 47.631  54.108 48.893  1.00 87.71  ? 17   ASP D CA  1 
ATOM   1863 C C   . ASP D 3 8  ? 48.994  54.720 49.087  1.00 91.44  ? 17   ASP D C   1 
ATOM   1864 O O   . ASP D 3 8  ? 49.962  54.341 48.431  1.00 94.85  ? 17   ASP D O   1 
ATOM   1865 C CB  . ASP D 3 8  ? 47.461  53.013 49.911  1.00 91.20  ? 17   ASP D CB  1 
ATOM   1866 C CG  . ASP D 3 8  ? 46.435  52.021 49.487  1.00 107.50 ? 17   ASP D CG  1 
ATOM   1867 O OD1 . ASP D 3 8  ? 46.544  51.520 48.342  1.00 109.16 ? 17   ASP D OD1 1 
ATOM   1868 O OD2 . ASP D 3 8  ? 45.524  51.748 50.290  1.00 117.40 ? 17   ASP D OD2 1 
ATOM   1869 N N   . PRO D 3 9  ? 49.090  55.663 50.026  1.00 94.93  ? 18   PRO D N   1 
ATOM   1870 C CA  . PRO D 3 9  ? 50.320  56.379 50.366  1.00 99.88  ? 18   PRO D CA  1 
ATOM   1871 C C   . PRO D 3 9  ? 51.468  55.439 50.750  1.00 102.18 ? 18   PRO D C   1 
ATOM   1872 O O   . PRO D 3 9  ? 52.641  55.822 50.715  1.00 103.24 ? 18   PRO D O   1 
ATOM   1873 C CB  . PRO D 3 9  ? 49.878  57.275 51.519  1.00 100.37 ? 18   PRO D CB  1 
ATOM   1874 C CG  . PRO D 3 9  ? 48.822  56.458 52.184  1.00 102.15 ? 18   PRO D CG  1 
ATOM   1875 C CD  . PRO D 3 9  ? 48.033  55.940 51.014  1.00 99.47  ? 18   PRO D CD  1 
ATOM   1876 N N   . GLN D 3 10 ? 51.122  54.209 51.116  1.00 101.45 ? 19   GLN D N   1 
ATOM   1877 C CA  . GLN D 3 10 ? 52.114  53.203 51.489  1.00 102.26 ? 19   GLN D CA  1 
ATOM   1878 C C   . GLN D 3 10 ? 53.174  53.100 50.385  1.00 97.62  ? 19   GLN D C   1 
ATOM   1879 O O   . GLN D 3 10 ? 54.375  53.003 50.647  1.00 88.58  ? 19   GLN D O   1 
ATOM   1880 C CB  . GLN D 3 10 ? 51.407  51.870 51.651  1.00 106.62 ? 19   GLN D CB  1 
ATOM   1881 C CG  . GLN D 3 10 ? 50.624  51.522 50.407  1.00 119.80 ? 19   GLN D CG  1 
ATOM   1882 C CD  . GLN D 3 10 ? 49.517  50.539 50.663  1.00 129.34 ? 19   GLN D CD  1 
ATOM   1883 O OE1 . GLN D 3 10 ? 48.912  50.016 49.725  1.00 135.95 ? 19   GLN D OE1 1 
ATOM   1884 N NE2 . GLN D 3 10 ? 49.233  50.282 51.937  1.00 126.75 ? 19   GLN D NE2 1 
ATOM   1885 N N   . ILE D 3 11 ? 52.704  53.132 49.142  1.00 98.59  ? 20   ILE D N   1 
ATOM   1886 C CA  . ILE D 3 11 ? 53.570  53.048 47.977  1.00 88.35  ? 20   ILE D CA  1 
ATOM   1887 C C   . ILE D 3 11 ? 53.417  54.306 47.145  1.00 86.45  ? 20   ILE D C   1 
ATOM   1888 O O   . ILE D 3 11 ? 52.316  54.635 46.688  1.00 82.86  ? 20   ILE D O   1 
ATOM   1889 C CB  . ILE D 3 11 ? 53.184  51.882 47.089  1.00 80.83  ? 20   ILE D CB  1 
ATOM   1890 C CG1 . ILE D 3 11 ? 52.873  50.661 47.955  1.00 72.88  ? 20   ILE D CG1 1 
ATOM   1891 C CG2 . ILE D 3 11 ? 54.305  51.617 46.098  1.00 69.18  ? 20   ILE D CG2 1 
ATOM   1892 C CD1 . ILE D 3 11 ? 51.709  49.835 47.441  1.00 70.62  ? 20   ILE D CD1 1 
ATOM   1893 N N   . GLN D 3 12 ? 54.526  55.001 46.938  1.00 83.15  ? 21   GLN D N   1 
ATOM   1894 C CA  . GLN D 3 12 ? 54.494  56.226 46.165  1.00 73.03  ? 21   GLN D CA  1 
ATOM   1895 C C   . GLN D 3 12 ? 55.739  56.456 45.349  1.00 63.82  ? 21   GLN D C   1 
ATOM   1896 O O   . GLN D 3 12 ? 56.852  56.153 45.771  1.00 63.68  ? 21   GLN D O   1 
ATOM   1897 C CB  . GLN D 3 12 ? 54.302  57.423 47.076  1.00 78.07  ? 21   GLN D CB  1 
ATOM   1898 C CG  . GLN D 3 12 ? 53.113  57.321 47.974  1.00 90.08  ? 21   GLN D CG  1 
ATOM   1899 C CD  . GLN D 3 12 ? 52.573  58.680 48.333  1.00 109.36 ? 21   GLN D CD  1 
ATOM   1900 O OE1 . GLN D 3 12 ? 53.316  59.672 48.375  1.00 115.23 ? 21   GLN D OE1 1 
ATOM   1901 N NE2 . GLN D 3 12 ? 51.273  58.740 48.605  1.00 112.87 ? 21   GLN D NE2 1 
ATOM   1902 N N   . LEU D 3 13 ? 55.543  57.029 44.175  1.00 65.61  ? 22   LEU D N   1 
ATOM   1903 C CA  . LEU D 3 13 ? 56.663  57.313 43.315  1.00 71.99  ? 22   LEU D CA  1 
ATOM   1904 C C   . LEU D 3 13 ? 57.514  58.402 43.933  1.00 72.34  ? 22   LEU D C   1 
ATOM   1905 O O   . LEU D 3 13 ? 57.056  59.126 44.809  1.00 78.23  ? 22   LEU D O   1 
ATOM   1906 C CB  . LEU D 3 13 ? 56.166  57.755 41.953  1.00 71.45  ? 22   LEU D CB  1 
ATOM   1907 C CG  . LEU D 3 13 ? 56.921  56.991 40.875  1.00 70.86  ? 22   LEU D CG  1 
ATOM   1908 C CD1 . LEU D 3 13 ? 56.618  55.499 40.969  1.00 64.37  ? 22   LEU D CD1 1 
ATOM   1909 C CD2 . LEU D 3 13 ? 56.513  57.530 39.542  1.00 76.04  ? 22   LEU D CD2 1 
ATOM   1910 N N   . THR D 3 14 ? 58.756  58.503 43.477  1.00 76.97  ? 23   THR D N   1 
ATOM   1911 C CA  . THR D 3 14 ? 59.685  59.512 43.972  1.00 80.65  ? 23   THR D CA  1 
ATOM   1912 C C   . THR D 3 14 ? 60.581  59.937 42.830  1.00 87.76  ? 23   THR D C   1 
ATOM   1913 O O   . THR D 3 14 ? 61.077  59.098 42.075  1.00 91.96  ? 23   THR D O   1 
ATOM   1914 C CB  . THR D 3 14 ? 60.567  58.974 45.110  1.00 73.55  ? 23   THR D CB  1 
ATOM   1915 O OG1 . THR D 3 14 ? 59.737  58.612 46.223  1.00 69.48  ? 23   THR D OG1 1 
ATOM   1916 C CG2 . THR D 3 14 ? 61.581  60.034 45.541  1.00 61.68  ? 23   THR D CG2 1 
ATOM   1917 N N   . ILE D 3 15 ? 60.791  61.240 42.703  1.00 92.57  ? 24   ILE D N   1 
ATOM   1918 C CA  . ILE D 3 15 ? 61.620  61.740 41.626  1.00 102.95 ? 24   ILE D CA  1 
ATOM   1919 C C   . ILE D 3 15 ? 62.884  62.395 42.147  1.00 115.67 ? 24   ILE D C   1 
ATOM   1920 O O   . ILE D 3 15 ? 63.085  62.500 43.357  1.00 117.70 ? 24   ILE D O   1 
ATOM   1921 C CB  . ILE D 3 15 ? 60.846  62.745 40.761  1.00 92.48  ? 24   ILE D CB  1 
ATOM   1922 C CG1 . ILE D 3 15 ? 59.401  62.265 40.584  1.00 88.66  ? 24   ILE D CG1 1 
ATOM   1923 C CG2 . ILE D 3 15 ? 61.517  62.885 39.400  1.00 93.19  ? 24   ILE D CG2 1 
ATOM   1924 C CD1 . ILE D 3 15 ? 59.257  60.815 40.142  1.00 86.67  ? 24   ILE D CD1 1 
ATOM   1925 N N   . THR D 3 16 ? 63.739  62.809 41.219  1.00 128.54 ? 25   THR D N   1 
ATOM   1926 C CA  . THR D 3 16 ? 64.994  63.466 41.548  1.00 143.34 ? 25   THR D CA  1 
ATOM   1927 C C   . THR D 3 16 ? 64.767  64.502 42.653  1.00 157.91 ? 25   THR D C   1 
ATOM   1928 O O   . THR D 3 16 ? 64.053  65.484 42.446  1.00 166.42 ? 25   THR D O   1 
ATOM   1929 C CB  . THR D 3 16 ? 65.583  64.147 40.289  1.00 139.75 ? 25   THR D CB  1 
ATOM   1930 O OG1 . THR D 3 16 ? 64.559  64.900 39.618  1.00 131.03 ? 25   THR D OG1 1 
ATOM   1931 C CG2 . THR D 3 16 ? 66.148  63.097 39.336  1.00 132.52 ? 25   THR D CG2 1 
ATOM   1932 N N   . ASP D 3 17 ? 65.379  64.273 43.818  1.00 163.44 ? 39   ASP D N   1 
ATOM   1933 C CA  . ASP D 3 17 ? 65.242  65.149 44.995  1.00 164.43 ? 39   ASP D CA  1 
ATOM   1934 C C   . ASP D 3 17 ? 63.836  64.932 45.557  1.00 160.37 ? 39   ASP D C   1 
ATOM   1935 O O   . ASP D 3 17 ? 62.843  65.164 44.871  1.00 166.61 ? 39   ASP D O   1 
ATOM   1936 C CB  . ASP D 3 17 ? 65.436  66.636 44.627  1.00 163.93 ? 39   ASP D CB  1 
ATOM   1937 C CG  . ASP D 3 17 ? 65.586  67.544 45.859  1.00 159.43 ? 39   ASP D CG  1 
ATOM   1938 O OD1 . ASP D 3 17 ? 66.684  67.584 46.460  1.00 157.29 ? 39   ASP D OD1 1 
ATOM   1939 O OD2 . ASP D 3 17 ? 64.602  68.217 46.231  1.00 155.46 ? 39   ASP D OD2 1 
ATOM   1940 N N   . PRO D 3 18 ? 63.736  64.491 46.818  1.00 149.34 ? 40   PRO D N   1 
ATOM   1941 C CA  . PRO D 3 18 ? 62.454  64.235 47.480  1.00 136.68 ? 40   PRO D CA  1 
ATOM   1942 C C   . PRO D 3 18 ? 61.206  64.932 46.927  1.00 124.66 ? 40   PRO D C   1 
ATOM   1943 O O   . PRO D 3 18 ? 60.886  66.061 47.296  1.00 122.54 ? 40   PRO D O   1 
ATOM   1944 C CB  . PRO D 3 18 ? 62.735  64.601 48.943  1.00 141.30 ? 40   PRO D CB  1 
ATOM   1945 C CG  . PRO D 3 18 ? 64.064  65.349 48.904  1.00 149.67 ? 40   PRO D CG  1 
ATOM   1946 C CD  . PRO D 3 18 ? 64.798  64.630 47.822  1.00 150.00 ? 40   PRO D CD  1 
ATOM   1947 N N   . LYS D 3 19 ? 60.518  64.227 46.034  1.00 113.59 ? 41   LYS D N   1 
ATOM   1948 C CA  . LYS D 3 19 ? 59.279  64.676 45.407  1.00 99.83  ? 41   LYS D CA  1 
ATOM   1949 C C   . LYS D 3 19 ? 58.446  63.407 45.472  1.00 91.57  ? 41   LYS D C   1 
ATOM   1950 O O   . LYS D 3 19 ? 58.704  62.487 44.704  1.00 97.96  ? 41   LYS D O   1 
ATOM   1951 C CB  . LYS D 3 19 ? 59.491  65.014 43.927  1.00 104.41 ? 41   LYS D CB  1 
ATOM   1952 C CG  . LYS D 3 19 ? 60.486  66.118 43.600  1.00 113.32 ? 41   LYS D CG  1 
ATOM   1953 C CD  . LYS D 3 19 ? 60.832  66.101 42.094  1.00 119.14 ? 41   LYS D CD  1 
ATOM   1954 C CE  . LYS D 3 19 ? 61.887  67.153 41.712  1.00 121.31 ? 41   LYS D CE  1 
ATOM   1955 N NZ  . LYS D 3 19 ? 62.453  66.979 40.330  1.00 118.35 ? 41   LYS D NZ  1 
ATOM   1956 N N   . VAL D 3 20 ? 57.472  63.318 46.368  1.00 79.02  ? 42   VAL D N   1 
ATOM   1957 C CA  . VAL D 3 20 ? 56.692  62.092 46.426  1.00 76.95  ? 42   VAL D CA  1 
ATOM   1958 C C   . VAL D 3 20 ? 55.237  62.234 46.040  1.00 78.28  ? 42   VAL D C   1 
ATOM   1959 O O   . VAL D 3 20 ? 54.473  62.908 46.722  1.00 85.20  ? 42   VAL D O   1 
ATOM   1960 C CB  . VAL D 3 20 ? 56.772  61.463 47.799  1.00 76.71  ? 42   VAL D CB  1 
ATOM   1961 C CG1 . VAL D 3 20 ? 55.905  60.194 47.851  1.00 67.61  ? 42   VAL D CG1 1 
ATOM   1962 C CG2 . VAL D 3 20 ? 58.221  61.132 48.097  1.00 89.93  ? 42   VAL D CG2 1 
ATOM   1963 N N   . TYR D 3 21 ? 54.858  61.561 44.956  1.00 73.06  ? 43   TYR D N   1 
ATOM   1964 C CA  . TYR D 3 21 ? 53.500  61.636 44.451  1.00 64.60  ? 43   TYR D CA  1 
ATOM   1965 C C   . TYR D 3 21 ? 52.760  60.346 44.520  1.00 57.23  ? 43   TYR D C   1 
ATOM   1966 O O   . TYR D 3 21 ? 53.248  59.307 44.076  1.00 55.04  ? 43   TYR D O   1 
ATOM   1967 C CB  . TYR D 3 21 ? 53.481  62.070 42.999  1.00 71.80  ? 43   TYR D CB  1 
ATOM   1968 C CG  . TYR D 3 21 ? 54.430  63.185 42.715  1.00 76.81  ? 43   TYR D CG  1 
ATOM   1969 C CD1 . TYR D 3 21 ? 55.801  62.969 42.748  1.00 78.41  ? 43   TYR D CD1 1 
ATOM   1970 C CD2 . TYR D 3 21 ? 53.965  64.465 42.443  1.00 80.41  ? 43   TYR D CD2 1 
ATOM   1971 C CE1 . TYR D 3 21 ? 56.688  63.993 42.522  1.00 91.72  ? 43   TYR D CE1 1 
ATOM   1972 C CE2 . TYR D 3 21 ? 54.844  65.503 42.212  1.00 88.08  ? 43   TYR D CE2 1 
ATOM   1973 C CZ  . TYR D 3 21 ? 56.210  65.259 42.253  1.00 97.13  ? 43   TYR D CZ  1 
ATOM   1974 O OH  . TYR D 3 21 ? 57.109  66.273 42.028  1.00 105.13 ? 43   TYR D OH  1 
ATOM   1975 N N   . PRO D 3 22 ? 51.539  60.401 45.048  1.00 60.45  ? 44   PRO D N   1 
ATOM   1976 C CA  . PRO D 3 22 ? 50.719  59.199 45.158  1.00 64.22  ? 44   PRO D CA  1 
ATOM   1977 C C   . PRO D 3 22 ? 50.591  58.610 43.770  1.00 58.07  ? 44   PRO D C   1 
ATOM   1978 O O   . PRO D 3 22 ? 50.949  59.242 42.771  1.00 48.71  ? 44   PRO D O   1 
ATOM   1979 C CB  . PRO D 3 22 ? 49.396  59.729 45.699  1.00 76.13  ? 44   PRO D CB  1 
ATOM   1980 C CG  . PRO D 3 22 ? 49.361  61.158 45.182  1.00 71.56  ? 44   PRO D CG  1 
ATOM   1981 C CD  . PRO D 3 22 ? 50.776  61.610 45.408  1.00 62.24  ? 44   PRO D CD  1 
ATOM   1982 N N   . ILE D 3 23 ? 50.038  57.415 43.702  1.00 55.12  ? 45   ILE D N   1 
ATOM   1983 C CA  . ILE D 3 23 ? 49.937  56.746 42.431  1.00 53.05  ? 45   ILE D CA  1 
ATOM   1984 C C   . ILE D 3 23 ? 48.506  56.481 41.952  1.00 52.93  ? 45   ILE D C   1 
ATOM   1985 O O   . ILE D 3 23 ? 47.659  55.980 42.706  1.00 51.16  ? 45   ILE D O   1 
ATOM   1986 C CB  . ILE D 3 23 ? 50.767  55.420 42.518  1.00 55.88  ? 45   ILE D CB  1 
ATOM   1987 C CG1 . ILE D 3 23 ? 52.255  55.762 42.746  1.00 48.57  ? 45   ILE D CG1 1 
ATOM   1988 C CG2 . ILE D 3 23 ? 50.570  54.566 41.270  1.00 39.53  ? 45   ILE D CG2 1 
ATOM   1989 C CD1 . ILE D 3 23 ? 53.149  54.550 43.164  1.00 41.78  ? 45   ILE D CD1 1 
ATOM   1990 N N   . ILE D 3 24 ? 48.246  56.836 40.693  1.00 53.96  ? 46   ILE D N   1 
ATOM   1991 C CA  . ILE D 3 24 ? 46.940  56.603 40.081  1.00 55.30  ? 46   ILE D CA  1 
ATOM   1992 C C   . ILE D 3 24 ? 47.097  55.656 38.911  1.00 55.95  ? 46   ILE D C   1 
ATOM   1993 O O   . ILE D 3 24 ? 47.942  55.855 38.035  1.00 58.09  ? 46   ILE D O   1 
ATOM   1994 C CB  . ILE D 3 24 ? 46.277  57.902 39.600  1.00 44.36  ? 46   ILE D CB  1 
ATOM   1995 C CG1 . ILE D 3 24 ? 45.968  58.765 40.816  1.00 55.58  ? 46   ILE D CG1 1 
ATOM   1996 C CG2 . ILE D 3 24 ? 44.966  57.592 38.873  1.00 27.54  ? 46   ILE D CG2 1 
ATOM   1997 C CD1 . ILE D 3 24 ? 45.177  58.002 41.891  1.00 67.26  ? 46   ILE D CD1 1 
ATOM   1998 N N   . LEU D 3 25 ? 46.242  54.645 38.886  1.00 58.18  ? 47   LEU D N   1 
ATOM   1999 C CA  . LEU D 3 25 ? 46.321  53.622 37.871  1.00 77.40  ? 47   LEU D CA  1 
ATOM   2000 C C   . LEU D 3 25 ? 45.225  53.565 36.829  1.00 90.26  ? 47   LEU D C   1 
ATOM   2001 O O   . LEU D 3 25 ? 44.044  53.404 37.152  1.00 90.43  ? 47   LEU D O   1 
ATOM   2002 C CB  . LEU D 3 25 ? 46.416  52.274 38.574  1.00 87.95  ? 47   LEU D CB  1 
ATOM   2003 C CG  . LEU D 3 25 ? 47.417  52.306 39.735  1.00 92.70  ? 47   LEU D CG  1 
ATOM   2004 C CD1 . LEU D 3 25 ? 47.531  50.937 40.365  1.00 84.27  ? 47   LEU D CD1 1 
ATOM   2005 C CD2 . LEU D 3 25 ? 48.773  52.767 39.220  1.00 94.83  ? 47   LEU D CD2 1 
ATOM   2006 N N   . ARG D 3 26 ? 45.641  53.685 35.570  1.00 106.66 ? 48   ARG D N   1 
ATOM   2007 C CA  . ARG D 3 26 ? 44.730  53.602 34.442  1.00 120.85 ? 48   ARG D CA  1 
ATOM   2008 C C   . ARG D 3 26 ? 44.139  52.210 34.544  1.00 129.51 ? 48   ARG D C   1 
ATOM   2009 O O   . ARG D 3 26 ? 42.951  52.045 34.807  1.00 136.33 ? 48   ARG D O   1 
ATOM   2010 C CB  . ARG D 3 26 ? 45.506  53.739 33.140  1.00 124.83 ? 48   ARG D CB  1 
ATOM   2011 C CG  . ARG D 3 26 ? 45.072  54.912 32.318  1.00 133.30 ? 48   ARG D CG  1 
ATOM   2012 C CD  . ARG D 3 26 ? 45.119  56.194 33.124  1.00 132.28 ? 48   ARG D CD  1 
ATOM   2013 N NE  . ARG D 3 26 ? 44.249  57.197 32.524  1.00 136.10 ? 48   ARG D NE  1 
ATOM   2014 C CZ  . ARG D 3 26 ? 42.930  57.061 32.400  1.00 139.73 ? 48   ARG D CZ  1 
ATOM   2015 N NH1 . ARG D 3 26 ? 42.328  55.963 32.841  1.00 139.48 ? 48   ARG D NH1 1 
ATOM   2016 N NH2 . ARG D 3 26 ? 42.213  58.018 31.825  1.00 139.35 ? 48   ARG D NH2 1 
ATOM   2017 N N   . LEU D 3 27 ? 44.997  51.214 34.352  1.00 133.19 ? 49   LEU D N   1 
ATOM   2018 C CA  . LEU D 3 27 ? 44.613  49.813 34.451  1.00 136.98 ? 49   LEU D CA  1 
ATOM   2019 C C   . LEU D 3 27 ? 43.927  49.235 33.229  1.00 136.83 ? 49   LEU D C   1 
ATOM   2020 O O   . LEU D 3 27 ? 42.701  49.248 33.114  1.00 140.44 ? 49   LEU D O   1 
ATOM   2021 C CB  . LEU D 3 27 ? 43.765  49.595 35.727  1.00 140.22 ? 49   LEU D CB  1 
ATOM   2022 C CG  . LEU D 3 27 ? 42.676  48.536 35.999  1.00 137.30 ? 49   LEU D CG  1 
ATOM   2023 C CD1 . LEU D 3 27 ? 41.327  49.114 35.594  1.00 129.04 ? 49   LEU D CD1 1 
ATOM   2024 C CD2 . LEU D 3 27 ? 42.966  47.211 35.296  1.00 137.94 ? 49   LEU D CD2 1 
ATOM   2025 N N   . GLY D 3 28 ? 44.740  48.749 32.299  1.00 131.81 ? 50   GLY D N   1 
ATOM   2026 C CA  . GLY D 3 28 ? 44.194  48.103 31.128  1.00 133.06 ? 50   GLY D CA  1 
ATOM   2027 C C   . GLY D 3 28 ? 44.155  46.669 31.611  1.00 134.26 ? 50   GLY D C   1 
ATOM   2028 O O   . GLY D 3 28 ? 43.097  46.045 31.755  1.00 133.76 ? 50   GLY D O   1 
ATOM   2029 N N   . SER D 3 29 ? 45.350  46.167 31.892  1.00 133.76 ? 51   SER D N   1 
ATOM   2030 C CA  . SER D 3 29 ? 45.539  44.827 32.415  1.00 130.16 ? 51   SER D CA  1 
ATOM   2031 C C   . SER D 3 29 ? 45.677  45.070 33.908  1.00 132.38 ? 51   SER D C   1 
ATOM   2032 O O   . SER D 3 29 ? 45.320  46.141 34.391  1.00 135.31 ? 51   SER D O   1 
ATOM   2033 C CB  . SER D 3 29 ? 46.833  44.234 31.870  1.00 117.80 ? 51   SER D CB  1 
ATOM   2034 O OG  . SER D 3 29 ? 47.921  45.057 32.232  1.00 100.72 ? 51   SER D OG  1 
ATOM   2035 N N   . ASN D 3 30 ? 46.197  44.093 34.640  1.00 133.06 ? 52   ASN D N   1 
ATOM   2036 C CA  . ASN D 3 30 ? 46.392  44.254 36.079  1.00 133.15 ? 52   ASN D CA  1 
ATOM   2037 C C   . ASN D 3 30 ? 47.864  43.982 36.445  1.00 126.54 ? 52   ASN D C   1 
ATOM   2038 O O   . ASN D 3 30 ? 48.226  42.870 36.832  1.00 125.50 ? 52   ASN D O   1 
ATOM   2039 C CB  . ASN D 3 30 ? 45.446  43.320 36.862  1.00 143.78 ? 52   ASN D CB  1 
ATOM   2040 C CG  . ASN D 3 30 ? 44.212  44.048 37.428  1.00 150.07 ? 52   ASN D CG  1 
ATOM   2041 O OD1 . ASN D 3 30 ? 44.321  44.874 38.338  1.00 151.06 ? 52   ASN D OD1 1 
ATOM   2042 N ND2 . ASN D 3 30 ? 43.038  43.734 36.889  1.00 152.36 ? 52   ASN D ND2 1 
ATOM   2043 N N   . LEU D 3 31 ? 48.700  45.014 36.303  1.00 119.87 ? 53   LEU D N   1 
ATOM   2044 C CA  . LEU D 3 31 ? 50.135  44.954 36.603  1.00 113.91 ? 53   LEU D CA  1 
ATOM   2045 C C   . LEU D 3 31 ? 50.492  44.132 37.813  1.00 112.70 ? 53   LEU D C   1 
ATOM   2046 O O   . LEU D 3 31 ? 49.717  44.020 38.757  1.00 116.80 ? 53   LEU D O   1 
ATOM   2047 C CB  . LEU D 3 31 ? 50.703  46.349 36.849  1.00 106.99 ? 53   LEU D CB  1 
ATOM   2048 C CG  . LEU D 3 31 ? 51.380  47.105 35.715  1.00 103.60 ? 53   LEU D CG  1 
ATOM   2049 C CD1 . LEU D 3 31 ? 50.432  47.243 34.534  1.00 99.21  ? 53   LEU D CD1 1 
ATOM   2050 C CD2 . LEU D 3 31 ? 51.808  48.473 36.234  1.00 94.90  ? 53   LEU D CD2 1 
ATOM   2051 N N   . SER D 3 32 ? 51.695  43.584 37.791  1.00 109.08 ? 54   SER D N   1 
ATOM   2052 C CA  . SER D 3 32 ? 52.168  42.799 38.909  1.00 103.58 ? 54   SER D CA  1 
ATOM   2053 C C   . SER D 3 32 ? 53.356  43.546 39.495  1.00 96.11  ? 54   SER D C   1 
ATOM   2054 O O   . SER D 3 32 ? 54.109  44.209 38.776  1.00 94.62  ? 54   SER D O   1 
ATOM   2055 C CB  . SER D 3 32 ? 52.591  41.404 38.440  1.00 109.67 ? 54   SER D CB  1 
ATOM   2056 O OG  . SER D 3 32 ? 53.000  40.597 39.532  1.00 114.64 ? 54   SER D OG  1 
ATOM   2057 N N   . LEU D 3 33 ? 53.502  43.472 40.810  1.00 87.26  ? 55   LEU D N   1 
ATOM   2058 C CA  . LEU D 3 33 ? 54.625  44.117 41.456  1.00 77.77  ? 55   LEU D CA  1 
ATOM   2059 C C   . LEU D 3 33 ? 55.257  43.179 42.482  1.00 72.72  ? 55   LEU D C   1 
ATOM   2060 O O   . LEU D 3 33 ? 54.555  42.517 43.236  1.00 75.95  ? 55   LEU D O   1 
ATOM   2061 C CB  . LEU D 3 33 ? 54.188  45.409 42.121  1.00 67.56  ? 55   LEU D CB  1 
ATOM   2062 C CG  . LEU D 3 33 ? 55.413  46.109 42.717  1.00 83.04  ? 55   LEU D CG  1 
ATOM   2063 C CD1 . LEU D 3 33 ? 56.551  46.232 41.701  1.00 82.96  ? 55   LEU D CD1 1 
ATOM   2064 C CD2 . LEU D 3 33 ? 55.000  47.466 43.193  1.00 89.72  ? 55   LEU D CD2 1 
ATOM   2065 N N   . SER D 3 34 ? 56.586  43.124 42.506  1.00 70.21  ? 56   SER D N   1 
ATOM   2066 C CA  . SER D 3 34 ? 57.295  42.239 43.424  1.00 62.55  ? 56   SER D CA  1 
ATOM   2067 C C   . SER D 3 34 ? 58.664  42.774 43.858  1.00 63.42  ? 56   SER D C   1 
ATOM   2068 O O   . SER D 3 34 ? 59.306  43.551 43.138  1.00 62.16  ? 56   SER D O   1 
ATOM   2069 C CB  . SER D 3 34 ? 57.436  40.869 42.765  1.00 55.89  ? 56   SER D CB  1 
ATOM   2070 O OG  . SER D 3 34 ? 57.190  40.988 41.372  1.00 76.63  ? 56   SER D OG  1 
ATOM   2071 N N   . MET D 3 35 ? 59.094  42.356 45.049  1.00 64.75  ? 57   MET D N   1 
ATOM   2072 C CA  . MET D 3 35 ? 60.378  42.774 45.626  1.00 66.61  ? 57   MET D CA  1 
ATOM   2073 C C   . MET D 3 35 ? 61.502  41.746 45.388  1.00 73.01  ? 57   MET D C   1 
ATOM   2074 O O   . MET D 3 35 ? 61.419  40.602 45.849  1.00 73.50  ? 57   MET D O   1 
ATOM   2075 C CB  . MET D 3 35 ? 60.201  43.012 47.126  1.00 52.39  ? 57   MET D CB  1 
ATOM   2076 C CG  . MET D 3 35 ? 61.484  43.297 47.892  1.00 44.84  ? 57   MET D CG  1 
ATOM   2077 S SD  . MET D 3 35 ? 62.367  44.826 47.435  1.00 45.26  ? 57   MET D SD  1 
ATOM   2078 C CE  . MET D 3 35 ? 61.232  46.023 48.068  1.00 38.49  ? 57   MET D CE  1 
ATOM   2079 N N   . ALA D 3 36 ? 62.561  42.170 44.696  1.00 75.97  ? 58   ALA D N   1 
ATOM   2080 C CA  . ALA D 3 36 ? 63.674  41.279 44.366  1.00 74.99  ? 58   ALA D CA  1 
ATOM   2081 C C   . ALA D 3 36 ? 64.983  41.534 45.116  1.00 69.15  ? 58   ALA D C   1 
ATOM   2082 O O   . ALA D 3 36 ? 65.380  42.687 45.327  1.00 57.07  ? 58   ALA D O   1 
ATOM   2083 C CB  . ALA D 3 36 ? 63.926  41.330 42.861  1.00 73.54  ? 58   ALA D CB  1 
ATOM   2084 N N   . ARG D 3 37 ? 65.652  40.441 45.495  1.00 69.84  ? 59   ARG D N   1 
ATOM   2085 C CA  . ARG D 3 37 ? 66.925  40.499 46.219  1.00 74.47  ? 59   ARG D CA  1 
ATOM   2086 C C   . ARG D 3 37 ? 67.905  39.377 45.805  1.00 73.65  ? 59   ARG D C   1 
ATOM   2087 O O   . ARG D 3 37 ? 67.495  38.224 45.625  1.00 62.32  ? 59   ARG D O   1 
ATOM   2088 C CB  . ARG D 3 37 ? 66.679  40.391 47.727  1.00 82.98  ? 59   ARG D CB  1 
ATOM   2089 C CG  . ARG D 3 37 ? 65.431  41.082 48.242  1.00 92.54  ? 59   ARG D CG  1 
ATOM   2090 C CD  . ARG D 3 37 ? 64.736  40.160 49.227  1.00 99.74  ? 59   ARG D CD  1 
ATOM   2091 N NE  . ARG D 3 37 ? 63.559  40.746 49.855  1.00 91.56  ? 59   ARG D NE  1 
ATOM   2092 C CZ  . ARG D 3 37 ? 63.586  41.869 50.558  1.00 80.30  ? 59   ARG D CZ  1 
ATOM   2093 N NH1 . ARG D 3 37 ? 64.733  42.525 50.708  1.00 68.68  ? 59   ARG D NH1 1 
ATOM   2094 N NH2 . ARG D 3 37 ? 62.473  42.312 51.127  1.00 83.43  ? 59   ARG D NH2 1 
ATOM   2095 N N   . ARG D 3 38 ? 69.193  39.726 45.683  1.00 77.49  ? 60   ARG D N   1 
ATOM   2096 C CA  . ARG D 3 38 ? 70.272  38.794 45.307  1.00 72.55  ? 60   ARG D CA  1 
ATOM   2097 C C   . ARG D 3 38 ? 70.392  37.621 46.254  1.00 78.54  ? 60   ARG D C   1 
ATOM   2098 O O   . ARG D 3 38 ? 70.221  37.774 47.462  1.00 84.87  ? 60   ARG D O   1 
ATOM   2099 C CB  . ARG D 3 38 ? 71.634  39.492 45.312  1.00 68.32  ? 60   ARG D CB  1 
ATOM   2100 C CG  . ARG D 3 38 ? 71.903  40.387 44.146  1.00 79.65  ? 60   ARG D CG  1 
ATOM   2101 C CD  . ARG D 3 38 ? 73.024  39.828 43.289  1.00 90.34  ? 60   ARG D CD  1 
ATOM   2102 N NE  . ARG D 3 38 ? 73.169  40.596 42.053  1.00 102.21 ? 60   ARG D NE  1 
ATOM   2103 C CZ  . ARG D 3 38 ? 73.519  41.877 41.999  1.00 98.04  ? 60   ARG D CZ  1 
ATOM   2104 N NH1 . ARG D 3 38 ? 73.774  42.549 43.115  1.00 102.29 ? 60   ARG D NH1 1 
ATOM   2105 N NH2 . ARG D 3 38 ? 73.591  42.494 40.827  1.00 86.96  ? 60   ARG D NH2 1 
ATOM   2106 N N   . ASN D 3 39 ? 70.722  36.457 45.703  1.00 85.47  ? 61   ASN D N   1 
ATOM   2107 C CA  . ASN D 3 39 ? 70.897  35.239 46.499  1.00 93.56  ? 61   ASN D CA  1 
ATOM   2108 C C   . ASN D 3 39 ? 72.392  35.095 46.813  1.00 92.98  ? 61   ASN D C   1 
ATOM   2109 O O   . ASN D 3 39 ? 73.116  34.342 46.159  1.00 93.12  ? 61   ASN D O   1 
ATOM   2110 C CB  . ASN D 3 39 ? 70.371  34.030 45.714  1.00 93.14  ? 61   ASN D CB  1 
ATOM   2111 C CG  . ASN D 3 39 ? 70.565  32.724 46.450  1.00 95.68  ? 61   ASN D CG  1 
ATOM   2112 O OD1 . ASN D 3 39 ? 70.508  32.671 47.682  1.00 101.65 ? 61   ASN D OD1 1 
ATOM   2113 N ND2 . ASN D 3 39 ? 70.780  31.653 45.695  1.00 83.18  ? 61   ASN D ND2 1 
ATOM   2114 N N   . LEU D 3 40 ? 72.835  35.837 47.825  1.00 90.63  ? 62   LEU D N   1 
ATOM   2115 C CA  . LEU D 3 40 ? 74.233  35.873 48.242  1.00 88.09  ? 62   LEU D CA  1 
ATOM   2116 C C   . LEU D 3 40 ? 74.592  34.843 49.296  1.00 89.56  ? 62   LEU D C   1 
ATOM   2117 O O   . LEU D 3 40 ? 75.646  34.934 49.925  1.00 87.79  ? 62   LEU D O   1 
ATOM   2118 C CB  . LEU D 3 40 ? 74.560  37.254 48.810  1.00 88.46  ? 62   LEU D CB  1 
ATOM   2119 C CG  . LEU D 3 40 ? 74.321  38.490 47.948  1.00 86.66  ? 62   LEU D CG  1 
ATOM   2120 C CD1 . LEU D 3 40 ? 74.561  39.742 48.783  1.00 78.28  ? 62   LEU D CD1 1 
ATOM   2121 C CD2 . LEU D 3 40 ? 75.244  38.449 46.736  1.00 92.60  ? 62   LEU D CD2 1 
ATOM   2122 N N   . ASP D 3 41 ? 73.722  33.868 49.501  1.00 94.53  ? 63   ASP D N   1 
ATOM   2123 C CA  . ASP D 3 41 ? 73.982  32.854 50.513  1.00 105.87 ? 63   ASP D CA  1 
ATOM   2124 C C   . ASP D 3 41 ? 73.787  31.447 49.969  1.00 107.43 ? 63   ASP D C   1 
ATOM   2125 O O   . ASP D 3 41 ? 74.040  30.462 50.664  1.00 110.67 ? 63   ASP D O   1 
ATOM   2126 C CB  . ASP D 3 41 ? 73.037  33.067 51.693  1.00 115.37 ? 63   ASP D CB  1 
ATOM   2127 C CG  . ASP D 3 41 ? 71.573  33.080 51.267  1.00 122.84 ? 63   ASP D CG  1 
ATOM   2128 O OD1 . ASP D 3 41 ? 71.063  32.032 50.816  1.00 117.80 ? 63   ASP D OD1 1 
ATOM   2129 O OD2 . ASP D 3 41 ? 70.932  34.145 51.370  1.00 131.32 ? 63   ASP D OD2 1 
ATOM   2130 N N   . SER D 3 42 ? 73.339  31.362 48.723  1.00 101.44 ? 64   SER D N   1 
ATOM   2131 C CA  . SER D 3 42 ? 73.073  30.083 48.091  1.00 85.94  ? 64   SER D CA  1 
ATOM   2132 C C   . SER D 3 42 ? 73.453  30.136 46.624  1.00 86.83  ? 64   SER D C   1 
ATOM   2133 O O   . SER D 3 42 ? 73.969  31.144 46.147  1.00 97.80  ? 64   SER D O   1 
ATOM   2134 C CB  . SER D 3 42 ? 71.586  29.779 48.242  1.00 78.07  ? 64   SER D CB  1 
ATOM   2135 O OG  . SER D 3 42 ? 71.169  28.747 47.382  1.00 77.82  ? 64   SER D OG  1 
ATOM   2136 N N   . LEU D 3 43 ? 73.217  29.046 45.907  1.00 81.76  ? 65   LEU D N   1 
ATOM   2137 C CA  . LEU D 3 43 ? 73.510  29.021 44.480  1.00 83.02  ? 65   LEU D CA  1 
ATOM   2138 C C   . LEU D 3 43 ? 72.593  28.053 43.735  1.00 88.85  ? 65   LEU D C   1 
ATOM   2139 O O   . LEU D 3 43 ? 72.728  27.874 42.526  1.00 88.23  ? 65   LEU D O   1 
ATOM   2140 C CB  . LEU D 3 43 ? 74.970  28.660 44.229  1.00 76.14  ? 65   LEU D CB  1 
ATOM   2141 C CG  . LEU D 3 43 ? 75.353  27.192 44.407  1.00 74.26  ? 65   LEU D CG  1 
ATOM   2142 C CD1 . LEU D 3 43 ? 76.831  26.998 44.088  1.00 67.86  ? 65   LEU D CD1 1 
ATOM   2143 C CD2 . LEU D 3 43 ? 75.054  26.760 45.822  1.00 72.28  ? 65   LEU D CD2 1 
ATOM   2144 N N   . GLU D 3 44 ? 71.667  27.427 44.462  1.00 95.99  ? 66   GLU D N   1 
ATOM   2145 C CA  . GLU D 3 44 ? 70.688  26.502 43.873  1.00 98.27  ? 66   GLU D CA  1 
ATOM   2146 C C   . GLU D 3 44 ? 69.311  27.147 43.932  1.00 91.97  ? 66   GLU D C   1 
ATOM   2147 O O   . GLU D 3 44 ? 68.423  26.818 43.152  1.00 89.72  ? 66   GLU D O   1 
ATOM   2148 C CB  . GLU D 3 44 ? 70.645  25.175 44.627  1.00 109.61 ? 66   GLU D CB  1 
ATOM   2149 C CG  . GLU D 3 44 ? 70.716  25.336 46.115  1.00 129.45 ? 66   GLU D CG  1 
ATOM   2150 C CD  . GLU D 3 44 ? 72.115  25.689 46.554  1.00 145.23 ? 66   GLU D CD  1 
ATOM   2151 O OE1 . GLU D 3 44 ? 73.019  24.857 46.326  1.00 150.00 ? 66   GLU D OE1 1 
ATOM   2152 O OE2 . GLU D 3 44 ? 72.318  26.789 47.110  1.00 152.12 ? 66   GLU D OE2 1 
ATOM   2153 N N   . ALA D 3 45 ? 69.132  28.051 44.885  1.00 88.61  ? 67   ALA D N   1 
ATOM   2154 C CA  . ALA D 3 45 ? 67.878  28.770 44.999  1.00 86.40  ? 67   ALA D CA  1 
ATOM   2155 C C   . ALA D 3 45 ? 67.923  29.746 43.834  1.00 82.59  ? 67   ALA D C   1 
ATOM   2156 O O   . ALA D 3 45 ? 68.924  29.805 43.109  1.00 76.49  ? 67   ALA D O   1 
ATOM   2157 C CB  . ALA D 3 45 ? 67.820  29.523 46.309  1.00 92.17  ? 67   ALA D CB  1 
ATOM   2158 N N   . ARG D 3 46 ? 66.859  30.516 43.651  1.00 79.12  ? 68   ARG D N   1 
ATOM   2159 C CA  . ARG D 3 46 ? 66.827  31.471 42.554  1.00 76.48  ? 68   ARG D CA  1 
ATOM   2160 C C   . ARG D 3 46 ? 67.939  32.522 42.605  1.00 73.82  ? 68   ARG D C   1 
ATOM   2161 O O   . ARG D 3 46 ? 68.395  32.926 43.685  1.00 68.25  ? 68   ARG D O   1 
ATOM   2162 C CB  . ARG D 3 46 ? 65.482  32.165 42.518  1.00 84.15  ? 68   ARG D CB  1 
ATOM   2163 C CG  . ARG D 3 46 ? 64.356  31.276 42.071  1.00 85.53  ? 68   ARG D CG  1 
ATOM   2164 C CD  . ARG D 3 46 ? 63.131  32.125 41.888  1.00 92.47  ? 68   ARG D CD  1 
ATOM   2165 N NE  . ARG D 3 46 ? 63.514  33.462 41.447  1.00 80.24  ? 68   ARG D NE  1 
ATOM   2166 C CZ  . ARG D 3 46 ? 62.653  34.426 41.155  1.00 74.16  ? 68   ARG D CZ  1 
ATOM   2167 N NH1 . ARG D 3 46 ? 61.353  34.206 41.253  1.00 76.18  ? 68   ARG D NH1 1 
ATOM   2168 N NH2 . ARG D 3 46 ? 63.094  35.612 40.770  1.00 73.93  ? 68   ARG D NH2 1 
ATOM   2169 N N   . ALA D 3 47 ? 68.369  32.961 41.423  1.00 67.08  ? 69   ALA D N   1 
ATOM   2170 C CA  . ALA D 3 47 ? 69.425  33.959 41.316  1.00 71.79  ? 69   ALA D CA  1 
ATOM   2171 C C   . ALA D 3 47 ? 69.020  35.112 42.198  1.00 79.70  ? 69   ALA D C   1 
ATOM   2172 O O   . ALA D 3 47 ? 69.784  35.537 43.066  1.00 85.55  ? 69   ALA D O   1 
ATOM   2173 C CB  . ALA D 3 47 ? 69.579  34.424 39.876  1.00 64.16  ? 69   ALA D CB  1 
ATOM   2174 N N   . PHE D 3 48 ? 67.808  35.613 41.959  1.00 84.49  ? 70   PHE D N   1 
ATOM   2175 C CA  . PHE D 3 48 ? 67.239  36.710 42.741  1.00 80.07  ? 70   PHE D CA  1 
ATOM   2176 C C   . PHE D 3 48 ? 65.924  36.245 43.355  1.00 77.36  ? 70   PHE D C   1 
ATOM   2177 O O   . PHE D 3 48 ? 65.103  35.613 42.688  1.00 76.92  ? 70   PHE D O   1 
ATOM   2178 C CB  . PHE D 3 48 ? 66.983  37.947 41.872  1.00 71.16  ? 70   PHE D CB  1 
ATOM   2179 C CG  . PHE D 3 48 ? 68.208  38.800 41.631  1.00 62.72  ? 70   PHE D CG  1 
ATOM   2180 C CD1 . PHE D 3 48 ? 69.252  38.342 40.820  1.00 60.26  ? 70   PHE D CD1 1 
ATOM   2181 C CD2 . PHE D 3 48 ? 68.300  40.080 42.188  1.00 64.37  ? 70   PHE D CD2 1 
ATOM   2182 C CE1 . PHE D 3 48 ? 70.371  39.146 40.560  1.00 65.94  ? 70   PHE D CE1 1 
ATOM   2183 C CE2 . PHE D 3 48 ? 69.410  40.896 41.937  1.00 66.76  ? 70   PHE D CE2 1 
ATOM   2184 C CZ  . PHE D 3 48 ? 70.447  40.425 41.117  1.00 72.48  ? 70   PHE D CZ  1 
ATOM   2185 N N   . GLN D 3 49 ? 65.738  36.557 44.633  1.00 75.06  ? 71   GLN D N   1 
ATOM   2186 C CA  . GLN D 3 49 ? 64.531  36.174 45.348  1.00 80.38  ? 71   GLN D CA  1 
ATOM   2187 C C   . GLN D 3 49 ? 63.383  37.121 45.002  1.00 79.79  ? 71   GLN D C   1 
ATOM   2188 O O   . GLN D 3 49 ? 63.521  38.343 45.110  1.00 75.24  ? 71   GLN D O   1 
ATOM   2189 C CB  . GLN D 3 49 ? 64.798  36.218 46.848  1.00 93.63  ? 71   GLN D CB  1 
ATOM   2190 C CG  . GLN D 3 49 ? 63.607  35.839 47.706  1.00 115.57 ? 71   GLN D CG  1 
ATOM   2191 C CD  . GLN D 3 49 ? 63.434  36.772 48.895  1.00 124.05 ? 71   GLN D CD  1 
ATOM   2192 O OE1 . GLN D 3 49 ? 62.966  37.909 48.751  1.00 125.36 ? 71   GLN D OE1 1 
ATOM   2193 N NE2 . GLN D 3 49 ? 63.824  36.301 50.076  1.00 121.72 ? 71   GLN D NE2 1 
ATOM   2194 N N   . SER D 3 50 ? 62.252  36.558 44.590  1.00 81.16  ? 72   SER D N   1 
ATOM   2195 C CA  . SER D 3 50 ? 61.105  37.380 44.237  1.00 85.70  ? 72   SER D CA  1 
ATOM   2196 C C   . SER D 3 50 ? 59.984  37.259 45.250  1.00 90.66  ? 72   SER D C   1 
ATOM   2197 O O   . SER D 3 50 ? 59.393  36.195 45.411  1.00 93.09  ? 72   SER D O   1 
ATOM   2198 C CB  . SER D 3 50 ? 60.573  36.994 42.858  1.00 91.13  ? 72   SER D CB  1 
ATOM   2199 O OG  . SER D 3 50 ? 59.338  37.646 42.596  1.00 91.60  ? 72   SER D OG  1 
ATOM   2200 N N   . THR D 3 51 ? 59.685  38.363 45.923  1.00 96.37  ? 73   THR D N   1 
ATOM   2201 C CA  . THR D 3 51 ? 58.622  38.389 46.920  1.00 97.08  ? 73   THR D CA  1 
ATOM   2202 C C   . THR D 3 51 ? 57.470  39.266 46.429  1.00 97.22  ? 73   THR D C   1 
ATOM   2203 O O   . THR D 3 51 ? 57.498  40.490 46.602  1.00 92.40  ? 73   THR D O   1 
ATOM   2204 C CB  . THR D 3 51 ? 59.122  38.977 48.256  1.00 96.98  ? 73   THR D CB  1 
ATOM   2205 O OG1 . THR D 3 51 ? 60.462  38.533 48.522  1.00 85.59  ? 73   THR D OG1 1 
ATOM   2206 C CG2 . THR D 3 51 ? 58.209  38.534 49.386  1.00 100.48 ? 73   THR D CG2 1 
ATOM   2207 N N   . PRO D 3 52 ? 56.444  38.657 45.806  1.00 95.92  ? 74   PRO D N   1 
ATOM   2208 C CA  . PRO D 3 52 ? 55.305  39.438 45.310  1.00 95.42  ? 74   PRO D CA  1 
ATOM   2209 C C   . PRO D 3 52 ? 54.843  40.457 46.349  1.00 91.15  ? 74   PRO D C   1 
ATOM   2210 O O   . PRO D 3 52 ? 54.782  40.150 47.538  1.00 82.12  ? 74   PRO D O   1 
ATOM   2211 C CB  . PRO D 3 52 ? 54.261  38.367 45.021  1.00 91.56  ? 74   PRO D CB  1 
ATOM   2212 C CG  . PRO D 3 52 ? 55.117  37.255 44.508  1.00 93.32  ? 74   PRO D CG  1 
ATOM   2213 C CD  . PRO D 3 52 ? 56.259  37.227 45.513  1.00 92.21  ? 74   PRO D CD  1 
ATOM   2214 N N   . ILE D 3 53 ? 54.524  41.665 45.890  1.00 96.19  ? 75   ILE D N   1 
ATOM   2215 C CA  . ILE D 3 53 ? 54.096  42.745 46.779  1.00 96.17  ? 75   ILE D CA  1 
ATOM   2216 C C   . ILE D 3 53 ? 52.607  43.117 46.716  1.00 93.39  ? 75   ILE D C   1 
ATOM   2217 O O   . ILE D 3 53 ? 52.071  43.442 45.652  1.00 86.19  ? 75   ILE D O   1 
ATOM   2218 C CB  . ILE D 3 53 ? 54.920  44.000 46.511  1.00 93.46  ? 75   ILE D CB  1 
ATOM   2219 C CG1 . ILE D 3 53 ? 56.415  43.661 46.599  1.00 94.99  ? 75   ILE D CG1 1 
ATOM   2220 C CG2 . ILE D 3 53 ? 54.530  45.075 47.505  1.00 88.20  ? 75   ILE D CG2 1 
ATOM   2221 C CD1 . ILE D 3 53 ? 57.355  44.777 46.135  1.00 89.76  ? 75   ILE D CD1 1 
ATOM   2222 N N   . VAL D 3 54 ? 51.964  43.090 47.881  1.00 97.49  ? 76   VAL D N   1 
ATOM   2223 C CA  . VAL D 3 54 ? 50.541  43.386 48.010  1.00 106.28 ? 76   VAL D CA  1 
ATOM   2224 C C   . VAL D 3 54 ? 50.153  44.850 47.810  1.00 111.95 ? 76   VAL D C   1 
ATOM   2225 O O   . VAL D 3 54 ? 50.428  45.697 48.663  1.00 111.27 ? 76   VAL D O   1 
ATOM   2226 C CB  . VAL D 3 54 ? 50.024  42.928 49.387  1.00 106.54 ? 76   VAL D CB  1 
ATOM   2227 C CG1 . VAL D 3 54 ? 50.977  43.402 50.484  1.00 104.69 ? 76   VAL D CG1 1 
ATOM   2228 C CG2 . VAL D 3 54 ? 48.608  43.461 49.617  1.00 101.98 ? 76   VAL D CG2 1 
ATOM   2229 N N   . VAL D 3 55 ? 49.497  45.134 46.685  1.00 114.87 ? 77   VAL D N   1 
ATOM   2230 C CA  . VAL D 3 55 ? 49.055  46.490 46.367  1.00 112.80 ? 77   VAL D CA  1 
ATOM   2231 C C   . VAL D 3 55 ? 47.624  46.661 46.859  1.00 115.44 ? 77   VAL D C   1 
ATOM   2232 O O   . VAL D 3 55 ? 46.690  46.044 46.337  1.00 112.46 ? 77   VAL D O   1 
ATOM   2233 C CB  . VAL D 3 55 ? 49.086  46.768 44.845  1.00 105.93 ? 77   VAL D CB  1 
ATOM   2234 C CG1 . VAL D 3 55 ? 48.902  48.251 44.593  1.00 106.78 ? 77   VAL D CG1 1 
ATOM   2235 C CG2 . VAL D 3 55 ? 50.393  46.300 44.252  1.00 104.15 ? 77   VAL D CG2 1 
ATOM   2236 N N   . GLN D 3 56 ? 47.457  47.509 47.866  1.00 120.35 ? 78   GLN D N   1 
ATOM   2237 C CA  . GLN D 3 56 ? 46.143  47.742 48.435  1.00 130.07 ? 78   GLN D CA  1 
ATOM   2238 C C   . GLN D 3 56 ? 45.464  48.969 47.822  1.00 131.02 ? 78   GLN D C   1 
ATOM   2239 O O   . GLN D 3 56 ? 44.758  49.713 48.500  1.00 135.82 ? 78   GLN D O   1 
ATOM   2240 C CB  . GLN D 3 56 ? 46.273  47.895 49.952  1.00 137.19 ? 78   GLN D CB  1 
ATOM   2241 C CG  . GLN D 3 56 ? 45.015  47.531 50.718  1.00 145.36 ? 78   GLN D CG  1 
ATOM   2242 C CD  . GLN D 3 56 ? 44.521  46.126 50.402  1.00 145.20 ? 78   GLN D CD  1 
ATOM   2243 O OE1 . GLN D 3 56 ? 45.239  45.140 50.594  1.00 143.02 ? 78   GLN D OE1 1 
ATOM   2244 N NE2 . GLN D 3 56 ? 43.286  46.032 49.917  1.00 144.10 ? 78   GLN D NE2 1 
ATOM   2245 N N   . MET D 3 57 ? 45.685  49.164 46.528  1.00 128.53 ? 79   MET D N   1 
ATOM   2246 C CA  . MET D 3 57 ? 45.108  50.278 45.786  1.00 123.72 ? 79   MET D CA  1 
ATOM   2247 C C   . MET D 3 57 ? 43.601  50.391 46.004  1.00 124.43 ? 79   MET D C   1 
ATOM   2248 O O   . MET D 3 57 ? 42.939  49.414 46.354  1.00 123.50 ? 79   MET D O   1 
ATOM   2249 C CB  . MET D 3 57 ? 45.369  50.070 44.308  1.00 119.71 ? 79   MET D CB  1 
ATOM   2250 C CG  . MET D 3 57 ? 45.009  48.665 43.880  1.00 114.37 ? 79   MET D CG  1 
ATOM   2251 S SD  . MET D 3 57 ? 44.884  48.467 42.115  1.00 118.02 ? 79   MET D SD  1 
ATOM   2252 C CE  . MET D 3 57 ? 43.092  48.415 41.900  1.00 122.63 ? 79   MET D CE  1 
ATOM   2253 N N   . THR D 3 58 ? 43.069  51.588 45.762  1.00 126.90 ? 80   THR D N   1 
ATOM   2254 C CA  . THR D 3 58 ? 41.645  51.880 45.926  1.00 123.00 ? 80   THR D CA  1 
ATOM   2255 C C   . THR D 3 58 ? 41.009  52.355 44.621  1.00 120.19 ? 80   THR D C   1 
ATOM   2256 O O   . THR D 3 58 ? 41.586  53.169 43.906  1.00 120.27 ? 80   THR D O   1 
ATOM   2257 C CB  . THR D 3 58 ? 41.422  53.008 46.940  1.00 121.45 ? 80   THR D CB  1 
ATOM   2258 O OG1 . THR D 3 58 ? 42.160  52.739 48.137  1.00 121.42 ? 80   THR D OG1 1 
ATOM   2259 C CG2 . THR D 3 58 ? 39.946  53.136 47.261  1.00 120.00 ? 80   THR D CG2 1 
ATOM   2260 N N   . LYS D 3 59 ? 39.814  51.863 44.315  1.00 113.69 ? 81   LYS D N   1 
ATOM   2261 C CA  . LYS D 3 59 ? 39.129  52.297 43.104  1.00 109.76 ? 81   LYS D CA  1 
ATOM   2262 C C   . LYS D 3 59 ? 38.342  53.552 43.479  1.00 111.81 ? 81   LYS D C   1 
ATOM   2263 O O   . LYS D 3 59 ? 37.774  53.632 44.569  1.00 114.70 ? 81   LYS D O   1 
ATOM   2264 C CB  . LYS D 3 59 ? 38.192  51.199 42.605  1.00 103.14 ? 81   LYS D CB  1 
ATOM   2265 C CG  . LYS D 3 59 ? 37.590  51.454 41.232  1.00 110.30 ? 81   LYS D CG  1 
ATOM   2266 C CD  . LYS D 3 59 ? 36.488  52.500 41.262  1.00 122.16 ? 81   LYS D CD  1 
ATOM   2267 C CE  . LYS D 3 59 ? 35.840  52.649 39.889  1.00 129.00 ? 81   LYS D CE  1 
ATOM   2268 N NZ  . LYS D 3 59 ? 34.684  53.592 39.896  1.00 131.48 ? 81   LYS D NZ  1 
ATOM   2269 N N   . LEU D 3 60 ? 38.297  54.531 42.582  1.00 109.79 ? 82   LEU D N   1 
ATOM   2270 C CA  . LEU D 3 60 ? 37.599  55.777 42.882  1.00 105.19 ? 82   LEU D CA  1 
ATOM   2271 C C   . LEU D 3 60 ? 36.281  56.053 42.159  1.00 107.57 ? 82   LEU D C   1 
ATOM   2272 O O   . LEU D 3 60 ? 36.050  55.567 41.049  1.00 109.27 ? 82   LEU D O   1 
ATOM   2273 C CB  . LEU D 3 60 ? 38.545  56.947 42.645  1.00 96.87  ? 82   LEU D CB  1 
ATOM   2274 C CG  . LEU D 3 60 ? 39.788  56.963 43.530  1.00 88.82  ? 82   LEU D CG  1 
ATOM   2275 C CD1 . LEU D 3 60 ? 40.542  58.241 43.261  1.00 90.69  ? 82   LEU D CD1 1 
ATOM   2276 C CD2 . LEU D 3 60 ? 39.399  56.884 45.002  1.00 86.35  ? 82   LEU D CD2 1 
ATOM   2277 N N   . ALA D 3 61 ? 35.431  56.858 42.803  1.00 107.20 ? 83   ALA D N   1 
ATOM   2278 C CA  . ALA D 3 61 ? 34.130  57.243 42.252  1.00 103.48 ? 83   ALA D CA  1 
ATOM   2279 C C   . ALA D 3 61 ? 34.092  58.747 41.964  1.00 100.82 ? 83   ALA D C   1 
ATOM   2280 O O   . ALA D 3 61 ? 33.606  59.161 40.915  1.00 106.57 ? 83   ALA D O   1 
ATOM   2281 C CB  . ALA D 3 61 ? 33.007  56.862 43.217  1.00 101.41 ? 83   ALA D CB  1 
ATOM   2282 N N   . THR D 3 62 ? 34.598  59.560 42.890  1.00 96.04  ? 84   THR D N   1 
ATOM   2283 C CA  . THR D 3 62 ? 34.620  61.013 42.693  1.00 89.35  ? 84   THR D CA  1 
ATOM   2284 C C   . THR D 3 62 ? 36.045  61.577 42.700  1.00 89.96  ? 84   THR D C   1 
ATOM   2285 O O   . THR D 3 62 ? 36.847  61.254 43.584  1.00 88.67  ? 84   THR D O   1 
ATOM   2286 C CB  . THR D 3 62 ? 33.786  61.766 43.764  1.00 81.43  ? 84   THR D CB  1 
ATOM   2287 O OG1 . THR D 3 62 ? 33.911  63.174 43.542  1.00 83.32  ? 84   THR D OG1 1 
ATOM   2288 C CG2 . THR D 3 62 ? 34.270  61.450 45.173  1.00 80.74  ? 84   THR D CG2 1 
ATOM   2289 N N   . THR D 3 63 ? 36.340  62.430 41.716  1.00 88.08  ? 85   THR D N   1 
ATOM   2290 C CA  . THR D 3 63 ? 37.664  63.050 41.553  1.00 83.88  ? 85   THR D CA  1 
ATOM   2291 C C   . THR D 3 63 ? 38.014  64.017 42.677  1.00 87.79  ? 85   THR D C   1 
ATOM   2292 O O   . THR D 3 63 ? 39.104  64.583 42.706  1.00 83.64  ? 85   THR D O   1 
ATOM   2293 C CB  . THR D 3 63 ? 37.761  63.852 40.221  1.00 82.23  ? 85   THR D CB  1 
ATOM   2294 O OG1 . THR D 3 63 ? 39.131  63.943 39.808  1.00 78.74  ? 85   THR D OG1 1 
ATOM   2295 C CG2 . THR D 3 63 ? 37.232  65.282 40.404  1.00 82.86  ? 85   THR D CG2 1 
ATOM   2296 N N   . GLU D 3 64 ? 37.084  64.216 43.596  1.00 96.78  ? 86   GLU D N   1 
ATOM   2297 C CA  . GLU D 3 64 ? 37.308  65.147 44.687  1.00 103.01 ? 86   GLU D CA  1 
ATOM   2298 C C   . GLU D 3 64 ? 38.193  64.520 45.741  1.00 98.92  ? 86   GLU D C   1 
ATOM   2299 O O   . GLU D 3 64 ? 38.760  65.200 46.602  1.00 94.15  ? 86   GLU D O   1 
ATOM   2300 C CB  . GLU D 3 64 ? 35.967  65.548 45.291  1.00 115.43 ? 86   GLU D CB  1 
ATOM   2301 C CG  . GLU D 3 64 ? 36.052  66.717 46.239  1.00 136.28 ? 86   GLU D CG  1 
ATOM   2302 C CD  . GLU D 3 64 ? 34.695  67.325 46.499  1.00 149.32 ? 86   GLU D CD  1 
ATOM   2303 O OE1 . GLU D 3 64 ? 33.768  66.559 46.836  1.00 149.61 ? 86   GLU D OE1 1 
ATOM   2304 O OE2 . GLU D 3 64 ? 34.554  68.562 46.367  1.00 157.08 ? 86   GLU D OE2 1 
ATOM   2305 N N   . GLU D 3 65 ? 38.307  63.204 45.649  1.00 97.92  ? 87   GLU D N   1 
ATOM   2306 C CA  . GLU D 3 65 ? 39.104  62.431 46.580  1.00 104.52 ? 87   GLU D CA  1 
ATOM   2307 C C   . GLU D 3 65 ? 40.608  62.549 46.308  1.00 99.03  ? 87   GLU D C   1 
ATOM   2308 O O   . GLU D 3 65 ? 41.421  62.122 47.123  1.00 98.99  ? 87   GLU D O   1 
ATOM   2309 C CB  . GLU D 3 65 ? 38.669  60.968 46.498  1.00 114.68 ? 87   GLU D CB  1 
ATOM   2310 C CG  . GLU D 3 65 ? 37.172  60.778 46.685  1.00 129.51 ? 87   GLU D CG  1 
ATOM   2311 C CD  . GLU D 3 65 ? 36.703  59.407 46.252  1.00 141.50 ? 87   GLU D CD  1 
ATOM   2312 O OE1 . GLU D 3 65 ? 37.196  58.401 46.802  1.00 152.78 ? 87   GLU D OE1 1 
ATOM   2313 O OE2 . GLU D 3 65 ? 35.841  59.336 45.356  1.00 141.49 ? 87   GLU D OE2 1 
ATOM   2314 N N   . LEU D 3 66 ? 40.976  63.143 45.175  1.00 89.03  ? 88   LEU D N   1 
ATOM   2315 C CA  . LEU D 3 66 ? 42.384  63.281 44.803  1.00 74.64  ? 88   LEU D CA  1 
ATOM   2316 C C   . LEU D 3 66 ? 43.048  64.536 45.326  1.00 71.92  ? 88   LEU D C   1 
ATOM   2317 O O   . LEU D 3 66 ? 42.378  65.524 45.580  1.00 84.43  ? 88   LEU D O   1 
ATOM   2318 C CB  . LEU D 3 66 ? 42.528  63.288 43.284  1.00 68.37  ? 88   LEU D CB  1 
ATOM   2319 C CG  . LEU D 3 66 ? 41.997  62.081 42.519  1.00 72.49  ? 88   LEU D CG  1 
ATOM   2320 C CD1 . LEU D 3 66 ? 42.290  62.244 41.028  1.00 79.49  ? 88   LEU D CD1 1 
ATOM   2321 C CD2 . LEU D 3 66 ? 42.654  60.831 43.053  1.00 78.87  ? 88   LEU D CD2 1 
ATOM   2322 N N   . PRO D 3 67 ? 44.382  64.504 45.505  1.00 64.30  ? 89   PRO D N   1 
ATOM   2323 C CA  . PRO D 3 67 ? 45.161  65.647 45.989  1.00 55.69  ? 89   PRO D CA  1 
ATOM   2324 C C   . PRO D 3 67 ? 45.472  66.474 44.758  1.00 52.10  ? 89   PRO D C   1 
ATOM   2325 O O   . PRO D 3 67 ? 45.227  66.028 43.630  1.00 50.65  ? 89   PRO D O   1 
ATOM   2326 C CB  . PRO D 3 67 ? 46.408  65.001 46.551  1.00 64.89  ? 89   PRO D CB  1 
ATOM   2327 C CG  . PRO D 3 67 ? 46.635  63.895 45.571  1.00 68.96  ? 89   PRO D CG  1 
ATOM   2328 C CD  . PRO D 3 67 ? 45.234  63.304 45.440  1.00 67.91  ? 89   PRO D CD  1 
ATOM   2329 N N   . ASP D 3 68 ? 46.041  67.654 44.959  1.00 54.51  ? 90   ASP D N   1 
ATOM   2330 C CA  . ASP D 3 68 ? 46.312  68.522 43.824  1.00 57.48  ? 90   ASP D CA  1 
ATOM   2331 C C   . ASP D 3 68 ? 47.312  68.000 42.799  1.00 59.22  ? 90   ASP D C   1 
ATOM   2332 O O   . ASP D 3 68 ? 47.192  68.304 41.610  1.00 59.00  ? 90   ASP D O   1 
ATOM   2333 C CB  . ASP D 3 68 ? 46.693  69.919 44.323  1.00 51.85  ? 90   ASP D CB  1 
ATOM   2334 C CG  . ASP D 3 68 ? 45.482  70.698 44.847  1.00 58.25  ? 90   ASP D CG  1 
ATOM   2335 O OD1 . ASP D 3 68 ? 44.422  70.068 45.116  1.00 57.30  ? 90   ASP D OD1 1 
ATOM   2336 O OD2 . ASP D 3 68 ? 45.596  71.937 44.998  1.00 63.12  ? 90   ASP D OD2 1 
ATOM   2337 N N   . GLU D 3 69 ? 48.281  67.203 43.237  1.00 67.30  ? 91   GLU D N   1 
ATOM   2338 C CA  . GLU D 3 69 ? 49.270  66.655 42.309  1.00 62.74  ? 91   GLU D CA  1 
ATOM   2339 C C   . GLU D 3 69 ? 49.551  65.205 42.565  1.00 61.34  ? 91   GLU D C   1 
ATOM   2340 O O   . GLU D 3 69 ? 49.640  64.759 43.707  1.00 65.43  ? 91   GLU D O   1 
ATOM   2341 C CB  . GLU D 3 69 ? 50.590  67.406 42.391  1.00 62.46  ? 91   GLU D CB  1 
ATOM   2342 C CG  . GLU D 3 69 ? 50.564  68.760 41.729  1.00 91.46  ? 91   GLU D CG  1 
ATOM   2343 C CD  . GLU D 3 69 ? 51.896  69.474 41.850  1.00 110.30 ? 91   GLU D CD  1 
ATOM   2344 O OE1 . GLU D 3 69 ? 52.932  68.844 41.537  1.00 113.54 ? 91   GLU D OE1 1 
ATOM   2345 O OE2 . GLU D 3 69 ? 51.910  70.661 42.253  1.00 117.13 ? 91   GLU D OE2 1 
ATOM   2346 N N   . PHE D 3 70 ? 49.711  64.466 41.483  1.00 63.08  ? 92   PHE D N   1 
ATOM   2347 C CA  . PHE D 3 70 ? 49.995  63.050 41.589  1.00 62.58  ? 92   PHE D CA  1 
ATOM   2348 C C   . PHE D 3 70 ? 50.432  62.581 40.223  1.00 59.42  ? 92   PHE D C   1 
ATOM   2349 O O   . PHE D 3 70 ? 50.347  63.329 39.236  1.00 57.04  ? 92   PHE D O   1 
ATOM   2350 C CB  . PHE D 3 70 ? 48.743  62.295 42.027  1.00 54.86  ? 92   PHE D CB  1 
ATOM   2351 C CG  . PHE D 3 70 ? 47.544  62.614 41.203  1.00 57.22  ? 92   PHE D CG  1 
ATOM   2352 C CD1 . PHE D 3 70 ? 47.325  61.972 39.993  1.00 65.41  ? 92   PHE D CD1 1 
ATOM   2353 C CD2 . PHE D 3 70 ? 46.647  63.599 41.614  1.00 57.79  ? 92   PHE D CD2 1 
ATOM   2354 C CE1 . PHE D 3 70 ? 46.220  62.306 39.197  1.00 65.94  ? 92   PHE D CE1 1 
ATOM   2355 C CE2 . PHE D 3 70 ? 45.538  63.943 40.829  1.00 50.85  ? 92   PHE D CE2 1 
ATOM   2356 C CZ  . PHE D 3 70 ? 45.327  63.294 39.614  1.00 51.30  ? 92   PHE D CZ  1 
ATOM   2357 N N   . VAL D 3 71 ? 50.917  61.349 40.173  1.00 53.21  ? 93   VAL D N   1 
ATOM   2358 C CA  . VAL D 3 71 ? 51.344  60.789 38.911  1.00 54.40  ? 93   VAL D CA  1 
ATOM   2359 C C   . VAL D 3 71 ? 50.277  59.773 38.504  1.00 56.45  ? 93   VAL D C   1 
ATOM   2360 O O   . VAL D 3 71 ? 49.568  59.212 39.355  1.00 50.91  ? 93   VAL D O   1 
ATOM   2361 C CB  . VAL D 3 71 ? 52.742  60.116 39.039  1.00 53.59  ? 93   VAL D CB  1 
ATOM   2362 C CG1 . VAL D 3 71 ? 53.754  61.136 39.547  1.00 51.66  ? 93   VAL D CG1 1 
ATOM   2363 C CG2 . VAL D 3 71 ? 52.676  58.921 39.985  1.00 61.36  ? 93   VAL D CG2 1 
ATOM   2364 N N   . VAL D 3 72 ? 50.138  59.569 37.201  1.00 62.83  ? 94   VAL D N   1 
ATOM   2365 C CA  . VAL D 3 72 ? 49.168  58.618 36.696  1.00 58.34  ? 94   VAL D CA  1 
ATOM   2366 C C   . VAL D 3 72 ? 49.804  57.611 35.767  1.00 67.38  ? 94   VAL D C   1 
ATOM   2367 O O   . VAL D 3 72 ? 50.291  57.948 34.678  1.00 71.20  ? 94   VAL D O   1 
ATOM   2368 C CB  . VAL D 3 72 ? 48.063  59.295 35.931  1.00 41.91  ? 94   VAL D CB  1 
ATOM   2369 C CG1 . VAL D 3 72 ? 47.099  58.233 35.405  1.00 30.19  ? 94   VAL D CG1 1 
ATOM   2370 C CG2 . VAL D 3 72 ? 47.367  60.281 36.835  1.00 49.29  ? 94   VAL D CG2 1 
ATOM   2371 N N   . VAL D 3 73 ? 49.791  56.365 36.212  1.00 67.26  ? 95   VAL D N   1 
ATOM   2372 C CA  . VAL D 3 73 ? 50.348  55.286 35.431  1.00 69.01  ? 95   VAL D CA  1 
ATOM   2373 C C   . VAL D 3 73 ? 49.319  54.907 34.407  1.00 70.82  ? 95   VAL D C   1 
ATOM   2374 O O   . VAL D 3 73 ? 48.409  54.123 34.681  1.00 56.90  ? 95   VAL D O   1 
ATOM   2375 C CB  . VAL D 3 73 ? 50.618  54.043 36.271  1.00 68.81  ? 95   VAL D CB  1 
ATOM   2376 C CG1 . VAL D 3 73 ? 51.253  52.964 35.392  1.00 68.40  ? 95   VAL D CG1 1 
ATOM   2377 C CG2 . VAL D 3 73 ? 51.498  54.399 37.456  1.00 58.42  ? 95   VAL D CG2 1 
ATOM   2378 N N   . THR D 3 74 ? 49.441  55.498 33.233  1.00 85.49  ? 96   THR D N   1 
ATOM   2379 C CA  . THR D 3 74 ? 48.528  55.174 32.166  1.00 92.86  ? 96   THR D CA  1 
ATOM   2380 C C   . THR D 3 74 ? 48.921  53.735 31.881  1.00 96.87  ? 96   THR D C   1 
ATOM   2381 O O   . THR D 3 74 ? 49.964  53.488 31.280  1.00 89.19  ? 96   THR D O   1 
ATOM   2382 C CB  . THR D 3 74 ? 48.793  56.054 30.933  1.00 99.78  ? 96   THR D CB  1 
ATOM   2383 O OG1 . THR D 3 74 ? 48.816  57.439 31.325  1.00 105.65 ? 96   THR D OG1 1 
ATOM   2384 C CG2 . THR D 3 74 ? 47.714  55.829 29.888  1.00 101.32 ? 96   THR D CG2 1 
ATOM   2385 N N   . ALA D 3 75 ? 48.113  52.796 32.368  1.00 107.55 ? 97   ALA D N   1 
ATOM   2386 C CA  . ALA D 3 75 ? 48.370  51.373 32.177  1.00 116.92 ? 97   ALA D CA  1 
ATOM   2387 C C   . ALA D 3 75 ? 48.451  51.075 30.694  1.00 124.14 ? 97   ALA D C   1 
ATOM   2388 O O   . ALA D 3 75 ? 47.708  50.241 30.178  1.00 128.65 ? 97   ALA D O   1 
ATOM   2389 C CB  . ALA D 3 75 ? 47.265  50.549 32.809  1.00 112.74 ? 97   ALA D CB  1 
ATOM   2390 N N   . LYS D 3 76 ? 49.365  51.773 30.027  1.00 125.81 ? 98   LYS D N   1 
ATOM   2391 C CA  . LYS D 3 76 ? 49.604  51.649 28.597  1.00 119.54 ? 98   LYS D CA  1 
ATOM   2392 C C   . LYS D 3 76 ? 50.509  50.447 28.304  1.00 117.61 ? 98   LYS D C   1 
ATOM   2393 O O   . LYS D 3 76 ? 50.136  49.612 27.456  1.00 117.21 ? 98   LYS D O   1 
ATOM   2394 C CB  . LYS D 3 76 ? 50.250  52.938 28.084  1.00 112.88 ? 98   LYS D CB  1 
ATOM   2395 C CG  . LYS D 3 76 ? 50.628  52.905 26.629  1.00 112.89 ? 98   LYS D CG  1 
ATOM   2396 C CD  . LYS D 3 76 ? 51.683  53.946 26.329  1.00 115.33 ? 98   LYS D CD  1 
ATOM   2397 C CE  . LYS D 3 76 ? 52.358  53.657 24.996  1.00 120.61 ? 98   LYS D CE  1 
ATOM   2398 N NZ  . LYS D 3 76 ? 53.654  54.383 24.862  1.00 121.55 ? 98   LYS D NZ  1 
ATOM   2399 O OXT . LYS D 3 76 ? 51.586  50.347 28.922  1.00 114.22 ? 98   LYS D OXT 1 
ATOM   2400 N N   . VAL E 4 1  ? -4.497  24.951 9.070   1.00 104.70 ? 9    VAL E N   1 
ATOM   2401 C CA  . VAL E 4 1  ? -4.625  23.702 8.254   1.00 109.49 ? 9    VAL E CA  1 
ATOM   2402 C C   . VAL E 4 1  ? -3.299  23.484 7.486   1.00 117.43 ? 9    VAL E C   1 
ATOM   2403 O O   . VAL E 4 1  ? -2.537  24.440 7.313   1.00 125.05 ? 9    VAL E O   1 
ATOM   2404 C CB  . VAL E 4 1  ? -5.857  23.814 7.309   1.00 99.88  ? 9    VAL E CB  1 
ATOM   2405 C CG1 . VAL E 4 1  ? -6.868  22.716 7.644   1.00 85.84  ? 9    VAL E CG1 1 
ATOM   2406 C CG2 . VAL E 4 1  ? -6.530  25.176 7.484   1.00 100.24 ? 9    VAL E CG2 1 
ATOM   2407 N N   . PRO E 4 2  ? -3.020  22.243 7.001   1.00 117.55 ? 10   PRO E N   1 
ATOM   2408 C CA  . PRO E 4 2  ? -1.790  21.894 6.274   1.00 117.68 ? 10   PRO E CA  1 
ATOM   2409 C C   . PRO E 4 2  ? -0.570  22.836 6.359   1.00 122.28 ? 10   PRO E C   1 
ATOM   2410 O O   . PRO E 4 2  ? -0.560  23.949 5.810   1.00 116.32 ? 10   PRO E O   1 
ATOM   2411 C CB  . PRO E 4 2  ? -2.306  21.643 4.871   1.00 111.78 ? 10   PRO E CB  1 
ATOM   2412 C CG  . PRO E 4 2  ? -3.531  20.792 5.185   1.00 106.17 ? 10   PRO E CG  1 
ATOM   2413 C CD  . PRO E 4 2  ? -4.099  21.353 6.529   1.00 113.31 ? 10   PRO E CD  1 
ATOM   2414 N N   . PRO E 4 3  ? 0.494   22.350 7.035   1.00 125.45 ? 11   PRO E N   1 
ATOM   2415 C CA  . PRO E 4 3  ? 1.833   22.844 7.392   1.00 120.59 ? 11   PRO E CA  1 
ATOM   2416 C C   . PRO E 4 3  ? 2.301   24.276 7.104   1.00 112.04 ? 11   PRO E C   1 
ATOM   2417 O O   . PRO E 4 3  ? 1.700   25.022 6.320   1.00 106.00 ? 11   PRO E O   1 
ATOM   2418 C CB  . PRO E 4 3  ? 2.740   21.798 6.765   1.00 125.94 ? 11   PRO E CB  1 
ATOM   2419 C CG  . PRO E 4 3  ? 2.024   20.534 7.141   1.00 130.02 ? 11   PRO E CG  1 
ATOM   2420 C CD  . PRO E 4 3  ? 0.524   20.869 6.998   1.00 127.40 ? 11   PRO E CD  1 
ATOM   2421 N N   . ALA E 4 4  ? 3.386   24.642 7.785   1.00 105.86 ? 12   ALA E N   1 
ATOM   2422 C CA  . ALA E 4 4  ? 4.002   25.953 7.645   1.00 97.98  ? 12   ALA E CA  1 
ATOM   2423 C C   . ALA E 4 4  ? 4.909   25.849 6.441   1.00 95.24  ? 12   ALA E C   1 
ATOM   2424 O O   . ALA E 4 4  ? 5.438   24.774 6.146   1.00 89.87  ? 12   ALA E O   1 
ATOM   2425 C CB  . ALA E 4 4  ? 4.825   26.302 8.895   1.00 87.29  ? 12   ALA E CB  1 
ATOM   2426 N N   . LEU E 4 5  ? 5.088   26.969 5.750   1.00 96.30  ? 13   LEU E N   1 
ATOM   2427 C CA  . LEU E 4 5  ? 5.927   27.001 4.562   1.00 96.01  ? 13   LEU E CA  1 
ATOM   2428 C C   . LEU E 4 5  ? 7.369   27.336 4.883   1.00 96.93  ? 13   LEU E C   1 
ATOM   2429 O O   . LEU E 4 5  ? 7.656   28.379 5.473   1.00 95.51  ? 13   LEU E O   1 
ATOM   2430 C CB  . LEU E 4 5  ? 5.392   28.019 3.563   1.00 93.91  ? 13   LEU E CB  1 
ATOM   2431 C CG  . LEU E 4 5  ? 3.932   27.842 3.151   1.00 101.22 ? 13   LEU E CG  1 
ATOM   2432 C CD1 . LEU E 4 5  ? 3.663   28.746 1.954   1.00 108.37 ? 13   LEU E CD1 1 
ATOM   2433 C CD2 . LEU E 4 5  ? 3.634   26.383 2.804   1.00 95.25  ? 13   LEU E CD2 1 
ATOM   2434 N N   . HIS E 4 6  ? 8.274   26.453 4.471   1.00 94.43  ? 14   HIS E N   1 
ATOM   2435 C CA  . HIS E 4 6  ? 9.694   26.642 4.712   1.00 86.31  ? 14   HIS E CA  1 
ATOM   2436 C C   . HIS E 4 6  ? 10.471  26.790 3.424   1.00 80.36  ? 14   HIS E C   1 
ATOM   2437 O O   . HIS E 4 6  ? 10.543  25.860 2.624   1.00 79.92  ? 14   HIS E O   1 
ATOM   2438 C CB  . HIS E 4 6  ? 10.234  25.464 5.503   1.00 85.79  ? 14   HIS E CB  1 
ATOM   2439 C CG  . HIS E 4 6  ? 9.636   25.346 6.864   1.00 92.82  ? 14   HIS E CG  1 
ATOM   2440 N ND1 . HIS E 4 6  ? 10.021  26.155 7.911   1.00 95.24  ? 14   HIS E ND1 1 
ATOM   2441 C CD2 . HIS E 4 6  ? 8.644   24.557 7.337   1.00 98.05  ? 14   HIS E CD2 1 
ATOM   2442 C CE1 . HIS E 4 6  ? 9.290   25.867 8.973   1.00 103.79 ? 14   HIS E CE1 1 
ATOM   2443 N NE2 . HIS E 4 6  ? 8.447   24.902 8.652   1.00 106.80 ? 14   HIS E NE2 1 
ATOM   2444 N N   . LEU E 4 7  ? 11.057  27.964 3.232   1.00 75.70  ? 15   LEU E N   1 
ATOM   2445 C CA  . LEU E 4 7  ? 11.836  28.224 2.035   1.00 84.03  ? 15   LEU E CA  1 
ATOM   2446 C C   . LEU E 4 7  ? 13.286  27.738 2.103   1.00 87.93  ? 15   LEU E C   1 
ATOM   2447 O O   . LEU E 4 7  ? 14.122  28.266 2.848   1.00 85.86  ? 15   LEU E O   1 
ATOM   2448 C CB  . LEU E 4 7  ? 11.819  29.720 1.699   1.00 89.50  ? 15   LEU E CB  1 
ATOM   2449 C CG  . LEU E 4 7  ? 12.619  30.219 0.477   1.00 91.10  ? 15   LEU E CG  1 
ATOM   2450 C CD1 . LEU E 4 7  ? 14.136  30.168 0.748   1.00 93.63  ? 15   LEU E CD1 1 
ATOM   2451 C CD2 . LEU E 4 7  ? 12.253  29.391 -0.753  1.00 82.86  ? 15   LEU E CD2 1 
ATOM   2452 N N   . VAL E 4 8  ? 13.577  26.726 1.299   1.00 91.75  ? 16   VAL E N   1 
ATOM   2453 C CA  . VAL E 4 8  ? 14.916  26.193 1.222   1.00 88.75  ? 16   VAL E CA  1 
ATOM   2454 C C   . VAL E 4 8  ? 15.686  27.123 0.302   1.00 95.95  ? 16   VAL E C   1 
ATOM   2455 O O   . VAL E 4 8  ? 15.483  27.138 -0.920  1.00 99.02  ? 16   VAL E O   1 
ATOM   2456 C CB  . VAL E 4 8  ? 14.906  24.784 0.647   1.00 76.48  ? 16   VAL E CB  1 
ATOM   2457 C CG1 . VAL E 4 8  ? 16.324  24.307 0.405   1.00 79.95  ? 16   VAL E CG1 1 
ATOM   2458 C CG2 . VAL E 4 8  ? 14.195  23.864 1.613   1.00 67.79  ? 16   VAL E CG2 1 
ATOM   2459 N N   . ASP E 4 9  ? 16.541  27.919 0.926   1.00 99.18  ? 17   ASP E N   1 
ATOM   2460 C CA  . ASP E 4 9  ? 17.391  28.889 0.262   1.00 106.63 ? 17   ASP E CA  1 
ATOM   2461 C C   . ASP E 4 9  ? 17.798  28.483 -1.143  1.00 113.91 ? 17   ASP E C   1 
ATOM   2462 O O   . ASP E 4 9  ? 17.657  27.330 -1.542  1.00 115.52 ? 17   ASP E O   1 
ATOM   2463 C CB  . ASP E 4 9  ? 18.641  29.088 1.098   1.00 108.66 ? 17   ASP E CB  1 
ATOM   2464 C CG  . ASP E 4 9  ? 18.408  28.758 2.543   1.00 118.50 ? 17   ASP E CG  1 
ATOM   2465 O OD1 . ASP E 4 9  ? 17.992  27.607 2.821   1.00 116.22 ? 17   ASP E OD1 1 
ATOM   2466 O OD2 . ASP E 4 9  ? 18.635  29.648 3.393   1.00 125.25 ? 17   ASP E OD2 1 
ATOM   2467 N N   . PRO E 4 10 ? 18.327  29.441 -1.911  1.00 122.53 ? 18   PRO E N   1 
ATOM   2468 C CA  . PRO E 4 10 ? 18.782  29.243 -3.289  1.00 127.88 ? 18   PRO E CA  1 
ATOM   2469 C C   . PRO E 4 10 ? 19.889  28.198 -3.303  1.00 128.49 ? 18   PRO E C   1 
ATOM   2470 O O   . PRO E 4 10 ? 19.928  27.323 -4.177  1.00 128.44 ? 18   PRO E O   1 
ATOM   2471 C CB  . PRO E 4 10 ? 19.306  30.622 -3.680  1.00 133.62 ? 18   PRO E CB  1 
ATOM   2472 C CG  . PRO E 4 10 ? 18.538  31.550 -2.799  1.00 135.14 ? 18   PRO E CG  1 
ATOM   2473 C CD  . PRO E 4 10 ? 18.548  30.831 -1.488  1.00 128.55 ? 18   PRO E CD  1 
ATOM   2474 N N   . GLN E 4 11 ? 20.789  28.326 -2.326  1.00 125.57 ? 19   GLN E N   1 
ATOM   2475 C CA  . GLN E 4 11 ? 21.919  27.422 -2.127  1.00 119.19 ? 19   GLN E CA  1 
ATOM   2476 C C   . GLN E 4 11 ? 21.546  26.019 -2.616  1.00 116.81 ? 19   GLN E C   1 
ATOM   2477 O O   . GLN E 4 11 ? 22.368  25.312 -3.198  1.00 121.51 ? 19   GLN E O   1 
ATOM   2478 C CB  . GLN E 4 11 ? 22.246  27.369 -0.634  1.00 119.84 ? 19   GLN E CB  1 
ATOM   2479 C CG  . GLN E 4 11 ? 21.055  26.850 0.182   1.00 131.78 ? 19   GLN E CG  1 
ATOM   2480 C CD  . GLN E 4 11 ? 21.218  26.982 1.685   1.00 133.60 ? 19   GLN E CD  1 
ATOM   2481 O OE1 . GLN E 4 11 ? 20.413  26.445 2.457   1.00 125.26 ? 19   GLN E OE1 1 
ATOM   2482 N NE2 . GLN E 4 11 ? 22.249  27.701 2.111   1.00 137.62 ? 19   GLN E NE2 1 
ATOM   2483 N N   . ILE E 4 12 ? 20.290  25.643 -2.373  1.00 107.63 ? 20   ILE E N   1 
ATOM   2484 C CA  . ILE E 4 12 ? 19.746  24.342 -2.749  1.00 94.44  ? 20   ILE E CA  1 
ATOM   2485 C C   . ILE E 4 12 ? 18.427  24.490 -3.499  1.00 94.25  ? 20   ILE E C   1 
ATOM   2486 O O   . ILE E 4 12 ? 17.468  25.078 -2.992  1.00 96.03  ? 20   ILE E O   1 
ATOM   2487 C CB  . ILE E 4 12 ? 19.454  23.507 -1.516  1.00 87.12  ? 20   ILE E CB  1 
ATOM   2488 C CG1 . ILE E 4 12 ? 20.693  23.436 -0.639  1.00 81.26  ? 20   ILE E CG1 1 
ATOM   2489 C CG2 . ILE E 4 12 ? 18.977  22.135 -1.923  1.00 81.71  ? 20   ILE E CG2 1 
ATOM   2490 C CD1 . ILE E 4 12 ? 20.356  23.284 0.837   1.00 91.90  ? 20   ILE E CD1 1 
ATOM   2491 N N   . GLN E 4 13 ? 18.370  23.934 -4.699  1.00 89.13  ? 21   GLN E N   1 
ATOM   2492 C CA  . GLN E 4 13 ? 17.158  24.008 -5.496  1.00 79.99  ? 21   GLN E CA  1 
ATOM   2493 C C   . GLN E 4 13 ? 17.022  22.783 -6.355  1.00 72.99  ? 21   GLN E C   1 
ATOM   2494 O O   . GLN E 4 13 ? 18.002  22.096 -6.621  1.00 81.28  ? 21   GLN E O   1 
ATOM   2495 C CB  . GLN E 4 13 ? 17.199  25.230 -6.387  1.00 84.85  ? 21   GLN E CB  1 
ATOM   2496 C CG  . GLN E 4 13 ? 17.088  26.512 -5.631  1.00 99.65  ? 21   GLN E CG  1 
ATOM   2497 C CD  . GLN E 4 13 ? 17.088  27.689 -6.552  1.00 106.81 ? 21   GLN E CD  1 
ATOM   2498 O OE1 . GLN E 4 13 ? 16.480  27.651 -7.622  1.00 113.74 ? 21   GLN E OE1 1 
ATOM   2499 N NE2 . GLN E 4 13 ? 17.760  28.753 -6.147  1.00 103.88 ? 21   GLN E NE2 1 
ATOM   2500 N N   . LEU E 4 14 ? 15.806  22.503 -6.796  1.00 62.21  ? 22   LEU E N   1 
ATOM   2501 C CA  . LEU E 4 14 ? 15.600  21.345 -7.640  1.00 61.05  ? 22   LEU E CA  1 
ATOM   2502 C C   . LEU E 4 14 ? 15.944  21.709 -9.077  1.00 78.59  ? 22   LEU E C   1 
ATOM   2503 O O   . LEU E 4 14 ? 15.974  22.891 -9.434  1.00 86.26  ? 22   LEU E O   1 
ATOM   2504 C CB  . LEU E 4 14 ? 14.157  20.876 -7.560  1.00 33.90  ? 22   LEU E CB  1 
ATOM   2505 C CG  . LEU E 4 14 ? 14.087  19.354 -7.455  1.00 47.59  ? 22   LEU E CG  1 
ATOM   2506 C CD1 . LEU E 4 14 ? 14.935  18.867 -6.285  1.00 51.98  ? 22   LEU E CD1 1 
ATOM   2507 C CD2 . LEU E 4 14 ? 12.646  18.923 -7.266  1.00 50.55  ? 22   LEU E CD2 1 
ATOM   2508 N N   . THR E 4 15 ? 16.231  20.692 -9.889  1.00 91.37  ? 23   THR E N   1 
ATOM   2509 C CA  . THR E 4 15 ? 16.563  20.883 -11.303 1.00 95.49  ? 23   THR E CA  1 
ATOM   2510 C C   . THR E 4 15 ? 15.876  19.800 -12.118 1.00 98.95  ? 23   THR E C   1 
ATOM   2511 O O   . THR E 4 15 ? 15.720  18.653 -11.671 1.00 93.52  ? 23   THR E O   1 
ATOM   2512 C CB  . THR E 4 15 ? 18.082  20.801 -11.575 1.00 92.36  ? 23   THR E CB  1 
ATOM   2513 O OG1 . THR E 4 15 ? 18.762  21.791 -10.799 1.00 86.90  ? 23   THR E OG1 1 
ATOM   2514 C CG2 . THR E 4 15 ? 18.370  21.061 -13.050 1.00 92.76  ? 23   THR E CG2 1 
ATOM   2515 N N   . ILE E 4 16 ? 15.461  20.169 -13.319 1.00 105.05 ? 24   ILE E N   1 
ATOM   2516 C CA  . ILE E 4 16 ? 14.771  19.224 -14.170 1.00 111.61 ? 24   ILE E CA  1 
ATOM   2517 C C   . ILE E 4 16 ? 15.430  19.076 -15.529 1.00 126.20 ? 24   ILE E C   1 
ATOM   2518 O O   . ILE E 4 16 ? 16.252  19.902 -15.920 1.00 131.99 ? 24   ILE E O   1 
ATOM   2519 C CB  . ILE E 4 16 ? 13.330  19.653 -14.376 1.00 94.71  ? 24   ILE E CB  1 
ATOM   2520 C CG1 . ILE E 4 16 ? 12.885  20.572 -13.228 1.00 85.56  ? 24   ILE E CG1 1 
ATOM   2521 C CG2 . ILE E 4 16 ? 12.460  18.421 -14.480 1.00 90.84  ? 24   ILE E CG2 1 
ATOM   2522 C CD1 . ILE E 4 16 ? 12.954  19.944 -11.839 1.00 81.10  ? 24   ILE E CD1 1 
ATOM   2523 N N   . THR E 4 17 ? 15.063  18.013 -16.238 1.00 136.10 ? 25   THR E N   1 
ATOM   2524 C CA  . THR E 4 17 ? 15.599  17.735 -17.566 1.00 146.87 ? 25   THR E CA  1 
ATOM   2525 C C   . THR E 4 17 ? 15.664  18.990 -18.443 1.00 153.54 ? 25   THR E C   1 
ATOM   2526 O O   . THR E 4 17 ? 14.739  19.278 -19.207 1.00 154.92 ? 25   THR E O   1 
ATOM   2527 C CB  . THR E 4 17 ? 14.752  16.653 -18.278 1.00 149.22 ? 25   THR E CB  1 
ATOM   2528 O OG1 . THR E 4 17 ? 13.360  16.905 -18.050 1.00 146.05 ? 25   THR E OG1 1 
ATOM   2529 C CG2 . THR E 4 17 ? 15.102  15.270 -17.755 1.00 148.78 ? 25   THR E CG2 1 
ATOM   2530 N N   . ASP E 4 18 ? 16.779  19.712 -18.310 1.00 158.10 ? 39   ASP E N   1 
ATOM   2531 C CA  . ASP E 4 18 ? 17.089  20.960 -19.025 1.00 158.30 ? 39   ASP E CA  1 
ATOM   2532 C C   . ASP E 4 18 ? 17.242  22.081 -17.990 1.00 151.83 ? 39   ASP E C   1 
ATOM   2533 O O   . ASP E 4 18 ? 16.470  22.167 -17.037 1.00 153.70 ? 39   ASP E O   1 
ATOM   2534 C CB  . ASP E 4 18 ? 15.998  21.327 -20.044 1.00 162.55 ? 39   ASP E CB  1 
ATOM   2535 C CG  . ASP E 4 18 ? 16.486  22.312 -21.098 1.00 166.02 ? 39   ASP E CG  1 
ATOM   2536 O OD1 . ASP E 4 18 ? 17.335  21.931 -21.937 1.00 164.96 ? 39   ASP E OD1 1 
ATOM   2537 O OD2 . ASP E 4 18 ? 16.023  23.472 -21.083 1.00 168.75 ? 39   ASP E OD2 1 
ATOM   2538 N N   . PRO E 4 19 ? 18.246  22.953 -18.170 1.00 142.30 ? 40   PRO E N   1 
ATOM   2539 C CA  . PRO E 4 19 ? 18.513  24.068 -17.257 1.00 133.37 ? 40   PRO E CA  1 
ATOM   2540 C C   . PRO E 4 19 ? 17.302  24.830 -16.694 1.00 127.44 ? 40   PRO E C   1 
ATOM   2541 O O   . PRO E 4 19 ? 17.040  25.966 -17.089 1.00 132.54 ? 40   PRO E O   1 
ATOM   2542 C CB  . PRO E 4 19 ? 19.451  24.968 -18.076 1.00 133.65 ? 40   PRO E CB  1 
ATOM   2543 C CG  . PRO E 4 19 ? 19.200  24.550 -19.521 1.00 134.42 ? 40   PRO E CG  1 
ATOM   2544 C CD  . PRO E 4 19 ? 19.072  23.070 -19.384 1.00 138.47 ? 40   PRO E CD  1 
ATOM   2545 N N   . LYS E 4 20 ? 16.577  24.205 -15.765 1.00 117.39 ? 41   LYS E N   1 
ATOM   2546 C CA  . LYS E 4 20 ? 15.413  24.826 -15.118 1.00 103.05 ? 41   LYS E CA  1 
ATOM   2547 C C   . LYS E 4 20 ? 15.449  24.501 -13.615 1.00 98.59  ? 41   LYS E C   1 
ATOM   2548 O O   . LYS E 4 20 ? 15.138  23.385 -13.191 1.00 94.90  ? 41   LYS E O   1 
ATOM   2549 C CB  . LYS E 4 20 ? 14.110  24.325 -15.758 1.00 96.77  ? 41   LYS E CB  1 
ATOM   2550 C CG  . LYS E 4 20 ? 13.834  22.842 -15.562 1.00 95.60  ? 41   LYS E CG  1 
ATOM   2551 C CD  . LYS E 4 20 ? 12.708  22.339 -16.463 1.00 99.91  ? 41   LYS E CD  1 
ATOM   2552 C CE  . LYS E 4 20 ? 13.171  22.184 -17.915 1.00 103.70 ? 41   LYS E CE  1 
ATOM   2553 N NZ  . LYS E 4 20 ? 12.100  21.657 -18.831 1.00 102.31 ? 41   LYS E NZ  1 
ATOM   2554 N N   . VAL E 4 21 ? 15.850  25.490 -12.819 1.00 99.51  ? 42   VAL E N   1 
ATOM   2555 C CA  . VAL E 4 21 ? 15.975  25.327 -11.374 1.00 100.38 ? 42   VAL E CA  1 
ATOM   2556 C C   . VAL E 4 21 ? 14.936  26.092 -10.568 1.00 102.12 ? 42   VAL E C   1 
ATOM   2557 O O   . VAL E 4 21 ? 14.739  27.295 -10.753 1.00 105.09 ? 42   VAL E O   1 
ATOM   2558 C CB  . VAL E 4 21 ? 17.351  25.784 -10.890 1.00 102.68 ? 42   VAL E CB  1 
ATOM   2559 C CG1 . VAL E 4 21 ? 17.551  25.381 -9.437  1.00 100.27 ? 42   VAL E CG1 1 
ATOM   2560 C CG2 . VAL E 4 21 ? 18.424  25.194 -11.775 1.00 108.84 ? 42   VAL E CG2 1 
ATOM   2561 N N   . TYR E 4 22 ? 14.298  25.382 -9.646  1.00 97.58  ? 43   TYR E N   1 
ATOM   2562 C CA  . TYR E 4 22 ? 13.272  25.964 -8.803  1.00 91.65  ? 43   TYR E CA  1 
ATOM   2563 C C   . TYR E 4 22 ? 13.650  25.820 -7.348  1.00 84.15  ? 43   TYR E C   1 
ATOM   2564 O O   . TYR E 4 22 ? 14.044  24.743 -6.911  1.00 85.14  ? 43   TYR E O   1 
ATOM   2565 C CB  . TYR E 4 22 ? 11.935  25.258 -9.033  1.00 98.03  ? 43   TYR E CB  1 
ATOM   2566 C CG  . TYR E 4 22 ? 11.578  25.086 -10.491 1.00 103.16 ? 43   TYR E CG  1 
ATOM   2567 C CD1 . TYR E 4 22 ? 12.159  24.076 -11.254 1.00 105.80 ? 43   TYR E CD1 1 
ATOM   2568 C CD2 . TYR E 4 22 ? 10.670  25.942 -11.110 1.00 106.96 ? 43   TYR E CD2 1 
ATOM   2569 C CE1 . TYR E 4 22 ? 11.846  23.921 -12.597 1.00 115.10 ? 43   TYR E CE1 1 
ATOM   2570 C CE2 . TYR E 4 22 ? 10.351  25.798 -12.452 1.00 114.37 ? 43   TYR E CE2 1 
ATOM   2571 C CZ  . TYR E 4 22 ? 10.941  24.784 -13.190 1.00 119.33 ? 43   TYR E CZ  1 
ATOM   2572 O OH  . TYR E 4 22 ? 10.625  24.628 -14.521 1.00 124.50 ? 43   TYR E OH  1 
ATOM   2573 N N   . PRO E 4 23 ? 13.551  26.911 -6.577  1.00 83.95  ? 44   PRO E N   1 
ATOM   2574 C CA  . PRO E 4 23 ? 13.891  26.841 -5.157  1.00 81.49  ? 44   PRO E CA  1 
ATOM   2575 C C   . PRO E 4 23 ? 12.893  25.875 -4.559  1.00 77.59  ? 44   PRO E C   1 
ATOM   2576 O O   . PRO E 4 23 ? 11.869  25.545 -5.189  1.00 67.42  ? 44   PRO E O   1 
ATOM   2577 C CB  . PRO E 4 23 ? 13.702  28.271 -4.680  1.00 85.50  ? 44   PRO E CB  1 
ATOM   2578 C CG  . PRO E 4 23 ? 12.602  28.758 -5.570  1.00 93.58  ? 44   PRO E CG  1 
ATOM   2579 C CD  . PRO E 4 23 ? 13.018  28.236 -6.922  1.00 89.52  ? 44   PRO E CD  1 
ATOM   2580 N N   . ILE E 4 24 ? 13.172  25.429 -3.345  1.00 73.87  ? 45   ILE E N   1 
ATOM   2581 C CA  . ILE E 4 24 ? 12.309  24.433 -2.739  1.00 71.98  ? 45   ILE E CA  1 
ATOM   2582 C C   . ILE E 4 24 ? 11.508  24.919 -1.537  1.00 71.74  ? 45   ILE E C   1 
ATOM   2583 O O   . ILE E 4 24 ? 11.992  25.702 -0.721  1.00 71.21  ? 45   ILE E O   1 
ATOM   2584 C CB  . ILE E 4 24 ? 13.165  23.169 -2.378  1.00 65.30  ? 45   ILE E CB  1 
ATOM   2585 C CG1 . ILE E 4 24 ? 14.049  22.799 -3.590  1.00 53.79  ? 45   ILE E CG1 1 
ATOM   2586 C CG2 . ILE E 4 24 ? 12.256  21.982 -2.002  1.00 54.64  ? 45   ILE E CG2 1 
ATOM   2587 C CD1 . ILE E 4 24 ? 15.118  21.732 -3.341  1.00 48.00  ? 45   ILE E CD1 1 
ATOM   2588 N N   . ILE E 4 25 ? 10.268  24.446 -1.461  1.00 71.52  ? 46   ILE E N   1 
ATOM   2589 C CA  . ILE E 4 25 ? 9.347   24.785 -0.379  1.00 78.00  ? 46   ILE E CA  1 
ATOM   2590 C C   . ILE E 4 25 ? 8.889   23.497 0.294   1.00 81.90  ? 46   ILE E C   1 
ATOM   2591 O O   . ILE E 4 25 ? 8.520   22.528 -0.381  1.00 80.13  ? 46   ILE E O   1 
ATOM   2592 C CB  . ILE E 4 25 ? 8.111   25.550 -0.914  1.00 81.79  ? 46   ILE E CB  1 
ATOM   2593 C CG1 . ILE E 4 25 ? 8.563   26.876 -1.536  1.00 82.89  ? 46   ILE E CG1 1 
ATOM   2594 C CG2 . ILE E 4 25 ? 7.096   25.783 0.202   1.00 71.70  ? 46   ILE E CG2 1 
ATOM   2595 C CD1 . ILE E 4 25 ? 9.465   27.719 -0.645  1.00 66.69  ? 46   ILE E CD1 1 
ATOM   2596 N N   . LEU E 4 26 ? 8.884   23.500 1.624   1.00 86.92  ? 47   LEU E N   1 
ATOM   2597 C CA  . LEU E 4 26 ? 8.525   22.308 2.373   1.00 91.62  ? 47   LEU E CA  1 
ATOM   2598 C C   . LEU E 4 26 ? 7.304   22.425 3.276   1.00 98.64  ? 47   LEU E C   1 
ATOM   2599 O O   . LEU E 4 26 ? 7.169   23.385 4.039   1.00 94.66  ? 47   LEU E O   1 
ATOM   2600 C CB  . LEU E 4 26 ? 9.736   21.889 3.198   1.00 90.61  ? 47   LEU E CB  1 
ATOM   2601 C CG  . LEU E 4 26 ? 11.048  22.212 2.468   1.00 91.64  ? 47   LEU E CG  1 
ATOM   2602 C CD1 . LEU E 4 26 ? 12.224  22.057 3.409   1.00 93.80  ? 47   LEU E CD1 1 
ATOM   2603 C CD2 . LEU E 4 26 ? 11.197  21.312 1.250   1.00 90.73  ? 47   LEU E CD2 1 
ATOM   2604 N N   . ARG E 4 27 ? 6.418   21.436 3.176   1.00 110.28 ? 48   ARG E N   1 
ATOM   2605 C CA  . ARG E 4 27 ? 5.220   21.381 4.007   1.00 123.29 ? 48   ARG E CA  1 
ATOM   2606 C C   . ARG E 4 27 ? 5.720   20.901 5.355   1.00 128.07 ? 48   ARG E C   1 
ATOM   2607 O O   . ARG E 4 27 ? 5.449   21.499 6.401   1.00 130.19 ? 48   ARG E O   1 
ATOM   2608 C CB  . ARG E 4 27 ? 4.233   20.356 3.453   1.00 131.13 ? 48   ARG E CB  1 
ATOM   2609 C CG  . ARG E 4 27 ? 3.788   20.645 2.049   1.00 143.52 ? 48   ARG E CG  1 
ATOM   2610 C CD  . ARG E 4 27 ? 2.283   20.834 1.973   1.00 160.75 ? 48   ARG E CD  1 
ATOM   2611 N NE  . ARG E 4 27 ? 1.754   21.828 2.915   1.00 174.48 ? 48   ARG E NE  1 
ATOM   2612 C CZ  . ARG E 4 27 ? 2.300   23.018 3.168   1.00 178.64 ? 48   ARG E CZ  1 
ATOM   2613 N NH1 . ARG E 4 27 ? 3.420   23.392 2.562   1.00 180.42 ? 48   ARG E NH1 1 
ATOM   2614 N NH2 . ARG E 4 27 ? 1.706   23.854 4.012   1.00 175.97 ? 48   ARG E NH2 1 
ATOM   2615 N N   . LEU E 4 28 ? 6.467   19.804 5.296   1.00 126.92 ? 49   LEU E N   1 
ATOM   2616 C CA  . LEU E 4 28 ? 7.062   19.183 6.463   1.00 123.96 ? 49   LEU E CA  1 
ATOM   2617 C C   . LEU E 4 28 ? 6.069   18.776 7.539   1.00 126.41 ? 49   LEU E C   1 
ATOM   2618 O O   . LEU E 4 28 ? 5.600   19.590 8.331   1.00 126.55 ? 49   LEU E O   1 
ATOM   2619 C CB  . LEU E 4 28 ? 8.180   20.090 7.031   1.00 116.37 ? 49   LEU E CB  1 
ATOM   2620 C CG  . LEU E 4 28 ? 8.332   20.646 8.459   1.00 107.16 ? 49   LEU E CG  1 
ATOM   2621 C CD1 . LEU E 4 28 ? 7.323   21.754 8.666   1.00 103.70 ? 49   LEU E CD1 1 
ATOM   2622 C CD2 . LEU E 4 28 ? 8.190   19.550 9.515   1.00 100.84 ? 49   LEU E CD2 1 
ATOM   2623 N N   . GLY E 4 29 ? 5.722   17.497 7.514   1.00 130.03 ? 50   GLY E N   1 
ATOM   2624 C CA  . GLY E 4 29 ? 4.852   16.936 8.523   1.00 137.68 ? 50   GLY E CA  1 
ATOM   2625 C C   . GLY E 4 29 ? 5.909   16.239 9.354   1.00 144.62 ? 50   GLY E C   1 
ATOM   2626 O O   . GLY E 4 29 ? 5.806   16.084 10.571  1.00 149.40 ? 50   GLY E O   1 
ATOM   2627 N N   . SER E 4 30 ? 6.958   15.835 8.642   1.00 147.22 ? 51   SER E N   1 
ATOM   2628 C CA  . SER E 4 30 ? 8.120   15.164 9.208   1.00 144.25 ? 51   SER E CA  1 
ATOM   2629 C C   . SER E 4 30 ? 9.272   16.142 9.033   1.00 138.06 ? 51   SER E C   1 
ATOM   2630 O O   . SER E 4 30 ? 9.153   17.104 8.277   1.00 136.25 ? 51   SER E O   1 
ATOM   2631 C CB  . SER E 4 30 ? 8.414   13.878 8.434   1.00 147.89 ? 51   SER E CB  1 
ATOM   2632 O OG  . SER E 4 30 ? 8.623   14.152 7.059   1.00 151.73 ? 51   SER E OG  1 
ATOM   2633 N N   . ASN E 4 31 ? 10.385  15.904 9.714   1.00 133.86 ? 52   ASN E N   1 
ATOM   2634 C CA  . ASN E 4 31 ? 11.515  16.813 9.589   1.00 139.30 ? 52   ASN E CA  1 
ATOM   2635 C C   . ASN E 4 31 ? 12.687  16.200 8.808   1.00 134.73 ? 52   ASN E C   1 
ATOM   2636 O O   . ASN E 4 31 ? 13.794  16.046 9.333   1.00 142.97 ? 52   ASN E O   1 
ATOM   2637 C CB  . ASN E 4 31 ? 11.968  17.275 10.980  1.00 152.42 ? 52   ASN E CB  1 
ATOM   2638 C CG  . ASN E 4 31 ? 12.681  18.619 10.949  1.00 164.98 ? 52   ASN E CG  1 
ATOM   2639 O OD1 . ASN E 4 31 ? 13.819  18.725 10.484  1.00 172.19 ? 52   ASN E OD1 1 
ATOM   2640 N ND2 . ASN E 4 31 ? 12.007  19.658 11.440  1.00 168.45 ? 52   ASN E ND2 1 
ATOM   2641 N N   . LEU E 4 32 ? 12.417  15.872 7.544   1.00 123.40 ? 53   LEU E N   1 
ATOM   2642 C CA  . LEU E 4 32 ? 13.384  15.280 6.612   1.00 109.70 ? 53   LEU E CA  1 
ATOM   2643 C C   . LEU E 4 32 ? 14.875  15.511 6.847   1.00 107.33 ? 53   LEU E C   1 
ATOM   2644 O O   . LEU E 4 32 ? 15.312  16.600 7.249   1.00 104.69 ? 53   LEU E O   1 
ATOM   2645 C CB  . LEU E 4 32 ? 13.066  15.730 5.186   1.00 100.67 ? 53   LEU E CB  1 
ATOM   2646 C CG  . LEU E 4 32 ? 12.108  14.888 4.346   1.00 91.48  ? 53   LEU E CG  1 
ATOM   2647 C CD1 . LEU E 4 32 ? 10.805  14.637 5.104   1.00 89.61  ? 53   LEU E CD1 1 
ATOM   2648 C CD2 . LEU E 4 32 ? 11.867  15.611 3.016   1.00 75.94  ? 53   LEU E CD2 1 
ATOM   2649 N N   . SER E 4 33 ? 15.648  14.467 6.559   1.00 101.41 ? 54   SER E N   1 
ATOM   2650 C CA  . SER E 4 33 ? 17.099  14.512 6.692   1.00 94.81  ? 54   SER E CA  1 
ATOM   2651 C C   . SER E 4 33 ? 17.761  14.370 5.332   1.00 86.02  ? 54   SER E C   1 
ATOM   2652 O O   . SER E 4 33 ? 17.342  13.563 4.510   1.00 84.91  ? 54   SER E O   1 
ATOM   2653 C CB  . SER E 4 33 ? 17.600  13.384 7.578   1.00 102.95 ? 54   SER E CB  1 
ATOM   2654 O OG  . SER E 4 33 ? 19.013  13.308 7.491   1.00 113.93 ? 54   SER E OG  1 
ATOM   2655 N N   . LEU E 4 34 ? 18.810  15.142 5.105   1.00 81.68  ? 55   LEU E N   1 
ATOM   2656 C CA  . LEU E 4 34 ? 19.502  15.074 3.837   1.00 80.45  ? 55   LEU E CA  1 
ATOM   2657 C C   . LEU E 4 34 ? 20.996  14.850 4.027   1.00 80.01  ? 55   LEU E C   1 
ATOM   2658 O O   . LEU E 4 34 ? 21.623  15.471 4.887   1.00 85.54  ? 55   LEU E O   1 
ATOM   2659 C CB  . LEU E 4 34 ? 19.252  16.356 3.066   1.00 75.03  ? 55   LEU E CB  1 
ATOM   2660 C CG  . LEU E 4 34 ? 19.985  16.382 1.739   1.00 81.08  ? 55   LEU E CG  1 
ATOM   2661 C CD1 . LEU E 4 34 ? 19.712  15.107 0.930   1.00 77.60  ? 55   LEU E CD1 1 
ATOM   2662 C CD2 . LEU E 4 34 ? 19.529  17.610 1.002   1.00 73.77  ? 55   LEU E CD2 1 
ATOM   2663 N N   . SER E 4 35 ? 21.566  13.963 3.220   1.00 74.21  ? 56   SER E N   1 
ATOM   2664 C CA  . SER E 4 35 ? 22.987  13.666 3.335   1.00 72.11  ? 56   SER E CA  1 
ATOM   2665 C C   . SER E 4 35 ? 23.669  13.398 2.003   1.00 69.06  ? 56   SER E C   1 
ATOM   2666 O O   . SER E 4 35 ? 23.077  12.834 1.085   1.00 71.07  ? 56   SER E O   1 
ATOM   2667 C CB  . SER E 4 35 ? 23.197  12.471 4.280   1.00 69.67  ? 56   SER E CB  1 
ATOM   2668 O OG  . SER E 4 35 ? 22.164  11.505 4.120   1.00 77.32  ? 56   SER E OG  1 
ATOM   2669 N N   . MET E 4 36 ? 24.923  13.823 1.911   1.00 64.69  ? 57   MET E N   1 
ATOM   2670 C CA  . MET E 4 36 ? 25.711  13.621 0.711   1.00 65.50  ? 57   MET E CA  1 
ATOM   2671 C C   . MET E 4 36 ? 26.469  12.317 0.846   1.00 71.37  ? 57   MET E C   1 
ATOM   2672 O O   . MET E 4 36 ? 27.171  12.103 1.829   1.00 74.86  ? 57   MET E O   1 
ATOM   2673 C CB  . MET E 4 36 ? 26.718  14.744 0.533   1.00 55.38  ? 57   MET E CB  1 
ATOM   2674 C CG  . MET E 4 36 ? 27.659  14.528 -0.633  1.00 64.52  ? 57   MET E CG  1 
ATOM   2675 S SD  . MET E 4 36 ? 26.800  14.641 -2.212  1.00 63.39  ? 57   MET E SD  1 
ATOM   2676 C CE  . MET E 4 36 ? 26.593  16.440 -2.272  1.00 62.02  ? 57   MET E CE  1 
ATOM   2677 N N   . ALA E 4 37 ? 26.336  11.454 -0.151  1.00 74.56  ? 58   ALA E N   1 
ATOM   2678 C CA  . ALA E 4 37 ? 27.022  10.170 -0.143  1.00 79.80  ? 58   ALA E CA  1 
ATOM   2679 C C   . ALA E 4 37 ? 28.118  10.105 -1.222  1.00 84.18  ? 58   ALA E C   1 
ATOM   2680 O O   . ALA E 4 37 ? 28.005  10.751 -2.270  1.00 81.30  ? 58   ALA E O   1 
ATOM   2681 C CB  . ALA E 4 37 ? 26.007  9.055  -0.347  1.00 79.56  ? 58   ALA E CB  1 
ATOM   2682 N N   . ARG E 4 38 ? 29.172  9.325  -0.948  1.00 91.88  ? 59   ARG E N   1 
ATOM   2683 C CA  . ARG E 4 38 ? 30.319  9.141  -1.860  1.00 95.25  ? 59   ARG E CA  1 
ATOM   2684 C C   . ARG E 4 38 ? 30.941  7.726  -1.736  1.00 90.14  ? 59   ARG E C   1 
ATOM   2685 O O   . ARG E 4 38 ? 31.000  7.161  -0.641  1.00 84.56  ? 59   ARG E O   1 
ATOM   2686 C CB  . ARG E 4 38 ? 31.409  10.185 -1.554  1.00 106.41 ? 59   ARG E CB  1 
ATOM   2687 C CG  . ARG E 4 38 ? 30.929  11.637 -1.466  1.00 119.78 ? 59   ARG E CG  1 
ATOM   2688 C CD  . ARG E 4 38 ? 31.892  12.495 -0.634  1.00 136.64 ? 59   ARG E CD  1 
ATOM   2689 N NE  . ARG E 4 38 ? 31.355  13.828 -0.359  1.00 143.97 ? 59   ARG E NE  1 
ATOM   2690 C CZ  . ARG E 4 38 ? 31.415  14.851 -1.205  1.00 148.04 ? 59   ARG E CZ  1 
ATOM   2691 N NH1 . ARG E 4 38 ? 31.997  14.703 -2.383  1.00 150.20 ? 59   ARG E NH1 1 
ATOM   2692 N NH2 . ARG E 4 38 ? 30.884  16.020 -0.877  1.00 150.10 ? 59   ARG E NH2 1 
ATOM   2693 N N   . ARG E 4 39 ? 31.411  7.165  -2.852  1.00 88.11  ? 60   ARG E N   1 
ATOM   2694 C CA  . ARG E 4 39 ? 32.034  5.834  -2.849  1.00 83.79  ? 60   ARG E CA  1 
ATOM   2695 C C   . ARG E 4 39 ? 33.382  5.802  -2.138  1.00 85.94  ? 60   ARG E C   1 
ATOM   2696 O O   . ARG E 4 39 ? 34.215  6.701  -2.300  1.00 87.35  ? 60   ARG E O   1 
ATOM   2697 C CB  . ARG E 4 39 ? 32.259  5.333  -4.278  1.00 74.35  ? 60   ARG E CB  1 
ATOM   2698 C CG  . ARG E 4 39 ? 31.039  4.781  -4.951  1.00 71.88  ? 60   ARG E CG  1 
ATOM   2699 C CD  . ARG E 4 39 ? 31.152  3.289  -5.134  1.00 75.01  ? 60   ARG E CD  1 
ATOM   2700 N NE  . ARG E 4 39 ? 29.912  2.702  -5.647  1.00 87.50  ? 60   ARG E NE  1 
ATOM   2701 C CZ  . ARG E 4 39 ? 29.307  3.070  -6.777  1.00 78.88  ? 60   ARG E CZ  1 
ATOM   2702 N NH1 . ARG E 4 39 ? 29.825  4.041  -7.528  1.00 60.58  ? 60   ARG E NH1 1 
ATOM   2703 N NH2 . ARG E 4 39 ? 28.192  2.454  -7.168  1.00 78.01  ? 60   ARG E NH2 1 
ATOM   2704 N N   . ASN E 4 40 ? 33.601  4.753  -1.357  1.00 85.94  ? 61   ASN E N   1 
ATOM   2705 C CA  . ASN E 4 40 ? 34.866  4.592  -0.656  1.00 84.36  ? 61   ASN E CA  1 
ATOM   2706 C C   . ASN E 4 40 ? 35.787  3.861  -1.622  1.00 79.15  ? 61   ASN E C   1 
ATOM   2707 O O   . ASN E 4 40 ? 35.942  2.643  -1.550  1.00 77.40  ? 61   ASN E O   1 
ATOM   2708 C CB  . ASN E 4 40 ? 34.661  3.777  0.618   1.00 93.73  ? 61   ASN E CB  1 
ATOM   2709 C CG  . ASN E 4 40 ? 35.965  3.384  1.273   1.00 107.09 ? 61   ASN E CG  1 
ATOM   2710 O OD1 . ASN E 4 40 ? 36.858  4.213  1.458   1.00 114.53 ? 61   ASN E OD1 1 
ATOM   2711 N ND2 . ASN E 4 40 ? 36.081  2.109  1.638   1.00 107.73 ? 61   ASN E ND2 1 
ATOM   2712 N N   . LEU E 4 41 ? 36.387  4.623  -2.531  1.00 75.03  ? 62   LEU E N   1 
ATOM   2713 C CA  . LEU E 4 41 ? 37.265  4.063  -3.543  1.00 80.09  ? 62   LEU E CA  1 
ATOM   2714 C C   . LEU E 4 41 ? 38.740  3.955  -3.177  1.00 92.79  ? 62   LEU E C   1 
ATOM   2715 O O   . LEU E 4 41 ? 39.576  3.781  -4.064  1.00 99.30  ? 62   LEU E O   1 
ATOM   2716 C CB  . LEU E 4 41 ? 37.152  4.875  -4.829  1.00 70.36  ? 62   LEU E CB  1 
ATOM   2717 C CG  . LEU E 4 41 ? 35.795  4.898  -5.533  1.00 73.82  ? 62   LEU E CG  1 
ATOM   2718 C CD1 . LEU E 4 41 ? 35.983  5.543  -6.908  1.00 71.44  ? 62   LEU E CD1 1 
ATOM   2719 C CD2 . LEU E 4 41 ? 35.229  3.487  -5.677  1.00 72.77  ? 62   LEU E CD2 1 
ATOM   2720 N N   . ASP E 4 42 ? 39.072  4.042  -1.893  1.00 99.22  ? 63   ASP E N   1 
ATOM   2721 C CA  . ASP E 4 42 ? 40.477  3.968  -1.477  1.00 97.67  ? 63   ASP E CA  1 
ATOM   2722 C C   . ASP E 4 42 ? 40.740  3.013  -0.314  1.00 90.43  ? 63   ASP E C   1 
ATOM   2723 O O   . ASP E 4 42 ? 41.858  2.912  0.189   1.00 88.69  ? 63   ASP E O   1 
ATOM   2724 C CB  . ASP E 4 42 ? 40.965  5.367  -1.110  1.00 108.22 ? 63   ASP E CB  1 
ATOM   2725 C CG  . ASP E 4 42 ? 39.929  6.152  -0.330  1.00 118.53 ? 63   ASP E CG  1 
ATOM   2726 O OD1 . ASP E 4 42 ? 39.427  5.633  0.691   1.00 125.25 ? 63   ASP E OD1 1 
ATOM   2727 O OD2 . ASP E 4 42 ? 39.617  7.288  -0.743  1.00 121.93 ? 63   ASP E OD2 1 
ATOM   2728 N N   . SER E 4 43 ? 39.701  2.308  0.099   1.00 81.93  ? 64   SER E N   1 
ATOM   2729 C CA  . SER E 4 43 ? 39.803  1.375  1.197   1.00 77.38  ? 64   SER E CA  1 
ATOM   2730 C C   . SER E 4 43 ? 38.811  0.256  0.961   1.00 74.83  ? 64   SER E C   1 
ATOM   2731 O O   . SER E 4 43 ? 38.062  0.268  -0.015  1.00 74.68  ? 64   SER E O   1 
ATOM   2732 C CB  . SER E 4 43 ? 39.482  2.089  2.508   1.00 88.22  ? 64   SER E CB  1 
ATOM   2733 O OG  . SER E 4 43 ? 39.014  1.178  3.485   1.00 97.58  ? 64   SER E OG  1 
ATOM   2734 N N   . LEU E 4 44 ? 38.802  -0.706 1.865   1.00 77.40  ? 65   LEU E N   1 
ATOM   2735 C CA  . LEU E 4 44 ? 37.905  -1.839 1.752   1.00 91.08  ? 65   LEU E CA  1 
ATOM   2736 C C   . LEU E 4 44 ? 37.428  -2.237 3.134   1.00 98.37  ? 65   LEU E C   1 
ATOM   2737 O O   . LEU E 4 44 ? 36.640  -3.175 3.309   1.00 95.77  ? 65   LEU E O   1 
ATOM   2738 C CB  . LEU E 4 44 ? 38.622  -2.999 1.062   1.00 98.27  ? 65   LEU E CB  1 
ATOM   2739 C CG  . LEU E 4 44 ? 40.111  -3.258 1.301   1.00 98.69  ? 65   LEU E CG  1 
ATOM   2740 C CD1 . LEU E 4 44 ? 40.476  -4.515 0.517   1.00 82.98  ? 65   LEU E CD1 1 
ATOM   2741 C CD2 . LEU E 4 44 ? 40.981  -2.060 0.863   1.00 94.02  ? 65   LEU E CD2 1 
ATOM   2742 N N   . GLU E 4 45 ? 37.932  -1.496 4.112   1.00 105.92 ? 66   GLU E N   1 
ATOM   2743 C CA  . GLU E 4 45 ? 37.588  -1.680 5.512   1.00 111.20 ? 66   GLU E CA  1 
ATOM   2744 C C   . GLU E 4 45 ? 36.716  -0.487 5.859   1.00 103.93 ? 66   GLU E C   1 
ATOM   2745 O O   . GLU E 4 45 ? 36.073  -0.442 6.909   1.00 101.43 ? 66   GLU E O   1 
ATOM   2746 C CB  . GLU E 4 45 ? 38.853  -1.684 6.375   1.00 120.82 ? 66   GLU E CB  1 
ATOM   2747 C CG  . GLU E 4 45 ? 39.958  -0.774 5.855   1.00 128.39 ? 66   GLU E CG  1 
ATOM   2748 C CD  . GLU E 4 45 ? 40.708  -1.380 4.679   1.00 132.19 ? 66   GLU E CD  1 
ATOM   2749 O OE1 . GLU E 4 45 ? 41.321  -2.453 4.869   1.00 128.64 ? 66   GLU E OE1 1 
ATOM   2750 O OE2 . GLU E 4 45 ? 40.686  -0.790 3.573   1.00 136.71 ? 66   GLU E OE2 1 
ATOM   2751 N N   . ALA E 4 46 ? 36.713  0.479  4.945   1.00 97.12  ? 67   ALA E N   1 
ATOM   2752 C CA  . ALA E 4 46 ? 35.925  1.691  5.093   1.00 92.38  ? 67   ALA E CA  1 
ATOM   2753 C C   . ALA E 4 46 ? 34.539  1.454  4.508   1.00 94.69  ? 67   ALA E C   1 
ATOM   2754 O O   . ALA E 4 46 ? 34.377  0.643  3.592   1.00 96.41  ? 67   ALA E O   1 
ATOM   2755 C CB  . ALA E 4 46 ? 36.597  2.835  4.375   1.00 71.26  ? 67   ALA E CB  1 
ATOM   2756 N N   . ARG E 4 47 ? 33.546  2.159  5.054   1.00 95.11  ? 68   ARG E N   1 
ATOM   2757 C CA  . ARG E 4 47 ? 32.156  2.058  4.602   1.00 84.44  ? 68   ARG E CA  1 
ATOM   2758 C C   . ARG E 4 47 ? 32.100  2.192  3.087   1.00 76.57  ? 68   ARG E C   1 
ATOM   2759 O O   . ARG E 4 47 ? 32.789  3.046  2.504   1.00 69.29  ? 68   ARG E O   1 
ATOM   2760 C CB  . ARG E 4 47 ? 31.293  3.178  5.211   1.00 86.92  ? 68   ARG E CB  1 
ATOM   2761 C CG  . ARG E 4 47 ? 30.829  2.976  6.638   1.00 89.26  ? 68   ARG E CG  1 
ATOM   2762 C CD  . ARG E 4 47 ? 29.784  4.019  7.010   1.00 92.71  ? 68   ARG E CD  1 
ATOM   2763 N NE  . ARG E 4 47 ? 28.725  4.091  6.003   1.00 114.47 ? 68   ARG E NE  1 
ATOM   2764 C CZ  . ARG E 4 47 ? 27.492  4.536  6.236   1.00 130.05 ? 68   ARG E CZ  1 
ATOM   2765 N NH1 . ARG E 4 47 ? 27.154  4.947  7.449   1.00 142.71 ? 68   ARG E NH1 1 
ATOM   2766 N NH2 . ARG E 4 47 ? 26.599  4.584  5.254   1.00 129.23 ? 68   ARG E NH2 1 
ATOM   2767 N N   . ALA E 4 48 ? 31.280  1.355  2.455   1.00 62.53  ? 69   ALA E N   1 
ATOM   2768 C CA  . ALA E 4 48 ? 31.122  1.411  1.009   1.00 58.74  ? 69   ALA E CA  1 
ATOM   2769 C C   . ALA E 4 48 ? 31.007  2.890  0.584   1.00 69.28  ? 69   ALA E C   1 
ATOM   2770 O O   . ALA E 4 48 ? 31.820  3.394  -0.207  1.00 68.63  ? 69   ALA E O   1 
ATOM   2771 C CB  . ALA E 4 48 ? 29.872  0.635  0.597   1.00 47.23  ? 69   ALA E CB  1 
ATOM   2772 N N   . PHE E 4 49 ? 30.004  3.576  1.142   1.00 75.34  ? 70   PHE E N   1 
ATOM   2773 C CA  . PHE E 4 49 ? 29.735  4.993  0.859   1.00 65.27  ? 70   PHE E CA  1 
ATOM   2774 C C   . PHE E 4 49 ? 29.900  5.892  2.109   1.00 69.41  ? 70   PHE E C   1 
ATOM   2775 O O   . PHE E 4 49 ? 29.527  5.484  3.220   1.00 67.79  ? 70   PHE E O   1 
ATOM   2776 C CB  . PHE E 4 49 ? 28.297  5.150  0.328   1.00 48.96  ? 70   PHE E CB  1 
ATOM   2777 C CG  . PHE E 4 49 ? 28.060  4.538  -1.033  1.00 38.21  ? 70   PHE E CG  1 
ATOM   2778 C CD1 . PHE E 4 49 ? 27.347  3.354  -1.158  1.00 35.67  ? 70   PHE E CD1 1 
ATOM   2779 C CD2 . PHE E 4 49 ? 28.503  5.180  -2.195  1.00 31.47  ? 70   PHE E CD2 1 
ATOM   2780 C CE1 . PHE E 4 49 ? 27.068  2.816  -2.410  1.00 39.53  ? 70   PHE E CE1 1 
ATOM   2781 C CE2 . PHE E 4 49 ? 28.230  4.654  -3.456  1.00 37.72  ? 70   PHE E CE2 1 
ATOM   2782 C CZ  . PHE E 4 49 ? 27.507  3.468  -3.565  1.00 42.33  ? 70   PHE E CZ  1 
ATOM   2783 N N   . GLN E 4 50 ? 30.437  7.109  1.922   1.00 72.99  ? 71   GLN E N   1 
ATOM   2784 C CA  . GLN E 4 50 ? 30.634  8.087  3.014   1.00 82.34  ? 71   GLN E CA  1 
ATOM   2785 C C   . GLN E 4 50 ? 29.464  9.091  3.095   1.00 89.37  ? 71   GLN E C   1 
ATOM   2786 O O   . GLN E 4 50 ? 29.366  10.000 2.266   1.00 91.24  ? 71   GLN E O   1 
ATOM   2787 C CB  . GLN E 4 50 ? 31.936  8.878  2.806   1.00 84.80  ? 71   GLN E CB  1 
ATOM   2788 C CG  . GLN E 4 50 ? 32.297  9.808  3.981   1.00 112.63 ? 71   GLN E CG  1 
ATOM   2789 C CD  . GLN E 4 50 ? 32.996  11.106 3.551   1.00 128.55 ? 71   GLN E CD  1 
ATOM   2790 O OE1 . GLN E 4 50 ? 32.411  11.941 2.856   1.00 132.22 ? 71   GLN E OE1 1 
ATOM   2791 N NE2 . GLN E 4 50 ? 34.248  11.278 3.973   1.00 131.36 ? 71   GLN E NE2 1 
ATOM   2792 N N   . SER E 4 51 ? 28.592  8.939  4.094   1.00 91.06  ? 72   SER E N   1 
ATOM   2793 C CA  . SER E 4 51 ? 27.443  9.840  4.261   1.00 92.86  ? 72   SER E CA  1 
ATOM   2794 C C   . SER E 4 51 ? 27.744  11.074 5.110   1.00 96.07  ? 72   SER E C   1 
ATOM   2795 O O   . SER E 4 51 ? 27.923  10.984 6.326   1.00 95.42  ? 72   SER E O   1 
ATOM   2796 C CB  . SER E 4 51 ? 26.258  9.096  4.883   1.00 93.39  ? 72   SER E CB  1 
ATOM   2797 O OG  . SER E 4 51 ? 25.222  10.008 5.222   1.00 105.51 ? 72   SER E OG  1 
ATOM   2798 N N   . THR E 4 52 ? 27.777  12.232 4.465   1.00 101.81 ? 73   THR E N   1 
ATOM   2799 C CA  . THR E 4 52 ? 28.050  13.484 5.154   1.00 102.40 ? 73   THR E CA  1 
ATOM   2800 C C   . THR E 4 52 ? 26.760  14.298 5.265   1.00 106.79 ? 73   THR E C   1 
ATOM   2801 O O   . THR E 4 52 ? 26.434  15.060 4.357   1.00 104.24 ? 73   THR E O   1 
ATOM   2802 C CB  . THR E 4 52 ? 29.078  14.318 4.373   1.00 96.76  ? 73   THR E CB  1 
ATOM   2803 O OG1 . THR E 4 52 ? 30.212  13.507 4.050   1.00 88.76  ? 73   THR E OG1 1 
ATOM   2804 C CG2 . THR E 4 52 ? 29.527  15.501 5.196   1.00 103.35 ? 73   THR E CG2 1 
ATOM   2805 N N   . PRO E 4 53 ? 26.000  14.136 6.368   1.00 112.31 ? 74   PRO E N   1 
ATOM   2806 C CA  . PRO E 4 53 ? 24.756  14.900 6.517   1.00 112.06 ? 74   PRO E CA  1 
ATOM   2807 C C   . PRO E 4 53 ? 24.925  16.337 6.015   1.00 110.09 ? 74   PRO E C   1 
ATOM   2808 O O   . PRO E 4 53 ? 25.971  16.962 6.224   1.00 101.60 ? 74   PRO E O   1 
ATOM   2809 C CB  . PRO E 4 53 ? 24.483  14.800 8.009   1.00 113.30 ? 74   PRO E CB  1 
ATOM   2810 C CG  . PRO E 4 53 ? 24.899  13.378 8.291   1.00 113.71 ? 74   PRO E CG  1 
ATOM   2811 C CD  . PRO E 4 53 ? 26.223  13.268 7.539   1.00 117.42 ? 74   PRO E CD  1 
ATOM   2812 N N   . ILE E 4 54 ? 23.890  16.842 5.341   1.00 114.18 ? 75   ILE E N   1 
ATOM   2813 C CA  . ILE E 4 54 ? 23.909  18.180 4.743   1.00 113.82 ? 75   ILE E CA  1 
ATOM   2814 C C   . ILE E 4 54 ? 23.051  19.236 5.456   1.00 113.98 ? 75   ILE E C   1 
ATOM   2815 O O   . ILE E 4 54 ? 21.902  18.974 5.833   1.00 110.96 ? 75   ILE E O   1 
ATOM   2816 C CB  . ILE E 4 54 ? 23.465  18.105 3.266   1.00 112.39 ? 75   ILE E CB  1 
ATOM   2817 C CG1 . ILE E 4 54 ? 24.259  17.011 2.535   1.00 115.63 ? 75   ILE E CG1 1 
ATOM   2818 C CG2 . ILE E 4 54 ? 23.687  19.446 2.600   1.00 103.52 ? 75   ILE E CG2 1 
ATOM   2819 C CD1 . ILE E 4 54 ? 23.715  16.630 1.158   1.00 106.24 ? 75   ILE E CD1 1 
ATOM   2820 N N   . VAL E 4 55 ? 23.619  20.436 5.603   1.00 112.75 ? 76   VAL E N   1 
ATOM   2821 C CA  . VAL E 4 55 ? 22.969  21.563 6.280   1.00 112.99 ? 76   VAL E CA  1 
ATOM   2822 C C   . VAL E 4 55 ? 22.012  22.386 5.431   1.00 116.99 ? 76   VAL E C   1 
ATOM   2823 O O   . VAL E 4 55 ? 22.442  23.176 4.587   1.00 113.33 ? 76   VAL E O   1 
ATOM   2824 C CB  . VAL E 4 55 ? 24.004  22.543 6.835   1.00 110.78 ? 76   VAL E CB  1 
ATOM   2825 C CG1 . VAL E 4 55 ? 24.987  22.930 5.736   1.00 107.00 ? 76   VAL E CG1 1 
ATOM   2826 C CG2 . VAL E 4 55 ? 23.297  23.783 7.382   1.00 109.00 ? 76   VAL E CG2 1 
ATOM   2827 N N   . VAL E 4 56 ? 20.717  22.225 5.686   1.00 121.54 ? 77   VAL E N   1 
ATOM   2828 C CA  . VAL E 4 56 ? 19.698  22.962 4.949   1.00 121.45 ? 77   VAL E CA  1 
ATOM   2829 C C   . VAL E 4 56 ? 19.363  24.240 5.714   1.00 121.65 ? 77   VAL E C   1 
ATOM   2830 O O   . VAL E 4 56 ? 18.862  24.192 6.837   1.00 123.04 ? 77   VAL E O   1 
ATOM   2831 C CB  . VAL E 4 56 ? 18.412  22.123 4.781   1.00 118.69 ? 77   VAL E CB  1 
ATOM   2832 C CG1 . VAL E 4 56 ? 17.471  22.815 3.806   1.00 119.81 ? 77   VAL E CG1 1 
ATOM   2833 C CG2 . VAL E 4 56 ? 18.760  20.718 4.303   1.00 112.61 ? 77   VAL E CG2 1 
ATOM   2834 N N   . GLN E 4 57 ? 19.635  25.386 5.107   1.00 122.28 ? 78   GLN E N   1 
ATOM   2835 C CA  . GLN E 4 57 ? 19.364  26.647 5.777   1.00 127.44 ? 78   GLN E CA  1 
ATOM   2836 C C   . GLN E 4 57 ? 17.962  27.174 5.464   1.00 119.46 ? 78   GLN E C   1 
ATOM   2837 O O   . GLN E 4 57 ? 17.743  28.381 5.365   1.00 121.85 ? 78   GLN E O   1 
ATOM   2838 C CB  . GLN E 4 57 ? 20.431  27.679 5.391   1.00 144.18 ? 78   GLN E CB  1 
ATOM   2839 C CG  . GLN E 4 57 ? 20.739  28.668 6.500   1.00 157.80 ? 78   GLN E CG  1 
ATOM   2840 C CD  . GLN E 4 57 ? 20.955  27.969 7.831   1.00 170.35 ? 78   GLN E CD  1 
ATOM   2841 O OE1 . GLN E 4 57 ? 21.781  27.062 7.940   1.00 173.21 ? 78   GLN E OE1 1 
ATOM   2842 N NE2 . GLN E 4 57 ? 20.206  28.384 8.849   1.00 176.49 ? 78   GLN E NE2 1 
ATOM   2843 N N   . MET E 4 58 ? 17.015  26.256 5.318   1.00 109.97 ? 79   MET E N   1 
ATOM   2844 C CA  . MET E 4 58 ? 15.629  26.598 5.018   1.00 98.88  ? 79   MET E CA  1 
ATOM   2845 C C   . MET E 4 58 ? 15.038  27.638 5.971   1.00 99.50  ? 79   MET E C   1 
ATOM   2846 O O   . MET E 4 58 ? 15.316  27.630 7.171   1.00 99.37  ? 79   MET E O   1 
ATOM   2847 C CB  . MET E 4 58 ? 14.778  25.344 5.084   1.00 84.76  ? 79   MET E CB  1 
ATOM   2848 C CG  . MET E 4 58 ? 14.898  24.664 6.422   1.00 69.79  ? 79   MET E CG  1 
ATOM   2849 S SD  . MET E 4 58 ? 13.498  23.619 6.759   1.00 81.90  ? 79   MET E SD  1 
ATOM   2850 C CE  . MET E 4 58 ? 12.681  24.590 8.046   1.00 92.94  ? 79   MET E CE  1 
ATOM   2851 N N   . THR E 4 59 ? 14.187  28.501 5.422   1.00 101.99 ? 80   THR E N   1 
ATOM   2852 C CA  . THR E 4 59 ? 13.542  29.576 6.173   1.00 101.02 ? 80   THR E CA  1 
ATOM   2853 C C   . THR E 4 59 ? 12.039  29.373 6.351   1.00 100.69 ? 80   THR E C   1 
ATOM   2854 O O   . THR E 4 59 ? 11.360  28.912 5.439   1.00 99.61  ? 80   THR E O   1 
ATOM   2855 C CB  . THR E 4 59 ? 13.720  30.917 5.453   1.00 99.17  ? 80   THR E CB  1 
ATOM   2856 O OG1 . THR E 4 59 ? 15.085  31.073 5.047   1.00 101.60 ? 80   THR E OG1 1 
ATOM   2857 C CG2 . THR E 4 59 ? 13.332  32.053 6.369   1.00 94.96  ? 80   THR E CG2 1 
ATOM   2858 N N   . LYS E 4 60 ? 11.517  29.735 7.518   1.00 102.27 ? 81   LYS E N   1 
ATOM   2859 C CA  . LYS E 4 60 ? 10.083  29.602 7.766   1.00 98.87  ? 81   LYS E CA  1 
ATOM   2860 C C   . LYS E 4 60 ? 9.390   30.874 7.290   1.00 96.17  ? 81   LYS E C   1 
ATOM   2861 O O   . LYS E 4 60 ? 9.836   31.981 7.588   1.00 92.83  ? 81   LYS E O   1 
ATOM   2862 C CB  . LYS E 4 60 ? 9.806   29.381 9.253   1.00 91.38  ? 81   LYS E CB  1 
ATOM   2863 C CG  . LYS E 4 60 ? 8.364   28.984 9.576   1.00 88.68  ? 81   LYS E CG  1 
ATOM   2864 C CD  . LYS E 4 60 ? 7.450   30.187 9.685   1.00 105.41 ? 81   LYS E CD  1 
ATOM   2865 C CE  . LYS E 4 60 ? 6.096   29.807 10.281  1.00 119.84 ? 81   LYS E CE  1 
ATOM   2866 N NZ  . LYS E 4 60 ? 5.237   31.002 10.581  1.00 122.22 ? 81   LYS E NZ  1 
ATOM   2867 N N   . LEU E 4 61 ? 8.292   30.710 6.557   1.00 96.16  ? 82   LEU E N   1 
ATOM   2868 C CA  . LEU E 4 61 ? 7.559   31.852 6.016   1.00 96.91  ? 82   LEU E CA  1 
ATOM   2869 C C   . LEU E 4 61 ? 6.297   32.340 6.751   1.00 95.03  ? 82   LEU E C   1 
ATOM   2870 O O   . LEU E 4 61 ? 5.528   31.553 7.312   1.00 91.40  ? 82   LEU E O   1 
ATOM   2871 C CB  . LEU E 4 61 ? 7.205   31.579 4.552   1.00 94.48  ? 82   LEU E CB  1 
ATOM   2872 C CG  . LEU E 4 61 ? 8.354   31.560 3.543   1.00 89.03  ? 82   LEU E CG  1 
ATOM   2873 C CD1 . LEU E 4 61 ? 7.768   31.635 2.154   1.00 85.61  ? 82   LEU E CD1 1 
ATOM   2874 C CD2 . LEU E 4 61 ? 9.277   32.744 3.752   1.00 91.54  ? 82   LEU E CD2 1 
ATOM   2875 N N   . ALA E 4 62 ? 6.099   33.657 6.719   1.00 93.55  ? 83   ALA E N   1 
ATOM   2876 C CA  . ALA E 4 62 ? 4.949   34.299 7.342   1.00 99.52  ? 83   ALA E CA  1 
ATOM   2877 C C   . ALA E 4 62 ? 3.986   34.709 6.241   1.00 102.71 ? 83   ALA E C   1 
ATOM   2878 O O   . ALA E 4 62 ? 2.796   34.398 6.292   1.00 108.30 ? 83   ALA E O   1 
ATOM   2879 C CB  . ALA E 4 62 ? 5.388   35.530 8.126   1.00 100.96 ? 83   ALA E CB  1 
ATOM   2880 N N   . THR E 4 63 ? 4.510   35.403 5.238   1.00 101.69 ? 84   THR E N   1 
ATOM   2881 C CA  . THR E 4 63 ? 3.684   35.858 4.131   1.00 101.11 ? 84   THR E CA  1 
ATOM   2882 C C   . THR E 4 63 ? 3.974   35.156 2.813   1.00 101.59 ? 84   THR E C   1 
ATOM   2883 O O   . THR E 4 63 ? 5.121   34.860 2.472   1.00 99.87  ? 84   THR E O   1 
ATOM   2884 C CB  . THR E 4 63 ? 3.824   37.385 3.903   1.00 104.96 ? 84   THR E CB  1 
ATOM   2885 O OG1 . THR E 4 63 ? 3.033   37.775 2.771   1.00 109.52 ? 84   THR E OG1 1 
ATOM   2886 C CG2 . THR E 4 63 ? 5.279   37.768 3.651   1.00 99.48  ? 84   THR E CG2 1 
ATOM   2887 N N   . THR E 4 64 ? 2.909   34.912 2.069   1.00 98.98  ? 85   THR E N   1 
ATOM   2888 C CA  . THR E 4 64 ? 2.990   34.257 0.783   1.00 97.56  ? 85   THR E CA  1 
ATOM   2889 C C   . THR E 4 64 ? 3.577   35.206 -0.270  1.00 95.08  ? 85   THR E C   1 
ATOM   2890 O O   . THR E 4 64 ? 3.821   34.814 -1.406  1.00 94.68  ? 85   THR E O   1 
ATOM   2891 C CB  . THR E 4 64 ? 1.575   33.779 0.361   1.00 102.80 ? 85   THR E CB  1 
ATOM   2892 O OG1 . THR E 4 64 ? 1.647   32.420 -0.078  1.00 108.03 ? 85   THR E OG1 1 
ATOM   2893 C CG2 . THR E 4 64 ? 1.001   34.653 -0.759  1.00 101.23 ? 85   THR E CG2 1 
ATOM   2894 N N   . GLU E 4 65 ? 3.818   36.453 0.109   1.00 99.30  ? 86   GLU E N   1 
ATOM   2895 C CA  . GLU E 4 65 ? 4.348   37.427 -0.838  1.00 107.59 ? 86   GLU E CA  1 
ATOM   2896 C C   . GLU E 4 65 ? 5.860   37.336 -0.995  1.00 105.68 ? 86   GLU E C   1 
ATOM   2897 O O   . GLU E 4 65 ? 6.431   37.817 -1.978  1.00 93.94  ? 86   GLU E O   1 
ATOM   2898 C CB  . GLU E 4 65 ? 3.945   38.839 -0.404  1.00 125.10 ? 86   GLU E CB  1 
ATOM   2899 C CG  . GLU E 4 65 ? 4.179   39.919 -1.464  1.00 147.00 ? 86   GLU E CG  1 
ATOM   2900 C CD  . GLU E 4 65 ? 3.472   41.235 -1.145  1.00 159.35 ? 86   GLU E CD  1 
ATOM   2901 O OE1 . GLU E 4 65 ? 3.704   41.787 -0.047  1.00 166.42 ? 86   GLU E OE1 1 
ATOM   2902 O OE2 . GLU E 4 65 ? 2.689   41.718 -1.996  1.00 157.61 ? 86   GLU E OE2 1 
ATOM   2903 N N   . GLU E 4 66 ? 6.503   36.711 -0.019  1.00 113.59 ? 87   GLU E N   1 
ATOM   2904 C CA  . GLU E 4 66 ? 7.948   36.547 -0.041  1.00 125.98 ? 87   GLU E CA  1 
ATOM   2905 C C   . GLU E 4 66 ? 8.371   35.579 -1.150  1.00 127.86 ? 87   GLU E C   1 
ATOM   2906 O O   . GLU E 4 66 ? 9.523   35.576 -1.590  1.00 128.61 ? 87   GLU E O   1 
ATOM   2907 C CB  . GLU E 4 66 ? 8.420   36.040 1.327   1.00 135.70 ? 87   GLU E CB  1 
ATOM   2908 C CG  . GLU E 4 66 ? 8.145   37.023 2.465   1.00 141.62 ? 87   GLU E CG  1 
ATOM   2909 C CD  . GLU E 4 66 ? 8.478   36.462 3.839   1.00 151.11 ? 87   GLU E CD  1 
ATOM   2910 O OE1 . GLU E 4 66 ? 9.623   36.005 4.035   1.00 154.45 ? 87   GLU E OE1 1 
ATOM   2911 O OE2 . GLU E 4 66 ? 7.596   36.486 4.727   1.00 153.26 ? 87   GLU E OE2 1 
ATOM   2912 N N   . LEU E 4 67 ? 7.421   34.771 -1.609  1.00 124.24 ? 88   LEU E N   1 
ATOM   2913 C CA  . LEU E 4 67 ? 7.672   33.786 -2.654  1.00 116.06 ? 88   LEU E CA  1 
ATOM   2914 C C   . LEU E 4 67 ? 7.647   34.394 -4.053  1.00 119.22 ? 88   LEU E C   1 
ATOM   2915 O O   . LEU E 4 67 ? 7.307   35.562 -4.232  1.00 121.01 ? 88   LEU E O   1 
ATOM   2916 C CB  . LEU E 4 67 ? 6.607   32.692 -2.595  1.00 104.97 ? 88   LEU E CB  1 
ATOM   2917 C CG  . LEU E 4 67 ? 6.402   31.950 -1.281  1.00 98.04  ? 88   LEU E CG  1 
ATOM   2918 C CD1 . LEU E 4 67 ? 5.180   31.048 -1.384  1.00 93.51  ? 88   LEU E CD1 1 
ATOM   2919 C CD2 . LEU E 4 67 ? 7.638   31.144 -0.971  1.00 102.73 ? 88   LEU E CD2 1 
ATOM   2920 N N   . PRO E 4 68 ? 8.048   33.604 -5.062  1.00 122.88 ? 89   PRO E N   1 
ATOM   2921 C CA  . PRO E 4 68 ? 8.082   33.982 -6.476  1.00 121.22 ? 89   PRO E CA  1 
ATOM   2922 C C   . PRO E 4 68 ? 6.968   33.207 -7.185  1.00 116.63 ? 89   PRO E C   1 
ATOM   2923 O O   . PRO E 4 68 ? 6.266   32.408 -6.566  1.00 112.22 ? 89   PRO E O   1 
ATOM   2924 C CB  . PRO E 4 68 ? 9.459   33.529 -6.910  1.00 125.78 ? 89   PRO E CB  1 
ATOM   2925 C CG  . PRO E 4 68 ? 9.558   32.225 -6.214  1.00 133.75 ? 89   PRO E CG  1 
ATOM   2926 C CD  . PRO E 4 68 ? 9.015   32.520 -4.814  1.00 128.79 ? 89   PRO E CD  1 
ATOM   2927 N N   . ASP E 4 69 ? 6.832   33.413 -8.486  1.00 115.94 ? 90   ASP E N   1 
ATOM   2928 C CA  . ASP E 4 69 ? 5.772   32.769 -9.252  1.00 121.60 ? 90   ASP E CA  1 
ATOM   2929 C C   . ASP E 4 69 ? 5.899   31.264 -9.538  1.00 117.68 ? 90   ASP E C   1 
ATOM   2930 O O   . ASP E 4 69 ? 4.894   30.551 -9.543  1.00 109.41 ? 90   ASP E O   1 
ATOM   2931 C CB  . ASP E 4 69 ? 5.595   33.540 -10.561 1.00 136.25 ? 90   ASP E CB  1 
ATOM   2932 C CG  . ASP E 4 69 ? 5.295   35.018 -10.331 1.00 148.35 ? 90   ASP E CG  1 
ATOM   2933 O OD1 . ASP E 4 69 ? 5.759   35.575 -9.311  1.00 154.23 ? 90   ASP E OD1 1 
ATOM   2934 O OD2 . ASP E 4 69 ? 4.607   35.626 -11.177 1.00 154.54 ? 90   ASP E OD2 1 
ATOM   2935 N N   . GLU E 4 70 ? 7.123   30.790 -9.768  1.00 117.54 ? 91   GLU E N   1 
ATOM   2936 C CA  . GLU E 4 70 ? 7.383   29.376 -10.082 1.00 111.07 ? 91   GLU E CA  1 
ATOM   2937 C C   . GLU E 4 70 ? 8.364   28.673 -9.136  1.00 100.16 ? 91   GLU E C   1 
ATOM   2938 O O   . GLU E 4 70 ? 9.546   29.008 -9.103  1.00 92.56  ? 91   GLU E O   1 
ATOM   2939 C CB  . GLU E 4 70 ? 7.920   29.256 -11.514 1.00 121.29 ? 91   GLU E CB  1 
ATOM   2940 C CG  . GLU E 4 70 ? 6.858   29.157 -12.596 1.00 130.52 ? 91   GLU E CG  1 
ATOM   2941 C CD  . GLU E 4 70 ? 7.454   29.165 -13.995 1.00 132.28 ? 91   GLU E CD  1 
ATOM   2942 O OE1 . GLU E 4 70 ? 8.587   28.658 -14.163 1.00 131.00 ? 91   GLU E OE1 1 
ATOM   2943 O OE2 . GLU E 4 70 ? 6.784   29.665 -14.926 1.00 134.18 ? 91   GLU E OE2 1 
ATOM   2944 N N   . PHE E 4 71 ? 7.876   27.678 -8.397  1.00 95.63  ? 92   PHE E N   1 
ATOM   2945 C CA  . PHE E 4 71 ? 8.715   26.930 -7.454  1.00 91.69  ? 92   PHE E CA  1 
ATOM   2946 C C   . PHE E 4 71 ? 8.154   25.528 -7.151  1.00 88.80  ? 92   PHE E C   1 
ATOM   2947 O O   . PHE E 4 71 ? 6.965   25.260 -7.371  1.00 79.90  ? 92   PHE E O   1 
ATOM   2948 C CB  . PHE E 4 71 ? 8.857   27.728 -6.157  1.00 85.85  ? 92   PHE E CB  1 
ATOM   2949 C CG  . PHE E 4 71 ? 7.541   28.072 -5.517  1.00 86.90  ? 92   PHE E CG  1 
ATOM   2950 C CD1 . PHE E 4 71 ? 6.809   27.100 -4.838  1.00 77.03  ? 92   PHE E CD1 1 
ATOM   2951 C CD2 . PHE E 4 71 ? 7.008   29.355 -5.633  1.00 92.35  ? 92   PHE E CD2 1 
ATOM   2952 C CE1 . PHE E 4 71 ? 5.568   27.396 -4.281  1.00 68.74  ? 92   PHE E CE1 1 
ATOM   2953 C CE2 . PHE E 4 71 ? 5.764   29.666 -5.079  1.00 92.81  ? 92   PHE E CE2 1 
ATOM   2954 C CZ  . PHE E 4 71 ? 5.044   28.681 -4.403  1.00 85.78  ? 92   PHE E CZ  1 
ATOM   2955 N N   . VAL E 4 72 ? 9.010   24.641 -6.643  1.00 87.38  ? 93   VAL E N   1 
ATOM   2956 C CA  . VAL E 4 72 ? 8.586   23.276 -6.330  1.00 85.33  ? 93   VAL E CA  1 
ATOM   2957 C C   . VAL E 4 72 ? 8.277   23.088 -4.852  1.00 78.51  ? 93   VAL E C   1 
ATOM   2958 O O   . VAL E 4 72 ? 9.020   23.547 -3.979  1.00 65.55  ? 93   VAL E O   1 
ATOM   2959 C CB  . VAL E 4 72 ? 9.655   22.249 -6.743  1.00 87.98  ? 93   VAL E CB  1 
ATOM   2960 C CG1 . VAL E 4 72 ? 10.017  22.448 -8.205  1.00 88.02  ? 93   VAL E CG1 1 
ATOM   2961 C CG2 . VAL E 4 72 ? 10.887  22.393 -5.865  1.00 91.55  ? 93   VAL E CG2 1 
ATOM   2962 N N   . VAL E 4 73 ? 7.180   22.392 -4.578  1.00 75.56  ? 94   VAL E N   1 
ATOM   2963 C CA  . VAL E 4 73 ? 6.756   22.158 -3.208  1.00 71.09  ? 94   VAL E CA  1 
ATOM   2964 C C   . VAL E 4 73 ? 6.772   20.708 -2.787  1.00 74.67  ? 94   VAL E C   1 
ATOM   2965 O O   . VAL E 4 73 ? 5.945   19.908 -3.225  1.00 73.43  ? 94   VAL E O   1 
ATOM   2966 C CB  . VAL E 4 73 ? 5.346   22.660 -2.969  1.00 69.12  ? 94   VAL E CB  1 
ATOM   2967 C CG1 . VAL E 4 73 ? 4.988   22.476 -1.499  1.00 70.00  ? 94   VAL E CG1 1 
ATOM   2968 C CG2 . VAL E 4 73 ? 5.244   24.112 -3.387  1.00 78.11  ? 94   VAL E CG2 1 
ATOM   2969 N N   . VAL E 4 74 ? 7.702   20.387 -1.900  1.00 78.69  ? 95   VAL E N   1 
ATOM   2970 C CA  . VAL E 4 74 ? 7.826   19.036 -1.405  1.00 79.53  ? 95   VAL E CA  1 
ATOM   2971 C C   . VAL E 4 74 ? 6.834   18.834 -0.296  1.00 79.46  ? 95   VAL E C   1 
ATOM   2972 O O   . VAL E 4 74 ? 7.125   19.112 0.867   1.00 76.33  ? 95   VAL E O   1 
ATOM   2973 C CB  . VAL E 4 74 ? 9.206   18.770 -0.823  1.00 83.00  ? 95   VAL E CB  1 
ATOM   2974 C CG1 . VAL E 4 74 ? 9.398   17.266 -0.654  1.00 86.94  ? 95   VAL E CG1 1 
ATOM   2975 C CG2 . VAL E 4 74 ? 10.282  19.400 -1.707  1.00 77.17  ? 95   VAL E CG2 1 
ATOM   2976 N N   . THR E 4 75 ? 5.650   18.367 -0.652  1.00 88.72  ? 96   THR E N   1 
ATOM   2977 C CA  . THR E 4 75 ? 4.641   18.114 0.355   1.00 103.43 ? 96   THR E CA  1 
ATOM   2978 C C   . THR E 4 75 ? 5.193   16.970 1.206   1.00 109.98 ? 96   THR E C   1 
ATOM   2979 O O   . THR E 4 75 ? 5.062   15.791 0.856   1.00 105.39 ? 96   THR E O   1 
ATOM   2980 C CB  . THR E 4 75 ? 3.307   17.708 -0.292  1.00 108.08 ? 96   THR E CB  1 
ATOM   2981 O OG1 . THR E 4 75 ? 2.961   18.661 -1.306  1.00 104.17 ? 96   THR E OG1 1 
ATOM   2982 C CG2 . THR E 4 75 ? 2.204   17.670 0.754   1.00 110.69 ? 96   THR E CG2 1 
ATOM   2983 N N   . ALA E 4 76 ? 5.841   17.329 2.311   1.00 117.47 ? 97   ALA E N   1 
ATOM   2984 C CA  . ALA E 4 76 ? 6.431   16.338 3.201   1.00 122.34 ? 97   ALA E CA  1 
ATOM   2985 C C   . ALA E 4 76 ? 5.341   15.576 3.927   1.00 133.19 ? 97   ALA E C   1 
ATOM   2986 O O   . ALA E 4 76 ? 5.320   15.521 5.157   1.00 135.56 ? 97   ALA E O   1 
ATOM   2987 C CB  . ALA E 4 76 ? 7.353   17.011 4.201   1.00 107.70 ? 97   ALA E CB  1 
ATOM   2988 N N   . LYS E 4 77 ? 4.431   14.994 3.151   1.00 144.67 ? 98   LYS E N   1 
ATOM   2989 C CA  . LYS E 4 77 ? 3.324   14.226 3.707   1.00 152.43 ? 98   LYS E CA  1 
ATOM   2990 C C   . LYS E 4 77 ? 3.757   12.777 3.926   1.00 157.49 ? 98   LYS E C   1 
ATOM   2991 O O   . LYS E 4 77 ? 3.508   12.249 5.032   1.00 159.42 ? 98   LYS E O   1 
ATOM   2992 C CB  . LYS E 4 77 ? 2.100   14.285 2.774   1.00 146.77 ? 98   LYS E CB  1 
ATOM   2993 C CG  . LYS E 4 77 ? 2.231   13.502 1.471   1.00 136.22 ? 98   LYS E CG  1 
ATOM   2994 C CD  . LYS E 4 77 ? 1.149   12.428 1.372   1.00 124.54 ? 98   LYS E CD  1 
ATOM   2995 C CE  . LYS E 4 77 ? 1.360   11.525 0.165   1.00 115.32 ? 98   LYS E CE  1 
ATOM   2996 N NZ  . LYS E 4 77 ? 0.386   10.399 0.176   1.00 106.66 ? 98   LYS E NZ  1 
ATOM   2997 O OXT . LYS E 4 77 ? 4.340   12.190 2.988   1.00 162.56 ? 98   LYS E OXT 1 
ATOM   2998 N N   . PRO F 3 1  ? 17.576  -1.657 3.805   1.00 168.52 ? 10   PRO F N   1 
ATOM   2999 C CA  . PRO F 3 1  ? 16.227  -1.384 4.367   1.00 172.86 ? 10   PRO F CA  1 
ATOM   3000 C C   . PRO F 3 1  ? 16.148  -0.031 5.096   1.00 174.85 ? 10   PRO F C   1 
ATOM   3001 O O   . PRO F 3 1  ? 16.867  0.193  6.069   1.00 179.41 ? 10   PRO F O   1 
ATOM   3002 C CB  . PRO F 3 1  ? 15.919  -2.533 5.322   1.00 170.71 ? 10   PRO F CB  1 
ATOM   3003 C CG  . PRO F 3 1  ? 17.330  -2.994 5.717   1.00 164.76 ? 10   PRO F CG  1 
ATOM   3004 C CD  . PRO F 3 1  ? 18.147  -2.867 4.426   1.00 162.83 ? 10   PRO F CD  1 
ATOM   3005 N N   . PRO F 3 2  ? 15.266  0.887  4.642   1.00 171.00 ? 11   PRO F N   1 
ATOM   3006 C CA  . PRO F 3 2  ? 14.335  0.775  3.511   1.00 160.82 ? 11   PRO F CA  1 
ATOM   3007 C C   . PRO F 3 2  ? 15.052  0.713  2.172   1.00 151.34 ? 11   PRO F C   1 
ATOM   3008 O O   . PRO F 3 2  ? 16.216  1.107  2.056   1.00 149.74 ? 11   PRO F O   1 
ATOM   3009 C CB  . PRO F 3 2  ? 13.477  2.028  3.649   1.00 160.73 ? 11   PRO F CB  1 
ATOM   3010 C CG  . PRO F 3 2  ? 14.452  3.021  4.209   1.00 166.46 ? 11   PRO F CG  1 
ATOM   3011 C CD  . PRO F 3 2  ? 15.160  2.218  5.269   1.00 170.35 ? 11   PRO F CD  1 
ATOM   3012 N N   . ALA F 3 3  ? 14.347  0.214  1.164   1.00 141.50 ? 12   ALA F N   1 
ATOM   3013 C CA  . ALA F 3 3  ? 14.908  0.088  -0.173  1.00 128.32 ? 12   ALA F CA  1 
ATOM   3014 C C   . ALA F 3 3  ? 15.434  1.430  -0.640  1.00 117.46 ? 12   ALA F C   1 
ATOM   3015 O O   . ALA F 3 3  ? 14.831  2.468  -0.369  1.00 115.00 ? 12   ALA F O   1 
ATOM   3016 C CB  . ALA F 3 3  ? 13.846  -0.409 -1.131  1.00 124.69 ? 12   ALA F CB  1 
ATOM   3017 N N   . LEU F 3 4  ? 16.568  1.418  -1.328  1.00 107.04 ? 13   LEU F N   1 
ATOM   3018 C CA  . LEU F 3 4  ? 17.109  2.668  -1.830  1.00 99.25  ? 13   LEU F CA  1 
ATOM   3019 C C   . LEU F 3 4  ? 16.448  2.983  -3.157  1.00 91.84  ? 13   LEU F C   1 
ATOM   3020 O O   . LEU F 3 4  ? 16.398  2.138  -4.056  1.00 86.48  ? 13   LEU F O   1 
ATOM   3021 C CB  . LEU F 3 4  ? 18.625  2.586  -2.019  1.00 100.09 ? 13   LEU F CB  1 
ATOM   3022 C CG  . LEU F 3 4  ? 19.503  2.723  -0.770  1.00 94.46  ? 13   LEU F CG  1 
ATOM   3023 C CD1 . LEU F 3 4  ? 20.931  3.006  -1.206  1.00 89.25  ? 13   LEU F CD1 1 
ATOM   3024 C CD2 . LEU F 3 4  ? 19.007  3.859  0.109   1.00 93.62  ? 13   LEU F CD2 1 
ATOM   3025 N N   . HIS F 3 5  ? 15.934  4.199  -3.274  1.00 82.56  ? 14   HIS F N   1 
ATOM   3026 C CA  . HIS F 3 5  ? 15.280  4.593  -4.497  1.00 77.32  ? 14   HIS F CA  1 
ATOM   3027 C C   . HIS F 3 5  ? 16.056  5.663  -5.219  1.00 78.38  ? 14   HIS F C   1 
ATOM   3028 O O   . HIS F 3 5  ? 16.482  6.656  -4.631  1.00 79.15  ? 14   HIS F O   1 
ATOM   3029 C CB  . HIS F 3 5  ? 13.868  5.046  -4.189  1.00 83.27  ? 14   HIS F CB  1 
ATOM   3030 C CG  . HIS F 3 5  ? 13.005  3.940  -3.667  1.00 103.25 ? 14   HIS F CG  1 
ATOM   3031 N ND1 . HIS F 3 5  ? 12.577  2.893  -4.458  1.00 103.14 ? 14   HIS F ND1 1 
ATOM   3032 C CD2 . HIS F 3 5  ? 12.557  3.677  -2.417  1.00 113.08 ? 14   HIS F CD2 1 
ATOM   3033 C CE1 . HIS F 3 5  ? 11.904  2.033  -3.714  1.00 105.72 ? 14   HIS F CE1 1 
ATOM   3034 N NE2 . HIS F 3 5  ? 11.878  2.483  -2.473  1.00 114.83 ? 14   HIS F NE2 1 
ATOM   3035 N N   . LEU F 3 6  ? 16.246  5.426  -6.508  1.00 78.93  ? 15   LEU F N   1 
ATOM   3036 C CA  . LEU F 3 6  ? 16.976  6.324  -7.376  1.00 81.74  ? 15   LEU F CA  1 
ATOM   3037 C C   . LEU F 3 6  ? 16.034  7.248  -8.146  1.00 87.72  ? 15   LEU F C   1 
ATOM   3038 O O   . LEU F 3 6  ? 15.249  6.818  -8.989  1.00 90.37  ? 15   LEU F O   1 
ATOM   3039 C CB  . LEU F 3 6  ? 17.814  5.494  -8.341  1.00 73.05  ? 15   LEU F CB  1 
ATOM   3040 C CG  . LEU F 3 6  ? 18.664  6.217  -9.378  1.00 72.23  ? 15   LEU F CG  1 
ATOM   3041 C CD1 . LEU F 3 6  ? 17.814  6.697  -10.559 1.00 77.65  ? 15   LEU F CD1 1 
ATOM   3042 C CD2 . LEU F 3 6  ? 19.374  7.360  -8.679  1.00 69.08  ? 15   LEU F CD2 1 
ATOM   3043 N N   . VAL F 3 7  ? 16.112  8.531  -7.851  1.00 87.74  ? 16   VAL F N   1 
ATOM   3044 C CA  . VAL F 3 7  ? 15.275  9.490  -8.533  1.00 89.08  ? 16   VAL F CA  1 
ATOM   3045 C C   . VAL F 3 7  ? 15.988  9.931  -9.804  1.00 93.00  ? 16   VAL F C   1 
ATOM   3046 O O   . VAL F 3 7  ? 16.936  10.722 -9.757  1.00 96.35  ? 16   VAL F O   1 
ATOM   3047 C CB  . VAL F 3 7  ? 15.018  10.700 -7.636  1.00 92.76  ? 16   VAL F CB  1 
ATOM   3048 C CG1 . VAL F 3 7  ? 14.166  11.729 -8.371  1.00 95.55  ? 16   VAL F CG1 1 
ATOM   3049 C CG2 . VAL F 3 7  ? 14.343  10.240 -6.349  1.00 84.40  ? 16   VAL F CG2 1 
ATOM   3050 N N   . ASP F 3 8  ? 15.519  9.401  -10.930 1.00 94.27  ? 17   ASP F N   1 
ATOM   3051 C CA  . ASP F 3 8  ? 16.052  9.668  -12.270 1.00 105.00 ? 17   ASP F CA  1 
ATOM   3052 C C   . ASP F 3 8  ? 16.710  11.028 -12.482 1.00 110.95 ? 17   ASP F C   1 
ATOM   3053 O O   . ASP F 3 8  ? 16.350  12.008 -11.831 1.00 117.05 ? 17   ASP F O   1 
ATOM   3054 C CB  . ASP F 3 8  ? 14.931  9.489  -13.273 1.00 108.74 ? 17   ASP F CB  1 
ATOM   3055 C CG  . ASP F 3 8  ? 14.002  8.377  -12.876 1.00 119.30 ? 17   ASP F CG  1 
ATOM   3056 O OD1 . ASP F 3 8  ? 13.502  8.416  -11.727 1.00 117.03 ? 17   ASP F OD1 1 
ATOM   3057 O OD2 . ASP F 3 8  ? 13.780  7.467  -13.702 1.00 126.94 ? 17   ASP F OD2 1 
ATOM   3058 N N   . PRO F 3 9  ? 17.667  11.104 -13.428 1.00 110.92 ? 18   PRO F N   1 
ATOM   3059 C CA  . PRO F 3 9  ? 18.403  12.336 -13.752 1.00 108.52 ? 18   PRO F CA  1 
ATOM   3060 C C   . PRO F 3 9  ? 17.503  13.521 -14.089 1.00 107.52 ? 18   PRO F C   1 
ATOM   3061 O O   . PRO F 3 9  ? 17.930  14.682 -14.052 1.00 103.86 ? 18   PRO F O   1 
ATOM   3062 C CB  . PRO F 3 9  ? 19.288  11.910 -14.926 1.00 104.91 ? 18   PRO F CB  1 
ATOM   3063 C CG  . PRO F 3 9  ? 18.467  10.866 -15.600 1.00 106.82 ? 18   PRO F CG  1 
ATOM   3064 C CD  . PRO F 3 9  ? 17.943  10.059 -14.432 1.00 108.61 ? 18   PRO F CD  1 
ATOM   3065 N N   . GLN F 3 10 ? 16.255  13.209 -14.417 1.00 107.98 ? 19   GLN F N   1 
ATOM   3066 C CA  . GLN F 3 10 ? 15.249  14.203 -14.754 1.00 108.87 ? 19   GLN F CA  1 
ATOM   3067 C C   . GLN F 3 10 ? 15.139  15.247 -13.632 1.00 107.16 ? 19   GLN F C   1 
ATOM   3068 O O   . GLN F 3 10 ? 15.088  16.451 -13.888 1.00 103.20 ? 19   GLN F O   1 
ATOM   3069 C CB  . GLN F 3 10 ? 13.922  13.485 -14.929 1.00 109.16 ? 19   GLN F CB  1 
ATOM   3070 C CG  . GLN F 3 10 ? 13.556  12.706 -13.680 1.00 115.50 ? 19   GLN F CG  1 
ATOM   3071 C CD  . GLN F 3 10 ? 12.510  11.650 -13.921 1.00 127.50 ? 19   GLN F CD  1 
ATOM   3072 O OE1 . GLN F 3 10 ? 11.946  11.096 -12.977 1.00 132.09 ? 19   GLN F OE1 1 
ATOM   3073 N NE2 . GLN F 3 10 ? 12.250  11.353 -15.188 1.00 131.44 ? 19   GLN F NE2 1 
ATOM   3074 N N   . ILE F 3 11 ? 15.110  14.763 -12.391 1.00 106.85 ? 20   ILE F N   1 
ATOM   3075 C CA  . ILE F 3 11 ? 15.005  15.607 -11.197 1.00 97.70  ? 20   ILE F CA  1 
ATOM   3076 C C   . ILE F 3 11 ? 16.252  15.433 -10.335 1.00 93.31  ? 20   ILE F C   1 
ATOM   3077 O O   . ILE F 3 11 ? 16.558  14.328 -9.880  1.00 91.57  ? 20   ILE F O   1 
ATOM   3078 C CB  . ILE F 3 11 ? 13.819  15.189 -10.318 1.00 90.99  ? 20   ILE F CB  1 
ATOM   3079 C CG1 . ILE F 3 11 ? 12.577  14.943 -11.181 1.00 79.05  ? 20   ILE F CG1 1 
ATOM   3080 C CG2 . ILE F 3 11 ? 13.593  16.244 -9.247  1.00 79.31  ? 20   ILE F CG2 1 
ATOM   3081 C CD1 . ILE F 3 11 ? 11.583  13.951 -10.571 1.00 68.80  ? 20   ILE F CD1 1 
ATOM   3082 N N   . GLN F 3 12 ? 16.975  16.512 -10.095 1.00 84.96  ? 21   GLN F N   1 
ATOM   3083 C CA  . GLN F 3 12 ? 18.161  16.400 -9.270  1.00 85.82  ? 21   GLN F CA  1 
ATOM   3084 C C   . GLN F 3 12 ? 18.323  17.642 -8.432  1.00 85.54  ? 21   GLN F C   1 
ATOM   3085 O O   . GLN F 3 12 ? 17.765  18.690 -8.742  1.00 87.31  ? 21   GLN F O   1 
ATOM   3086 C CB  . GLN F 3 12 ? 19.414  16.210 -10.128 1.00 94.79  ? 21   GLN F CB  1 
ATOM   3087 C CG  . GLN F 3 12 ? 19.355  15.048 -11.104 1.00 103.48 ? 21   GLN F CG  1 
ATOM   3088 C CD  . GLN F 3 12 ? 20.737  14.559 -11.525 1.00 113.12 ? 21   GLN F CD  1 
ATOM   3089 O OE1 . GLN F 3 12 ? 21.742  15.268 -11.388 1.00 110.78 ? 21   GLN F OE1 1 
ATOM   3090 N NE2 . GLN F 3 12 ? 20.790  13.339 -12.048 1.00 114.19 ? 21   GLN F NE2 1 
ATOM   3091 N N   . LEU F 3 13 ? 19.095  17.521 -7.362  1.00 83.76  ? 22   LEU F N   1 
ATOM   3092 C CA  . LEU F 3 13 ? 19.339  18.651 -6.486  1.00 82.84  ? 22   LEU F CA  1 
ATOM   3093 C C   . LEU F 3 13 ? 20.511  19.456 -7.021  1.00 86.55  ? 22   LEU F C   1 
ATOM   3094 O O   . LEU F 3 13 ? 21.294  18.964 -7.829  1.00 87.72  ? 22   LEU F O   1 
ATOM   3095 C CB  . LEU F 3 13 ? 19.648  18.167 -5.075  1.00 70.24  ? 22   LEU F CB  1 
ATOM   3096 C CG  . LEU F 3 13 ? 18.772  18.719 -3.952  1.00 65.43  ? 22   LEU F CG  1 
ATOM   3097 C CD1 . LEU F 3 13 ? 17.300  18.380 -4.159  1.00 64.74  ? 22   LEU F CD1 1 
ATOM   3098 C CD2 . LEU F 3 13 ? 19.260  18.121 -2.660  1.00 61.27  ? 22   LEU F CD2 1 
ATOM   3099 N N   . THR F 3 14 ? 20.628  20.694 -6.556  1.00 91.88  ? 23   THR F N   1 
ATOM   3100 C CA  . THR F 3 14 ? 21.692  21.588 -6.992  1.00 93.70  ? 23   THR F CA  1 
ATOM   3101 C C   . THR F 3 14 ? 22.192  22.408 -5.817  1.00 101.99 ? 23   THR F C   1 
ATOM   3102 O O   . THR F 3 14 ? 21.393  23.008 -5.091  1.00 105.01 ? 23   THR F O   1 
ATOM   3103 C CB  . THR F 3 14 ? 21.185  22.556 -8.071  1.00 84.65  ? 23   THR F CB  1 
ATOM   3104 O OG1 . THR F 3 14 ? 20.665  21.805 -9.173  1.00 83.82  ? 23   THR F OG1 1 
ATOM   3105 C CG2 . THR F 3 14 ? 22.312  23.453 -8.555  1.00 73.84  ? 23   THR F CG2 1 
ATOM   3106 N N   . ILE F 3 15 ? 23.511  22.446 -5.640  1.00 109.38 ? 24   ILE F N   1 
ATOM   3107 C CA  . ILE F 3 15 ? 24.103  23.197 -4.539  1.00 113.74 ? 24   ILE F CA  1 
ATOM   3108 C C   . ILE F 3 15 ? 24.977  24.351 -4.989  1.00 121.82 ? 24   ILE F C   1 
ATOM   3109 O O   . ILE F 3 15 ? 25.784  24.201 -5.903  1.00 121.94 ? 24   ILE F O   1 
ATOM   3110 C CB  . ILE F 3 15 ? 24.954  22.299 -3.656  1.00 104.16 ? 24   ILE F CB  1 
ATOM   3111 C CG1 . ILE F 3 15 ? 24.220  20.976 -3.421  1.00 96.85  ? 24   ILE F CG1 1 
ATOM   3112 C CG2 . ILE F 3 15 ? 25.289  23.029 -2.361  1.00 96.41  ? 24   ILE F CG2 1 
ATOM   3113 C CD1 . ILE F 3 15 ? 22.766  21.118 -3.011  1.00 87.76  ? 24   ILE F CD1 1 
ATOM   3114 N N   . THR F 3 16 ? 24.814  25.493 -4.325  1.00 132.85 ? 25   THR F N   1 
ATOM   3115 C CA  . THR F 3 16 ? 25.574  26.700 -4.631  1.00 147.69 ? 25   THR F CA  1 
ATOM   3116 C C   . THR F 3 16 ? 26.852  26.404 -5.424  1.00 160.09 ? 25   THR F C   1 
ATOM   3117 O O   . THR F 3 16 ? 27.854  25.949 -4.867  1.00 164.67 ? 25   THR F O   1 
ATOM   3118 C CB  . THR F 3 16 ? 25.918  27.464 -3.333  1.00 146.16 ? 25   THR F CB  1 
ATOM   3119 O OG1 . THR F 3 16 ? 26.047  26.534 -2.250  1.00 144.68 ? 25   THR F OG1 1 
ATOM   3120 C CG2 . THR F 3 16 ? 24.827  28.474 -3.008  1.00 140.68 ? 25   THR F CG2 1 
ATOM   3121 N N   . ASP F 3 17 ? 26.773  26.668 -6.731  1.00 167.78 ? 39   ASP F N   1 
ATOM   3122 C CA  . ASP F 3 17 ? 27.836  26.458 -7.729  1.00 169.13 ? 39   ASP F CA  1 
ATOM   3123 C C   . ASP F 3 17 ? 27.536  25.176 -8.508  1.00 172.42 ? 39   ASP F C   1 
ATOM   3124 O O   . ASP F 3 17 ? 27.681  24.079 -7.973  1.00 176.21 ? 39   ASP F O   1 
ATOM   3125 C CB  . ASP F 3 17 ? 29.226  26.348 -7.091  1.00 159.45 ? 39   ASP F CB  1 
ATOM   3126 C CG  . ASP F 3 17 ? 30.326  26.186 -8.127  1.00 147.75 ? 39   ASP F CG  1 
ATOM   3127 O OD1 . ASP F 3 17 ? 30.506  27.107 -8.953  1.00 139.80 ? 39   ASP F OD1 1 
ATOM   3128 O OD2 . ASP F 3 17 ? 31.005  25.136 -8.124  1.00 140.83 ? 39   ASP F OD2 1 
ATOM   3129 N N   . PRO F 3 18 ? 27.144  25.306 -9.793  1.00 171.69 ? 40   PRO F N   1 
ATOM   3130 C CA  . PRO F 3 18 ? 26.808  24.186 -10.675 1.00 165.82 ? 40   PRO F CA  1 
ATOM   3131 C C   . PRO F 3 18 ? 27.187  22.803 -10.173 1.00 156.88 ? 40   PRO F C   1 
ATOM   3132 O O   . PRO F 3 18 ? 28.111  22.169 -10.682 1.00 159.82 ? 40   PRO F O   1 
ATOM   3133 C CB  . PRO F 3 18 ? 27.503  24.564 -11.972 1.00 170.95 ? 40   PRO F CB  1 
ATOM   3134 C CG  . PRO F 3 18 ? 27.185  26.012 -12.041 1.00 176.89 ? 40   PRO F CG  1 
ATOM   3135 C CD  . PRO F 3 18 ? 27.439  26.503 -10.605 1.00 177.02 ? 40   PRO F CD  1 
ATOM   3136 N N   . LYS F 3 19 ? 26.456  22.354 -9.159  1.00 142.98 ? 41   LYS F N   1 
ATOM   3137 C CA  . LYS F 3 19 ? 26.655  21.044 -8.565  1.00 121.91 ? 41   LYS F CA  1 
ATOM   3138 C C   . LYS F 3 19 ? 25.298  20.378 -8.564  1.00 104.24 ? 41   LYS F C   1 
ATOM   3139 O O   . LYS F 3 19 ? 24.377  20.814 -7.875  1.00 94.18  ? 41   LYS F O   1 
ATOM   3140 C CB  . LYS F 3 19 ? 27.188  21.169 -7.139  1.00 122.47 ? 41   LYS F CB  1 
ATOM   3141 C CG  . LYS F 3 19 ? 28.691  21.358 -7.061  1.00 122.43 ? 41   LYS F CG  1 
ATOM   3142 C CD  . LYS F 3 19 ? 29.114  21.736 -5.654  1.00 133.30 ? 41   LYS F CD  1 
ATOM   3143 C CE  . LYS F 3 19 ? 28.501  23.070 -5.245  1.00 141.18 ? 41   LYS F CE  1 
ATOM   3144 N NZ  . LYS F 3 19 ? 28.887  23.496 -3.871  1.00 145.03 ? 41   LYS F NZ  1 
ATOM   3145 N N   . VAL F 3 20 ? 25.181  19.328 -9.363  1.00 95.29  ? 42   VAL F N   1 
ATOM   3146 C CA  . VAL F 3 20 ? 23.934  18.598 -9.476  1.00 95.82  ? 42   VAL F CA  1 
ATOM   3147 C C   . VAL F 3 20 ? 24.134  17.135 -9.116  1.00 90.99  ? 42   VAL F C   1 
ATOM   3148 O O   . VAL F 3 20 ? 24.910  16.427 -9.755  1.00 93.66  ? 42   VAL F O   1 
ATOM   3149 C CB  . VAL F 3 20 ? 23.385  18.703 -10.897 1.00 98.24  ? 42   VAL F CB  1 
ATOM   3150 C CG1 . VAL F 3 20 ? 22.009  18.058 -10.976 1.00 95.10  ? 42   VAL F CG1 1 
ATOM   3151 C CG2 . VAL F 3 20 ? 23.334  20.168 -11.306 1.00 101.81 ? 42   VAL F CG2 1 
ATOM   3152 N N   . TYR F 3 21 ? 23.413  16.689 -8.094  1.00 83.96  ? 43   TYR F N   1 
ATOM   3153 C CA  . TYR F 3 21 ? 23.525  15.321 -7.618  1.00 77.65  ? 43   TYR F CA  1 
ATOM   3154 C C   . TYR F 3 21 ? 22.222  14.551 -7.726  1.00 72.60  ? 43   TYR F C   1 
ATOM   3155 O O   . TYR F 3 21 ? 21.177  15.008 -7.269  1.00 70.23  ? 43   TYR F O   1 
ATOM   3156 C CB  . TYR F 3 21 ? 23.973  15.314 -6.155  1.00 82.74  ? 43   TYR F CB  1 
ATOM   3157 C CG  . TYR F 3 21 ? 25.101  16.273 -5.853  1.00 89.12  ? 43   TYR F CG  1 
ATOM   3158 C CD1 . TYR F 3 21 ? 24.914  17.648 -5.960  1.00 96.97  ? 43   TYR F CD1 1 
ATOM   3159 C CD2 . TYR F 3 21 ? 26.359  15.809 -5.480  1.00 86.39  ? 43   TYR F CD2 1 
ATOM   3160 C CE1 . TYR F 3 21 ? 25.948  18.538 -5.709  1.00 103.49 ? 43   TYR F CE1 1 
ATOM   3161 C CE2 . TYR F 3 21 ? 27.405  16.695 -5.225  1.00 89.22  ? 43   TYR F CE2 1 
ATOM   3162 C CZ  . TYR F 3 21 ? 27.189  18.059 -5.343  1.00 98.30  ? 43   TYR F CZ  1 
ATOM   3163 O OH  . TYR F 3 21 ? 28.203  18.956 -5.105  1.00 102.51 ? 43   TYR F OH  1 
ATOM   3164 N N   . PRO F 3 22 ? 22.270  13.354 -8.323  1.00 77.94  ? 44   PRO F N   1 
ATOM   3165 C CA  . PRO F 3 22 ? 21.041  12.561 -8.446  1.00 76.61  ? 44   PRO F CA  1 
ATOM   3166 C C   . PRO F 3 22 ? 20.416  12.396 -7.067  1.00 70.09  ? 44   PRO F C   1 
ATOM   3167 O O   . PRO F 3 22 ? 21.027  12.729 -6.050  1.00 63.46  ? 44   PRO F O   1 
ATOM   3168 C CB  . PRO F 3 22 ? 21.535  11.240 -9.038  1.00 85.07  ? 44   PRO F CB  1 
ATOM   3169 C CG  . PRO F 3 22 ? 22.990  11.164 -8.575  1.00 81.85  ? 44   PRO F CG  1 
ATOM   3170 C CD  . PRO F 3 22 ? 23.453  12.585 -8.755  1.00 82.38  ? 44   PRO F CD  1 
ATOM   3171 N N   . ILE F 3 23 ? 19.210  11.862 -7.017  1.00 67.12  ? 45   ILE F N   1 
ATOM   3172 C CA  . ILE F 3 23 ? 18.560  11.729 -5.729  1.00 70.20  ? 45   ILE F CA  1 
ATOM   3173 C C   . ILE F 3 23 ? 18.255  10.297 -5.301  1.00 70.84  ? 45   ILE F C   1 
ATOM   3174 O O   . ILE F 3 23 ? 17.703  9.507  -6.066  1.00 75.77  ? 45   ILE F O   1 
ATOM   3175 C CB  . ILE F 3 23 ? 17.267  12.594 -5.714  1.00 69.70  ? 45   ILE F CB  1 
ATOM   3176 C CG1 . ILE F 3 23 ? 17.650  14.081 -5.898  1.00 55.49  ? 45   ILE F CG1 1 
ATOM   3177 C CG2 . ILE F 3 23 ? 16.473  12.333 -4.433  1.00 56.87  ? 45   ILE F CG2 1 
ATOM   3178 C CD1 . ILE F 3 23 ? 16.475  15.040 -6.105  1.00 59.33  ? 45   ILE F CD1 1 
ATOM   3179 N N   . ILE F 3 24 ? 18.636  9.963  -4.073  1.00 66.68  ? 46   ILE F N   1 
ATOM   3180 C CA  . ILE F 3 24 ? 18.375  8.633  -3.542  1.00 69.07  ? 46   ILE F CA  1 
ATOM   3181 C C   . ILE F 3 24 ? 17.458  8.758  -2.360  1.00 70.26  ? 46   ILE F C   1 
ATOM   3182 O O   . ILE F 3 24 ? 17.646  9.628  -1.515  1.00 70.76  ? 46   ILE F O   1 
ATOM   3183 C CB  . ILE F 3 24 ? 19.642  7.924  -3.082  1.00 64.21  ? 46   ILE F CB  1 
ATOM   3184 C CG1 . ILE F 3 24 ? 20.533  7.657  -4.292  1.00 66.72  ? 46   ILE F CG1 1 
ATOM   3185 C CG2 . ILE F 3 24 ? 19.267  6.631  -2.348  1.00 55.73  ? 46   ILE F CG2 1 
ATOM   3186 C CD1 . ILE F 3 24 ? 19.797  6.981  -5.445  1.00 63.11  ? 46   ILE F CD1 1 
ATOM   3187 N N   . LEU F 3 25 ? 16.489  7.861  -2.277  1.00 76.49  ? 47   LEU F N   1 
ATOM   3188 C CA  . LEU F 3 25 ? 15.517  7.944  -1.212  1.00 86.15  ? 47   LEU F CA  1 
ATOM   3189 C C   . LEU F 3 25 ? 15.509  6.761  -0.270  1.00 93.47  ? 47   LEU F C   1 
ATOM   3190 O O   . LEU F 3 25 ? 15.365  5.618  -0.710  1.00 89.07  ? 47   LEU F O   1 
ATOM   3191 C CB  . LEU F 3 25 ? 14.134  8.129  -1.837  1.00 88.37  ? 47   LEU F CB  1 
ATOM   3192 C CG  . LEU F 3 25 ? 14.159  9.131  -3.001  1.00 91.71  ? 47   LEU F CG  1 
ATOM   3193 C CD1 . LEU F 3 25 ? 12.827  9.138  -3.712  1.00 88.14  ? 47   LEU F CD1 1 
ATOM   3194 C CD2 . LEU F 3 25 ? 14.502  10.519 -2.488  1.00 88.95  ? 47   LEU F CD2 1 
ATOM   3195 N N   . ARG F 3 26 ? 15.692  7.047  1.023   1.00 104.10 ? 48   ARG F N   1 
ATOM   3196 C CA  . ARG F 3 26 ? 15.654  6.019  2.060   1.00 113.47 ? 48   ARG F CA  1 
ATOM   3197 C C   . ARG F 3 26 ? 14.207  5.576  2.019   1.00 122.68 ? 48   ARG F C   1 
ATOM   3198 O O   . ARG F 3 26 ? 13.900  4.387  1.927   1.00 128.04 ? 48   ARG F O   1 
ATOM   3199 C CB  . ARG F 3 26 ? 15.960  6.604  3.447   1.00 108.42 ? 48   ARG F CB  1 
ATOM   3200 C CG  . ARG F 3 26 ? 17.432  6.833  3.729   1.00 113.61 ? 48   ARG F CG  1 
ATOM   3201 C CD  . ARG F 3 26 ? 17.928  5.954  4.871   1.00 118.19 ? 48   ARG F CD  1 
ATOM   3202 N NE  . ARG F 3 26 ? 19.143  5.232  4.494   1.00 119.37 ? 48   ARG F NE  1 
ATOM   3203 C CZ  . ARG F 3 26 ? 19.183  4.261  3.583   1.00 108.05 ? 48   ARG F CZ  1 
ATOM   3204 N NH1 . ARG F 3 26 ? 18.071  3.891  2.959   1.00 108.67 ? 48   ARG F NH1 1 
ATOM   3205 N NH2 . ARG F 3 26 ? 20.334  3.665  3.286   1.00 87.79  ? 48   ARG F NH2 1 
ATOM   3206 N N   . LEU F 3 27 ? 13.321  6.565  2.072   1.00 127.44 ? 49   LEU F N   1 
ATOM   3207 C CA  . LEU F 3 27 ? 11.885  6.338  2.016   1.00 134.66 ? 49   LEU F CA  1 
ATOM   3208 C C   . LEU F 3 27 ? 11.309  5.578  3.203   1.00 139.97 ? 49   LEU F C   1 
ATOM   3209 O O   . LEU F 3 27 ? 11.475  4.365  3.337   1.00 143.66 ? 49   LEU F O   1 
ATOM   3210 C CB  . LEU F 3 27 ? 11.522  5.650  0.681   1.00 128.89 ? 49   LEU F CB  1 
ATOM   3211 C CG  . LEU F 3 27 ? 10.676  4.379  0.472   1.00 112.48 ? 49   LEU F CG  1 
ATOM   3212 C CD1 . LEU F 3 27 ? 11.472  3.152  0.932   1.00 98.31  ? 49   LEU F CD1 1 
ATOM   3213 C CD2 . LEU F 3 27 ? 9.326   4.495  1.180   1.00 110.63 ? 49   LEU F CD2 1 
ATOM   3214 N N   . GLY F 3 28 ? 10.650  6.321  4.081   1.00 139.90 ? 50   GLY F N   1 
ATOM   3215 C CA  . GLY F 3 28 ? 10.012  5.710  5.225   1.00 144.03 ? 50   GLY F CA  1 
ATOM   3216 C C   . GLY F 3 28 ? 8.556   5.784  4.842   1.00 147.25 ? 50   GLY F C   1 
ATOM   3217 O O   . GLY F 3 28 ? 7.843   4.781  4.774   1.00 152.02 ? 50   GLY F O   1 
ATOM   3218 N N   . SER F 3 29 ? 8.135   7.009  4.553   1.00 146.37 ? 51   SER F N   1 
ATOM   3219 C CA  . SER F 3 29 ? 6.772   7.299  4.144   1.00 146.27 ? 51   SER F CA  1 
ATOM   3220 C C   . SER F 3 29 ? 6.814   7.407  2.620   1.00 146.93 ? 51   SER F C   1 
ATOM   3221 O O   . SER F 3 29 ? 7.658   6.773  1.985   1.00 149.15 ? 51   SER F O   1 
ATOM   3222 C CB  . SER F 3 29 ? 6.329   8.623  4.767   1.00 143.12 ? 51   SER F CB  1 
ATOM   3223 O OG  . SER F 3 29 ? 6.684   8.671  6.143   1.00 141.55 ? 51   SER F OG  1 
ATOM   3224 N N   . ASN F 3 30 ? 5.913   8.193  2.033   1.00 145.07 ? 52   ASN F N   1 
ATOM   3225 C CA  . ASN F 3 30 ? 5.908   8.368  0.580   1.00 144.59 ? 52   ASN F CA  1 
ATOM   3226 C C   . ASN F 3 30 ? 5.677   9.839  0.216   1.00 141.27 ? 52   ASN F C   1 
ATOM   3227 O O   . ASN F 3 30 ? 4.564   10.256 -0.118  1.00 145.60 ? 52   ASN F O   1 
ATOM   3228 C CB  . ASN F 3 30 ? 4.844   7.475  -0.076  1.00 150.57 ? 52   ASN F CB  1 
ATOM   3229 C CG  . ASN F 3 30 ? 5.348   6.799  -1.356  1.00 150.32 ? 52   ASN F CG  1 
ATOM   3230 O OD1 . ASN F 3 30 ? 5.784   7.468  -2.297  1.00 143.08 ? 52   ASN F OD1 1 
ATOM   3231 N ND2 . ASN F 3 30 ? 5.285   5.466  -1.392  1.00 151.39 ? 52   ASN F ND2 1 
ATOM   3232 N N   . LEU F 3 31 ? 6.757   10.613 0.295   1.00 132.99 ? 53   LEU F N   1 
ATOM   3233 C CA  . LEU F 3 31 ? 6.748   12.038 -0.011  1.00 122.90 ? 53   LEU F CA  1 
ATOM   3234 C C   . LEU F 3 31 ? 5.959   12.402 -1.239  1.00 120.31 ? 53   LEU F C   1 
ATOM   3235 O O   . LEU F 3 31 ? 5.848   11.631 -2.191  1.00 124.03 ? 53   LEU F O   1 
ATOM   3236 C CB  . LEU F 3 31 ? 8.169   12.559 -0.215  1.00 113.66 ? 53   LEU F CB  1 
ATOM   3237 C CG  . LEU F 3 31 ? 8.853   13.268 0.948   1.00 111.47 ? 53   LEU F CG  1 
ATOM   3238 C CD1 . LEU F 3 31 ? 8.925   12.354 2.171   1.00 103.71 ? 53   LEU F CD1 1 
ATOM   3239 C CD2 . LEU F 3 31 ? 10.237  13.697 0.491   1.00 104.61 ? 53   LEU F CD2 1 
ATOM   3240 N N   . SER F 3 32 ? 5.427   13.608 -1.212  1.00 114.69 ? 54   SER F N   1 
ATOM   3241 C CA  . SER F 3 32 ? 4.673   14.103 -2.330  1.00 112.67 ? 54   SER F CA  1 
ATOM   3242 C C   . SER F 3 32 ? 5.405   15.332 -2.837  1.00 104.47 ? 54   SER F C   1 
ATOM   3243 O O   . SER F 3 32 ? 5.967   16.104 -2.058  1.00 106.54 ? 54   SER F O   1 
ATOM   3244 C CB  . SER F 3 32 ? 3.258   14.469 -1.891  1.00 124.12 ? 54   SER F CB  1 
ATOM   3245 O OG  . SER F 3 32 ? 2.504   14.966 -2.982  1.00 137.34 ? 54   SER F OG  1 
ATOM   3246 N N   . LEU F 3 33 ? 5.427   15.493 -4.149  1.00 93.36  ? 55   LEU F N   1 
ATOM   3247 C CA  . LEU F 3 33 ? 6.069   16.644 -4.739  1.00 86.70  ? 55   LEU F CA  1 
ATOM   3248 C C   . LEU F 3 33 ? 5.104   17.272 -5.735  1.00 89.57  ? 55   LEU F C   1 
ATOM   3249 O O   . LEU F 3 33 ? 4.348   16.570 -6.401  1.00 91.39  ? 55   LEU F O   1 
ATOM   3250 C CB  . LEU F 3 33 ? 7.359   16.230 -5.431  1.00 71.02  ? 55   LEU F CB  1 
ATOM   3251 C CG  . LEU F 3 33 ? 8.019   17.368 -6.204  1.00 66.77  ? 55   LEU F CG  1 
ATOM   3252 C CD1 . LEU F 3 33 ? 8.091   18.634 -5.368  1.00 61.43  ? 55   LEU F CD1 1 
ATOM   3253 C CD2 . LEU F 3 33 ? 9.396   16.927 -6.614  1.00 66.73  ? 55   LEU F CD2 1 
ATOM   3254 N N   . SER F 3 34 ? 5.113   18.593 -5.827  1.00 87.55  ? 56   SER F N   1 
ATOM   3255 C CA  . SER F 3 34 ? 4.219   19.273 -6.744  1.00 81.42  ? 56   SER F CA  1 
ATOM   3256 C C   . SER F 3 34 ? 4.785   20.614 -7.172  1.00 85.71  ? 56   SER F C   1 
ATOM   3257 O O   . SER F 3 34 ? 5.679   21.160 -6.520  1.00 86.40  ? 56   SER F O   1 
ATOM   3258 C CB  . SER F 3 34 ? 2.846   19.450 -6.098  1.00 76.36  ? 56   SER F CB  1 
ATOM   3259 O OG  . SER F 3 34 ? 2.944   19.388 -4.687  1.00 77.83  ? 56   SER F OG  1 
ATOM   3260 N N   . MET F 3 35 ? 4.265   21.128 -8.285  1.00 86.66  ? 57   MET F N   1 
ATOM   3261 C CA  . MET F 3 35 ? 4.699   22.408 -8.845  1.00 82.81  ? 57   MET F CA  1 
ATOM   3262 C C   . MET F 3 35 ? 3.652   23.500 -8.605  1.00 89.65  ? 57   MET F C   1 
ATOM   3263 O O   . MET F 3 35 ? 2.471   23.333 -8.912  1.00 93.24  ? 57   MET F O   1 
ATOM   3264 C CB  . MET F 3 35 ? 4.955   22.250 -10.342 1.00 59.71  ? 57   MET F CB  1 
ATOM   3265 C CG  . MET F 3 35 ? 5.326   23.533 -11.055 1.00 56.40  ? 57   MET F CG  1 
ATOM   3266 S SD  . MET F 3 35 ? 6.868   24.297 -10.508 1.00 76.03  ? 57   MET F SD  1 
ATOM   3267 C CE  . MET F 3 35 ? 8.130   23.161 -11.235 1.00 64.48  ? 57   MET F CE  1 
ATOM   3268 N N   . ALA F 3 36 ? 4.092   24.627 -8.065  1.00 88.01  ? 58   ALA F N   1 
ATOM   3269 C CA  . ALA F 3 36 ? 3.170   25.704 -7.770  1.00 81.69  ? 58   ALA F CA  1 
ATOM   3270 C C   . ALA F 3 36 ? 3.521   27.005 -8.484  1.00 84.64  ? 58   ALA F C   1 
ATOM   3271 O O   . ALA F 3 36 ? 4.692   27.271 -8.786  1.00 76.02  ? 58   ALA F O   1 
ATOM   3272 C CB  . ALA F 3 36 ? 3.118   25.922 -6.262  1.00 78.42  ? 58   ALA F CB  1 
ATOM   3273 N N   . ARG F 3 37 ? 2.490   27.810 -8.747  1.00 89.35  ? 59   ARG F N   1 
ATOM   3274 C CA  . ARG F 3 37 ? 2.646   29.097 -9.421  1.00 89.98  ? 59   ARG F CA  1 
ATOM   3275 C C   . ARG F 3 37 ? 1.598   30.099 -8.943  1.00 87.69  ? 59   ARG F C   1 
ATOM   3276 O O   . ARG F 3 37 ? 0.463   29.721 -8.662  1.00 85.25  ? 59   ARG F O   1 
ATOM   3277 C CB  . ARG F 3 37 ? 2.483   28.922 -10.924 1.00 95.44  ? 59   ARG F CB  1 
ATOM   3278 C CG  . ARG F 3 37 ? 3.177   27.709 -11.482 1.00 103.83 ? 59   ARG F CG  1 
ATOM   3279 C CD  . ARG F 3 37 ? 2.303   27.068 -12.538 1.00 106.83 ? 59   ARG F CD  1 
ATOM   3280 N NE  . ARG F 3 37 ? 2.903   25.863 -13.092 1.00 112.17 ? 59   ARG F NE  1 
ATOM   3281 C CZ  . ARG F 3 37 ? 4.074   25.838 -13.714 1.00 111.09 ? 59   ARG F CZ  1 
ATOM   3282 N NH1 . ARG F 3 37 ? 4.775   26.954 -13.864 1.00 100.41 ? 59   ARG F NH1 1 
ATOM   3283 N NH2 . ARG F 3 37 ? 4.544   24.695 -14.187 1.00 114.77 ? 59   ARG F NH2 1 
ATOM   3284 N N   . ARG F 3 38 ? 1.987   31.373 -8.864  1.00 87.54  ? 60   ARG F N   1 
ATOM   3285 C CA  . ARG F 3 38 ? 1.094   32.464 -8.448  1.00 86.70  ? 60   ARG F CA  1 
ATOM   3286 C C   . ARG F 3 38 ? -0.128  32.585 -9.365  1.00 88.06  ? 60   ARG F C   1 
ATOM   3287 O O   . ARG F 3 38 ? -0.012  32.413 -10.578 1.00 87.86  ? 60   ARG F O   1 
ATOM   3288 C CB  . ARG F 3 38 ? 1.837   33.806 -8.491  1.00 81.97  ? 60   ARG F CB  1 
ATOM   3289 C CG  . ARG F 3 38 ? 2.700   34.127 -7.292  1.00 87.55  ? 60   ARG F CG  1 
ATOM   3290 C CD  . ARG F 3 38 ? 2.002   35.080 -6.323  1.00 93.60  ? 60   ARG F CD  1 
ATOM   3291 N NE  . ARG F 3 38 ? 2.740   35.221 -5.066  1.00 99.96  ? 60   ARG F NE  1 
ATOM   3292 C CZ  . ARG F 3 38 ? 4.017   35.594 -4.973  1.00 97.98  ? 60   ARG F CZ  1 
ATOM   3293 N NH1 . ARG F 3 38 ? 4.717   35.871 -6.070  1.00 95.19  ? 60   ARG F NH1 1 
ATOM   3294 N NH2 . ARG F 3 38 ? 4.597   35.686 -3.779  1.00 94.09  ? 60   ARG F NH2 1 
ATOM   3295 N N   . ASN F 3 39 ? -1.288  32.899 -8.788  1.00 92.63  ? 61   ASN F N   1 
ATOM   3296 C CA  . ASN F 3 39 ? -2.524  33.078 -9.557  1.00 92.93  ? 61   ASN F CA  1 
ATOM   3297 C C   . ASN F 3 39 ? -2.702  34.574 -9.833  1.00 96.23  ? 61   ASN F C   1 
ATOM   3298 O O   . ASN F 3 39 ? -3.497  35.252 -9.179  1.00 93.66  ? 61   ASN F O   1 
ATOM   3299 C CB  . ASN F 3 39 ? -3.719  32.529 -8.772  1.00 89.61  ? 61   ASN F CB  1 
ATOM   3300 C CG  . ASN F 3 39 ? -5.035  32.791 -9.460  1.00 95.08  ? 61   ASN F CG  1 
ATOM   3301 O OD1 . ASN F 3 39 ? -5.123  32.749 -10.687 1.00 108.94 ? 61   ASN F OD1 1 
ATOM   3302 N ND2 . ASN F 3 39 ? -6.074  33.050 -8.674  1.00 90.07  ? 61   ASN F ND2 1 
ATOM   3303 N N   . LEU F 3 40 ? -1.942  35.066 -10.810 1.00 100.92 ? 62   LEU F N   1 
ATOM   3304 C CA  . LEU F 3 40 ? -1.927  36.475 -11.202 1.00 99.95  ? 62   LEU F CA  1 
ATOM   3305 C C   . LEU F 3 40 ? -2.947  36.871 -12.244 1.00 102.42 ? 62   LEU F C   1 
ATOM   3306 O O   . LEU F 3 40 ? -2.825  37.929 -12.841 1.00 101.38 ? 62   LEU F O   1 
ATOM   3307 C CB  . LEU F 3 40 ? -0.558  36.851 -11.759 1.00 91.92  ? 62   LEU F CB  1 
ATOM   3308 C CG  . LEU F 3 40 ? 0.645   36.664 -10.854 1.00 92.48  ? 62   LEU F CG  1 
ATOM   3309 C CD1 . LEU F 3 40 ? 1.906   36.945 -11.653 1.00 95.73  ? 62   LEU F CD1 1 
ATOM   3310 C CD2 . LEU F 3 40 ? 0.522   37.589 -9.651  1.00 86.05  ? 62   LEU F CD2 1 
ATOM   3311 N N   . ASP F 3 41 ? -3.940  36.032 -12.486 1.00 104.24 ? 63   ASP F N   1 
ATOM   3312 C CA  . ASP F 3 41 ? -4.940  36.358 -13.492 1.00 111.39 ? 63   ASP F CA  1 
ATOM   3313 C C   . ASP F 3 41 ? -6.313  36.106 -12.917 1.00 111.10 ? 63   ASP F C   1 
ATOM   3314 O O   . ASP F 3 41 ? -7.332  36.435 -13.527 1.00 109.11 ? 63   ASP F O   1 
ATOM   3315 C CB  . ASP F 3 41 ? -4.743  35.482 -14.727 1.00 123.28 ? 63   ASP F CB  1 
ATOM   3316 C CG  . ASP F 3 41 ? -4.829  33.994 -14.407 1.00 135.12 ? 63   ASP F CG  1 
ATOM   3317 O OD1 . ASP F 3 41 ? -5.896  33.532 -13.949 1.00 139.22 ? 63   ASP F OD1 1 
ATOM   3318 O OD2 . ASP F 3 41 ? -3.825  33.283 -14.610 1.00 141.44 ? 63   ASP F OD2 1 
ATOM   3319 N N   . SER F 3 42 ? -6.325  35.505 -11.735 1.00 115.19 ? 64   SER F N   1 
ATOM   3320 C CA  . SER F 3 42 ? -7.562  35.169 -11.055 1.00 121.57 ? 64   SER F CA  1 
ATOM   3321 C C   . SER F 3 42 ? -7.417  35.498 -9.565  1.00 126.06 ? 64   SER F C   1 
ATOM   3322 O O   . SER F 3 42 ? -6.302  35.523 -9.032  1.00 126.03 ? 64   SER F O   1 
ATOM   3323 C CB  . SER F 3 42 ? -7.855  33.679 -11.267 1.00 116.88 ? 64   SER F CB  1 
ATOM   3324 O OG  . SER F 3 42 ? -9.134  33.319 -10.792 1.00 111.12 ? 64   SER F OG  1 
ATOM   3325 N N   . LEU F 3 43 ? -8.541  35.768 -8.904  1.00 127.82 ? 65   LEU F N   1 
ATOM   3326 C CA  . LEU F 3 43 ? -8.524  36.105 -7.482  1.00 126.83 ? 65   LEU F CA  1 
ATOM   3327 C C   . LEU F 3 43 ? -9.438  35.174 -6.695  1.00 130.79 ? 65   LEU F C   1 
ATOM   3328 O O   . LEU F 3 43 ? -9.267  34.987 -5.490  1.00 134.65 ? 65   LEU F O   1 
ATOM   3329 C CB  . LEU F 3 43 ? -8.951  37.562 -7.270  1.00 115.87 ? 65   LEU F CB  1 
ATOM   3330 C CG  . LEU F 3 43 ? -10.435 37.918 -7.162  1.00 101.11 ? 65   LEU F CG  1 
ATOM   3331 C CD1 . LEU F 3 43 ? -10.560 39.423 -7.025  1.00 80.31  ? 65   LEU F CD1 1 
ATOM   3332 C CD2 . LEU F 3 43 ? -11.199 37.428 -8.380  1.00 102.60 ? 65   LEU F CD2 1 
ATOM   3333 N N   . GLU F 3 44 ? -10.420 34.602 -7.378  1.00 130.81 ? 66   GLU F N   1 
ATOM   3334 C CA  . GLU F 3 44 ? -11.328 33.665 -6.737  1.00 131.43 ? 66   GLU F CA  1 
ATOM   3335 C C   . GLU F 3 44 ? -10.623 32.305 -6.764  1.00 134.36 ? 66   GLU F C   1 
ATOM   3336 O O   . GLU F 3 44 ? -10.814 31.470 -5.879  1.00 134.89 ? 66   GLU F O   1 
ATOM   3337 C CB  . GLU F 3 44 ? -12.655 33.593 -7.503  1.00 131.36 ? 66   GLU F CB  1 
ATOM   3338 C CG  . GLU F 3 44 ? -12.505 33.299 -8.999  1.00 134.10 ? 66   GLU F CG  1 
ATOM   3339 C CD  . GLU F 3 44 ? -12.148 34.532 -9.815  1.00 133.16 ? 66   GLU F CD  1 
ATOM   3340 O OE1 . GLU F 3 44 ? -13.046 35.363 -10.074 1.00 132.97 ? 66   GLU F OE1 1 
ATOM   3341 O OE2 . GLU F 3 44 ? -10.968 34.674 -10.193 1.00 126.87 ? 66   GLU F OE2 1 
ATOM   3342 N N   . ALA F 3 45 ? -9.793  32.106 -7.787  1.00 132.73 ? 67   ALA F N   1 
ATOM   3343 C CA  . ALA F 3 45 ? -9.040  30.868 -7.967  1.00 123.80 ? 67   ALA F CA  1 
ATOM   3344 C C   . ALA F 3 45 ? -8.043  30.665 -6.834  1.00 121.73 ? 67   ALA F C   1 
ATOM   3345 O O   . ALA F 3 45 ? -7.761  31.596 -6.073  1.00 121.19 ? 67   ALA F O   1 
ATOM   3346 C CB  . ALA F 3 45 ? -8.305  30.905 -9.295  1.00 111.71 ? 67   ALA F CB  1 
ATOM   3347 N N   . ARG F 3 46 ? -7.513  29.445 -6.728  1.00 117.94 ? 68   ARG F N   1 
ATOM   3348 C CA  . ARG F 3 46 ? -6.531  29.108 -5.695  1.00 106.50 ? 68   ARG F CA  1 
ATOM   3349 C C   . ARG F 3 46 ? -5.382  30.110 -5.690  1.00 92.43  ? 68   ARG F C   1 
ATOM   3350 O O   . ARG F 3 46 ? -4.860  30.487 -6.745  1.00 87.51  ? 68   ARG F O   1 
ATOM   3351 C CB  . ARG F 3 46 ? -5.967  27.700 -5.909  1.00 115.33 ? 68   ARG F CB  1 
ATOM   3352 C CG  . ARG F 3 46 ? -6.784  26.584 -5.286  1.00 126.04 ? 68   ARG F CG  1 
ATOM   3353 C CD  . ARG F 3 46 ? -6.031  25.261 -5.366  1.00 137.62 ? 68   ARG F CD  1 
ATOM   3354 N NE  . ARG F 3 46 ? -4.743  25.313 -4.673  1.00 144.15 ? 68   ARG F NE  1 
ATOM   3355 C CZ  . ARG F 3 46 ? -3.882  24.300 -4.612  1.00 143.77 ? 68   ARG F CZ  1 
ATOM   3356 N NH1 . ARG F 3 46 ? -4.166  23.147 -5.203  1.00 143.05 ? 68   ARG F NH1 1 
ATOM   3357 N NH2 . ARG F 3 46 ? -2.734  24.438 -3.961  1.00 143.67 ? 68   ARG F NH2 1 
ATOM   3358 N N   . ALA F 3 47 ? -4.995  30.537 -4.494  1.00 77.77  ? 69   ALA F N   1 
ATOM   3359 C CA  . ALA F 3 47 ? -3.927  31.504 -4.356  1.00 76.94  ? 69   ALA F CA  1 
ATOM   3360 C C   . ALA F 3 47 ? -2.788  31.089 -5.269  1.00 89.37  ? 69   ALA F C   1 
ATOM   3361 O O   . ALA F 3 47 ? -2.246  31.923 -6.002  1.00 91.30  ? 69   ALA F O   1 
ATOM   3362 C CB  . ALA F 3 47 ? -3.468  31.572 -2.913  1.00 58.93  ? 69   ALA F CB  1 
ATOM   3363 N N   . PHE F 3 48 ? -2.444  29.796 -5.228  1.00 97.10  ? 70   PHE F N   1 
ATOM   3364 C CA  . PHE F 3 48 ? -1.373  29.225 -6.060  1.00 91.34  ? 70   PHE F CA  1 
ATOM   3365 C C   . PHE F 3 48 ? -1.752  27.910 -6.729  1.00 92.95  ? 70   PHE F C   1 
ATOM   3366 O O   . PHE F 3 48 ? -2.387  27.041 -6.124  1.00 84.47  ? 70   PHE F O   1 
ATOM   3367 C CB  . PHE F 3 48 ? -0.091  28.996 -5.257  1.00 70.77  ? 70   PHE F CB  1 
ATOM   3368 C CG  . PHE F 3 48 ? 0.746   30.235 -5.069  1.00 65.91  ? 70   PHE F CG  1 
ATOM   3369 C CD1 . PHE F 3 48 ? 0.364   31.221 -4.161  1.00 77.66  ? 70   PHE F CD1 1 
ATOM   3370 C CD2 . PHE F 3 48 ? 1.948   30.386 -5.757  1.00 61.05  ? 70   PHE F CD2 1 
ATOM   3371 C CE1 . PHE F 3 48 ? 1.169   32.332 -3.933  1.00 83.13  ? 70   PHE F CE1 1 
ATOM   3372 C CE2 . PHE F 3 48 ? 2.761   31.487 -5.537  1.00 68.89  ? 70   PHE F CE2 1 
ATOM   3373 C CZ  . PHE F 3 48 ? 2.371   32.461 -4.618  1.00 84.02  ? 70   PHE F CZ  1 
ATOM   3374 N N   . GLN F 3 49 ? -1.320  27.775 -7.978  1.00 99.89  ? 71   GLN F N   1 
ATOM   3375 C CA  . GLN F 3 49 ? -1.588  26.605 -8.799  1.00 110.62 ? 71   GLN F CA  1 
ATOM   3376 C C   . GLN F 3 49 ? -0.696  25.423 -8.436  1.00 114.66 ? 71   GLN F C   1 
ATOM   3377 O O   . GLN F 3 49 ? 0.499   25.411 -8.747  1.00 112.46 ? 71   GLN F O   1 
ATOM   3378 C CB  . GLN F 3 49 ? -1.373  26.967 -10.264 1.00 119.16 ? 71   GLN F CB  1 
ATOM   3379 C CG  . GLN F 3 49 ? -1.856  25.936 -11.253 1.00 123.99 ? 71   GLN F CG  1 
ATOM   3380 C CD  . GLN F 3 49 ? -1.150  26.070 -12.584 1.00 122.40 ? 71   GLN F CD  1 
ATOM   3381 O OE1 . GLN F 3 49 ? -0.014  25.621 -12.740 1.00 124.40 ? 71   GLN F OE1 1 
ATOM   3382 N NE2 . GLN F 3 49 ? -1.811  26.706 -13.546 1.00 108.31 ? 71   GLN F NE2 1 
ATOM   3383 N N   . SER F 3 50 ? -1.283  24.428 -7.780  1.00 115.65 ? 72   SER F N   1 
ATOM   3384 C CA  . SER F 3 50 ? -0.538  23.242 -7.396  1.00 114.96 ? 72   SER F CA  1 
ATOM   3385 C C   . SER F 3 50 ? -0.722  22.137 -8.418  1.00 114.32 ? 72   SER F C   1 
ATOM   3386 O O   . SER F 3 50 ? -1.808  21.571 -8.560  1.00 115.66 ? 72   SER F O   1 
ATOM   3387 C CB  . SER F 3 50 ? -0.988  22.726 -6.040  1.00 114.28 ? 72   SER F CB  1 
ATOM   3388 O OG  . SER F 3 50 ? -0.416  21.450 -5.820  1.00 113.82 ? 72   SER F OG  1 
ATOM   3389 N N   . THR F 3 51 ? 0.358   21.833 -9.122  1.00 110.05 ? 73   THR F N   1 
ATOM   3390 C CA  . THR F 3 51 ? 0.344   20.804 -10.142 1.00 100.20 ? 73   THR F CA  1 
ATOM   3391 C C   . THR F 3 51 ? 1.219   19.654 -9.667  1.00 97.67  ? 73   THR F C   1 
ATOM   3392 O O   . THR F 3 51 ? 2.439   19.707 -9.801  1.00 96.41  ? 73   THR F O   1 
ATOM   3393 C CB  . THR F 3 51 ? 0.924   21.337 -11.458 1.00 93.69  ? 73   THR F CB  1 
ATOM   3394 O OG1 . THR F 3 51 ? 0.529   22.706 -11.648 1.00 77.80  ? 73   THR F OG1 1 
ATOM   3395 C CG2 . THR F 3 51 ? 0.427   20.501 -12.613 1.00 90.86  ? 73   THR F CG2 1 
ATOM   3396 N N   . PRO F 3 52 ? 0.612   18.608 -9.084  1.00 97.47  ? 74   PRO F N   1 
ATOM   3397 C CA  . PRO F 3 52 ? 1.402   17.466 -8.609  1.00 100.92 ? 74   PRO F CA  1 
ATOM   3398 C C   . PRO F 3 52 ? 2.469   17.038 -9.631  1.00 102.13 ? 74   PRO F C   1 
ATOM   3399 O O   . PRO F 3 52 ? 2.215   17.050 -10.834 1.00 99.19  ? 74   PRO F O   1 
ATOM   3400 C CB  . PRO F 3 52 ? 0.333   16.404 -8.363  1.00 97.20  ? 74   PRO F CB  1 
ATOM   3401 C CG  . PRO F 3 52 ? -0.793  17.236 -7.812  1.00 98.51  ? 74   PRO F CG  1 
ATOM   3402 C CD  . PRO F 3 52 ? -0.816  18.429 -8.762  1.00 98.77  ? 74   PRO F CD  1 
ATOM   3403 N N   . ILE F 3 53 ? 3.659   16.678 -9.144  1.00 103.14 ? 75   ILE F N   1 
ATOM   3404 C CA  . ILE F 3 53 ? 4.775   16.270 -10.009 1.00 97.33  ? 75   ILE F CA  1 
ATOM   3405 C C   . ILE F 3 53 ? 5.077   14.765 -9.995  1.00 93.06  ? 75   ILE F C   1 
ATOM   3406 O O   . ILE F 3 53 ? 5.312   14.165 -8.938  1.00 87.21  ? 75   ILE F O   1 
ATOM   3407 C CB  . ILE F 3 53 ? 6.066   17.030 -9.632  1.00 99.96  ? 75   ILE F CB  1 
ATOM   3408 C CG1 . ILE F 3 53 ? 5.815   18.540 -9.699  1.00 101.40 ? 75   ILE F CG1 1 
ATOM   3409 C CG2 . ILE F 3 53 ? 7.194   16.637 -10.573 1.00 96.73  ? 75   ILE F CG2 1 
ATOM   3410 C CD1 . ILE F 3 53 ? 6.980   19.394 -9.203  1.00 99.81  ? 75   ILE F CD1 1 
ATOM   3411 N N   . VAL F 3 54 ? 5.091   14.177 -11.188 1.00 94.41  ? 76   VAL F N   1 
ATOM   3412 C CA  . VAL F 3 54 ? 5.340   12.752 -11.357 1.00 107.01 ? 76   VAL F CA  1 
ATOM   3413 C C   . VAL F 3 54 ? 6.805   12.370 -11.185 1.00 110.95 ? 76   VAL F C   1 
ATOM   3414 O O   . VAL F 3 54 ? 7.650   12.668 -12.033 1.00 106.68 ? 76   VAL F O   1 
ATOM   3415 C CB  . VAL F 3 54 ? 4.862   12.278 -12.743 1.00 110.21 ? 76   VAL F CB  1 
ATOM   3416 C CG1 . VAL F 3 54 ? 5.468   13.167 -13.826 1.00 103.93 ? 76   VAL F CG1 1 
ATOM   3417 C CG2 . VAL F 3 54 ? 5.240   10.812 -12.954 1.00 111.87 ? 76   VAL F CG2 1 
ATOM   3418 N N   . VAL F 3 55 ? 7.098   11.699 -10.078 1.00 116.31 ? 77   VAL F N   1 
ATOM   3419 C CA  . VAL F 3 55 ? 8.455   11.267 -9.797  1.00 117.66 ? 77   VAL F CA  1 
ATOM   3420 C C   . VAL F 3 55 ? 8.570   9.828  -10.297 1.00 122.34 ? 77   VAL F C   1 
ATOM   3421 O O   . VAL F 3 55 ? 7.867   8.934  -9.815  1.00 122.74 ? 77   VAL F O   1 
ATOM   3422 C CB  . VAL F 3 55 ? 8.746   11.335 -8.278  1.00 115.75 ? 77   VAL F CB  1 
ATOM   3423 C CG1 . VAL F 3 55 ? 10.220  11.090 -8.018  1.00 117.61 ? 77   VAL F CG1 1 
ATOM   3424 C CG2 . VAL F 3 55 ? 8.331   12.696 -7.725  1.00 114.27 ? 77   VAL F CG2 1 
ATOM   3425 N N   . GLN F 3 56 ? 9.447   9.616  -11.274 1.00 125.66 ? 78   GLN F N   1 
ATOM   3426 C CA  . GLN F 3 56 ? 9.643   8.291  -11.858 1.00 132.38 ? 78   GLN F CA  1 
ATOM   3427 C C   . GLN F 3 56 ? 10.847  7.550  -11.259 1.00 132.51 ? 78   GLN F C   1 
ATOM   3428 O O   . GLN F 3 56 ? 11.543  6.801  -11.947 1.00 137.53 ? 78   GLN F O   1 
ATOM   3429 C CB  . GLN F 3 56 ? 9.810   8.425  -13.377 1.00 137.75 ? 78   GLN F CB  1 
ATOM   3430 C CG  . GLN F 3 56 ? 9.529   7.146  -14.153 1.00 143.80 ? 78   GLN F CG  1 
ATOM   3431 C CD  . GLN F 3 56 ? 8.137   6.609  -13.884 1.00 146.86 ? 78   GLN F CD  1 
ATOM   3432 O OE1 . GLN F 3 56 ? 7.144   7.324  -14.035 1.00 148.92 ? 78   GLN F OE1 1 
ATOM   3433 N NE2 . GLN F 3 56 ? 8.057   5.345  -13.481 1.00 146.31 ? 78   GLN F NE2 1 
ATOM   3434 N N   . MET F 3 57 ? 11.079  7.764  -9.970  1.00 127.58 ? 79   MET F N   1 
ATOM   3435 C CA  . MET F 3 57 ? 12.180  7.139  -9.237  1.00 121.24 ? 79   MET F CA  1 
ATOM   3436 C C   . MET F 3 57 ? 12.266  5.627  -9.452  1.00 123.68 ? 79   MET F C   1 
ATOM   3437 O O   . MET F 3 57 ? 11.252  4.969  -9.705  1.00 126.50 ? 79   MET F O   1 
ATOM   3438 C CB  . MET F 3 57 ? 11.985  7.402  -7.759  1.00 111.87 ? 79   MET F CB  1 
ATOM   3439 C CG  . MET F 3 57 ? 10.556  7.140  -7.357  1.00 101.50 ? 79   MET F CG  1 
ATOM   3440 S SD  . MET F 3 57 ? 10.401  6.948  -5.622  1.00 94.22  ? 79   MET F SD  1 
ATOM   3441 C CE  . MET F 3 57 ? 10.172  5.141  -5.528  1.00 93.62  ? 79   MET F CE  1 
ATOM   3442 N N   . THR F 3 58 ? 13.480  5.091  -9.312  1.00 123.17 ? 80   THR F N   1 
ATOM   3443 C CA  . THR F 3 58 ? 13.754  3.658  -9.473  1.00 117.11 ? 80   THR F CA  1 
ATOM   3444 C C   . THR F 3 58 ? 14.189  3.027  -8.143  1.00 114.74 ? 80   THR F C   1 
ATOM   3445 O O   . THR F 3 58 ? 14.934  3.636  -7.374  1.00 112.48 ? 80   THR F O   1 
ATOM   3446 C CB  . THR F 3 58 ? 14.899  3.407  -10.494 1.00 109.89 ? 80   THR F CB  1 
ATOM   3447 O OG1 . THR F 3 58 ? 14.670  4.171  -11.684 1.00 107.06 ? 80   THR F OG1 1 
ATOM   3448 C CG2 . THR F 3 58 ? 14.975  1.932  -10.855 1.00 103.65 ? 80   THR F CG2 1 
ATOM   3449 N N   . LYS F 3 59 ? 13.718  1.814  -7.868  1.00 111.09 ? 81   LYS F N   1 
ATOM   3450 C CA  . LYS F 3 59 ? 14.108  1.119  -6.641  1.00 112.12 ? 81   LYS F CA  1 
ATOM   3451 C C   . LYS F 3 59 ? 15.385  0.345  -6.992  1.00 113.78 ? 81   LYS F C   1 
ATOM   3452 O O   . LYS F 3 59 ? 15.537  -0.132 -8.121  1.00 113.73 ? 81   LYS F O   1 
ATOM   3453 C CB  . LYS F 3 59 ? 12.992  0.168  -6.183  1.00 105.13 ? 81   LYS F CB  1 
ATOM   3454 C CG  . LYS F 3 59 ? 13.207  -0.498 -4.816  1.00 105.85 ? 81   LYS F CG  1 
ATOM   3455 C CD  . LYS F 3 59 ? 14.251  -1.615 -4.843  1.00 113.84 ? 81   LYS F CD  1 
ATOM   3456 C CE  . LYS F 3 59 ? 14.276  -2.386 -3.522  1.00 121.51 ? 81   LYS F CE  1 
ATOM   3457 N NZ  . LYS F 3 59 ? 15.196  -3.561 -3.514  1.00 121.46 ? 81   LYS F NZ  1 
ATOM   3458 N N   . LEU F 3 60 ? 16.310  0.224  -6.045  1.00 110.52 ? 82   LEU F N   1 
ATOM   3459 C CA  . LEU F 3 60 ? 17.556  -0.470 -6.343  1.00 104.65 ? 82   LEU F CA  1 
ATOM   3460 C C   . LEU F 3 60 ? 17.800  -1.801 -5.652  1.00 104.25 ? 82   LEU F C   1 
ATOM   3461 O O   . LEU F 3 60 ? 17.356  -2.038 -4.519  1.00 101.83 ? 82   LEU F O   1 
ATOM   3462 C CB  . LEU F 3 60 ? 18.745  0.449  -6.067  1.00 98.42  ? 82   LEU F CB  1 
ATOM   3463 C CG  . LEU F 3 60 ? 18.938  1.652  -6.991  1.00 89.36  ? 82   LEU F CG  1 
ATOM   3464 C CD1 . LEU F 3 60 ? 20.225  2.350  -6.596  1.00 82.12  ? 82   LEU F CD1 1 
ATOM   3465 C CD2 . LEU F 3 60 ? 18.995  1.217  -8.460  1.00 80.61  ? 82   LEU F CD2 1 
ATOM   3466 N N   . ALA F 3 61 ? 18.528  -2.658 -6.364  1.00 102.24 ? 83   ALA F N   1 
ATOM   3467 C CA  . ALA F 3 61 ? 18.902  -3.980 -5.881  1.00 97.11  ? 83   ALA F CA  1 
ATOM   3468 C C   . ALA F 3 61 ? 20.375  -3.944 -5.488  1.00 92.21  ? 83   ALA F C   1 
ATOM   3469 O O   . ALA F 3 61 ? 20.713  -4.229 -4.340  1.00 93.06  ? 83   ALA F O   1 
ATOM   3470 C CB  . ALA F 3 61 ? 18.671  -5.022 -6.973  1.00 95.86  ? 83   ALA F CB  1 
ATOM   3471 N N   . THR F 3 62 ? 21.236  -3.580 -6.444  1.00 89.19  ? 84   THR F N   1 
ATOM   3472 C CA  . THR F 3 62 ? 22.686  -3.498 -6.229  1.00 85.06  ? 84   THR F CA  1 
ATOM   3473 C C   . THR F 3 62 ? 23.238  -2.079 -6.175  1.00 84.47  ? 84   THR F C   1 
ATOM   3474 O O   . THR F 3 62 ? 22.998  -1.254 -7.060  1.00 82.26  ? 84   THR F O   1 
ATOM   3475 C CB  . THR F 3 62 ? 23.490  -4.246 -7.323  1.00 87.17  ? 84   THR F CB  1 
ATOM   3476 O OG1 . THR F 3 62 ? 24.893  -4.018 -7.128  1.00 89.48  ? 84   THR F OG1 1 
ATOM   3477 C CG2 . THR F 3 62 ? 23.119  -3.739 -8.703  1.00 92.88  ? 84   THR F CG2 1 
ATOM   3478 N N   . THR F 3 63 ? 24.017  -1.831 -5.132  1.00 84.83  ? 85   THR F N   1 
ATOM   3479 C CA  . THR F 3 63 ? 24.633  -0.545 -4.892  1.00 84.67  ? 85   THR F CA  1 
ATOM   3480 C C   . THR F 3 63 ? 25.618  -0.166 -5.999  1.00 89.06  ? 85   THR F C   1 
ATOM   3481 O O   . THR F 3 63 ? 26.102  0.959  -6.051  1.00 90.70  ? 85   THR F O   1 
ATOM   3482 C CB  . THR F 3 63 ? 25.354  -0.576 -3.536  1.00 88.05  ? 85   THR F CB  1 
ATOM   3483 O OG1 . THR F 3 63 ? 25.323  0.729  -2.954  1.00 94.73  ? 85   THR F OG1 1 
ATOM   3484 C CG2 . THR F 3 63 ? 26.804  -1.032 -3.701  1.00 87.74  ? 85   THR F CG2 1 
ATOM   3485 N N   . GLU F 3 64 ? 25.911  -1.104 -6.889  1.00 95.50  ? 86   GLU F N   1 
ATOM   3486 C CA  . GLU F 3 64 ? 26.849  -0.844 -7.977  1.00 103.52 ? 86   GLU F CA  1 
ATOM   3487 C C   . GLU F 3 64 ? 26.219  0.054  -9.048  1.00 99.10  ? 86   GLU F C   1 
ATOM   3488 O O   . GLU F 3 64 ? 26.918  0.642  -9.883  1.00 89.63  ? 86   GLU F O   1 
ATOM   3489 C CB  . GLU F 3 64 ? 27.294  -2.177 -8.585  1.00 115.18 ? 86   GLU F CB  1 
ATOM   3490 C CG  . GLU F 3 64 ? 28.469  -2.083 -9.547  1.00 134.92 ? 86   GLU F CG  1 
ATOM   3491 C CD  . GLU F 3 64 ? 29.029  -3.455 -9.912  1.00 147.22 ? 86   GLU F CD  1 
ATOM   3492 O OE1 . GLU F 3 64 ? 28.228  -4.335 -10.305 1.00 149.79 ? 86   GLU F OE1 1 
ATOM   3493 O OE2 . GLU F 3 64 ? 30.264  -3.653 -9.810  1.00 147.51 ? 86   GLU F OE2 1 
ATOM   3494 N N   . GLU F 3 65 ? 24.895  0.162  -8.997  1.00 100.95 ? 87   GLU F N   1 
ATOM   3495 C CA  . GLU F 3 65 ? 24.131  0.965  -9.945  1.00 105.36 ? 87   GLU F CA  1 
ATOM   3496 C C   . GLU F 3 65 ? 24.237  2.459  -9.675  1.00 101.65 ? 87   GLU F C   1 
ATOM   3497 O O   . GLU F 3 65 ? 23.953  3.279  -10.547 1.00 100.72 ? 87   GLU F O   1 
ATOM   3498 C CB  . GLU F 3 65 ? 22.658  0.576  -9.878  1.00 110.48 ? 87   GLU F CB  1 
ATOM   3499 C CG  . GLU F 3 65 ? 22.389  -0.881 -10.140 1.00 121.59 ? 87   GLU F CG  1 
ATOM   3500 C CD  . GLU F 3 65 ? 20.938  -1.237 -9.900  1.00 133.83 ? 87   GLU F CD  1 
ATOM   3501 O OE1 . GLU F 3 65 ? 20.061  -0.579 -10.494 1.00 142.52 ? 87   GLU F OE1 1 
ATOM   3502 O OE2 . GLU F 3 65 ? 20.669  -2.171 -9.119  1.00 139.02 ? 87   GLU F OE2 1 
ATOM   3503 N N   . LEU F 3 66 ? 24.644  2.804  -8.459  1.00 94.27  ? 88   LEU F N   1 
ATOM   3504 C CA  . LEU F 3 66 ? 24.749  4.195  -8.048  1.00 78.70  ? 88   LEU F CA  1 
ATOM   3505 C C   . LEU F 3 66 ? 25.918  4.980  -8.588  1.00 82.68  ? 88   LEU F C   1 
ATOM   3506 O O   . LEU F 3 66 ? 26.858  4.426  -9.150  1.00 98.13  ? 88   LEU F O   1 
ATOM   3507 C CB  . LEU F 3 66 ? 24.782  4.279  -6.531  1.00 61.76  ? 88   LEU F CB  1 
ATOM   3508 C CG  . LEU F 3 66 ? 23.476  3.880  -5.848  1.00 54.91  ? 88   LEU F CG  1 
ATOM   3509 C CD1 . LEU F 3 66 ? 23.616  3.947  -4.329  1.00 70.90  ? 88   LEU F CD1 1 
ATOM   3510 C CD2 . LEU F 3 66 ? 22.384  4.816  -6.307  1.00 52.66  ? 88   LEU F CD2 1 
ATOM   3511 N N   . PRO F 3 67 ? 25.856  6.304  -8.431  1.00 78.24  ? 89   PRO F N   1 
ATOM   3512 C CA  . PRO F 3 67 ? 26.888  7.235  -8.874  1.00 79.76  ? 89   PRO F CA  1 
ATOM   3513 C C   . PRO F 3 67 ? 27.833  7.419  -7.697  1.00 86.06  ? 89   PRO F C   1 
ATOM   3514 O O   . PRO F 3 67 ? 27.449  7.161  -6.553  1.00 83.67  ? 89   PRO F O   1 
ATOM   3515 C CB  . PRO F 3 67 ? 26.090  8.491  -9.180  1.00 81.76  ? 89   PRO F CB  1 
ATOM   3516 C CG  . PRO F 3 67 ? 25.092  8.487  -8.080  1.00 80.31  ? 89   PRO F CG  1 
ATOM   3517 C CD  . PRO F 3 67 ? 24.641  7.035  -8.028  1.00 79.74  ? 89   PRO F CD  1 
ATOM   3518 N N   . ASP F 3 68 ? 29.063  7.853  -7.973  1.00 94.62  ? 90   ASP F N   1 
ATOM   3519 C CA  . ASP F 3 68 ? 30.063  8.047  -6.926  1.00 96.43  ? 90   ASP F CA  1 
ATOM   3520 C C   . ASP F 3 68 ? 29.530  9.004  -5.883  1.00 90.08  ? 90   ASP F C   1 
ATOM   3521 O O   . ASP F 3 68 ? 29.511  8.682  -4.694  1.00 84.63  ? 90   ASP F O   1 
ATOM   3522 C CB  . ASP F 3 68 ? 31.376  8.578  -7.520  1.00 109.67 ? 90   ASP F CB  1 
ATOM   3523 C CG  . ASP F 3 68 ? 32.500  7.539  -7.494  1.00 120.80 ? 90   ASP F CG  1 
ATOM   3524 O OD1 . ASP F 3 68 ? 32.228  6.344  -7.750  1.00 122.94 ? 90   ASP F OD1 1 
ATOM   3525 O OD2 . ASP F 3 68 ? 33.662  7.921  -7.227  1.00 129.81 ? 90   ASP F OD2 1 
ATOM   3526 N N   . GLU F 3 69 ? 29.089  10.175 -6.334  1.00 84.70  ? 91   GLU F N   1 
ATOM   3527 C CA  . GLU F 3 69 ? 28.536  11.172 -5.433  1.00 74.57  ? 91   GLU F CA  1 
ATOM   3528 C C   . GLU F 3 69 ? 27.080  11.445 -5.751  1.00 71.70  ? 91   GLU F C   1 
ATOM   3529 O O   . GLU F 3 69 ? 26.714  11.673 -6.904  1.00 76.45  ? 91   GLU F O   1 
ATOM   3530 C CB  . GLU F 3 69 ? 29.341  12.472 -5.512  1.00 69.96  ? 91   GLU F CB  1 
ATOM   3531 C CG  . GLU F 3 69 ? 30.578  12.476 -4.614  1.00 84.31  ? 91   GLU F CG  1 
ATOM   3532 C CD  . GLU F 3 69 ? 31.434  13.736 -4.740  1.00 95.96  ? 91   GLU F CD  1 
ATOM   3533 O OE1 . GLU F 3 69 ? 30.863  14.849 -4.753  1.00 96.41  ? 91   GLU F OE1 1 
ATOM   3534 O OE2 . GLU F 3 69 ? 32.683  13.613 -4.801  1.00 104.72 ? 91   GLU F OE2 1 
ATOM   3535 N N   . PHE F 3 70 ? 26.253  11.389 -4.716  1.00 67.48  ? 92   PHE F N   1 
ATOM   3536 C CA  . PHE F 3 70 ? 24.824  11.662 -4.828  1.00 69.56  ? 92   PHE F CA  1 
ATOM   3537 C C   . PHE F 3 70 ? 24.337  12.036 -3.434  1.00 73.03  ? 92   PHE F C   1 
ATOM   3538 O O   . PHE F 3 70 ? 25.006  11.772 -2.434  1.00 76.10  ? 92   PHE F O   1 
ATOM   3539 C CB  . PHE F 3 70 ? 24.061  10.443 -5.359  1.00 55.93  ? 92   PHE F CB  1 
ATOM   3540 C CG  . PHE F 3 70 ? 24.272  9.214  -4.550  1.00 51.18  ? 92   PHE F CG  1 
ATOM   3541 C CD1 . PHE F 3 70 ? 23.476  8.949  -3.437  1.00 49.81  ? 92   PHE F CD1 1 
ATOM   3542 C CD2 . PHE F 3 70 ? 25.329  8.357  -4.846  1.00 57.65  ? 92   PHE F CD2 1 
ATOM   3543 C CE1 . PHE F 3 70 ? 23.737  7.836  -2.620  1.00 57.78  ? 92   PHE F CE1 1 
ATOM   3544 C CE2 . PHE F 3 70 ? 25.605  7.247  -4.047  1.00 52.44  ? 92   PHE F CE2 1 
ATOM   3545 C CZ  . PHE F 3 70 ? 24.809  6.984  -2.926  1.00 56.59  ? 92   PHE F CZ  1 
ATOM   3546 N N   . VAL F 3 71 ? 23.174  12.661 -3.364  1.00 73.69  ? 93   VAL F N   1 
ATOM   3547 C CA  . VAL F 3 71 ? 22.639  13.084 -2.084  1.00 64.13  ? 93   VAL F CA  1 
ATOM   3548 C C   . VAL F 3 71 ? 21.595  12.086 -1.655  1.00 60.38  ? 93   VAL F C   1 
ATOM   3549 O O   . VAL F 3 71 ? 20.915  11.486 -2.489  1.00 59.32  ? 93   VAL F O   1 
ATOM   3550 C CB  . VAL F 3 71 ? 21.985  14.449 -2.206  1.00 58.74  ? 93   VAL F CB  1 
ATOM   3551 C CG1 . VAL F 3 71 ? 22.924  15.413 -2.950  1.00 46.55  ? 93   VAL F CG1 1 
ATOM   3552 C CG2 . VAL F 3 71 ? 20.680  14.312 -2.962  1.00 73.11  ? 93   VAL F CG2 1 
ATOM   3553 N N   . VAL F 3 72 ? 21.461  11.903 -0.351  1.00 60.74  ? 94   VAL F N   1 
ATOM   3554 C CA  . VAL F 3 72 ? 20.484  10.964 0.139   1.00 57.63  ? 94   VAL F CA  1 
ATOM   3555 C C   . VAL F 3 72 ? 19.511  11.618 1.084   1.00 71.21  ? 94   VAL F C   1 
ATOM   3556 O O   . VAL F 3 72 ? 19.876  12.099 2.170   1.00 68.11  ? 94   VAL F O   1 
ATOM   3557 C CB  . VAL F 3 72 ? 21.143  9.794  0.841   1.00 45.37  ? 94   VAL F CB  1 
ATOM   3558 C CG1 . VAL F 3 72 ? 20.072  8.777  1.258   1.00 38.86  ? 94   VAL F CG1 1 
ATOM   3559 C CG2 . VAL F 3 72 ? 22.172  9.154  -0.095  1.00 45.42  ? 94   VAL F CG2 1 
ATOM   3560 N N   . VAL F 3 73 ? 18.262  11.635 0.633   1.00 84.95  ? 95   VAL F N   1 
ATOM   3561 C CA  . VAL F 3 73 ? 17.151  12.200 1.376   1.00 93.65  ? 95   VAL F CA  1 
ATOM   3562 C C   . VAL F 3 73 ? 16.687  11.159 2.375   1.00 97.75  ? 95   VAL F C   1 
ATOM   3563 O O   . VAL F 3 73 ? 15.797  10.360 2.075   1.00 91.90  ? 95   VAL F O   1 
ATOM   3564 C CB  . VAL F 3 73 ? 15.961  12.513 0.452   1.00 96.11  ? 95   VAL F CB  1 
ATOM   3565 C CG1 . VAL F 3 73 ? 14.844  13.152 1.250   1.00 93.92  ? 95   VAL F CG1 1 
ATOM   3566 C CG2 . VAL F 3 73 ? 16.404  13.412 -0.686  1.00 95.90  ? 95   VAL F CG2 1 
ATOM   3567 N N   . THR F 3 74 ? 17.297  11.147 3.555   1.00 107.81 ? 96   THR F N   1 
ATOM   3568 C CA  . THR F 3 74 ? 16.882  10.183 4.555   1.00 111.58 ? 96   THR F CA  1 
ATOM   3569 C C   . THR F 3 74 ? 15.453  10.551 4.891   1.00 111.54 ? 96   THR F C   1 
ATOM   3570 O O   . THR F 3 74 ? 15.183  11.585 5.519   1.00 94.63  ? 96   THR F O   1 
ATOM   3571 C CB  . THR F 3 74 ? 17.751  10.232 5.820   1.00 115.59 ? 96   THR F CB  1 
ATOM   3572 O OG1 . THR F 3 74 ? 19.140  10.177 5.449   1.00 117.51 ? 96   THR F OG1 1 
ATOM   3573 C CG2 . THR F 3 74 ? 17.415  9.031  6.726   1.00 108.70 ? 96   THR F CG2 1 
ATOM   3574 N N   . ALA F 3 75 ? 14.548  9.702  4.410   1.00 121.22 ? 97   ALA F N   1 
ATOM   3575 C CA  . ALA F 3 75 ? 13.120  9.873  4.611   1.00 129.56 ? 97   ALA F CA  1 
ATOM   3576 C C   . ALA F 3 75 ? 12.815  9.788  6.091   1.00 140.06 ? 97   ALA F C   1 
ATOM   3577 O O   . ALA F 3 75 ? 11.891  9.090  6.513   1.00 142.86 ? 97   ALA F O   1 
ATOM   3578 C CB  . ALA F 3 75 ? 12.352  8.801  3.852   1.00 116.85 ? 97   ALA F CB  1 
ATOM   3579 N N   . LYS F 3 76 ? 13.619  10.490 6.878   1.00 148.71 ? 98   LYS F N   1 
ATOM   3580 C CA  . LYS F 3 76 ? 13.441  10.523 8.312   1.00 154.47 ? 98   LYS F CA  1 
ATOM   3581 C C   . LYS F 3 76 ? 12.494  11.684 8.581   1.00 159.92 ? 98   LYS F C   1 
ATOM   3582 O O   . LYS F 3 76 ? 11.654  11.561 9.494   1.00 162.37 ? 98   LYS F O   1 
ATOM   3583 C CB  . LYS F 3 76 ? 14.791  10.731 9.010   1.00 153.87 ? 98   LYS F CB  1 
ATOM   3584 C CG  . LYS F 3 76 ? 15.165  12.174 9.302   1.00 152.19 ? 98   LYS F CG  1 
ATOM   3585 C CD  . LYS F 3 76 ? 15.072  12.464 10.796  1.00 147.06 ? 98   LYS F CD  1 
ATOM   3586 C CE  . LYS F 3 76 ? 15.517  13.878 11.122  1.00 147.50 ? 98   LYS F CE  1 
ATOM   3587 N NZ  . LYS F 3 76 ? 15.443  14.150 12.580  1.00 147.13 ? 98   LYS F NZ  1 
ATOM   3588 O OXT . LYS F 3 76 ? 12.604  12.702 7.861   1.00 163.32 ? 98   LYS F OXT 1 
ATOM   3589 N N   . VAL G 4 1  ? 70.431  19.171 7.650   1.00 157.77 ? 9    VAL G N   1 
ATOM   3590 C CA  . VAL G 4 1  ? 71.834  19.190 7.143   1.00 158.16 ? 9    VAL G CA  1 
ATOM   3591 C C   . VAL G 4 1  ? 72.615  20.385 7.703   1.00 151.39 ? 9    VAL G C   1 
ATOM   3592 O O   . VAL G 4 1  ? 72.905  21.348 6.994   1.00 147.69 ? 9    VAL G O   1 
ATOM   3593 C CB  . VAL G 4 1  ? 71.854  19.231 5.599   1.00 165.05 ? 9    VAL G CB  1 
ATOM   3594 C CG1 . VAL G 4 1  ? 71.375  17.892 5.038   1.00 164.73 ? 9    VAL G CG1 1 
ATOM   3595 C CG2 . VAL G 4 1  ? 70.959  20.354 5.103   1.00 169.68 ? 9    VAL G CG2 1 
ATOM   3596 N N   . PRO G 4 2  ? 72.964  20.323 8.999   1.00 148.10 ? 10   PRO G N   1 
ATOM   3597 C CA  . PRO G 4 2  ? 73.708  21.335 9.764   1.00 145.53 ? 10   PRO G CA  1 
ATOM   3598 C C   . PRO G 4 2  ? 75.246  21.478 9.628   1.00 142.77 ? 10   PRO G C   1 
ATOM   3599 O O   . PRO G 4 2  ? 75.858  22.195 10.418  1.00 144.96 ? 10   PRO G O   1 
ATOM   3600 C CB  . PRO G 4 2  ? 73.316  21.021 11.214  1.00 144.42 ? 10   PRO G CB  1 
ATOM   3601 C CG  . PRO G 4 2  ? 71.991  20.314 11.083  1.00 142.83 ? 10   PRO G CG  1 
ATOM   3602 C CD  . PRO G 4 2  ? 72.249  19.419 9.919   1.00 145.00 ? 10   PRO G CD  1 
ATOM   3603 N N   . PRO G 4 3  ? 75.895  20.802 8.660   1.00 135.79 ? 11   PRO G N   1 
ATOM   3604 C CA  . PRO G 4 3  ? 77.356  20.989 8.591   1.00 128.65 ? 11   PRO G CA  1 
ATOM   3605 C C   . PRO G 4 3  ? 77.772  22.364 8.059   1.00 125.54 ? 11   PRO G C   1 
ATOM   3606 O O   . PRO G 4 3  ? 77.237  22.844 7.056   1.00 128.47 ? 11   PRO G O   1 
ATOM   3607 C CB  . PRO G 4 3  ? 77.805  19.859 7.674   1.00 127.54 ? 11   PRO G CB  1 
ATOM   3608 C CG  . PRO G 4 3  ? 76.774  18.804 7.922   1.00 129.24 ? 11   PRO G CG  1 
ATOM   3609 C CD  . PRO G 4 3  ? 75.498  19.597 7.916   1.00 132.34 ? 11   PRO G CD  1 
ATOM   3610 N N   . ALA G 4 4  ? 78.746  22.979 8.723   1.00 118.05 ? 12   ALA G N   1 
ATOM   3611 C CA  . ALA G 4 4  ? 79.212  24.315 8.351   1.00 106.85 ? 12   ALA G CA  1 
ATOM   3612 C C   . ALA G 4 4  ? 80.003  24.391 7.064   1.00 95.67  ? 12   ALA G C   1 
ATOM   3613 O O   . ALA G 4 4  ? 80.439  23.383 6.516   1.00 92.68  ? 12   ALA G O   1 
ATOM   3614 C CB  . ALA G 4 4  ? 80.040  24.914 9.483   1.00 109.94 ? 12   ALA G CB  1 
ATOM   3615 N N   . LEU G 4 5  ? 80.186  25.614 6.589   1.00 90.37  ? 13   LEU G N   1 
ATOM   3616 C CA  . LEU G 4 5  ? 80.948  25.832 5.382   1.00 90.90  ? 13   LEU G CA  1 
ATOM   3617 C C   . LEU G 4 5  ? 82.349  26.181 5.789   1.00 90.35  ? 13   LEU G C   1 
ATOM   3618 O O   . LEU G 4 5  ? 82.557  27.097 6.585   1.00 90.67  ? 13   LEU G O   1 
ATOM   3619 C CB  . LEU G 4 5  ? 80.370  26.978 4.567   1.00 93.66  ? 13   LEU G CB  1 
ATOM   3620 C CG  . LEU G 4 5  ? 78.974  26.713 4.020   1.00 100.62 ? 13   LEU G CG  1 
ATOM   3621 C CD1 . LEU G 4 5  ? 78.655  27.742 2.958   1.00 98.68  ? 13   LEU G CD1 1 
ATOM   3622 C CD2 . LEU G 4 5  ? 78.906  25.317 3.430   1.00 97.91  ? 13   LEU G CD2 1 
ATOM   3623 N N   . HIS G 4 6  ? 83.306  25.438 5.249   1.00 85.99  ? 14   HIS G N   1 
ATOM   3624 C CA  . HIS G 4 6  ? 84.707  25.681 5.539   1.00 79.73  ? 14   HIS G CA  1 
ATOM   3625 C C   . HIS G 4 6  ? 85.454  25.933 4.259   1.00 80.77  ? 14   HIS G C   1 
ATOM   3626 O O   . HIS G 4 6  ? 85.542  25.064 3.393   1.00 81.15  ? 14   HIS G O   1 
ATOM   3627 C CB  . HIS G 4 6  ? 85.303  24.497 6.266   1.00 76.05  ? 14   HIS G CB  1 
ATOM   3628 C CG  . HIS G 4 6  ? 84.677  24.262 7.596   1.00 74.91  ? 14   HIS G CG  1 
ATOM   3629 N ND1 . HIS G 4 6  ? 85.002  25.007 8.708   1.00 72.01  ? 14   HIS G ND1 1 
ATOM   3630 C CD2 . HIS G 4 6  ? 83.680  23.427 7.972   1.00 70.27  ? 14   HIS G CD2 1 
ATOM   3631 C CE1 . HIS G 4 6  ? 84.229  24.641 9.714   1.00 78.67  ? 14   HIS G CE1 1 
ATOM   3632 N NE2 . HIS G 4 6  ? 83.418  23.684 9.293   1.00 75.93  ? 14   HIS G NE2 1 
ATOM   3633 N N   . LEU G 4 7  ? 85.985  27.139 4.144   1.00 84.11  ? 15   LEU G N   1 
ATOM   3634 C CA  . LEU G 4 7  ? 86.727  27.514 2.965   1.00 88.83  ? 15   LEU G CA  1 
ATOM   3635 C C   . LEU G 4 7  ? 88.171  27.076 3.077   1.00 91.26  ? 15   LEU G C   1 
ATOM   3636 O O   . LEU G 4 7  ? 88.906  27.501 3.969   1.00 92.05  ? 15   LEU G O   1 
ATOM   3637 C CB  . LEU G 4 7  ? 86.658  29.026 2.752   1.00 88.00  ? 15   LEU G CB  1 
ATOM   3638 C CG  . LEU G 4 7  ? 87.445  29.622 1.572   1.00 82.23  ? 15   LEU G CG  1 
ATOM   3639 C CD1 . LEU G 4 7  ? 88.954  29.637 1.887   1.00 84.93  ? 15   LEU G CD1 1 
ATOM   3640 C CD2 . LEU G 4 7  ? 87.141  28.837 0.290   1.00 67.82  ? 15   LEU G CD2 1 
ATOM   3641 N N   . VAL G 4 8  ? 88.572  26.220 2.151   1.00 93.70  ? 16   VAL G N   1 
ATOM   3642 C CA  . VAL G 4 8  ? 89.931  25.739 2.117   1.00 90.69  ? 16   VAL G CA  1 
ATOM   3643 C C   . VAL G 4 8  ? 90.793  26.691 1.299   1.00 96.26  ? 16   VAL G C   1 
ATOM   3644 O O   . VAL G 4 8  ? 90.703  26.749 0.064   1.00 93.34  ? 16   VAL G O   1 
ATOM   3645 C CB  . VAL G 4 8  ? 89.978  24.345 1.533   1.00 81.31  ? 16   VAL G CB  1 
ATOM   3646 C CG1 . VAL G 4 8  ? 91.401  23.988 1.168   1.00 85.73  ? 16   VAL G CG1 1 
ATOM   3647 C CG2 . VAL G 4 8  ? 89.407  23.366 2.556   1.00 67.11  ? 16   VAL G CG2 1 
ATOM   3648 N N   . ASP G 4 9  ? 91.610  27.439 2.033   1.00 103.37 ? 17   ASP G N   1 
ATOM   3649 C CA  . ASP G 4 9  ? 92.527  28.433 1.502   1.00 112.22 ? 17   ASP G CA  1 
ATOM   3650 C C   . ASP G 4 9  ? 92.985  28.163 0.085   1.00 117.37 ? 17   ASP G C   1 
ATOM   3651 O O   . ASP G 4 9  ? 92.918  27.039 -0.407  1.00 120.82 ? 17   ASP G O   1 
ATOM   3652 C CB  . ASP G 4 9  ? 93.748  28.527 2.408   1.00 114.81 ? 17   ASP G CB  1 
ATOM   3653 C CG  . ASP G 4 9  ? 93.423  28.191 3.844   1.00 122.86 ? 17   ASP G CG  1 
ATOM   3654 O OD1 . ASP G 4 9  ? 93.033  27.033 4.102   1.00 120.19 ? 17   ASP G OD1 1 
ATOM   3655 O OD2 . ASP G 4 9  ? 93.547  29.079 4.712   1.00 129.81 ? 17   ASP G OD2 1 
ATOM   3656 N N   . PRO G 4 10 ? 93.474  29.208 -0.589  1.00 120.99 ? 18   PRO G N   1 
ATOM   3657 C CA  . PRO G 4 10 ? 93.969  29.161 -1.966  1.00 122.43 ? 18   PRO G CA  1 
ATOM   3658 C C   . PRO G 4 10 ? 95.110  28.171 -2.031  1.00 118.49 ? 18   PRO G C   1 
ATOM   3659 O O   . PRO G 4 10 ? 95.230  27.397 -2.982  1.00 116.49 ? 18   PRO G O   1 
ATOM   3660 C CB  . PRO G 4 10 ? 94.450  30.585 -2.207  1.00 128.25 ? 18   PRO G CB  1 
ATOM   3661 C CG  . PRO G 4 10 ? 93.607  31.397 -1.271  1.00 129.35 ? 18   PRO G CG  1 
ATOM   3662 C CD  . PRO G 4 10 ? 93.621  30.560 -0.033  1.00 122.75 ? 18   PRO G CD  1 
ATOM   3663 N N   . GLN G 4 11 ? 95.945  28.229 -0.997  1.00 115.52 ? 19   GLN G N   1 
ATOM   3664 C CA  . GLN G 4 11 ? 97.095  27.348 -0.841  1.00 110.25 ? 19   GLN G CA  1 
ATOM   3665 C C   . GLN G 4 11 ? 96.789  26.010 -1.518  1.00 104.20 ? 19   GLN G C   1 
ATOM   3666 O O   . GLN G 4 11 ? 97.566  25.503 -2.329  1.00 103.85 ? 19   GLN G O   1 
ATOM   3667 C CB  . GLN G 4 11 ? 97.355  27.130 0.660   1.00 111.09 ? 19   GLN G CB  1 
ATOM   3668 C CG  . GLN G 4 11 ? 96.164  26.488 1.409   1.00 114.61 ? 19   GLN G CG  1 
ATOM   3669 C CD  . GLN G 4 11 ? 96.366  26.376 2.919   1.00 116.41 ? 19   GLN G CD  1 
ATOM   3670 O OE1 . GLN G 4 11 ? 95.671  25.607 3.598   1.00 105.08 ? 19   GLN G OE1 1 
ATOM   3671 N NE2 . GLN G 4 11 ? 97.307  27.151 3.453   1.00 125.91 ? 19   GLN G NE2 1 
ATOM   3672 N N   . ILE G 4 12 ? 95.622  25.471 -1.186  1.00 97.94  ? 20   ILE G N   1 
ATOM   3673 C CA  . ILE G 4 12 ? 95.162  24.200 -1.708  1.00 91.91  ? 20   ILE G CA  1 
ATOM   3674 C C   . ILE G 4 12 ? 93.905  24.384 -2.535  1.00 94.65  ? 20   ILE G C   1 
ATOM   3675 O O   . ILE G 4 12 ? 92.940  25.020 -2.099  1.00 100.39 ? 20   ILE G O   1 
ATOM   3676 C CB  . ILE G 4 12 ? 94.786  23.255 -0.578  1.00 88.63  ? 20   ILE G CB  1 
ATOM   3677 C CG1 . ILE G 4 12 ? 95.895  23.237 0.479   1.00 89.97  ? 20   ILE G CG1 1 
ATOM   3678 C CG2 . ILE G 4 12 ? 94.471  21.880 -1.158  1.00 72.77  ? 20   ILE G CG2 1 
ATOM   3679 C CD1 . ILE G 4 12 ? 95.380  23.084 1.926   1.00 88.17  ? 20   ILE G CD1 1 
ATOM   3680 N N   . GLN G 4 13 ? 93.900  23.800 -3.719  1.00 88.39  ? 21   GLN G N   1 
ATOM   3681 C CA  . GLN G 4 13 ? 92.735  23.906 -4.562  1.00 79.96  ? 21   GLN G CA  1 
ATOM   3682 C C   . GLN G 4 13 ? 92.630  22.720 -5.479  1.00 68.12  ? 21   GLN G C   1 
ATOM   3683 O O   . GLN G 4 13 ? 93.591  21.982 -5.660  1.00 71.92  ? 21   GLN G O   1 
ATOM   3684 C CB  . GLN G 4 13 ? 92.795  25.192 -5.370  1.00 92.42  ? 21   GLN G CB  1 
ATOM   3685 C CG  . GLN G 4 13 ? 92.421  26.422 -4.579  1.00 101.17 ? 21   GLN G CG  1 
ATOM   3686 C CD  . GLN G 4 13 ? 92.518  27.675 -5.405  1.00 102.42 ? 21   GLN G CD  1 
ATOM   3687 O OE1 . GLN G 4 13 ? 91.995  27.742 -6.520  1.00 100.27 ? 21   GLN G OE1 1 
ATOM   3688 N NE2 . GLN G 4 13 ? 93.185  28.684 -4.865  1.00 98.39  ? 21   GLN G NE2 1 
ATOM   3689 N N   . LEU G 4 14 ? 91.451  22.533 -6.052  1.00 62.31  ? 22   LEU G N   1 
ATOM   3690 C CA  . LEU G 4 14 ? 91.226  21.434 -6.967  1.00 57.81  ? 22   LEU G CA  1 
ATOM   3691 C C   . LEU G 4 14 ? 91.510  21.887 -8.383  1.00 68.35  ? 22   LEU G C   1 
ATOM   3692 O O   . LEU G 4 14 ? 91.332  23.058 -8.707  1.00 74.42  ? 22   LEU G O   1 
ATOM   3693 C CB  . LEU G 4 14 ? 89.790  20.967 -6.884  1.00 43.27  ? 22   LEU G CB  1 
ATOM   3694 C CG  . LEU G 4 14 ? 89.754  19.454 -6.927  1.00 59.56  ? 22   LEU G CG  1 
ATOM   3695 C CD1 . LEU G 4 14 ? 90.488  18.911 -5.708  1.00 72.53  ? 22   LEU G CD1 1 
ATOM   3696 C CD2 . LEU G 4 14 ? 88.327  18.980 -6.936  1.00 53.30  ? 22   LEU G CD2 1 
ATOM   3697 N N   . THR G 4 15 ? 91.945  20.962 -9.229  1.00 76.66  ? 23   THR G N   1 
ATOM   3698 C CA  . THR G 4 15 ? 92.246  21.293 -10.613 1.00 83.47  ? 23   THR G CA  1 
ATOM   3699 C C   . THR G 4 15 ? 91.625  20.265 -11.530 1.00 93.94  ? 23   THR G C   1 
ATOM   3700 O O   . THR G 4 15 ? 91.447  19.100 -11.159 1.00 89.34  ? 23   THR G O   1 
ATOM   3701 C CB  . THR G 4 15 ? 93.754  21.347 -10.858 1.00 81.08  ? 23   THR G CB  1 
ATOM   3702 O OG1 . THR G 4 15 ? 94.327  22.323 -9.987  1.00 80.93  ? 23   THR G OG1 1 
ATOM   3703 C CG2 . THR G 4 15 ? 94.052  21.752 -12.287 1.00 81.08  ? 23   THR G CG2 1 
ATOM   3704 N N   . ILE G 4 16 ? 91.297  20.704 -12.738 1.00 109.64 ? 24   ILE G N   1 
ATOM   3705 C CA  . ILE G 4 16 ? 90.660  19.827 -13.703 1.00 122.21 ? 24   ILE G CA  1 
ATOM   3706 C C   . ILE G 4 16 ? 91.353  19.775 -15.055 1.00 132.64 ? 24   ILE G C   1 
ATOM   3707 O O   . ILE G 4 16 ? 92.267  20.555 -15.327 1.00 132.79 ? 24   ILE G O   1 
ATOM   3708 C CB  . ILE G 4 16 ? 89.205  20.255 -13.920 1.00 116.49 ? 24   ILE G CB  1 
ATOM   3709 C CG1 . ILE G 4 16 ? 88.544  20.499 -12.562 1.00 107.93 ? 24   ILE G CG1 1 
ATOM   3710 C CG2 . ILE G 4 16 ? 88.452  19.185 -14.701 1.00 114.79 ? 24   ILE G CG2 1 
ATOM   3711 C CD1 . ILE G 4 16 ? 88.689  19.331 -11.598 1.00 95.03  ? 24   ILE G CD1 1 
ATOM   3712 N N   . THR G 4 17 ? 90.899  18.838 -15.887 1.00 142.14 ? 25   THR G N   1 
ATOM   3713 C CA  . THR G 4 17 ? 91.416  18.634 -17.233 1.00 150.58 ? 25   THR G CA  1 
ATOM   3714 C C   . THR G 4 17 ? 91.478  19.953 -18.028 1.00 155.18 ? 25   THR G C   1 
ATOM   3715 O O   . THR G 4 17 ? 90.605  20.256 -18.850 1.00 155.93 ? 25   THR G O   1 
ATOM   3716 C CB  . THR G 4 17 ? 90.555  17.571 -17.980 1.00 151.49 ? 25   THR G CB  1 
ATOM   3717 O OG1 . THR G 4 17 ? 89.173  17.747 -17.646 1.00 155.36 ? 25   THR G OG1 1 
ATOM   3718 C CG2 . THR G 4 17 ? 90.974  16.160 -17.581 1.00 145.77 ? 25   THR G CG2 1 
ATOM   3719 N N   . ASP G 4 18 ? 92.546  20.704 -17.744 1.00 155.77 ? 39   ASP G N   1 
ATOM   3720 C CA  . ASP G 4 18 ? 92.911  22.017 -18.302 1.00 150.90 ? 39   ASP G CA  1 
ATOM   3721 C C   . ASP G 4 18 ? 93.048  22.930 -17.079 1.00 149.93 ? 39   ASP G C   1 
ATOM   3722 O O   . ASP G 4 18 ? 92.138  23.019 -16.259 1.00 148.19 ? 39   ASP G O   1 
ATOM   3723 C CB  . ASP G 4 18 ? 91.863  22.573 -19.282 1.00 143.31 ? 39   ASP G CB  1 
ATOM   3724 C CG  . ASP G 4 18 ? 92.424  23.692 -20.167 1.00 132.85 ? 39   ASP G CG  1 
ATOM   3725 O OD1 . ASP G 4 18 ? 93.408  23.451 -20.902 1.00 123.17 ? 39   ASP G OD1 1 
ATOM   3726 O OD2 . ASP G 4 18 ? 91.884  24.816 -20.131 1.00 132.47 ? 39   ASP G OD2 1 
ATOM   3727 N N   . PRO G 4 19 ? 94.197  23.612 -16.951 1.00 149.28 ? 40   PRO G N   1 
ATOM   3728 C CA  . PRO G 4 19 ? 94.567  24.530 -15.869 1.00 148.81 ? 40   PRO G CA  1 
ATOM   3729 C C   . PRO G 4 19 ? 93.506  25.369 -15.153 1.00 147.88 ? 40   PRO G C   1 
ATOM   3730 O O   . PRO G 4 19 ? 93.759  26.523 -14.818 1.00 150.01 ? 40   PRO G O   1 
ATOM   3731 C CB  . PRO G 4 19 ? 95.659  25.396 -16.509 1.00 150.12 ? 40   PRO G CB  1 
ATOM   3732 C CG  . PRO G 4 19 ? 95.397  25.274 -17.983 1.00 150.55 ? 40   PRO G CG  1 
ATOM   3733 C CD  . PRO G 4 19 ? 95.084  23.819 -18.106 1.00 149.95 ? 40   PRO G CD  1 
ATOM   3734 N N   . LYS G 4 20 ? 92.330  24.801 -14.900 1.00 143.30 ? 41   LYS G N   1 
ATOM   3735 C CA  . LYS G 4 20 ? 91.289  25.534 -14.185 1.00 130.66 ? 41   LYS G CA  1 
ATOM   3736 C C   . LYS G 4 20 ? 91.371  25.058 -12.740 1.00 125.06 ? 41   LYS G C   1 
ATOM   3737 O O   . LYS G 4 20 ? 91.495  23.859 -12.471 1.00 118.88 ? 41   LYS G O   1 
ATOM   3738 C CB  . LYS G 4 20 ? 89.906  25.244 -14.766 1.00 123.04 ? 41   LYS G CB  1 
ATOM   3739 C CG  . LYS G 4 20 ? 89.347  23.901 -14.379 1.00 116.09 ? 41   LYS G CG  1 
ATOM   3740 C CD  . LYS G 4 20 ? 88.135  23.574 -15.209 1.00 108.77 ? 41   LYS G CD  1 
ATOM   3741 C CE  . LYS G 4 20 ? 88.558  23.295 -16.629 1.00 109.85 ? 41   LYS G CE  1 
ATOM   3742 N NZ  . LYS G 4 20 ? 89.593  22.224 -16.653 1.00 109.18 ? 41   LYS G NZ  1 
ATOM   3743 N N   . VAL G 4 21 ? 91.313  26.006 -11.816 1.00 121.07 ? 42   VAL G N   1 
ATOM   3744 C CA  . VAL G 4 21 ? 91.426  25.695 -10.399 1.00 120.50 ? 42   VAL G CA  1 
ATOM   3745 C C   . VAL G 4 21 ? 90.291  26.319 -9.590  1.00 111.67 ? 42   VAL G C   1 
ATOM   3746 O O   . VAL G 4 21 ? 89.926  27.469 -9.807  1.00 110.67 ? 42   VAL G O   1 
ATOM   3747 C CB  . VAL G 4 21 ? 92.792  26.199 -9.863  1.00 125.64 ? 42   VAL G CB  1 
ATOM   3748 C CG1 . VAL G 4 21 ? 92.989  25.771 -8.429  1.00 128.04 ? 42   VAL G CG1 1 
ATOM   3749 C CG2 . VAL G 4 21 ? 93.920  25.663 -10.738 1.00 126.32 ? 42   VAL G CG2 1 
ATOM   3750 N N   . TYR G 4 22 ? 89.732  25.557 -8.658  1.00 104.62 ? 43   TYR G N   1 
ATOM   3751 C CA  . TYR G 4 22 ? 88.638  26.060 -7.840  1.00 99.34  ? 43   TYR G CA  1 
ATOM   3752 C C   . TYR G 4 22 ? 88.944  25.879 -6.366  1.00 91.41  ? 43   TYR G C   1 
ATOM   3753 O O   . TYR G 4 22 ? 89.345  24.801 -5.946  1.00 90.65  ? 43   TYR G O   1 
ATOM   3754 C CB  . TYR G 4 22 ? 87.338  25.314 -8.167  1.00 103.70 ? 43   TYR G CB  1 
ATOM   3755 C CG  . TYR G 4 22 ? 86.988  25.261 -9.645  1.00 110.92 ? 43   TYR G CG  1 
ATOM   3756 C CD1 . TYR G 4 22 ? 87.693  24.440 -10.522 1.00 114.31 ? 43   TYR G CD1 1 
ATOM   3757 C CD2 . TYR G 4 22 ? 85.950  26.037 -10.165 1.00 111.35 ? 43   TYR G CD2 1 
ATOM   3758 C CE1 . TYR G 4 22 ? 87.370  24.392 -11.878 1.00 118.62 ? 43   TYR G CE1 1 
ATOM   3759 C CE2 . TYR G 4 22 ? 85.624  25.999 -11.522 1.00 113.19 ? 43   TYR G CE2 1 
ATOM   3760 C CZ  . TYR G 4 22 ? 86.335  25.173 -12.371 1.00 118.40 ? 43   TYR G CZ  1 
ATOM   3761 O OH  . TYR G 4 22 ? 85.999  25.126 -13.705 1.00 119.70 ? 43   TYR G OH  1 
ATOM   3762 N N   . PRO G 4 23 ? 88.769  26.932 -5.555  1.00 90.06  ? 44   PRO G N   1 
ATOM   3763 C CA  . PRO G 4 23 ? 89.050  26.772 -4.129  1.00 85.93  ? 44   PRO G CA  1 
ATOM   3764 C C   . PRO G 4 23 ? 88.046  25.760 -3.611  1.00 81.93  ? 44   PRO G C   1 
ATOM   3765 O O   . PRO G 4 23 ? 86.985  25.520 -4.212  1.00 71.32  ? 44   PRO G O   1 
ATOM   3766 C CB  . PRO G 4 23 ? 88.823  28.164 -3.571  1.00 84.87  ? 44   PRO G CB  1 
ATOM   3767 C CG  . PRO G 4 23 ? 87.703  28.647 -4.418  1.00 92.69  ? 44   PRO G CG  1 
ATOM   3768 C CD  . PRO G 4 23 ? 88.143  28.236 -5.812  1.00 90.95  ? 44   PRO G CD  1 
ATOM   3769 N N   . ILE G 4 24 ? 88.361  25.183 -2.471  1.00 79.41  ? 45   ILE G N   1 
ATOM   3770 C CA  . ILE G 4 24 ? 87.508  24.144 -1.958  1.00 76.00  ? 45   ILE G CA  1 
ATOM   3771 C C   . ILE G 4 24 ? 86.655  24.537 -0.760  1.00 74.85  ? 45   ILE G C   1 
ATOM   3772 O O   . ILE G 4 24 ? 87.077  25.316 0.094   1.00 79.32  ? 45   ILE G O   1 
ATOM   3773 C CB  . ILE G 4 24 ? 88.404  22.928 -1.649  1.00 71.25  ? 45   ILE G CB  1 
ATOM   3774 C CG1 . ILE G 4 24 ? 89.404  22.761 -2.811  1.00 62.30  ? 45   ILE G CG1 1 
ATOM   3775 C CG2 . ILE G 4 24 ? 87.556  21.671 -1.465  1.00 59.67  ? 45   ILE G CG2 1 
ATOM   3776 C CD1 . ILE G 4 24 ? 90.598  21.864 -2.551  1.00 55.73  ? 45   ILE G CD1 1 
ATOM   3777 N N   . ILE G 4 25 ? 85.437  24.010 -0.725  1.00 68.73  ? 46   ILE G N   1 
ATOM   3778 C CA  . ILE G 4 25 ? 84.507  24.271 0.375   1.00 71.45  ? 46   ILE G CA  1 
ATOM   3779 C C   . ILE G 4 25 ? 84.079  22.937 0.986   1.00 72.98  ? 46   ILE G C   1 
ATOM   3780 O O   . ILE G 4 25 ? 83.769  21.986 0.262   1.00 78.13  ? 46   ILE G O   1 
ATOM   3781 C CB  . ILE G 4 25 ? 83.232  25.008 -0.098  1.00 63.72  ? 46   ILE G CB  1 
ATOM   3782 C CG1 . ILE G 4 25 ? 83.603  26.326 -0.776  1.00 42.61  ? 46   ILE G CG1 1 
ATOM   3783 C CG2 . ILE G 4 25 ? 82.312  25.250 1.091   1.00 50.99  ? 46   ILE G CG2 1 
ATOM   3784 C CD1 . ILE G 4 25 ? 84.510  27.213 0.058   1.00 51.24  ? 46   ILE G CD1 1 
ATOM   3785 N N   . LEU G 4 26 ? 84.016  22.867 2.310   1.00 68.55  ? 47   LEU G N   1 
ATOM   3786 C CA  . LEU G 4 26 ? 83.669  21.605 2.930   1.00 70.83  ? 47   LEU G CA  1 
ATOM   3787 C C   . LEU G 4 26 ? 82.431  21.618 3.789   1.00 74.73  ? 47   LEU G C   1 
ATOM   3788 O O   . LEU G 4 26 ? 82.245  22.501 4.632   1.00 67.22  ? 47   LEU G O   1 
ATOM   3789 C CB  . LEU G 4 26 ? 84.851  21.116 3.761   1.00 77.00  ? 47   LEU G CB  1 
ATOM   3790 C CG  . LEU G 4 26 ? 86.211  21.450 3.134   1.00 80.22  ? 47   LEU G CG  1 
ATOM   3791 C CD1 . LEU G 4 26 ? 87.317  21.210 4.146   1.00 80.23  ? 47   LEU G CD1 1 
ATOM   3792 C CD2 . LEU G 4 26 ? 86.425  20.629 1.869   1.00 73.34  ? 47   LEU G CD2 1 
ATOM   3793 N N   . ARG G 4 27 ? 81.592  20.614 3.548   1.00 86.99  ? 48   ARG G N   1 
ATOM   3794 C CA  . ARG G 4 27 ? 80.351  20.397 4.283   1.00 95.68  ? 48   ARG G CA  1 
ATOM   3795 C C   . ARG G 4 27 ? 80.749  19.329 5.286   1.00 100.27 ? 48   ARG G C   1 
ATOM   3796 O O   . ARG G 4 27 ? 80.001  18.388 5.547   1.00 99.53  ? 48   ARG G O   1 
ATOM   3797 C CB  . ARG G 4 27 ? 79.266  19.831 3.364   1.00 98.72  ? 48   ARG G CB  1 
ATOM   3798 C CG  . ARG G 4 27 ? 79.256  20.406 1.963   1.00 106.58 ? 48   ARG G CG  1 
ATOM   3799 C CD  . ARG G 4 27 ? 77.842  20.480 1.427   1.00 114.11 ? 48   ARG G CD  1 
ATOM   3800 N NE  . ARG G 4 27 ? 76.920  21.138 2.363   1.00 126.19 ? 48   ARG G NE  1 
ATOM   3801 C CZ  . ARG G 4 27 ? 77.228  22.170 3.154   1.00 123.93 ? 48   ARG G CZ  1 
ATOM   3802 N NH1 . ARG G 4 27 ? 78.452  22.683 3.148   1.00 122.81 ? 48   ARG G NH1 1 
ATOM   3803 N NH2 . ARG G 4 27 ? 76.305  22.706 3.948   1.00 114.89 ? 48   ARG G NH2 1 
ATOM   3804 N N   . LEU G 4 28 ? 81.954  19.480 5.821   1.00 105.81 ? 49   LEU G N   1 
ATOM   3805 C CA  . LEU G 4 28 ? 82.505  18.533 6.772   1.00 114.11 ? 49   LEU G CA  1 
ATOM   3806 C C   . LEU G 4 28 ? 81.460  17.866 7.657   1.00 123.21 ? 49   LEU G C   1 
ATOM   3807 O O   . LEU G 4 28 ? 80.737  18.524 8.404   1.00 127.80 ? 49   LEU G O   1 
ATOM   3808 C CB  . LEU G 4 28 ? 83.581  19.218 7.632   1.00 111.54 ? 49   LEU G CB  1 
ATOM   3809 C CG  . LEU G 4 28 ? 83.295  20.200 8.781   1.00 109.52 ? 49   LEU G CG  1 
ATOM   3810 C CD1 . LEU G 4 28 ? 81.969  20.933 8.557   1.00 109.32 ? 49   LEU G CD1 1 
ATOM   3811 C CD2 . LEU G 4 28 ? 83.287  19.431 10.103  1.00 101.49 ? 49   LEU G CD2 1 
ATOM   3812 N N   . GLY G 4 29 ? 81.365  16.547 7.524   1.00 129.74 ? 50   GLY G N   1 
ATOM   3813 C CA  . GLY G 4 29 ? 80.447  15.769 8.336   1.00 136.50 ? 50   GLY G CA  1 
ATOM   3814 C C   . GLY G 4 29 ? 81.366  15.040 9.294   1.00 144.09 ? 50   GLY G C   1 
ATOM   3815 O O   . GLY G 4 29 ? 81.026  14.742 10.441  1.00 145.71 ? 50   GLY G O   1 
ATOM   3816 N N   . SER G 4 30 ? 82.560  14.766 8.782   1.00 148.16 ? 51   SER G N   1 
ATOM   3817 C CA  . SER G 4 30 ? 83.620  14.098 9.519   1.00 144.17 ? 51   SER G CA  1 
ATOM   3818 C C   . SER G 4 30 ? 84.702  15.171 9.627   1.00 143.01 ? 51   SER G C   1 
ATOM   3819 O O   . SER G 4 30 ? 84.411  16.362 9.502   1.00 142.29 ? 51   SER G O   1 
ATOM   3820 C CB  . SER G 4 30 ? 84.145  12.907 8.711   1.00 139.89 ? 51   SER G CB  1 
ATOM   3821 O OG  . SER G 4 30 ? 83.086  12.179 8.108   1.00 136.35 ? 51   SER G OG  1 
ATOM   3822 N N   . ASN G 4 31 ? 85.941  14.759 9.860   1.00 141.84 ? 52   ASN G N   1 
ATOM   3823 C CA  . ASN G 4 31 ? 87.044  15.712 9.945   1.00 142.26 ? 52   ASN G CA  1 
ATOM   3824 C C   . ASN G 4 31 ? 88.169  15.171 9.065   1.00 139.22 ? 52   ASN G C   1 
ATOM   3825 O O   . ASN G 4 31 ? 89.271  14.901 9.541   1.00 147.75 ? 52   ASN G O   1 
ATOM   3826 C CB  . ASN G 4 31 ? 87.521  15.876 11.398  1.00 145.39 ? 52   ASN G CB  1 
ATOM   3827 C CG  . ASN G 4 31 ? 87.985  17.301 11.709  1.00 146.29 ? 52   ASN G CG  1 
ATOM   3828 O OD1 . ASN G 4 31 ? 88.953  17.795 11.129  1.00 148.88 ? 52   ASN G OD1 1 
ATOM   3829 N ND2 . ASN G 4 31 ? 87.285  17.967 12.624  1.00 143.26 ? 52   ASN G ND2 1 
ATOM   3830 N N   . LEU G 4 32 ? 87.864  15.014 7.777   1.00 127.69 ? 53   LEU G N   1 
ATOM   3831 C CA  . LEU G 4 32 ? 88.795  14.500 6.773   1.00 111.67 ? 53   LEU G CA  1 
ATOM   3832 C C   . LEU G 4 32 ? 90.271  14.776 7.018   1.00 105.31 ? 53   LEU G C   1 
ATOM   3833 O O   . LEU G 4 32 ? 90.663  15.894 7.352   1.00 100.13 ? 53   LEU G O   1 
ATOM   3834 C CB  . LEU G 4 32 ? 88.428  15.039 5.388   1.00 107.34 ? 53   LEU G CB  1 
ATOM   3835 C CG  . LEU G 4 32 ? 87.629  14.138 4.443   1.00 107.20 ? 53   LEU G CG  1 
ATOM   3836 C CD1 . LEU G 4 32 ? 86.256  13.826 5.019   1.00 103.98 ? 53   LEU G CD1 1 
ATOM   3837 C CD2 . LEU G 4 32 ? 87.512  14.831 3.091   1.00 97.63  ? 53   LEU G CD2 1 
ATOM   3838 N N   . SER G 4 33 ? 91.087  13.743 6.831   1.00 102.29 ? 54   SER G N   1 
ATOM   3839 C CA  . SER G 4 33 ? 92.528  13.862 7.004   1.00 101.33 ? 54   SER G CA  1 
ATOM   3840 C C   . SER G 4 33 ? 93.210  13.821 5.645   1.00 96.98  ? 54   SER G C   1 
ATOM   3841 O O   . SER G 4 33 ? 92.788  13.091 4.745   1.00 98.03  ? 54   SER G O   1 
ATOM   3842 C CB  . SER G 4 33 ? 93.061  12.720 7.876   1.00 108.19 ? 54   SER G CB  1 
ATOM   3843 O OG  . SER G 4 33 ? 94.483  12.718 7.908   1.00 111.15 ? 54   SER G OG  1 
ATOM   3844 N N   . LEU G 4 34 ? 94.259  14.616 5.490   1.00 89.32  ? 55   LEU G N   1 
ATOM   3845 C CA  . LEU G 4 34 ? 94.984  14.632 4.238   1.00 82.88  ? 55   LEU G CA  1 
ATOM   3846 C C   . LEU G 4 34 ? 96.473  14.501 4.489   1.00 84.84  ? 55   LEU G C   1 
ATOM   3847 O O   . LEU G 4 34 ? 97.017  15.148 5.382   1.00 90.69  ? 55   LEU G O   1 
ATOM   3848 C CB  . LEU G 4 34 ? 94.709  15.919 3.473   1.00 67.90  ? 55   LEU G CB  1 
ATOM   3849 C CG  . LEU G 4 34 ? 95.514  15.987 2.175   1.00 66.53  ? 55   LEU G CG  1 
ATOM   3850 C CD1 . LEU G 4 34 ? 95.132  14.842 1.219   1.00 64.85  ? 55   LEU G CD1 1 
ATOM   3851 C CD2 . LEU G 4 34 ? 95.264  17.321 1.535   1.00 54.59  ? 55   LEU G CD2 1 
ATOM   3852 N N   . SER G 4 35 ? 97.123  13.650 3.702   1.00 82.38  ? 56   SER G N   1 
ATOM   3853 C CA  . SER G 4 35 ? 98.559  13.431 3.821   1.00 73.89  ? 56   SER G CA  1 
ATOM   3854 C C   . SER G 4 35 ? 99.198  13.239 2.453   1.00 70.40  ? 56   SER G C   1 
ATOM   3855 O O   . SER G 4 35 ? 98.562  12.753 1.510   1.00 66.71  ? 56   SER G O   1 
ATOM   3856 C CB  . SER G 4 35 ? 98.849  12.216 4.715   1.00 70.23  ? 56   SER G CB  1 
ATOM   3857 O OG  . SER G 4 35 ? 97.759  11.310 4.709   1.00 78.77  ? 56   SER G OG  1 
ATOM   3858 N N   . MET G 4 36 ? 100.459 13.650 2.360   1.00 71.63  ? 57   MET G N   1 
ATOM   3859 C CA  . MET G 4 36 ? 101.247 13.549 1.137   1.00 73.10  ? 57   MET G CA  1 
ATOM   3860 C C   . MET G 4 36 ? 102.113 12.292 1.228   1.00 79.10  ? 57   MET G C   1 
ATOM   3861 O O   . MET G 4 36 ? 102.846 12.106 2.200   1.00 82.38  ? 57   MET G O   1 
ATOM   3862 C CB  . MET G 4 36 ? 102.145 14.776 1.003   1.00 59.69  ? 57   MET G CB  1 
ATOM   3863 C CG  . MET G 4 36 ? 103.129 14.691 -0.140  1.00 59.63  ? 57   MET G CG  1 
ATOM   3864 S SD  . MET G 4 36 ? 102.329 14.946 -1.719  1.00 63.55  ? 57   MET G SD  1 
ATOM   3865 C CE  . MET G 4 36 ? 102.093 16.743 -1.569  1.00 62.60  ? 57   MET G CE  1 
ATOM   3866 N N   . ALA G 4 37 ? 102.029 11.430 0.220   1.00 82.19  ? 58   ALA G N   1 
ATOM   3867 C CA  . ALA G 4 37 ? 102.811 10.195 0.215   1.00 83.02  ? 58   ALA G CA  1 
ATOM   3868 C C   . ALA G 4 37 ? 103.908 10.228 -0.839  1.00 83.25  ? 58   ALA G C   1 
ATOM   3869 O O   . ALA G 4 37 ? 103.827 10.979 -1.821  1.00 76.23  ? 58   ALA G O   1 
ATOM   3870 C CB  . ALA G 4 37 ? 101.898 8.989  -0.014  1.00 78.09  ? 58   ALA G CB  1 
ATOM   3871 N N   . ARG G 4 38 ? 104.932 9.402  -0.620  1.00 91.35  ? 59   ARG G N   1 
ATOM   3872 C CA  . ARG G 4 38 ? 106.082 9.301  -1.520  1.00 97.23  ? 59   ARG G CA  1 
ATOM   3873 C C   . ARG G 4 38 ? 106.738 7.908  -1.441  1.00 92.55  ? 59   ARG G C   1 
ATOM   3874 O O   . ARG G 4 38 ? 106.862 7.337  -0.351  1.00 88.58  ? 59   ARG G O   1 
ATOM   3875 C CB  . ARG G 4 38 ? 107.118 10.372 -1.150  1.00 109.05 ? 59   ARG G CB  1 
ATOM   3876 C CG  . ARG G 4 38 ? 106.552 11.790 -1.030  1.00 123.64 ? 59   ARG G CG  1 
ATOM   3877 C CD  . ARG G 4 38 ? 107.360 12.640 -0.045  1.00 134.89 ? 59   ARG G CD  1 
ATOM   3878 N NE  . ARG G 4 38 ? 106.733 13.933 0.234   1.00 137.62 ? 59   ARG G NE  1 
ATOM   3879 C CZ  . ARG G 4 38 ? 106.784 14.986 -0.577  1.00 136.86 ? 59   ARG G CZ  1 
ATOM   3880 N NH1 . ARG G 4 38 ? 107.443 14.911 -1.725  1.00 130.83 ? 59   ARG G NH1 1 
ATOM   3881 N NH2 . ARG G 4 38 ? 106.168 16.114 -0.244  1.00 137.24 ? 59   ARG G NH2 1 
ATOM   3882 N N   . ARG G 4 39 ? 107.152 7.370  -2.592  1.00 88.05  ? 60   ARG G N   1 
ATOM   3883 C CA  . ARG G 4 39 ? 107.813 6.063  -2.645  1.00 83.54  ? 60   ARG G CA  1 
ATOM   3884 C C   . ARG G 4 39 ? 109.144 6.091  -1.921  1.00 92.74  ? 60   ARG G C   1 
ATOM   3885 O O   . ARG G 4 39 ? 109.892 7.069  -2.002  1.00 95.92  ? 60   ARG G O   1 
ATOM   3886 C CB  . ARG G 4 39 ? 108.099 5.636  -4.088  1.00 67.82  ? 60   ARG G CB  1 
ATOM   3887 C CG  . ARG G 4 39 ? 106.915 5.086  -4.833  1.00 70.86  ? 60   ARG G CG  1 
ATOM   3888 C CD  . ARG G 4 39 ? 107.205 3.705  -5.429  1.00 67.09  ? 60   ARG G CD  1 
ATOM   3889 N NE  . ARG G 4 39 ? 105.971 3.061  -5.904  1.00 79.56  ? 60   ARG G NE  1 
ATOM   3890 C CZ  . ARG G 4 39 ? 105.244 3.480  -6.940  1.00 90.00  ? 60   ARG G CZ  1 
ATOM   3891 N NH1 . ARG G 4 39 ? 105.621 4.549  -7.634  1.00 98.67  ? 60   ARG G NH1 1 
ATOM   3892 N NH2 . ARG G 4 39 ? 104.131 2.837  -7.277  1.00 88.45  ? 60   ARG G NH2 1 
ATOM   3893 N N   . ASN G 4 40 ? 109.446 5.012  -1.215  1.00 96.86  ? 61   ASN G N   1 
ATOM   3894 C CA  . ASN G 4 40 ? 110.721 4.916  -0.525  1.00 100.23 ? 61   ASN G CA  1 
ATOM   3895 C C   . ASN G 4 40 ? 111.679 4.214  -1.486  1.00 97.49  ? 61   ASN G C   1 
ATOM   3896 O O   . ASN G 4 40 ? 111.878 3.001  -1.411  1.00 103.97 ? 61   ASN G O   1 
ATOM   3897 C CB  . ASN G 4 40 ? 110.565 4.108  0.756   1.00 109.96 ? 61   ASN G CB  1 
ATOM   3898 C CG  . ASN G 4 40 ? 111.891 3.634  1.296   1.00 117.30 ? 61   ASN G CG  1 
ATOM   3899 O OD1 . ASN G 4 40 ? 112.839 4.414  1.421   1.00 113.16 ? 61   ASN G OD1 1 
ATOM   3900 N ND2 . ASN G 4 40 ? 111.970 2.346  1.621   1.00 119.67 ? 61   ASN G ND2 1 
ATOM   3901 N N   . LEU G 4 41 ? 112.272 4.986  -2.388  1.00 88.52  ? 62   LEU G N   1 
ATOM   3902 C CA  . LEU G 4 41 ? 113.166 4.438  -3.401  1.00 84.04  ? 62   LEU G CA  1 
ATOM   3903 C C   . LEU G 4 41 ? 114.630 4.321  -3.037  1.00 86.45  ? 62   LEU G C   1 
ATOM   3904 O O   . LEU G 4 41 ? 115.471 4.104  -3.902  1.00 89.05  ? 62   LEU G O   1 
ATOM   3905 C CB  . LEU G 4 41 ? 113.068 5.277  -4.661  1.00 74.32  ? 62   LEU G CB  1 
ATOM   3906 C CG  . LEU G 4 41 ? 111.710 5.334  -5.336  1.00 75.69  ? 62   LEU G CG  1 
ATOM   3907 C CD1 . LEU G 4 41 ? 111.859 6.173  -6.585  1.00 76.27  ? 62   LEU G CD1 1 
ATOM   3908 C CD2 . LEU G 4 41 ? 111.214 3.931  -5.683  1.00 89.05  ? 62   LEU G CD2 1 
ATOM   3909 N N   . ASP G 4 42 ? 114.949 4.449  -1.766  1.00 89.19  ? 63   ASP G N   1 
ATOM   3910 C CA  . ASP G 4 42 ? 116.340 4.390  -1.373  1.00 93.32  ? 63   ASP G CA  1 
ATOM   3911 C C   . ASP G 4 42 ? 116.555 3.402  -0.248  1.00 92.00  ? 63   ASP G C   1 
ATOM   3912 O O   . ASP G 4 42 ? 117.624 3.350  0.352   1.00 95.39  ? 63   ASP G O   1 
ATOM   3913 C CB  . ASP G 4 42 ? 116.772 5.776  -0.933  1.00 104.27 ? 63   ASP G CB  1 
ATOM   3914 C CG  . ASP G 4 42 ? 115.698 6.472  -0.129  1.00 118.76 ? 63   ASP G CG  1 
ATOM   3915 O OD1 . ASP G 4 42 ? 115.121 5.821  0.775   1.00 123.09 ? 63   ASP G OD1 1 
ATOM   3916 O OD2 . ASP G 4 42 ? 115.430 7.662  -0.406  1.00 126.01 ? 63   ASP G OD2 1 
ATOM   3917 N N   . SER G 4 43 ? 115.537 2.612  0.041   1.00 86.75  ? 64   SER G N   1 
ATOM   3918 C CA  . SER G 4 43 ? 115.655 1.650  1.113   1.00 80.40  ? 64   SER G CA  1 
ATOM   3919 C C   . SER G 4 43 ? 114.683 0.510  0.916   1.00 78.36  ? 64   SER G C   1 
ATOM   3920 O O   . SER G 4 43 ? 113.749 0.604  0.116   1.00 80.07  ? 64   SER G O   1 
ATOM   3921 C CB  . SER G 4 43 ? 115.390 2.337  2.449   1.00 83.56  ? 64   SER G CB  1 
ATOM   3922 O OG  . SER G 4 43 ? 115.153 1.379  3.460   1.00 90.35  ? 64   SER G OG  1 
ATOM   3923 N N   . LEU G 4 44 ? 114.904 -0.571 1.650   1.00 75.05  ? 65   LEU G N   1 
ATOM   3924 C CA  . LEU G 4 44 ? 114.032 -1.728 1.548   1.00 85.69  ? 65   LEU G CA  1 
ATOM   3925 C C   . LEU G 4 44 ? 113.441 -2.083 2.912   1.00 80.02  ? 65   LEU G C   1 
ATOM   3926 O O   . LEU G 4 44 ? 112.612 -2.999 3.046   1.00 64.85  ? 65   LEU G O   1 
ATOM   3927 C CB  . LEU G 4 44 ? 114.796 -2.916 0.920   1.00 99.76  ? 65   LEU G CB  1 
ATOM   3928 C CG  . LEU G 4 44 ? 116.200 -3.405 1.304   1.00 93.74  ? 65   LEU G CG  1 
ATOM   3929 C CD1 . LEU G 4 44 ? 116.599 -4.530 0.355   1.00 92.50  ? 65   LEU G CD1 1 
ATOM   3930 C CD2 . LEU G 4 44 ? 117.205 -2.276 1.220   1.00 88.46  ? 65   LEU G CD2 1 
ATOM   3931 N N   . GLU G 4 45 ? 113.864 -1.331 3.923   1.00 82.19  ? 66   GLU G N   1 
ATOM   3932 C CA  . GLU G 4 45 ? 113.383 -1.535 5.281   1.00 94.74  ? 66   GLU G CA  1 
ATOM   3933 C C   . GLU G 4 45 ? 112.459 -0.388 5.681   1.00 95.20  ? 66   GLU G C   1 
ATOM   3934 O O   . GLU G 4 45 ? 111.753 -0.467 6.691   1.00 94.73  ? 66   GLU G O   1 
ATOM   3935 C CB  . GLU G 4 45 ? 114.560 -1.637 6.264   1.00 107.02 ? 66   GLU G CB  1 
ATOM   3936 C CG  . GLU G 4 45 ? 115.618 -0.539 6.138   1.00 113.53 ? 66   GLU G CG  1 
ATOM   3937 C CD  . GLU G 4 45 ? 116.709 -0.877 5.133   1.00 114.57 ? 66   GLU G CD  1 
ATOM   3938 O OE1 . GLU G 4 45 ? 117.369 -1.927 5.296   1.00 123.55 ? 66   GLU G OE1 1 
ATOM   3939 O OE2 . GLU G 4 45 ? 116.916 -0.094 4.184   1.00 108.58 ? 66   GLU G OE2 1 
ATOM   3940 N N   . ALA G 4 46 ? 112.471 0.673  4.876   1.00 94.05  ? 67   ALA G N   1 
ATOM   3941 C CA  . ALA G 4 46 ? 111.636 1.842  5.122   1.00 93.12  ? 67   ALA G CA  1 
ATOM   3942 C C   . ALA G 4 46 ? 110.218 1.578  4.611   1.00 100.32 ? 67   ALA G C   1 
ATOM   3943 O O   . ALA G 4 46 ? 110.015 0.736  3.723   1.00 96.06  ? 67   ALA G O   1 
ATOM   3944 C CB  . ALA G 4 46 ? 112.231 3.063  4.439   1.00 84.69  ? 67   ALA G CB  1 
ATOM   3945 N N   . ARG G 4 47 ? 109.243 2.293  5.180   1.00 104.54 ? 68   ARG G N   1 
ATOM   3946 C CA  . ARG G 4 47 ? 107.836 2.127  4.809   1.00 95.82  ? 68   ARG G CA  1 
ATOM   3947 C C   . ARG G 4 47 ? 107.607 2.366  3.326   1.00 87.81  ? 68   ARG G C   1 
ATOM   3948 O O   . ARG G 4 47 ? 108.062 3.386  2.770   1.00 73.37  ? 68   ARG G O   1 
ATOM   3949 C CB  . ARG G 4 47 ? 106.935 3.068  5.627   1.00 98.61  ? 68   ARG G CB  1 
ATOM   3950 C CG  . ARG G 4 47 ? 106.125 2.384  6.739   1.00 98.21  ? 68   ARG G CG  1 
ATOM   3951 C CD  . ARG G 4 47 ? 105.093 3.333  7.356   1.00 104.19 ? 68   ARG G CD  1 
ATOM   3952 N NE  . ARG G 4 47 ? 104.191 3.881  6.343   1.00 115.66 ? 68   ARG G NE  1 
ATOM   3953 C CZ  . ARG G 4 47 ? 103.231 4.772  6.583   1.00 116.06 ? 68   ARG G CZ  1 
ATOM   3954 N NH1 . ARG G 4 47 ? 103.034 5.227  7.815   1.00 108.09 ? 68   ARG G NH1 1 
ATOM   3955 N NH2 . ARG G 4 47 ? 102.471 5.216  5.584   1.00 114.92 ? 68   ARG G NH2 1 
ATOM   3956 N N   . ALA G 4 48 ? 106.907 1.409  2.707   1.00 82.07  ? 69   ALA G N   1 
ATOM   3957 C CA  . ALA G 4 48 ? 106.571 1.437  1.283   1.00 78.72  ? 69   ALA G CA  1 
ATOM   3958 C C   . ALA G 4 48 ? 106.419 2.878  0.810   1.00 82.58  ? 69   ALA G C   1 
ATOM   3959 O O   . ALA G 4 48 ? 107.038 3.292  -0.185  1.00 72.43  ? 69   ALA G O   1 
ATOM   3960 C CB  . ALA G 4 48 ? 105.281 0.661  1.038   1.00 69.84  ? 69   ALA G CB  1 
ATOM   3961 N N   . PHE G 4 49 ? 105.600 3.635  1.542   1.00 87.04  ? 70   PHE G N   1 
ATOM   3962 C CA  . PHE G 4 49 ? 105.360 5.044  1.248   1.00 82.46  ? 70   PHE G CA  1 
ATOM   3963 C C   . PHE G 4 49 ? 105.478 5.908  2.491   1.00 74.36  ? 70   PHE G C   1 
ATOM   3964 O O   . PHE G 4 49 ? 104.885 5.593  3.523   1.00 66.64  ? 70   PHE G O   1 
ATOM   3965 C CB  . PHE G 4 49 ? 103.968 5.250  0.656   1.00 83.75  ? 70   PHE G CB  1 
ATOM   3966 C CG  . PHE G 4 49 ? 103.834 4.770  -0.754  1.00 79.85  ? 70   PHE G CG  1 
ATOM   3967 C CD1 . PHE G 4 49 ? 103.647 3.416  -1.029  1.00 77.60  ? 70   PHE G CD1 1 
ATOM   3968 C CD2 . PHE G 4 49 ? 103.872 5.679  -1.811  1.00 67.46  ? 70   PHE G CD2 1 
ATOM   3969 C CE1 . PHE G 4 49 ? 103.488 2.968  -2.338  1.00 73.34  ? 70   PHE G CE1 1 
ATOM   3970 C CE2 . PHE G 4 49 ? 103.718 5.251  -3.127  1.00 50.27  ? 70   PHE G CE2 1 
ATOM   3971 C CZ  . PHE G 4 49 ? 103.523 3.890  -3.394  1.00 57.50  ? 70   PHE G CZ  1 
ATOM   3972 N N   . GLN G 4 50 ? 106.228 7.004  2.375   1.00 70.53  ? 71   GLN G N   1 
ATOM   3973 C CA  . GLN G 4 50 ? 106.418 7.941  3.478   1.00 73.29  ? 71   GLN G CA  1 
ATOM   3974 C C   . GLN G 4 50 ? 105.255 8.939  3.596   1.00 79.29  ? 71   GLN G C   1 
ATOM   3975 O O   . GLN G 4 50 ? 105.256 9.987  2.956   1.00 70.90  ? 71   GLN G O   1 
ATOM   3976 C CB  . GLN G 4 50 ? 107.727 8.696  3.279   1.00 69.24  ? 71   GLN G CB  1 
ATOM   3977 C CG  . GLN G 4 50 ? 108.036 9.679  4.382   1.00 84.84  ? 71   GLN G CG  1 
ATOM   3978 C CD  . GLN G 4 50 ? 108.006 11.107 3.897   1.00 101.36 ? 71   GLN G CD  1 
ATOM   3979 O OE1 . GLN G 4 50 ? 106.951 11.632 3.540   1.00 116.56 ? 71   GLN G OE1 1 
ATOM   3980 N NE2 . GLN G 4 50 ? 109.169 11.747 3.870   1.00 96.78  ? 71   GLN G NE2 1 
ATOM   3981 N N   . SER G 4 51 ? 104.266 8.606  4.421   1.00 87.84  ? 72   SER G N   1 
ATOM   3982 C CA  . SER G 4 51 ? 103.094 9.454  4.620   1.00 91.87  ? 72   SER G CA  1 
ATOM   3983 C C   . SER G 4 51 ? 103.335 10.637 5.549   1.00 97.45  ? 72   SER G C   1 
ATOM   3984 O O   . SER G 4 51 ? 103.564 10.462 6.744   1.00 95.89  ? 72   SER G O   1 
ATOM   3985 C CB  . SER G 4 51 ? 101.935 8.630  5.179   1.00 90.74  ? 72   SER G CB  1 
ATOM   3986 O OG  . SER G 4 51 ? 100.898 9.487  5.627   1.00 97.05  ? 72   SER G OG  1 
ATOM   3987 N N   . THR G 4 52 ? 103.261 11.842 4.997   1.00 104.51 ? 73   THR G N   1 
ATOM   3988 C CA  . THR G 4 52 ? 103.456 13.052 5.781   1.00 106.44 ? 73   THR G CA  1 
ATOM   3989 C C   . THR G 4 52 ? 102.136 13.805 5.876   1.00 111.26 ? 73   THR G C   1 
ATOM   3990 O O   . THR G 4 52 ? 101.756 14.511 4.945   1.00 115.22 ? 73   THR G O   1 
ATOM   3991 C CB  . THR G 4 52 ? 104.470 13.981 5.120   1.00 101.04 ? 73   THR G CB  1 
ATOM   3992 O OG1 . THR G 4 52 ? 105.640 13.237 4.772   1.00 96.51  ? 73   THR G OG1 1 
ATOM   3993 C CG2 . THR G 4 52 ? 104.848 15.100 6.066   1.00 101.35 ? 73   THR G CG2 1 
ATOM   3994 N N   . PRO G 4 53 ? 101.408 13.651 6.994   1.00 112.49 ? 74   PRO G N   1 
ATOM   3995 C CA  . PRO G 4 53 ? 100.127 14.348 7.158   1.00 109.73 ? 74   PRO G CA  1 
ATOM   3996 C C   . PRO G 4 53 ? 100.221 15.810 6.697   1.00 103.50 ? 74   PRO G C   1 
ATOM   3997 O O   . PRO G 4 53 ? 101.209 16.487 6.975   1.00 93.33  ? 74   PRO G O   1 
ATOM   3998 C CB  . PRO G 4 53 ? 99.863  14.196 8.650   1.00 109.07 ? 74   PRO G CB  1 
ATOM   3999 C CG  . PRO G 4 53 ? 100.356 12.787 8.893   1.00 109.33 ? 74   PRO G CG  1 
ATOM   4000 C CD  . PRO G 4 53 ? 101.683 12.779 8.150   1.00 112.14 ? 74   PRO G CD  1 
ATOM   4001 N N   . ILE G 4 54 ? 99.198  16.283 5.983   1.00 105.29 ? 75   ILE G N   1 
ATOM   4002 C CA  . ILE G 4 54 ? 99.180  17.651 5.453   1.00 109.01 ? 75   ILE G CA  1 
ATOM   4003 C C   . ILE G 4 54 ? 98.264  18.641 6.183   1.00 110.92 ? 75   ILE G C   1 
ATOM   4004 O O   . ILE G 4 54 ? 97.092  18.349 6.452   1.00 105.33 ? 75   ILE G O   1 
ATOM   4005 C CB  . ILE G 4 54 ? 98.780  17.662 3.965   1.00 111.53 ? 75   ILE G CB  1 
ATOM   4006 C CG1 . ILE G 4 54 ? 99.690  16.721 3.165   1.00 120.98 ? 75   ILE G CG1 1 
ATOM   4007 C CG2 . ILE G 4 54 ? 98.883  19.079 3.425   1.00 103.64 ? 75   ILE G CG2 1 
ATOM   4008 C CD1 . ILE G 4 54 ? 99.313  16.575 1.688   1.00 117.70 ? 75   ILE G CD1 1 
ATOM   4009 N N   . VAL G 4 55 ? 98.812  19.828 6.460   1.00 113.76 ? 76   VAL G N   1 
ATOM   4010 C CA  . VAL G 4 55 ? 98.110  20.895 7.174   1.00 110.90 ? 76   VAL G CA  1 
ATOM   4011 C C   . VAL G 4 55 ? 97.199  21.778 6.332   1.00 113.38 ? 76   VAL G C   1 
ATOM   4012 O O   . VAL G 4 55 ? 97.651  22.630 5.562   1.00 107.42 ? 76   VAL G O   1 
ATOM   4013 C CB  . VAL G 4 55 ? 99.098  21.814 7.930   1.00 106.73 ? 76   VAL G CB  1 
ATOM   4014 C CG1 . VAL G 4 55 ? 100.159 22.339 6.981   1.00 110.49 ? 76   VAL G CG1 1 
ATOM   4015 C CG2 . VAL G 4 55 ? 98.346  22.971 8.560   1.00 105.63 ? 76   VAL G CG2 1 
ATOM   4016 N N   . VAL G 4 56 ? 95.900  21.573 6.512   1.00 118.76 ? 77   VAL G N   1 
ATOM   4017 C CA  . VAL G 4 56 ? 94.878  22.331 5.807   1.00 116.92 ? 77   VAL G CA  1 
ATOM   4018 C C   . VAL G 4 56 ? 94.511  23.524 6.675   1.00 116.69 ? 77   VAL G C   1 
ATOM   4019 O O   . VAL G 4 56 ? 93.998  23.359 7.781   1.00 115.11 ? 77   VAL G O   1 
ATOM   4020 C CB  . VAL G 4 56 ? 93.618  21.481 5.599   1.00 113.63 ? 77   VAL G CB  1 
ATOM   4021 C CG1 . VAL G 4 56 ? 92.670  22.189 4.654   1.00 107.25 ? 77   VAL G CG1 1 
ATOM   4022 C CG2 . VAL G 4 56 ? 94.002  20.102 5.081   1.00 110.01 ? 77   VAL G CG2 1 
ATOM   4023 N N   . GLN G 4 57 ? 94.764  24.726 6.181   1.00 117.73 ? 78   GLN G N   1 
ATOM   4024 C CA  . GLN G 4 57 ? 94.450  25.905 6.969   1.00 128.81 ? 78   GLN G CA  1 
ATOM   4025 C C   . GLN G 4 57 ? 93.036  26.444 6.712   1.00 125.76 ? 78   GLN G C   1 
ATOM   4026 O O   . GLN G 4 57 ? 92.798  27.651 6.755   1.00 129.65 ? 78   GLN G O   1 
ATOM   4027 C CB  . GLN G 4 57 ? 95.499  26.986 6.707   1.00 142.91 ? 78   GLN G CB  1 
ATOM   4028 C CG  . GLN G 4 57 ? 95.705  27.893 7.898   1.00 160.90 ? 78   GLN G CG  1 
ATOM   4029 C CD  . GLN G 4 57 ? 95.817  27.104 9.190   1.00 170.06 ? 78   GLN G CD  1 
ATOM   4030 O OE1 . GLN G 4 57 ? 96.657  26.210 9.312   1.00 170.10 ? 78   GLN G OE1 1 
ATOM   4031 N NE2 . GLN G 4 57 ? 94.966  27.426 10.159  1.00 172.93 ? 78   GLN G NE2 1 
ATOM   4032 N N   . MET G 4 58 ? 92.097  25.534 6.469   1.00 118.35 ? 79   MET G N   1 
ATOM   4033 C CA  . MET G 4 58 ? 90.710  25.896 6.192   1.00 105.71 ? 79   MET G CA  1 
ATOM   4034 C C   . MET G 4 58 ? 90.050  26.821 7.218   1.00 104.68 ? 79   MET G C   1 
ATOM   4035 O O   . MET G 4 58 ? 90.265  26.706 8.427   1.00 98.25  ? 79   MET G O   1 
ATOM   4036 C CB  . MET G 4 58 ? 89.867  24.638 6.052   1.00 91.69  ? 79   MET G CB  1 
ATOM   4037 C CG  . MET G 4 58 ? 89.993  23.743 7.241   1.00 88.11  ? 79   MET G CG  1 
ATOM   4038 S SD  . MET G 4 58 ? 88.579  22.691 7.435   1.00 88.74  ? 79   MET G SD  1 
ATOM   4039 C CE  . MET G 4 58 ? 87.696  23.598 8.738   1.00 97.51  ? 79   MET G CE  1 
ATOM   4040 N N   . THR G 4 59 ? 89.218  27.718 6.696   1.00 107.53 ? 80   THR G N   1 
ATOM   4041 C CA  . THR G 4 59 ? 88.483  28.717 7.473   1.00 101.69 ? 80   THR G CA  1 
ATOM   4042 C C   . THR G 4 59 ? 86.998  28.358 7.589   1.00 100.42 ? 80   THR G C   1 
ATOM   4043 O O   . THR G 4 59 ? 86.417  27.788 6.666   1.00 100.67 ? 80   THR G O   1 
ATOM   4044 C CB  . THR G 4 59 ? 88.562  30.106 6.782   1.00 94.03  ? 80   THR G CB  1 
ATOM   4045 O OG1 . THR G 4 59 ? 89.934  30.459 6.541   1.00 98.81  ? 80   THR G OG1 1 
ATOM   4046 C CG2 . THR G 4 59 ? 87.875  31.169 7.633   1.00 74.89  ? 80   THR G CG2 1 
ATOM   4047 N N   . LYS G 4 60 ? 86.385  28.691 8.719   1.00 97.01  ? 81   LYS G N   1 
ATOM   4048 C CA  . LYS G 4 60 ? 84.960  28.429 8.893   1.00 95.48  ? 81   LYS G CA  1 
ATOM   4049 C C   . LYS G 4 60 ? 84.257  29.729 8.492   1.00 91.36  ? 81   LYS G C   1 
ATOM   4050 O O   . LYS G 4 60 ? 84.708  30.821 8.844   1.00 87.53  ? 81   LYS G O   1 
ATOM   4051 C CB  . LYS G 4 60 ? 84.658  28.053 10.349  1.00 90.28  ? 81   LYS G CB  1 
ATOM   4052 C CG  . LYS G 4 60 ? 83.230  27.614 10.614  1.00 91.80  ? 81   LYS G CG  1 
ATOM   4053 C CD  . LYS G 4 60 ? 82.283  28.795 10.656  1.00 111.84 ? 81   LYS G CD  1 
ATOM   4054 C CE  . LYS G 4 60 ? 80.896  28.385 11.118  1.00 125.56 ? 81   LYS G CE  1 
ATOM   4055 N NZ  . LYS G 4 60 ? 80.023  29.574 11.339  1.00 127.07 ? 81   LYS G NZ  1 
ATOM   4056 N N   . LEU G 4 61 ? 83.169  29.627 7.739   1.00 91.66  ? 82   LEU G N   1 
ATOM   4057 C CA  . LEU G 4 61 ? 82.475  30.835 7.306   1.00 89.48  ? 82   LEU G CA  1 
ATOM   4058 C C   . LEU G 4 61 ? 81.201  31.155 8.075   1.00 90.08  ? 82   LEU G C   1 
ATOM   4059 O O   . LEU G 4 61 ? 80.513  30.262 8.591   1.00 88.00  ? 82   LEU G O   1 
ATOM   4060 C CB  . LEU G 4 61 ? 82.154  30.764 5.807   1.00 83.18  ? 82   LEU G CB  1 
ATOM   4061 C CG  . LEU G 4 61 ? 83.340  30.744 4.835   1.00 80.69  ? 82   LEU G CG  1 
ATOM   4062 C CD1 . LEU G 4 61 ? 82.837  30.865 3.415   1.00 80.96  ? 82   LEU G CD1 1 
ATOM   4063 C CD2 . LEU G 4 61 ? 84.270  31.895 5.135   1.00 86.01  ? 82   LEU G CD2 1 
ATOM   4064 N N   . ALA G 4 62 ? 80.907  32.452 8.142   1.00 91.80  ? 83   ALA G N   1 
ATOM   4065 C CA  . ALA G 4 62 ? 79.717  32.964 8.809   1.00 90.45  ? 83   ALA G CA  1 
ATOM   4066 C C   . ALA G 4 62 ? 78.747  33.459 7.729   1.00 91.16  ? 83   ALA G C   1 
ATOM   4067 O O   . ALA G 4 62 ? 77.536  33.233 7.821   1.00 84.47  ? 83   ALA G O   1 
ATOM   4068 C CB  . ALA G 4 62 ? 80.096  34.099 9.743   1.00 95.39  ? 83   ALA G CB  1 
ATOM   4069 N N   . THR G 4 63 ? 79.289  34.122 6.704   1.00 94.94  ? 84   THR G N   1 
ATOM   4070 C CA  . THR G 4 63 ? 78.483  34.633 5.592   1.00 93.35  ? 84   THR G CA  1 
ATOM   4071 C C   . THR G 4 63 ? 78.821  34.003 4.229   1.00 85.92  ? 84   THR G C   1 
ATOM   4072 O O   . THR G 4 63 ? 79.966  33.652 3.944   1.00 83.56  ? 84   THR G O   1 
ATOM   4073 C CB  . THR G 4 63 ? 78.606  36.173 5.461   1.00 101.64 ? 84   THR G CB  1 
ATOM   4074 O OG1 . THR G 4 63 ? 77.852  36.617 4.325   1.00 114.18 ? 84   THR G OG1 1 
ATOM   4075 C CG2 . THR G 4 63 ? 80.053  36.589 5.285   1.00 100.98 ? 84   THR G CG2 1 
ATOM   4076 N N   . THR G 4 64 ? 77.801  33.877 3.392   1.00 80.74  ? 85   THR G N   1 
ATOM   4077 C CA  . THR G 4 64 ? 77.930  33.303 2.062   1.00 78.83  ? 85   THR G CA  1 
ATOM   4078 C C   . THR G 4 64 ? 78.536  34.318 1.083   1.00 80.68  ? 85   THR G C   1 
ATOM   4079 O O   . THR G 4 64 ? 78.830  33.995 -0.069  1.00 71.92  ? 85   THR G O   1 
ATOM   4080 C CB  . THR G 4 64 ? 76.527  32.864 1.549   1.00 85.92  ? 85   THR G CB  1 
ATOM   4081 O OG1 . THR G 4 64 ? 76.628  31.602 0.884   1.00 91.46  ? 85   THR G OG1 1 
ATOM   4082 C CG2 . THR G 4 64 ? 75.939  33.899 0.581   1.00 87.65  ? 85   THR G CG2 1 
ATOM   4083 N N   . GLU G 4 65 ? 78.726  35.547 1.551   1.00 94.89  ? 86   GLU G N   1 
ATOM   4084 C CA  . GLU G 4 65 ? 79.256  36.611 0.704   1.00 105.33 ? 86   GLU G CA  1 
ATOM   4085 C C   . GLU G 4 65 ? 80.775  36.592 0.587   1.00 97.74  ? 86   GLU G C   1 
ATOM   4086 O O   . GLU G 4 65 ? 81.344  37.145 -0.356  1.00 90.52  ? 86   GLU G O   1 
ATOM   4087 C CB  . GLU G 4 65 ? 78.773  37.968 1.230   1.00 123.62 ? 86   GLU G CB  1 
ATOM   4088 C CG  . GLU G 4 65 ? 78.927  39.123 0.244   1.00 144.17 ? 86   GLU G CG  1 
ATOM   4089 C CD  . GLU G 4 65 ? 78.159  40.364 0.675   1.00 158.05 ? 86   GLU G CD  1 
ATOM   4090 O OE1 . GLU G 4 65 ? 78.359  40.817 1.820   1.00 167.39 ? 86   GLU G OE1 1 
ATOM   4091 O OE2 . GLU G 4 65 ? 77.358  40.888 -0.130  1.00 161.34 ? 86   GLU G OE2 1 
ATOM   4092 N N   . GLU G 4 66 ? 81.428  35.950 1.545   1.00 100.02 ? 87   GLU G N   1 
ATOM   4093 C CA  . GLU G 4 66 ? 82.881  35.852 1.541   1.00 109.07 ? 87   GLU G CA  1 
ATOM   4094 C C   . GLU G 4 66 ? 83.351  34.973 0.380   1.00 108.79 ? 87   GLU G C   1 
ATOM   4095 O O   . GLU G 4 66 ? 84.501  35.043 -0.045  1.00 109.71 ? 87   GLU G O   1 
ATOM   4096 C CB  . GLU G 4 66 ? 83.359  35.255 2.866   1.00 118.54 ? 87   GLU G CB  1 
ATOM   4097 C CG  . GLU G 4 66 ? 82.962  36.068 4.093   1.00 131.26 ? 87   GLU G CG  1 
ATOM   4098 C CD  . GLU G 4 66 ? 83.183  35.312 5.396   1.00 143.43 ? 87   GLU G CD  1 
ATOM   4099 O OE1 . GLU G 4 66 ? 84.307  34.817 5.613   1.00 149.88 ? 87   GLU G OE1 1 
ATOM   4100 O OE2 . GLU G 4 66 ? 82.239  35.212 6.209   1.00 145.96 ? 87   GLU G OE2 1 
ATOM   4101 N N   . LEU G 4 67 ? 82.442  34.156 -0.137  1.00 106.19 ? 88   LEU G N   1 
ATOM   4102 C CA  . LEU G 4 67 ? 82.747  33.244 -1.231  1.00 99.32  ? 88   LEU G CA  1 
ATOM   4103 C C   . LEU G 4 67 ? 82.905  33.895 -2.604  1.00 105.60 ? 88   LEU G C   1 
ATOM   4104 O O   . LEU G 4 67 ? 82.583  35.068 -2.795  1.00 111.48 ? 88   LEU G O   1 
ATOM   4105 C CB  . LEU G 4 67 ? 81.651  32.178 -1.319  1.00 90.56  ? 88   LEU G CB  1 
ATOM   4106 C CG  . LEU G 4 67 ? 81.480  31.254 -0.109  1.00 82.97  ? 88   LEU G CG  1 
ATOM   4107 C CD1 . LEU G 4 67 ? 80.324  30.276 -0.332  1.00 78.10  ? 88   LEU G CD1 1 
ATOM   4108 C CD2 . LEU G 4 67 ? 82.782  30.499 0.117   1.00 83.69  ? 88   LEU G CD2 1 
ATOM   4109 N N   . PRO G 4 68 ? 83.455  33.137 -3.571  1.00 107.51 ? 89   PRO G N   1 
ATOM   4110 C CA  . PRO G 4 68 ? 83.673  33.569 -4.955  1.00 111.09 ? 89   PRO G CA  1 
ATOM   4111 C C   . PRO G 4 68 ? 82.466  33.085 -5.764  1.00 113.75 ? 89   PRO G C   1 
ATOM   4112 O O   . PRO G 4 68 ? 81.562  32.453 -5.213  1.00 113.74 ? 89   PRO G O   1 
ATOM   4113 C CB  . PRO G 4 68 ? 84.952  32.843 -5.342  1.00 104.37 ? 89   PRO G CB  1 
ATOM   4114 C CG  . PRO G 4 68 ? 84.783  31.545 -4.656  1.00 99.66  ? 89   PRO G CG  1 
ATOM   4115 C CD  . PRO G 4 68 ? 84.300  31.965 -3.273  1.00 102.45 ? 89   PRO G CD  1 
ATOM   4116 N N   . ASP G 4 69 ? 82.447  33.356 -7.061  1.00 115.43 ? 90   ASP G N   1 
ATOM   4117 C CA  . ASP G 4 69 ? 81.310  32.934 -7.863  1.00 118.77 ? 90   ASP G CA  1 
ATOM   4118 C C   . ASP G 4 69 ? 81.330  31.469 -8.297  1.00 118.78 ? 90   ASP G C   1 
ATOM   4119 O O   . ASP G 4 69 ? 80.278  30.861 -8.426  1.00 115.46 ? 90   ASP G O   1 
ATOM   4120 C CB  . ASP G 4 69 ? 81.149  33.863 -9.072  1.00 123.40 ? 90   ASP G CB  1 
ATOM   4121 C CG  . ASP G 4 69 ? 80.517  35.204 -8.697  1.00 121.64 ? 90   ASP G CG  1 
ATOM   4122 O OD1 . ASP G 4 69 ? 81.114  35.961 -7.895  1.00 113.35 ? 90   ASP G OD1 1 
ATOM   4123 O OD2 . ASP G 4 69 ? 79.411  35.495 -9.203  1.00 123.56 ? 90   ASP G OD2 1 
ATOM   4124 N N   . GLU G 4 70 ? 82.518  30.906 -8.511  1.00 123.22 ? 91   GLU G N   1 
ATOM   4125 C CA  . GLU G 4 70 ? 82.658  29.497 -8.915  1.00 118.81 ? 91   GLU G CA  1 
ATOM   4126 C C   . GLU G 4 70 ? 83.675  28.754 -8.036  1.00 104.92 ? 91   GLU G C   1 
ATOM   4127 O O   . GLU G 4 70 ? 84.807  29.195 -7.867  1.00 105.97 ? 91   GLU G O   1 
ATOM   4128 C CB  . GLU G 4 70 ? 83.070  29.396 -10.398 1.00 130.19 ? 91   GLU G CB  1 
ATOM   4129 C CG  . GLU G 4 70 ? 81.904  29.480 -11.394 1.00 141.61 ? 91   GLU G CG  1 
ATOM   4130 C CD  . GLU G 4 70 ? 82.347  29.496 -12.856 1.00 141.64 ? 91   GLU G CD  1 
ATOM   4131 O OE1 . GLU G 4 70 ? 83.216  28.678 -13.234 1.00 136.54 ? 91   GLU G OE1 1 
ATOM   4132 O OE2 . GLU G 4 70 ? 81.811  30.321 -13.630 1.00 139.26 ? 91   GLU G OE2 1 
ATOM   4133 N N   . PHE G 4 71 ? 83.265  27.626 -7.472  1.00 87.88  ? 92   PHE G N   1 
ATOM   4134 C CA  . PHE G 4 71 ? 84.141  26.846 -6.613  1.00 74.86  ? 92   PHE G CA  1 
ATOM   4135 C C   . PHE G 4 71 ? 83.555  25.449 -6.462  1.00 75.82  ? 92   PHE G C   1 
ATOM   4136 O O   . PHE G 4 71 ? 82.414  25.187 -6.865  1.00 71.14  ? 92   PHE G O   1 
ATOM   4137 C CB  . PHE G 4 71 ? 84.265  27.523 -5.246  1.00 73.83  ? 92   PHE G CB  1 
ATOM   4138 C CG  . PHE G 4 71 ? 82.939  27.790 -4.586  1.00 88.31  ? 92   PHE G CG  1 
ATOM   4139 C CD1 . PHE G 4 71 ? 82.290  26.796 -3.858  1.00 92.78  ? 92   PHE G CD1 1 
ATOM   4140 C CD2 . PHE G 4 71 ? 82.307  29.023 -4.742  1.00 91.91  ? 92   PHE G CD2 1 
ATOM   4141 C CE1 . PHE G 4 71 ? 81.027  27.024 -3.300  1.00 90.44  ? 92   PHE G CE1 1 
ATOM   4142 C CE2 . PHE G 4 71 ? 81.042  29.260 -4.187  1.00 89.07  ? 92   PHE G CE2 1 
ATOM   4143 C CZ  . PHE G 4 71 ? 80.403  28.260 -3.465  1.00 89.84  ? 92   PHE G CZ  1 
ATOM   4144 N N   . VAL G 4 72 ? 84.333  24.550 -5.874  1.00 74.95  ? 93   VAL G N   1 
ATOM   4145 C CA  . VAL G 4 72 ? 83.871  23.180 -5.692  1.00 66.05  ? 93   VAL G CA  1 
ATOM   4146 C C   . VAL G 4 72 ? 83.526  22.921 -4.245  1.00 56.82  ? 93   VAL G C   1 
ATOM   4147 O O   . VAL G 4 72 ? 84.192  23.431 -3.328  1.00 50.90  ? 93   VAL G O   1 
ATOM   4148 C CB  . VAL G 4 72 ? 84.946  22.207 -6.105  1.00 70.77  ? 93   VAL G CB  1 
ATOM   4149 C CG1 . VAL G 4 72 ? 85.437  22.569 -7.500  1.00 71.76  ? 93   VAL G CG1 1 
ATOM   4150 C CG2 . VAL G 4 72 ? 86.092  22.269 -5.108  1.00 77.95  ? 93   VAL G CG2 1 
ATOM   4151 N N   . VAL G 4 73 ? 82.507  22.098 -4.048  1.00 51.70  ? 94   VAL G N   1 
ATOM   4152 C CA  . VAL G 4 73 ? 82.044  21.777 -2.714  1.00 52.68  ? 94   VAL G CA  1 
ATOM   4153 C C   . VAL G 4 73 ? 82.064  20.303 -2.361  1.00 65.59  ? 94   VAL G C   1 
ATOM   4154 O O   . VAL G 4 73 ? 81.224  19.514 -2.817  1.00 68.49  ? 94   VAL G O   1 
ATOM   4155 C CB  . VAL G 4 73 ? 80.642  22.283 -2.533  1.00 41.97  ? 94   VAL G CB  1 
ATOM   4156 C CG1 . VAL G 4 73 ? 80.070  21.843 -1.176  1.00 20.77  ? 94   VAL G CG1 1 
ATOM   4157 C CG2 . VAL G 4 73 ? 80.665  23.771 -2.699  1.00 44.94  ? 94   VAL G CG2 1 
ATOM   4158 N N   . VAL G 4 74 ? 83.015  19.947 -1.512  1.00 69.65  ? 95   VAL G N   1 
ATOM   4159 C CA  . VAL G 4 74 ? 83.155  18.575 -1.077  1.00 77.68  ? 95   VAL G CA  1 
ATOM   4160 C C   . VAL G 4 74 ? 82.130  18.283 -0.009  1.00 80.45  ? 95   VAL G C   1 
ATOM   4161 O O   . VAL G 4 74 ? 82.341  18.550 1.175   1.00 70.40  ? 95   VAL G O   1 
ATOM   4162 C CB  . VAL G 4 74 ? 84.539  18.311 -0.495  1.00 80.72  ? 95   VAL G CB  1 
ATOM   4163 C CG1 . VAL G 4 74 ? 84.744  16.803 -0.331  1.00 84.16  ? 95   VAL G CG1 1 
ATOM   4164 C CG2 . VAL G 4 74 ? 85.600  18.937 -1.391  1.00 75.21  ? 95   VAL G CG2 1 
ATOM   4165 N N   . THR G 4 75 ? 81.000  17.751 -0.442  1.00 94.31  ? 96   THR G N   1 
ATOM   4166 C CA  . THR G 4 75 ? 79.953  17.403 0.490   1.00 104.76 ? 96   THR G CA  1 
ATOM   4167 C C   . THR G 4 75 ? 80.496  16.210 1.274   1.00 108.11 ? 96   THR G C   1 
ATOM   4168 O O   . THR G 4 75 ? 80.420  15.063 0.823   1.00 107.38 ? 96   THR G O   1 
ATOM   4169 C CB  . THR G 4 75 ? 78.656  17.031 -0.260  1.00 107.40 ? 96   THR G CB  1 
ATOM   4170 O OG1 . THR G 4 75 ? 78.340  18.069 -1.205  1.00 100.51 ? 96   THR G OG1 1 
ATOM   4171 C CG2 . THR G 4 75 ? 77.494  16.862 0.726   1.00 106.05 ? 96   THR G CG2 1 
ATOM   4172 N N   . ALA G 4 76 ? 81.077  16.505 2.434   1.00 114.17 ? 97   ALA G N   1 
ATOM   4173 C CA  . ALA G 4 76 ? 81.650  15.489 3.310   1.00 120.68 ? 97   ALA G CA  1 
ATOM   4174 C C   . ALA G 4 76 ? 80.557  14.581 3.861   1.00 128.07 ? 97   ALA G C   1 
ATOM   4175 O O   . ALA G 4 76 ? 80.514  14.301 5.064   1.00 130.96 ? 97   ALA G O   1 
ATOM   4176 C CB  . ALA G 4 76 ? 82.404  16.157 4.462   1.00 112.52 ? 97   ALA G CB  1 
ATOM   4177 N N   . LYS G 4 77 ? 79.666  14.135 2.978   1.00 131.83 ? 98   LYS G N   1 
ATOM   4178 C CA  . LYS G 4 77 ? 78.575  13.253 3.369   1.00 132.49 ? 98   LYS G CA  1 
ATOM   4179 C C   . LYS G 4 77 ? 79.054  11.798 3.330   1.00 137.53 ? 98   LYS G C   1 
ATOM   4180 O O   . LYS G 4 77 ? 78.901  11.107 4.360   1.00 142.61 ? 98   LYS G O   1 
ATOM   4181 C CB  . LYS G 4 77 ? 77.373  13.437 2.437   1.00 121.79 ? 98   LYS G CB  1 
ATOM   4182 C CG  . LYS G 4 77 ? 77.620  12.974 1.021   1.00 113.57 ? 98   LYS G CG  1 
ATOM   4183 C CD  . LYS G 4 77 ? 76.375  12.333 0.439   1.00 108.40 ? 98   LYS G CD  1 
ATOM   4184 C CE  . LYS G 4 77 ? 76.712  11.493 -0.786  1.00 111.30 ? 98   LYS G CE  1 
ATOM   4185 N NZ  . LYS G 4 77 ? 77.627  10.353 -0.470  1.00 108.42 ? 98   LYS G NZ  1 
ATOM   4186 O OXT . LYS G 4 77 ? 79.580  11.364 2.278   1.00 134.34 ? 98   LYS G OXT 1 
ATOM   4187 N N   . PRO H 3 1  ? 86.615  -0.141 6.164   1.00 152.71 ? 10   PRO H N   1 
ATOM   4188 C CA  . PRO H 3 1  ? 87.341  0.396  4.982   1.00 150.73 ? 10   PRO H CA  1 
ATOM   4189 C C   . PRO H 3 1  ? 88.831  0.613  5.310   1.00 146.94 ? 10   PRO H C   1 
ATOM   4190 O O   . PRO H 3 1  ? 89.288  0.293  6.413   1.00 147.15 ? 10   PRO H O   1 
ATOM   4191 C CB  . PRO H 3 1  ? 86.653  1.708  4.620   1.00 153.32 ? 10   PRO H CB  1 
ATOM   4192 C CG  . PRO H 3 1  ? 85.244  1.469  5.153   1.00 153.37 ? 10   PRO H CG  1 
ATOM   4193 C CD  . PRO H 3 1  ? 85.458  0.719  6.476   1.00 152.27 ? 10   PRO H CD  1 
ATOM   4194 N N   . PRO H 3 2  ? 89.611  1.144  4.357   1.00 143.13 ? 11   PRO H N   1 
ATOM   4195 C CA  . PRO H 3 2  ? 89.201  1.541  3.011   1.00 138.89 ? 11   PRO H CA  1 
ATOM   4196 C C   . PRO H 3 2  ? 90.068  0.921  1.920   1.00 136.60 ? 11   PRO H C   1 
ATOM   4197 O O   . PRO H 3 2  ? 91.217  0.536  2.152   1.00 137.55 ? 11   PRO H O   1 
ATOM   4198 C CB  . PRO H 3 2  ? 89.339  3.066  3.043   1.00 138.99 ? 11   PRO H CB  1 
ATOM   4199 C CG  . PRO H 3 2  ? 90.204  3.358  4.312   1.00 140.22 ? 11   PRO H CG  1 
ATOM   4200 C CD  . PRO H 3 2  ? 90.700  2.020  4.801   1.00 143.22 ? 11   PRO H CD  1 
ATOM   4201 N N   . ALA H 3 3  ? 89.504  0.841  0.721   1.00 131.84 ? 12   ALA H N   1 
ATOM   4202 C CA  . ALA H 3 3  ? 90.207  0.305  -0.438  1.00 124.66 ? 12   ALA H CA  1 
ATOM   4203 C C   . ALA H 3 3  ? 90.777  1.521  -1.160  1.00 123.08 ? 12   ALA H C   1 
ATOM   4204 O O   . ALA H 3 3  ? 90.077  2.518  -1.336  1.00 130.07 ? 12   ALA H O   1 
ATOM   4205 C CB  . ALA H 3 3  ? 89.232  -0.432 -1.338  1.00 114.09 ? 12   ALA H CB  1 
ATOM   4206 N N   . LEU H 3 4  ? 92.040  1.461  -1.562  1.00 112.29 ? 13   LEU H N   1 
ATOM   4207 C CA  . LEU H 3 4  ? 92.641  2.602  -2.236  1.00 98.75  ? 13   LEU H CA  1 
ATOM   4208 C C   . LEU H 3 4  ? 91.978  2.903  -3.575  1.00 88.70  ? 13   LEU H C   1 
ATOM   4209 O O   . LEU H 3 4  ? 91.881  2.032  -4.444  1.00 84.29  ? 13   LEU H O   1 
ATOM   4210 C CB  . LEU H 3 4  ? 94.143  2.377  -2.419  1.00 102.31 ? 13   LEU H CB  1 
ATOM   4211 C CG  . LEU H 3 4  ? 94.954  2.331  -1.118  1.00 105.69 ? 13   LEU H CG  1 
ATOM   4212 C CD1 . LEU H 3 4  ? 96.437  2.394  -1.433  1.00 100.70 ? 13   LEU H CD1 1 
ATOM   4213 C CD2 . LEU H 3 4  ? 94.573  3.506  -0.234  1.00 112.95 ? 13   LEU H CD2 1 
ATOM   4214 N N   . HIS H 3 5  ? 91.527  4.150  -3.717  1.00 79.93  ? 14   HIS H N   1 
ATOM   4215 C CA  . HIS H 3 5  ? 90.851  4.631  -4.919  1.00 69.47  ? 14   HIS H CA  1 
ATOM   4216 C C   . HIS H 3 5  ? 91.580  5.772  -5.596  1.00 67.09  ? 14   HIS H C   1 
ATOM   4217 O O   . HIS H 3 5  ? 91.736  6.859  -5.025  1.00 62.77  ? 14   HIS H O   1 
ATOM   4218 C CB  . HIS H 3 5  ? 89.451  5.092  -4.570  1.00 76.86  ? 14   HIS H CB  1 
ATOM   4219 C CG  . HIS H 3 5  ? 88.587  4.001  -4.035  1.00 93.73  ? 14   HIS H CG  1 
ATOM   4220 N ND1 . HIS H 3 5  ? 88.177  2.935  -4.807  1.00 96.40  ? 14   HIS H ND1 1 
ATOM   4221 C CD2 . HIS H 3 5  ? 88.080  3.792  -2.800  1.00 101.05 ? 14   HIS H CD2 1 
ATOM   4222 C CE1 . HIS H 3 5  ? 87.452  2.116  -4.066  1.00 103.03 ? 14   HIS H CE1 1 
ATOM   4223 N NE2 . HIS H 3 5  ? 87.377  2.611  -2.844  1.00 104.18 ? 14   HIS H NE2 1 
ATOM   4224 N N   . LEU H 3 6  ? 91.997  5.514  -6.830  1.00 68.27  ? 15   LEU H N   1 
ATOM   4225 C CA  . LEU H 3 6  ? 92.718  6.479  -7.635  1.00 83.08  ? 15   LEU H CA  1 
ATOM   4226 C C   . LEU H 3 6  ? 91.815  7.477  -8.381  1.00 96.20  ? 15   LEU H C   1 
ATOM   4227 O O   . LEU H 3 6  ? 91.058  7.091  -9.271  1.00 106.51 ? 15   LEU H O   1 
ATOM   4228 C CB  . LEU H 3 6  ? 93.596  5.714  -8.621  1.00 72.30  ? 15   LEU H CB  1 
ATOM   4229 C CG  . LEU H 3 6  ? 94.462  6.542  -9.567  1.00 79.84  ? 15   LEU H CG  1 
ATOM   4230 C CD1 . LEU H 3 6  ? 93.606  7.113  -10.697 1.00 89.22  ? 15   LEU H CD1 1 
ATOM   4231 C CD2 . LEU H 3 6  ? 95.169  7.641  -8.784  1.00 75.98  ? 15   LEU H CD2 1 
ATOM   4232 N N   . VAL H 3 7  ? 91.913  8.759  -8.022  1.00 98.08  ? 16   VAL H N   1 
ATOM   4233 C CA  . VAL H 3 7  ? 91.120  9.818  -8.654  1.00 98.25  ? 16   VAL H CA  1 
ATOM   4234 C C   . VAL H 3 7  ? 91.808  10.317 -9.921  1.00 100.93 ? 16   VAL H C   1 
ATOM   4235 O O   . VAL H 3 7  ? 92.818  11.020 -9.850  1.00 104.29 ? 16   VAL H O   1 
ATOM   4236 C CB  . VAL H 3 7  ? 90.941  11.008 -7.705  1.00 97.17  ? 16   VAL H CB  1 
ATOM   4237 C CG1 . VAL H 3 7  ? 90.215  12.136 -8.423  1.00 99.37  ? 16   VAL H CG1 1 
ATOM   4238 C CG2 . VAL H 3 7  ? 90.188  10.562 -6.456  1.00 84.22  ? 16   VAL H CG2 1 
ATOM   4239 N N   . ASP H 3 8  ? 91.242  9.963  -11.070 1.00 99.23  ? 17   ASP H N   1 
ATOM   4240 C CA  . ASP H 3 8  ? 91.787  10.322 -12.380 1.00 102.92 ? 17   ASP H CA  1 
ATOM   4241 C C   . ASP H 3 8  ? 92.476  11.665 -12.438 1.00 105.21 ? 17   ASP H C   1 
ATOM   4242 O O   . ASP H 3 8  ? 92.102  12.592 -11.723 1.00 109.68 ? 17   ASP H O   1 
ATOM   4243 C CB  . ASP H 3 8  ? 90.688  10.294 -13.422 1.00 104.96 ? 17   ASP H CB  1 
ATOM   4244 C CG  . ASP H 3 8  ? 89.677  9.234  -13.137 1.00 112.62 ? 17   ASP H CG  1 
ATOM   4245 O OD1 . ASP H 3 8  ? 89.100  9.274  -12.024 1.00 107.81 ? 17   ASP H OD1 1 
ATOM   4246 O OD2 . ASP H 3 8  ? 89.466  8.368  -14.012 1.00 120.77 ? 17   ASP H OD2 1 
ATOM   4247 N N   . PRO H 3 9  ? 93.478  11.790 -13.326 1.00 107.22 ? 18   PRO H N   1 
ATOM   4248 C CA  . PRO H 3 9  ? 94.276  13.001 -13.537 1.00 108.76 ? 18   PRO H CA  1 
ATOM   4249 C C   . PRO H 3 9  ? 93.359  14.170 -13.849 1.00 111.72 ? 18   PRO H C   1 
ATOM   4250 O O   . PRO H 3 9  ? 93.726  15.338 -13.683 1.00 111.39 ? 18   PRO H O   1 
ATOM   4251 C CB  . PRO H 3 9  ? 95.159  12.624 -14.721 1.00 101.72 ? 18   PRO H CB  1 
ATOM   4252 C CG  . PRO H 3 9  ? 94.256  11.746 -15.515 1.00 100.73 ? 18   PRO H CG  1 
ATOM   4253 C CD  . PRO H 3 9  ? 93.670  10.853 -14.448 1.00 104.40 ? 18   PRO H CD  1 
ATOM   4254 N N   . GLN H 3 10 ? 92.161  13.827 -14.313 1.00 115.46 ? 19   GLN H N   1 
ATOM   4255 C CA  . GLN H 3 10 ? 91.136  14.803 -14.647 1.00 116.20 ? 19   GLN H CA  1 
ATOM   4256 C C   . GLN H 3 10 ? 90.991  15.741 -13.452 1.00 109.81 ? 19   GLN H C   1 
ATOM   4257 O O   . GLN H 3 10 ? 90.851  16.953 -13.597 1.00 108.89 ? 19   GLN H O   1 
ATOM   4258 C CB  . GLN H 3 10 ? 89.820  14.068 -14.914 1.00 122.57 ? 19   GLN H CB  1 
ATOM   4259 C CG  . GLN H 3 10 ? 89.380  13.187 -13.747 1.00 126.07 ? 19   GLN H CG  1 
ATOM   4260 C CD  . GLN H 3 10 ? 88.340  12.145 -14.131 1.00 128.00 ? 19   GLN H CD  1 
ATOM   4261 O OE1 . GLN H 3 10 ? 87.752  11.493 -13.265 1.00 133.37 ? 19   GLN H OE1 1 
ATOM   4262 N NE2 . GLN H 3 10 ? 88.120  11.974 -15.428 1.00 121.88 ? 19   GLN H NE2 1 
ATOM   4263 N N   . ILE H 3 11 ? 91.055  15.156 -12.264 1.00 103.54 ? 20   ILE H N   1 
ATOM   4264 C CA  . ILE H 3 11 ? 90.932  15.899 -11.023 1.00 90.56  ? 20   ILE H CA  1 
ATOM   4265 C C   . ILE H 3 11 ? 92.171  15.705 -10.167 1.00 81.69  ? 20   ILE H C   1 
ATOM   4266 O O   . ILE H 3 11 ? 92.584  14.580 -9.891  1.00 82.38  ? 20   ILE H O   1 
ATOM   4267 C CB  . ILE H 3 11 ? 89.765  15.392 -10.215 1.00 88.73  ? 20   ILE H CB  1 
ATOM   4268 C CG1 . ILE H 3 11 ? 88.592  15.095 -11.145 1.00 86.53  ? 20   ILE H CG1 1 
ATOM   4269 C CG2 . ILE H 3 11 ? 89.422  16.407 -9.152  1.00 86.99  ? 20   ILE H CG2 1 
ATOM   4270 C CD1 . ILE H 3 11 ? 87.638  14.049 -10.605 1.00 80.54  ? 20   ILE H CD1 1 
ATOM   4271 N N   . GLN H 3 12 ? 92.766  16.796 -9.727  1.00 72.48  ? 21   GLN H N   1 
ATOM   4272 C CA  . GLN H 3 12 ? 93.938  16.665 -8.904  1.00 71.07  ? 21   GLN H CA  1 
ATOM   4273 C C   . GLN H 3 12 ? 94.099  17.865 -8.016  1.00 69.97  ? 21   GLN H C   1 
ATOM   4274 O O   . GLN H 3 12 ? 93.659  18.965 -8.340  1.00 71.42  ? 21   GLN H O   1 
ATOM   4275 C CB  . GLN H 3 12 ? 95.179  16.534 -9.764  1.00 82.32  ? 21   GLN H CB  1 
ATOM   4276 C CG  . GLN H 3 12 ? 95.065  15.542 -10.877 1.00 90.76  ? 21   GLN H CG  1 
ATOM   4277 C CD  . GLN H 3 12 ? 96.417  15.066 -11.321 1.00 103.62 ? 21   GLN H CD  1 
ATOM   4278 O OE1 . GLN H 3 12 ? 97.394  15.821 -11.301 1.00 101.66 ? 21   GLN H OE1 1 
ATOM   4279 N NE2 . GLN H 3 12 ? 96.491  13.807 -11.729 1.00 107.95 ? 21   GLN H NE2 1 
ATOM   4280 N N   . LEU H 3 13 ? 94.752  17.652 -6.890  1.00 71.39  ? 22   LEU H N   1 
ATOM   4281 C CA  . LEU H 3 13 ? 94.981  18.739 -5.976  1.00 68.45  ? 22   LEU H CA  1 
ATOM   4282 C C   . LEU H 3 13 ? 96.079  19.647 -6.498  1.00 72.30  ? 22   LEU H C   1 
ATOM   4283 O O   . LEU H 3 13 ? 96.837  19.278 -7.399  1.00 72.56  ? 22   LEU H O   1 
ATOM   4284 C CB  . LEU H 3 13 ? 95.376  18.194 -4.621  1.00 61.67  ? 22   LEU H CB  1 
ATOM   4285 C CG  . LEU H 3 13 ? 94.608  18.933 -3.544  1.00 66.57  ? 22   LEU H CG  1 
ATOM   4286 C CD1 . LEU H 3 13 ? 93.108  18.729 -3.735  1.00 73.52  ? 22   LEU H CD1 1 
ATOM   4287 C CD2 . LEU H 3 13 ? 95.050  18.407 -2.211  1.00 75.51  ? 22   LEU H CD2 1 
ATOM   4288 N N   . THR H 3 14 ? 96.155  20.841 -5.923  1.00 83.82  ? 23   THR H N   1 
ATOM   4289 C CA  . THR H 3 14 ? 97.157  21.820 -6.304  1.00 89.34  ? 23   THR H CA  1 
ATOM   4290 C C   . THR H 3 14 ? 97.616  22.576 -5.082  1.00 93.87  ? 23   THR H C   1 
ATOM   4291 O O   . THR H 3 14 ? 96.842  23.285 -4.428  1.00 88.22  ? 23   THR H O   1 
ATOM   4292 C CB  . THR H 3 14 ? 96.611  22.841 -7.320  1.00 90.16  ? 23   THR H CB  1 
ATOM   4293 O OG1 . THR H 3 14 ? 96.239  22.157 -8.520  1.00 84.12  ? 23   THR H OG1 1 
ATOM   4294 C CG2 . THR H 3 14 ? 97.667  23.901 -7.644  1.00 84.89  ? 23   THR H CG2 1 
ATOM   4295 N N   . ILE H 3 15 ? 98.890  22.400 -4.776  1.00 104.52 ? 24   ILE H N   1 
ATOM   4296 C CA  . ILE H 3 15 ? 99.506  23.075 -3.655  1.00 121.37 ? 24   ILE H CA  1 
ATOM   4297 C C   . ILE H 3 15 ? 100.115 24.322 -4.269  1.00 130.27 ? 24   ILE H C   1 
ATOM   4298 O O   . ILE H 3 15 ? 100.514 24.294 -5.431  1.00 135.27 ? 24   ILE H O   1 
ATOM   4299 C CB  . ILE H 3 15 ? 100.612 22.202 -3.050  1.00 122.42 ? 24   ILE H CB  1 
ATOM   4300 C CG1 . ILE H 3 15 ? 100.090 20.770 -2.878  1.00 122.70 ? 24   ILE H CG1 1 
ATOM   4301 C CG2 . ILE H 3 15 ? 101.099 22.801 -1.741  1.00 121.42 ? 24   ILE H CG2 1 
ATOM   4302 C CD1 . ILE H 3 15 ? 98.675  20.665 -2.333  1.00 115.30 ? 24   ILE H CD1 1 
ATOM   4303 N N   . THR H 3 16 ? 100.166 25.414 -3.514  1.00 136.78 ? 25   THR H N   1 
ATOM   4304 C CA  . THR H 3 16 ? 100.740 26.652 -4.026  1.00 145.83 ? 25   THR H CA  1 
ATOM   4305 C C   . THR H 3 16 ? 101.898 26.328 -4.985  1.00 155.58 ? 25   THR H C   1 
ATOM   4306 O O   . THR H 3 16 ? 102.685 25.420 -4.715  1.00 161.90 ? 25   THR H O   1 
ATOM   4307 C CB  . THR H 3 16 ? 101.231 27.533 -2.860  1.00 144.58 ? 25   THR H CB  1 
ATOM   4308 O OG1 . THR H 3 16 ? 101.965 26.731 -1.927  1.00 144.26 ? 25   THR H OG1 1 
ATOM   4309 C CG2 . THR H 3 16 ? 100.050 28.166 -2.145  1.00 142.12 ? 25   THR H CG2 1 
ATOM   4310 N N   . ASP H 3 17 ? 101.977 27.053 -6.106  1.00 158.76 ? 39   ASP H N   1 
ATOM   4311 C CA  . ASP H 3 17 ? 103.014 26.848 -7.138  1.00 155.50 ? 39   ASP H CA  1 
ATOM   4312 C C   . ASP H 3 17 ? 102.709 25.554 -7.897  1.00 151.68 ? 39   ASP H C   1 
ATOM   4313 O O   . ASP H 3 17 ? 103.318 24.519 -7.630  1.00 152.71 ? 39   ASP H O   1 
ATOM   4314 C CB  . ASP H 3 17 ? 104.415 26.767 -6.503  1.00 155.01 ? 39   ASP H CB  1 
ATOM   4315 C CG  . ASP H 3 17 ? 105.537 26.735 -7.537  1.00 154.36 ? 39   ASP H CG  1 
ATOM   4316 O OD1 . ASP H 3 17 ? 105.671 27.714 -8.304  1.00 152.87 ? 39   ASP H OD1 1 
ATOM   4317 O OD2 . ASP H 3 17 ? 106.288 25.734 -7.579  1.00 155.38 ? 39   ASP H OD2 1 
ATOM   4318 N N   . PRO H 3 18 ? 101.790 25.613 -8.883  1.00 144.81 ? 40   PRO H N   1 
ATOM   4319 C CA  . PRO H 3 18 ? 101.391 24.455 -9.678  1.00 138.14 ? 40   PRO H CA  1 
ATOM   4320 C C   . PRO H 3 18 ? 101.971 23.104 -9.281  1.00 133.84 ? 40   PRO H C   1 
ATOM   4321 O O   . PRO H 3 18 ? 102.632 22.438 -10.074 1.00 135.08 ? 40   PRO H O   1 
ATOM   4322 C CB  . PRO H 3 18 ? 101.748 24.893 -11.084 1.00 135.87 ? 40   PRO H CB  1 
ATOM   4323 C CG  . PRO H 3 18 ? 101.187 26.282 -11.071 1.00 139.66 ? 40   PRO H CG  1 
ATOM   4324 C CD  . PRO H 3 18 ? 101.571 26.836 -9.677  1.00 142.58 ? 40   PRO H CD  1 
ATOM   4325 N N   . LYS H 3 19 ? 101.712 22.723 -8.032  1.00 126.33 ? 41   LYS H N   1 
ATOM   4326 C CA  . LYS H 3 19 ? 102.136 21.443 -7.476  1.00 113.78 ? 41   LYS H CA  1 
ATOM   4327 C C   . LYS H 3 19 ? 100.875 20.583 -7.547  1.00 110.38 ? 41   LYS H C   1 
ATOM   4328 O O   . LYS H 3 19 ? 100.027 20.602 -6.647  1.00 111.44 ? 41   LYS H O   1 
ATOM   4329 C CB  . LYS H 3 19 ? 102.593 21.613 -6.023  1.00 108.85 ? 41   LYS H CB  1 
ATOM   4330 C CG  . LYS H 3 19 ? 103.927 22.324 -5.870  1.00 110.55 ? 41   LYS H CG  1 
ATOM   4331 C CD  . LYS H 3 19 ? 104.323 22.520 -4.405  1.00 121.24 ? 41   LYS H CD  1 
ATOM   4332 C CE  . LYS H 3 19 ? 105.692 23.212 -4.299  1.00 126.64 ? 41   LYS H CE  1 
ATOM   4333 N NZ  . LYS H 3 19 ? 106.111 23.528 -2.897  1.00 122.97 ? 41   LYS H NZ  1 
ATOM   4334 N N   . VAL H 3 20 ? 100.749 19.839 -8.637  1.00 101.48 ? 42   VAL H N   1 
ATOM   4335 C CA  . VAL H 3 20 ? 99.572  19.018 -8.856  1.00 95.09  ? 42   VAL H CA  1 
ATOM   4336 C C   . VAL H 3 20 ? 99.788  17.556 -8.550  1.00 86.49  ? 42   VAL H C   1 
ATOM   4337 O O   . VAL H 3 20 ? 100.545 16.877 -9.231  1.00 91.52  ? 42   VAL H O   1 
ATOM   4338 C CB  . VAL H 3 20 ? 99.090  19.139 -10.312 1.00 97.62  ? 42   VAL H CB  1 
ATOM   4339 C CG1 . VAL H 3 20 ? 97.745  18.449 -10.471 1.00 91.67  ? 42   VAL H CG1 1 
ATOM   4340 C CG2 . VAL H 3 20 ? 98.997  20.605 -10.707 1.00 100.67 ? 42   VAL H CG2 1 
ATOM   4341 N N   . TYR H 3 21 ? 99.090  17.067 -7.539  1.00 71.70  ? 43   TYR H N   1 
ATOM   4342 C CA  . TYR H 3 21 ? 99.226  15.680 -7.155  1.00 67.55  ? 43   TYR H CA  1 
ATOM   4343 C C   . TYR H 3 21 ? 97.928  14.937 -7.343  1.00 69.40  ? 43   TYR H C   1 
ATOM   4344 O O   . TYR H 3 21 ? 96.873  15.405 -6.914  1.00 74.45  ? 43   TYR H O   1 
ATOM   4345 C CB  . TYR H 3 21 ? 99.613  15.565 -5.685  1.00 67.15  ? 43   TYR H CB  1 
ATOM   4346 C CG  . TYR H 3 21 ? 100.760 16.443 -5.275  1.00 76.16  ? 43   TYR H CG  1 
ATOM   4347 C CD1 . TYR H 3 21 ? 100.644 17.830 -5.303  1.00 87.80  ? 43   TYR H CD1 1 
ATOM   4348 C CD2 . TYR H 3 21 ? 101.955 15.888 -4.828  1.00 80.76  ? 43   TYR H CD2 1 
ATOM   4349 C CE1 . TYR H 3 21 ? 101.688 18.643 -4.888  1.00 97.52  ? 43   TYR H CE1 1 
ATOM   4350 C CE2 . TYR H 3 21 ? 103.011 16.694 -4.413  1.00 85.24  ? 43   TYR H CE2 1 
ATOM   4351 C CZ  . TYR H 3 21 ? 102.871 18.072 -4.438  1.00 91.58  ? 43   TYR H CZ  1 
ATOM   4352 O OH  . TYR H 3 21 ? 103.899 18.876 -3.982  1.00 88.68  ? 43   TYR H OH  1 
ATOM   4353 N N   . PRO H 3 22 ? 97.984  13.756 -7.977  1.00 72.50  ? 44   PRO H N   1 
ATOM   4354 C CA  . PRO H 3 22 ? 96.758  12.979 -8.180  1.00 72.60  ? 44   PRO H CA  1 
ATOM   4355 C C   . PRO H 3 22 ? 96.135  12.743 -6.812  1.00 64.78  ? 44   PRO H C   1 
ATOM   4356 O O   . PRO H 3 22 ? 96.764  13.000 -5.782  1.00 61.42  ? 44   PRO H O   1 
ATOM   4357 C CB  . PRO H 3 22 ? 97.258  11.695 -8.849  1.00 81.39  ? 44   PRO H CB  1 
ATOM   4358 C CG  . PRO H 3 22 ? 98.688  11.585 -8.384  1.00 83.35  ? 44   PRO H CG  1 
ATOM   4359 C CD  . PRO H 3 22 ? 99.164  13.020 -8.462  1.00 80.71  ? 44   PRO H CD  1 
ATOM   4360 N N   . ILE H 3 23 ? 94.912  12.243 -6.787  1.00 59.58  ? 45   ILE H N   1 
ATOM   4361 C CA  . ILE H 3 23 ? 94.251  12.069 -5.510  1.00 69.11  ? 45   ILE H CA  1 
ATOM   4362 C C   . ILE H 3 23 ? 93.880  10.626 -5.194  1.00 67.93  ? 45   ILE H C   1 
ATOM   4363 O O   . ILE H 3 23 ? 93.284  9.934  -6.017  1.00 70.83  ? 45   ILE H O   1 
ATOM   4364 C CB  . ILE H 3 23 ? 92.988  13.013 -5.459  1.00 69.68  ? 45   ILE H CB  1 
ATOM   4365 C CG1 . ILE H 3 23 ? 93.454  14.475 -5.590  1.00 56.31  ? 45   ILE H CG1 1 
ATOM   4366 C CG2 . ILE H 3 23 ? 92.180  12.803 -4.163  1.00 50.05  ? 45   ILE H CG2 1 
ATOM   4367 C CD1 . ILE H 3 23 ? 92.360  15.457 -5.986  1.00 55.48  ? 45   ILE H CD1 1 
ATOM   4368 N N   . ILE H 3 24 ? 94.258  10.173 -4.001  1.00 60.76  ? 46   ILE H N   1 
ATOM   4369 C CA  . ILE H 3 24 ? 93.929  8.822  -3.568  1.00 60.48  ? 46   ILE H CA  1 
ATOM   4370 C C   . ILE H 3 24 ? 92.946  8.914  -2.422  1.00 66.27  ? 46   ILE H C   1 
ATOM   4371 O O   . ILE H 3 24 ? 93.055  9.798  -1.572  1.00 68.57  ? 46   ILE H O   1 
ATOM   4372 C CB  . ILE H 3 24 ? 95.159  8.057  -3.083  1.00 59.07  ? 46   ILE H CB  1 
ATOM   4373 C CG1 . ILE H 3 24 ? 96.133  7.854  -4.245  1.00 70.04  ? 46   ILE H CG1 1 
ATOM   4374 C CG2 . ILE H 3 24 ? 94.735  6.714  -2.494  1.00 45.80  ? 46   ILE H CG2 1 
ATOM   4375 C CD1 . ILE H 3 24 ? 95.557  7.063  -5.401  1.00 73.53  ? 46   ILE H CD1 1 
ATOM   4376 N N   . LEU H 3 25 ? 92.006  7.982  -2.372  1.00 73.76  ? 47   LEU H N   1 
ATOM   4377 C CA  . LEU H 3 25 ? 91.002  8.042  -1.333  1.00 88.42  ? 47   LEU H CA  1 
ATOM   4378 C C   . LEU H 3 25 ? 90.900  6.831  -0.441  1.00 93.12  ? 47   LEU H C   1 
ATOM   4379 O O   . LEU H 3 25 ? 90.766  5.704  -0.910  1.00 87.26  ? 47   LEU H O   1 
ATOM   4380 C CB  . LEU H 3 25 ? 89.642  8.315  -1.970  1.00 94.43  ? 47   LEU H CB  1 
ATOM   4381 C CG  . LEU H 3 25 ? 89.694  9.409  -3.041  1.00 90.26  ? 47   LEU H CG  1 
ATOM   4382 C CD1 . LEU H 3 25 ? 88.323  9.583  -3.640  1.00 80.68  ? 47   LEU H CD1 1 
ATOM   4383 C CD2 . LEU H 3 25 ? 90.189  10.716 -2.438  1.00 82.96  ? 47   LEU H CD2 1 
ATOM   4384 N N   . ARG H 3 26 ? 90.964  7.086  0.858   1.00 104.78 ? 48   ARG H N   1 
ATOM   4385 C CA  . ARG H 3 26 ? 90.830  6.037  1.848   1.00 114.57 ? 48   ARG H CA  1 
ATOM   4386 C C   . ARG H 3 26 ? 89.383  6.066  2.294   1.00 121.18 ? 48   ARG H C   1 
ATOM   4387 O O   . ARG H 3 26 ? 89.081  6.085  3.486   1.00 122.32 ? 48   ARG H O   1 
ATOM   4388 C CB  . ARG H 3 26 ? 91.744  6.298  3.033   1.00 112.63 ? 48   ARG H CB  1 
ATOM   4389 C CG  . ARG H 3 26 ? 93.002  5.481  2.979   1.00 110.97 ? 48   ARG H CG  1 
ATOM   4390 C CD  . ARG H 3 26 ? 93.341  4.916  4.346   1.00 113.05 ? 48   ARG H CD  1 
ATOM   4391 N NE  . ARG H 3 26 ? 94.279  3.802  4.238   1.00 115.59 ? 48   ARG H NE  1 
ATOM   4392 C CZ  . ARG H 3 26 ? 94.010  2.661  3.614   1.00 114.50 ? 48   ARG H CZ  1 
ATOM   4393 N NH1 . ARG H 3 26 ? 92.828  2.479  3.046   1.00 118.06 ? 48   ARG H NH1 1 
ATOM   4394 N NH2 . ARG H 3 26 ? 94.929  1.709  3.546   1.00 107.49 ? 48   ARG H NH2 1 
ATOM   4395 N N   . LEU H 3 27 ? 88.496  6.069  1.307   1.00 127.41 ? 49   LEU H N   1 
ATOM   4396 C CA  . LEU H 3 27 ? 87.060  6.115  1.530   1.00 132.90 ? 49   LEU H CA  1 
ATOM   4397 C C   . LEU H 3 27 ? 86.536  5.289  2.711   1.00 140.31 ? 49   LEU H C   1 
ATOM   4398 O O   . LEU H 3 27 ? 86.429  4.061  2.644   1.00 140.51 ? 49   LEU H O   1 
ATOM   4399 C CB  . LEU H 3 27 ? 86.328  5.718  0.233   1.00 125.65 ? 49   LEU H CB  1 
ATOM   4400 C CG  . LEU H 3 27 ? 86.125  4.268  -0.255  1.00 111.79 ? 49   LEU H CG  1 
ATOM   4401 C CD1 . LEU H 3 27 ? 87.301  3.380  0.174   1.00 104.43 ? 49   LEU H CD1 1 
ATOM   4402 C CD2 . LEU H 3 27 ? 84.799  3.719  0.286   1.00 97.52  ? 49   LEU H CD2 1 
ATOM   4403 N N   . GLY H 3 28 ? 86.234  5.978  3.807   1.00 144.04 ? 50   GLY H N   1 
ATOM   4404 C CA  . GLY H 3 28 ? 85.673  5.309  4.965   1.00 147.91 ? 50   GLY H CA  1 
ATOM   4405 C C   . GLY H 3 28 ? 84.195  5.493  4.717   1.00 150.97 ? 50   GLY H C   1 
ATOM   4406 O O   . GLY H 3 28 ? 83.392  4.560  4.796   1.00 152.03 ? 50   GLY H O   1 
ATOM   4407 N N   . SER H 3 29 ? 83.861  6.737  4.392   1.00 152.32 ? 51   SER H N   1 
ATOM   4408 C CA  . SER H 3 29 ? 82.509  7.152  4.060   1.00 150.95 ? 51   SER H CA  1 
ATOM   4409 C C   . SER H 3 29 ? 82.548  7.382  2.550   1.00 150.01 ? 51   SER H C   1 
ATOM   4410 O O   . SER H 3 29 ? 83.489  6.943  1.886   1.00 149.35 ? 51   SER H O   1 
ATOM   4411 C CB  . SER H 3 29 ? 82.171  8.447  4.800   1.00 149.17 ? 51   SER H CB  1 
ATOM   4412 O OG  . SER H 3 29 ? 83.251  9.362  4.733   1.00 146.59 ? 51   SER H OG  1 
ATOM   4413 N N   . ASN H 3 30 ? 81.547  8.057  1.997   1.00 148.48 ? 52   ASN H N   1 
ATOM   4414 C CA  . ASN H 3 30 ? 81.546  8.306  0.560   1.00 144.89 ? 52   ASN H CA  1 
ATOM   4415 C C   . ASN H 3 30 ? 81.268  9.766  0.228   1.00 131.93 ? 52   ASN H C   1 
ATOM   4416 O O   . ASN H 3 30 ? 80.122  10.192 0.075   1.00 127.15 ? 52   ASN H O   1 
ATOM   4417 C CB  . ASN H 3 30 ? 80.538  7.393  -0.143  1.00 160.37 ? 52   ASN H CB  1 
ATOM   4418 C CG  . ASN H 3 30 ? 81.116  6.737  -1.388  1.00 172.03 ? 52   ASN H CG  1 
ATOM   4419 O OD1 . ASN H 3 30 ? 81.384  7.405  -2.389  1.00 178.35 ? 52   ASN H OD1 1 
ATOM   4420 N ND2 . ASN H 3 30 ? 81.324  5.423  -1.324  1.00 174.77 ? 52   ASN H ND2 1 
ATOM   4421 N N   . LEU H 3 31 ? 82.350  10.524 0.119   1.00 121.74 ? 53   LEU H N   1 
ATOM   4422 C CA  . LEU H 3 31 ? 82.283  11.938 -0.189  1.00 112.24 ? 53   LEU H CA  1 
ATOM   4423 C C   . LEU H 3 31 ? 81.485  12.257 -1.435  1.00 111.24 ? 53   LEU H C   1 
ATOM   4424 O O   . LEU H 3 31 ? 81.400  11.467 -2.380  1.00 111.11 ? 53   LEU H O   1 
ATOM   4425 C CB  . LEU H 3 31 ? 83.691  12.515 -0.350  1.00 97.43  ? 53   LEU H CB  1 
ATOM   4426 C CG  . LEU H 3 31 ? 84.427  13.042 0.881   1.00 83.76  ? 53   LEU H CG  1 
ATOM   4427 C CD1 . LEU H 3 31 ? 84.415  12.011 2.009   1.00 82.36  ? 53   LEU H CD1 1 
ATOM   4428 C CD2 . LEU H 3 31 ? 85.847  13.405 0.468   1.00 68.48  ? 53   LEU H CD2 1 
ATOM   4429 N N   . SER H 3 32 ? 80.903  13.444 -1.415  1.00 106.70 ? 54   SER H N   1 
ATOM   4430 C CA  . SER H 3 32 ? 80.124  13.930 -2.524  1.00 98.23  ? 54   SER H CA  1 
ATOM   4431 C C   . SER H 3 32 ? 80.833  15.190 -2.953  1.00 92.55  ? 54   SER H C   1 
ATOM   4432 O O   . SER H 3 32 ? 81.389  15.910 -2.126  1.00 88.34  ? 54   SER H O   1 
ATOM   4433 C CB  . SER H 3 32 ? 78.708  14.256 -2.064  1.00 99.29  ? 54   SER H CB  1 
ATOM   4434 O OG  . SER H 3 32 ? 77.935  14.765 -3.128  1.00 101.96 ? 54   SER H OG  1 
ATOM   4435 N N   . LEU H 3 33 ? 80.841  15.448 -4.247  1.00 89.64  ? 55   LEU H N   1 
ATOM   4436 C CA  . LEU H 3 33 ? 81.474  16.653 -4.733  1.00 91.11  ? 55   LEU H CA  1 
ATOM   4437 C C   . LEU H 3 33 ? 80.571  17.396 -5.727  1.00 93.17  ? 55   LEU H C   1 
ATOM   4438 O O   . LEU H 3 33 ? 79.898  16.774 -6.553  1.00 95.46  ? 55   LEU H O   1 
ATOM   4439 C CB  . LEU H 3 33 ? 82.808  16.302 -5.370  1.00 82.98  ? 55   LEU H CB  1 
ATOM   4440 C CG  . LEU H 3 33 ? 83.514  17.508 -5.977  1.00 88.72  ? 55   LEU H CG  1 
ATOM   4441 C CD1 . LEU H 3 33 ? 83.610  18.663 -4.971  1.00 87.98  ? 55   LEU H CD1 1 
ATOM   4442 C CD2 . LEU H 3 33 ? 84.880  17.061 -6.427  1.00 91.24  ? 55   LEU H CD2 1 
ATOM   4443 N N   . SER H 3 34 ? 80.545  18.725 -5.635  1.00 87.46  ? 56   SER H N   1 
ATOM   4444 C CA  . SER H 3 34 ? 79.720  19.525 -6.530  1.00 72.82  ? 56   SER H CA  1 
ATOM   4445 C C   . SER H 3 34 ? 80.343  20.871 -6.889  1.00 66.22  ? 56   SER H C   1 
ATOM   4446 O O   . SER H 3 34 ? 81.131  21.448 -6.129  1.00 64.55  ? 56   SER H O   1 
ATOM   4447 C CB  . SER H 3 34 ? 78.338  19.742 -5.912  1.00 67.27  ? 56   SER H CB  1 
ATOM   4448 O OG  . SER H 3 34 ? 78.236  19.084 -4.660  1.00 65.24  ? 56   SER H OG  1 
ATOM   4449 N N   . MET H 3 35 ? 79.983  21.358 -8.069  1.00 65.81  ? 57   MET H N   1 
ATOM   4450 C CA  . MET H 3 35 ? 80.487  22.628 -8.566  1.00 73.11  ? 57   MET H CA  1 
ATOM   4451 C C   . MET H 3 35 ? 79.445  23.704 -8.273  1.00 83.51  ? 57   MET H C   1 
ATOM   4452 O O   . MET H 3 35 ? 78.261  23.510 -8.551  1.00 83.87  ? 57   MET H O   1 
ATOM   4453 C CB  . MET H 3 35 ? 80.734  22.530 -10.072 1.00 62.25  ? 57   MET H CB  1 
ATOM   4454 C CG  . MET H 3 35 ? 81.128  23.840 -10.712 1.00 72.29  ? 57   MET H CG  1 
ATOM   4455 S SD  . MET H 3 35 ? 82.650  24.465 -10.031 1.00 71.05  ? 57   MET H SD  1 
ATOM   4456 C CE  . MET H 3 35 ? 83.814  23.617 -11.085 1.00 57.45  ? 57   MET H CE  1 
ATOM   4457 N N   . ALA H 3 36 ? 79.883  24.839 -7.725  1.00 89.51  ? 58   ALA H N   1 
ATOM   4458 C CA  . ALA H 3 36 ? 78.958  25.925 -7.382  1.00 89.24  ? 58   ALA H CA  1 
ATOM   4459 C C   . ALA H 3 36 ? 79.255  27.279 -8.044  1.00 84.98  ? 58   ALA H C   1 
ATOM   4460 O O   . ALA H 3 36 ? 80.409  27.604 -8.314  1.00 81.41  ? 58   ALA H O   1 
ATOM   4461 C CB  . ALA H 3 36 ? 78.919  26.091 -5.861  1.00 88.21  ? 58   ALA H CB  1 
ATOM   4462 N N   . ARG H 3 37 ? 78.200  28.056 -8.308  1.00 83.63  ? 59   ARG H N   1 
ATOM   4463 C CA  . ARG H 3 37 ? 78.328  29.386 -8.915  1.00 82.21  ? 59   ARG H CA  1 
ATOM   4464 C C   . ARG H 3 37 ? 77.234  30.352 -8.437  1.00 85.43  ? 59   ARG H C   1 
ATOM   4465 O O   . ARG H 3 37 ? 76.086  29.953 -8.206  1.00 77.98  ? 59   ARG H O   1 
ATOM   4466 C CB  . ARG H 3 37 ? 78.272  29.310 -10.443 1.00 74.39  ? 59   ARG H CB  1 
ATOM   4467 C CG  . ARG H 3 37 ? 79.081  28.194 -11.050 1.00 87.06  ? 59   ARG H CG  1 
ATOM   4468 C CD  . ARG H 3 37 ? 78.230  27.432 -12.048 1.00 96.94  ? 59   ARG H CD  1 
ATOM   4469 N NE  . ARG H 3 37 ? 78.882  26.216 -12.523 1.00 100.51 ? 59   ARG H NE  1 
ATOM   4470 C CZ  . ARG H 3 37 ? 80.042  26.206 -13.167 1.00 106.73 ? 59   ARG H CZ  1 
ATOM   4471 N NH1 . ARG H 3 37 ? 80.671  27.352 -13.404 1.00 107.56 ? 59   ARG H NH1 1 
ATOM   4472 N NH2 . ARG H 3 37 ? 80.565  25.057 -13.585 1.00 108.52 ? 59   ARG H NH2 1 
ATOM   4473 N N   . ARG H 3 38 ? 77.600  31.626 -8.299  1.00 87.69  ? 60   ARG H N   1 
ATOM   4474 C CA  . ARG H 3 38 ? 76.673  32.675 -7.864  1.00 87.23  ? 60   ARG H CA  1 
ATOM   4475 C C   . ARG H 3 38 ? 75.520  32.924 -8.828  1.00 94.54  ? 60   ARG H C   1 
ATOM   4476 O O   . ARG H 3 38 ? 75.698  33.000 -10.047 1.00 99.39  ? 60   ARG H O   1 
ATOM   4477 C CB  . ARG H 3 38 ? 77.413  33.996 -7.682  1.00 71.58  ? 60   ARG H CB  1 
ATOM   4478 C CG  . ARG H 3 38 ? 78.235  34.063 -6.439  1.00 69.48  ? 60   ARG H CG  1 
ATOM   4479 C CD  . ARG H 3 38 ? 77.521  34.879 -5.393  1.00 76.63  ? 60   ARG H CD  1 
ATOM   4480 N NE  . ARG H 3 38 ? 78.284  34.985 -4.147  1.00 89.14  ? 60   ARG H NE  1 
ATOM   4481 C CZ  . ARG H 3 38 ? 79.529  35.450 -4.051  1.00 88.45  ? 60   ARG H CZ  1 
ATOM   4482 N NH1 . ARG H 3 38 ? 80.190  35.861 -5.130  1.00 87.67  ? 60   ARG H NH1 1 
ATOM   4483 N NH2 . ARG H 3 38 ? 80.111  35.515 -2.862  1.00 84.20  ? 60   ARG H NH2 1 
ATOM   4484 N N   . ASN H 3 39 ? 74.333  33.075 -8.268  1.00 97.75  ? 61   ASN H N   1 
ATOM   4485 C CA  . ASN H 3 39 ? 73.153  33.340 -9.064  1.00 100.81 ? 61   ASN H CA  1 
ATOM   4486 C C   . ASN H 3 39 ? 73.065  34.862 -9.206  1.00 101.40 ? 61   ASN H C   1 
ATOM   4487 O O   . ASN H 3 39 ? 72.349  35.533 -8.460  1.00 103.43 ? 61   ASN H O   1 
ATOM   4488 C CB  . ASN H 3 39 ? 71.937  32.758 -8.346  1.00 102.62 ? 61   ASN H CB  1 
ATOM   4489 C CG  . ASN H 3 39 ? 70.650  33.056 -9.053  1.00 105.11 ? 61   ASN H CG  1 
ATOM   4490 O OD1 . ASN H 3 39 ? 70.568  32.993 -10.278 1.00 114.44 ? 61   ASN H OD1 1 
ATOM   4491 N ND2 . ASN H 3 39 ? 69.623  33.372 -8.282  1.00 100.91 ? 61   ASN H ND2 1 
ATOM   4492 N N   . LEU H 3 40 ? 73.817  35.398 -10.164 1.00 99.92  ? 62   LEU H N   1 
ATOM   4493 C CA  . LEU H 3 40 ? 73.867  36.841 -10.403 1.00 99.79  ? 62   LEU H CA  1 
ATOM   4494 C C   . LEU H 3 40 ? 72.853  37.370 -11.410 1.00 103.42 ? 62   LEU H C   1 
ATOM   4495 O O   . LEU H 3 40 ? 72.856  38.558 -11.725 1.00 100.94 ? 62   LEU H O   1 
ATOM   4496 C CB  . LEU H 3 40 ? 75.259  37.241 -10.886 1.00 92.98  ? 62   LEU H CB  1 
ATOM   4497 C CG  . LEU H 3 40 ? 76.460  36.988 -9.986  1.00 83.86  ? 62   LEU H CG  1 
ATOM   4498 C CD1 . LEU H 3 40 ? 77.713  37.279 -10.779 1.00 80.09  ? 62   LEU H CD1 1 
ATOM   4499 C CD2 . LEU H 3 40 ? 76.389  37.868 -8.752  1.00 76.99  ? 62   LEU H CD2 1 
ATOM   4500 N N   . ASP H 3 41 ? 72.001  36.496 -11.929 1.00 106.83 ? 63   ASP H N   1 
ATOM   4501 C CA  . ASP H 3 41 ? 71.011  36.917 -12.911 1.00 113.31 ? 63   ASP H CA  1 
ATOM   4502 C C   . ASP H 3 41 ? 69.617  36.723 -12.355 1.00 112.10 ? 63   ASP H C   1 
ATOM   4503 O O   . ASP H 3 41 ? 68.621  36.899 -13.056 1.00 122.92 ? 63   ASP H O   1 
ATOM   4504 C CB  . ASP H 3 41 ? 71.166  36.109 -14.205 1.00 123.50 ? 63   ASP H CB  1 
ATOM   4505 C CG  . ASP H 3 41 ? 71.099  34.608 -13.970 1.00 133.93 ? 63   ASP H CG  1 
ATOM   4506 O OD1 . ASP H 3 41 ? 70.039  34.105 -13.538 1.00 136.66 ? 63   ASP H OD1 1 
ATOM   4507 O OD2 . ASP H 3 41 ? 72.118  33.930 -14.219 1.00 141.29 ? 63   ASP H OD2 1 
ATOM   4508 N N   . SER H 3 42 ? 69.551  36.376 -11.081 1.00 102.47 ? 64   SER H N   1 
ATOM   4509 C CA  . SER H 3 42 ? 68.273  36.131 -10.455 1.00 94.57  ? 64   SER H CA  1 
ATOM   4510 C C   . SER H 3 42 ? 68.327  36.591 -9.013  1.00 93.69  ? 64   SER H C   1 
ATOM   4511 O O   . SER H 3 42 ? 69.350  37.109 -8.554  1.00 88.80  ? 64   SER H O   1 
ATOM   4512 C CB  . SER H 3 42 ? 67.970  34.628 -10.532 1.00 90.28  ? 64   SER H CB  1 
ATOM   4513 O OG  . SER H 3 42 ? 66.865  34.250 -9.728  1.00 88.62  ? 64   SER H OG  1 
ATOM   4514 N N   . LEU H 3 43 ? 67.205  36.409 -8.318  1.00 91.32  ? 65   LEU H N   1 
ATOM   4515 C CA  . LEU H 3 43 ? 67.064  36.745 -6.905  1.00 76.60  ? 65   LEU H CA  1 
ATOM   4516 C C   . LEU H 3 43 ? 66.114  35.705 -6.311  1.00 66.82  ? 65   LEU H C   1 
ATOM   4517 O O   . LEU H 3 43 ? 65.928  35.627 -5.094  1.00 64.85  ? 65   LEU H O   1 
ATOM   4518 C CB  . LEU H 3 43 ? 66.512  38.174 -6.720  1.00 74.84  ? 65   LEU H CB  1 
ATOM   4519 C CG  . LEU H 3 43 ? 65.131  38.659 -7.187  1.00 64.28  ? 65   LEU H CG  1 
ATOM   4520 C CD1 . LEU H 3 43 ? 64.924  40.096 -6.705  1.00 51.92  ? 65   LEU H CD1 1 
ATOM   4521 C CD2 . LEU H 3 43 ? 65.027  38.604 -8.701  1.00 62.57  ? 65   LEU H CD2 1 
ATOM   4522 N N   . GLU H 3 44 ? 65.539  34.895 -7.202  1.00 54.62  ? 66   GLU H N   1 
ATOM   4523 C CA  . GLU H 3 44 ? 64.608  33.828 -6.844  1.00 53.03  ? 66   GLU H CA  1 
ATOM   4524 C C   . GLU H 3 44 ? 65.265  32.466 -6.958  1.00 54.73  ? 66   GLU H C   1 
ATOM   4525 O O   . GLU H 3 44 ? 64.818  31.504 -6.324  1.00 55.90  ? 66   GLU H O   1 
ATOM   4526 C CB  . GLU H 3 44 ? 63.395  33.851 -7.758  1.00 70.57  ? 66   GLU H CB  1 
ATOM   4527 C CG  . GLU H 3 44 ? 63.742  34.123 -9.201  1.00 89.12  ? 66   GLU H CG  1 
ATOM   4528 C CD  . GLU H 3 44 ? 64.105  35.576 -9.420  1.00 101.84 ? 66   GLU H CD  1 
ATOM   4529 O OE1 . GLU H 3 44 ? 63.265  36.441 -9.096  1.00 107.17 ? 66   GLU H OE1 1 
ATOM   4530 O OE2 . GLU H 3 44 ? 65.219  35.858 -9.908  1.00 106.49 ? 66   GLU H OE2 1 
ATOM   4531 N N   . ALA H 3 45 ? 66.307  32.389 -7.790  1.00 59.22  ? 67   ALA H N   1 
ATOM   4532 C CA  . ALA H 3 45 ? 67.074  31.157 -8.004  1.00 60.87  ? 67   ALA H CA  1 
ATOM   4533 C C   . ALA H 3 45 ? 67.983  30.919 -6.803  1.00 64.12  ? 67   ALA H C   1 
ATOM   4534 O O   . ALA H 3 45 ? 68.463  31.873 -6.196  1.00 74.68  ? 67   ALA H O   1 
ATOM   4535 C CB  . ALA H 3 45 ? 67.920  31.283 -9.265  1.00 50.81  ? 67   ALA H CB  1 
ATOM   4536 N N   . ARG H 3 46 ? 68.225  29.657 -6.460  1.00 60.98  ? 68   ARG H N   1 
ATOM   4537 C CA  . ARG H 3 46 ? 69.086  29.339 -5.320  1.00 55.07  ? 68   ARG H CA  1 
ATOM   4538 C C   . ARG H 3 46 ? 70.315  30.242 -5.312  1.00 48.20  ? 68   ARG H C   1 
ATOM   4539 O O   . ARG H 3 46 ? 70.938  30.467 -6.358  1.00 41.29  ? 68   ARG H O   1 
ATOM   4540 C CB  . ARG H 3 46 ? 69.526  27.883 -5.379  1.00 64.26  ? 68   ARG H CB  1 
ATOM   4541 C CG  . ARG H 3 46 ? 68.429  26.855 -5.109  1.00 77.73  ? 68   ARG H CG  1 
ATOM   4542 C CD  . ARG H 3 46 ? 69.056  25.469 -5.123  1.00 108.28 ? 68   ARG H CD  1 
ATOM   4543 N NE  . ARG H 3 46 ? 70.293  25.466 -4.338  1.00 130.93 ? 68   ARG H NE  1 
ATOM   4544 C CZ  . ARG H 3 46 ? 71.196  24.490 -4.346  1.00 135.82 ? 68   ARG H CZ  1 
ATOM   4545 N NH1 . ARG H 3 46 ? 71.011  23.419 -5.104  1.00 148.50 ? 68   ARG H NH1 1 
ATOM   4546 N NH2 . ARG H 3 46 ? 72.285  24.584 -3.593  1.00 122.65 ? 68   ARG H NH2 1 
ATOM   4547 N N   . ALA H 3 47 ? 70.654  30.760 -4.130  1.00 54.49  ? 69   ALA H N   1 
ATOM   4548 C CA  . ALA H 3 47 ? 71.794  31.673 -3.973  1.00 71.05  ? 69   ALA H CA  1 
ATOM   4549 C C   . ALA H 3 47 ? 73.003  31.296 -4.846  1.00 82.52  ? 69   ALA H C   1 
ATOM   4550 O O   . ALA H 3 47 ? 73.601  32.153 -5.508  1.00 86.79  ? 69   ALA H O   1 
ATOM   4551 C CB  . ALA H 3 47 ? 72.205  31.757 -2.481  1.00 63.86  ? 69   ALA H CB  1 
ATOM   4552 N N   . PHE H 3 48 ? 73.350  30.011 -4.840  1.00 89.97  ? 70   PHE H N   1 
ATOM   4553 C CA  . PHE H 3 48 ? 74.471  29.480 -5.621  1.00 81.09  ? 70   PHE H CA  1 
ATOM   4554 C C   . PHE H 3 48 ? 73.954  28.292 -6.448  1.00 82.79  ? 70   PHE H C   1 
ATOM   4555 O O   . PHE H 3 48 ? 73.021  27.598 -6.030  1.00 72.90  ? 70   PHE H O   1 
ATOM   4556 C CB  . PHE H 3 48 ? 75.602  29.014 -4.679  1.00 66.98  ? 70   PHE H CB  1 
ATOM   4557 C CG  . PHE H 3 48 ? 76.339  30.139 -3.993  1.00 60.12  ? 70   PHE H CG  1 
ATOM   4558 C CD1 . PHE H 3 48 ? 75.672  31.022 -3.143  1.00 74.92  ? 70   PHE H CD1 1 
ATOM   4559 C CD2 . PHE H 3 48 ? 77.701  30.323 -4.211  1.00 57.72  ? 70   PHE H CD2 1 
ATOM   4560 C CE1 . PHE H 3 48 ? 76.353  32.077 -2.523  1.00 79.49  ? 70   PHE H CE1 1 
ATOM   4561 C CE2 . PHE H 3 48 ? 78.394  31.372 -3.599  1.00 69.32  ? 70   PHE H CE2 1 
ATOM   4562 C CZ  . PHE H 3 48 ? 77.721  32.251 -2.754  1.00 72.65  ? 70   PHE H CZ  1 
ATOM   4563 N N   . GLN H 3 49 ? 74.555  28.055 -7.611  1.00 88.92  ? 71   GLN H N   1 
ATOM   4564 C CA  . GLN H 3 49 ? 74.142  26.950 -8.478  1.00 97.98  ? 71   GLN H CA  1 
ATOM   4565 C C   . GLN H 3 49 ? 75.009  25.694 -8.281  1.00 96.33  ? 71   GLN H C   1 
ATOM   4566 O O   . GLN H 3 49 ? 76.199  25.705 -8.602  1.00 89.03  ? 71   GLN H O   1 
ATOM   4567 C CB  . GLN H 3 49 ? 74.202  27.412 -9.930  1.00 114.94 ? 71   GLN H CB  1 
ATOM   4568 C CG  . GLN H 3 49 ? 73.928  26.333 -10.953 1.00 141.64 ? 71   GLN H CG  1 
ATOM   4569 C CD  . GLN H 3 49 ? 75.102  26.129 -11.891 1.00 162.21 ? 71   GLN H CD  1 
ATOM   4570 O OE1 . GLN H 3 49 ? 76.142  25.595 -11.497 1.00 171.32 ? 71   GLN H OE1 1 
ATOM   4571 N NE2 . GLN H 3 49 ? 74.947  26.565 -13.139 1.00 166.80 ? 71   GLN H NE2 1 
ATOM   4572 N N   . SER H 3 50 ? 74.404  24.618 -7.764  1.00 100.44 ? 72   SER H N   1 
ATOM   4573 C CA  . SER H 3 50 ? 75.119  23.353 -7.500  1.00 100.81 ? 72   SER H CA  1 
ATOM   4574 C C   . SER H 3 50 ? 74.991  22.282 -8.582  1.00 95.89  ? 72   SER H C   1 
ATOM   4575 O O   . SER H 3 50 ? 73.932  21.682 -8.794  1.00 85.06  ? 72   SER H O   1 
ATOM   4576 C CB  . SER H 3 50 ? 74.687  22.740 -6.153  1.00 101.29 ? 72   SER H CB  1 
ATOM   4577 O OG  . SER H 3 50 ? 75.377  21.521 -5.881  1.00 90.22  ? 72   SER H OG  1 
ATOM   4578 N N   . THR H 3 51 ? 76.113  22.035 -9.238  1.00 97.58  ? 73   THR H N   1 
ATOM   4579 C CA  . THR H 3 51 ? 76.197  21.058 -10.301 1.00 96.96  ? 73   THR H CA  1 
ATOM   4580 C C   . THR H 3 51 ? 76.979  19.864 -9.786  1.00 100.50 ? 73   THR H C   1 
ATOM   4581 O O   . THR H 3 51 ? 78.205  19.836 -9.909  1.00 103.44 ? 73   THR H O   1 
ATOM   4582 C CB  . THR H 3 51 ? 76.977  21.625 -11.490 1.00 95.09  ? 73   THR H CB  1 
ATOM   4583 O OG1 . THR H 3 51 ? 76.623  22.999 -11.690 1.00 80.89  ? 73   THR H OG1 1 
ATOM   4584 C CG2 . THR H 3 51 ? 76.683  20.827 -12.739 1.00 98.72  ? 73   THR H CG2 1 
ATOM   4585 N N   . PRO H 3 52 ? 76.297  18.871 -9.191  1.00 103.16 ? 74   PRO H N   1 
ATOM   4586 C CA  . PRO H 3 52 ? 77.049  17.714 -8.697  1.00 105.26 ? 74   PRO H CA  1 
ATOM   4587 C C   . PRO H 3 52 ? 78.101  17.317 -9.727  1.00 106.09 ? 74   PRO H C   1 
ATOM   4588 O O   . PRO H 3 52 ? 77.848  17.368 -10.931 1.00 103.69 ? 74   PRO H O   1 
ATOM   4589 C CB  . PRO H 3 52 ? 75.965  16.661 -8.507  1.00 104.34 ? 74   PRO H CB  1 
ATOM   4590 C CG  . PRO H 3 52 ? 74.824  17.492 -8.001  1.00 107.26 ? 74   PRO H CG  1 
ATOM   4591 C CD  . PRO H 3 52 ? 74.855  18.707 -8.934  1.00 105.61 ? 74   PRO H CD  1 
ATOM   4592 N N   . ILE H 3 53 ? 79.282  16.943 -9.248  1.00 108.20 ? 75   ILE H N   1 
ATOM   4593 C CA  . ILE H 3 53 ? 80.380  16.576 -10.132 1.00 108.25 ? 75   ILE H CA  1 
ATOM   4594 C C   . ILE H 3 53 ? 80.684  15.077 -10.143 1.00 105.88 ? 75   ILE H C   1 
ATOM   4595 O O   . ILE H 3 53 ? 80.737  14.430 -9.099  1.00 101.57 ? 75   ILE H O   1 
ATOM   4596 C CB  . ILE H 3 53 ? 81.648  17.371 -9.754  1.00 110.19 ? 75   ILE H CB  1 
ATOM   4597 C CG1 . ILE H 3 53 ? 81.326  18.876 -9.752  1.00 114.14 ? 75   ILE H CG1 1 
ATOM   4598 C CG2 . ILE H 3 53 ? 82.764  17.054 -10.735 1.00 101.89 ? 75   ILE H CG2 1 
ATOM   4599 C CD1 . ILE H 3 53 ? 82.416  19.773 -9.167  1.00 109.85 ? 75   ILE H CD1 1 
ATOM   4600 N N   . VAL H 3 54 ? 80.883  14.544 -11.344 1.00 108.42 ? 76   VAL H N   1 
ATOM   4601 C CA  . VAL H 3 54 ? 81.162  13.128 -11.550 1.00 114.97 ? 76   VAL H CA  1 
ATOM   4602 C C   . VAL H 3 54 ? 82.632  12.748 -11.372 1.00 120.01 ? 76   VAL H C   1 
ATOM   4603 O O   . VAL H 3 54 ? 83.481  13.093 -12.198 1.00 120.74 ? 76   VAL H O   1 
ATOM   4604 C CB  . VAL H 3 54 ? 80.698  12.699 -12.959 1.00 114.99 ? 76   VAL H CB  1 
ATOM   4605 C CG1 . VAL H 3 54 ? 81.202  13.696 -13.992 1.00 111.47 ? 76   VAL H CG1 1 
ATOM   4606 C CG2 . VAL H 3 54 ? 81.199  11.300 -13.277 1.00 113.26 ? 76   VAL H CG2 1 
ATOM   4607 N N   . VAL H 3 55 ? 82.926  12.032 -10.291 1.00 122.08 ? 77   VAL H N   1 
ATOM   4608 C CA  . VAL H 3 55 ? 84.292  11.593 -10.010 1.00 121.61 ? 77   VAL H CA  1 
ATOM   4609 C C   . VAL H 3 55 ? 84.462  10.209 -10.630 1.00 124.59 ? 77   VAL H C   1 
ATOM   4610 O O   . VAL H 3 55 ? 83.799  9.254  -10.218 1.00 124.36 ? 77   VAL H O   1 
ATOM   4611 C CB  . VAL H 3 55 ? 84.556  11.485 -8.484  1.00 116.60 ? 77   VAL H CB  1 
ATOM   4612 C CG1 . VAL H 3 55 ? 86.031  11.272 -8.227  1.00 113.89 ? 77   VAL H CG1 1 
ATOM   4613 C CG2 . VAL H 3 55 ? 84.077  12.730 -7.776  1.00 116.51 ? 77   VAL H CG2 1 
ATOM   4614 N N   . GLN H 3 56 ? 85.345  10.094 -11.617 1.00 124.92 ? 78   GLN H N   1 
ATOM   4615 C CA  . GLN H 3 56 ? 85.550  8.809  -12.265 1.00 126.65 ? 78   GLN H CA  1 
ATOM   4616 C C   . GLN H 3 56 ? 86.700  8.028  -11.631 1.00 124.94 ? 78   GLN H C   1 
ATOM   4617 O O   . GLN H 3 56 ? 87.466  7.351  -12.316 1.00 131.44 ? 78   GLN H O   1 
ATOM   4618 C CB  . GLN H 3 56 ? 85.802  9.013  -13.759 1.00 133.47 ? 78   GLN H CB  1 
ATOM   4619 C CG  . GLN H 3 56 ? 85.515  7.771  -14.590 1.00 140.47 ? 78   GLN H CG  1 
ATOM   4620 C CD  . GLN H 3 56 ? 84.127  7.204  -14.323 1.00 145.46 ? 78   GLN H CD  1 
ATOM   4621 O OE1 . GLN H 3 56 ? 83.126  7.905  -14.456 1.00 148.59 ? 78   GLN H OE1 1 
ATOM   4622 N NE2 . GLN H 3 56 ? 84.063  5.928  -13.946 1.00 145.30 ? 78   GLN H NE2 1 
ATOM   4623 N N   . MET H 3 57 ? 86.804  8.125  -10.312 1.00 119.13 ? 79   MET H N   1 
ATOM   4624 C CA  . MET H 3 57 ? 87.841  7.444  -9.550  1.00 113.42 ? 79   MET H CA  1 
ATOM   4625 C C   . MET H 3 57 ? 87.927  5.946  -9.839  1.00 119.27 ? 79   MET H C   1 
ATOM   4626 O O   . MET H 3 57 ? 86.924  5.293  -10.150 1.00 124.68 ? 79   MET H O   1 
ATOM   4627 C CB  . MET H 3 57 ? 87.577  7.627  -8.070  1.00 102.13 ? 79   MET H CB  1 
ATOM   4628 C CG  . MET H 3 57 ? 86.205  7.143  -7.698  1.00 94.61  ? 79   MET H CG  1 
ATOM   4629 S SD  . MET H 3 57 ? 86.029  6.866  -5.953  1.00 102.57 ? 79   MET H SD  1 
ATOM   4630 C CE  . MET H 3 57 ? 85.819  5.059  -5.919  1.00 111.63 ? 79   MET H CE  1 
ATOM   4631 N N   . THR H 3 58 ? 89.139  5.416  -9.694  1.00 119.77 ? 80   THR H N   1 
ATOM   4632 C CA  . THR H 3 58 ? 89.437  4.005  -9.927  1.00 113.22 ? 80   THR H CA  1 
ATOM   4633 C C   . THR H 3 58 ? 89.859  3.325  -8.617  1.00 114.79 ? 80   THR H C   1 
ATOM   4634 O O   . THR H 3 58 ? 90.520  3.941  -7.778  1.00 113.29 ? 80   THR H O   1 
ATOM   4635 C CB  . THR H 3 58 ? 90.597  3.858  -10.940 1.00 103.15 ? 80   THR H CB  1 
ATOM   4636 O OG1 . THR H 3 58 ? 90.306  4.616  -12.122 1.00 86.09  ? 80   THR H OG1 1 
ATOM   4637 C CG2 . THR H 3 58 ? 90.797  2.400  -11.309 1.00 101.71 ? 80   THR H CG2 1 
ATOM   4638 N N   . LYS H 3 59 ? 89.475  2.060  -8.442  1.00 114.99 ? 81   LYS H N   1 
ATOM   4639 C CA  . LYS H 3 59 ? 89.845  1.305  -7.242  1.00 115.31 ? 81   LYS H CA  1 
ATOM   4640 C C   . LYS H 3 59 ? 91.135  0.536  -7.542  1.00 118.65 ? 81   LYS H C   1 
ATOM   4641 O O   . LYS H 3 59 ? 91.278  -0.047 -8.621  1.00 123.45 ? 81   LYS H O   1 
ATOM   4642 C CB  . LYS H 3 59 ? 88.728  0.334  -6.862  1.00 106.31 ? 81   LYS H CB  1 
ATOM   4643 C CG  . LYS H 3 59 ? 88.934  -0.372 -5.536  1.00 109.78 ? 81   LYS H CG  1 
ATOM   4644 C CD  . LYS H 3 59 ? 89.999  -1.447 -5.604  1.00 118.93 ? 81   LYS H CD  1 
ATOM   4645 C CE  . LYS H 3 59 ? 90.054  -2.224 -4.297  1.00 126.39 ? 81   LYS H CE  1 
ATOM   4646 N NZ  . LYS H 3 59 ? 90.947  -3.416 -4.373  1.00 127.06 ? 81   LYS H NZ  1 
ATOM   4647 N N   . LEU H 3 60 ? 92.069  0.525  -6.592  1.00 113.08 ? 82   LEU H N   1 
ATOM   4648 C CA  . LEU H 3 60 ? 93.343  -0.147 -6.816  1.00 104.32 ? 82   LEU H CA  1 
ATOM   4649 C C   . LEU H 3 60 ? 93.554  -1.503 -6.188  1.00 106.32 ? 82   LEU H C   1 
ATOM   4650 O O   . LEU H 3 60 ? 93.069  -1.783 -5.091  1.00 106.91 ? 82   LEU H O   1 
ATOM   4651 C CB  . LEU H 3 60 ? 94.504  0.744  -6.389  1.00 89.79  ? 82   LEU H CB  1 
ATOM   4652 C CG  . LEU H 3 60 ? 94.797  1.939  -7.286  1.00 79.83  ? 82   LEU H CG  1 
ATOM   4653 C CD1 . LEU H 3 60 ? 96.183  2.429  -6.950  1.00 66.86  ? 82   LEU H CD1 1 
ATOM   4654 C CD2 . LEU H 3 60 ? 94.716  1.557  -8.765  1.00 72.09  ? 82   LEU H CD2 1 
ATOM   4655 N N   . ALA H 3 61 ? 94.314  -2.330 -6.905  1.00 109.23 ? 83   ALA H N   1 
ATOM   4656 C CA  . ALA H 3 61 ? 94.662  -3.674 -6.468  1.00 109.11 ? 83   ALA H CA  1 
ATOM   4657 C C   . ALA H 3 61 ? 96.130  -3.683 -6.038  1.00 106.15 ? 83   ALA H C   1 
ATOM   4658 O O   . ALA H 3 61 ? 96.451  -4.102 -4.925  1.00 107.67 ? 83   ALA H O   1 
ATOM   4659 C CB  . ALA H 3 61 ? 94.436  -4.668 -7.601  1.00 105.46 ? 83   ALA H CB  1 
ATOM   4660 N N   . THR H 3 62 ? 97.012  -3.203 -6.920  1.00 99.48  ? 84   THR H N   1 
ATOM   4661 C CA  . THR H 3 62 ? 98.454  -3.155 -6.647  1.00 89.64  ? 84   THR H CA  1 
ATOM   4662 C C   . THR H 3 62 ? 98.985  -1.737 -6.464  1.00 86.17  ? 84   THR H C   1 
ATOM   4663 O O   . THR H 3 62 ? 98.649  -0.839 -7.232  1.00 83.30  ? 84   THR H O   1 
ATOM   4664 C CB  . THR H 3 62 ? 99.284  -3.851 -7.786  1.00 89.85  ? 84   THR H CB  1 
ATOM   4665 O OG1 . THR H 3 62 ? 100.685 -3.752 -7.494  1.00 100.59 ? 84   THR H OG1 1 
ATOM   4666 C CG2 . THR H 3 62 ? 99.021  -3.207 -9.144  1.00 79.40  ? 84   THR H CG2 1 
ATOM   4667 N N   . THR H 3 63 ? 99.831  -1.554 -5.452  1.00 87.45  ? 85   THR H N   1 
ATOM   4668 C CA  . THR H 3 63 ? 100.431 -0.253 -5.145  1.00 86.42  ? 85   THR H CA  1 
ATOM   4669 C C   . THR H 3 63 ? 101.466 0.154  -6.197  1.00 90.68  ? 85   THR H C   1 
ATOM   4670 O O   . THR H 3 63 ? 102.059 1.228  -6.124  1.00 90.14  ? 85   THR H O   1 
ATOM   4671 C CB  . THR H 3 63 ? 101.121 -0.275 -3.746  1.00 84.06  ? 85   THR H CB  1 
ATOM   4672 O OG1 . THR H 3 63 ? 101.134 1.047  -3.196  1.00 83.43  ? 85   THR H OG1 1 
ATOM   4673 C CG2 . THR H 3 63 ? 102.563 -0.771 -3.850  1.00 81.41  ? 85   THR H CG2 1 
ATOM   4674 N N   . GLU H 3 64 ? 101.681 -0.712 -7.177  1.00 95.89  ? 86   GLU H N   1 
ATOM   4675 C CA  . GLU H 3 64 ? 102.651 -0.440 -8.220  1.00 103.83 ? 86   GLU H CA  1 
ATOM   4676 C C   . GLU H 3 64 ? 102.041 0.453  -9.292  1.00 106.14 ? 86   GLU H C   1 
ATOM   4677 O O   . GLU H 3 64 ? 102.753 1.013  -10.125 1.00 105.42 ? 86   GLU H O   1 
ATOM   4678 C CB  . GLU H 3 64 ? 103.134 -1.758 -8.824  1.00 114.42 ? 86   GLU H CB  1 
ATOM   4679 C CG  . GLU H 3 64 ? 104.303 -1.615 -9.778  1.00 141.36 ? 86   GLU H CG  1 
ATOM   4680 C CD  . GLU H 3 64 ? 104.908 -2.954 -10.167 1.00 159.72 ? 86   GLU H CD  1 
ATOM   4681 O OE1 . GLU H 3 64 ? 104.162 -3.836 -10.646 1.00 165.44 ? 86   GLU H OE1 1 
ATOM   4682 O OE2 . GLU H 3 64 ? 106.135 -3.121 -9.996  1.00 167.43 ? 86   GLU H OE2 1 
ATOM   4683 N N   . GLU H 3 65 ? 100.718 0.590  -9.254  1.00 109.10 ? 87   GLU H N   1 
ATOM   4684 C CA  . GLU H 3 65 ? 99.991  1.419  -10.215 1.00 110.39 ? 87   GLU H CA  1 
ATOM   4685 C C   . GLU H 3 65 ? 100.088 2.892  -9.836  1.00 104.67 ? 87   GLU H C   1 
ATOM   4686 O O   . GLU H 3 65 ? 99.719  3.774  -10.607 1.00 100.12 ? 87   GLU H O   1 
ATOM   4687 C CB  . GLU H 3 65 ? 98.517  1.023  -10.237 1.00 116.00 ? 87   GLU H CB  1 
ATOM   4688 C CG  . GLU H 3 65 ? 98.258  -0.432 -10.559 1.00 120.55 ? 87   GLU H CG  1 
ATOM   4689 C CD  . GLU H 3 65 ? 96.808  -0.812 -10.330 1.00 130.87 ? 87   GLU H CD  1 
ATOM   4690 O OE1 . GLU H 3 65 ? 95.924  -0.156 -10.916 1.00 141.31 ? 87   GLU H OE1 1 
ATOM   4691 O OE2 . GLU H 3 65 ? 96.546  -1.762 -9.563  1.00 130.94 ? 87   GLU H OE2 1 
ATOM   4692 N N   . LEU H 3 66 ? 100.591 3.154  -8.641  1.00 99.78  ? 88   LEU H N   1 
ATOM   4693 C CA  . LEU H 3 66 ? 100.697 4.518  -8.162  1.00 90.59  ? 88   LEU H CA  1 
ATOM   4694 C C   . LEU H 3 66 ? 101.901 5.306  -8.640  1.00 83.07  ? 88   LEU H C   1 
ATOM   4695 O O   . LEU H 3 66 ? 102.904 4.747  -9.069  1.00 77.03  ? 88   LEU H O   1 
ATOM   4696 C CB  . LEU H 3 66 ? 100.675 4.534  -6.629  1.00 84.32  ? 88   LEU H CB  1 
ATOM   4697 C CG  . LEU H 3 66 ? 99.381  4.036  -5.974  1.00 86.61  ? 88   LEU H CG  1 
ATOM   4698 C CD1 . LEU H 3 66 ? 99.503  4.144  -4.466  1.00 93.83  ? 88   LEU H CD1 1 
ATOM   4699 C CD2 . LEU H 3 66 ? 98.194  4.856  -6.464  1.00 81.88  ? 88   LEU H CD2 1 
ATOM   4700 N N   . PRO H 3 67 ? 101.779 6.640  -8.611  1.00 83.35  ? 89   PRO H N   1 
ATOM   4701 C CA  . PRO H 3 67 ? 102.842 7.558  -9.013  1.00 80.02  ? 89   PRO H CA  1 
ATOM   4702 C C   . PRO H 3 67 ? 103.805 7.600  -7.827  1.00 77.44  ? 89   PRO H C   1 
ATOM   4703 O O   . PRO H 3 67 ? 103.555 6.947  -6.806  1.00 62.92  ? 89   PRO H O   1 
ATOM   4704 C CB  . PRO H 3 67 ? 102.099 8.879  -9.200  1.00 84.36  ? 89   PRO H CB  1 
ATOM   4705 C CG  . PRO H 3 67 ? 100.707 8.437  -9.593  1.00 79.67  ? 89   PRO H CG  1 
ATOM   4706 C CD  . PRO H 3 67 ? 100.475 7.331  -8.615  1.00 81.67  ? 89   PRO H CD  1 
ATOM   4707 N N   . ASP H 3 68 ? 104.887 8.367  -7.948  1.00 86.39  ? 90   ASP H N   1 
ATOM   4708 C CA  . ASP H 3 68 ? 105.873 8.471  -6.872  1.00 97.17  ? 90   ASP H CA  1 
ATOM   4709 C C   . ASP H 3 68 ? 105.548 9.524  -5.813  1.00 96.86  ? 90   ASP H C   1 
ATOM   4710 O O   . ASP H 3 68 ? 106.078 9.473  -4.707  1.00 91.79  ? 90   ASP H O   1 
ATOM   4711 C CB  . ASP H 3 68 ? 107.270 8.729  -7.450  1.00 112.13 ? 90   ASP H CB  1 
ATOM   4712 C CG  . ASP H 3 68 ? 108.001 7.439  -7.823  1.00 134.79 ? 90   ASP H CG  1 
ATOM   4713 O OD1 . ASP H 3 68 ? 107.549 6.714  -8.739  1.00 140.50 ? 90   ASP H OD1 1 
ATOM   4714 O OD2 . ASP H 3 68 ? 109.037 7.147  -7.191  1.00 149.05 ? 90   ASP H OD2 1 
ATOM   4715 N N   . GLU H 3 69 ? 104.686 10.477 -6.154  1.00 103.89 ? 91   GLU H N   1 
ATOM   4716 C CA  . GLU H 3 69 ? 104.269 11.519 -5.217  1.00 97.16  ? 91   GLU H CA  1 
ATOM   4717 C C   . GLU H 3 69 ? 102.815 11.871 -5.446  1.00 87.30  ? 91   GLU H C   1 
ATOM   4718 O O   . GLU H 3 69 ? 102.418 12.219 -6.566  1.00 82.71  ? 91   GLU H O   1 
ATOM   4719 C CB  . GLU H 3 69 ? 105.113 12.778 -5.373  1.00 110.44 ? 91   GLU H CB  1 
ATOM   4720 C CG  . GLU H 3 69 ? 106.301 12.820 -4.449  1.00 126.64 ? 91   GLU H CG  1 
ATOM   4721 C CD  . GLU H 3 69 ? 106.873 14.211 -4.319  1.00 138.35 ? 91   GLU H CD  1 
ATOM   4722 O OE1 . GLU H 3 69 ? 106.114 15.131 -3.948  1.00 150.32 ? 91   GLU H OE1 1 
ATOM   4723 O OE2 . GLU H 3 69 ? 108.079 14.388 -4.581  1.00 141.28 ? 91   GLU H OE2 1 
ATOM   4724 N N   . PHE H 3 70 ? 102.025 11.775 -4.383  1.00 75.28  ? 92   PHE H N   1 
ATOM   4725 C CA  . PHE H 3 70 ? 100.608 12.082 -4.474  1.00 73.37  ? 92   PHE H CA  1 
ATOM   4726 C C   . PHE H 3 70 ? 100.030 12.475 -3.122  1.00 72.45  ? 92   PHE H C   1 
ATOM   4727 O O   . PHE H 3 70 ? 100.723 12.439 -2.105  1.00 77.16  ? 92   PHE H O   1 
ATOM   4728 C CB  . PHE H 3 70 ? 99.865  10.877 -5.046  1.00 60.63  ? 92   PHE H CB  1 
ATOM   4729 C CG  . PHE H 3 70 ? 100.113 9.616  -4.302  1.00 61.07  ? 92   PHE H CG  1 
ATOM   4730 C CD1 . PHE H 3 70 ? 99.450  9.359  -3.103  1.00 61.02  ? 92   PHE H CD1 1 
ATOM   4731 C CD2 . PHE H 3 70 ? 101.026 8.683  -4.783  1.00 63.51  ? 92   PHE H CD2 1 
ATOM   4732 C CE1 . PHE H 3 70 ? 99.696  8.175  -2.388  1.00 62.47  ? 92   PHE H CE1 1 
ATOM   4733 C CE2 . PHE H 3 70 ? 101.279 7.501  -4.081  1.00 65.62  ? 92   PHE H CE2 1 
ATOM   4734 C CZ  . PHE H 3 70 ? 100.613 7.246  -2.879  1.00 62.57  ? 92   PHE H CZ  1 
ATOM   4735 N N   . VAL H 3 71 ? 98.767  12.878 -3.115  1.00 68.82  ? 93   VAL H N   1 
ATOM   4736 C CA  . VAL H 3 71 ? 98.126  13.253 -1.869  1.00 64.34  ? 93   VAL H CA  1 
ATOM   4737 C C   . VAL H 3 71 ? 97.100  12.184 -1.556  1.00 60.32  ? 93   VAL H C   1 
ATOM   4738 O O   . VAL H 3 71 ? 96.542  11.538 -2.455  1.00 47.66  ? 93   VAL H O   1 
ATOM   4739 C CB  . VAL H 3 71 ? 97.421  14.624 -1.957  1.00 64.89  ? 93   VAL H CB  1 
ATOM   4740 C CG1 . VAL H 3 71 ? 98.399  15.678 -2.443  1.00 61.10  ? 93   VAL H CG1 1 
ATOM   4741 C CG2 . VAL H 3 71 ? 96.220  14.536 -2.884  1.00 65.79  ? 93   VAL H CG2 1 
ATOM   4742 N N   . VAL H 3 72 ? 96.855  12.000 -0.269  1.00 59.06  ? 94   VAL H N   1 
ATOM   4743 C CA  . VAL H 3 72 ? 95.913  11.000 0.152   1.00 53.98  ? 94   VAL H CA  1 
ATOM   4744 C C   . VAL H 3 72 ? 94.871  11.573 1.061   1.00 60.74  ? 94   VAL H C   1 
ATOM   4745 O O   . VAL H 3 72 ? 95.162  12.017 2.174   1.00 60.23  ? 94   VAL H O   1 
ATOM   4746 C CB  . VAL H 3 72 ? 96.605  9.885  0.887   1.00 48.12  ? 94   VAL H CB  1 
ATOM   4747 C CG1 . VAL H 3 72 ? 95.593  8.797  1.233   1.00 40.37  ? 94   VAL H CG1 1 
ATOM   4748 C CG2 . VAL H 3 72 ? 97.737  9.352  0.027   1.00 55.83  ? 94   VAL H CG2 1 
ATOM   4749 N N   . VAL H 3 73 ? 93.646  11.554 0.567   1.00 73.15  ? 95   VAL H N   1 
ATOM   4750 C CA  . VAL H 3 73 ? 92.513  12.049 1.315   1.00 81.23  ? 95   VAL H CA  1 
ATOM   4751 C C   . VAL H 3 73 ? 92.071  10.922 2.220   1.00 82.56  ? 95   VAL H C   1 
ATOM   4752 O O   . VAL H 3 73 ? 91.310  10.046 1.809   1.00 76.33  ? 95   VAL H O   1 
ATOM   4753 C CB  . VAL H 3 73 ? 91.345  12.400 0.394   1.00 85.46  ? 95   VAL H CB  1 
ATOM   4754 C CG1 . VAL H 3 73 ? 90.249  13.065 1.200   1.00 89.35  ? 95   VAL H CG1 1 
ATOM   4755 C CG2 . VAL H 3 73 ? 91.826  13.298 -0.741  1.00 84.33  ? 95   VAL H CG2 1 
ATOM   4756 N N   . THR H 3 74 ? 92.582  10.929 3.442   1.00 90.56  ? 96   THR H N   1 
ATOM   4757 C CA  . THR H 3 74 ? 92.217  9.916  4.415   1.00 95.65  ? 96   THR H CA  1 
ATOM   4758 C C   . THR H 3 74 ? 90.773  10.208 4.733   1.00 101.05 ? 96   THR H C   1 
ATOM   4759 O O   . THR H 3 74 ? 90.499  11.146 5.478   1.00 94.70  ? 96   THR H O   1 
ATOM   4760 C CB  . THR H 3 74 ? 92.994  10.074 5.714   1.00 99.26  ? 96   THR H CB  1 
ATOM   4761 O OG1 . THR H 3 74 ? 94.382  10.293 5.422   1.00 100.70 ? 96   THR H OG1 1 
ATOM   4762 C CG2 . THR H 3 74 ? 92.811  8.829  6.582   1.00 102.24 ? 96   THR H CG2 1 
ATOM   4763 N N   . ALA H 3 75 ? 89.859  9.420  4.169   1.00 112.14 ? 97   ALA H N   1 
ATOM   4764 C CA  . ALA H 3 75 ? 88.427  9.618  4.393   1.00 119.25 ? 97   ALA H CA  1 
ATOM   4765 C C   . ALA H 3 75 ? 88.061  9.596  5.876   1.00 126.71 ? 97   ALA H C   1 
ATOM   4766 O O   . ALA H 3 75 ? 87.172  8.846  6.294   1.00 126.29 ? 97   ALA H O   1 
ATOM   4767 C CB  . ALA H 3 75 ? 87.620  8.567  3.631   1.00 111.25 ? 97   ALA H CB  1 
ATOM   4768 N N   . LYS H 3 76 ? 88.758  10.443 6.641   1.00 134.40 ? 98   LYS H N   1 
ATOM   4769 C CA  . LYS H 3 76 ? 88.597  10.627 8.089   1.00 139.91 ? 98   LYS H CA  1 
ATOM   4770 C C   . LYS H 3 76 ? 87.362  11.483 8.388   1.00 148.31 ? 98   LYS H C   1 
ATOM   4771 O O   . LYS H 3 76 ? 86.665  11.188 9.381   1.00 156.19 ? 98   LYS H O   1 
ATOM   4772 C CB  . LYS H 3 76 ? 89.857  11.300 8.677   1.00 127.43 ? 98   LYS H CB  1 
ATOM   4773 C CG  . LYS H 3 76 ? 89.721  11.829 10.117  1.00 114.89 ? 98   LYS H CG  1 
ATOM   4774 C CD  . LYS H 3 76 ? 90.893  12.750 10.496  1.00 105.97 ? 98   LYS H CD  1 
ATOM   4775 C CE  . LYS H 3 76 ? 90.585  13.623 11.724  1.00 98.59  ? 98   LYS H CE  1 
ATOM   4776 N NZ  . LYS H 3 76 ? 91.524  14.794 11.865  1.00 80.75  ? 98   LYS H NZ  1 
ATOM   4777 O OXT . LYS H 3 76 ? 87.109  12.448 7.635   1.00 151.03 ? 98   LYS H OXT 1 
HETATM 4778 C C1  . D10 I 5 .  ? 47.813  23.498 17.431  1.00 77.23  ? 1099 D10 B C1  1 
HETATM 4779 C C2  . D10 I 5 .  ? 48.955  23.619 16.401  1.00 79.70  ? 1099 D10 B C2  1 
HETATM 4780 C C3  . D10 I 5 .  ? 49.884  22.450 16.875  1.00 73.66  ? 1099 D10 B C3  1 
HETATM 4781 C C4  . D10 I 5 .  ? 51.182  22.294 16.051  1.00 64.29  ? 1099 D10 B C4  1 
HETATM 4782 C C5  . D10 I 5 .  ? 50.980  21.247 14.937  1.00 53.13  ? 1099 D10 B C5  1 
HETATM 4783 C C6  . D10 I 5 .  ? 52.288  21.128 14.121  1.00 67.86  ? 1099 D10 B C6  1 
HETATM 4784 C C7  . D10 I 5 .  ? 52.135  20.077 12.985  1.00 65.09  ? 1099 D10 B C7  1 
HETATM 4785 C C8  . D10 I 5 .  ? 52.046  20.761 11.577  1.00 59.45  ? 1099 D10 B C8  1 
HETATM 4786 C C9  . D10 I 5 .  ? 52.714  19.844 10.502  1.00 43.96  ? 1099 D10 B C9  1 
HETATM 4787 C C10 . D10 I 5 .  ? 52.630  20.477 9.083   1.00 40.27  ? 1099 D10 B C10 1 
HETATM 4788 C C1  . D10 J 5 .  ? 58.394  53.885 36.361  1.00 52.57  ? 1099 D10 C C1  1 
HETATM 4789 C C2  . D10 J 5 .  ? 57.040  53.248 36.016  1.00 44.18  ? 1099 D10 C C2  1 
HETATM 4790 C C3  . D10 J 5 .  ? 56.495  53.112 37.464  1.00 47.08  ? 1099 D10 C C3  1 
HETATM 4791 C C4  . D10 J 5 .  ? 55.474  51.967 37.657  1.00 60.84  ? 1099 D10 C C4  1 
HETATM 4792 C C5  . D10 J 5 .  ? 54.897  52.016 39.093  1.00 60.51  ? 1099 D10 C C5  1 
HETATM 4793 C C6  . D10 J 5 .  ? 53.889  50.872 39.245  1.00 50.88  ? 1099 D10 C C6  1 
HETATM 4794 C C7  . D10 J 5 .  ? 53.137  51.008 40.572  1.00 65.95  ? 1099 D10 C C7  1 
HETATM 4795 C C8  . D10 J 5 .  ? 51.828  50.190 40.486  1.00 79.31  ? 1099 D10 C C8  1 
HETATM 4796 C C9  . D10 J 5 .  ? 52.052  48.749 41.009  1.00 77.31  ? 1099 D10 C C9  1 
HETATM 4797 C C10 . D10 J 5 .  ? 50.737  47.943 40.910  1.00 76.56  ? 1099 D10 C C10 1 
HETATM 4798 C C1  . D10 K 5 .  ? 15.501  19.241 1.057   1.00 40.25  ? 1099 D10 F C1  1 
HETATM 4799 C C2  . D10 K 5 .  ? 14.309  18.397 0.551   1.00 55.54  ? 1099 D10 F C2  1 
HETATM 4800 C C3  . D10 K 5 .  ? 14.792  18.119 -0.907  1.00 67.96  ? 1099 D10 F C3  1 
HETATM 4801 C C4  . D10 K 5 .  ? 13.670  17.961 -1.962  1.00 74.08  ? 1099 D10 F C4  1 
HETATM 4802 C C5  . D10 K 5 .  ? 13.936  16.709 -2.837  1.00 76.72  ? 1099 D10 F C5  1 
HETATM 4803 C C6  . D10 K 5 .  ? 12.819  16.563 -3.896  1.00 70.83  ? 1099 D10 F C6  1 
HETATM 4804 C C7  . D10 K 5 .  ? 12.624  15.078 -4.264  1.00 70.34  ? 1099 D10 F C7  1 
HETATM 4805 C C8  . D10 K 5 .  ? 11.262  14.586 -3.713  1.00 73.32  ? 1099 D10 F C8  1 
HETATM 4806 C C9  . D10 K 5 .  ? 10.606  13.612 -4.721  1.00 77.75  ? 1099 D10 F C9  1 
HETATM 4807 C C10 . D10 K 5 .  ? 9.250   13.122 -4.170  1.00 83.14  ? 1099 D10 F C10 1 
HETATM 4808 C C1  . D10 L 5 .  ? 90.794  18.368 1.986   1.00 60.72  ? 1099 D10 H C1  1 
HETATM 4809 C C2  . D10 L 5 .  ? 90.594  18.763 0.505   1.00 48.53  ? 1099 D10 H C2  1 
HETATM 4810 C C3  . D10 L 5 .  ? 89.983  17.436 -0.003  1.00 36.46  ? 1099 D10 H C3  1 
HETATM 4811 C C4  . D10 L 5 .  ? 89.855  17.340 -1.530  1.00 49.18  ? 1099 D10 H C4  1 
HETATM 4812 C C5  . D10 L 5 .  ? 89.243  15.969 -1.884  1.00 49.37  ? 1099 D10 H C5  1 
HETATM 4813 C C6  . D10 L 5 .  ? 89.087  15.853 -3.417  1.00 39.36  ? 1099 D10 H C6  1 
HETATM 4814 C C7  . D10 L 5 .  ? 88.452  14.490 -3.766  1.00 60.39  ? 1099 D10 H C7  1 
HETATM 4815 C C8  . D10 L 5 .  ? 86.962  14.393 -3.299  1.00 67.30  ? 1099 D10 H C8  1 
HETATM 4816 C C9  . D10 L 5 .  ? 86.276  13.175 -3.985  1.00 64.31  ? 1099 D10 H C9  1 
HETATM 4817 C C10 . D10 L 5 .  ? 84.803  13.060 -3.541  1.00 61.15  ? 1099 D10 H C10 1 
HETATM 4818 O O   . HOH M 6 .  ? 75.144  34.099 9.501   1.00 45.71  ? 2001 HOH B O   1 
HETATM 4819 O O   . HOH M 6 .  ? 38.048  4.875  4.015   1.00 62.00  ? 2002 HOH B O   1 
HETATM 4820 O O   . HOH N 6 .  ? 63.998  53.156 39.386  1.00 40.07  ? 2001 HOH C O   1 
HETATM 4821 O O   . HOH O 6 .  ? 34.763  57.431 45.689  1.00 35.45  ? 2001 HOH D O   1 
HETATM 4822 O O   . HOH P 6 .  ? -1.704  34.678 -5.937  1.00 62.79  ? 2001 HOH F O   1 
HETATM 4823 O O   . HOH Q 6 .  ? 96.074  20.550 8.816   1.00 66.98  ? 2001 HOH G O   1 
HETATM 4824 O O   . HOH R 6 .  ? 92.263  2.511  0.789   1.00 76.76  ? 2001 HOH H O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  VAL 1  9  9  VAL VAL A . n 
A 1 2  PRO 2  10 10 PRO PRO A . n 
A 1 3  PRO 3  11 11 PRO PRO A . n 
A 1 4  ALA 4  12 12 ALA ALA A . n 
A 1 5  LEU 5  13 13 LEU LEU A . n 
A 1 6  HIS 6  14 14 HIS HIS A . n 
A 1 7  LEU 7  15 15 LEU LEU A . n 
A 1 8  VAL 8  16 16 VAL VAL A . n 
A 1 9  ASP 9  17 17 ASP ASP A . n 
A 1 10 PRO 10 18 18 PRO PRO A . n 
A 1 11 GLN 11 19 19 GLN GLN A . n 
A 1 12 ILE 12 20 20 ILE ILE A . n 
A 1 13 GLN 13 21 21 GLN GLN A . n 
A 1 14 LEU 14 22 22 LEU LEU A . n 
A 1 15 THR 15 23 23 THR THR A . n 
A 1 16 ILE 16 24 24 ILE ILE A . n 
A 1 17 THR 17 25 25 THR THR A . n 
A 1 18 ALA 18 38 38 ALA ALA A . n 
A 1 19 ASP 19 39 39 ASP ASP A . n 
A 1 20 PRO 20 40 40 PRO PRO A . n 
A 1 21 LYS 21 41 41 LYS LYS A . n 
A 1 22 VAL 22 42 42 VAL VAL A . n 
A 1 23 TYR 23 43 43 TYR TYR A . n 
A 1 24 PRO 24 44 44 PRO PRO A . n 
A 1 25 ILE 25 45 45 ILE ILE A . n 
A 1 26 ILE 26 46 46 ILE ILE A . n 
A 1 27 LEU 27 47 47 LEU LEU A . n 
A 1 28 ARG 28 48 48 ARG ARG A . n 
A 1 29 LEU 29 49 49 LEU LEU A . n 
A 1 30 GLY 30 50 50 GLY GLY A . n 
A 1 31 SER 31 51 51 SER SER A . n 
A 1 32 ASN 32 52 52 ASN ASN A . n 
A 1 33 LEU 33 53 53 LEU LEU A . n 
A 1 34 SER 34 54 54 SER SER A . n 
A 1 35 LEU 35 55 55 LEU LEU A . n 
A 1 36 SER 36 56 56 SER SER A . n 
A 1 37 MET 37 57 57 MET MET A . n 
A 1 38 ALA 38 58 58 ALA ALA A . n 
A 1 39 ARG 39 59 59 ARG ARG A . n 
A 1 40 ARG 40 60 60 ARG ARG A . n 
A 1 41 ASN 41 61 61 ASN ASN A . n 
A 1 42 LEU 42 62 62 LEU LEU A . n 
A 1 43 ASP 43 63 63 ASP ASP A . n 
A 1 44 SER 44 64 64 SER SER A . n 
A 1 45 LEU 45 65 65 LEU LEU A . n 
A 1 46 GLU 46 66 66 GLU GLU A . n 
A 1 47 ALA 47 67 67 ALA ALA A . n 
A 1 48 ARG 48 68 68 ARG ARG A . n 
A 1 49 ALA 49 69 69 ALA ALA A . n 
A 1 50 PHE 50 70 70 PHE PHE A . n 
A 1 51 GLN 51 71 71 GLN GLN A . n 
A 1 52 SER 52 72 72 SER SER A . n 
A 1 53 THR 53 73 73 THR THR A . n 
A 1 54 PRO 54 74 74 PRO PRO A . n 
A 1 55 ILE 55 75 75 ILE ILE A . n 
A 1 56 VAL 56 76 76 VAL VAL A . n 
A 1 57 VAL 57 77 77 VAL VAL A . n 
A 1 58 GLN 58 78 78 GLN GLN A . n 
A 1 59 MET 59 79 79 MET MET A . n 
A 1 60 THR 60 80 80 THR THR A . n 
A 1 61 LYS 61 81 81 LYS LYS A . n 
A 1 62 LEU 62 82 82 LEU LEU A . n 
A 1 63 ALA 63 83 83 ALA ALA A . n 
A 1 64 THR 64 84 84 THR THR A . n 
A 1 65 THR 65 85 85 THR THR A . n 
A 1 66 GLU 66 86 86 GLU GLU A . n 
A 1 67 GLU 67 87 87 GLU GLU A . n 
A 1 68 LEU 68 88 88 LEU LEU A . n 
A 1 69 PRO 69 89 89 PRO PRO A . n 
A 1 70 ASP 70 90 90 ASP ASP A . n 
A 1 71 GLU 71 91 91 GLU GLU A . n 
A 1 72 PHE 72 92 92 PHE PHE A . n 
A 1 73 VAL 73 93 93 VAL VAL A . n 
A 1 74 VAL 74 94 94 VAL VAL A . n 
A 1 75 VAL 75 95 95 VAL VAL A . n 
A 1 76 THR 76 96 96 THR THR A . n 
A 1 77 ALA 77 97 97 ALA ALA A . n 
A 1 78 LYS 78 98 98 LYS LYS A . n 
B 2 1  VAL 1  9  9  VAL VAL B . n 
B 2 2  PRO 2  10 10 PRO PRO B . n 
B 2 3  PRO 3  11 11 PRO PRO B . n 
B 2 4  ALA 4  12 12 ALA ALA B . n 
B 2 5  LEU 5  13 13 LEU LEU B . n 
B 2 6  HIS 6  14 14 HIS HIS B . n 
B 2 7  LEU 7  15 15 LEU LEU B . n 
B 2 8  VAL 8  16 16 VAL VAL B . n 
B 2 9  ASP 9  17 17 ASP ASP B . n 
B 2 10 PRO 10 18 18 PRO PRO B . n 
B 2 11 GLN 11 19 19 GLN GLN B . n 
B 2 12 ILE 12 20 20 ILE ILE B . n 
B 2 13 GLN 13 21 21 GLN GLN B . n 
B 2 14 LEU 14 22 22 LEU LEU B . n 
B 2 15 THR 15 23 23 THR THR B . n 
B 2 16 ILE 16 24 24 ILE ILE B . n 
B 2 17 THR 17 25 25 THR THR B . n 
B 2 18 ARG 18 26 26 ARG ARG B . n 
B 2 19 ALA 19 38 38 ALA ALA B . n 
B 2 20 ASP 20 39 39 ASP ASP B . n 
B 2 21 PRO 21 40 40 PRO PRO B . n 
B 2 22 LYS 22 41 41 LYS LYS B . n 
B 2 23 VAL 23 42 42 VAL VAL B . n 
B 2 24 TYR 24 43 43 TYR TYR B . n 
B 2 25 PRO 25 44 44 PRO PRO B . n 
B 2 26 ILE 26 45 45 ILE ILE B . n 
B 2 27 ILE 27 46 46 ILE ILE B . n 
B 2 28 LEU 28 47 47 LEU LEU B . n 
B 2 29 ARG 29 48 48 ARG ARG B . n 
B 2 30 LEU 30 49 49 LEU LEU B . n 
B 2 31 GLY 31 50 50 GLY GLY B . n 
B 2 32 SER 32 51 51 SER SER B . n 
B 2 33 ASN 33 52 52 ASN ASN B . n 
B 2 34 LEU 34 53 53 LEU LEU B . n 
B 2 35 SER 35 54 54 SER SER B . n 
B 2 36 LEU 36 55 55 LEU LEU B . n 
B 2 37 SER 37 56 56 SER SER B . n 
B 2 38 MET 38 57 57 MET MET B . n 
B 2 39 ALA 39 58 58 ALA ALA B . n 
B 2 40 ARG 40 59 59 ARG ARG B . n 
B 2 41 ARG 41 60 60 ARG ARG B . n 
B 2 42 ASN 42 61 61 ASN ASN B . n 
B 2 43 LEU 43 62 62 LEU LEU B . n 
B 2 44 ASP 44 63 63 ASP ASP B . n 
B 2 45 SER 45 64 64 SER SER B . n 
B 2 46 LEU 46 65 65 LEU LEU B . n 
B 2 47 GLU 47 66 66 GLU GLU B . n 
B 2 48 ALA 48 67 67 ALA ALA B . n 
B 2 49 ARG 49 68 68 ARG ARG B . n 
B 2 50 ALA 50 69 69 ALA ALA B . n 
B 2 51 PHE 51 70 70 PHE PHE B . n 
B 2 52 GLN 52 71 71 GLN GLN B . n 
B 2 53 SER 53 72 72 SER SER B . n 
B 2 54 THR 54 73 73 THR THR B . n 
B 2 55 PRO 55 74 74 PRO PRO B . n 
B 2 56 ILE 56 75 75 ILE ILE B . n 
B 2 57 VAL 57 76 76 VAL VAL B . n 
B 2 58 VAL 58 77 77 VAL VAL B . n 
B 2 59 GLN 59 78 78 GLN GLN B . n 
B 2 60 MET 60 79 79 MET MET B . n 
B 2 61 THR 61 80 80 THR THR B . n 
B 2 62 LYS 62 81 81 LYS LYS B . n 
B 2 63 LEU 63 82 82 LEU LEU B . n 
B 2 64 ALA 64 83 83 ALA ALA B . n 
B 2 65 THR 65 84 84 THR THR B . n 
B 2 66 THR 66 85 85 THR THR B . n 
B 2 67 GLU 67 86 86 GLU GLU B . n 
B 2 68 GLU 68 87 87 GLU GLU B . n 
B 2 69 LEU 69 88 88 LEU LEU B . n 
B 2 70 PRO 70 89 89 PRO PRO B . n 
B 2 71 ASP 71 90 90 ASP ASP B . n 
B 2 72 GLU 72 91 91 GLU GLU B . n 
B 2 73 PHE 73 92 92 PHE PHE B . n 
B 2 74 VAL 74 93 93 VAL VAL B . n 
B 2 75 VAL 75 94 94 VAL VAL B . n 
B 2 76 VAL 76 95 95 VAL VAL B . n 
B 2 77 THR 77 96 96 THR THR B . n 
B 2 78 ALA 78 97 97 ALA ALA B . n 
B 2 79 LYS 79 98 98 LYS LYS B . n 
C 3 1  PRO 1  10 10 PRO PRO C . n 
C 3 2  PRO 2  11 11 PRO PRO C . n 
C 3 3  ALA 3  12 12 ALA ALA C . n 
C 3 4  LEU 4  13 13 LEU LEU C . n 
C 3 5  HIS 5  14 14 HIS HIS C . n 
C 3 6  LEU 6  15 15 LEU LEU C . n 
C 3 7  VAL 7  16 16 VAL VAL C . n 
C 3 8  ASP 8  17 17 ASP ASP C . n 
C 3 9  PRO 9  18 18 PRO PRO C . n 
C 3 10 GLN 10 19 19 GLN GLN C . n 
C 3 11 ILE 11 20 20 ILE ILE C . n 
C 3 12 GLN 12 21 21 GLN GLN C . n 
C 3 13 LEU 13 22 22 LEU LEU C . n 
C 3 14 THR 14 23 23 THR THR C . n 
C 3 15 ILE 15 24 24 ILE ILE C . n 
C 3 16 THR 16 25 25 THR THR C . n 
C 3 17 ASP 17 39 39 ASP ASP C . n 
C 3 18 PRO 18 40 40 PRO PRO C . n 
C 3 19 LYS 19 41 41 LYS LYS C . n 
C 3 20 VAL 20 42 42 VAL VAL C . n 
C 3 21 TYR 21 43 43 TYR TYR C . n 
C 3 22 PRO 22 44 44 PRO PRO C . n 
C 3 23 ILE 23 45 45 ILE ILE C . n 
C 3 24 ILE 24 46 46 ILE ILE C . n 
C 3 25 LEU 25 47 47 LEU LEU C . n 
C 3 26 ARG 26 48 48 ARG ARG C . n 
C 3 27 LEU 27 49 49 LEU LEU C . n 
C 3 28 GLY 28 50 50 GLY GLY C . n 
C 3 29 SER 29 51 51 SER SER C . n 
C 3 30 ASN 30 52 52 ASN ASN C . n 
C 3 31 LEU 31 53 53 LEU LEU C . n 
C 3 32 SER 32 54 54 SER SER C . n 
C 3 33 LEU 33 55 55 LEU LEU C . n 
C 3 34 SER 34 56 56 SER SER C . n 
C 3 35 MET 35 57 57 MET MET C . n 
C 3 36 ALA 36 58 58 ALA ALA C . n 
C 3 37 ARG 37 59 59 ARG ARG C . n 
C 3 38 ARG 38 60 60 ARG ARG C . n 
C 3 39 ASN 39 61 61 ASN ASN C . n 
C 3 40 LEU 40 62 62 LEU LEU C . n 
C 3 41 ASP 41 63 63 ASP ASP C . n 
C 3 42 SER 42 64 64 SER SER C . n 
C 3 43 LEU 43 65 65 LEU LEU C . n 
C 3 44 GLU 44 66 66 GLU GLU C . n 
C 3 45 ALA 45 67 67 ALA ALA C . n 
C 3 46 ARG 46 68 68 ARG ARG C . n 
C 3 47 ALA 47 69 69 ALA ALA C . n 
C 3 48 PHE 48 70 70 PHE PHE C . n 
C 3 49 GLN 49 71 71 GLN GLN C . n 
C 3 50 SER 50 72 72 SER SER C . n 
C 3 51 THR 51 73 73 THR THR C . n 
C 3 52 PRO 52 74 74 PRO PRO C . n 
C 3 53 ILE 53 75 75 ILE ILE C . n 
C 3 54 VAL 54 76 76 VAL VAL C . n 
C 3 55 VAL 55 77 77 VAL VAL C . n 
C 3 56 GLN 56 78 78 GLN GLN C . n 
C 3 57 MET 57 79 79 MET MET C . n 
C 3 58 THR 58 80 80 THR THR C . n 
C 3 59 LYS 59 81 81 LYS LYS C . n 
C 3 60 LEU 60 82 82 LEU LEU C . n 
C 3 61 ALA 61 83 83 ALA ALA C . n 
C 3 62 THR 62 84 84 THR THR C . n 
C 3 63 THR 63 85 85 THR THR C . n 
C 3 64 GLU 64 86 86 GLU GLU C . n 
C 3 65 GLU 65 87 87 GLU GLU C . n 
C 3 66 LEU 66 88 88 LEU LEU C . n 
C 3 67 PRO 67 89 89 PRO PRO C . n 
C 3 68 ASP 68 90 90 ASP ASP C . n 
C 3 69 GLU 69 91 91 GLU GLU C . n 
C 3 70 PHE 70 92 92 PHE PHE C . n 
C 3 71 VAL 71 93 93 VAL VAL C . n 
C 3 72 VAL 72 94 94 VAL VAL C . n 
C 3 73 VAL 73 95 95 VAL VAL C . n 
C 3 74 THR 74 96 96 THR THR C . n 
C 3 75 ALA 75 97 97 ALA ALA C . n 
C 3 76 LYS 76 98 98 LYS LYS C . n 
D 3 1  PRO 1  10 10 PRO PRO D . n 
D 3 2  PRO 2  11 11 PRO PRO D . n 
D 3 3  ALA 3  12 12 ALA ALA D . n 
D 3 4  LEU 4  13 13 LEU LEU D . n 
D 3 5  HIS 5  14 14 HIS HIS D . n 
D 3 6  LEU 6  15 15 LEU LEU D . n 
D 3 7  VAL 7  16 16 VAL VAL D . n 
D 3 8  ASP 8  17 17 ASP ASP D . n 
D 3 9  PRO 9  18 18 PRO PRO D . n 
D 3 10 GLN 10 19 19 GLN GLN D . n 
D 3 11 ILE 11 20 20 ILE ILE D . n 
D 3 12 GLN 12 21 21 GLN GLN D . n 
D 3 13 LEU 13 22 22 LEU LEU D . n 
D 3 14 THR 14 23 23 THR THR D . n 
D 3 15 ILE 15 24 24 ILE ILE D . n 
D 3 16 THR 16 25 25 THR THR D . n 
D 3 17 ASP 17 39 39 ASP ASP D . n 
D 3 18 PRO 18 40 40 PRO PRO D . n 
D 3 19 LYS 19 41 41 LYS LYS D . n 
D 3 20 VAL 20 42 42 VAL VAL D . n 
D 3 21 TYR 21 43 43 TYR TYR D . n 
D 3 22 PRO 22 44 44 PRO PRO D . n 
D 3 23 ILE 23 45 45 ILE ILE D . n 
D 3 24 ILE 24 46 46 ILE ILE D . n 
D 3 25 LEU 25 47 47 LEU LEU D . n 
D 3 26 ARG 26 48 48 ARG ARG D . n 
D 3 27 LEU 27 49 49 LEU LEU D . n 
D 3 28 GLY 28 50 50 GLY GLY D . n 
D 3 29 SER 29 51 51 SER SER D . n 
D 3 30 ASN 30 52 52 ASN ASN D . n 
D 3 31 LEU 31 53 53 LEU LEU D . n 
D 3 32 SER 32 54 54 SER SER D . n 
D 3 33 LEU 33 55 55 LEU LEU D . n 
D 3 34 SER 34 56 56 SER SER D . n 
D 3 35 MET 35 57 57 MET MET D . n 
D 3 36 ALA 36 58 58 ALA ALA D . n 
D 3 37 ARG 37 59 59 ARG ARG D . n 
D 3 38 ARG 38 60 60 ARG ARG D . n 
D 3 39 ASN 39 61 61 ASN ASN D . n 
D 3 40 LEU 40 62 62 LEU LEU D . n 
D 3 41 ASP 41 63 63 ASP ASP D . n 
D 3 42 SER 42 64 64 SER SER D . n 
D 3 43 LEU 43 65 65 LEU LEU D . n 
D 3 44 GLU 44 66 66 GLU GLU D . n 
D 3 45 ALA 45 67 67 ALA ALA D . n 
D 3 46 ARG 46 68 68 ARG ARG D . n 
D 3 47 ALA 47 69 69 ALA ALA D . n 
D 3 48 PHE 48 70 70 PHE PHE D . n 
D 3 49 GLN 49 71 71 GLN GLN D . n 
D 3 50 SER 50 72 72 SER SER D . n 
D 3 51 THR 51 73 73 THR THR D . n 
D 3 52 PRO 52 74 74 PRO PRO D . n 
D 3 53 ILE 53 75 75 ILE ILE D . n 
D 3 54 VAL 54 76 76 VAL VAL D . n 
D 3 55 VAL 55 77 77 VAL VAL D . n 
D 3 56 GLN 56 78 78 GLN GLN D . n 
D 3 57 MET 57 79 79 MET MET D . n 
D 3 58 THR 58 80 80 THR THR D . n 
D 3 59 LYS 59 81 81 LYS LYS D . n 
D 3 60 LEU 60 82 82 LEU LEU D . n 
D 3 61 ALA 61 83 83 ALA ALA D . n 
D 3 62 THR 62 84 84 THR THR D . n 
D 3 63 THR 63 85 85 THR THR D . n 
D 3 64 GLU 64 86 86 GLU GLU D . n 
D 3 65 GLU 65 87 87 GLU GLU D . n 
D 3 66 LEU 66 88 88 LEU LEU D . n 
D 3 67 PRO 67 89 89 PRO PRO D . n 
D 3 68 ASP 68 90 90 ASP ASP D . n 
D 3 69 GLU 69 91 91 GLU GLU D . n 
D 3 70 PHE 70 92 92 PHE PHE D . n 
D 3 71 VAL 71 93 93 VAL VAL D . n 
D 3 72 VAL 72 94 94 VAL VAL D . n 
D 3 73 VAL 73 95 95 VAL VAL D . n 
D 3 74 THR 74 96 96 THR THR D . n 
D 3 75 ALA 75 97 97 ALA ALA D . n 
D 3 76 LYS 76 98 98 LYS LYS D . n 
E 4 1  VAL 1  9  9  VAL VAL E . n 
E 4 2  PRO 2  10 10 PRO PRO E . n 
E 4 3  PRO 3  11 11 PRO PRO E . n 
E 4 4  ALA 4  12 12 ALA ALA E . n 
E 4 5  LEU 5  13 13 LEU LEU E . n 
E 4 6  HIS 6  14 14 HIS HIS E . n 
E 4 7  LEU 7  15 15 LEU LEU E . n 
E 4 8  VAL 8  16 16 VAL VAL E . n 
E 4 9  ASP 9  17 17 ASP ASP E . n 
E 4 10 PRO 10 18 18 PRO PRO E . n 
E 4 11 GLN 11 19 19 GLN GLN E . n 
E 4 12 ILE 12 20 20 ILE ILE E . n 
E 4 13 GLN 13 21 21 GLN GLN E . n 
E 4 14 LEU 14 22 22 LEU LEU E . n 
E 4 15 THR 15 23 23 THR THR E . n 
E 4 16 ILE 16 24 24 ILE ILE E . n 
E 4 17 THR 17 25 25 THR THR E . n 
E 4 18 ASP 18 39 39 ASP ASP E . n 
E 4 19 PRO 19 40 40 PRO PRO E . n 
E 4 20 LYS 20 41 41 LYS LYS E . n 
E 4 21 VAL 21 42 42 VAL VAL E . n 
E 4 22 TYR 22 43 43 TYR TYR E . n 
E 4 23 PRO 23 44 44 PRO PRO E . n 
E 4 24 ILE 24 45 45 ILE ILE E . n 
E 4 25 ILE 25 46 46 ILE ILE E . n 
E 4 26 LEU 26 47 47 LEU LEU E . n 
E 4 27 ARG 27 48 48 ARG ARG E . n 
E 4 28 LEU 28 49 49 LEU LEU E . n 
E 4 29 GLY 29 50 50 GLY GLY E . n 
E 4 30 SER 30 51 51 SER SER E . n 
E 4 31 ASN 31 52 52 ASN ASN E . n 
E 4 32 LEU 32 53 53 LEU LEU E . n 
E 4 33 SER 33 54 54 SER SER E . n 
E 4 34 LEU 34 55 55 LEU LEU E . n 
E 4 35 SER 35 56 56 SER SER E . n 
E 4 36 MET 36 57 57 MET MET E . n 
E 4 37 ALA 37 58 58 ALA ALA E . n 
E 4 38 ARG 38 59 59 ARG ARG E . n 
E 4 39 ARG 39 60 60 ARG ARG E . n 
E 4 40 ASN 40 61 61 ASN ASN E . n 
E 4 41 LEU 41 62 62 LEU LEU E . n 
E 4 42 ASP 42 63 63 ASP ASP E . n 
E 4 43 SER 43 64 64 SER SER E . n 
E 4 44 LEU 44 65 65 LEU LEU E . n 
E 4 45 GLU 45 66 66 GLU GLU E . n 
E 4 46 ALA 46 67 67 ALA ALA E . n 
E 4 47 ARG 47 68 68 ARG ARG E . n 
E 4 48 ALA 48 69 69 ALA ALA E . n 
E 4 49 PHE 49 70 70 PHE PHE E . n 
E 4 50 GLN 50 71 71 GLN GLN E . n 
E 4 51 SER 51 72 72 SER SER E . n 
E 4 52 THR 52 73 73 THR THR E . n 
E 4 53 PRO 53 74 74 PRO PRO E . n 
E 4 54 ILE 54 75 75 ILE ILE E . n 
E 4 55 VAL 55 76 76 VAL VAL E . n 
E 4 56 VAL 56 77 77 VAL VAL E . n 
E 4 57 GLN 57 78 78 GLN GLN E . n 
E 4 58 MET 58 79 79 MET MET E . n 
E 4 59 THR 59 80 80 THR THR E . n 
E 4 60 LYS 60 81 81 LYS LYS E . n 
E 4 61 LEU 61 82 82 LEU LEU E . n 
E 4 62 ALA 62 83 83 ALA ALA E . n 
E 4 63 THR 63 84 84 THR THR E . n 
E 4 64 THR 64 85 85 THR THR E . n 
E 4 65 GLU 65 86 86 GLU GLU E . n 
E 4 66 GLU 66 87 87 GLU GLU E . n 
E 4 67 LEU 67 88 88 LEU LEU E . n 
E 4 68 PRO 68 89 89 PRO PRO E . n 
E 4 69 ASP 69 90 90 ASP ASP E . n 
E 4 70 GLU 70 91 91 GLU GLU E . n 
E 4 71 PHE 71 92 92 PHE PHE E . n 
E 4 72 VAL 72 93 93 VAL VAL E . n 
E 4 73 VAL 73 94 94 VAL VAL E . n 
E 4 74 VAL 74 95 95 VAL VAL E . n 
E 4 75 THR 75 96 96 THR THR E . n 
E 4 76 ALA 76 97 97 ALA ALA E . n 
E 4 77 LYS 77 98 98 LYS LYS E . n 
F 3 1  PRO 1  10 10 PRO PRO F . n 
F 3 2  PRO 2  11 11 PRO PRO F . n 
F 3 3  ALA 3  12 12 ALA ALA F . n 
F 3 4  LEU 4  13 13 LEU LEU F . n 
F 3 5  HIS 5  14 14 HIS HIS F . n 
F 3 6  LEU 6  15 15 LEU LEU F . n 
F 3 7  VAL 7  16 16 VAL VAL F . n 
F 3 8  ASP 8  17 17 ASP ASP F . n 
F 3 9  PRO 9  18 18 PRO PRO F . n 
F 3 10 GLN 10 19 19 GLN GLN F . n 
F 3 11 ILE 11 20 20 ILE ILE F . n 
F 3 12 GLN 12 21 21 GLN GLN F . n 
F 3 13 LEU 13 22 22 LEU LEU F . n 
F 3 14 THR 14 23 23 THR THR F . n 
F 3 15 ILE 15 24 24 ILE ILE F . n 
F 3 16 THR 16 25 25 THR THR F . n 
F 3 17 ASP 17 39 39 ASP ASP F . n 
F 3 18 PRO 18 40 40 PRO PRO F . n 
F 3 19 LYS 19 41 41 LYS LYS F . n 
F 3 20 VAL 20 42 42 VAL VAL F . n 
F 3 21 TYR 21 43 43 TYR TYR F . n 
F 3 22 PRO 22 44 44 PRO PRO F . n 
F 3 23 ILE 23 45 45 ILE ILE F . n 
F 3 24 ILE 24 46 46 ILE ILE F . n 
F 3 25 LEU 25 47 47 LEU LEU F . n 
F 3 26 ARG 26 48 48 ARG ARG F . n 
F 3 27 LEU 27 49 49 LEU LEU F . n 
F 3 28 GLY 28 50 50 GLY GLY F . n 
F 3 29 SER 29 51 51 SER SER F . n 
F 3 30 ASN 30 52 52 ASN ASN F . n 
F 3 31 LEU 31 53 53 LEU LEU F . n 
F 3 32 SER 32 54 54 SER SER F . n 
F 3 33 LEU 33 55 55 LEU LEU F . n 
F 3 34 SER 34 56 56 SER SER F . n 
F 3 35 MET 35 57 57 MET MET F . n 
F 3 36 ALA 36 58 58 ALA ALA F . n 
F 3 37 ARG 37 59 59 ARG ARG F . n 
F 3 38 ARG 38 60 60 ARG ARG F . n 
F 3 39 ASN 39 61 61 ASN ASN F . n 
F 3 40 LEU 40 62 62 LEU LEU F . n 
F 3 41 ASP 41 63 63 ASP ASP F . n 
F 3 42 SER 42 64 64 SER SER F . n 
F 3 43 LEU 43 65 65 LEU LEU F . n 
F 3 44 GLU 44 66 66 GLU GLU F . n 
F 3 45 ALA 45 67 67 ALA ALA F . n 
F 3 46 ARG 46 68 68 ARG ARG F . n 
F 3 47 ALA 47 69 69 ALA ALA F . n 
F 3 48 PHE 48 70 70 PHE PHE F . n 
F 3 49 GLN 49 71 71 GLN GLN F . n 
F 3 50 SER 50 72 72 SER SER F . n 
F 3 51 THR 51 73 73 THR THR F . n 
F 3 52 PRO 52 74 74 PRO PRO F . n 
F 3 53 ILE 53 75 75 ILE ILE F . n 
F 3 54 VAL 54 76 76 VAL VAL F . n 
F 3 55 VAL 55 77 77 VAL VAL F . n 
F 3 56 GLN 56 78 78 GLN GLN F . n 
F 3 57 MET 57 79 79 MET MET F . n 
F 3 58 THR 58 80 80 THR THR F . n 
F 3 59 LYS 59 81 81 LYS LYS F . n 
F 3 60 LEU 60 82 82 LEU LEU F . n 
F 3 61 ALA 61 83 83 ALA ALA F . n 
F 3 62 THR 62 84 84 THR THR F . n 
F 3 63 THR 63 85 85 THR THR F . n 
F 3 64 GLU 64 86 86 GLU GLU F . n 
F 3 65 GLU 65 87 87 GLU GLU F . n 
F 3 66 LEU 66 88 88 LEU LEU F . n 
F 3 67 PRO 67 89 89 PRO PRO F . n 
F 3 68 ASP 68 90 90 ASP ASP F . n 
F 3 69 GLU 69 91 91 GLU GLU F . n 
F 3 70 PHE 70 92 92 PHE PHE F . n 
F 3 71 VAL 71 93 93 VAL VAL F . n 
F 3 72 VAL 72 94 94 VAL VAL F . n 
F 3 73 VAL 73 95 95 VAL VAL F . n 
F 3 74 THR 74 96 96 THR THR F . n 
F 3 75 ALA 75 97 97 ALA ALA F . n 
F 3 76 LYS 76 98 98 LYS LYS F . n 
G 4 1  VAL 1  9  9  VAL VAL G . n 
G 4 2  PRO 2  10 10 PRO PRO G . n 
G 4 3  PRO 3  11 11 PRO PRO G . n 
G 4 4  ALA 4  12 12 ALA ALA G . n 
G 4 5  LEU 5  13 13 LEU LEU G . n 
G 4 6  HIS 6  14 14 HIS HIS G . n 
G 4 7  LEU 7  15 15 LEU LEU G . n 
G 4 8  VAL 8  16 16 VAL VAL G . n 
G 4 9  ASP 9  17 17 ASP ASP G . n 
G 4 10 PRO 10 18 18 PRO PRO G . n 
G 4 11 GLN 11 19 19 GLN GLN G . n 
G 4 12 ILE 12 20 20 ILE ILE G . n 
G 4 13 GLN 13 21 21 GLN GLN G . n 
G 4 14 LEU 14 22 22 LEU LEU G . n 
G 4 15 THR 15 23 23 THR THR G . n 
G 4 16 ILE 16 24 24 ILE ILE G . n 
G 4 17 THR 17 25 25 THR THR G . n 
G 4 18 ASP 18 39 39 ASP ASP G . n 
G 4 19 PRO 19 40 40 PRO PRO G . n 
G 4 20 LYS 20 41 41 LYS LYS G . n 
G 4 21 VAL 21 42 42 VAL VAL G . n 
G 4 22 TYR 22 43 43 TYR TYR G . n 
G 4 23 PRO 23 44 44 PRO PRO G . n 
G 4 24 ILE 24 45 45 ILE ILE G . n 
G 4 25 ILE 25 46 46 ILE ILE G . n 
G 4 26 LEU 26 47 47 LEU LEU G . n 
G 4 27 ARG 27 48 48 ARG ARG G . n 
G 4 28 LEU 28 49 49 LEU LEU G . n 
G 4 29 GLY 29 50 50 GLY GLY G . n 
G 4 30 SER 30 51 51 SER SER G . n 
G 4 31 ASN 31 52 52 ASN ASN G . n 
G 4 32 LEU 32 53 53 LEU LEU G . n 
G 4 33 SER 33 54 54 SER SER G . n 
G 4 34 LEU 34 55 55 LEU LEU G . n 
G 4 35 SER 35 56 56 SER SER G . n 
G 4 36 MET 36 57 57 MET MET G . n 
G 4 37 ALA 37 58 58 ALA ALA G . n 
G 4 38 ARG 38 59 59 ARG ARG G . n 
G 4 39 ARG 39 60 60 ARG ARG G . n 
G 4 40 ASN 40 61 61 ASN ASN G . n 
G 4 41 LEU 41 62 62 LEU LEU G . n 
G 4 42 ASP 42 63 63 ASP ASP G . n 
G 4 43 SER 43 64 64 SER SER G . n 
G 4 44 LEU 44 65 65 LEU LEU G . n 
G 4 45 GLU 45 66 66 GLU GLU G . n 
G 4 46 ALA 46 67 67 ALA ALA G . n 
G 4 47 ARG 47 68 68 ARG ARG G . n 
G 4 48 ALA 48 69 69 ALA ALA G . n 
G 4 49 PHE 49 70 70 PHE PHE G . n 
G 4 50 GLN 50 71 71 GLN GLN G . n 
G 4 51 SER 51 72 72 SER SER G . n 
G 4 52 THR 52 73 73 THR THR G . n 
G 4 53 PRO 53 74 74 PRO PRO G . n 
G 4 54 ILE 54 75 75 ILE ILE G . n 
G 4 55 VAL 55 76 76 VAL VAL G . n 
G 4 56 VAL 56 77 77 VAL VAL G . n 
G 4 57 GLN 57 78 78 GLN GLN G . n 
G 4 58 MET 58 79 79 MET MET G . n 
G 4 59 THR 59 80 80 THR THR G . n 
G 4 60 LYS 60 81 81 LYS LYS G . n 
G 4 61 LEU 61 82 82 LEU LEU G . n 
G 4 62 ALA 62 83 83 ALA ALA G . n 
G 4 63 THR 63 84 84 THR THR G . n 
G 4 64 THR 64 85 85 THR THR G . n 
G 4 65 GLU 65 86 86 GLU GLU G . n 
G 4 66 GLU 66 87 87 GLU GLU G . n 
G 4 67 LEU 67 88 88 LEU LEU G . n 
G 4 68 PRO 68 89 89 PRO PRO G . n 
G 4 69 ASP 69 90 90 ASP ASP G . n 
G 4 70 GLU 70 91 91 GLU GLU G . n 
G 4 71 PHE 71 92 92 PHE PHE G . n 
G 4 72 VAL 72 93 93 VAL VAL G . n 
G 4 73 VAL 73 94 94 VAL VAL G . n 
G 4 74 VAL 74 95 95 VAL VAL G . n 
G 4 75 THR 75 96 96 THR THR G . n 
G 4 76 ALA 76 97 97 ALA ALA G . n 
G 4 77 LYS 77 98 98 LYS LYS G . n 
H 3 1  PRO 1  10 10 PRO PRO H . n 
H 3 2  PRO 2  11 11 PRO PRO H . n 
H 3 3  ALA 3  12 12 ALA ALA H . n 
H 3 4  LEU 4  13 13 LEU LEU H . n 
H 3 5  HIS 5  14 14 HIS HIS H . n 
H 3 6  LEU 6  15 15 LEU LEU H . n 
H 3 7  VAL 7  16 16 VAL VAL H . n 
H 3 8  ASP 8  17 17 ASP ASP H . n 
H 3 9  PRO 9  18 18 PRO PRO H . n 
H 3 10 GLN 10 19 19 GLN GLN H . n 
H 3 11 ILE 11 20 20 ILE ILE H . n 
H 3 12 GLN 12 21 21 GLN GLN H . n 
H 3 13 LEU 13 22 22 LEU LEU H . n 
H 3 14 THR 14 23 23 THR THR H . n 
H 3 15 ILE 15 24 24 ILE ILE H . n 
H 3 16 THR 16 25 25 THR THR H . n 
H 3 17 ASP 17 39 39 ASP ASP H . n 
H 3 18 PRO 18 40 40 PRO PRO H . n 
H 3 19 LYS 19 41 41 LYS LYS H . n 
H 3 20 VAL 20 42 42 VAL VAL H . n 
H 3 21 TYR 21 43 43 TYR TYR H . n 
H 3 22 PRO 22 44 44 PRO PRO H . n 
H 3 23 ILE 23 45 45 ILE ILE H . n 
H 3 24 ILE 24 46 46 ILE ILE H . n 
H 3 25 LEU 25 47 47 LEU LEU H . n 
H 3 26 ARG 26 48 48 ARG ARG H . n 
H 3 27 LEU 27 49 49 LEU LEU H . n 
H 3 28 GLY 28 50 50 GLY GLY H . n 
H 3 29 SER 29 51 51 SER SER H . n 
H 3 30 ASN 30 52 52 ASN ASN H . n 
H 3 31 LEU 31 53 53 LEU LEU H . n 
H 3 32 SER 32 54 54 SER SER H . n 
H 3 33 LEU 33 55 55 LEU LEU H . n 
H 3 34 SER 34 56 56 SER SER H . n 
H 3 35 MET 35 57 57 MET MET H . n 
H 3 36 ALA 36 58 58 ALA ALA H . n 
H 3 37 ARG 37 59 59 ARG ARG H . n 
H 3 38 ARG 38 60 60 ARG ARG H . n 
H 3 39 ASN 39 61 61 ASN ASN H . n 
H 3 40 LEU 40 62 62 LEU LEU H . n 
H 3 41 ASP 41 63 63 ASP ASP H . n 
H 3 42 SER 42 64 64 SER SER H . n 
H 3 43 LEU 43 65 65 LEU LEU H . n 
H 3 44 GLU 44 66 66 GLU GLU H . n 
H 3 45 ALA 45 67 67 ALA ALA H . n 
H 3 46 ARG 46 68 68 ARG ARG H . n 
H 3 47 ALA 47 69 69 ALA ALA H . n 
H 3 48 PHE 48 70 70 PHE PHE H . n 
H 3 49 GLN 49 71 71 GLN GLN H . n 
H 3 50 SER 50 72 72 SER SER H . n 
H 3 51 THR 51 73 73 THR THR H . n 
H 3 52 PRO 52 74 74 PRO PRO H . n 
H 3 53 ILE 53 75 75 ILE ILE H . n 
H 3 54 VAL 54 76 76 VAL VAL H . n 
H 3 55 VAL 55 77 77 VAL VAL H . n 
H 3 56 GLN 56 78 78 GLN GLN H . n 
H 3 57 MET 57 79 79 MET MET H . n 
H 3 58 THR 58 80 80 THR THR H . n 
H 3 59 LYS 59 81 81 LYS LYS H . n 
H 3 60 LEU 60 82 82 LEU LEU H . n 
H 3 61 ALA 61 83 83 ALA ALA H . n 
H 3 62 THR 62 84 84 THR THR H . n 
H 3 63 THR 63 85 85 THR THR H . n 
H 3 64 GLU 64 86 86 GLU GLU H . n 
H 3 65 GLU 65 87 87 GLU GLU H . n 
H 3 66 LEU 66 88 88 LEU LEU H . n 
H 3 67 PRO 67 89 89 PRO PRO H . n 
H 3 68 ASP 68 90 90 ASP ASP H . n 
H 3 69 GLU 69 91 91 GLU GLU H . n 
H 3 70 PHE 70 92 92 PHE PHE H . n 
H 3 71 VAL 71 93 93 VAL VAL H . n 
H 3 72 VAL 72 94 94 VAL VAL H . n 
H 3 73 VAL 73 95 95 VAL VAL H . n 
H 3 74 THR 74 96 96 THR THR H . n 
H 3 75 ALA 75 97 97 ALA ALA H . n 
H 3 76 LYS 76 98 98 LYS LYS H . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
I 5 D10 1 1099 1099 D10 D10 B . 
J 5 D10 1 1099 1099 D10 D10 C . 
K 5 D10 1 1099 1099 D10 D10 F . 
L 5 D10 1 1099 1099 D10 D10 H . 
M 6 HOH 1 2001 2001 HOH HOH B . 
M 6 HOH 2 2002 2002 HOH HOH B . 
N 6 HOH 1 2001 2001 HOH HOH C . 
O 6 HOH 1 2001 2001 HOH HOH D . 
P 6 HOH 1 2001 2001 HOH HOH F . 
Q 6 HOH 1 2001 2001 HOH HOH G . 
R 6 HOH 1 2001 2001 HOH HOH H . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PQS dimeric 2 
2 author_and_software_defined_assembly PQS dimeric 2 
3 author_and_software_defined_assembly PQS dimeric 2 
4 author_and_software_defined_assembly PQS dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,I,M   
2 1 C,D,J,N,O 
3 1 E,F,K,P   
4 1 G,H,L,Q,R 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-07-19 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS       refinement       1.1 ? 1 
DENZO     'data reduction' .   ? 2 
SCALEPACK 'data scaling'   .   ? 3 
SHELX     phasing          .   ? 4 
# 
_pdbx_database_remark.id     700 
_pdbx_database_remark.text   
;
SHEET
THE SHEET STRUCTURE OF THIS MOLECULE IS BIFURCATED. IN
ORDER TO REPRESENT THIS FEATURE IN THE SHEET RECORDS BELOW,
TWO SHEETS ARE DEFINED.
;
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   C 
_pdbx_validate_close_contact.auth_comp_id_1   ASP 
_pdbx_validate_close_contact.auth_seq_id_1    39 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   N 
_pdbx_validate_close_contact.auth_asym_id_2   C 
_pdbx_validate_close_contact.auth_comp_id_2   LYS 
_pdbx_validate_close_contact.auth_seq_id_2    41 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.13 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 C A VAL 9  ? ? N  A PRO 10 ? ? CA A PRO 10 ? ? 132.23 119.30 12.93  1.50 Y 
2 1 N A THR 25 ? ? CA A THR 25 ? ? C  A THR 25 ? ? 140.47 111.00 29.47  2.70 N 
3 1 N A ALA 38 ? ? CA A ALA 38 ? ? C  A ALA 38 ? ? 132.87 111.00 21.87  2.70 N 
4 1 N A ASP 39 ? ? CA A ASP 39 ? ? C  A ASP 39 ? ? 92.12  111.00 -18.88 2.70 N 
5 1 N B GLY 50 ? ? CA B GLY 50 ? ? C  B GLY 50 ? ? 96.06  113.10 -17.04 2.50 N 
6 1 C E PRO 10 ? ? N  E PRO 11 ? ? CA E PRO 11 ? ? 135.84 119.30 16.54  1.50 Y 
7 1 C E PRO 10 ? ? N  E PRO 11 ? ? CD E PRO 11 ? ? 111.28 128.40 -17.12 2.10 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PRO A 10 ? ? 2.26    -152.68 
2  1 ASP A 17 ? ? -34.39  167.56  
3  1 ALA A 38 ? ? 99.37   -36.88  
4  1 ASP A 39 ? ? -154.80 -31.63  
5  1 PRO A 40 ? ? -34.73  166.50  
6  1 ARG A 48 ? ? -106.47 43.15   
7  1 LEU A 65 ? ? -160.72 -0.78   
8  1 ARG A 68 ? ? -4.02   126.28  
9  1 GLN A 78 ? ? -91.39  34.11   
10 1 PHE A 92 ? ? 172.76  161.38  
11 1 PRO B 11 ? ? -37.21  82.37   
12 1 ALA B 12 ? ? -33.81  143.67  
13 1 ASP B 17 ? ? -32.91  152.72  
14 1 ARG B 26 ? ? 176.71  129.73  
15 1 ALA B 38 ? ? 77.68   -56.70  
16 1 ASP B 39 ? ? 153.62  -29.31  
17 1 PRO B 40 ? ? -69.83  -158.37 
18 1 LYS B 41 ? ? 74.11   95.30   
19 1 PRO B 44 ? ? -58.08  172.53  
20 1 ARG B 48 ? ? -101.30 40.96   
21 1 LEU B 65 ? ? -140.48 15.80   
22 1 GLN B 78 ? ? -91.90  35.70   
23 1 ALA B 97 ? ? -68.00  55.46   
24 1 PRO C 11 ? ? -20.34  145.44  
25 1 ALA C 12 ? ? -59.51  171.24  
26 1 ASP C 17 ? ? -37.76  163.54  
27 1 THR C 25 ? ? -7.59   83.68   
28 1 ASP C 39 ? ? 121.70  137.08  
29 1 PRO C 40 ? ? -32.50  18.63   
30 1 ARG C 48 ? ? -94.38  30.33   
31 1 LEU C 49 ? ? -26.30  105.20  
32 1 ASN C 52 ? ? -116.86 78.05   
33 1 GLN C 78 ? ? -86.67  41.70   
34 1 ALA C 97 ? ? -67.85  52.77   
35 1 ASP D 17 ? ? -36.54  154.19  
36 1 ASP D 39 ? ? 72.54   120.26  
37 1 PRO D 40 ? ? -21.68  93.11   
38 1 PRO D 44 ? ? -56.29  170.89  
39 1 LEU D 49 ? ? 80.64   87.11   
40 1 LEU D 53 ? ? -38.10  151.93  
41 1 LEU D 65 ? ? -151.63 1.93    
42 1 GLN D 78 ? ? -95.20  36.47   
43 1 ALA D 97 ? ? -57.62  57.02   
44 1 PRO E 10 ? ? 16.83   111.31  
45 1 PRO E 11 ? ? 5.67    163.80  
46 1 ASP E 17 ? ? -30.59  165.85  
47 1 GLN E 19 ? ? -30.13  -37.71  
48 1 THR E 25 ? ? -43.57  86.77   
49 1 ASP E 39 ? ? 118.10  138.33  
50 1 PRO E 40 ? ? -39.99  73.13   
51 1 LEU E 49 ? ? 57.69   98.16   
52 1 ASN E 52 ? ? -108.88 61.82   
53 1 LEU E 53 ? ? -24.38  142.99  
54 1 LEU E 65 ? ? -143.35 -0.75   
55 1 PRO E 74 ? ? -39.61  140.31  
56 1 GLN E 78 ? ? -91.11  35.02   
57 1 THR E 96 ? ? -65.85  94.96   
58 1 ASP F 17 ? ? -28.42  152.46  
59 1 THR F 25 ? ? -19.23  102.22  
60 1 ASP F 39 ? ? 101.57  108.95  
61 1 PRO F 40 ? ? -12.09  71.30   
62 1 PRO F 44 ? ? -54.21  171.15  
63 1 LEU F 49 ? ? 65.55   104.01  
64 1 SER F 51 ? ? -99.07  -151.77 
65 1 LEU F 53 ? ? -42.60  150.50  
66 1 GLN F 78 ? ? -97.60  34.82   
67 1 MET F 79 ? ? -49.11  153.01  
68 1 ALA F 97 ? ? -63.15  46.13   
69 1 ASP G 17 ? ? -27.04  160.06  
70 1 GLN G 19 ? ? -29.58  -49.53  
71 1 THR G 25 ? ? -49.76  80.43   
72 1 ASP G 39 ? ? 123.59  126.68  
73 1 PRO G 40 ? ? -31.86  38.91   
74 1 ARG G 48 ? ? -98.96  40.01   
75 1 LEU G 49 ? ? -31.86  117.53  
76 1 SER G 51 ? ? -114.62 -158.93 
77 1 LEU G 53 ? ? -29.51  134.72  
78 1 GLN G 78 ? ? -90.80  35.09   
79 1 THR G 96 ? ? -69.63  95.28   
80 1 ALA G 97 ? ? -66.08  46.23   
81 1 ASP H 17 ? ? -33.65  150.05  
82 1 THR H 25 ? ? -33.79  138.19  
83 1 ASP H 39 ? ? 72.82   81.58   
84 1 PRO H 40 ? ? 5.09    58.15   
85 1 ARG H 48 ? ? -97.11  49.74   
86 1 LEU H 49 ? ? -38.99  102.63  
87 1 SER H 51 ? ? -107.33 -164.96 
88 1 LEU H 65 ? ? -146.21 -7.88   
89 1 GLN H 78 ? ? -93.51  37.99   
90 1 ALA H 97 ? ? -56.04  53.60   
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
5 DECANE D10 
6 water  HOH 
# 



If you find results from this site helpful for your research, please cite one of our papers:

elNémo is maintained by Yves-Henri Sanejouand.
It was developed by Karsten Suhre.
Between 2003 and 2014, it was hosted by IGS (Marseille).
Last modification: October 18th, 2018.