CNRS Nantes University UFIP UFIP
home |  start a new run |  job status |  references&downloads |  examples |  help  

Should you encounter any unexpected behaviour,
please let us know.


***  TRANSPORT PROTEIN 22-APR-18 6D6T  ***

elNémo ID: 19122306214594798

Job options:

ID        	=	 19122306214594798
JOBID     	=	 TRANSPORT PROTEIN 22-APR-18 6D6T
USERID    	=	 unknown
PRIVAT    	=	 0

NMODES    	=	 5
DQMIN     	=	 -100
DQMAX     	=	 100
DQSTEP    	=	 20
DOGRAPHS  	=	 on

DOPROJMODS	=	 on
DORMSD    	=	 on

NRBL      	=	 0
CUTOFF    	=	 0
CAONLY    	=	 0


Input data for this run:


HEADER    TRANSPORT PROTEIN                       22-APR-18   6D6T              
TITLE     HUMAN GABA-A RECEPTOR ALPHA1-BETA2-GAMMA2 SUBTYPE IN COMPLEX WITH GABA
TITLE    2 AND FLUMAZENIL, CONFORMATION B                                       
COMPND    MOL_ID: 1;                                                            
COMPND   2 MOLECULE: GAMMA-AMINOBUTYRIC ACID RECEPTOR SUBUNIT BETA-2,GAMMA-     
COMPND   3 AMINOBUTYRIC ACID RECEPTOR SUBUNIT BETA-2;                           
COMPND   4 CHAIN: A, C;                                                         
COMPND   5 SYNONYM: GABA(A) RECEPTOR SUBUNIT BETA-2,GABA(A) RECEPTOR SUBUNIT    
COMPND   6 BETA-2;                                                              
COMPND   7 ENGINEERED: YES;                                                     
COMPND   8 MOL_ID: 2;                                                           
COMPND   9 MOLECULE: GAMMA-AMINOBUTYRIC ACID RECEPTOR SUBUNIT ALPHA-1,GAMMA-    
COMPND  10 AMINOBUTYRIC ACID RECEPTOR SUBUNIT ALPHA-1;                          
COMPND  11 CHAIN: B, D;                                                         
COMPND  12 SYNONYM: GABA(A) RECEPTOR SUBUNIT ALPHA-1,GABA(A) RECEPTOR SUBUNIT   
COMPND  13 ALPHA-1;                                                             
COMPND  14 ENGINEERED: YES;                                                     
COMPND  15 MOL_ID: 3;                                                           
COMPND  16 MOLECULE: HUMAN GABA-A RECEPTOR SUBUNIT GAMMA-2;                     
COMPND  17 CHAIN: E;                                                            
COMPND  18 ENGINEERED: YES;                                                     
COMPND  19 MOL_ID: 4;                                                           
COMPND  20 MOLECULE: KAPPA FAB LIGHT CHAIN;                                     
COMPND  21 CHAIN: I, L;                                                         
COMPND  22 MOL_ID: 5;                                                           
COMPND  23 MOLECULE: IGG2B FAB HEAVY CHAIN;                                     
COMPND  24 CHAIN: J, K                                                          
SOURCE    MOL_ID: 1;                                                            
SOURCE   2 ORGANISM_SCIENTIFIC: HOMO SAPIENS;                                   
SOURCE   3 ORGANISM_COMMON: HUMAN;                                              
SOURCE   4 ORGANISM_TAXID: 9606;                                                
SOURCE   5 GENE: GABRB2;                                                        
SOURCE   6 EXPRESSION_SYSTEM: HOMO SAPIENS;                                     
SOURCE   7 EXPRESSION_SYSTEM_COMMON: HUMAN;                                     
SOURCE   8 EXPRESSION_SYSTEM_TAXID: 9606;                                       
SOURCE   9 EXPRESSION_SYSTEM_VARIANT: GNTI-;                                    
SOURCE  10 EXPRESSION_SYSTEM_CELL_LINE: HEK293;                                 
SOURCE  11 EXPRESSION_SYSTEM_ATCC_NUMBER: CRL-3022;                             
SOURCE  12 EXPRESSION_SYSTEM_PLASMID: PEZT-BM;                                  
SOURCE  13 MOL_ID: 2;                                                           
SOURCE  14 ORGANISM_SCIENTIFIC: HOMO SAPIENS;                                   
SOURCE  15 ORGANISM_COMMON: HUMAN;                                              
SOURCE  16 ORGANISM_TAXID: 9606;                                                
SOURCE  17 GENE: GABRA1;                                                        
SOURCE  18 EXPRESSION_SYSTEM: HOMO SAPIENS;                                     
SOURCE  19 EXPRESSION_SYSTEM_COMMON: HUMAN;                                     
SOURCE  20 EXPRESSION_SYSTEM_TAXID: 9606;                                       
SOURCE  21 EXPRESSION_SYSTEM_VARIANT: GNTI-;                                    
SOURCE  22 EXPRESSION_SYSTEM_CELL_LINE: HEK293;                                 
SOURCE  23 EXPRESSION_SYSTEM_ATCC_NUMBER: CRL-3022;                             
SOURCE  24 MOL_ID: 3;                                                           
SOURCE  25 ORGANISM_SCIENTIFIC: HOMO SAPIENS;                                   
SOURCE  26 ORGANISM_COMMON: HUMAN;                                              
SOURCE  27 ORGANISM_TAXID: 9606;                                                
SOURCE  28 GENE: GABRG2;                                                        
SOURCE  29 EXPRESSION_SYSTEM: HOMO SAPIENS;                                     
SOURCE  30 EXPRESSION_SYSTEM_COMMON: HUMAN;                                     
SOURCE  31 EXPRESSION_SYSTEM_TAXID: 9606;                                       
SOURCE  32 EXPRESSION_SYSTEM_VARIANT: GNTI-;                                    
SOURCE  33 EXPRESSION_SYSTEM_CELL_LINE: HEK293;                                 
SOURCE  34 EXPRESSION_SYSTEM_ATCC_NUMBER: CRL-3022;                             
SOURCE  35 EXPRESSION_SYSTEM_PLASMID: PEZT-BM;                                  
SOURCE  36 MOL_ID: 4;                                                           
SOURCE  37 ORGANISM_SCIENTIFIC: MUS MUSCULUS;                                   
SOURCE  38 ORGANISM_COMMON: HOUSE MOUSE;                                        
SOURCE  39 ORGANISM_TAXID: 10090;                                               
SOURCE  40 STRAIN: BALB/C;                                                      
SOURCE  41 MOL_ID: 5;                                                           
SOURCE  42 ORGANISM_SCIENTIFIC: MUS MUSCULUS;                                   
SOURCE  43 ORGANISM_COMMON: HOUSE MOUSE;                                        
SOURCE  44 ORGANISM_TAXID: 10090;                                               
SOURCE  45 STRAIN: BALB/C                                                       
KEYWDS    LIGAND-GATED ION CHANNEL, GABA-A RECEPTOR, CYS-LOOP RECEPTOR,         
KEYWDS   2 TRANSPORT PROTEIN                                                    
EXPDTA    ELECTRON MICROSCOPY                                                   
AUTHOR    S.ZHU,C.M.NOVIELLO,J.TENG,R.M.WALSH JR,J.J.KIM,R.E.HIBBS              
REVDAT   4   18-DEC-19 6D6T    1       CRYST1 SCALE                             
REVDAT   3   18-JUL-18 6D6T    1       JRNL                                     
REVDAT   2   11-JUL-18 6D6T    1       JRNL                                     
REVDAT   1   27-JUN-18 6D6T    0                                                
JRNL        AUTH   S.ZHU,C.M.NOVIELLO,J.TENG,R.M.WALSH,J.J.KIM,R.E.HIBBS        
JRNL        TITL   STRUCTURE OF A HUMAN SYNAPTIC GABAARECEPTOR.                 
JRNL        REF    NATURE                        V. 559    67 2018              
JRNL        REFN                   ESSN 1476-4687                               
JRNL        PMID   29950725                                                     
JRNL        DOI    10.1038/S41586-018-0255-3                                    
REMARK   2                                                                      
REMARK   2 RESOLUTION.    3.80 ANGSTROMS.                                       
REMARK   3                                                                      
REMARK   3 REFINEMENT.                                                          
REMARK   3   SOFTWARE PACKAGES      : RELION, EPU, GCTF, COOT, RELION,          
REMARK   3                            RELION, RELION, RELION, PHENIX            
REMARK   3   RECONSTRUCTION SCHEMA  : BACK PROJECTION                           
REMARK   3                                                                      
REMARK   3 EM MAP-MODEL FITTING AND REFINEMENT                                  
REMARK   3   PDB ENTRY                    : NULL                                
REMARK   3   REFINEMENT SPACE             : REAL                                
REMARK   3   REFINEMENT PROTOCOL          : AB INITIO MODEL                     
REMARK   3   REFINEMENT TARGET            : NULL                                
REMARK   3   OVERALL ANISOTROPIC B VALUE  : NULL                                
REMARK   3                                                                      
REMARK   3 FITTING PROCEDURE : NULL                                             
REMARK   3                                                                      
REMARK   3 EM IMAGE RECONSTRUCTION STATISTICS                                   
REMARK   3   NOMINAL PIXEL SIZE (ANGSTROMS)    : NULL                           
REMARK   3   ACTUAL PIXEL SIZE  (ANGSTROMS)    : NULL                           
REMARK   3   EFFECTIVE RESOLUTION (ANGSTROMS)  : 3.860                          
REMARK   3   NUMBER OF PARTICLES               : 200442                         
REMARK   3   CTF CORRECTION METHOD             : PHASE FLIPPING AND AMPLITUDE   
REMARK   3                                       CORRECTION                     
REMARK   3                                                                      
REMARK   3 EM RECONSTRUCTION MAGNIFICATION CALIBRATION: NULL                    
REMARK   3                                                                      
REMARK   3 OTHER DETAILS: NULL                                                  
REMARK   4                                                                      
REMARK   4 6D6T COMPLIES WITH FORMAT V. 3.30, 13-JUL-11                         
REMARK 100                                                                      
REMARK 100 THIS ENTRY HAS BEEN PROCESSED BY RCSB ON 25-APR-18.                  
REMARK 100 THE DEPOSITION ID IS D_1000233990.                                   
REMARK 245                                                                      
REMARK 245 EXPERIMENTAL DETAILS                                                 
REMARK 245   RECONSTRUCTION METHOD          : SINGLE PARTICLE                   
REMARK 245   SPECIMEN TYPE                  : NULL                              
REMARK 245                                                                      
REMARK 245 ELECTRON MICROSCOPE SAMPLE                                           
REMARK 245   SAMPLE TYPE                    : PARTICLE                          
REMARK 245   PARTICLE TYPE                  : POINT                             
REMARK 245   NAME OF SAMPLE                 : HUMAN GABA-A RECEPTOR ALPHA1      
REMARK 245                                    -BETA2-GAMMA2 SUBTYPE IN          
REMARK 245                                    COMPLEX WITH GABA AND             
REMARK 245                                    FLUMAZENIL, CONFORMATION B        
REMARK 245   SAMPLE CONCENTRATION (MG ML-1) : 6.00                              
REMARK 245   SAMPLE SUPPORT DETAILS         : SAMPLE WAS GLOW DISCHARGED AT     
REMARK 245                                    30 MA FOR 80 SECONDS USING A      
REMARK 245                                    PELCO EASIGLOW                    
REMARK 245   SAMPLE VITRIFICATION DETAILS   : 3 SECONDS BLOT TIME               
REMARK 245   SAMPLE BUFFER                  : NULL                              
REMARK 245   PH                             : 7.40                              
REMARK 245   SAMPLE DETAILS                 : FAB FRAGMENTS GENERATED BY        
REMARK 245  PROTEOLYTIC CLEAVAGE OF IGG ANTIBODY                                
REMARK 245                                                                      
REMARK 245 DATA ACQUISITION                                                     
REMARK 245   DATE OF EXPERIMENT                : NULL                           
REMARK 245   NUMBER OF MICROGRAPHS-IMAGES      : 5594                           
REMARK 245   TEMPERATURE (KELVIN)              : NULL                           
REMARK 245   MICROSCOPE MODEL                  : FEI TITAN KRIOS                
REMARK 245   DETECTOR TYPE                     : GATAN K2 SUMMIT (4K X 4K)      
REMARK 245   MINIMUM DEFOCUS (NM)              : 500.00                         
REMARK 245   MAXIMUM DEFOCUS (NM)              : 4500.00                        
REMARK 245   MINIMUM TILT ANGLE (DEGREES)      : NULL                           
REMARK 245   MAXIMUM TILT ANGLE (DEGREES)      : NULL                           
REMARK 245   NOMINAL CS                        : 2.70                           
REMARK 245   IMAGING MODE                      : BRIGHT FIELD                   
REMARK 245   ELECTRON DOSE (ELECTRONS NM**-2)  : 47.00                          
REMARK 245   ILLUMINATION MODE                 : FLOOD BEAM                     
REMARK 245   NOMINAL MAGNIFICATION             : NULL                           
REMARK 245   CALIBRATED MAGNIFICATION          : 46730                          
REMARK 245   SOURCE                            : FIELD EMISSION GUN             
REMARK 245   ACCELERATION VOLTAGE (KV)         : 300                            
REMARK 245   IMAGING DETAILS                   : NULL                           
REMARK 247                                                                      
REMARK 247 ELECTRON MICROSCOPY                                                  
REMARK 247  THE COORDINATES IN THIS ENTRY WERE GENERATED FROM ELECTRON          
REMARK 247  MICROSCOPY DATA. PROTEIN DATA BANK CONVENTIONS REQUIRE              
REMARK 247  THAT CRYST1 AND SCALE RECORDS BE INCLUDED, BUT THE VALUES           
REMARK 247  ON THESE RECORDS ARE MEANINGLESS EXCEPT FOR THE CALCULATION         
REMARK 247  OF THE STRUCTURE FACTORS.                                           
REMARK 300                                                                      
REMARK 300 BIOMOLECULE: 1                                                       
REMARK 300 SEE REMARK 350 FOR THE AUTHOR PROVIDED AND/OR PROGRAM                
REMARK 300 GENERATED ASSEMBLY INFORMATION FOR THE STRUCTURE IN                  
REMARK 300 THIS ENTRY. THE REMARK MAY ALSO PROVIDE INFORMATION ON               
REMARK 300 BURIED SURFACE AREA.                                                 
REMARK 350                                                                      
REMARK 350 COORDINATES FOR A COMPLETE MULTIMER REPRESENTING THE KNOWN           
REMARK 350 BIOLOGICALLY SIGNIFICANT OLIGOMERIZATION STATE OF THE                
REMARK 350 MOLECULE CAN BE GENERATED BY APPLYING BIOMT TRANSFORMATIONS          
REMARK 350 GIVEN BELOW.  BOTH NON-CRYSTALLOGRAPHIC AND                          
REMARK 350 CRYSTALLOGRAPHIC OPERATIONS ARE GIVEN.                               
REMARK 350                                                                      
REMARK 350 BIOMOLECULE: 1                                                       
REMARK 350 AUTHOR DETERMINED BIOLOGICAL UNIT: NONAMERIC                         
REMARK 350 APPLY THE FOLLOWING TO CHAINS: A, B, C, D, E, I, J, L, K             
REMARK 350   BIOMT1   1  1.000000  0.000000  0.000000        0.00000            
REMARK 350   BIOMT2   1  0.000000  1.000000  0.000000        0.00000            
REMARK 350   BIOMT3   1  0.000000  0.000000  1.000000        0.00000            
REMARK 465                                                                      
REMARK 465 MISSING RESIDUES                                                     
REMARK 465 THE FOLLOWING RESIDUES WERE NOT LOCATED IN THE                       
REMARK 465 EXPERIMENT. (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN               
REMARK 465 IDENTIFIER; SSSEQ=SEQUENCE NUMBER; I=INSERTION CODE.)                
REMARK 465                                                                      
REMARK 465   M RES C SSSEQI                                                     
REMARK 465     GLN A     1                                                      
REMARK 465     SER A     2                                                      
REMARK 465     VAL A     3                                                      
REMARK 465     ASN A     4                                                      
REMARK 465     ASP A     5                                                      
REMARK 465     PRO A     6                                                      
REMARK 465     SER A     7                                                      
REMARK 465     ASN A   341                                                      
REMARK 465     GLN B     1                                                      
REMARK 465     PRO B     2                                                      
REMARK 465     SER B     3                                                      
REMARK 465     LEU B     4                                                      
REMARK 465     GLN B     5                                                      
REMARK 465     ASP B     6                                                      
REMARK 465     GLU B     7                                                      
REMARK 465     LEU B     8                                                      
REMARK 465     LYS B     9                                                      
REMARK 465     ASP B    10                                                      
REMARK 465     ASN B    11                                                      
REMARK 465     THR B    12                                                      
REMARK 465     ASN B   346                                                      
REMARK 465     ARG B   347                                                      
REMARK 465     GLU B   348                                                      
REMARK 465     PRO B   349                                                      
REMARK 465     GLN B   350                                                      
REMARK 465     LEU B   351                                                      
REMARK 465     LYS B   352                                                      
REMARK 465     ALA B   353                                                      
REMARK 465     PRO B   354                                                      
REMARK 465     THR B   355                                                      
REMARK 465     PRO B   356                                                      
REMARK 465     HIS B   357                                                      
REMARK 465     GLN B   358                                                      
REMARK 465     GLN C     1                                                      
REMARK 465     SER C     2                                                      
REMARK 465     VAL C     3                                                      
REMARK 465     ASN C     4                                                      
REMARK 465     ASP C     5                                                      
REMARK 465     PRO C     6                                                      
REMARK 465     SER C     7                                                      
REMARK 465     ASN C   341                                                      
REMARK 465     GLN D     1                                                      
REMARK 465     PRO D     2                                                      
REMARK 465     SER D     3                                                      
REMARK 465     LEU D     4                                                      
REMARK 465     GLN D     5                                                      
REMARK 465     ASP D     6                                                      
REMARK 465     GLU D     7                                                      
REMARK 465     LEU D     8                                                      
REMARK 465     LYS D     9                                                      
REMARK 465     ASP D    10                                                      
REMARK 465     GLU D   348                                                      
REMARK 465     PRO D   349                                                      
REMARK 465     GLN D   350                                                      
REMARK 465     LEU D   351                                                      
REMARK 465     LYS D   352                                                      
REMARK 465     ALA D   353                                                      
REMARK 465     PRO D   354                                                      
REMARK 465     THR D   355                                                      
REMARK 465     PRO D   356                                                      
REMARK 465     HIS D   357                                                      
REMARK 465     GLN D   358                                                      
REMARK 465     TRP E   -36                                                      
REMARK 465     SER E   -35                                                      
REMARK 465     HIS E   -34                                                      
REMARK 465     PRO E   -33                                                      
REMARK 465     GLN E   -32                                                      
REMARK 465     PHE E   -31                                                      
REMARK 465     GLU E   -30                                                      
REMARK 465     LYS E   -29                                                      
REMARK 465     GLY E   -28                                                      
REMARK 465     GLY E   -27                                                      
REMARK 465     GLY E   -26                                                      
REMARK 465     SER E   -25                                                      
REMARK 465     GLY E   -24                                                      
REMARK 465     GLY E   -23                                                      
REMARK 465     GLY E   -22                                                      
REMARK 465     SER E   -21                                                      
REMARK 465     GLY E   -20                                                      
REMARK 465     GLY E   -19                                                      
REMARK 465     SER E   -18                                                      
REMARK 465     SER E   -17                                                      
REMARK 465     ALA E   -16                                                      
REMARK 465     TRP E   -15                                                      
REMARK 465     SER E   -14                                                      
REMARK 465     HIS E   -13                                                      
REMARK 465     PRO E   -12                                                      
REMARK 465     GLN E   -11                                                      
REMARK 465     PHE E   -10                                                      
REMARK 465     GLU E    -9                                                      
REMARK 465     LYS E    -8                                                      
REMARK 465     LEU E    -7                                                      
REMARK 465     GLU E    -6                                                      
REMARK 465     VAL E    -5                                                      
REMARK 465     LEU E    -4                                                      
REMARK 465     PHE E    -3                                                      
REMARK 465     GLN E    -2                                                      
REMARK 465     GLY E    -1                                                      
REMARK 465     PRO E     0                                                      
REMARK 465     GLN E     1                                                      
REMARK 465     LYS E     2                                                      
REMARK 465     SER E     3                                                      
REMARK 465     ASP E     4                                                      
REMARK 465     ASP E     5                                                      
REMARK 465     ASP E     6                                                      
REMARK 465     TYR E     7                                                      
REMARK 465     GLU E     8                                                      
REMARK 465     ASP E     9                                                      
REMARK 465     TYR E    10                                                      
REMARK 465     ALA E    11                                                      
REMARK 465     SER E    12                                                      
REMARK 465     ASN E    13                                                      
REMARK 465     LYS E    14                                                      
REMARK 465     THR E    15                                                      
REMARK 465     TRP E    16                                                      
REMARK 465     VAL E    17                                                      
REMARK 465     LEU E    18                                                      
REMARK 465     THR E    19                                                      
REMARK 465     PRO E    20                                                      
REMARK 465     LYS E    21                                                      
REMARK 465     VAL E    22                                                      
REMARK 465     PRO E    23                                                      
REMARK 465     GLU E    24                                                      
REMARK 465     PHE E   158                                                      
REMARK 465     PRO E   159                                                      
REMARK 465     MET E   160                                                      
REMARK 465     ARG I   107                                                      
REMARK 465     ALA I   108                                                      
REMARK 465     ASP I   109                                                      
REMARK 465     ALA I   110                                                      
REMARK 465     ALA I   111                                                      
REMARK 465     PRO I   112                                                      
REMARK 465     THR I   113                                                      
REMARK 465     VAL I   114                                                      
REMARK 465     SER I   115                                                      
REMARK 465     ILE I   116                                                      
REMARK 465     PHE I   117                                                      
REMARK 465     PRO I   118                                                      
REMARK 465     PRO I   119                                                      
REMARK 465     SER I   120                                                      
REMARK 465     SER I   121                                                      
REMARK 465     GLU I   122                                                      
REMARK 465     GLN I   123                                                      
REMARK 465     LEU I   124                                                      
REMARK 465     THR I   125                                                      
REMARK 465     SER I   126                                                      
REMARK 465     GLY I   127                                                      
REMARK 465     GLY I   128                                                      
REMARK 465     ALA I   129                                                      
REMARK 465     SER I   130                                                      
REMARK 465     VAL I   131                                                      
REMARK 465     VAL I   132                                                      
REMARK 465     CYS I   133                                                      
REMARK 465     PHE I   134                                                      
REMARK 465     LEU I   135                                                      
REMARK 465     ASN I   136                                                      
REMARK 465     ASN I   137                                                      
REMARK 465     PHE I   138                                                      
REMARK 465     TYR I   139                                                      
REMARK 465     PRO I   140                                                      
REMARK 465     LYS I   141                                                      
REMARK 465     ASP I   142                                                      
REMARK 465     ILE I   143                                                      
REMARK 465     ASN I   144                                                      
REMARK 465     VAL I   145                                                      
REMARK 465     LYS I   146                                                      
REMARK 465     TRP I   147                                                      
REMARK 465     LYS I   148                                                      
REMARK 465     ILE I   149                                                      
REMARK 465     ASP I   150                                                      
REMARK 465     GLY I   151                                                      
REMARK 465     SER I   152                                                      
REMARK 465     GLU I   153                                                      
REMARK 465     ARG I   154                                                      
REMARK 465     GLN I   155                                                      
REMARK 465     ASN I   156                                                      
REMARK 465     GLY I   157                                                      
REMARK 465     VAL I   158                                                      
REMARK 465     LEU I   159                                                      
REMARK 465     ASN I   160                                                      
REMARK 465     SER I   161                                                      
REMARK 465     TRP I   162                                                      
REMARK 465     THR I   163                                                      
REMARK 465     ASP I   164                                                      
REMARK 465     GLN I   165                                                      
REMARK 465     ASP I   166                                                      
REMARK 465     SER I   167                                                      
REMARK 465     LYS I   168                                                      
REMARK 465     ASP I   169                                                      
REMARK 465     SER I   170                                                      
REMARK 465     THR I   171                                                      
REMARK 465     TYR I   172                                                      
REMARK 465     SER I   173                                                      
REMARK 465     MET I   174                                                      
REMARK 465     SER I   175                                                      
REMARK 465     SER I   176                                                      
REMARK 465     THR I   177                                                      
REMARK 465     LEU I   178                                                      
REMARK 465     THR I   179                                                      
REMARK 465     LEU I   180                                                      
REMARK 465     THR I   181                                                      
REMARK 465     LYS I   182                                                      
REMARK 465     ASP I   183                                                      
REMARK 465     GLU I   184                                                      
REMARK 465     TYR I   185                                                      
REMARK 465     GLU I   186                                                      
REMARK 465     ARG I   187                                                      
REMARK 465     HIS I   188                                                      
REMARK 465     ASN I   189                                                      
REMARK 465     SER I   190                                                      
REMARK 465     TYR I   191                                                      
REMARK 465     THR I   192                                                      
REMARK 465     CYS I   193                                                      
REMARK 465     GLU I   194                                                      
REMARK 465     ALA I   195                                                      
REMARK 465     THR I   196                                                      
REMARK 465     HIS I   197                                                      
REMARK 465     LYS I   198                                                      
REMARK 465     THR I   199                                                      
REMARK 465     SER I   200                                                      
REMARK 465     THR I   201                                                      
REMARK 465     SER I   202                                                      
REMARK 465     PRO I   203                                                      
REMARK 465     ILE I   204                                                      
REMARK 465     VAL I   205                                                      
REMARK 465     LYS I   206                                                      
REMARK 465     SER I   207                                                      
REMARK 465     PHE I   208                                                      
REMARK 465     ASN I   209                                                      
REMARK 465     ARG I   210                                                      
REMARK 465     ASN I   211                                                      
REMARK 465     GLU I   212                                                      
REMARK 465     CYS I   213                                                      
REMARK 465     GLU J     1                                                      
REMARK 465     THR J   118                                                      
REMARK 465     ALA J   119                                                      
REMARK 465     LYS J   120                                                      
REMARK 465     THR J   121                                                      
REMARK 465     THR J   122                                                      
REMARK 465     PRO J   123                                                      
REMARK 465     PRO J   124                                                      
REMARK 465     SER J   125                                                      
REMARK 465     VAL J   126                                                      
REMARK 465     TYR J   127                                                      
REMARK 465     PRO J   128                                                      
REMARK 465     LEU J   129                                                      
REMARK 465     ALA J   130                                                      
REMARK 465     PRO J   131                                                      
REMARK 465     GLY J   132                                                      
REMARK 465     CYS J   133                                                      
REMARK 465     GLY J   134                                                      
REMARK 465     ASP J   135                                                      
REMARK 465     THR J   136                                                      
REMARK 465     THR J   137                                                      
REMARK 465     GLY J   138                                                      
REMARK 465     SER J   139                                                      
REMARK 465     SER J   140                                                      
REMARK 465     VAL J   141                                                      
REMARK 465     THR J   142                                                      
REMARK 465     LEU J   143                                                      
REMARK 465     GLY J   144                                                      
REMARK 465     CYS J   145                                                      
REMARK 465     LEU J   146                                                      
REMARK 465     VAL J   147                                                      
REMARK 465     LYS J   148                                                      
REMARK 465     GLY J   149                                                      
REMARK 465     TYR J   150                                                      
REMARK 465     PHE J   151                                                      
REMARK 465     PRO J   152                                                      
REMARK 465     GLU J   153                                                      
REMARK 465     SER J   154                                                      
REMARK 465     VAL J   155                                                      
REMARK 465     THR J   156                                                      
REMARK 465     VAL J   157                                                      
REMARK 465     THR J   158                                                      
REMARK 465     TRP J   159                                                      
REMARK 465     ASN J   160                                                      
REMARK 465     SER J   161                                                      
REMARK 465     GLY J   162                                                      
REMARK 465     SER J   163                                                      
REMARK 465     LEU J   164                                                      
REMARK 465     SER J   165                                                      
REMARK 465     SER J   166                                                      
REMARK 465     SER J   167                                                      
REMARK 465     VAL J   168                                                      
REMARK 465     HIS J   169                                                      
REMARK 465     THR J   170                                                      
REMARK 465     PHE J   171                                                      
REMARK 465     PRO J   172                                                      
REMARK 465     ALA J   173                                                      
REMARK 465     LEU J   174                                                      
REMARK 465     LEU J   175                                                      
REMARK 465     GLN J   176                                                      
REMARK 465     SER J   177                                                      
REMARK 465     GLY J   178                                                      
REMARK 465     LEU J   179                                                      
REMARK 465     TYR J   180                                                      
REMARK 465     THR J   181                                                      
REMARK 465     MET J   182                                                      
REMARK 465     SER J   183                                                      
REMARK 465     SER J   184                                                      
REMARK 465     SER J   185                                                      
REMARK 465     VAL J   186                                                      
REMARK 465     THR J   187                                                      
REMARK 465     VAL J   188                                                      
REMARK 465     PRO J   189                                                      
REMARK 465     SER J   190                                                      
REMARK 465     SER J   191                                                      
REMARK 465     THR J   192                                                      
REMARK 465     TRP J   193                                                      
REMARK 465     PRO J   194                                                      
REMARK 465     SER J   195                                                      
REMARK 465     GLN J   196                                                      
REMARK 465     THR J   197                                                      
REMARK 465     VAL J   198                                                      
REMARK 465     THR J   199                                                      
REMARK 465     CYS J   200                                                      
REMARK 465     SER J   201                                                      
REMARK 465     VAL J   202                                                      
REMARK 465     ALA J   203                                                      
REMARK 465     HIS J   204                                                      
REMARK 465     PRO J   205                                                      
REMARK 465     ALA J   206                                                      
REMARK 465     SER J   207                                                      
REMARK 465     SER J   208                                                      
REMARK 465     THR J   209                                                      
REMARK 465     THR J   210                                                      
REMARK 465     VAL J   211                                                      
REMARK 465     ASP J   212                                                      
REMARK 465     LYS J   213                                                      
REMARK 465     LYS J   214                                                      
REMARK 465     LEU J   215                                                      
REMARK 465     GLU J   216                                                      
REMARK 465     PRO J   217                                                      
REMARK 465     SER J   218                                                      
REMARK 465     GLY J   219                                                      
REMARK 465     PRO J   220                                                      
REMARK 465     ILE J   221                                                      
REMARK 465     SER J   222                                                      
REMARK 465     THR J   223                                                      
REMARK 465     ILE J   224                                                      
REMARK 465     ASN J   225                                                      
REMARK 465     PRO J   226                                                      
REMARK 465     CYS J   227                                                      
REMARK 465     PRO J   228                                                      
REMARK 465     PRO J   229                                                      
REMARK 465     CYS J   230                                                      
REMARK 465     LYS J   231                                                      
REMARK 465     GLU J   232                                                      
REMARK 465     CYS J   233                                                      
REMARK 465     HIS J   234                                                      
REMARK 465     LYS J   235                                                      
REMARK 465     CYS J   236                                                      
REMARK 465     PRO J   237                                                      
REMARK 465     ALA J   238                                                      
REMARK 465     PRO J   239                                                      
REMARK 465     ASN J   240                                                      
REMARK 465     LEU J   241                                                      
REMARK 465     GLU J   242                                                      
REMARK 465     GLY J   243                                                      
REMARK 465     GLY J   244                                                      
REMARK 465     PRO J   245                                                      
REMARK 465     SER J   246                                                      
REMARK 465     VAL J   247                                                      
REMARK 465     PHE J   248                                                      
REMARK 465     ILE J   249                                                      
REMARK 465     PHE J   250                                                      
REMARK 465     PRO J   251                                                      
REMARK 465     PRO J   252                                                      
REMARK 465     ASN J   253                                                      
REMARK 465     ILE J   254                                                      
REMARK 465     LYS J   255                                                      
REMARK 465     ASP J   256                                                      
REMARK 465     VAL J   257                                                      
REMARK 465     LEU J   258                                                      
REMARK 465     MET J   259                                                      
REMARK 465     ILE J   260                                                      
REMARK 465     SER J   261                                                      
REMARK 465     LEU J   262                                                      
REMARK 465     THR J   263                                                      
REMARK 465     PRO J   264                                                      
REMARK 465     LYS J   265                                                      
REMARK 465     VAL J   266                                                      
REMARK 465     THR J   267                                                      
REMARK 465     CYS J   268                                                      
REMARK 465     VAL J   269                                                      
REMARK 465     VAL J   270                                                      
REMARK 465     VAL J   271                                                      
REMARK 465     ASP J   272                                                      
REMARK 465     VAL J   273                                                      
REMARK 465     SER J   274                                                      
REMARK 465     GLU J   275                                                      
REMARK 465     ASP J   276                                                      
REMARK 465     ASP J   277                                                      
REMARK 465     PRO J   278                                                      
REMARK 465     ASP J   279                                                      
REMARK 465     VAL J   280                                                      
REMARK 465     GLN J   281                                                      
REMARK 465     ILE J   282                                                      
REMARK 465     SER J   283                                                      
REMARK 465     TRP J   284                                                      
REMARK 465     PHE J   285                                                      
REMARK 465     VAL J   286                                                      
REMARK 465     ASN J   287                                                      
REMARK 465     ASN J   288                                                      
REMARK 465     VAL J   289                                                      
REMARK 465     GLU J   290                                                      
REMARK 465     VAL J   291                                                      
REMARK 465     HIS J   292                                                      
REMARK 465     THR J   293                                                      
REMARK 465     ALA J   294                                                      
REMARK 465     GLN J   295                                                      
REMARK 465     THR J   296                                                      
REMARK 465     GLN J   297                                                      
REMARK 465     THR J   298                                                      
REMARK 465     HIS J   299                                                      
REMARK 465     ARG J   300                                                      
REMARK 465     GLU J   301                                                      
REMARK 465     ASP J   302                                                      
REMARK 465     TYR J   303                                                      
REMARK 465     ASN J   304                                                      
REMARK 465     SER J   305                                                      
REMARK 465     THR J   306                                                      
REMARK 465     ILE J   307                                                      
REMARK 465     ARG J   308                                                      
REMARK 465     VAL J   309                                                      
REMARK 465     VAL J   310                                                      
REMARK 465     SER J   311                                                      
REMARK 465     THR J   312                                                      
REMARK 465     LEU J   313                                                      
REMARK 465     PRO J   314                                                      
REMARK 465     ILE J   315                                                      
REMARK 465     GLN J   316                                                      
REMARK 465     HIS J   317                                                      
REMARK 465     GLN J   318                                                      
REMARK 465     ASP J   319                                                      
REMARK 465     TRP J   320                                                      
REMARK 465     MET J   321                                                      
REMARK 465     SER J   322                                                      
REMARK 465     GLY J   323                                                      
REMARK 465     LYS J   324                                                      
REMARK 465     GLU J   325                                                      
REMARK 465     PHE J   326                                                      
REMARK 465     LYS J   327                                                      
REMARK 465     CYS J   328                                                      
REMARK 465     LYS J   329                                                      
REMARK 465     VAL J   330                                                      
REMARK 465     ASN J   331                                                      
REMARK 465     ASN J   332                                                      
REMARK 465     LYS J   333                                                      
REMARK 465     ASP J   334                                                      
REMARK 465     LEU J   335                                                      
REMARK 465     PRO J   336                                                      
REMARK 465     SER J   337                                                      
REMARK 465     PRO J   338                                                      
REMARK 465     ILE J   339                                                      
REMARK 465     GLU J   340                                                      
REMARK 465     ARG J   341                                                      
REMARK 465     THR J   342                                                      
REMARK 465     ILE J   343                                                      
REMARK 465     SER J   344                                                      
REMARK 465     LYS J   345                                                      
REMARK 465     ILE J   346                                                      
REMARK 465     LYS J   347                                                      
REMARK 465     GLY J   348                                                      
REMARK 465     LEU J   349                                                      
REMARK 465     VAL J   350                                                      
REMARK 465     ARG J   351                                                      
REMARK 465     ALA J   352                                                      
REMARK 465     PRO J   353                                                      
REMARK 465     GLN J   354                                                      
REMARK 465     VAL J   355                                                      
REMARK 465     TYR J   356                                                      
REMARK 465     ILE J   357                                                      
REMARK 465     LEU J   358                                                      
REMARK 465     PRO J   359                                                      
REMARK 465     PRO J   360                                                      
REMARK 465     PRO J   361                                                      
REMARK 465     ALA J   362                                                      
REMARK 465     GLU J   363                                                      
REMARK 465     GLN J   364                                                      
REMARK 465     LEU J   365                                                      
REMARK 465     SER J   366                                                      
REMARK 465     ARG J   367                                                      
REMARK 465     LYS J   368                                                      
REMARK 465     ASP J   369                                                      
REMARK 465     VAL J   370                                                      
REMARK 465     SER J   371                                                      
REMARK 465     LEU J   372                                                      
REMARK 465     THR J   373                                                      
REMARK 465     CYS J   374                                                      
REMARK 465     LEU J   375                                                      
REMARK 465     VAL J   376                                                      
REMARK 465     VAL J   377                                                      
REMARK 465     GLY J   378                                                      
REMARK 465     PHE J   379                                                      
REMARK 465     ASN J   380                                                      
REMARK 465     PRO J   381                                                      
REMARK 465     GLY J   382                                                      
REMARK 465     ASP J   383                                                      
REMARK 465     ILE J   384                                                      
REMARK 465     SER J   385                                                      
REMARK 465     VAL J   386                                                      
REMARK 465     GLU J   387                                                      
REMARK 465     TRP J   388                                                      
REMARK 465     THR J   389                                                      
REMARK 465     SER J   390                                                      
REMARK 465     ASN J   391                                                      
REMARK 465     GLY J   392                                                      
REMARK 465     HIS J   393                                                      
REMARK 465     THR J   394                                                      
REMARK 465     GLU J   395                                                      
REMARK 465     GLU J   396                                                      
REMARK 465     ASN J   397                                                      
REMARK 465     TYR J   398                                                      
REMARK 465     LYS J   399                                                      
REMARK 465     ASP J   400                                                      
REMARK 465     THR J   401                                                      
REMARK 465     ALA J   402                                                      
REMARK 465     PRO J   403                                                      
REMARK 465     VAL J   404                                                      
REMARK 465     LEU J   405                                                      
REMARK 465     ASP J   406                                                      
REMARK 465     SER J   407                                                      
REMARK 465     ASP J   408                                                      
REMARK 465     GLY J   409                                                      
REMARK 465     SER J   410                                                      
REMARK 465     TYR J   411                                                      
REMARK 465     PHE J   412                                                      
REMARK 465     ILE J   413                                                      
REMARK 465     TYR J   414                                                      
REMARK 465     SER J   415                                                      
REMARK 465     LYS J   416                                                      
REMARK 465     LEU J   417                                                      
REMARK 465     ASN J   418                                                      
REMARK 465     MET J   419                                                      
REMARK 465     LYS J   420                                                      
REMARK 465     THR J   421                                                      
REMARK 465     SER J   422                                                      
REMARK 465     LYS J   423                                                      
REMARK 465     TRP J   424                                                      
REMARK 465     GLU J   425                                                      
REMARK 465     LYS J   426                                                      
REMARK 465     THR J   427                                                      
REMARK 465     ASP J   428                                                      
REMARK 465     SER J   429                                                      
REMARK 465     PHE J   430                                                      
REMARK 465     SER J   431                                                      
REMARK 465     CYS J   432                                                      
REMARK 465     ASN J   433                                                      
REMARK 465     VAL J   434                                                      
REMARK 465     ARG J   435                                                      
REMARK 465     HIS J   436                                                      
REMARK 465     GLU J   437                                                      
REMARK 465     GLY J   438                                                      
REMARK 465     LEU J   439                                                      
REMARK 465     LYS J   440                                                      
REMARK 465     ASN J   441                                                      
REMARK 465     TYR J   442                                                      
REMARK 465     TYR J   443                                                      
REMARK 465     LEU J   444                                                      
REMARK 465     LYS J   445                                                      
REMARK 465     LYS J   446                                                      
REMARK 465     THR J   447                                                      
REMARK 465     ILE J   448                                                      
REMARK 465     SER J   449                                                      
REMARK 465     ARG J   450                                                      
REMARK 465     SER J   451                                                      
REMARK 465     PRO J   452                                                      
REMARK 465     GLY J   453                                                      
REMARK 465     LYS J   454                                                      
REMARK 465     ARG L   107                                                      
REMARK 465     ALA L   108                                                      
REMARK 465     ASP L   109                                                      
REMARK 465     ALA L   110                                                      
REMARK 465     ALA L   111                                                      
REMARK 465     PRO L   112                                                      
REMARK 465     THR L   113                                                      
REMARK 465     VAL L   114                                                      
REMARK 465     SER L   115                                                      
REMARK 465     ILE L   116                                                      
REMARK 465     PHE L   117                                                      
REMARK 465     PRO L   118                                                      
REMARK 465     PRO L   119                                                      
REMARK 465     SER L   120                                                      
REMARK 465     SER L   121                                                      
REMARK 465     GLU L   122                                                      
REMARK 465     GLN L   123                                                      
REMARK 465     LEU L   124                                                      
REMARK 465     THR L   125                                                      
REMARK 465     SER L   126                                                      
REMARK 465     GLY L   127                                                      
REMARK 465     GLY L   128                                                      
REMARK 465     ALA L   129                                                      
REMARK 465     SER L   130                                                      
REMARK 465     VAL L   131                                                      
REMARK 465     VAL L   132                                                      
REMARK 465     CYS L   133                                                      
REMARK 465     PHE L   134                                                      
REMARK 465     LEU L   135                                                      
REMARK 465     ASN L   136                                                      
REMARK 465     ASN L   137                                                      
REMARK 465     PHE L   138                                                      
REMARK 465     TYR L   139                                                      
REMARK 465     PRO L   140                                                      
REMARK 465     LYS L   141                                                      
REMARK 465     ASP L   142                                                      
REMARK 465     ILE L   143                                                      
REMARK 465     ASN L   144                                                      
REMARK 465     VAL L   145                                                      
REMARK 465     LYS L   146                                                      
REMARK 465     TRP L   147                                                      
REMARK 465     LYS L   148                                                      
REMARK 465     ILE L   149                                                      
REMARK 465     ASP L   150                                                      
REMARK 465     GLY L   151                                                      
REMARK 465     SER L   152                                                      
REMARK 465     GLU L   153                                                      
REMARK 465     ARG L   154                                                      
REMARK 465     GLN L   155                                                      
REMARK 465     ASN L   156                                                      
REMARK 465     GLY L   157                                                      
REMARK 465     VAL L   158                                                      
REMARK 465     LEU L   159                                                      
REMARK 465     ASN L   160                                                      
REMARK 465     SER L   161                                                      
REMARK 465     TRP L   162                                                      
REMARK 465     THR L   163                                                      
REMARK 465     ASP L   164                                                      
REMARK 465     GLN L   165                                                      
REMARK 465     ASP L   166                                                      
REMARK 465     SER L   167                                                      
REMARK 465     LYS L   168                                                      
REMARK 465     ASP L   169                                                      
REMARK 465     SER L   170                                                      
REMARK 465     THR L   171                                                      
REMARK 465     TYR L   172                                                      
REMARK 465     SER L   173                                                      
REMARK 465     MET L   174                                                      
REMARK 465     SER L   175                                                      
REMARK 465     SER L   176                                                      
REMARK 465     THR L   177                                                      
REMARK 465     LEU L   178                                                      
REMARK 465     THR L   179                                                      
REMARK 465     LEU L   180                                                      
REMARK 465     THR L   181                                                      
REMARK 465     LYS L   182                                                      
REMARK 465     ASP L   183                                                      
REMARK 465     GLU L   184                                                      
REMARK 465     TYR L   185                                                      
REMARK 465     GLU L   186                                                      
REMARK 465     ARG L   187                                                      
REMARK 465     HIS L   188                                                      
REMARK 465     ASN L   189                                                      
REMARK 465     SER L   190                                                      
REMARK 465     TYR L   191                                                      
REMARK 465     THR L   192                                                      
REMARK 465     CYS L   193                                                      
REMARK 465     GLU L   194                                                      
REMARK 465     ALA L   195                                                      
REMARK 465     THR L   196                                                      
REMARK 465     HIS L   197                                                      
REMARK 465     LYS L   198                                                      
REMARK 465     THR L   199                                                      
REMARK 465     SER L   200                                                      
REMARK 465     THR L   201                                                      
REMARK 465     SER L   202                                                      
REMARK 465     PRO L   203                                                      
REMARK 465     ILE L   204                                                      
REMARK 465     VAL L   205                                                      
REMARK 465     LYS L   206                                                      
REMARK 465     SER L   207                                                      
REMARK 465     PHE L   208                                                      
REMARK 465     ASN L   209                                                      
REMARK 465     ARG L   210                                                      
REMARK 465     ASN L   211                                                      
REMARK 465     GLU L   212                                                      
REMARK 465     CYS L   213                                                      
REMARK 465     GLU K     1                                                      
REMARK 465     VAL K     2                                                      
REMARK 465     ALA K   119                                                      
REMARK 465     LYS K   120                                                      
REMARK 465     THR K   121                                                      
REMARK 465     THR K   122                                                      
REMARK 465     PRO K   123                                                      
REMARK 465     PRO K   124                                                      
REMARK 465     SER K   125                                                      
REMARK 465     VAL K   126                                                      
REMARK 465     TYR K   127                                                      
REMARK 465     PRO K   128                                                      
REMARK 465     LEU K   129                                                      
REMARK 465     ALA K   130                                                      
REMARK 465     PRO K   131                                                      
REMARK 465     GLY K   132                                                      
REMARK 465     CYS K   133                                                      
REMARK 465     GLY K   134                                                      
REMARK 465     ASP K   135                                                      
REMARK 465     THR K   136                                                      
REMARK 465     THR K   137                                                      
REMARK 465     GLY K   138                                                      
REMARK 465     SER K   139                                                      
REMARK 465     SER K   140                                                      
REMARK 465     VAL K   141                                                      
REMARK 465     THR K   142                                                      
REMARK 465     LEU K   143                                                      
REMARK 465     GLY K   144                                                      
REMARK 465     CYS K   145                                                      
REMARK 465     LEU K   146                                                      
REMARK 465     VAL K   147                                                      
REMARK 465     LYS K   148                                                      
REMARK 465     GLY K   149                                                      
REMARK 465     TYR K   150                                                      
REMARK 465     PHE K   151                                                      
REMARK 465     PRO K   152                                                      
REMARK 465     GLU K   153                                                      
REMARK 465     SER K   154                                                      
REMARK 465     VAL K   155                                                      
REMARK 465     THR K   156                                                      
REMARK 465     VAL K   157                                                      
REMARK 465     THR K   158                                                      
REMARK 465     TRP K   159                                                      
REMARK 465     ASN K   160                                                      
REMARK 465     SER K   161                                                      
REMARK 465     GLY K   162                                                      
REMARK 465     SER K   163                                                      
REMARK 465     LEU K   164                                                      
REMARK 465     SER K   165                                                      
REMARK 465     SER K   166                                                      
REMARK 465     SER K   167                                                      
REMARK 465     VAL K   168                                                      
REMARK 465     HIS K   169                                                      
REMARK 465     THR K   170                                                      
REMARK 465     PHE K   171                                                      
REMARK 465     PRO K   172                                                      
REMARK 465     ALA K   173                                                      
REMARK 465     LEU K   174                                                      
REMARK 465     LEU K   175                                                      
REMARK 465     GLN K   176                                                      
REMARK 465     SER K   177                                                      
REMARK 465     GLY K   178                                                      
REMARK 465     LEU K   179                                                      
REMARK 465     TYR K   180                                                      
REMARK 465     THR K   181                                                      
REMARK 465     MET K   182                                                      
REMARK 465     SER K   183                                                      
REMARK 465     SER K   184                                                      
REMARK 465     SER K   185                                                      
REMARK 465     VAL K   186                                                      
REMARK 465     THR K   187                                                      
REMARK 465     VAL K   188                                                      
REMARK 465     PRO K   189                                                      
REMARK 465     SER K   190                                                      
REMARK 465     SER K   191                                                      
REMARK 465     THR K   192                                                      
REMARK 465     TRP K   193                                                      
REMARK 465     PRO K   194                                                      
REMARK 465     SER K   195                                                      
REMARK 465     GLN K   196                                                      
REMARK 465     THR K   197                                                      
REMARK 465     VAL K   198                                                      
REMARK 465     THR K   199                                                      
REMARK 465     CYS K   200                                                      
REMARK 465     SER K   201                                                      
REMARK 465     VAL K   202                                                      
REMARK 465     ALA K   203                                                      
REMARK 465     HIS K   204                                                      
REMARK 465     PRO K   205                                                      
REMARK 465     ALA K   206                                                      
REMARK 465     SER K   207                                                      
REMARK 465     SER K   208                                                      
REMARK 465     THR K   209                                                      
REMARK 465     THR K   210                                                      
REMARK 465     VAL K   211                                                      
REMARK 465     ASP K   212                                                      
REMARK 465     LYS K   213                                                      
REMARK 465     LYS K   214                                                      
REMARK 465     LEU K   215                                                      
REMARK 465     GLU K   216                                                      
REMARK 465     PRO K   217                                                      
REMARK 465     SER K   218                                                      
REMARK 465     GLY K   219                                                      
REMARK 465     PRO K   220                                                      
REMARK 465     ILE K   221                                                      
REMARK 465     SER K   222                                                      
REMARK 465     THR K   223                                                      
REMARK 465     ILE K   224                                                      
REMARK 465     ASN K   225                                                      
REMARK 465     PRO K   226                                                      
REMARK 465     CYS K   227                                                      
REMARK 465     PRO K   228                                                      
REMARK 465     PRO K   229                                                      
REMARK 465     CYS K   230                                                      
REMARK 465     LYS K   231                                                      
REMARK 465     GLU K   232                                                      
REMARK 465     CYS K   233                                                      
REMARK 465     HIS K   234                                                      
REMARK 465     LYS K   235                                                      
REMARK 465     CYS K   236                                                      
REMARK 465     PRO K   237                                                      
REMARK 465     ALA K   238                                                      
REMARK 465     PRO K   239                                                      
REMARK 465     ASN K   240                                                      
REMARK 465     LEU K   241                                                      
REMARK 465     GLU K   242                                                      
REMARK 465     GLY K   243                                                      
REMARK 465     GLY K   244                                                      
REMARK 465     PRO K   245                                                      
REMARK 465     SER K   246                                                      
REMARK 465     VAL K   247                                                      
REMARK 465     PHE K   248                                                      
REMARK 465     ILE K   249                                                      
REMARK 465     PHE K   250                                                      
REMARK 465     PRO K   251                                                      
REMARK 465     PRO K   252                                                      
REMARK 465     ASN K   253                                                      
REMARK 465     ILE K   254                                                      
REMARK 465     LYS K   255                                                      
REMARK 465     ASP K   256                                                      
REMARK 465     VAL K   257                                                      
REMARK 465     LEU K   258                                                      
REMARK 465     MET K   259                                                      
REMARK 465     ILE K   260                                                      
REMARK 465     SER K   261                                                      
REMARK 465     LEU K   262                                                      
REMARK 465     THR K   263                                                      
REMARK 465     PRO K   264                                                      
REMARK 465     LYS K   265                                                      
REMARK 465     VAL K   266                                                      
REMARK 465     THR K   267                                                      
REMARK 465     CYS K   268                                                      
REMARK 465     VAL K   269                                                      
REMARK 465     VAL K   270                                                      
REMARK 465     VAL K   271                                                      
REMARK 465     ASP K   272                                                      
REMARK 465     VAL K   273                                                      
REMARK 465     SER K   274                                                      
REMARK 465     GLU K   275                                                      
REMARK 465     ASP K   276                                                      
REMARK 465     ASP K   277                                                      
REMARK 465     PRO K   278                                                      
REMARK 465     ASP K   279                                                      
REMARK 465     VAL K   280                                                      
REMARK 465     GLN K   281                                                      
REMARK 465     ILE K   282                                                      
REMARK 465     SER K   283                                                      
REMARK 465     TRP K   284                                                      
REMARK 465     PHE K   285                                                      
REMARK 465     VAL K   286                                                      
REMARK 465     ASN K   287                                                      
REMARK 465     ASN K   288                                                      
REMARK 465     VAL K   289                                                      
REMARK 465     GLU K   290                                                      
REMARK 465     VAL K   291                                                      
REMARK 465     HIS K   292                                                      
REMARK 465     THR K   293                                                      
REMARK 465     ALA K   294                                                      
REMARK 465     GLN K   295                                                      
REMARK 465     THR K   296                                                      
REMARK 465     GLN K   297                                                      
REMARK 465     THR K   298                                                      
REMARK 465     HIS K   299                                                      
REMARK 465     ARG K   300                                                      
REMARK 465     GLU K   301                                                      
REMARK 465     ASP K   302                                                      
REMARK 465     TYR K   303                                                      
REMARK 465     ASN K   304                                                      
REMARK 465     SER K   305                                                      
REMARK 465     THR K   306                                                      
REMARK 465     ILE K   307                                                      
REMARK 465     ARG K   308                                                      
REMARK 465     VAL K   309                                                      
REMARK 465     VAL K   310                                                      
REMARK 465     SER K   311                                                      
REMARK 465     THR K   312                                                      
REMARK 465     LEU K   313                                                      
REMARK 465     PRO K   314                                                      
REMARK 465     ILE K   315                                                      
REMARK 465     GLN K   316                                                      
REMARK 465     HIS K   317                                                      
REMARK 465     GLN K   318                                                      
REMARK 465     ASP K   319                                                      
REMARK 465     TRP K   320                                                      
REMARK 465     MET K   321                                                      
REMARK 465     SER K   322                                                      
REMARK 465     GLY K   323                                                      
REMARK 465     LYS K   324                                                      
REMARK 465     GLU K   325                                                      
REMARK 465     PHE K   326                                                      
REMARK 465     LYS K   327                                                      
REMARK 465     CYS K   328                                                      
REMARK 465     LYS K   329                                                      
REMARK 465     VAL K   330                                                      
REMARK 465     ASN K   331                                                      
REMARK 465     ASN K   332                                                      
REMARK 465     LYS K   333                                                      
REMARK 465     ASP K   334                                                      
REMARK 465     LEU K   335                                                      
REMARK 465     PRO K   336                                                      
REMARK 465     SER K   337                                                      
REMARK 465     PRO K   338                                                      
REMARK 465     ILE K   339                                                      
REMARK 465     GLU K   340                                                      
REMARK 465     ARG K   341                                                      
REMARK 465     THR K   342                                                      
REMARK 465     ILE K   343                                                      
REMARK 465     SER K   344                                                      
REMARK 465     LYS K   345                                                      
REMARK 465     ILE K   346                                                      
REMARK 465     LYS K   347                                                      
REMARK 465     GLY K   348                                                      
REMARK 465     LEU K   349                                                      
REMARK 465     VAL K   350                                                      
REMARK 465     ARG K   351                                                      
REMARK 465     ALA K   352                                                      
REMARK 465     PRO K   353                                                      
REMARK 465     GLN K   354                                                      
REMARK 465     VAL K   355                                                      
REMARK 465     TYR K   356                                                      
REMARK 465     ILE K   357                                                      
REMARK 465     LEU K   358                                                      
REMARK 465     PRO K   359                                                      
REMARK 465     PRO K   360                                                      
REMARK 465     PRO K   361                                                      
REMARK 465     ALA K   362                                                      
REMARK 465     GLU K   363                                                      
REMARK 465     GLN K   364                                                      
REMARK 465     LEU K   365                                                      
REMARK 465     SER K   366                                                      
REMARK 465     ARG K   367                                                      
REMARK 465     LYS K   368                                                      
REMARK 465     ASP K   369                                                      
REMARK 465     VAL K   370                                                      
REMARK 465     SER K   371                                                      
REMARK 465     LEU K   372                                                      
REMARK 465     THR K   373                                                      
REMARK 465     CYS K   374                                                      
REMARK 465     LEU K   375                                                      
REMARK 465     VAL K   376                                                      
REMARK 465     VAL K   377                                                      
REMARK 465     GLY K   378                                                      
REMARK 465     PHE K   379                                                      
REMARK 465     ASN K   380                                                      
REMARK 465     PRO K   381                                                      
REMARK 465     GLY K   382                                                      
REMARK 465     ASP K   383                                                      
REMARK 465     ILE K   384                                                      
REMARK 465     SER K   385                                                      
REMARK 465     VAL K   386                                                      
REMARK 465     GLU K   387                                                      
REMARK 465     TRP K   388                                                      
REMARK 465     THR K   389                                                      
REMARK 465     SER K   390                                                      
REMARK 465     ASN K   391                                                      
REMARK 465     GLY K   392                                                      
REMARK 465     HIS K   393                                                      
REMARK 465     THR K   394                                                      
REMARK 465     GLU K   395                                                      
REMARK 465     GLU K   396                                                      
REMARK 465     ASN K   397                                                      
REMARK 465     TYR K   398                                                      
REMARK 465     LYS K   399                                                      
REMARK 465     ASP K   400                                                      
REMARK 465     THR K   401                                                      
REMARK 465     ALA K   402                                                      
REMARK 465     PRO K   403                                                      
REMARK 465     VAL K   404                                                      
REMARK 465     LEU K   405                                                      
REMARK 465     ASP K   406                                                      
REMARK 465     SER K   407                                                      
REMARK 465     ASP K   408                                                      
REMARK 465     GLY K   409                                                      
REMARK 465     SER K   410                                                      
REMARK 465     TYR K   411                                                      
REMARK 465     PHE K   412                                                      
REMARK 465     ILE K   413                                                      
REMARK 465     TYR K   414                                                      
REMARK 465     SER K   415                                                      
REMARK 465     LYS K   416                                                      
REMARK 465     LEU K   417                                                      
REMARK 465     ASN K   418                                                      
REMARK 465     MET K   419                                                      
REMARK 465     LYS K   420                                                      
REMARK 465     THR K   421                                                      
REMARK 465     SER K   422                                                      
REMARK 465     LYS K   423                                                      
REMARK 465     TRP K   424                                                      
REMARK 465     GLU K   425                                                      
REMARK 465     LYS K   426                                                      
REMARK 465     THR K   427                                                      
REMARK 465     ASP K   428                                                      
REMARK 465     SER K   429                                                      
REMARK 465     PHE K   430                                                      
REMARK 465     SER K   431                                                      
REMARK 465     CYS K   432                                                      
REMARK 465     ASN K   433                                                      
REMARK 465     VAL K   434                                                      
REMARK 465     ARG K   435                                                      
REMARK 465     HIS K   436                                                      
REMARK 465     GLU K   437                                                      
REMARK 465     GLY K   438                                                      
REMARK 465     LEU K   439                                                      
REMARK 465     LYS K   440                                                      
REMARK 465     ASN K   441                                                      
REMARK 465     TYR K   442                                                      
REMARK 465     TYR K   443                                                      
REMARK 465     LEU K   444                                                      
REMARK 465     LYS K   445                                                      
REMARK 465     LYS K   446                                                      
REMARK 465     THR K   447                                                      
REMARK 465     ILE K   448                                                      
REMARK 465     SER K   449                                                      
REMARK 465     ARG K   450                                                      
REMARK 465     SER K   451                                                      
REMARK 465     PRO K   452                                                      
REMARK 465     GLY K   453                                                      
REMARK 465     LYS K   454                                                      
REMARK 470                                                                      
REMARK 470 MISSING ATOM                                                         
REMARK 470 THE FOLLOWING RESIDUES HAVE MISSING ATOMS (M=MODEL NUMBER;           
REMARK 470 RES=RESIDUE NAME; C=CHAIN IDENTIFIER; SSEQ=SEQUENCE NUMBER;          
REMARK 470 I=INSERTION CODE):                                                   
REMARK 470   M RES CSSEQI  ATOMS                                                
REMARK 470     VAL E 262    CG1  CG2                                            
REMARK 500                                                                      
REMARK 500 GEOMETRY AND STEREOCHEMISTRY                                         
REMARK 500 SUBTOPIC: TORSION ANGLES                                             
REMARK 500                                                                      
REMARK 500 TORSION ANGLES OUTSIDE THE EXPECTED RAMACHANDRAN REGIONS:            
REMARK 500 (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN IDENTIFIER;               
REMARK 500 SSEQ=SEQUENCE NUMBER; I=INSERTION CODE).                             
REMARK 500                                                                      
REMARK 500 STANDARD TABLE:                                                      
REMARK 500 FORMAT:(10X,I3,1X,A3,1X,A1,I4,A1,4X,F7.2,3X,F7.2)                    
REMARK 500                                                                      
REMARK 500 EXPECTED VALUES: GJ KLEYWEGT AND TA JONES (1996). PHI/PSI-           
REMARK 500 CHOLOGY: RAMACHANDRAN REVISITED. STRUCTURE 4, 1395 - 1400            
REMARK 500                                                                      
REMARK 500  M RES CSSEQI        PSI       PHI                                   
REMARK 500    LYS A 103      116.81   -161.47                                   
REMARK 500    VAL A 189      -51.86   -122.89                                   
REMARK 500    THR B  82       -6.04     72.38                                   
REMARK 500    ARG B 173     -169.44   -124.28                                   
REMARK 500    TYR B 191     -166.40    -78.67                                   
REMARK 500    SER B 205     -169.65   -127.78                                   
REMARK 500    SER C  46      148.72   -171.25                                   
REMARK 500    THR D  82       -9.99     72.81                                   
REMARK 500    MET D 114      147.48   -171.01                                   
REMARK 500    ALA D 161       17.04     52.72                                   
REMARK 500    ASN E 128       31.29    -91.50                                   
REMARK 500    SER E 187      -12.04     73.98                                   
REMARK 500    THR E 193        2.27    -67.86                                   
REMARK 500    SER E 195       33.56    -96.57                                   
REMARK 500    VAL E 204      -60.17   -122.35                                   
REMARK 500    ALA E 264     -168.27   -167.69                                   
REMARK 500    UNK E 300       -9.44     72.29                                   
REMARK 500    SER I  93     -166.74   -118.33                                   
REMARK 500    ILE J  48      -61.15   -107.53                                   
REMARK 500    SER L  67     -166.15   -164.62                                   
REMARK 500    SER L  93     -166.99   -117.29                                   
REMARK 500                                                                      
REMARK 500 REMARK: NULL                                                         
REMARK 610                                                                      
REMARK 610 MISSING HETEROATOM                                                   
REMARK 610 THE FOLLOWING RESIDUES HAVE MISSING ATOMS (M=MODEL NUMBER;           
REMARK 610 RES=RESIDUE NAME; C=CHAIN IDENTIFIER; SSEQ=SEQUENCE NUMBER;          
REMARK 610 I=INSERTION CODE):                                                   
REMARK 610   M RES C SSEQI                                                      
REMARK 610     Y01 A  406                                                       
REMARK 610     Y01 A  407                                                       
REMARK 610     Y01 A  408                                                       
REMARK 610     Y01 A  409                                                       
REMARK 610     Y01 A  410                                                       
REMARK 610     Y01 B  409                                                       
REMARK 610     Y01 B  410                                                       
REMARK 610     Y01 B  411                                                       
REMARK 610     Y01 B  412                                                       
REMARK 610     Y01 D  407                                                       
REMARK 610     Y01 D  408                                                       
REMARK 610     Y01 D  409                                                       
REMARK 800                                                                      
REMARK 800 SITE                                                                 
REMARK 800 SITE_IDENTIFIER: AC1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue ABU A 405                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AC2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue Y01 A 406                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AC3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue Y01 A 407                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AC4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue Y01 A 408                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AC5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue Y01 A 409                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AC6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue Y01 A 410                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AC7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue Y01 B 409                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AC8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue Y01 B 410                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AC9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue Y01 B 411                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AD1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue Y01 B 412                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AD2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue ABU C 405                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AD3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue FYP D 406                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AD4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue Y01 D 407                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AD5                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue Y01 D 408                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AD6                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for residue Y01 D 409                 
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AD7                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for Mono-Saccharide NAG A 404 bound   
REMARK 800  to ASN A 80                                                         
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AD8                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for Poly-Saccharide residues NAG A    
REMARK 800  401 through BMA A 403 bound to ASN A 149                            
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AD9                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for Poly-Saccharide residues NAG B    
REMARK 800  401 through MAN B 408 bound to ASN B 111                            
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AE1                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for Mono-Saccharide NAG C 404 bound   
REMARK 800  to ASN C 80                                                         
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AE2                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for Poly-Saccharide residues NAG C    
REMARK 800  401 through BMA C 403 bound to ASN C 149                            
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AE3                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for Poly-Saccharide residues NAG D    
REMARK 800  401 through MAN D 405 bound to ASN D 111                            
REMARK 800                                                                      
REMARK 800 SITE_IDENTIFIER: AE4                                                 
REMARK 800 EVIDENCE_CODE: SOFTWARE                                              
REMARK 800 SITE_DESCRIPTION: binding site for Mono-Saccharide NAG E 401 bound   
REMARK 800  to ASN E 208                                                        
REMARK 900                                                                      
REMARK 900 RELATED ENTRIES                                                      
REMARK 900 RELATED ID: EMD-7816   RELATED DB: EMDB                              
REMARK 900 HUMAN GABA-A RECEPTOR ALPHA1-BETA2-GAMMA2 SUBTYPE IN COMPLEX WITH    
REMARK 900 GABA AND FLUMAZENIL, CONFORMATION B                                  
REMARK 999                                                                      
REMARK 999 SEQUENCE                                                             
REMARK 999 THE FULL SEQUENCE OF HUMAN GABA-A RECEPTOR SUBUNIT GAMMA-2 IS        
REMARK 999 WSHPQFEKGGGSGGGSGGSSAWSHPQFEKLEVLFQGPQKSDDDYEDYASNKTWVLTPKV          
REMARK 999 PEGDVTVILNNLLEGYDNKLRPDIGVKPTLIHTDMYVNSIGPVNAINMEYTIDIFFAQT          
REMARK 999 WYDRRLKFNSTIKVLRLNSNMVGKIWIPDTFFRNSKKADAHWITTPNRMLRIWNDGRVL          
REMARK 999 YTLRLTIDAECQLQLHNFPMDEHSCPLEFSSYGYPREEIVYQWKRSSVEVGDTRSWRLY          
REMARK 999 QFSFVGLRNTTEVVKTTSGDYVVMSVYFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWIN          
REMARK 999 KDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFVSVCFIFVFSALVEYGTL          
REMARK 999 HYFVSSQPARAAKMDSYARIFFPTAFCLFNLVYWVSYLYL                             
DBREF  6D6T A    1   307  UNP    P47870   GBRB2_HUMAN     25    331             
DBREF  6D6T A  315   341  UNP    P47870   GBRB2_HUMAN    486    512             
DBREF  6D6T B    1   312  UNP    P14867   GBRA1_HUMAN     28    339             
DBREF  6D6T B  320   358  UNP    P14867   GBRA1_HUMAN    418    456             
DBREF  6D6T C    1   307  UNP    P47870   GBRB2_HUMAN     25    331             
DBREF  6D6T C  315   341  UNP    P47870   GBRB2_HUMAN    486    512             
DBREF  6D6T D    1   312  UNP    P14867   GBRA1_HUMAN     28    339             
DBREF  6D6T D  320   358  UNP    P14867   GBRA1_HUMAN    418    456             
DBREF  6D6T E  -36   346  PDB    6D6T     6D6T           -36    346             
DBREF  6D6T I    1   213  PDB    6D6T     6D6T             1    213             
DBREF  6D6T J    1   454  PDB    6D6T     6D6T             1    454             
DBREF  6D6T L    1   213  PDB    6D6T     6D6T             1    213             
DBREF  6D6T K    1   454  PDB    6D6T     6D6T             1    454             
SEQADV 6D6T SER A  308  UNP  P47870              LINKER                         
SEQADV 6D6T GLN A  309  UNP  P47870              LINKER                         
SEQADV 6D6T PRO A  310  UNP  P47870              LINKER                         
SEQADV 6D6T ALA A  311  UNP  P47870              LINKER                         
SEQADV 6D6T ARG A  312  UNP  P47870              LINKER                         
SEQADV 6D6T ALA A  313  UNP  P47870              LINKER                         
SEQADV 6D6T ALA A  314  UNP  P47870              LINKER                         
SEQADV 6D6T SER B  313  UNP  P14867              LINKER                         
SEQADV 6D6T GLN B  314  UNP  P14867              LINKER                         
SEQADV 6D6T PRO B  315  UNP  P14867              LINKER                         
SEQADV 6D6T ALA B  316  UNP  P14867              LINKER                         
SEQADV 6D6T ARG B  317  UNP  P14867              LINKER                         
SEQADV 6D6T ALA B  318  UNP  P14867              LINKER                         
SEQADV 6D6T ALA B  319  UNP  P14867              LINKER                         
SEQADV 6D6T SER C  308  UNP  P47870              LINKER                         
SEQADV 6D6T GLN C  309  UNP  P47870              LINKER                         
SEQADV 6D6T PRO C  310  UNP  P47870              LINKER                         
SEQADV 6D6T ALA C  311  UNP  P47870              LINKER                         
SEQADV 6D6T ARG C  312  UNP  P47870              LINKER                         
SEQADV 6D6T ALA C  313  UNP  P47870              LINKER                         
SEQADV 6D6T ALA C  314  UNP  P47870              LINKER                         
SEQADV 6D6T SER D  313  UNP  P14867              LINKER                         
SEQADV 6D6T GLN D  314  UNP  P14867              LINKER                         
SEQADV 6D6T PRO D  315  UNP  P14867              LINKER                         
SEQADV 6D6T ALA D  316  UNP  P14867              LINKER                         
SEQADV 6D6T ARG D  317  UNP  P14867              LINKER                         
SEQADV 6D6T ALA D  318  UNP  P14867              LINKER                         
SEQADV 6D6T ALA D  319  UNP  P14867              LINKER                         
SEQRES   1 A  341  GLN SER VAL ASN ASP PRO SER ASN MET SER LEU VAL LYS          
SEQRES   2 A  341  GLU THR VAL ASP ARG LEU LEU LYS GLY TYR ASP ILE ARG          
SEQRES   3 A  341  LEU ARG PRO ASP PHE GLY GLY PRO PRO VAL ALA VAL GLY          
SEQRES   4 A  341  MET ASN ILE ASP ILE ALA SER ILE ASP MET VAL SER GLU          
SEQRES   5 A  341  VAL ASN MET ASP TYR THR LEU THR MET TYR PHE GLN GLN          
SEQRES   6 A  341  ALA TRP ARG ASP LYS ARG LEU SER TYR ASN VAL ILE PRO          
SEQRES   7 A  341  LEU ASN LEU THR LEU ASP ASN ARG VAL ALA ASP GLN LEU          
SEQRES   8 A  341  TRP VAL PRO ASP THR TYR PHE LEU ASN ASP LYS LYS SER          
SEQRES   9 A  341  PHE VAL HIS GLY VAL THR VAL LYS ASN ARG MET ILE ARG          
SEQRES  10 A  341  LEU HIS PRO ASP GLY THR VAL LEU TYR GLY LEU ARG ILE          
SEQRES  11 A  341  THR THR THR ALA ALA CYS MET MET ASP LEU ARG ARG TYR          
SEQRES  12 A  341  PRO LEU ASP GLU GLN ASN CYS THR LEU GLU ILE GLU SER          
SEQRES  13 A  341  TYR GLY TYR THR THR ASP ASP ILE GLU PHE TYR TRP ARG          
SEQRES  14 A  341  GLY ASP ASP ASN ALA VAL THR GLY VAL THR LYS ILE GLU          
SEQRES  15 A  341  LEU PRO GLN PHE SER ILE VAL ASP TYR LYS LEU ILE THR          
SEQRES  16 A  341  LYS LYS VAL VAL PHE SER THR GLY SER TYR PRO ARG LEU          
SEQRES  17 A  341  SER LEU SER PHE LYS LEU LYS ARG ASN ILE GLY TYR PHE          
SEQRES  18 A  341  ILE LEU GLN THR TYR MET PRO SER ILE LEU ILE THR ILE          
SEQRES  19 A  341  LEU SER TRP VAL SER PHE TRP ILE ASN TYR ASP ALA SER          
SEQRES  20 A  341  ALA ALA ARG VAL ALA LEU GLY ILE THR THR VAL LEU THR          
SEQRES  21 A  341  MET THR THR ILE ASN THR HIS LEU ARG GLU THR LEU PRO          
SEQRES  22 A  341  LYS ILE PRO TYR VAL LYS ALA ILE ASP MET TYR LEU MET          
SEQRES  23 A  341  GLY CYS PHE VAL PHE VAL PHE MET ALA LEU LEU GLU TYR          
SEQRES  24 A  341  ALA LEU VAL ASN TYR ILE PHE PHE SER GLN PRO ALA ARG          
SEQRES  25 A  341  ALA ALA ALA ILE ASP ARG TRP SER ARG ILE PHE PHE PRO          
SEQRES  26 A  341  VAL VAL PHE SER PHE PHE ASN ILE VAL TYR TRP LEU TYR          
SEQRES  27 A  341  TYR VAL ASN                                                  
SEQRES   1 B  358  GLN PRO SER LEU GLN ASP GLU LEU LYS ASP ASN THR THR          
SEQRES   2 B  358  VAL PHE THR ARG ILE LEU ASP ARG LEU LEU ASP GLY TYR          
SEQRES   3 B  358  ASP ASN ARG LEU ARG PRO GLY LEU GLY GLU ARG VAL THR          
SEQRES   4 B  358  GLU VAL LYS THR ASP ILE PHE VAL THR SER PHE GLY PRO          
SEQRES   5 B  358  VAL SER ASP HIS ASP MET GLU TYR THR ILE ASP VAL PHE          
SEQRES   6 B  358  PHE ARG GLN SER TRP LYS ASP GLU ARG LEU LYS PHE LYS          
SEQRES   7 B  358  GLY PRO MET THR VAL LEU ARG LEU ASN ASN LEU MET ALA          
SEQRES   8 B  358  SER LYS ILE TRP THR PRO ASP THR PHE PHE HIS ASN GLY          
SEQRES   9 B  358  LYS LYS SER VAL ALA HIS ASN MET THR MET PRO ASN LYS          
SEQRES  10 B  358  LEU LEU ARG ILE THR GLU ASP GLY THR LEU LEU TYR THR          
SEQRES  11 B  358  MET ARG LEU THR VAL ARG ALA GLU CYS PRO MET HIS LEU          
SEQRES  12 B  358  GLU ASP PHE PRO MET ASP ALA HIS ALA CYS PRO LEU LYS          
SEQRES  13 B  358  PHE GLY SER TYR ALA TYR THR ARG ALA GLU VAL VAL TYR          
SEQRES  14 B  358  GLU TRP THR ARG GLU PRO ALA ARG SER VAL VAL VAL ALA          
SEQRES  15 B  358  GLU ASP GLY SER ARG LEU ASN GLN TYR ASP LEU LEU GLY          
SEQRES  16 B  358  GLN THR VAL ASP SER GLY ILE VAL GLN SER SER THR GLY          
SEQRES  17 B  358  GLU TYR VAL VAL MET THR THR HIS PHE HIS LEU LYS ARG          
SEQRES  18 B  358  LYS ILE GLY TYR PHE VAL ILE GLN THR TYR LEU PRO CYS          
SEQRES  19 B  358  ILE MET THR VAL ILE LEU SER GLN VAL SER PHE TRP LEU          
SEQRES  20 B  358  ASN ARG GLU SER VAL PRO ALA ARG THR VAL PHE GLY VAL          
SEQRES  21 B  358  THR THR VAL LEU THR MET THR THR LEU SER ILE SER ALA          
SEQRES  22 B  358  ARG ASN SER LEU PRO LYS VAL ALA TYR ALA THR ALA MET          
SEQRES  23 B  358  ASP TRP PHE ILE ALA VAL CYS TYR ALA PHE VAL PHE SER          
SEQRES  24 B  358  ALA LEU ILE GLU PHE ALA THR VAL ASN TYR PHE THR LYS          
SEQRES  25 B  358  SER GLN PRO ALA ARG ALA ALA LYS ILE ASP ARG LEU SER          
SEQRES  26 B  358  ARG ILE ALA PHE PRO LEU LEU PHE GLY ILE PHE ASN LEU          
SEQRES  27 B  358  VAL TYR TRP ALA THR TYR LEU ASN ARG GLU PRO GLN LEU          
SEQRES  28 B  358  LYS ALA PRO THR PRO HIS GLN                                  
SEQRES   1 C  341  GLN SER VAL ASN ASP PRO SER ASN MET SER LEU VAL LYS          
SEQRES   2 C  341  GLU THR VAL ASP ARG LEU LEU LYS GLY TYR ASP ILE ARG          
SEQRES   3 C  341  LEU ARG PRO ASP PHE GLY GLY PRO PRO VAL ALA VAL GLY          
SEQRES   4 C  341  MET ASN ILE ASP ILE ALA SER ILE ASP MET VAL SER GLU          
SEQRES   5 C  341  VAL ASN MET ASP TYR THR LEU THR MET TYR PHE GLN GLN          
SEQRES   6 C  341  ALA TRP ARG ASP LYS ARG LEU SER TYR ASN VAL ILE PRO          
SEQRES   7 C  341  LEU ASN LEU THR LEU ASP ASN ARG VAL ALA ASP GLN LEU          
SEQRES   8 C  341  TRP VAL PRO ASP THR TYR PHE LEU ASN ASP LYS LYS SER          
SEQRES   9 C  341  PHE VAL HIS GLY VAL THR VAL LYS ASN ARG MET ILE ARG          
SEQRES  10 C  341  LEU HIS PRO ASP GLY THR VAL LEU TYR GLY LEU ARG ILE          
SEQRES  11 C  341  THR THR THR ALA ALA CYS MET MET ASP LEU ARG ARG TYR          
SEQRES  12 C  341  PRO LEU ASP GLU GLN ASN CYS THR LEU GLU ILE GLU SER          
SEQRES  13 C  341  TYR GLY TYR THR THR ASP ASP ILE GLU PHE TYR TRP ARG          
SEQRES  14 C  341  GLY ASP ASP ASN ALA VAL THR GLY VAL THR LYS ILE GLU          
SEQRES  15 C  341  LEU PRO GLN PHE SER ILE VAL ASP TYR LYS LEU ILE THR          
SEQRES  16 C  341  LYS LYS VAL VAL PHE SER THR GLY SER TYR PRO ARG LEU          
SEQRES  17 C  341  SER LEU SER PHE LYS LEU LYS ARG ASN ILE GLY TYR PHE          
SEQRES  18 C  341  ILE LEU GLN THR TYR MET PRO SER ILE LEU ILE THR ILE          
SEQRES  19 C  341  LEU SER TRP VAL SER PHE TRP ILE ASN TYR ASP ALA SER          
SEQRES  20 C  341  ALA ALA ARG VAL ALA LEU GLY ILE THR THR VAL LEU THR          
SEQRES  21 C  341  MET THR THR ILE ASN THR HIS LEU ARG GLU THR LEU PRO          
SEQRES  22 C  341  LYS ILE PRO TYR VAL LYS ALA ILE ASP MET TYR LEU MET          
SEQRES  23 C  341  GLY CYS PHE VAL PHE VAL PHE MET ALA LEU LEU GLU TYR          
SEQRES  24 C  341  ALA LEU VAL ASN TYR ILE PHE PHE SER GLN PRO ALA ARG          
SEQRES  25 C  341  ALA ALA ALA ILE ASP ARG TRP SER ARG ILE PHE PHE PRO          
SEQRES  26 C  341  VAL VAL PHE SER PHE PHE ASN ILE VAL TYR TRP LEU TYR          
SEQRES  27 C  341  TYR VAL ASN                                                  
SEQRES   1 D  358  GLN PRO SER LEU GLN ASP GLU LEU LYS ASP ASN THR THR          
SEQRES   2 D  358  VAL PHE THR ARG ILE LEU ASP ARG LEU LEU ASP GLY TYR          
SEQRES   3 D  358  ASP ASN ARG LEU ARG PRO GLY LEU GLY GLU ARG VAL THR          
SEQRES   4 D  358  GLU VAL LYS THR ASP ILE PHE VAL THR SER PHE GLY PRO          
SEQRES   5 D  358  VAL SER ASP HIS ASP MET GLU TYR THR ILE ASP VAL PHE          
SEQRES   6 D  358  PHE ARG GLN SER TRP LYS ASP GLU ARG LEU LYS PHE LYS          
SEQRES   7 D  358  GLY PRO MET THR VAL LEU ARG LEU ASN ASN LEU MET ALA          
SEQRES   8 D  358  SER LYS ILE TRP THR PRO ASP THR PHE PHE HIS ASN GLY          
SEQRES   9 D  358  LYS LYS SER VAL ALA HIS ASN MET THR MET PRO ASN LYS          
SEQRES  10 D  358  LEU LEU ARG ILE THR GLU ASP GLY THR LEU LEU TYR THR          
SEQRES  11 D  358  MET ARG LEU THR VAL ARG ALA GLU CYS PRO MET HIS LEU          
SEQRES  12 D  358  GLU ASP PHE PRO MET ASP ALA HIS ALA CYS PRO LEU LYS          
SEQRES  13 D  358  PHE GLY SER TYR ALA TYR THR ARG ALA GLU VAL VAL TYR          
SEQRES  14 D  358  GLU TRP THR ARG GLU PRO ALA ARG SER VAL VAL VAL ALA          
SEQRES  15 D  358  GLU ASP GLY SER ARG LEU ASN GLN TYR ASP LEU LEU GLY          
SEQRES  16 D  358  GLN THR VAL ASP SER GLY ILE VAL GLN SER SER THR GLY          
SEQRES  17 D  358  GLU TYR VAL VAL MET THR THR HIS PHE HIS LEU LYS ARG          
SEQRES  18 D  358  LYS ILE GLY TYR PHE VAL ILE GLN THR TYR LEU PRO CYS          
SEQRES  19 D  358  ILE MET THR VAL ILE LEU SER GLN VAL SER PHE TRP LEU          
SEQRES  20 D  358  ASN ARG GLU SER VAL PRO ALA ARG THR VAL PHE GLY VAL          
SEQRES  21 D  358  THR THR VAL LEU THR MET THR THR LEU SER ILE SER ALA          
SEQRES  22 D  358  ARG ASN SER LEU PRO LYS VAL ALA TYR ALA THR ALA MET          
SEQRES  23 D  358  ASP TRP PHE ILE ALA VAL CYS TYR ALA PHE VAL PHE SER          
SEQRES  24 D  358  ALA LEU ILE GLU PHE ALA THR VAL ASN TYR PHE THR LYS          
SEQRES  25 D  358  SER GLN PRO ALA ARG ALA ALA LYS ILE ASP ARG LEU SER          
SEQRES  26 D  358  ARG ILE ALA PHE PRO LEU LEU PHE GLY ILE PHE ASN LEU          
SEQRES  27 D  358  VAL TYR TRP ALA THR TYR LEU ASN ARG GLU PRO GLN LEU          
SEQRES  28 D  358  LYS ALA PRO THR PRO HIS GLN                                  
SEQRES   1 E  366  TRP SER HIS PRO GLN PHE GLU LYS GLY GLY GLY SER GLY          
SEQRES   2 E  366  GLY GLY SER GLY GLY SER SER ALA TRP SER HIS PRO GLN          
SEQRES   3 E  366  PHE GLU LYS LEU GLU VAL LEU PHE GLN GLY PRO GLN LYS          
SEQRES   4 E  366  SER ASP ASP ASP TYR GLU ASP TYR ALA SER ASN LYS THR          
SEQRES   5 E  366  TRP VAL LEU THR PRO LYS VAL PRO GLU GLY ASP VAL THR          
SEQRES   6 E  366  VAL ILE LEU ASN ASN LEU LEU GLU GLY TYR ASP ASN LYS          
SEQRES   7 E  366  LEU ARG PRO ASP ILE GLY VAL LYS PRO THR LEU ILE HIS          
SEQRES   8 E  366  THR ASP MET TYR VAL ASN SER ILE GLY PRO VAL ASN ALA          
SEQRES   9 E  366  ILE ASN MET GLU TYR THR ILE ASP ILE PHE PHE ALA GLN          
SEQRES  10 E  366  THR TRP TYR ASP ARG ARG LEU LYS PHE ASN SER THR ILE          
SEQRES  11 E  366  LYS VAL LEU ARG LEU ASN SER ASN MET VAL GLY LYS ILE          
SEQRES  12 E  366  TRP ILE PRO ASP THR PHE PHE ARG ASN SER LYS LYS ALA          
SEQRES  13 E  366  ASP ALA HIS TRP ILE THR THR PRO ASN ARG MET LEU ARG          
SEQRES  14 E  366  ILE TRP ASN ASP GLY ARG VAL LEU TYR THR LEU ARG LEU          
SEQRES  15 E  366  THR ILE ASP ALA GLU CYS GLN LEU GLN LEU HIS ASN PHE          
SEQRES  16 E  366  PRO MET ASP GLU HIS SER CYS PRO LEU GLU PHE SER SER          
SEQRES  17 E  366  TYR GLY TYR PRO ARG GLU GLU ILE VAL TYR GLN TRP LYS          
SEQRES  18 E  366  ARG SER SER VAL GLU VAL GLY ASP THR ARG SER TRP ARG          
SEQRES  19 E  366  LEU TYR GLN PHE SER PHE VAL GLY LEU ARG ASN THR THR          
SEQRES  20 E  366  GLU VAL VAL LYS THR THR SER GLY ASP TYR VAL VAL MET          
SEQRES  21 E  366  SER VAL TYR PHE ASP LEU SER ARG ARG MET GLY TYR PHE          
SEQRES  22 E  366  THR ILE GLN THR TYR ILE PRO CYS THR LEU ILE VAL VAL          
SEQRES  23 E  366  LEU SER TRP VAL SER PHE TRP ILE ASN LYS ASP ALA VAL          
SEQRES  24 E  366  PRO ALA ARG THR SER LEU GLY ILE THR THR VAL LEU THR          
SEQRES  25 E  366  MET THR THR LEU SER THR ILE ALA ARG LYS SER LEU UNK          
SEQRES  26 E  366  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  27 E  366  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  28 E  366  UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK          
SEQRES  29 E  366  UNK UNK                                                      
SEQRES   1 I  213  ASN ILE VAL MET THR GLN SER PRO LYS SER MET SER MET          
SEQRES   2 I  213  SER VAL GLY GLU ARG VAL THR LEU SER CYS LYS ALA SER          
SEQRES   3 I  213  GLU TYR VAL GLY THR TYR VAL SER TRP TYR GLN GLN LYS          
SEQRES   4 I  213  PRO GLU GLN SER PRO LYS LEU LEU ILE TYR GLY ALA SER          
SEQRES   5 I  213  ASN ARG TYR THR GLY VAL PRO ASP ARG PHE THR GLY SER          
SEQRES   6 I  213  GLY SER ALA THR ASP PHE THR LEU THR ILE GLY SER VAL          
SEQRES   7 I  213  GLN ALA GLU ASP LEU ALA ASP TYR HIS CYS GLY GLN SER          
SEQRES   8 I  213  TYR SER TYR PRO THR PHE GLY ALA GLY THR LYS LEU GLU          
SEQRES   9 I  213  LEU LYS ARG ALA ASP ALA ALA PRO THR VAL SER ILE PHE          
SEQRES  10 I  213  PRO PRO SER SER GLU GLN LEU THR SER GLY GLY ALA SER          
SEQRES  11 I  213  VAL VAL CYS PHE LEU ASN ASN PHE TYR PRO LYS ASP ILE          
SEQRES  12 I  213  ASN VAL LYS TRP LYS ILE ASP GLY SER GLU ARG GLN ASN          
SEQRES  13 I  213  GLY VAL LEU ASN SER TRP THR ASP GLN ASP SER LYS ASP          
SEQRES  14 I  213  SER THR TYR SER MET SER SER THR LEU THR LEU THR LYS          
SEQRES  15 I  213  ASP GLU TYR GLU ARG HIS ASN SER TYR THR CYS GLU ALA          
SEQRES  16 I  213  THR HIS LYS THR SER THR SER PRO ILE VAL LYS SER PHE          
SEQRES  17 I  213  ASN ARG ASN GLU CYS                                          
SEQRES   1 J  454  GLU VAL GLN LEU GLN GLN SER GLY ALA GLU LEU VAL LYS          
SEQRES   2 J  454  PRO GLY ALA SER VAL LYS LEU SER CYS THR ALA SER GLY          
SEQRES   3 J  454  PHE ASN ILE LYS ASP THR TYR MET TYR TRP VAL LYS GLN          
SEQRES   4 J  454  ARG PRO GLU GLN GLY LEU GLU TRP ILE GLY ARG ILE ASP          
SEQRES   5 J  454  PRO ALA ASN GLY ASP THR LYS TYR ASP PRO LYS PHE GLN          
SEQRES   6 J  454  GLY LYS ALA THR ILE THR THR ASP THR PHE SER ASN THR          
SEQRES   7 J  454  ALA TYR LEU GLN LEU SER SER LEU THR SER GLU ASP THR          
SEQRES   8 J  454  ALA VAL TYR TYR CYS ALA ARG LYS GLY LEU ARG TRP ALA          
SEQRES   9 J  454  MET ASP TYR TRP GLY GLN GLY THR SER VAL THR VAL SER          
SEQRES  10 J  454  THR ALA LYS THR THR PRO PRO SER VAL TYR PRO LEU ALA          
SEQRES  11 J  454  PRO GLY CYS GLY ASP THR THR GLY SER SER VAL THR LEU          
SEQRES  12 J  454  GLY CYS LEU VAL LYS GLY TYR PHE PRO GLU SER VAL THR          
SEQRES  13 J  454  VAL THR TRP ASN SER GLY SER LEU SER SER SER VAL HIS          
SEQRES  14 J  454  THR PHE PRO ALA LEU LEU GLN SER GLY LEU TYR THR MET          
SEQRES  15 J  454  SER SER SER VAL THR VAL PRO SER SER THR TRP PRO SER          
SEQRES  16 J  454  GLN THR VAL THR CYS SER VAL ALA HIS PRO ALA SER SER          
SEQRES  17 J  454  THR THR VAL ASP LYS LYS LEU GLU PRO SER GLY PRO ILE          
SEQRES  18 J  454  SER THR ILE ASN PRO CYS PRO PRO CYS LYS GLU CYS HIS          
SEQRES  19 J  454  LYS CYS PRO ALA PRO ASN LEU GLU GLY GLY PRO SER VAL          
SEQRES  20 J  454  PHE ILE PHE PRO PRO ASN ILE LYS ASP VAL LEU MET ILE          
SEQRES  21 J  454  SER LEU THR PRO LYS VAL THR CYS VAL VAL VAL ASP VAL          
SEQRES  22 J  454  SER GLU ASP ASP PRO ASP VAL GLN ILE SER TRP PHE VAL          
SEQRES  23 J  454  ASN ASN VAL GLU VAL HIS THR ALA GLN THR GLN THR HIS          
SEQRES  24 J  454  ARG GLU ASP TYR ASN SER THR ILE ARG VAL VAL SER THR          
SEQRES  25 J  454  LEU PRO ILE GLN HIS GLN ASP TRP MET SER GLY LYS GLU          
SEQRES  26 J  454  PHE LYS CYS LYS VAL ASN ASN LYS ASP LEU PRO SER PRO          
SEQRES  27 J  454  ILE GLU ARG THR ILE SER LYS ILE LYS GLY LEU VAL ARG          
SEQRES  28 J  454  ALA PRO GLN VAL TYR ILE LEU PRO PRO PRO ALA GLU GLN          
SEQRES  29 J  454  LEU SER ARG LYS ASP VAL SER LEU THR CYS LEU VAL VAL          
SEQRES  30 J  454  GLY PHE ASN PRO GLY ASP ILE SER VAL GLU TRP THR SER          
SEQRES  31 J  454  ASN GLY HIS THR GLU GLU ASN TYR LYS ASP THR ALA PRO          
SEQRES  32 J  454  VAL LEU ASP SER ASP GLY SER TYR PHE ILE TYR SER LYS          
SEQRES  33 J  454  LEU ASN MET LYS THR SER LYS TRP GLU LYS THR ASP SER          
SEQRES  34 J  454  PHE SER CYS ASN VAL ARG HIS GLU GLY LEU LYS ASN TYR          
SEQRES  35 J  454  TYR LEU LYS LYS THR ILE SER ARG SER PRO GLY LYS              
SEQRES   1 L  213  ASN ILE VAL MET THR GLN SER PRO LYS SER MET SER MET          
SEQRES   2 L  213  SER VAL GLY GLU ARG VAL THR LEU SER CYS LYS ALA SER          
SEQRES   3 L  213  GLU TYR VAL GLY THR TYR VAL SER TRP TYR GLN GLN LYS          
SEQRES   4 L  213  PRO GLU GLN SER PRO LYS LEU LEU ILE TYR GLY ALA SER          
SEQRES   5 L  213  ASN ARG TYR THR GLY VAL PRO ASP ARG PHE THR GLY SER          
SEQRES   6 L  213  GLY SER ALA THR ASP PHE THR LEU THR ILE GLY SER VAL          
SEQRES   7 L  213  GLN ALA GLU ASP LEU ALA ASP TYR HIS CYS GLY GLN SER          
SEQRES   8 L  213  TYR SER TYR PRO THR PHE GLY ALA GLY THR LYS LEU GLU          
SEQRES   9 L  213  LEU LYS ARG ALA ASP ALA ALA PRO THR VAL SER ILE PHE          
SEQRES  10 L  213  PRO PRO SER SER GLU GLN LEU THR SER GLY GLY ALA SER          
SEQRES  11 L  213  VAL VAL CYS PHE LEU ASN ASN PHE TYR PRO LYS ASP ILE          
SEQRES  12 L  213  ASN VAL LYS TRP LYS ILE ASP GLY SER GLU ARG GLN ASN          
SEQRES  13 L  213  GLY VAL LEU ASN SER TRP THR ASP GLN ASP SER LYS ASP          
SEQRES  14 L  213  SER THR TYR SER MET SER SER THR LEU THR LEU THR LYS          
SEQRES  15 L  213  ASP GLU TYR GLU ARG HIS ASN SER TYR THR CYS GLU ALA          
SEQRES  16 L  213  THR HIS LYS THR SER THR SER PRO ILE VAL LYS SER PHE          
SEQRES  17 L  213  ASN ARG ASN GLU CYS                                          
SEQRES   1 K  454  GLU VAL GLN LEU GLN GLN SER GLY ALA GLU LEU VAL LYS          
SEQRES   2 K  454  PRO GLY ALA SER VAL LYS LEU SER CYS THR ALA SER GLY          
SEQRES   3 K  454  PHE ASN ILE LYS ASP THR TYR MET TYR TRP VAL LYS GLN          
SEQRES   4 K  454  ARG PRO GLU GLN GLY LEU GLU TRP ILE GLY ARG ILE ASP          
SEQRES   5 K  454  PRO ALA ASN GLY ASP THR LYS TYR ASP PRO LYS PHE GLN          
SEQRES   6 K  454  GLY LYS ALA THR ILE THR THR ASP THR PHE SER ASN THR          
SEQRES   7 K  454  ALA TYR LEU GLN LEU SER SER LEU THR SER GLU ASP THR          
SEQRES   8 K  454  ALA VAL TYR TYR CYS ALA ARG LYS GLY LEU ARG TRP ALA          
SEQRES   9 K  454  MET ASP TYR TRP GLY GLN GLY THR SER VAL THR VAL SER          
SEQRES  10 K  454  THR ALA LYS THR THR PRO PRO SER VAL TYR PRO LEU ALA          
SEQRES  11 K  454  PRO GLY CYS GLY ASP THR THR GLY SER SER VAL THR LEU          
SEQRES  12 K  454  GLY CYS LEU VAL LYS GLY TYR PHE PRO GLU SER VAL THR          
SEQRES  13 K  454  VAL THR TRP ASN SER GLY SER LEU SER SER SER VAL HIS          
SEQRES  14 K  454  THR PHE PRO ALA LEU LEU GLN SER GLY LEU TYR THR MET          
SEQRES  15 K  454  SER SER SER VAL THR VAL PRO SER SER THR TRP PRO SER          
SEQRES  16 K  454  GLN THR VAL THR CYS SER VAL ALA HIS PRO ALA SER SER          
SEQRES  17 K  454  THR THR VAL ASP LYS LYS LEU GLU PRO SER GLY PRO ILE          
SEQRES  18 K  454  SER THR ILE ASN PRO CYS PRO PRO CYS LYS GLU CYS HIS          
SEQRES  19 K  454  LYS CYS PRO ALA PRO ASN LEU GLU GLY GLY PRO SER VAL          
SEQRES  20 K  454  PHE ILE PHE PRO PRO ASN ILE LYS ASP VAL LEU MET ILE          
SEQRES  21 K  454  SER LEU THR PRO LYS VAL THR CYS VAL VAL VAL ASP VAL          
SEQRES  22 K  454  SER GLU ASP ASP PRO ASP VAL GLN ILE SER TRP PHE VAL          
SEQRES  23 K  454  ASN ASN VAL GLU VAL HIS THR ALA GLN THR GLN THR HIS          
SEQRES  24 K  454  ARG GLU ASP TYR ASN SER THR ILE ARG VAL VAL SER THR          
SEQRES  25 K  454  LEU PRO ILE GLN HIS GLN ASP TRP MET SER GLY LYS GLU          
SEQRES  26 K  454  PHE LYS CYS LYS VAL ASN ASN LYS ASP LEU PRO SER PRO          
SEQRES  27 K  454  ILE GLU ARG THR ILE SER LYS ILE LYS GLY LEU VAL ARG          
SEQRES  28 K  454  ALA PRO GLN VAL TYR ILE LEU PRO PRO PRO ALA GLU GLN          
SEQRES  29 K  454  LEU SER ARG LYS ASP VAL SER LEU THR CYS LEU VAL VAL          
SEQRES  30 K  454  GLY PHE ASN PRO GLY ASP ILE SER VAL GLU TRP THR SER          
SEQRES  31 K  454  ASN GLY HIS THR GLU GLU ASN TYR LYS ASP THR ALA PRO          
SEQRES  32 K  454  VAL LEU ASP SER ASP GLY SER TYR PHE ILE TYR SER LYS          
SEQRES  33 K  454  LEU ASN MET LYS THR SER LYS TRP GLU LYS THR ASP SER          
SEQRES  34 K  454  PHE SER CYS ASN VAL ARG HIS GLU GLY LEU LYS ASN TYR          
SEQRES  35 K  454  TYR LEU LYS LYS THR ILE SER ARG SER PRO GLY LYS              
HET    NAG  A 401      14                                                       
HET    NAG  A 402      14                                                       
HET    BMA  A 403      11                                                       
HET    NAG  A 404      14                                                       
HET    ABU  A 405       7                                                       
HET    Y01  A 406      21                                                       
HET    Y01  A 407      21                                                       
HET    Y01  A 408      21                                                       
HET    Y01  A 409      21                                                       
HET    Y01  A 410      21                                                       
HET    NAG  B 401      14                                                       
HET    NAG  B 402      14                                                       
HET    BMA  B 403      11                                                       
HET    MAN  B 404      11                                                       
HET    MAN  B 405      11                                                       
HET    MAN  B 406      11                                                       
HET    MAN  B 407      11                                                       
HET    MAN  B 408      11                                                       
HET    Y01  B 409      21                                                       
HET    Y01  B 410      21                                                       
HET    Y01  B 411      21                                                       
HET    Y01  B 412      21                                                       
HET    NAG  C 401      14                                                       
HET    NAG  C 402      14                                                       
HET    BMA  C 403      11                                                       
HET    NAG  C 404      14                                                       
HET    ABU  C 405       7                                                       
HET    NAG  D 401      14                                                       
HET    NAG  D 402      14                                                       
HET    BMA  D 403      11                                                       
HET    MAN  D 404      11                                                       
HET    MAN  D 405      11                                                       
HET    FYP  D 406      22                                                       
HET    Y01  D 407      21                                                       
HET    Y01  D 408      21                                                       
HET    Y01  D 409      21                                                       
HET    NAG  E 401      14                                                       
HETNAM     NAG N-ACETYL-D-GLUCOSAMINE                                           
HETNAM     BMA BETA-D-MANNOSE                                                   
HETNAM     ABU GAMMA-AMINO-BUTANOIC ACID                                        
HETNAM     Y01 CHOLESTEROL HEMISUCCINATE                                        
HETNAM     MAN ALPHA-D-MANNOSE                                                  
HETNAM     FYP ETHYL 8-FLUORO-5-METHYL-6-OXO-5,6-DIHYDRO-4H-IMIDAZO[1,          
HETNAM   2 FYP  5-A][1,4]BENZODIAZEPINE-3-CARBOXYLATE                           
HETSYN     ABU GAMMA(AMINO)-BUTYRIC ACID                                        
FORMUL  10  NAG    11(C8 H15 N O6)                                              
FORMUL  10  BMA    4(C6 H12 O6)                                                 
FORMUL  12  ABU    2(C4 H9 N O2)                                                
FORMUL  13  Y01    12(C31 H50 O4)                                               
FORMUL  18  MAN    7(C6 H12 O6)                                                 
FORMUL  27  FYP    C15 H14 F N3 O3                                              
HELIX    1 AA1 ASN A    8  LYS A   21  1                                  14    
HELIX    2 AA2 ASP A   84  GLN A   90  5                                   7    
HELIX    3 AA3 ASN A  217  TRP A  237  1                                  21    
HELIX    4 AA4 TRP A  237  ILE A  242  1                                   6    
HELIX    5 AA5 ALA A  246  LEU A  272  1                                  27    
HELIX    6 AA6 LYS A  279  ILE A  305  1                                  27    
HELIX    7 AA7 GLN A  309  VAL A  340  1                                  32    
HELIX    8 AA8 VAL B   14  ASP B   24  1                                  11    
HELIX    9 AA9 ASN B   87  LYS B   93  5                                   7    
HELIX   10 AB1 GLU B  174  SER B  178  5                                   5    
HELIX   11 AB2 ILE B  223  THR B  230  1                                   8    
HELIX   12 AB3 THR B  230  SER B  244  1                                  15    
HELIX   13 AB4 SER B  251  LEU B  277  1                                  27    
HELIX   14 AB5 THR B  284  THR B  311  1                                  28    
HELIX   15 AB6 GLN B  314  LEU B  345  1                                  32    
HELIX   16 AB7 MET C    9  LYS C   21  1                                  13    
HELIX   17 AB8 ASP C   84  GLN C   90  5                                   7    
HELIX   18 AB9 GLY C  170  ALA C  174  5                                   5    
HELIX   19 AC1 ASN C  217  TRP C  241  1                                  25    
HELIX   20 AC2 SER C  247  LEU C  272  1                                  26    
HELIX   21 AC3 LYS C  279  ILE C  305  1                                  27    
HELIX   22 AC4 GLN C  309  TYR C  339  1                                  31    
HELIX   23 AC5 THR D   12  ASP D   24  1                                  13    
HELIX   24 AC6 ASN D   87  LYS D   93  5                                   7    
HELIX   25 AC7 HIS D  142  PHE D  146  5                                   5    
HELIX   26 AC8 GLU D  174  SER D  178  5                                   5    
HELIX   27 AC9 ILE D  223  THR D  230  1                                   8    
HELIX   28 AD1 THR D  230  SER D  244  1                                  15    
HELIX   29 AD2 PHE D  245  LEU D  247  5                                   3    
HELIX   30 AD3 SER D  251  LEU D  277  1                                  27    
HELIX   31 AD4 THR D  284  THR D  311  1                                  28    
HELIX   32 AD5 GLN D  314  ARG D  347  1                                  34    
HELIX   33 AD6 ASP E   26  GLU E   36  1                                  11    
HELIX   34 AD7 ASN E   99  VAL E  103  5                                   5    
HELIX   35 AD8 THR E  240  TRP E  256  1                                  17    
HELIX   36 AD9 ARG E  265  LEU E  287  1                                  23    
HELIX   37 AE1 UNK E  300  UNK E  318  1                                  19    
HELIX   38 AE2 UNK E  328  UNK E  344  1                                  17    
HELIX   39 AE3 PRO J   62  GLN J   65  5                                   4    
HELIX   40 AE4 THR J   87  THR J   91  5                                   5    
HELIX   41 AE5 PRO K   62  GLN K   65  5                                   4    
SHEET    1 AA1 6 THR A  82  LEU A  83  0                                        
SHEET    2 AA1 6 ARG A 114  ARG A 117 -1  O  ILE A 116   N  LEU A  83           
SHEET    3 AA1 6 THR A 123  ALA A 135 -1  O  LEU A 125   N  ARG A 117           
SHEET    4 AA1 6 ASP A  56  ARG A  68 -1  N  GLN A  65   O  TYR A 126           
SHEET    5 AA1 6 VAL A  36  SER A  51 -1  N  GLY A  39   O  ALA A  66           
SHEET    6 AA1 6 ILE A 164  TRP A 168  1  O  GLU A 165   N  VAL A  38           
SHEET    1 AA2 5 ASP A 101  VAL A 106  0                                        
SHEET    2 AA2 5 THR A 123  ALA A 135 -1  O  THR A 133   N  LYS A 102           
SHEET    3 AA2 5 ASP A  56  ARG A  68 -1  N  GLN A  65   O  TYR A 126           
SHEET    4 AA2 5 VAL A  36  SER A  51 -1  N  GLY A  39   O  ALA A  66           
SHEET    5 AA2 5 VAL A 175  THR A 176  1  O  THR A 176   N  ILE A  44           
SHEET    1 AA3 4 THR A  96  PHE A  98  0                                        
SHEET    2 AA3 4 THR A 151  SER A 156 -1  O  GLU A 155   N  TYR A  97           
SHEET    3 AA3 4 GLY A 203  ARG A 216 -1  O  LEU A 208   N  ILE A 154           
SHEET    4 AA3 4 GLU A 147  GLN A 148 -1  N  GLN A 148   O  LEU A 214           
SHEET    1 AA4 4 THR A  96  PHE A  98  0                                        
SHEET    2 AA4 4 THR A 151  SER A 156 -1  O  GLU A 155   N  TYR A  97           
SHEET    3 AA4 4 GLY A 203  ARG A 216 -1  O  LEU A 208   N  ILE A 154           
SHEET    4 AA4 4 PHE A 186  PHE A 200 -1  N  PHE A 200   O  GLY A 203           
SHEET    1 AA5 6 VAL B  83  LEU B  86  0                                        
SHEET    2 AA5 6 LYS B 117  THR B 122 -1  O  ILE B 121   N  LEU B  84           
SHEET    3 AA5 6 LEU B 127  GLU B 138 -1  O  THR B 130   N  LEU B 118           
SHEET    4 AA5 6 GLU B  59  TRP B  70 -1  N  VAL B  64   O  LEU B 133           
SHEET    5 AA5 6 THR B  39  VAL B  53 -1  N  LYS B  42   O  SER B  69           
SHEET    6 AA5 6 VAL B 167  TRP B 171  1  O  GLU B 170   N  THR B  43           
SHEET    1 AA6 5 VAL B 108  ALA B 109  0                                        
SHEET    2 AA6 5 LEU B 127  GLU B 138 -1  O  THR B 134   N  VAL B 108           
SHEET    3 AA6 5 GLU B  59  TRP B  70 -1  N  VAL B  64   O  LEU B 133           
SHEET    4 AA6 5 THR B  39  VAL B  53 -1  N  LYS B  42   O  SER B  69           
SHEET    5 AA6 5 VAL B 180  VAL B 181  1  O  VAL B 180   N  VAL B  47           
SHEET    1 AA7 4 THR B  99  PHE B 101  0                                        
SHEET    2 AA7 4 ALA B 150  SER B 159 -1  O  GLY B 158   N  PHE B 100           
SHEET    3 AA7 4 GLU B 209  ARG B 221 -1  O  MET B 213   N  PHE B 157           
SHEET    4 AA7 4 TYR B 191  GLN B 204 -1  N  VAL B 203   O  TYR B 210           
SHEET    1 AA8 3 ASP C 101  VAL C 106  0                                        
SHEET    2 AA8 3 THR C 123  ALA C 135 -1  O  THR C 133   N  LYS C 102           
SHEET    3 AA8 3 ARG C 114  ARG C 117 -1  N  ARG C 117   O  LEU C 125           
SHEET    1 AA9 5 ASP C 101  VAL C 106  0                                        
SHEET    2 AA9 5 THR C 123  ALA C 135 -1  O  THR C 133   N  LYS C 102           
SHEET    3 AA9 5 ASP C  56  ARG C  68 -1  N  GLN C  65   O  TYR C 126           
SHEET    4 AA9 5 VAL C  36  SER C  51 -1  N  ALA C  45   O  THR C  60           
SHEET    5 AA9 5 ILE C 164  TRP C 168  1  O  GLU C 165   N  VAL C  38           
SHEET    1 AB1 4 THR C  96  PHE C  98  0                                        
SHEET    2 AB1 4 GLU C 147  SER C 156 -1  O  GLU C 155   N  TYR C  97           
SHEET    3 AB1 4 SER C 204  ARG C 216 -1  O  LEU C 208   N  ILE C 154           
SHEET    4 AB1 4 PHE C 186  VAL C 199 -1  N  VAL C 198   O  TYR C 205           
SHEET    1 AB2 6 VAL D  83  LEU D  86  0                                        
SHEET    2 AB2 6 LYS D 117  THR D 122 -1  O  ILE D 121   N  LEU D  84           
SHEET    3 AB2 6 THR D 126  GLU D 138 -1  O  LEU D 128   N  ARG D 120           
SHEET    4 AB2 6 GLU D  59  LYS D  71 -1  N  TYR D  60   O  ALA D 137           
SHEET    5 AB2 6 THR D  39  ASP D  44 -1  N  LYS D  42   O  SER D  69           
SHEET    6 AB2 6 VAL D 167  TRP D 171  1  O  GLU D 170   N  THR D  43           
SHEET    1 AB3 5 VAL D 108  ALA D 109  0                                        
SHEET    2 AB3 5 THR D 126  GLU D 138 -1  O  THR D 134   N  VAL D 108           
SHEET    3 AB3 5 GLU D  59  LYS D  71 -1  N  TYR D  60   O  ALA D 137           
SHEET    4 AB3 5 PHE D  46  SER D  54 -1  N  SER D  54   O  GLU D  59           
SHEET    5 AB3 5 VAL D 180  VAL D 181  1  O  VAL D 180   N  VAL D  47           
SHEET    1 AB4 4 THR D  99  PHE D 101  0                                        
SHEET    2 AB4 4 ALA D 150  SER D 159 -1  O  GLY D 158   N  PHE D 100           
SHEET    3 AB4 4 GLU D 209  ARG D 221 -1  O  MET D 213   N  PHE D 157           
SHEET    4 AB4 4 TYR D 191  GLN D 204 -1  N  ASP D 199   O  THR D 214           
SHEET    1 AB5 4 LEU E  96  LEU E  98  0                                        
SHEET    2 AB5 4 MET E 130  ILE E 133 -1  O  ILE E 133   N  LEU E  96           
SHEET    3 AB5 4 VAL E 139  ALA E 149 -1  O  LEU E 140   N  ARG E 132           
SHEET    4 AB5 4 SER E 116  ASP E 120 -1  N  LYS E 117   O  ASP E 148           
SHEET    1 AB6 6 LEU E  96  LEU E  98  0                                        
SHEET    2 AB6 6 MET E 130  ILE E 133 -1  O  ILE E 133   N  LEU E  96           
SHEET    3 AB6 6 VAL E 139  ALA E 149 -1  O  LEU E 140   N  ARG E 132           
SHEET    4 AB6 6 TYR E  72  TRP E  82 -1  N  PHE E  78   O  LEU E 143           
SHEET    5 AB6 6 THR E  51  ILE E  62 -1  N  HIS E  54   O  THR E  81           
SHEET    6 AB6 6 ILE E 179  VAL E 190  1  O  VAL E 180   N  ILE E  53           
SHEET    1 AB7 4 THR E 111  PHE E 113  0                                        
SHEET    2 AB7 4 GLU E 162  SER E 171 -1  O  SER E 170   N  PHE E 112           
SHEET    3 AB7 4 ASP E 219  ARG E 231 -1  O  LEU E 229   N  HIS E 163           
SHEET    4 AB7 4 PHE E 201  LYS E 214 -1  N  GLY E 205   O  ASP E 228           
SHEET    1 AB8 4 MET I   4  SER I   7  0                                        
SHEET    2 AB8 4 VAL I  19  ALA I  25 -1  O  SER I  22   N  SER I   7           
SHEET    3 AB8 4 ASP I  70  ILE I  75 -1  O  ILE I  75   N  VAL I  19           
SHEET    4 AB8 4 PHE I  62  SER I  65 -1  N  THR I  63   O  THR I  74           
SHEET    1 AB9 2 SER I  10  MET I  13  0                                        
SHEET    2 AB9 2 LYS I 102  LEU I 105  1  O  LYS I 102   N  MET I  11           
SHEET    1 AC1 4 LYS I  45  TYR I  49  0                                        
SHEET    2 AC1 4 VAL I  33  GLN I  38 -1  N  TRP I  35   O  LEU I  47           
SHEET    3 AC1 4 ASP I  85  GLN I  90 -1  O  ASP I  85   N  GLN I  38           
SHEET    4 AC1 4 THR I  96  PHE I  97 -1  O  THR I  96   N  GLN I  90           
SHEET    1 AC2 4 GLN J   3  GLN J   6  0                                        
SHEET    2 AC2 4 VAL J  18  SER J  25 -1  O  THR J  23   N  GLN J   5           
SHEET    3 AC2 4 THR J  78  LEU J  83 -1  O  LEU J  81   N  LEU J  20           
SHEET    4 AC2 4 ALA J  68  ASP J  73 -1  N  THR J  71   O  TYR J  80           
SHEET    1 AC3 6 GLU J  10  VAL J  12  0                                        
SHEET    2 AC3 6 THR J 112  VAL J 116  1  O  SER J 113   N  GLU J  10           
SHEET    3 AC3 6 ALA J  92  ARG J  98 -1  N  TYR J  94   O  THR J 112           
SHEET    4 AC3 6 MET J  34  GLN J  39 -1  N  TYR J  35   O  ALA J  97           
SHEET    5 AC3 6 GLU J  46  ILE J  51 -1  O  GLY J  49   N  TRP J  36           
SHEET    6 AC3 6 THR J  58  TYR J  60 -1  O  LYS J  59   N  ARG J  50           
SHEET    1 AC4 4 GLU J  10  VAL J  12  0                                        
SHEET    2 AC4 4 THR J 112  VAL J 116  1  O  SER J 113   N  GLU J  10           
SHEET    3 AC4 4 ALA J  92  ARG J  98 -1  N  TYR J  94   O  THR J 112           
SHEET    4 AC4 4 TYR J 107  TRP J 108 -1  O  TYR J 107   N  ARG J  98           
SHEET    1 AC5 4 MET L   4  SER L   7  0                                        
SHEET    2 AC5 4 VAL L  19  ALA L  25 -1  O  LYS L  24   N  THR L   5           
SHEET    3 AC5 4 ASP L  70  ILE L  75 -1  O  ILE L  75   N  VAL L  19           
SHEET    4 AC5 4 PHE L  62  SER L  65 -1  N  THR L  63   O  THR L  74           
SHEET    1 AC6 2 SER L  10  MET L  11  0                                        
SHEET    2 AC6 2 LYS L 102  LEU L 103  1  O  LYS L 102   N  MET L  11           
SHEET    1 AC7 4 LYS L  45  ILE L  48  0                                        
SHEET    2 AC7 4 VAL L  33  GLN L  38 -1  N  GLN L  37   O  LYS L  45           
SHEET    3 AC7 4 ASP L  85  GLN L  90 -1  O  HIS L  87   N  TYR L  36           
SHEET    4 AC7 4 THR L  96  PHE L  97 -1  O  THR L  96   N  GLN L  90           
SHEET    1 AC8 4 LEU K   4  GLN K   6  0                                        
SHEET    2 AC8 4 LYS K  19  ALA K  24 -1  O  THR K  23   N  GLN K   5           
SHEET    3 AC8 4 THR K  78  LEU K  83 -1  O  LEU K  81   N  LEU K  20           
SHEET    4 AC8 4 ALA K  68  ASP K  73 -1  N  THR K  69   O  GLN K  82           
SHEET    1 AC9 6 GLU K  10  VAL K  12  0                                        
SHEET    2 AC9 6 THR K 112  VAL K 116  1  O  THR K 115   N  GLU K  10           
SHEET    3 AC9 6 ALA K  92  ARG K  98 -1  N  ALA K  92   O  VAL K 114           
SHEET    4 AC9 6 MET K  34  GLN K  39 -1  N  TYR K  35   O  ALA K  97           
SHEET    5 AC9 6 LEU K  45  ILE K  51 -1  O  ILE K  48   N  TRP K  36           
SHEET    6 AC9 6 THR K  58  TYR K  60 -1  O  LYS K  59   N  ARG K  50           
SHEET    1 AD1 4 GLU K  10  VAL K  12  0                                        
SHEET    2 AD1 4 THR K 112  VAL K 116  1  O  THR K 115   N  GLU K  10           
SHEET    3 AD1 4 ALA K  92  ARG K  98 -1  N  ALA K  92   O  VAL K 114           
SHEET    4 AD1 4 TYR K 107  TRP K 108 -1  O  TYR K 107   N  ARG K  98           
SSBOND   1 CYS A  136    CYS A  150                          1555   1555  2.04  
SSBOND   2 CYS B  139    CYS B  153                          1555   1555  2.03  
SSBOND   3 CYS B  234    CYS B  293                          1555   1555  2.03  
SSBOND   4 CYS C  136    CYS C  150                          1555   1555  2.04  
SSBOND   5 CYS D  139    CYS D  153                          1555   1555  2.04  
SSBOND   6 CYS D  234    CYS D  293                          1555   1555  2.04  
SSBOND   7 CYS E  151    CYS E  165                          1555   1555  2.03  
SSBOND   8 CYS I   23    CYS I   88                          1555   1555  2.04  
SSBOND   9 CYS J   22    CYS J   96                          1555   1555  2.04  
SSBOND  10 CYS L   23    CYS L   88                          1555   1555  2.03  
SSBOND  11 CYS K   22    CYS K   96                          1555   1555  2.03  
LINK         ND2 ASN A  80                 C1  NAG A 404     1555   1555  1.44  
LINK         ND2 ASN A 149                 C1  NAG A 401     1555   1555  1.44  
LINK         ND2 ASN B 111                 C1  NAG B 401     1555   1555  1.44  
LINK         ND2 ASN C  80                 C1  NAG C 404     1555   1555  1.44  
LINK         ND2 ASN C 149                 C1  NAG C 401     1555   1555  1.44  
LINK         ND2 ASN D 111                 C1  NAG D 401     1555   1555  1.45  
LINK         ND2 ASN E 208                 C1  NAG E 401     1555   1555  1.44  
LINK         O4  NAG A 401                 C1  NAG A 402     1555   1555  1.44  
LINK         O4  NAG A 402                 C1  BMA A 403     1555   1555  1.44  
LINK         O4  NAG B 401                 C1  NAG B 402     1555   1555  1.45  
LINK         O4  NAG B 402                 C1  BMA B 403     1555   1555  1.44  
LINK         O3  BMA B 403                 C1  MAN B 407     1555   1555  1.45  
LINK         O6  BMA B 403                 C1  MAN B 404     1555   1555  1.44  
LINK         O3  MAN B 404                 C1  MAN B 405     1555   1555  1.45  
LINK         O6  MAN B 404                 C1  MAN B 406     1555   1555  1.45  
LINK         O2  MAN B 407                 C1  MAN B 408     1555   1555  1.44  
LINK         O4  NAG C 401                 C1  NAG C 402     1555   1555  1.44  
LINK         O4  NAG C 402                 C1  BMA C 403     1555   1555  1.44  
LINK         O4  NAG D 401                 C1  NAG D 402     1555   1555  1.44  
LINK         O4  NAG D 402                 C1  BMA D 403     1555   1555  1.44  
LINK         O3  BMA D 403                 C1  MAN D 404     1555   1555  1.44  
LINK         O6  BMA D 403                 C1  MAN D 405     1555   1555  1.44  
CISPEP   1 TYR A  143    PRO A  144          0         0.19                     
CISPEP   2 PHE B  146    PRO B  147          0         1.48                     
CISPEP   3 TYR C  143    PRO C  144          0        -2.08                     
CISPEP   4 PHE D  146    PRO D  147          0        -1.40                     
CISPEP   5 SER I    7    PRO I    8          0        -5.25                     
CISPEP   6 SER L    7    PRO L    8          0        -7.08                     
SITE     1 AC1  6 TYR A 157  PHE A 200  THR A 202  TYR A 205                    
SITE     2 AC1  6 PHE B  65  ARG B  67                                          
SITE     1 AC2  4 MET A 294  TRP A 319  PHE A 323  PHE A 324                    
SITE     1 AC3  1 TRP A 241                                                     
SITE     1 AC4  1 Y01 A 410                                                     
SITE     1 AC5  3 PHE A 331  TYR A 338  TYR A 339                               
SITE     1 AC6  1 Y01 A 408                                                     
SITE     1 AC7  3 ASN B 308  LYS B 312  ILE C 242                               
SITE     1 AC8  1 ILE B 235                                                     
SITE     1 AC9  2 ILE B 228  LEU B 232                                          
SITE     1 AD1  2 LEU B 324  LEU B 332                                          
SITE     1 AD2  6 TYR C 157  THR C 202  TYR C 205  PHE D  65                    
SITE     2 AD2  6 ARG D  67  LEU D 118                                          
SITE     1 AD3 10 HIS D 102  TYR D 160  SER D 205  SER D 206                    
SITE     2 AD3 10 TYR D 210  ASP E  56  TYR E  58  PHE E  77                    
SITE     3 AD3 10 ALA E  79  THR E 142                                          
SITE     1 AD4  3 GLY D 224  ILE D 228  LEU D 232                               
SITE     1 AD5  2 ILE D 321  LEU D 332                                          
SITE     1 AD6  2 VAL D 227  TRP D 341                                          
SITE     1 AD7  2 ASN A  80  HIS A 119                                          
SITE     1 AD8  5 ASN A 149  ILE A 194  LYS A 196  SER A 211                    
SITE     2 AD8  5 LYS A 213                                                     
SITE     1 AD9  6 ASN B 111  NAG D 401  ASN E 101  GLY E 104                    
SITE     2 AD9  6 ASP E 120  TRP E 123                                          
SITE     1 AE1  2 ASN C  80  HIS C 119                                          
SITE     1 AE2  4 ASN C 149  ILE C 194  SER C 211  LYS C 213                    
SITE     1 AE3  2 MAN B 404  ASN D 111                                          
SITE     1 AE4  2 SER E 187  ASN E 208                                          
CRYST1    1.000    1.000    1.000  90.00  90.00  90.00 P 1           1          
ORIGX1      1.000000  0.000000  0.000000        0.00000                         
ORIGX2      0.000000  1.000000  0.000000        0.00000                         
ORIGX3      0.000000  0.000000  1.000000        0.00000                         
SCALE1      1.000000  0.000000  0.000000        0.00000                         
SCALE2      0.000000  1.000000  0.000000        0.00000                         
SCALE3      0.000000  0.000000  1.000000        0.00000                         
ATOM      1  N   ASN A   8     137.407 199.972 141.192  1.00 72.29           N  
ATOM      2  CA  ASN A   8     135.953 200.032 141.111  1.00 72.29           C  
ATOM      3  C   ASN A   8     135.415 198.850 140.308  1.00 72.29           C  
ATOM      4  O   ASN A   8     136.171 198.152 139.636  1.00 72.29           O  
ATOM      5  CB  ASN A   8     135.507 201.356 140.485  1.00 72.29           C  
ATOM      6  CG  ASN A   8     134.029 201.627 140.681  1.00 72.29           C  
ATOM      7  OD1 ASN A   8     133.375 200.995 141.509  1.00 72.29           O  
ATOM      8  ND2 ASN A   8     133.494 202.572 139.917  1.00 72.29           N  
ATOM      9  N   MET A   9     134.104 198.620 140.393  1.00 68.11           N  
ATOM     10  CA  MET A   9     133.504 197.492 139.688  1.00 68.11           C  
ATOM     11  C   MET A   9     133.309 197.794 138.206  1.00 68.11           C  
ATOM     12  O   MET A   9     133.682 196.984 137.348  1.00 68.11           O  
ATOM     13  CB  MET A   9     132.172 197.122 140.337  1.00 68.11           C  
ATOM     14  CG  MET A   9     131.478 195.940 139.692  1.00 68.11           C  
ATOM     15  SD  MET A   9     132.417 194.416 139.878  1.00 68.11           S  
ATOM     16  CE  MET A   9     131.427 193.296 138.894  1.00 68.11           C  
ATOM     17  N   SER A  10     132.727 198.953 137.888  1.00 63.22           N  
ATOM     18  CA  SER A  10     132.351 199.243 136.507  1.00 63.22           C  
ATOM     19  C   SER A  10     133.570 199.340 135.599  1.00 63.22           C  
ATOM     20  O   SER A  10     133.504 198.959 134.423  1.00 63.22           O  
ATOM     21  CB  SER A  10     131.535 200.531 136.447  1.00 63.22           C  
ATOM     22  OG  SER A  10     130.320 200.391 137.160  1.00 63.22           O  
ATOM     23  N   LEU A  11     134.688 199.854 136.117  1.00 56.65           N  
ATOM     24  CA  LEU A  11     135.905 199.908 135.313  1.00 56.65           C  
ATOM     25  C   LEU A  11     136.353 198.513 134.899  1.00 56.65           C  
ATOM     26  O   LEU A  11     136.653 198.275 133.723  1.00 56.65           O  
ATOM     27  CB  LEU A  11     137.017 200.615 136.083  1.00 56.65           C  
ATOM     28  CG  LEU A  11     136.819 202.105 136.346  1.00 56.65           C  
ATOM     29  CD1 LEU A  11     138.028 202.673 137.064  1.00 56.65           C  
ATOM     30  CD2 LEU A  11     136.570 202.843 135.045  1.00 56.65           C  
ATOM     31  N   VAL A  12     136.393 197.577 135.849  1.00 50.74           N  
ATOM     32  CA  VAL A  12     136.793 196.211 135.531  1.00 50.74           C  
ATOM     33  C   VAL A  12     135.795 195.573 134.575  1.00 50.74           C  
ATOM     34  O   VAL A  12     136.177 194.843 133.651  1.00 50.74           O  
ATOM     35  CB  VAL A  12     136.943 195.392 136.823  1.00 50.74           C  
ATOM     36  CG1 VAL A  12     137.374 193.980 136.504  1.00 50.74           C  
ATOM     37  CG2 VAL A  12     137.941 196.054 137.746  1.00 50.74           C  
ATOM     38  N   LYS A  13     134.504 195.841 134.777  1.00 50.45           N  
ATOM     39  CA  LYS A  13     133.484 195.281 133.897  1.00 50.45           C  
ATOM     40  C   LYS A  13     133.701 195.726 132.457  1.00 50.45           C  
ATOM     41  O   LYS A  13     133.769 194.897 131.539  1.00 50.45           O  
ATOM     42  CB  LYS A  13     132.095 195.691 134.384  1.00 50.45           C  
ATOM     43  CG  LYS A  13     130.945 195.045 133.633  1.00 50.45           C  
ATOM     44  CD  LYS A  13     129.611 195.540 134.172  1.00 50.45           C  
ATOM     45  CE  LYS A  13     128.444 194.791 133.556  1.00 50.45           C  
ATOM     46  NZ  LYS A  13     128.393 194.956 132.080  1.00 50.45           N  
ATOM     47  N   GLU A  14     133.826 197.037 132.240  1.00 53.25           N  
ATOM     48  CA  GLU A  14     134.000 197.532 130.880  1.00 53.25           C  
ATOM     49  C   GLU A  14     135.347 197.125 130.301  1.00 53.25           C  
ATOM     50  O   GLU A  14     135.455 196.917 129.089  1.00 53.25           O  
ATOM     51  CB  GLU A  14     133.832 199.051 130.834  1.00 53.25           C  
ATOM     52  CG  GLU A  14     134.913 199.835 131.548  1.00 53.25           C  
ATOM     53  CD  GLU A  14     134.815 201.324 131.282  1.00 53.25           C  
ATOM     54  OE1 GLU A  14     133.927 201.732 130.504  1.00 53.25           O  
ATOM     55  OE2 GLU A  14     135.626 202.088 131.848  1.00 53.25           O  
ATOM     56  N   THR A  15     136.376 196.977 131.139  1.00 48.43           N  
ATOM     57  CA  THR A  15     137.665 196.514 130.637  1.00 48.43           C  
ATOM     58  C   THR A  15     137.565 195.089 130.109  1.00 48.43           C  
ATOM     59  O   THR A  15     138.017 194.795 128.996  1.00 48.43           O  
ATOM     60  CB  THR A  15     138.720 196.613 131.737  1.00 48.43           C  
ATOM     61  OG1 THR A  15     139.074 197.986 131.932  1.00 48.43           O  
ATOM     62  CG2 THR A  15     139.957 195.824 131.363  1.00 48.43           C  
ATOM     63  N   VAL A  16     136.962 194.189 130.889  1.00 43.40           N  
ATOM     64  CA  VAL A  16     136.782 192.817 130.422  1.00 43.40           C  
ATOM     65  C   VAL A  16     135.928 192.793 129.161  1.00 43.40           C  
ATOM     66  O   VAL A  16     136.217 192.055 128.208  1.00 43.40           O  
ATOM     67  CB  VAL A  16     136.173 191.946 131.534  1.00 43.40           C  
ATOM     68  CG1 VAL A  16     135.808 190.586 130.992  1.00 43.40           C  
ATOM     69  CG2 VAL A  16     137.152 191.803 132.677  1.00 43.40           C  
ATOM     70  N   ASP A  17     134.876 193.616 129.123  1.00 49.00           N  
ATOM     71  CA  ASP A  17     133.993 193.616 127.962  1.00 49.00           C  
ATOM     72  C   ASP A  17     134.712 194.098 126.709  1.00 49.00           C  
ATOM     73  O   ASP A  17     134.503 193.553 125.619  1.00 49.00           O  
ATOM     74  CB  ASP A  17     132.760 194.473 128.240  1.00 49.00           C  
ATOM     75  CG  ASP A  17     131.765 193.779 129.144  1.00 49.00           C  
ATOM     76  OD1 ASP A  17     131.618 192.545 129.026  1.00 49.00           O  
ATOM     77  OD2 ASP A  17     131.134 194.465 129.974  1.00 49.00           O  
ATOM     78  N   ARG A  18     135.565 195.114 126.836  1.00 46.84           N  
ATOM     79  CA  ARG A  18     136.290 195.593 125.667  1.00 46.84           C  
ATOM     80  C   ARG A  18     137.408 194.639 125.272  1.00 46.84           C  
ATOM     81  O   ARG A  18     137.808 194.612 124.104  1.00 46.84           O  
ATOM     82  CB  ARG A  18     136.845 196.997 125.920  1.00 46.84           C  
ATOM     83  CG  ARG A  18     138.239 197.033 126.513  1.00 46.84           C  
ATOM     84  CD  ARG A  18     139.273 197.454 125.483  1.00 46.84           C  
ATOM     85  NE  ARG A  18     140.633 197.284 125.984  1.00 46.84           N  
ATOM     86  CZ  ARG A  18     141.266 198.173 126.741  1.00 46.84           C  
ATOM     87  NH1 ARG A  18     142.503 197.935 127.151  1.00 46.84           N  
ATOM     88  NH2 ARG A  18     140.661 199.299 127.093  1.00 46.84           N  
ATOM     89  N   LEU A  19     137.925 193.855 126.220  1.00 44.10           N  
ATOM     90  CA  LEU A  19     138.907 192.838 125.862  1.00 44.10           C  
ATOM     91  C   LEU A  19     138.264 191.722 125.054  1.00 44.10           C  
ATOM     92  O   LEU A  19     138.778 191.328 124.002  1.00 44.10           O  
ATOM     93  CB  LEU A  19     139.571 192.273 127.115  1.00 44.10           C  
ATOM     94  CG  LEU A  19     140.512 193.214 127.856  1.00 44.10           C  
ATOM     95  CD1 LEU A  19     141.273 192.456 128.925  1.00 44.10           C  
ATOM     96  CD2 LEU A  19     141.463 193.890 126.887  1.00 44.10           C  
ATOM     97  N   LEU A  20     137.130 191.202 125.527  1.00 41.22           N  
ATOM     98  CA  LEU A  20     136.519 190.060 124.854  1.00 41.22           C  
ATOM     99  C   LEU A  20     135.857 190.453 123.540  1.00 41.22           C  
ATOM    100  O   LEU A  20     135.662 189.598 122.670  1.00 41.22           O  
ATOM    101  CB  LEU A  20     135.507 189.385 125.774  1.00 41.22           C  
ATOM    102  CG  LEU A  20     136.010 188.149 126.515  1.00 41.22           C  
ATOM    103  CD1 LEU A  20     137.300 188.437 127.257  1.00 41.22           C  
ATOM    104  CD2 LEU A  20     134.949 187.666 127.477  1.00 41.22           C  
ATOM    105  N   LYS A  21     135.501 191.723 123.373  1.00 51.59           N  
ATOM    106  CA  LYS A  21     134.894 192.163 122.125  1.00 51.59           C  
ATOM    107  C   LYS A  21     135.920 192.166 121.000  1.00 51.59           C  
ATOM    108  O   LYS A  21     137.050 192.632 121.168  1.00 51.59           O  
ATOM    109  CB  LYS A  21     134.293 193.557 122.284  1.00 51.59           C  
ATOM    110  CG  LYS A  21     133.657 194.100 121.015  1.00 51.59           C  
ATOM    111  CD  LYS A  21     133.014 195.454 121.256  1.00 51.59           C  
ATOM    112  CE  LYS A  21     132.264 195.935 120.027  1.00 51.59           C  
ATOM    113  NZ  LYS A  21     131.565 197.223 120.285  1.00 51.59           N  
ATOM    114  N   GLY A  22     135.519 191.648 119.845  1.00 43.16           N  
ATOM    115  CA  GLY A  22     136.421 191.591 118.707  1.00 43.16           C  
ATOM    116  C   GLY A  22     137.602 190.671 118.917  1.00 43.16           C  
ATOM    117  O   GLY A  22     138.711 190.969 118.458  1.00 43.16           O  
ATOM    118  N   TYR A  23     137.391 189.557 119.608  1.00 33.97           N  
ATOM    119  CA  TYR A  23     138.436 188.580 119.873  1.00 33.97           C  
ATOM    120  C   TYR A  23     138.184 187.351 119.013  1.00 33.97           C  
ATOM    121  O   TYR A  23     137.134 186.712 119.133  1.00 33.97           O  
ATOM    122  CB  TYR A  23     138.463 188.200 121.354  1.00 33.97           C  
ATOM    123  CG  TYR A  23     139.687 187.427 121.779  1.00 33.97           C  
ATOM    124  CD1 TYR A  23     139.721 186.047 121.700  1.00 33.97           C  
ATOM    125  CD2 TYR A  23     140.806 188.079 122.262  1.00 33.97           C  
ATOM    126  CE1 TYR A  23     140.836 185.340 122.087  1.00 33.97           C  
ATOM    127  CE2 TYR A  23     141.924 187.380 122.652  1.00 33.97           C  
ATOM    128  CZ  TYR A  23     141.934 186.012 122.563  1.00 33.97           C  
ATOM    129  OH  TYR A  23     143.051 185.309 122.949  1.00 33.97           O  
ATOM    130  N   ASP A  24     139.141 187.026 118.150  1.00 35.52           N  
ATOM    131  CA  ASP A  24     139.029 185.894 117.238  1.00 35.52           C  
ATOM    132  C   ASP A  24     139.789 184.727 117.853  1.00 35.52           C  
ATOM    133  O   ASP A  24     141.023 184.720 117.861  1.00 35.52           O  
ATOM    134  CB  ASP A  24     139.574 186.248 115.857  1.00 35.52           C  
ATOM    135  CG  ASP A  24     139.046 185.335 114.774  1.00 35.52           C  
ATOM    136  OD1 ASP A  24     138.316 184.378 115.105  1.00 35.52           O  
ATOM    137  OD2 ASP A  24     139.353 185.580 113.589  1.00 35.52           O  
ATOM    138  N   ILE A  25     139.047 183.741 118.356  1.00 24.94           N  
ATOM    139  CA  ILE A  25     139.649 182.696 119.174  1.00 24.94           C  
ATOM    140  C   ILE A  25     140.586 181.824 118.351  1.00 24.94           C  
ATOM    141  O   ILE A  25     141.700 181.511 118.784  1.00 24.94           O  
ATOM    142  CB  ILE A  25     138.551 181.858 119.849  1.00 24.94           C  
ATOM    143  CG1 ILE A  25     139.111 180.506 120.284  1.00 24.94           C  
ATOM    144  CG2 ILE A  25     137.373 181.679 118.913  1.00 24.94           C  
ATOM    145  CD1 ILE A  25     138.088 179.587 120.905  1.00 24.94           C  
ATOM    146  N   ARG A  26     140.166 181.431 117.152  1.00 27.66           N  
ATOM    147  CA  ARG A  26     140.896 180.427 116.390  1.00 27.66           C  
ATOM    148  C   ARG A  26     142.235 180.920 115.859  1.00 27.66           C  
ATOM    149  O   ARG A  26     143.003 180.114 115.327  1.00 27.66           O  
ATOM    150  CB  ARG A  26     140.035 179.936 115.228  1.00 27.66           C  
ATOM    151  CG  ARG A  26     139.645 181.036 114.276  1.00 27.66           C  
ATOM    152  CD  ARG A  26     138.780 180.517 113.153  1.00 27.66           C  
ATOM    153  NE  ARG A  26     137.387 180.372 113.551  1.00 27.66           N  
ATOM    154  CZ  ARG A  26     136.508 181.366 113.546  1.00 27.66           C  
ATOM    155  NH1 ARG A  26     136.882 182.581 113.174  1.00 27.66           N  
ATOM    156  NH2 ARG A  26     135.256 181.148 113.920  1.00 27.66           N  
ATOM    157  N   LEU A  27     142.534 182.208 115.985  1.00 29.31           N  
ATOM    158  CA  LEU A  27     143.819 182.752 115.564  1.00 29.31           C  
ATOM    159  C   LEU A  27     144.736 182.879 116.773  1.00 29.31           C  
ATOM    160  O   LEU A  27     144.479 183.689 117.670  1.00 29.31           O  
ATOM    161  CB  LEU A  27     143.637 184.110 114.891  1.00 29.31           C  
ATOM    162  CG  LEU A  27     143.490 184.133 113.372  1.00 29.31           C  
ATOM    163  CD1 LEU A  27     142.409 183.180 112.916  1.00 29.31           C  
ATOM    164  CD2 LEU A  27     143.182 185.543 112.915  1.00 29.31           C  
ATOM    165  N   ARG A  28     145.810 182.096 116.791  1.00 24.52           N  
ATOM    166  CA  ARG A  28     146.746 182.151 117.897  1.00 24.52           C  
ATOM    167  C   ARG A  28     147.495 183.484 117.885  1.00 24.52           C  
ATOM    168  O   ARG A  28     147.561 184.156 116.855  1.00 24.52           O  
ATOM    169  CB  ARG A  28     147.713 180.970 117.824  1.00 24.52           C  
ATOM    170  CG  ARG A  28     148.518 180.870 116.547  1.00 24.52           C  
ATOM    171  CD  ARG A  28     149.893 181.475 116.724  1.00 24.52           C  
ATOM    172  NE  ARG A  28     150.752 181.222 115.577  1.00 24.52           N  
ATOM    173  CZ  ARG A  28     151.905 181.842 115.368  1.00 24.52           C  
ATOM    174  NH1 ARG A  28     152.326 182.757 116.227  1.00 24.52           N  
ATOM    175  NH2 ARG A  28     152.631 181.557 114.298  1.00 24.52           N  
ATOM    176  N   PRO A  29     148.050 183.898 119.025  1.00 28.59           N  
ATOM    177  CA  PRO A  29     148.696 185.214 119.093  1.00 28.59           C  
ATOM    178  C   PRO A  29     149.880 185.314 118.146  1.00 28.59           C  
ATOM    179  O   PRO A  29     150.633 184.356 117.962  1.00 28.59           O  
ATOM    180  CB  PRO A  29     149.144 185.312 120.555  1.00 28.59           C  
ATOM    181  CG  PRO A  29     148.280 184.368 121.280  1.00 28.59           C  
ATOM    182  CD  PRO A  29     148.037 183.238 120.338  1.00 28.59           C  
ATOM    183  N   ASP A  30     150.039 186.494 117.549  1.00 37.04           N  
ATOM    184  CA  ASP A  30     151.114 186.771 116.599  1.00 37.04           C  
ATOM    185  C   ASP A  30     151.084 185.763 115.449  1.00 37.04           C  
ATOM    186  O   ASP A  30     151.987 184.947 115.268  1.00 37.04           O  
ATOM    187  CB  ASP A  30     152.471 186.767 117.306  1.00 37.04           C  
ATOM    188  CG  ASP A  30     152.478 187.623 118.551  1.00 37.04           C  
ATOM    189  OD1 ASP A  30     151.807 188.674 118.553  1.00 37.04           O  
ATOM    190  OD2 ASP A  30     153.151 187.243 119.530  1.00 37.04           O  
ATOM    191  N   PHE A  31     149.995 185.834 114.682  1.00 36.70           N  
ATOM    192  CA  PHE A  31     149.737 184.814 113.670  1.00 36.70           C  
ATOM    193  C   PHE A  31     150.806 184.821 112.585  1.00 36.70           C  
ATOM    194  O   PHE A  31     151.303 183.764 112.181  1.00 36.70           O  
ATOM    195  CB  PHE A  31     148.352 185.013 113.064  1.00 36.70           C  
ATOM    196  CG  PHE A  31     147.910 183.875 112.197  1.00 36.70           C  
ATOM    197  CD1 PHE A  31     147.482 182.689 112.759  1.00 36.70           C  
ATOM    198  CD2 PHE A  31     147.926 183.988 110.822  1.00 36.70           C  
ATOM    199  CE1 PHE A  31     147.076 181.639 111.968  1.00 36.70           C  
ATOM    200  CE2 PHE A  31     147.520 182.939 110.026  1.00 36.70           C  
ATOM    201  CZ  PHE A  31     147.095 181.764 110.601  1.00 36.70           C  
ATOM    202  N   GLY A  32     151.175 186.002 112.100  1.00 46.82           N  
ATOM    203  CA  GLY A  32     152.170 186.087 111.051  1.00 46.82           C  
ATOM    204  C   GLY A  32     153.598 186.260 111.509  1.00 46.82           C  
ATOM    205  O   GLY A  32     154.517 186.127 110.698  1.00 46.82           O  
ATOM    206  N   GLY A  33     153.815 186.547 112.788  1.00 41.45           N  
ATOM    207  CA  GLY A  33     155.131 186.872 113.280  1.00 41.45           C  
ATOM    208  C   GLY A  33     155.875 185.698 113.882  1.00 41.45           C  
ATOM    209  O   GLY A  33     155.673 184.539 113.509  1.00 41.45           O  
ATOM    210  N   PRO A  34     156.763 185.989 114.826  1.00 30.92           N  
ATOM    211  CA  PRO A  34     157.590 184.942 115.434  1.00 30.92           C  
ATOM    212  C   PRO A  34     156.749 183.987 116.261  1.00 30.92           C  
ATOM    213  O   PRO A  34     155.575 184.266 116.546  1.00 30.92           O  
ATOM    214  CB  PRO A  34     158.562 185.737 116.321  1.00 30.92           C  
ATOM    215  CG  PRO A  34     158.526 187.130 115.789  1.00 30.92           C  
ATOM    216  CD  PRO A  34     157.132 187.330 115.303  1.00 30.92           C  
ATOM    217  N   PRO A  35     157.308 182.848 116.662  1.00 20.34           N  
ATOM    218  CA  PRO A  35     156.564 181.933 117.530  1.00 20.34           C  
ATOM    219  C   PRO A  35     156.332 182.533 118.905  1.00 20.34           C  
ATOM    220  O   PRO A  35     157.101 183.369 119.383  1.00 20.34           O  
ATOM    221  CB  PRO A  35     157.475 180.705 117.611  1.00 20.34           C  
ATOM    222  CG  PRO A  35     158.831 181.233 117.335  1.00 20.34           C  
ATOM    223  CD  PRO A  35     158.626 182.300 116.306  1.00 20.34           C  
ATOM    224  N   VAL A  36     155.257 182.085 119.543  1.00 18.65           N  
ATOM    225  CA  VAL A  36     154.871 182.555 120.867  1.00 18.65           C  
ATOM    226  C   VAL A  36     155.360 181.543 121.892  1.00 18.65           C  
ATOM    227  O   VAL A  36     154.998 180.363 121.833  1.00 18.65           O  
ATOM    228  CB  VAL A  36     153.354 182.760 120.967  1.00 18.65           C  
ATOM    229  CG1 VAL A  36     152.625 181.634 120.272  1.00 18.65           C  
ATOM    230  CG2 VAL A  36     152.934 182.836 122.412  1.00 18.65           C  
ATOM    231  N   ALA A  37     156.184 181.999 122.829  1.00 15.92           N  
ATOM    232  CA  ALA A  37     156.766 181.110 123.822  1.00 15.92           C  
ATOM    233  C   ALA A  37     155.719 180.686 124.839  1.00 15.92           C  
ATOM    234  O   ALA A  37     154.846 181.470 125.217  1.00 15.92           O  
ATOM    235  CB  ALA A  37     157.932 181.794 124.531  1.00 15.92           C  
ATOM    236  N   VAL A  38     155.808 179.435 125.277  1.00 12.55           N  
ATOM    237  CA  VAL A  38     154.909 178.877 126.277  1.00 12.55           C  
ATOM    238  C   VAL A  38     155.749 178.206 127.349  1.00 12.55           C  
ATOM    239  O   VAL A  38     156.545 177.312 127.045  1.00 12.55           O  
ATOM    240  CB  VAL A  38     153.926 177.870 125.657  1.00 12.55           C  
ATOM    241  CG1 VAL A  38     153.238 177.085 126.739  1.00 12.55           C  
ATOM    242  CG2 VAL A  38     152.914 178.595 124.811  1.00 12.55           C  
ATOM    243  N   GLY A  39     155.578 178.629 128.597  1.00 16.07           N  
ATOM    244  CA  GLY A  39     156.335 178.089 129.711  1.00 16.07           C  
ATOM    245  C   GLY A  39     155.464 177.168 130.548  1.00 16.07           C  
ATOM    246  O   GLY A  39     154.375 177.552 130.973  1.00 16.07           O  
ATOM    247  N   MET A  40     155.963 175.960 130.783  1.00 21.24           N  
ATOM    248  CA  MET A  40     155.211 174.937 131.492  1.00 21.24           C  
ATOM    249  C   MET A  40     155.807 174.686 132.869  1.00 21.24           C  
ATOM    250  O   MET A  40     157.025 174.733 133.050  1.00 21.24           O  
ATOM    251  CB  MET A  40     155.164 173.639 130.689  1.00 21.24           C  
ATOM    252  CG  MET A  40     154.041 173.624 129.679  1.00 21.24           C  
ATOM    253  SD  MET A  40     153.903 172.074 128.791  1.00 21.24           S  
ATOM    254  CE  MET A  40     155.289 172.220 127.683  1.00 21.24           C  
ATOM    255  N   ASN A  41     154.932 174.430 133.836  1.00 24.24           N  
ATOM    256  CA  ASN A  41     155.310 174.285 135.232  1.00 24.24           C  
ATOM    257  C   ASN A  41     154.407 173.245 135.877  1.00 24.24           C  
ATOM    258  O   ASN A  41     153.182 173.331 135.769  1.00 24.24           O  
ATOM    259  CB  ASN A  41     155.197 175.626 135.955  1.00 24.24           C  
ATOM    260  CG  ASN A  41     155.661 175.558 137.382  1.00 24.24           C  
ATOM    261  OD1 ASN A  41     156.181 174.541 137.827  1.00 24.24           O  
ATOM    262  ND2 ASN A  41     155.486 176.649 138.111  1.00 24.24           N  
ATOM    263  N   ILE A  42     155.004 172.273 136.557  1.00 19.82           N  
ATOM    264  CA  ILE A  42     154.287 171.103 137.046  1.00 19.82           C  
ATOM    265  C   ILE A  42     154.502 170.973 138.544  1.00 19.82           C  
ATOM    266  O   ILE A  42     155.623 171.142 139.032  1.00 19.82           O  
ATOM    267  CB  ILE A  42     154.759 169.831 136.319  1.00 19.82           C  
ATOM    268  CG1 ILE A  42     154.476 169.943 134.824  1.00 19.82           C  
ATOM    269  CG2 ILE A  42     154.088 168.609 136.891  1.00 19.82           C  
ATOM    270  CD1 ILE A  42     155.062 168.822 134.017  1.00 19.82           C  
ATOM    271  N   ASP A  43     153.432 170.663 139.274  1.00 26.82           N  
ATOM    272  CA  ASP A  43     153.517 170.395 140.708  1.00 26.82           C  
ATOM    273  C   ASP A  43     152.859 169.052 140.987  1.00 26.82           C  
ATOM    274  O   ASP A  43     151.632 168.942 140.944  1.00 26.82           O  
ATOM    275  CB  ASP A  43     152.847 171.501 141.519  1.00 26.82           C  
ATOM    276  CG  ASP A  43     153.469 172.858 141.277  1.00 26.82           C  
ATOM    277  OD1 ASP A  43     154.678 172.909 140.979  1.00 26.82           O  
ATOM    278  OD2 ASP A  43     152.753 173.876 141.386  1.00 26.82           O  
ATOM    279  N   ILE A  44     153.661 168.038 141.282  1.00 19.39           N  
ATOM    280  CA  ILE A  44     153.169 166.673 141.423  1.00 19.39           C  
ATOM    281  C   ILE A  44     152.676 166.461 142.847  1.00 19.39           C  
ATOM    282  O   ILE A  44     153.426 166.660 143.806  1.00 19.39           O  
ATOM    283  CB  ILE A  44     154.260 165.658 141.065  1.00 19.39           C  
ATOM    284  CG1 ILE A  44     154.539 165.699 139.569  1.00 19.39           C  
ATOM    285  CG2 ILE A  44     153.854 164.270 141.487  1.00 19.39           C  
ATOM    286  CD1 ILE A  44     155.532 164.669 139.122  1.00 19.39           C  
ATOM    287  N   ALA A  45     151.411 166.058 142.990  1.00 19.26           N  
ATOM    288  CA  ALA A  45     150.855 165.821 144.316  1.00 19.26           C  
ATOM    289  C   ALA A  45     151.176 164.419 144.813  1.00 19.26           C  
ATOM    290  O   ALA A  45     151.699 164.252 145.920  1.00 19.26           O  
ATOM    291  CB  ALA A  45     149.345 166.047 144.304  1.00 19.26           C  
ATOM    292  N   SER A  46     150.874 163.398 144.015  1.00 24.57           N  
ATOM    293  CA  SER A  46     151.085 162.027 144.458  1.00 24.57           C  
ATOM    294  C   SER A  46     151.162 161.103 143.254  1.00 24.57           C  
ATOM    295  O   SER A  46     150.680 161.426 142.167  1.00 24.57           O  
ATOM    296  CB  SER A  46     149.972 161.565 145.400  1.00 24.57           C  
ATOM    297  OG  SER A  46     148.751 161.426 144.698  1.00 24.57           O  
ATOM    298  N   ILE A  47     151.780 159.946 143.470  1.00 20.98           N  
ATOM    299  CA  ILE A  47     151.831 158.866 142.493  1.00 20.98           C  
ATOM    300  C   ILE A  47     151.099 157.687 143.110  1.00 20.98           C  
ATOM    301  O   ILE A  47     151.617 157.040 144.027  1.00 20.98           O  
ATOM    302  CB  ILE A  47     153.267 158.487 142.122  1.00 20.98           C  
ATOM    303  CG1 ILE A  47     153.950 159.646 141.405  1.00 20.98           C  
ATOM    304  CG2 ILE A  47     153.275 157.255 141.251  1.00 20.98           C  
ATOM    305  CD1 ILE A  47     155.364 159.347 140.999  1.00 20.98           C  
ATOM    306  N   ASP A  48     149.898 157.403 142.609  1.00 33.77           N  
ATOM    307  CA  ASP A  48     149.024 156.449 143.283  1.00 33.77           C  
ATOM    308  C   ASP A  48     149.592 155.037 143.233  1.00 33.77           C  
ATOM    309  O   ASP A  48     149.912 154.448 144.271  1.00 33.77           O  
ATOM    310  CB  ASP A  48     147.626 156.494 142.666  1.00 33.77           C  
ATOM    311  CG  ASP A  48     146.838 157.717 143.097  1.00 33.77           C  
ATOM    312  OD1 ASP A  48     147.041 158.187 144.236  1.00 33.77           O  
ATOM    313  OD2 ASP A  48     146.013 158.206 142.297  1.00 33.77           O  
ATOM    314  N   MET A  49     149.731 154.474 142.037  1.00 36.70           N  
ATOM    315  CA  MET A  49     150.137 153.083 141.928  1.00 36.70           C  
ATOM    316  C   MET A  49     150.968 152.886 140.671  1.00 36.70           C  
ATOM    317  O   MET A  49     150.792 153.587 139.668  1.00 36.70           O  
ATOM    318  CB  MET A  49     148.929 152.143 141.919  1.00 36.70           C  
ATOM    319  CG  MET A  49     147.987 152.353 140.755  1.00 36.70           C  
ATOM    320  SD  MET A  49     146.401 151.545 141.030  1.00 36.70           S  
ATOM    321  CE  MET A  49     146.928 149.856 141.298  1.00 36.70           C  
ATOM    322  N   VAL A  50     151.869 151.909 140.744  1.00 35.15           N  
ATOM    323  CA  VAL A  50     152.848 151.621 139.701  1.00 35.15           C  
ATOM    324  C   VAL A  50     152.801 150.119 139.465  1.00 35.15           C  
ATOM    325  O   VAL A  50     153.413 149.350 140.213  1.00 35.15           O  
ATOM    326  CB  VAL A  50     154.259 152.068 140.096  1.00 35.15           C  
ATOM    327  CG1 VAL A  50     155.228 151.788 138.980  1.00 35.15           C  
ATOM    328  CG2 VAL A  50     154.268 153.538 140.449  1.00 35.15           C  
ATOM    329  N   SER A  51     152.084 149.691 138.430  1.00 42.83           N  
ATOM    330  CA  SER A  51     151.814 148.273 138.233  1.00 42.83           C  
ATOM    331  C   SER A  51     152.761 147.656 137.214  1.00 42.83           C  
ATOM    332  O   SER A  51     153.167 148.309 136.251  1.00 42.83           O  
ATOM    333  CB  SER A  51     150.371 148.064 137.782  1.00 42.83           C  
ATOM    334  OG  SER A  51     150.120 146.693 137.542  1.00 42.83           O  
ATOM    335  N   GLU A  52     153.112 146.387 137.438  1.00 47.22           N  
ATOM    336  CA  GLU A  52     153.923 145.654 136.471  1.00 47.22           C  
ATOM    337  C   GLU A  52     153.069 144.862 135.491  1.00 47.22           C  
ATOM    338  O   GLU A  52     153.523 144.566 134.382  1.00 47.22           O  
ATOM    339  CB  GLU A  52     154.889 144.707 137.184  1.00 47.22           C  
ATOM    340  CG  GLU A  52     155.880 145.391 138.103  1.00 47.22           C  
ATOM    341  CD  GLU A  52     155.382 145.479 139.527  1.00 47.22           C  
ATOM    342  OE1 GLU A  52     154.158 145.358 139.737  1.00 47.22           O  
ATOM    343  OE2 GLU A  52     156.215 145.657 140.440  1.00 47.22           O  
ATOM    344  N   VAL A  53     151.846 144.504 135.880  1.00 42.24           N  
ATOM    345  CA  VAL A  53     150.986 143.717 134.999  1.00 42.24           C  
ATOM    346  C   VAL A  53     150.629 144.516 133.753  1.00 42.24           C  
ATOM    347  O   VAL A  53     150.773 144.037 132.623  1.00 42.24           O  
ATOM    348  CB  VAL A  53     149.724 143.257 135.749  1.00 42.24           C  
ATOM    349  CG1 VAL A  53     148.846 142.424 134.835  1.00 42.24           C  
ATOM    350  CG2 VAL A  53     150.098 142.476 136.994  1.00 42.24           C  
ATOM    351  N   ASN A  54     150.154 145.745 133.941  1.00 38.54           N  
ATOM    352  CA  ASN A  54     149.760 146.602 132.833  1.00 38.54           C  
ATOM    353  C   ASN A  54     150.873 147.531 132.375  1.00 38.54           C  
ATOM    354  O   ASN A  54     150.732 148.166 131.325  1.00 38.54           O  
ATOM    355  CB  ASN A  54     148.540 147.436 133.226  1.00 38.54           C  
ATOM    356  CG  ASN A  54     147.458 146.606 133.871  1.00 38.54           C  
ATOM    357  OD1 ASN A  54     147.290 145.432 133.549  1.00 38.54           O  
ATOM    358  ND2 ASN A  54     146.721 147.207 134.795  1.00 38.54           N  
ATOM    359  N   MET A  55     151.963 147.628 133.136  1.00 40.00           N  
ATOM    360  CA  MET A  55     153.101 148.479 132.790  1.00 40.00           C  
ATOM    361  C   MET A  55     152.684 149.945 132.698  1.00 40.00           C  
ATOM    362  O   MET A  55     152.822 150.590 131.659  1.00 40.00           O  
ATOM    363  CB  MET A  55     153.762 148.011 131.492  1.00 40.00           C  
ATOM    364  CG  MET A  55     154.259 146.580 131.541  1.00 40.00           C  
ATOM    365  SD  MET A  55     155.080 146.064 130.024  1.00 40.00           S  
ATOM    366  CE  MET A  55     155.572 144.399 130.460  1.00 40.00           C  
ATOM    367  N   ASP A  56     152.165 150.472 133.805  1.00 35.65           N  
ATOM    368  CA  ASP A  56     151.699 151.848 133.835  1.00 35.65           C  
ATOM    369  C   ASP A  56     151.721 152.371 135.263  1.00 35.65           C  
ATOM    370  O   ASP A  56     151.674 151.606 136.230  1.00 35.65           O  
ATOM    371  CB  ASP A  56     150.291 151.965 133.250  1.00 35.65           C  
ATOM    372  CG  ASP A  56     149.313 151.015 133.903  1.00 35.65           C  
ATOM    373  OD1 ASP A  56     149.749 150.180 134.721  1.00 35.65           O  
ATOM    374  OD2 ASP A  56     148.105 151.103 133.598  1.00 35.65           O  
ATOM    375  N   TYR A  57     151.759 153.696 135.381  1.00 27.12           N  
ATOM    376  CA  TYR A  57     151.750 154.358 136.676  1.00 27.12           C  
ATOM    377  C   TYR A  57     150.787 155.533 136.643  1.00 27.12           C  
ATOM    378  O   TYR A  57     150.644 156.205 135.615  1.00 27.12           O  
ATOM    379  CB  TYR A  57     153.147 154.839 137.070  1.00 27.12           C  
ATOM    380  CG  TYR A  57     153.672 155.974 136.234  1.00 27.12           C  
ATOM    381  CD1 TYR A  57     154.080 155.765 134.932  1.00 27.12           C  
ATOM    382  CD2 TYR A  57     153.778 157.249 136.754  1.00 27.12           C  
ATOM    383  CE1 TYR A  57     154.566 156.794 134.166  1.00 27.12           C  
ATOM    384  CE2 TYR A  57     154.263 158.285 135.994  1.00 27.12           C  
ATOM    385  CZ  TYR A  57     154.655 158.052 134.700  1.00 27.12           C  
ATOM    386  OH  TYR A  57     155.143 159.081 133.932  1.00 27.12           O  
ATOM    387  N   THR A  58     150.130 155.775 137.773  1.00 25.87           N  
ATOM    388  CA  THR A  58     149.129 156.829 137.891  1.00 25.87           C  
ATOM    389  C   THR A  58     149.683 157.991 138.702  1.00 25.87           C  
ATOM    390  O   THR A  58     150.239 157.783 139.783  1.00 25.87           O  
ATOM    391  CB  THR A  58     147.861 156.290 138.549  1.00 25.87           C  
ATOM    392  OG1 THR A  58     147.168 155.444 137.626  1.00 25.87           O  
ATOM    393  CG2 THR A  58     146.955 157.424 138.976  1.00 25.87           C  
ATOM    394  N   LEU A  59     149.525 159.211 138.189  1.00 21.68           N  
ATOM    395  CA  LEU A  59     149.981 160.401 138.892  1.00 21.68           C  
ATOM    396  C   LEU A  59     148.907 161.478 138.873  1.00 21.68           C  
ATOM    397  O   LEU A  59     148.077 161.532 137.965  1.00 21.68           O  
ATOM    398  CB  LEU A  59     151.279 160.950 138.286  1.00 21.68           C  
ATOM    399  CG  LEU A  59     151.281 161.553 136.884  1.00 21.68           C  
ATOM    400  CD1 LEU A  59     150.943 163.029 136.914  1.00 21.68           C  
ATOM    401  CD2 LEU A  59     152.638 161.353 136.253  1.00 21.68           C  
ATOM    402  N   THR A  60     148.942 162.342 139.885  1.00 21.65           N  
ATOM    403  CA  THR A  60     148.076 163.509 139.983  1.00 21.65           C  
ATOM    404  C   THR A  60     148.949 164.750 140.070  1.00 21.65           C  
ATOM    405  O   THR A  60     149.905 164.781 140.851  1.00 21.65           O  
ATOM    406  CB  THR A  60     147.168 163.415 141.206  1.00 21.65           C  
ATOM    407  OG1 THR A  60     146.258 162.322 141.043  1.00 21.65           O  
ATOM    408  CG2 THR A  60     146.385 164.694 141.383  1.00 21.65           C  
ATOM    409  N   MET A  61     148.633 165.770 139.278  1.00 39.51           N  
ATOM    410  CA  MET A  61     149.520 166.918 139.195  1.00 39.51           C  
ATOM    411  C   MET A  61     148.728 168.188 138.945  1.00 39.51           C  
ATOM    412  O   MET A  61     147.569 168.154 138.528  1.00 39.51           O  
ATOM    413  CB  MET A  61     150.557 166.735 138.089  1.00 39.51           C  
ATOM    414  CG  MET A  61     149.959 166.636 136.712  1.00 39.51           C  
ATOM    415  SD  MET A  61     151.222 166.301 135.482  1.00 39.51           S  
ATOM    416  CE  MET A  61     150.205 165.985 134.052  1.00 39.51           C  
ATOM    417  N   TYR A  62     149.376 169.314 139.218  1.00 24.56           N  
ATOM    418  CA  TYR A  62     148.893 170.633 138.841  1.00 24.56           C  
ATOM    419  C   TYR A  62     149.730 171.097 137.661  1.00 24.56           C  
ATOM    420  O   TYR A  62     150.955 171.217 137.775  1.00 24.56           O  
ATOM    421  CB  TYR A  62     149.004 171.628 139.994  1.00 24.56           C  
ATOM    422  CG  TYR A  62     148.345 171.188 141.273  1.00 24.56           C  
ATOM    423  CD1 TYR A  62     147.316 170.266 141.265  1.00 24.56           C  
ATOM    424  CD2 TYR A  62     148.751 171.699 142.491  1.00 24.56           C  
ATOM    425  CE1 TYR A  62     146.714 169.865 142.431  1.00 24.56           C  
ATOM    426  CE2 TYR A  62     148.155 171.302 143.660  1.00 24.56           C  
ATOM    427  CZ  TYR A  62     147.140 170.384 143.624  1.00 24.56           C  
ATOM    428  OH  TYR A  62     146.543 169.986 144.791  1.00 24.56           O  
ATOM    429  N   PHE A  63     149.069 171.347 136.540  1.00 16.43           N  
ATOM    430  CA  PHE A  63     149.710 171.689 135.280  1.00 16.43           C  
ATOM    431  C   PHE A  63     149.490 173.170 135.030  1.00 16.43           C  
ATOM    432  O   PHE A  63     148.361 173.652 135.144  1.00 16.43           O  
ATOM    433  CB  PHE A  63     149.102 170.854 134.156  1.00 16.43           C  
ATOM    434  CG  PHE A  63     149.915 170.809 132.910  1.00 16.43           C  
ATOM    435  CD1 PHE A  63     151.096 170.103 132.867  1.00 16.43           C  
ATOM    436  CD2 PHE A  63     149.474 171.430 131.764  1.00 16.43           C  
ATOM    437  CE1 PHE A  63     151.836 170.047 131.714  1.00 16.43           C  
ATOM    438  CE2 PHE A  63     150.208 171.375 130.611  1.00 16.43           C  
ATOM    439  CZ  PHE A  63     151.390 170.682 130.585  1.00 16.43           C  
ATOM    440  N   GLN A  64     150.550 173.901 134.703  1.00 22.88           N  
ATOM    441  CA  GLN A  64     150.421 175.344 134.575  1.00 22.88           C  
ATOM    442  C   GLN A  64     151.167 175.822 133.343  1.00 22.88           C  
ATOM    443  O   GLN A  64     152.334 175.478 133.149  1.00 22.88           O  
ATOM    444  CB  GLN A  64     150.950 176.042 135.827  1.00 22.88           C  
ATOM    445  CG  GLN A  64     150.906 177.541 135.763  1.00 22.88           C  
ATOM    446  CD  GLN A  64     151.076 178.166 137.122  1.00 22.88           C  
ATOM    447  OE1 GLN A  64     150.442 177.748 138.089  1.00 22.88           O  
ATOM    448  NE2 GLN A  64     151.944 179.164 137.209  1.00 22.88           N  
ATOM    449  N   GLN A  65     150.496 176.615 132.517  1.00 18.15           N  
ATOM    450  CA  GLN A  65     151.068 177.133 131.285  1.00 18.15           C  
ATOM    451  C   GLN A  65     150.969 178.649 131.283  1.00 18.15           C  
ATOM    452  O   GLN A  65     149.912 179.208 131.585  1.00 18.15           O  
ATOM    453  CB  GLN A  65     150.355 176.550 130.069  1.00 18.15           C  
ATOM    454  CG  GLN A  65     150.513 175.054 129.941  1.00 18.15           C  
ATOM    455  CD  GLN A  65     149.678 174.479 128.824  1.00 18.15           C  
ATOM    456  OE1 GLN A  65     148.602 174.983 128.519  1.00 18.15           O  
ATOM    457  NE2 GLN A  65     150.174 173.421 128.202  1.00 18.15           N  
ATOM    458  N   ALA A  66     152.066 179.310 130.937  1.00 17.46           N  
ATOM    459  CA  ALA A  66     152.124 180.765 130.909  1.00 17.46           C  
ATOM    460  C   ALA A  66     152.559 181.202 129.524  1.00 17.46           C  
ATOM    461  O   ALA A  66     153.577 180.723 129.015  1.00 17.46           O  
ATOM    462  CB  ALA A  66     153.091 181.297 131.964  1.00 17.46           C  
ATOM    463  N   TRP A  67     151.795 182.105 128.914  1.00 39.51           N  
ATOM    464  CA  TRP A  67     152.163 182.594 127.590  1.00 39.51           C  
ATOM    465  C   TRP A  67     151.861 184.076 127.471  1.00 39.51           C  
ATOM    466  O   TRP A  67     150.878 184.561 128.035  1.00 39.51           O  
ATOM    467  CB  TRP A  67     151.450 181.815 126.476  1.00 39.51           C  
ATOM    468  CG  TRP A  67     149.978 181.991 126.423  1.00 39.51           C  
ATOM    469  CD1 TRP A  67     149.297 182.959 125.761  1.00 39.51           C  
ATOM    470  CD2 TRP A  67     148.997 181.159 127.040  1.00 39.51           C  
ATOM    471  NE1 TRP A  67     147.948 182.792 125.935  1.00 39.51           N  
ATOM    472  CE2 TRP A  67     147.739 181.690 126.718  1.00 39.51           C  
ATOM    473  CE3 TRP A  67     149.062 180.018 127.838  1.00 39.51           C  
ATOM    474  CZ2 TRP A  67     146.556 181.123 127.168  1.00 39.51           C  
ATOM    475  CZ3 TRP A  67     147.889 179.459 128.284  1.00 39.51           C  
ATOM    476  CH2 TRP A  67     146.652 180.007 127.946  1.00 39.51           C  
ATOM    477  N   ARG A  68     152.720 184.793 126.755  1.00 28.45           N  
ATOM    478  CA  ARG A  68     152.505 186.213 126.535  1.00 28.45           C  
ATOM    479  C   ARG A  68     151.580 186.426 125.347  1.00 28.45           C  
ATOM    480  O   ARG A  68     151.761 185.829 124.284  1.00 28.45           O  
ATOM    481  CB  ARG A  68     153.831 186.931 126.302  1.00 28.45           C  
ATOM    482  CG  ARG A  68     153.714 188.437 126.402  1.00 28.45           C  
ATOM    483  CD  ARG A  68     155.054 189.120 126.248  1.00 28.45           C  
ATOM    484  NE  ARG A  68     154.924 190.564 126.389  1.00 28.45           N  
ATOM    485  CZ  ARG A  68     154.513 191.372 125.418  1.00 28.45           C  
ATOM    486  NH1 ARG A  68     154.192 190.875 124.232  1.00 28.45           N  
ATOM    487  NH2 ARG A  68     154.421 192.676 125.634  1.00 28.45           N  
ATOM    488  N   ASP A  69     150.593 187.297 125.530  1.00 30.41           N  
ATOM    489  CA  ASP A  69     149.546 187.506 124.540  1.00 30.41           C  
ATOM    490  C   ASP A  69     149.268 188.996 124.449  1.00 30.41           C  
ATOM    491  O   ASP A  69     148.817 189.602 125.424  1.00 30.41           O  
ATOM    492  CB  ASP A  69     148.280 186.740 124.922  1.00 30.41           C  
ATOM    493  CG  ASP A  69     147.263 186.703 123.810  1.00 30.41           C  
ATOM    494  OD1 ASP A  69     147.529 187.288 122.741  1.00 30.41           O  
ATOM    495  OD2 ASP A  69     146.196 186.085 124.001  1.00 30.41           O  
ATOM    496  N   LYS A  70     149.526 189.583 123.280  1.00 29.22           N  
ATOM    497  CA  LYS A  70     149.447 191.034 123.157  1.00 29.22           C  
ATOM    498  C   LYS A  70     148.009 191.530 123.098  1.00 29.22           C  
ATOM    499  O   LYS A  70     147.754 192.704 123.383  1.00 29.22           O  
ATOM    500  CB  LYS A  70     150.218 191.498 121.924  1.00 29.22           C  
ATOM    501  CG  LYS A  70     151.717 191.279 122.024  1.00 29.22           C  
ATOM    502  CD  LYS A  70     152.435 191.757 120.774  1.00 29.22           C  
ATOM    503  CE  LYS A  70     153.937 191.554 120.895  1.00 29.22           C  
ATOM    504  NZ  LYS A  70     154.658 191.997 119.671  1.00 29.22           N  
ATOM    505  N   ARG A  71     147.061 190.671 122.725  1.00 26.74           N  
ATOM    506  CA  ARG A  71     145.685 191.135 122.584  1.00 26.74           C  
ATOM    507  C   ARG A  71     145.053 191.423 123.938  1.00 26.74           C  
ATOM    508  O   ARG A  71     144.379 192.445 124.107  1.00 26.74           O  
ATOM    509  CB  ARG A  71     144.860 190.113 121.807  1.00 26.74           C  
ATOM    510  CG  ARG A  71     145.329 189.911 120.379  1.00 26.74           C  
ATOM    511  CD  ARG A  71     144.305 189.143 119.573  1.00 26.74           C  
ATOM    512  NE  ARG A  71     143.971 187.873 120.205  1.00 26.74           N  
ATOM    513  CZ  ARG A  71     144.577 186.725 119.933  1.00 26.74           C  
ATOM    514  NH1 ARG A  71     145.550 186.685 119.036  1.00 26.74           N  
ATOM    515  NH2 ARG A  71     144.212 185.617 120.559  1.00 26.74           N  
ATOM    516  N   LEU A  72     145.255 190.543 124.912  1.00 29.16           N  
ATOM    517  CA  LEU A  72     144.716 190.740 126.255  1.00 29.16           C  
ATOM    518  C   LEU A  72     145.673 191.647 127.014  1.00 29.16           C  
ATOM    519  O   LEU A  72     146.655 191.183 127.594  1.00 29.16           O  
ATOM    520  CB  LEU A  72     144.536 189.404 126.966  1.00 29.16           C  
ATOM    521  CG  LEU A  72     143.594 188.416 126.286  1.00 29.16           C  
ATOM    522  CD1 LEU A  72     143.515 187.127 127.079  1.00 29.16           C  
ATOM    523  CD2 LEU A  72     142.223 189.035 126.130  1.00 29.16           C  
ATOM    524  N   SER A  73     145.390 192.946 127.013  1.00 38.03           N  
ATOM    525  CA  SER A  73     146.283 193.912 127.647  1.00 38.03           C  
ATOM    526  C   SER A  73     145.475 195.131 128.050  1.00 38.03           C  
ATOM    527  O   SER A  73     144.722 195.670 127.234  1.00 38.03           O  
ATOM    528  CB  SER A  73     147.414 194.305 126.707  1.00 38.03           C  
ATOM    529  OG  SER A  73     148.199 195.334 127.277  1.00 38.03           O  
ATOM    530  N   TYR A  74     145.632 195.566 129.296  1.00 45.66           N  
ATOM    531  CA  TYR A  74     144.891 196.693 129.839  1.00 45.66           C  
ATOM    532  C   TYR A  74     145.805 197.511 130.736  1.00 45.66           C  
ATOM    533  O   TYR A  74     146.660 196.957 131.431  1.00 45.66           O  
ATOM    534  CB  TYR A  74     143.675 196.218 130.628  1.00 45.66           C  
ATOM    535  CG  TYR A  74     144.025 195.277 131.751  1.00 45.66           C  
ATOM    536  CD1 TYR A  74     144.148 193.915 131.529  1.00 45.66           C  
ATOM    537  CD2 TYR A  74     144.235 195.750 133.034  1.00 45.66           C  
ATOM    538  CE1 TYR A  74     144.468 193.056 132.554  1.00 45.66           C  
ATOM    539  CE2 TYR A  74     144.554 194.898 134.063  1.00 45.66           C  
ATOM    540  CZ  TYR A  74     144.671 193.554 133.817  1.00 45.66           C  
ATOM    541  OH  TYR A  74     144.991 192.705 134.847  1.00 45.66           O  
ATOM    542  N   ASN A  75     145.624 198.829 130.716  1.00 62.03           N  
ATOM    543  CA  ASN A  75     146.433 199.738 131.515  1.00 62.03           C  
ATOM    544  C   ASN A  75     145.616 200.557 132.502  1.00 62.03           C  
ATOM    545  O   ASN A  75     146.164 201.469 133.128  1.00 62.03           O  
ATOM    546  CB  ASN A  75     147.223 200.677 130.602  1.00 62.03           C  
ATOM    547  CG  ASN A  75     148.197 199.937 129.719  1.00 62.03           C  
ATOM    548  OD1 ASN A  75     148.864 199.002 130.161  1.00 62.03           O  
ATOM    549  ND2 ASN A  75     148.284 200.344 128.459  1.00 62.03           N  
ATOM    550  N   VAL A  76     144.326 200.266 132.653  1.00 60.57           N  
ATOM    551  CA  VAL A  76     143.480 201.090 133.509  1.00 60.57           C  
ATOM    552  C   VAL A  76     143.628 200.694 134.973  1.00 60.57           C  
ATOM    553  O   VAL A  76     143.771 201.556 135.846  1.00 60.57           O  
ATOM    554  CB  VAL A  76     142.017 200.996 133.043  1.00 60.57           C  
ATOM    555  CG1 VAL A  76     141.149 201.954 133.838  1.00 60.57           C  
ATOM    556  CG2 VAL A  76     141.918 201.276 131.555  1.00 60.57           C  
ATOM    557  N   ILE A  77     143.604 199.403 135.266  1.00 57.71           N  
ATOM    558  CA  ILE A  77     143.592 198.890 136.634  1.00 57.71           C  
ATOM    559  C   ILE A  77     144.907 198.164 136.886  1.00 57.71           C  
ATOM    560  O   ILE A  77     145.307 197.334 136.063  1.00 57.71           O  
ATOM    561  CB  ILE A  77     142.400 197.947 136.879  1.00 57.71           C  
ATOM    562  CG1 ILE A  77     141.078 198.685 136.669  1.00 57.71           C  
ATOM    563  CG2 ILE A  77     142.463 197.358 138.270  1.00 57.71           C  
ATOM    564  CD1 ILE A  77     140.504 198.532 135.282  1.00 57.71           C  
ATOM    565  N   PRO A  78     145.600 198.436 137.994  1.00 58.51           N  
ATOM    566  CA  PRO A  78     146.856 197.719 138.267  1.00 58.51           C  
ATOM    567  C   PRO A  78     146.660 196.317 138.821  1.00 58.51           C  
ATOM    568  O   PRO A  78     147.652 195.597 138.992  1.00 58.51           O  
ATOM    569  CB  PRO A  78     147.554 198.622 139.288  1.00 58.51           C  
ATOM    570  CG  PRO A  78     146.431 199.278 140.009  1.00 58.51           C  
ATOM    571  CD  PRO A  78     145.348 199.498 138.982  1.00 58.51           C  
ATOM    572  N   LEU A  79     145.429 195.911 139.123  1.00 51.03           N  
ATOM    573  CA  LEU A  79     145.192 194.612 139.735  1.00 51.03           C  
ATOM    574  C   LEU A  79     145.488 193.475 138.760  1.00 51.03           C  
ATOM    575  O   LEU A  79     145.603 193.668 137.548  1.00 51.03           O  
ATOM    576  CB  LEU A  79     143.746 194.506 140.214  1.00 51.03           C  
ATOM    577  CG  LEU A  79     143.339 195.478 141.314  1.00 51.03           C  
ATOM    578  CD1 LEU A  79     141.873 195.296 141.654  1.00 51.03           C  
ATOM    579  CD2 LEU A  79     144.206 195.268 142.538  1.00 51.03           C  
ATOM    580  N   ASN A  80     145.611 192.272 139.315  1.00 41.19           N  
ATOM    581  CA  ASN A  80     145.740 191.050 138.530  1.00 41.19           C  
ATOM    582  C   ASN A  80     144.373 190.388 138.440  1.00 41.19           C  
ATOM    583  O   ASN A  80     143.933 189.733 139.388  1.00 41.19           O  
ATOM    584  CB  ASN A  80     146.753 190.104 139.162  1.00 41.19           C  
ATOM    585  CG  ASN A  80     148.163 190.617 139.062  1.00 41.19           C  
ATOM    586  OD1 ASN A  80     148.450 191.506 138.265  1.00 41.19           O  
ATOM    587  ND2 ASN A  80     149.057 190.060 139.868  1.00 41.19           N  
ATOM    588  N   LEU A  81     143.705 190.547 137.304  1.00 27.25           N  
ATOM    589  CA  LEU A  81     142.385 189.961 137.144  1.00 27.25           C  
ATOM    590  C   LEU A  81     142.470 188.443 137.126  1.00 27.25           C  
ATOM    591  O   LEU A  81     143.352 187.859 136.491  1.00 27.25           O  
ATOM    592  CB  LEU A  81     141.728 190.460 135.863  1.00 27.25           C  
ATOM    593  CG  LEU A  81     141.245 191.903 135.917  1.00 27.25           C  
ATOM    594  CD1 LEU A  81     140.412 192.229 134.696  1.00 27.25           C  
ATOM    595  CD2 LEU A  81     140.451 192.131 137.186  1.00 27.25           C  
ATOM    596  N   THR A  82     141.560 187.807 137.852  1.00 21.75           N  
ATOM    597  CA  THR A  82     141.378 186.365 137.805  1.00 21.75           C  
ATOM    598  C   THR A  82     139.938 186.086 137.424  1.00 21.75           C  
ATOM    599  O   THR A  82     139.016 186.544 138.104  1.00 21.75           O  
ATOM    600  CB  THR A  82     141.701 185.712 139.144  1.00 21.75           C  
ATOM    601  OG1 THR A  82     143.114 185.750 139.361  1.00 21.75           O  
ATOM    602  CG2 THR A  82     141.234 184.276 139.139  1.00 21.75           C  
ATOM    603  N   LEU A  83     139.741 185.337 136.347  1.00 18.77           N  
ATOM    604  CA  LEU A  83     138.408 185.159 135.799  1.00 18.77           C  
ATOM    605  C   LEU A  83     137.855 183.793 136.170  1.00 18.77           C  
ATOM    606  O   LEU A  83     138.603 182.861 136.472  1.00 18.77           O  
ATOM    607  CB  LEU A  83     138.419 185.320 134.282  1.00 18.77           C  
ATOM    608  CG  LEU A  83     138.987 186.649 133.799  1.00 18.77           C  
ATOM    609  CD1 LEU A  83     138.926 186.732 132.290  1.00 18.77           C  
ATOM    610  CD2 LEU A  83     138.228 187.795 134.432  1.00 18.77           C  
ATOM    611  N   ASP A  84     136.532 183.690 136.159  1.00 21.93           N  
ATOM    612  CA  ASP A  84     135.896 182.404 136.376  1.00 21.93           C  
ATOM    613  C   ASP A  84     136.272 181.460 135.243  1.00 21.93           C  
ATOM    614  O   ASP A  84     136.496 181.881 134.107  1.00 21.93           O  
ATOM    615  CB  ASP A  84     134.379 182.566 136.462  1.00 21.93           C  
ATOM    616  CG  ASP A  84     133.738 181.583 137.425  1.00 21.93           C  
ATOM    617  OD1 ASP A  84     134.100 181.596 138.619  1.00 21.93           O  
ATOM    618  OD2 ASP A  84     132.862 180.805 136.992  1.00 21.93           O  
ATOM    619  N   ASN A  85     136.351 180.169 135.561  1.00 18.18           N  
ATOM    620  CA  ASN A  85     136.841 179.207 134.582  1.00 18.18           C  
ATOM    621  C   ASN A  85     135.968 179.136 133.336  1.00 18.18           C  
ATOM    622  O   ASN A  85     136.424 178.622 132.309  1.00 18.18           O  
ATOM    623  CB  ASN A  85     136.958 177.828 135.217  1.00 18.18           C  
ATOM    624  CG  ASN A  85     135.709 177.423 135.948  1.00 18.18           C  
ATOM    625  OD1 ASN A  85     134.621 177.917 135.664  1.00 18.18           O  
ATOM    626  ND2 ASN A  85     135.854 176.515 136.900  1.00 18.18           N  
ATOM    627  N   ARG A  86     134.733 179.643 133.394  1.00 21.76           N  
ATOM    628  CA  ARG A  86     133.890 179.656 132.203  1.00 21.76           C  
ATOM    629  C   ARG A  86     134.526 180.449 131.072  1.00 21.76           C  
ATOM    630  O   ARG A  86     134.222 180.208 129.900  1.00 21.76           O  
ATOM    631  CB  ARG A  86     132.511 180.228 132.522  1.00 21.76           C  
ATOM    632  CG  ARG A  86     131.437 179.181 132.728  1.00 21.76           C  
ATOM    633  CD  ARG A  86     131.419 178.696 134.158  1.00 21.76           C  
ATOM    634  NE  ARG A  86     131.236 179.806 135.085  1.00 21.76           N  
ATOM    635  CZ  ARG A  86     130.062 180.366 135.353  1.00 21.76           C  
ATOM    636  NH1 ARG A  86     128.962 179.918 134.765  1.00 21.76           N  
ATOM    637  NH2 ARG A  86     129.988 181.374 136.209  1.00 21.76           N  
ATOM    638  N   VAL A  87     135.407 181.397 131.397  1.00 18.45           N  
ATOM    639  CA  VAL A  87     136.067 182.182 130.364  1.00 18.45           C  
ATOM    640  C   VAL A  87     137.112 181.385 129.604  1.00 18.45           C  
ATOM    641  O   VAL A  87     137.586 181.843 128.561  1.00 18.45           O  
ATOM    642  CB  VAL A  87     136.726 183.438 130.966  1.00 18.45           C  
ATOM    643  CG1 VAL A  87     138.113 183.114 131.472  1.00 18.45           C  
ATOM    644  CG2 VAL A  87     136.772 184.560 129.950  1.00 18.45           C  
ATOM    645  N   ALA A  88     137.476 180.197 130.091  1.00 16.73           N  
ATOM    646  CA  ALA A  88     138.554 179.445 129.460  1.00 16.73           C  
ATOM    647  C   ALA A  88     138.219 179.059 128.028  1.00 16.73           C  
ATOM    648  O   ALA A  88     139.125 178.856 127.215  1.00 16.73           O  
ATOM    649  CB  ALA A  88     138.875 178.199 130.281  1.00 16.73           C  
ATOM    650  N   ASP A  89     136.934 178.944 127.699  1.00 19.74           N  
ATOM    651  CA  ASP A  89     136.563 178.567 126.340  1.00 19.74           C  
ATOM    652  C   ASP A  89     136.674 179.745 125.382  1.00 19.74           C  
ATOM    653  O   ASP A  89     136.991 179.562 124.203  1.00 19.74           O  
ATOM    654  CB  ASP A  89     135.148 177.997 126.321  1.00 19.74           C  
ATOM    655  CG  ASP A  89     135.051 176.668 127.034  1.00 19.74           C  
ATOM    656  OD1 ASP A  89     136.060 175.935 127.064  1.00 19.74           O  
ATOM    657  OD2 ASP A  89     133.964 176.353 127.563  1.00 19.74           O  
ATOM    658  N   GLN A  90     136.410 180.960 125.863  1.00 20.25           N  
ATOM    659  CA  GLN A  90     136.372 182.107 124.962  1.00 20.25           C  
ATOM    660  C   GLN A  90     137.772 182.567 124.577  1.00 20.25           C  
ATOM    661  O   GLN A  90     137.992 183.017 123.448  1.00 20.25           O  
ATOM    662  CB  GLN A  90     135.580 183.242 125.600  1.00 20.25           C  
ATOM    663  CG  GLN A  90     134.112 182.913 125.785  1.00 20.25           C  
ATOM    664  CD  GLN A  90     133.368 183.979 126.552  1.00 20.25           C  
ATOM    665  OE1 GLN A  90     133.934 184.648 127.413  1.00 20.25           O  
ATOM    666  NE2 GLN A  90     132.089 184.144 126.245  1.00 20.25           N  
ATOM    667  N   LEU A  91     138.729 182.470 125.494  1.00 18.96           N  
ATOM    668  CA  LEU A  91     140.098 182.846 125.181  1.00 18.96           C  
ATOM    669  C   LEU A  91     140.775 181.772 124.336  1.00 18.96           C  
ATOM    670  O   LEU A  91     140.233 180.690 124.102  1.00 18.96           O  
ATOM    671  CB  LEU A  91     140.907 183.063 126.457  1.00 18.96           C  
ATOM    672  CG  LEU A  91     140.394 184.101 127.447  1.00 18.96           C  
ATOM    673  CD1 LEU A  91     141.359 184.207 128.610  1.00 18.96           C  
ATOM    674  CD2 LEU A  91     140.222 185.441 126.770  1.00 18.96           C  
ATOM    675  N   TRP A  92     141.979 182.089 123.871  1.00 18.68           N  
ATOM    676  CA  TRP A  92     142.815 181.089 123.226  1.00 18.68           C  
ATOM    677  C   TRP A  92     143.588 180.306 124.275  1.00 18.68           C  
ATOM    678  O   TRP A  92     143.946 180.838 125.327  1.00 18.68           O  
ATOM    679  CB  TRP A  92     143.787 181.748 122.253  1.00 18.68           C  
ATOM    680  CG  TRP A  92     144.666 180.771 121.548  1.00 18.68           C  
ATOM    681  CD1 TRP A  92     144.312 179.947 120.527  1.00 18.68           C  
ATOM    682  CD2 TRP A  92     146.050 180.517 121.806  1.00 18.68           C  
ATOM    683  NE1 TRP A  92     145.387 179.195 120.130  1.00 18.68           N  
ATOM    684  CE2 TRP A  92     146.468 179.528 120.900  1.00 18.68           C  
ATOM    685  CE3 TRP A  92     146.976 181.031 122.713  1.00 18.68           C  
ATOM    686  CZ2 TRP A  92     147.767 179.039 120.878  1.00 18.68           C  
ATOM    687  CZ3 TRP A  92     148.267 180.547 122.685  1.00 18.68           C  
ATOM    688  CH2 TRP A  92     148.650 179.560 121.776  1.00 18.68           C  
ATOM    689  N   VAL A  93     143.841 179.034 123.989  1.00 19.71           N  
ATOM    690  CA  VAL A  93     144.634 178.189 124.877  1.00 19.71           C  
ATOM    691  C   VAL A  93     145.467 177.232 124.035  1.00 19.71           C  
ATOM    692  O   VAL A  93     144.933 176.594 123.119  1.00 19.71           O  
ATOM    693  CB  VAL A  93     143.741 177.423 125.859  1.00 19.71           C  
ATOM    694  CG1 VAL A  93     143.488 178.256 127.092  1.00 19.71           C  
ATOM    695  CG2 VAL A  93     142.431 177.060 125.192  1.00 19.71           C  
ATOM    696  N   PRO A  94     146.762 177.090 124.304  1.00 16.31           N  
ATOM    697  CA  PRO A  94     147.577 176.184 123.497  1.00 16.31           C  
ATOM    698  C   PRO A  94     147.208 174.739 123.770  1.00 16.31           C  
ATOM    699  O   PRO A  94     147.065 174.321 124.920  1.00 16.31           O  
ATOM    700  CB  PRO A  94     149.003 176.493 123.956  1.00 16.31           C  
ATOM    701  CG  PRO A  94     148.836 176.912 125.351  1.00 16.31           C  
ATOM    702  CD  PRO A  94     147.537 177.673 125.407  1.00 16.31           C  
ATOM    703  N   ASP A  95     147.054 173.975 122.695  1.00 18.59           N  
ATOM    704  CA  ASP A  95     146.705 172.567 122.798  1.00 18.59           C  
ATOM    705  C   ASP A  95     147.958 171.764 123.098  1.00 18.59           C  
ATOM    706  O   ASP A  95     148.986 171.935 122.438  1.00 18.59           O  
ATOM    707  CB  ASP A  95     146.049 172.077 121.511  1.00 18.59           C  
ATOM    708  CG  ASP A  95     146.733 172.610 120.283  1.00 18.59           C  
ATOM    709  OD1 ASP A  95     147.675 173.412 120.445  1.00 18.59           O  
ATOM    710  OD2 ASP A  95     146.333 172.235 119.162  1.00 18.59           O  
ATOM    711  N   THR A  96     147.872 170.901 124.103  1.00 13.76           N  
ATOM    712  CA  THR A  96     149.028 170.165 124.592  1.00 13.76           C  
ATOM    713  C   THR A  96     148.586 168.772 124.998  1.00 13.76           C  
ATOM    714  O   THR A  96     147.782 168.625 125.921  1.00 13.76           O  
ATOM    715  CB  THR A  96     149.662 170.890 125.774  1.00 13.76           C  
ATOM    716  OG1 THR A  96     150.116 172.179 125.349  1.00 13.76           O  
ATOM    717  CG2 THR A  96     150.821 170.105 126.300  1.00 13.76           C  
ATOM    718  N   TYR A  97     149.112 167.756 124.324  1.00 14.94           N  
ATOM    719  CA  TYR A  97     148.725 166.374 124.564  1.00 14.94           C  
ATOM    720  C   TYR A  97     149.915 165.604 125.108  1.00 14.94           C  
ATOM    721  O   TYR A  97     151.032 165.747 124.606  1.00 14.94           O  
ATOM    722  CB  TYR A  97     148.222 165.713 123.284  1.00 14.94           C  
ATOM    723  CG  TYR A  97     149.325 165.344 122.327  1.00 14.94           C  
ATOM    724  CD1 TYR A  97     150.048 166.319 121.670  1.00 14.94           C  
ATOM    725  CD2 TYR A  97     149.647 164.020 122.085  1.00 14.94           C  
ATOM    726  CE1 TYR A  97     151.056 165.990 120.797  1.00 14.94           C  
ATOM    727  CE2 TYR A  97     150.654 163.682 121.211  1.00 14.94           C  
ATOM    728  CZ  TYR A  97     151.356 164.670 120.574  1.00 14.94           C  
ATOM    729  OH  TYR A  97     152.363 164.337 119.703  1.00 14.94           O  
ATOM    730  N   PHE A  98     149.677 164.801 126.139  1.00 16.48           N  
ATOM    731  CA  PHE A  98     150.702 163.905 126.650  1.00 16.48           C  
ATOM    732  C   PHE A  98     150.792 162.688 125.742  1.00 16.48           C  
ATOM    733  O   PHE A  98     149.781 162.041 125.462  1.00 16.48           O  
ATOM    734  CB  PHE A  98     150.372 163.494 128.080  1.00 16.48           C  
ATOM    735  CG  PHE A  98     150.124 164.652 128.991  1.00 16.48           C  
ATOM    736  CD1 PHE A  98     150.885 165.794 128.888  1.00 16.48           C  
ATOM    737  CD2 PHE A  98     149.126 164.607 129.938  1.00 16.48           C  
ATOM    738  CE1 PHE A  98     150.665 166.863 129.714  1.00 16.48           C  
ATOM    739  CE2 PHE A  98     148.901 165.677 130.765  1.00 16.48           C  
ATOM    740  CZ  PHE A  98     149.673 166.806 130.654  1.00 16.48           C  
ATOM    741  N   LEU A  99     152.003 162.376 125.281  1.00 18.25           N  
ATOM    742  CA  LEU A  99     152.135 161.420 124.187  1.00 18.25           C  
ATOM    743  C   LEU A  99     151.798 159.999 124.614  1.00 18.25           C  
ATOM    744  O   LEU A  99     151.265 159.228 123.810  1.00 18.25           O  
ATOM    745  CB  LEU A  99     153.546 161.461 123.610  1.00 18.25           C  
ATOM    746  CG  LEU A  99     153.727 160.521 122.420  1.00 18.25           C  
ATOM    747  CD1 LEU A  99     152.833 160.966 121.293  1.00 18.25           C  
ATOM    748  CD2 LEU A  99     155.163 160.453 121.957  1.00 18.25           C  
ATOM    749  N   ASN A 100     152.082 159.629 125.860  1.00 23.42           N  
ATOM    750  CA  ASN A 100     151.970 158.233 126.262  1.00 23.42           C  
ATOM    751  C   ASN A 100     150.960 158.014 127.380  1.00 23.42           C  
ATOM    752  O   ASN A 100     151.118 157.079 128.168  1.00 23.42           O  
ATOM    753  CB  ASN A 100     153.337 157.682 126.671  1.00 23.42           C  
ATOM    754  CG  ASN A 100     153.964 158.456 127.807  1.00 23.42           C  
ATOM    755  OD1 ASN A 100     153.323 159.296 128.432  1.00 23.42           O  
ATOM    756  ND2 ASN A 100     155.228 158.172 128.085  1.00 23.42           N  
ATOM    757  N   ASP A 101     149.938 158.855 127.485  1.00 20.18           N  
ATOM    758  CA  ASP A 101     148.881 158.612 128.456  1.00 20.18           C  
ATOM    759  C   ASP A 101     147.809 157.720 127.849  1.00 20.18           C  
ATOM    760  O   ASP A 101     147.520 157.798 126.654  1.00 20.18           O  
ATOM    761  CB  ASP A 101     148.271 159.926 128.940  1.00 20.18           C  
ATOM    762  CG  ASP A 101     147.394 160.584 127.903  1.00 20.18           C  
ATOM    763  OD1 ASP A 101     147.734 160.523 126.705  1.00 20.18           O  
ATOM    764  OD2 ASP A 101     146.363 161.171 128.289  1.00 20.18           O  
ATOM    765  N   LYS A 102     147.242 156.846 128.672  1.00 20.09           N  
ATOM    766  CA  LYS A 102     146.208 155.935 128.203  1.00 20.09           C  
ATOM    767  C   LYS A 102     144.807 156.414 128.553  1.00 20.09           C  
ATOM    768  O   LYS A 102     143.859 156.145 127.809  1.00 20.09           O  
ATOM    769  CB  LYS A 102     146.446 154.540 128.779  1.00 20.09           C  
ATOM    770  CG  LYS A 102     147.796 153.969 128.411  1.00 20.09           C  
ATOM    771  CD  LYS A 102     148.148 152.767 129.260  1.00 20.09           C  
ATOM    772  CE  LYS A 102     147.208 151.617 128.997  1.00 20.09           C  
ATOM    773  NZ  LYS A 102     147.647 150.398 129.718  1.00 20.09           N  
ATOM    774  N   LYS A 103     144.655 157.112 129.675  1.00 22.79           N  
ATOM    775  CA  LYS A 103     143.352 157.622 130.093  1.00 22.79           C  
ATOM    776  C   LYS A 103     143.575 158.724 131.112  1.00 22.79           C  
ATOM    777  O   LYS A 103     144.114 158.464 132.191  1.00 22.79           O  
ATOM    778  CB  LYS A 103     142.498 156.507 130.682  1.00 22.79           C  
ATOM    779  CG  LYS A 103     141.282 156.991 131.440  1.00 22.79           C  
ATOM    780  CD  LYS A 103     140.478 155.813 131.953  1.00 22.79           C  
ATOM    781  CE  LYS A 103     141.333 154.909 132.819  1.00 22.79           C  
ATOM    782  NZ  LYS A 103     140.577 153.722 133.295  1.00 22.79           N  
ATOM    783  N   SER A 104     143.165 159.944 130.780  1.00 21.96           N  
ATOM    784  CA  SER A 104     143.353 161.084 131.663  1.00 21.96           C  
ATOM    785  C   SER A 104     142.103 161.946 131.654  1.00 21.96           C  
ATOM    786  O   SER A 104     141.449 162.087 130.619  1.00 21.96           O  
ATOM    787  CB  SER A 104     144.560 161.922 131.242  1.00 21.96           C  
ATOM    788  OG  SER A 104     145.740 161.142 131.209  1.00 21.96           O  
ATOM    789  N   PHE A 105     141.780 162.528 132.806  1.00 20.64           N  
ATOM    790  CA  PHE A 105     140.585 163.344 132.939  1.00 20.64           C  
ATOM    791  C   PHE A 105     140.831 164.478 133.918  1.00 20.64           C  
ATOM    792  O   PHE A 105     141.491 164.290 134.941  1.00 20.64           O  
ATOM    793  CB  PHE A 105     139.389 162.510 133.404  1.00 20.64           C  
ATOM    794  CG  PHE A 105     139.589 161.847 134.733  1.00 20.64           C  
ATOM    795  CD1 PHE A 105     140.237 160.634 134.821  1.00 20.64           C  
ATOM    796  CD2 PHE A 105     139.105 162.424 135.890  1.00 20.64           C  
ATOM    797  CE1 PHE A 105     140.413 160.016 136.035  1.00 20.64           C  
ATOM    798  CE2 PHE A 105     139.278 161.808 137.108  1.00 20.64           C  
ATOM    799  CZ  PHE A 105     139.936 160.604 137.180  1.00 20.64           C  
ATOM    800  N   VAL A 106     140.284 165.647 133.604  1.00 39.51           N  
ATOM    801  CA  VAL A 106     140.410 166.815 134.468  1.00 39.51           C  
ATOM    802  C   VAL A 106     139.404 166.705 135.601  1.00 39.51           C  
ATOM    803  O   VAL A 106     138.215 166.469 135.368  1.00 39.51           O  
ATOM    804  CB  VAL A 106     140.197 168.103 133.666  1.00 39.51           C  
ATOM    805  CG1 VAL A 106     140.248 169.297 134.583  1.00 39.51           C  
ATOM    806  CG2 VAL A 106     141.239 168.216 132.580  1.00 39.51           C  
ATOM    807  N   HIS A 107     139.875 166.884 136.830  1.00 23.66           N  
ATOM    808  CA  HIS A 107     139.015 166.725 137.995  1.00 23.66           C  
ATOM    809  C   HIS A 107     137.936 167.796 138.005  1.00 23.66           C  
ATOM    810  O   HIS A 107     138.240 168.992 137.978  1.00 23.66           O  
ATOM    811  CB  HIS A 107     139.835 166.801 139.276  1.00 23.66           C  
ATOM    812  CG  HIS A 107     140.657 165.582 139.541  1.00 23.66           C  
ATOM    813  ND1 HIS A 107     140.131 164.440 140.101  1.00 23.66           N  
ATOM    814  CD2 HIS A 107     141.969 165.329 139.330  1.00 23.66           C  
ATOM    815  CE1 HIS A 107     141.084 163.532 140.218  1.00 23.66           C  
ATOM    816  NE2 HIS A 107     142.209 164.047 139.760  1.00 23.66           N  
ATOM    817  N   GLY A 108     136.678 167.370 138.039  1.00 21.31           N  
ATOM    818  CA  GLY A 108     135.588 168.291 138.273  1.00 21.31           C  
ATOM    819  C   GLY A 108     134.804 167.891 139.504  1.00 21.31           C  
ATOM    820  O   GLY A 108     134.103 166.877 139.489  1.00 21.31           O  
ATOM    821  N   VAL A 109     134.902 168.678 140.572  1.00 20.38           N  
ATOM    822  CA  VAL A 109     134.255 168.323 141.828  1.00 20.38           C  
ATOM    823  C   VAL A 109     133.113 169.284 142.088  1.00 20.38           C  
ATOM    824  O   VAL A 109     131.946 168.883 142.118  1.00 20.38           O  
ATOM    825  CB  VAL A 109     135.247 168.346 143.000  1.00 20.38           C  
ATOM    826  CG1 VAL A 109     134.551 167.919 144.274  1.00 20.38           C  
ATOM    827  CG2 VAL A 109     136.432 167.457 142.702  1.00 20.38           C  
ATOM    828  N   THR A 110     133.438 170.558 142.276  1.00 16.65           N  
ATOM    829  CA  THR A 110     132.424 171.599 142.352  1.00 16.65           C  
ATOM    830  C   THR A 110     132.335 172.400 141.066  1.00 16.65           C  
ATOM    831  O   THR A 110     131.236 172.755 140.634  1.00 16.65           O  
ATOM    832  CB  THR A 110     132.704 172.530 143.528  1.00 16.65           C  
ATOM    833  OG1 THR A 110     134.066 172.963 143.475  1.00 16.65           O  
ATOM    834  CG2 THR A 110     132.476 171.803 144.828  1.00 16.65           C  
ATOM    835  N   VAL A 111     133.477 172.698 140.454  1.00 18.65           N  
ATOM    836  CA  VAL A 111     133.559 173.167 139.080  1.00 18.65           C  
ATOM    837  C   VAL A 111     134.746 172.467 138.438  1.00 18.65           C  
ATOM    838  O   VAL A 111     135.536 171.803 139.107  1.00 18.65           O  
ATOM    839  CB  VAL A 111     133.729 174.693 138.979  1.00 18.65           C  
ATOM    840  CG1 VAL A 111     132.515 175.411 139.530  1.00 18.65           C  
ATOM    841  CG2 VAL A 111     134.971 175.104 139.714  1.00 18.65           C  
ATOM    842  N   LYS A 112     134.868 172.617 137.125  1.00 20.09           N  
ATOM    843  CA  LYS A 112     136.055 172.113 136.454  1.00 20.09           C  
ATOM    844  C   LYS A 112     137.278 172.867 136.951  1.00 20.09           C  
ATOM    845  O   LYS A 112     137.366 174.089 136.819  1.00 20.09           O  
ATOM    846  CB  LYS A 112     135.914 172.249 134.943  1.00 20.09           C  
ATOM    847  CG  LYS A 112     134.869 171.331 134.351  1.00 20.09           C  
ATOM    848  CD  LYS A 112     135.020 171.190 132.851  1.00 20.09           C  
ATOM    849  CE  LYS A 112     136.157 170.252 132.491  1.00 20.09           C  
ATOM    850  NZ  LYS A 112     137.488 170.909 132.565  1.00 20.09           N  
ATOM    851  N   ASN A 113     138.225 172.133 137.529  1.00 18.52           N  
ATOM    852  CA  ASN A 113     139.371 172.742 138.196  1.00 18.52           C  
ATOM    853  C   ASN A 113     140.329 173.290 137.147  1.00 18.52           C  
ATOM    854  O   ASN A 113     141.251 172.619 136.682  1.00 18.52           O  
ATOM    855  CB  ASN A 113     140.060 171.733 139.100  1.00 18.52           C  
ATOM    856  CG  ASN A 113     139.122 171.138 140.112  1.00 18.52           C  
ATOM    857  OD1 ASN A 113     139.181 169.947 140.406  1.00 18.52           O  
ATOM    858  ND2 ASN A 113     138.237 171.963 140.647  1.00 18.52           N  
ATOM    859  N   ARG A 114     140.104 174.542 136.768  1.00 17.57           N  
ATOM    860  CA  ARG A 114     141.049 175.263 135.932  1.00 17.57           C  
ATOM    861  C   ARG A 114     140.968 176.741 136.259  1.00 17.57           C  
ATOM    862  O   ARG A 114     139.890 177.264 136.548  1.00 17.57           O  
ATOM    863  CB  ARG A 114     140.793 175.030 134.443  1.00 17.57           C  
ATOM    864  CG  ARG A 114     139.454 175.497 133.939  1.00 17.57           C  
ATOM    865  CD  ARG A 114     139.314 175.164 132.473  1.00 17.57           C  
ATOM    866  NE  ARG A 114     137.979 175.446 131.971  1.00 17.57           N  
ATOM    867  CZ  ARG A 114     137.520 175.001 130.809  1.00 17.57           C  
ATOM    868  NH1 ARG A 114     138.293 174.252 130.040  1.00 17.57           N  
ATOM    869  NH2 ARG A 114     136.290 175.300 130.421  1.00 17.57           N  
ATOM    870  N   MET A 115     142.115 177.404 136.227  1.00 21.84           N  
ATOM    871  CA  MET A 115     142.197 178.815 136.569  1.00 21.84           C  
ATOM    872  C   MET A 115     142.736 179.610 135.392  1.00 21.84           C  
ATOM    873  O   MET A 115     143.664 179.170 134.702  1.00 21.84           O  
ATOM    874  CB  MET A 115     143.070 179.052 137.804  1.00 21.84           C  
ATOM    875  CG  MET A 115     144.555 178.847 137.604  1.00 21.84           C  
ATOM    876  SD  MET A 115     145.507 179.605 138.934  1.00 21.84           S  
ATOM    877  CE  MET A 115     147.172 179.193 138.433  1.00 21.84           C  
ATOM    878  N   ILE A 116     142.131 180.773 135.171  1.00 17.04           N  
ATOM    879  CA  ILE A 116     142.548 181.736 134.164  1.00 17.04           C  
ATOM    880  C   ILE A 116     142.908 183.021 134.887  1.00 17.04           C  
ATOM    881  O   ILE A 116     142.051 183.633 135.542  1.00 17.04           O  
ATOM    882  CB  ILE A 116     141.448 181.995 133.128  1.00 17.04           C  
ATOM    883  CG1 ILE A 116     141.329 180.819 132.169  1.00 17.04           C  
ATOM    884  CG2 ILE A 116     141.748 183.263 132.364  1.00 17.04           C  
ATOM    885  CD1 ILE A 116     142.324 180.868 131.051  1.00 17.04           C  
ATOM    886  N   ARG A 117     144.169 183.431 134.777  1.00 20.21           N  
ATOM    887  CA  ARG A 117     144.653 184.627 135.451  1.00 20.21           C  
ATOM    888  C   ARG A 117     145.331 185.522 134.429  1.00 20.21           C  
ATOM    889  O   ARG A 117     146.331 185.125 133.821  1.00 20.21           O  
ATOM    890  CB  ARG A 117     145.624 184.265 136.573  1.00 20.21           C  
ATOM    891  CG  ARG A 117     146.020 185.435 137.435  1.00 20.21           C  
ATOM    892  CD  ARG A 117     147.240 185.102 138.260  1.00 20.21           C  
ATOM    893  NE  ARG A 117     147.041 183.899 139.053  1.00 20.21           N  
ATOM    894  CZ  ARG A 117     146.625 183.903 140.311  1.00 20.21           C  
ATOM    895  NH1 ARG A 117     146.367 185.052 140.915  1.00 20.21           N  
ATOM    896  NH2 ARG A 117     146.471 182.762 140.965  1.00 20.21           N  
ATOM    897  N   LEU A 118     144.787 186.717 134.231  1.00 22.32           N  
ATOM    898  CA  LEU A 118     145.366 187.661 133.291  1.00 22.32           C  
ATOM    899  C   LEU A 118     146.481 188.440 133.982  1.00 22.32           C  
ATOM    900  O   LEU A 118     146.942 188.078 135.066  1.00 22.32           O  
ATOM    901  CB  LEU A 118     144.288 188.583 132.734  1.00 22.32           C  
ATOM    902  CG  LEU A 118     143.152 187.910 131.970  1.00 22.32           C  
ATOM    903  CD1 LEU A 118     142.155 188.940 131.492  1.00 22.32           C  
ATOM    904  CD2 LEU A 118     143.695 187.124 130.805  1.00 22.32           C  
ATOM    905  N   HIS A 119     146.932 189.517 133.352  1.00 31.80           N  
ATOM    906  CA  HIS A 119     147.969 190.378 133.899  1.00 31.80           C  
ATOM    907  C   HIS A 119     147.894 191.720 133.193  1.00 31.80           C  
ATOM    908  O   HIS A 119     147.249 191.836 132.145  1.00 31.80           O  
ATOM    909  CB  HIS A 119     149.360 189.756 133.729  1.00 31.80           C  
ATOM    910  CG  HIS A 119     149.749 188.837 134.842  1.00 31.80           C  
ATOM    911  ND1 HIS A 119     149.482 187.486 134.818  1.00 31.80           N  
ATOM    912  CD2 HIS A 119     150.375 189.077 136.017  1.00 31.80           C  
ATOM    913  CE1 HIS A 119     149.934 186.932 135.929  1.00 31.80           C  
ATOM    914  NE2 HIS A 119     150.480 187.875 136.673  1.00 31.80           N  
ATOM    915  N   PRO A 120     148.535 192.757 133.738  1.00 36.74           N  
ATOM    916  CA  PRO A 120     148.516 194.047 133.034  1.00 36.74           C  
ATOM    917  C   PRO A 120     149.360 194.056 131.774  1.00 36.74           C  
ATOM    918  O   PRO A 120     148.973 194.690 130.785  1.00 36.74           O  
ATOM    919  CB  PRO A 120     149.048 195.025 134.088  1.00 36.74           C  
ATOM    920  CG  PRO A 120     149.872 194.187 134.987  1.00 36.74           C  
ATOM    921  CD  PRO A 120     149.169 192.868 135.061  1.00 36.74           C  
ATOM    922  N   ASP A 121     150.502 193.377 131.774  1.00 35.83           N  
ATOM    923  CA  ASP A 121     151.375 193.390 130.608  1.00 35.83           C  
ATOM    924  C   ASP A 121     150.971 192.380 129.545  1.00 35.83           C  
ATOM    925  O   ASP A 121     151.578 192.366 128.470  1.00 35.83           O  
ATOM    926  CB  ASP A 121     152.826 193.140 131.030  1.00 35.83           C  
ATOM    927  CG  ASP A 121     152.989 191.869 131.836  1.00 35.83           C  
ATOM    928  OD1 ASP A 121     151.969 191.211 132.125  1.00 35.83           O  
ATOM    929  OD2 ASP A 121     154.139 191.527 132.184  1.00 35.83           O  
ATOM    930  N   GLY A 122     149.972 191.543 129.806  1.00 26.19           N  
ATOM    931  CA  GLY A 122     149.493 190.600 128.822  1.00 26.19           C  
ATOM    932  C   GLY A 122     149.820 189.148 129.086  1.00 26.19           C  
ATOM    933  O   GLY A 122     149.311 188.282 128.366  1.00 26.19           O  
ATOM    934  N   THR A 123     150.646 188.850 130.082  1.00 24.99           N  
ATOM    935  CA  THR A 123     150.976 187.464 130.382  1.00 24.99           C  
ATOM    936  C   THR A 123     149.751 186.744 130.927  1.00 24.99           C  
ATOM    937  O   THR A 123     149.115 187.215 131.873  1.00 24.99           O  
ATOM    938  CB  THR A 123     152.119 187.397 131.391  1.00 24.99           C  
ATOM    939  OG1 THR A 123     153.303 187.956 130.810  1.00 24.99           O  
ATOM    940  CG2 THR A 123     152.389 185.963 131.790  1.00 24.99           C  
ATOM    941  N   VAL A 124     149.421 185.601 130.337  1.00 21.54           N  
ATOM    942  CA  VAL A 124     148.270 184.808 130.743  1.00 21.54           C  
ATOM    943  C   VAL A 124     148.770 183.547 131.424  1.00 21.54           C  
ATOM    944  O   VAL A 124     149.730 182.916 130.957  1.00 21.54           O  
ATOM    945  CB  VAL A 124     147.375 184.463 129.541  1.00 21.54           C  
ATOM    946  CG1 VAL A 124     146.315 183.467 129.940  1.00 21.54           C  
ATOM    947  CG2 VAL A 124     146.734 185.716 128.999  1.00 21.54           C  
ATOM    948  N   LEU A 125     148.114 183.180 132.526  1.00 20.36           N  
ATOM    949  CA  LEU A 125     148.434 181.991 133.299  1.00 20.36           C  
ATOM    950  C   LEU A 125     147.215 181.083 133.307  1.00 20.36           C  
ATOM    951  O   LEU A 125     146.123 181.512 133.696  1.00 20.36           O  
ATOM    952  CB  LEU A 125     148.825 182.368 134.725  1.00 20.36           C  
ATOM    953  CG  LEU A 125     149.618 181.346 135.522  1.00 20.36           C  
ATOM    954  CD1 LEU A 125     150.908 181.081 134.806  1.00 20.36           C  
ATOM    955  CD2 LEU A 125     149.889 181.871 136.910  1.00 20.36           C  
ATOM    956  N   TYR A 126     147.399 179.836 132.881  1.00 39.51           N  
ATOM    957  CA  TYR A 126     146.308 178.891 132.692  1.00 39.51           C  
ATOM    958  C   TYR A 126     146.660 177.599 133.404  1.00 39.51           C  
ATOM    959  O   TYR A 126     147.709 177.009 133.133  1.00 39.51           O  
ATOM    960  CB  TYR A 126     146.077 178.653 131.198  1.00 39.51           C  
ATOM    961  CG  TYR A 126     145.112 177.552 130.834  1.00 39.51           C  
ATOM    962  CD1 TYR A 126     143.765 177.813 130.675  1.00 39.51           C  
ATOM    963  CD2 TYR A 126     145.555 176.263 130.605  1.00 39.51           C  
ATOM    964  CE1 TYR A 126     142.885 176.820 130.326  1.00 39.51           C  
ATOM    965  CE2 TYR A 126     144.680 175.262 130.253  1.00 39.51           C  
ATOM    966  CZ  TYR A 126     143.346 175.547 130.115  1.00 39.51           C  
ATOM    967  OH  TYR A 126     142.464 174.555 129.765  1.00 39.51           O  
ATOM    968  N   GLY A 127     145.802 177.155 134.302  1.00 27.83           N  
ATOM    969  CA  GLY A 127     146.132 176.033 135.170  1.00 27.83           C  
ATOM    970  C   GLY A 127     145.060 174.968 135.211  1.00 27.83           C  
ATOM    971  O   GLY A 127     143.879 175.269 135.351  1.00 27.83           O  
ATOM    972  N   LEU A 128     145.497 173.713 135.120  1.00 19.30           N  
ATOM    973  CA  LEU A 128     144.638 172.543 135.217  1.00 19.30           C  
ATOM    974  C   LEU A 128     145.101 171.664 136.369  1.00 19.30           C  
ATOM    975  O   LEU A 128     146.213 171.810 136.881  1.00 19.30           O  
ATOM    976  CB  LEU A 128     144.658 171.712 133.934  1.00 19.30           C  
ATOM    977  CG  LEU A 128     144.186 172.334 132.631  1.00 19.30           C  
ATOM    978  CD1 LEU A 128     144.555 171.427 131.483  1.00 19.30           C  
ATOM    979  CD2 LEU A 128     142.695 172.522 132.680  1.00 19.30           C  
ATOM    980  N   ARG A 129     144.239 170.730 136.758  1.00 39.51           N  
ATOM    981  CA  ARG A 129     144.552 169.708 137.751  1.00 39.51           C  
ATOM    982  C   ARG A 129     144.260 168.353 137.123  1.00 39.51           C  
ATOM    983  O   ARG A 129     143.095 167.982 136.959  1.00 39.51           O  
ATOM    984  CB  ARG A 129     143.737 169.911 139.023  1.00 39.51           C  
ATOM    985  CG  ARG A 129     144.005 168.867 140.072  1.00 39.51           C  
ATOM    986  CD  ARG A 129     143.324 169.209 141.376  1.00 39.51           C  
ATOM    987  NE  ARG A 129     143.762 168.325 142.445  1.00 39.51           N  
ATOM    988  CZ  ARG A 129     143.149 167.198 142.772  1.00 39.51           C  
ATOM    989  NH1 ARG A 129     143.619 166.450 143.756  1.00 39.51           N  
ATOM    990  NH2 ARG A 129     142.061 166.821 142.118  1.00 39.51           N  
ATOM    991  N   ILE A 130     145.305 167.607 136.786  1.00 21.26           N  
ATOM    992  CA  ILE A 130     145.193 166.477 135.874  1.00 21.26           C  
ATOM    993  C   ILE A 130     145.592 165.190 136.581  1.00 21.26           C  
ATOM    994  O   ILE A 130     146.556 165.167 137.352  1.00 21.26           O  
ATOM    995  CB  ILE A 130     146.063 166.706 134.624  1.00 21.26           C  
ATOM    996  CG1 ILE A 130     145.523 167.881 133.818  1.00 21.26           C  
ATOM    997  CG2 ILE A 130     146.119 165.470 133.769  1.00 21.26           C  
ATOM    998  CD1 ILE A 130     146.322 168.172 132.581  1.00 21.26           C  
ATOM    999  N   THR A 131     144.849 164.118 136.314  1.00 17.85           N  
ATOM   1000  CA  THR A 131     145.212 162.768 136.732  1.00 17.85           C  
ATOM   1001  C   THR A 131     145.478 161.930 135.490  1.00 17.85           C  
ATOM   1002  O   THR A 131     144.580 161.741 134.665  1.00 17.85           O  
ATOM   1003  CB  THR A 131     144.109 162.128 137.571  1.00 17.85           C  
ATOM   1004  OG1 THR A 131     144.057 162.755 138.857  1.00 17.85           O  
ATOM   1005  CG2 THR A 131     144.375 160.647 137.743  1.00 17.85           C  
ATOM   1006  N   THR A 132     146.700 161.426 135.360  1.00 21.58           N  
ATOM   1007  CA  THR A 132     147.143 160.744 134.153  1.00 21.58           C  
ATOM   1008  C   THR A 132     147.592 159.327 134.479  1.00 21.58           C  
ATOM   1009  O   THR A 132     148.365 159.117 135.418  1.00 21.58           O  
ATOM   1010  CB  THR A 132     148.285 161.514 133.490  1.00 21.58           C  
ATOM   1011  OG1 THR A 132     147.764 162.692 132.865  1.00 21.58           O  
ATOM   1012  CG2 THR A 132     148.976 160.659 132.449  1.00 21.58           C  
ATOM   1013  N   THR A 133     147.107 158.363 133.704  1.00 18.86           N  
ATOM   1014  CA  THR A 133     147.562 156.979 133.801  1.00 18.86           C  
ATOM   1015  C   THR A 133     148.587 156.706 132.701  1.00 18.86           C  
ATOM   1016  O   THR A 133     148.304 156.096 131.672  1.00 18.86           O  
ATOM   1017  CB  THR A 133     146.375 156.029 133.720  1.00 18.86           C  
ATOM   1018  OG1 THR A 133     145.414 156.391 134.718  1.00 18.86           O  
ATOM   1019  CG2 THR A 133     146.816 154.599 133.960  1.00 18.86           C  
ATOM   1020  N   ALA A 134     149.802 157.192 132.933  1.00 24.99           N  
ATOM   1021  CA  ALA A 134     150.829 157.088 131.909  1.00 24.99           C  
ATOM   1022  C   ALA A 134     151.367 155.664 131.838  1.00 24.99           C  
ATOM   1023  O   ALA A 134     151.230 154.874 132.773  1.00 24.99           O  
ATOM   1024  CB  ALA A 134     151.968 158.067 132.187  1.00 24.99           C  
ATOM   1025  N   ALA A 135     151.996 155.343 130.710  1.00 29.40           N  
ATOM   1026  CA  ALA A 135     152.541 154.016 130.464  1.00 29.40           C  
ATOM   1027  C   ALA A 135     154.032 154.116 130.187  1.00 29.40           C  
ATOM   1028  O   ALA A 135     154.462 154.928 129.362  1.00 29.40           O  
ATOM   1029  CB  ALA A 135     151.833 153.340 129.291  1.00 29.40           C  
ATOM   1030  N   CYS A 136     154.815 153.290 130.876  1.00 48.85           N  
ATOM   1031  CA  CYS A 136     156.253 153.206 130.672  1.00 48.85           C  
ATOM   1032  C   CYS A 136     156.657 151.744 130.623  1.00 48.85           C  
ATOM   1033  O   CYS A 136     156.204 150.945 131.448  1.00 48.85           O  
ATOM   1034  CB  CYS A 136     157.026 153.922 131.784  1.00 48.85           C  
ATOM   1035  SG  CYS A 136     156.362 153.680 133.448  1.00 48.85           S  
ATOM   1036  N   MET A 137     157.512 151.400 129.665  1.00 62.11           N  
ATOM   1037  CA  MET A 137     157.971 150.025 129.531  1.00 62.11           C  
ATOM   1038  C   MET A 137     158.891 149.651 130.681  1.00 62.11           C  
ATOM   1039  O   MET A 137     159.832 150.380 131.004  1.00 62.11           O  
ATOM   1040  CB  MET A 137     158.687 149.833 128.199  1.00 62.11           C  
ATOM   1041  CG  MET A 137     157.731 149.561 127.076  1.00 62.11           C  
ATOM   1042  SD  MET A 137     156.613 148.260 127.606  1.00 62.11           S  
ATOM   1043  CE  MET A 137     157.724 146.857 127.608  1.00 62.11           C  
ATOM   1044  N   MET A 138     158.623 148.502 131.290  1.00 62.07           N  
ATOM   1045  CA  MET A 138     159.402 148.010 132.414  1.00 62.07           C  
ATOM   1046  C   MET A 138     160.182 146.778 131.988  1.00 62.07           C  
ATOM   1047  O   MET A 138     159.595 145.790 131.537  1.00 62.07           O  
ATOM   1048  CB  MET A 138     158.503 147.683 133.605  1.00 62.07           C  
ATOM   1049  CG  MET A 138     157.756 148.882 134.137  1.00 62.07           C  
ATOM   1050  SD  MET A 138     157.041 148.601 135.760  1.00 62.07           S  
ATOM   1051  CE  MET A 138     156.276 150.191 136.023  1.00 62.07           C  
ATOM   1052  N   ASP A 139     161.498 146.840 132.138  1.00 61.13           N  
ATOM   1053  CA  ASP A 139     162.375 145.715 131.860  1.00 61.13           C  
ATOM   1054  C   ASP A 139     162.496 144.892 133.134  1.00 61.13           C  
ATOM   1055  O   ASP A 139     163.131 145.327 134.099  1.00 61.13           O  
ATOM   1056  CB  ASP A 139     163.745 146.203 131.392  1.00 61.13           C  
ATOM   1057  CG  ASP A 139     164.652 145.073 130.969  1.00 61.13           C  
ATOM   1058  OD1 ASP A 139     164.178 143.921 130.904  1.00 61.13           O  
ATOM   1059  OD2 ASP A 139     165.843 145.336 130.701  1.00 61.13           O  
ATOM   1060  N   LEU A 140     161.887 143.707 133.136  1.00 54.08           N  
ATOM   1061  CA  LEU A 140     161.826 142.867 134.323  1.00 54.08           C  
ATOM   1062  C   LEU A 140     162.730 141.647 134.220  1.00 54.08           C  
ATOM   1063  O   LEU A 140     162.469 140.632 134.870  1.00 54.08           O  
ATOM   1064  CB  LEU A 140     160.386 142.435 134.591  1.00 54.08           C  
ATOM   1065  CG  LEU A 140     159.423 143.594 134.823  1.00 54.08           C  
ATOM   1066  CD1 LEU A 140     158.011 143.088 135.020  1.00 54.08           C  
ATOM   1067  CD2 LEU A 140     159.874 144.410 136.017  1.00 54.08           C  
ATOM   1068  N   ARG A 141     163.786 141.722 133.411  1.00 57.50           N  
ATOM   1069  CA  ARG A 141     164.744 140.625 133.357  1.00 57.50           C  
ATOM   1070  C   ARG A 141     165.384 140.400 134.719  1.00 57.50           C  
ATOM   1071  O   ARG A 141     165.499 139.261 135.186  1.00 57.50           O  
ATOM   1072  CB  ARG A 141     165.812 140.909 132.302  1.00 57.50           C  
ATOM   1073  CG  ARG A 141     165.306 140.866 130.875  1.00 57.50           C  
ATOM   1074  CD  ARG A 141     166.407 141.260 129.909  1.00 57.50           C  
ATOM   1075  NE  ARG A 141     165.972 141.192 128.519  1.00 57.50           N  
ATOM   1076  CZ  ARG A 141     166.732 141.532 127.484  1.00 57.50           C  
ATOM   1077  NH1 ARG A 141     167.967 141.969 127.683  1.00 57.50           N  
ATOM   1078  NH2 ARG A 141     166.258 141.438 126.250  1.00 57.50           N  
ATOM   1079  N   ARG A 142     165.797 141.479 135.378  1.00 53.20           N  
ATOM   1080  CA  ARG A 142     166.438 141.405 136.681  1.00 53.20           C  
ATOM   1081  C   ARG A 142     165.448 141.508 137.831  1.00 53.20           C  
ATOM   1082  O   ARG A 142     165.847 141.850 138.948  1.00 53.20           O  
ATOM   1083  CB  ARG A 142     167.496 142.499 136.806  1.00 53.20           C  
ATOM   1084  CG  ARG A 142     168.586 142.421 135.763  1.00 53.20           C  
ATOM   1085  CD  ARG A 142     169.451 143.665 135.794  1.00 53.20           C  
ATOM   1086  NE  ARG A 142     170.449 143.662 134.731  1.00 53.20           N  
ATOM   1087  CZ  ARG A 142     171.727 143.350 134.909  1.00 53.20           C  
ATOM   1088  NH1 ARG A 142     172.167 143.020 136.114  1.00 53.20           N  
ATOM   1089  NH2 ARG A 142     172.566 143.373 133.884  1.00 53.20           N  
ATOM   1090  N   TYR A 143     164.172 141.240 137.582  1.00 51.72           N  
ATOM   1091  CA  TYR A 143     163.187 141.277 138.650  1.00 51.72           C  
ATOM   1092  C   TYR A 143     163.601 140.328 139.772  1.00 51.72           C  
ATOM   1093  O   TYR A 143     164.081 139.222 139.502  1.00 51.72           O  
ATOM   1094  CB  TYR A 143     161.810 140.889 138.113  1.00 51.72           C  
ATOM   1095  CG  TYR A 143     160.691 140.997 139.118  1.00 51.72           C  
ATOM   1096  CD1 TYR A 143     159.974 142.174 139.263  1.00 51.72           C  
ATOM   1097  CD2 TYR A 143     160.346 139.920 139.917  1.00 51.72           C  
ATOM   1098  CE1 TYR A 143     158.948 142.275 140.176  1.00 51.72           C  
ATOM   1099  CE2 TYR A 143     159.323 140.012 140.832  1.00 51.72           C  
ATOM   1100  CZ  TYR A 143     158.627 141.190 140.958  1.00 51.72           C  
ATOM   1101  OH  TYR A 143     157.606 141.281 141.873  1.00 51.72           O  
ATOM   1102  N   PRO A 144     163.437 140.724 141.040  1.00 51.08           N  
ATOM   1103  CA  PRO A 144     162.881 142.011 141.458  1.00 51.08           C  
ATOM   1104  C   PRO A 144     163.886 143.160 141.424  1.00 51.08           C  
ATOM   1105  O   PRO A 144     163.484 144.304 141.230  1.00 51.08           O  
ATOM   1106  CB  PRO A 144     162.434 141.734 142.891  1.00 51.08           C  
ATOM   1107  CG  PRO A 144     163.404 140.734 143.376  1.00 51.08           C  
ATOM   1108  CD  PRO A 144     163.721 139.857 142.196  1.00 51.08           C  
ATOM   1109  N   LEU A 145     165.169 142.862 141.606  1.00 50.96           N  
ATOM   1110  CA  LEU A 145     166.191 143.898 141.747  1.00 50.96           C  
ATOM   1111  C   LEU A 145     166.431 144.566 140.402  1.00 50.96           C  
ATOM   1112  O   LEU A 145     167.214 144.079 139.586  1.00 50.96           O  
ATOM   1113  CB  LEU A 145     167.483 143.296 142.284  1.00 50.96           C  
ATOM   1114  CG  LEU A 145     167.407 142.508 143.589  1.00 50.96           C  
ATOM   1115  CD1 LEU A 145     167.071 141.046 143.341  1.00 50.96           C  
ATOM   1116  CD2 LEU A 145     168.713 142.631 144.347  1.00 50.96           C  
ATOM   1117  N   ASP A 146     165.788 145.708 140.174  1.00 58.56           N  
ATOM   1118  CA  ASP A 146     165.920 146.399 138.901  1.00 58.56           C  
ATOM   1119  C   ASP A 146     165.711 147.891 139.110  1.00 58.56           C  
ATOM   1120  O   ASP A 146     165.303 148.342 140.182  1.00 58.56           O  
ATOM   1121  CB  ASP A 146     164.927 145.861 137.869  1.00 58.56           C  
ATOM   1122  CG  ASP A 146     163.494 146.201 138.213  1.00 58.56           C  
ATOM   1123  OD1 ASP A 146     163.187 146.351 139.412  1.00 58.56           O  
ATOM   1124  OD2 ASP A 146     162.671 146.317 137.283  1.00 58.56           O  
ATOM   1125  N   GLU A 147     166.006 148.654 138.063  1.00 61.89           N  
ATOM   1126  CA  GLU A 147     165.782 150.091 138.037  1.00 61.89           C  
ATOM   1127  C   GLU A 147     164.899 150.431 136.848  1.00 61.89           C  
ATOM   1128  O   GLU A 147     165.136 149.949 135.736  1.00 61.89           O  
ATOM   1129  CB  GLU A 147     167.102 150.855 137.954  1.00 61.89           C  
ATOM   1130  CG  GLU A 147     168.020 150.623 139.136  1.00 61.89           C  
ATOM   1131  CD  GLU A 147     169.343 151.344 138.993  1.00 61.89           C  
ATOM   1132  OE1 GLU A 147     169.511 152.089 138.004  1.00 61.89           O  
ATOM   1133  OE2 GLU A 147     170.215 151.166 139.869  1.00 61.89           O  
ATOM   1134  N   GLN A 148     163.885 151.253 137.084  1.00 55.48           N  
ATOM   1135  CA  GLN A 148     162.977 151.706 136.046  1.00 55.48           C  
ATOM   1136  C   GLN A 148     163.243 153.170 135.730  1.00 55.48           C  
ATOM   1137  O   GLN A 148     163.695 153.933 136.586  1.00 55.48           O  
ATOM   1138  CB  GLN A 148     161.524 151.516 136.475  1.00 55.48           C  
ATOM   1139  CG  GLN A 148     161.197 150.081 136.780  1.00 55.48           C  
ATOM   1140  CD  GLN A 148     161.629 149.167 135.662  1.00 55.48           C  
ATOM   1141  OE1 GLN A 148     161.372 149.439 134.491  1.00 55.48           O  
ATOM   1142  NE2 GLN A 148     162.308 148.086 136.011  1.00 55.48           N  
ATOM   1143  N   ASN A 149     162.944 153.556 134.496  1.00 44.69           N  
ATOM   1144  CA  ASN A 149     163.164 154.910 134.004  1.00 44.69           C  
ATOM   1145  C   ASN A 149     161.868 155.465 133.427  1.00 44.69           C  
ATOM   1146  O   ASN A 149     161.802 155.909 132.280  1.00 44.69           O  
ATOM   1147  CB  ASN A 149     164.305 154.935 132.988  1.00 44.69           C  
ATOM   1148  CG  ASN A 149     164.606 156.329 132.481  1.00 44.69           C  
ATOM   1149  OD1 ASN A 149     164.167 157.321 133.056  1.00 44.69           O  
ATOM   1150  ND2 ASN A 149     165.355 156.411 131.396  1.00 44.69           N  
ATOM   1151  N   CYS A 150     160.800 155.401 134.217  1.00 42.30           N  
ATOM   1152  CA  CYS A 150     159.505 155.882 133.756  1.00 42.30           C  
ATOM   1153  C   CYS A 150     159.526 157.387 133.508  1.00 42.30           C  
ATOM   1154  O   CYS A 150     160.161 158.157 134.243  1.00 42.30           O  
ATOM   1155  CB  CYS A 150     158.417 155.514 134.763  1.00 42.30           C  
ATOM   1156  SG  CYS A 150     157.977 153.764 134.683  1.00 42.30           S  
ATOM   1157  N   THR A 151     158.807 157.795 132.461  1.00 29.99           N  
ATOM   1158  CA  THR A 151     158.853 159.138 131.908  1.00 29.99           C  
ATOM   1159  C   THR A 151     157.444 159.686 131.734  1.00 29.99           C  
ATOM   1160  O   THR A 151     156.444 158.992 131.927  1.00 29.99           O  
ATOM   1161  CB  THR A 151     159.558 159.164 130.545  1.00 29.99           C  
ATOM   1162  OG1 THR A 151     158.711 158.557 129.564  1.00 29.99           O  
ATOM   1163  CG2 THR A 151     160.855 158.399 130.591  1.00 29.99           C  
ATOM   1164  N   LEU A 152     157.391 160.961 131.361  1.00 24.76           N  
ATOM   1165  CA  LEU A 152     156.180 161.634 130.922  1.00 24.76           C  
ATOM   1166  C   LEU A 152     156.578 162.585 129.807  1.00 24.76           C  
ATOM   1167  O   LEU A 152     157.443 163.445 130.005  1.00 24.76           O  
ATOM   1168  CB  LEU A 152     155.518 162.398 132.069  1.00 24.76           C  
ATOM   1169  CG  LEU A 152     154.253 163.180 131.738  1.00 24.76           C  
ATOM   1170  CD1 LEU A 152     153.107 162.233 131.465  1.00 24.76           C  
ATOM   1171  CD2 LEU A 152     153.913 164.114 132.876  1.00 24.76           C  
ATOM   1172  N   GLU A 153     155.816 162.377 128.712  1.00 23.24           N  
ATOM   1173  CA  GLU A 153     156.215 163.099 127.510  1.00 23.24           C  
ATOM   1174  C   GLU A 153     155.122 164.081 127.127  1.00 23.24           C  
ATOM   1175  O   GLU A 153     153.972 163.685 126.912  1.00 23.24           O  
ATOM   1176  CB  GLU A 153     156.499 162.131 126.362  1.00 23.24           C  
ATOM   1177  CG  GLU A 153     157.701 161.243 126.613  1.00 23.24           C  
ATOM   1178  CD  GLU A 153     158.032 160.345 125.438  1.00 23.24           C  
ATOM   1179  OE1 GLU A 153     157.368 160.464 124.389  1.00 23.24           O  
ATOM   1180  OE2 GLU A 153     158.958 159.517 125.565  1.00 23.24           O  
ATOM   1181  N   ILE A 154     155.630 165.401 126.976  1.00 13.96           N  
ATOM   1182  CA  ILE A 154     154.705 166.475 126.655  1.00 13.96           C  
ATOM   1183  C   ILE A 154     155.048 166.995 125.269  1.00 13.96           C  
ATOM   1184  O   ILE A 154     156.226 167.178 124.946  1.00 13.96           O  
ATOM   1185  CB  ILE A 154     154.785 167.596 127.700  1.00 13.96           C  
ATOM   1186  CG1 ILE A 154     154.320 167.078 129.057  1.00 13.96           C  
ATOM   1187  CG2 ILE A 154     153.972 168.778 127.272  1.00 13.96           C  
ATOM   1188  CD1 ILE A 154     154.404 168.097 130.151  1.00 13.96           C  
ATOM   1189  N   GLU A 155     154.026 167.243 124.456  1.00 18.59           N  
ATOM   1190  CA  GLU A 155     154.230 167.765 123.114  1.00 18.59           C  
ATOM   1191  C   GLU A 155     153.115 168.739 122.781  1.00 18.59           C  
ATOM   1192  O   GLU A 155     152.182 168.942 123.557  1.00 18.59           O  
ATOM   1193  CB  GLU A 155     154.270 166.656 122.058  1.00 18.59           C  
ATOM   1194  CG  GLU A 155     155.464 165.733 122.150  1.00 18.59           C  
ATOM   1195  CD  GLU A 155     155.617 164.854 120.923  1.00 18.59           C  
ATOM   1196  OE1 GLU A 155     154.670 164.788 120.112  1.00 18.59           O  
ATOM   1197  OE2 GLU A 155     156.688 164.234 120.766  1.00 18.59           O  
ATOM   1198  N   SER A 156     153.233 169.349 121.609  1.00 16.95           N  
ATOM   1199  CA  SER A 156     152.167 170.130 121.005  1.00 16.95           C  
ATOM   1200  C   SER A 156     151.665 169.388 119.780  1.00 16.95           C  
ATOM   1201  O   SER A 156     152.458 168.826 119.022  1.00 16.95           O  
ATOM   1202  CB  SER A 156     152.649 171.519 120.607  1.00 16.95           C  
ATOM   1203  OG  SER A 156     151.744 172.113 119.695  1.00 16.95           O  
ATOM   1204  N   TYR A 157     150.350 169.381 119.581  1.00 18.04           N  
ATOM   1205  CA  TYR A 157     149.783 168.583 118.507  1.00 18.04           C  
ATOM   1206  C   TYR A 157     149.383 169.386 117.282  1.00 18.04           C  
ATOM   1207  O   TYR A 157     149.322 168.817 116.188  1.00 18.04           O  
ATOM   1208  CB  TYR A 157     148.558 167.815 119.000  1.00 18.04           C  
ATOM   1209  CG  TYR A 157     148.068 166.791 118.012  1.00 18.04           C  
ATOM   1210  CD1 TYR A 157     148.912 165.801 117.547  1.00 18.04           C  
ATOM   1211  CD2 TYR A 157     146.765 166.807 117.555  1.00 18.04           C  
ATOM   1212  CE1 TYR A 157     148.478 164.862 116.647  1.00 18.04           C  
ATOM   1213  CE2 TYR A 157     146.320 165.870 116.656  1.00 18.04           C  
ATOM   1214  CZ  TYR A 157     147.181 164.896 116.205  1.00 18.04           C  
ATOM   1215  OH  TYR A 157     146.740 163.953 115.302  1.00 18.04           O  
ATOM   1216  N   GLY A 158     149.078 170.694 117.426  1.00 19.27           N  
ATOM   1217  CA  GLY A 158     148.574 171.441 116.294  1.00 19.27           C  
ATOM   1218  C   GLY A 158     149.615 172.254 115.560  1.00 19.27           C  
ATOM   1219  O   GLY A 158     149.606 172.312 114.328  1.00 19.27           O  
ATOM   1220  N   TYR A 159     150.527 172.874 116.297  1.00 17.44           N  
ATOM   1221  CA  TYR A 159     151.437 173.862 115.741  1.00 17.44           C  
ATOM   1222  C   TYR A 159     152.853 173.310 115.674  1.00 17.44           C  
ATOM   1223  O   TYR A 159     153.330 172.681 116.622  1.00 17.44           O  
ATOM   1224  CB  TYR A 159     151.410 175.138 116.579  1.00 17.44           C  
ATOM   1225  CG  TYR A 159     150.014 175.616 116.888  1.00 17.44           C  
ATOM   1226  CD1 TYR A 159     149.322 175.129 117.984  1.00 17.44           C  
ATOM   1227  CD2 TYR A 159     149.389 176.556 116.089  1.00 17.44           C  
ATOM   1228  CE1 TYR A 159     148.049 175.557 118.270  1.00 17.44           C  
ATOM   1229  CE2 TYR A 159     148.115 176.993 116.371  1.00 17.44           C  
ATOM   1230  CZ  TYR A 159     147.450 176.490 117.464  1.00 17.44           C  
ATOM   1231  OH  TYR A 159     146.177 176.916 117.754  1.00 17.44           O  
ATOM   1232  N   THR A 160     153.521 173.555 114.552  1.00 19.39           N  
ATOM   1233  CA  THR A 160     154.894 173.118 114.373  1.00 19.39           C  
ATOM   1234  C   THR A 160     155.842 173.986 115.189  1.00 19.39           C  
ATOM   1235  O   THR A 160     155.455 174.999 115.772  1.00 19.39           O  
ATOM   1236  CB  THR A 160     155.294 173.176 112.904  1.00 19.39           C  
ATOM   1237  OG1 THR A 160     155.493 174.541 112.524  1.00 19.39           O  
ATOM   1238  CG2 THR A 160     154.206 172.577 112.039  1.00 19.39           C  
ATOM   1239  N   THR A 161     157.112 173.585 115.203  1.00 19.53           N  
ATOM   1240  CA  THR A 161     158.136 174.302 115.954  1.00 19.53           C  
ATOM   1241  C   THR A 161     158.285 175.745 115.496  1.00 19.53           C  
ATOM   1242  O   THR A 161     158.959 176.540 116.157  1.00 19.53           O  
ATOM   1243  CB  THR A 161     159.481 173.597 115.838  1.00 19.53           C  
ATOM   1244  OG1 THR A 161     160.439 174.276 116.657  1.00 19.53           O  
ATOM   1245  CG2 THR A 161     159.957 173.618 114.399  1.00 19.53           C  
ATOM   1246  N   ASP A 162     157.682 176.092 114.358  1.00 23.25           N  
ATOM   1247  CA  ASP A 162     157.765 177.459 113.860  1.00 23.25           C  
ATOM   1248  C   ASP A 162     156.820 178.399 114.592  1.00 23.25           C  
ATOM   1249  O   ASP A 162     157.040 179.614 114.584  1.00 23.25           O  
ATOM   1250  CB  ASP A 162     157.469 177.491 112.362  1.00 23.25           C  
ATOM   1251  CG  ASP A 162     158.477 176.704 111.554  1.00 23.25           C  
ATOM   1252  OD1 ASP A 162     159.616 176.529 112.036  1.00 23.25           O  
ATOM   1253  OD2 ASP A 162     158.137 176.265 110.435  1.00 23.25           O  
ATOM   1254  N   ASP A 163     155.770 177.872 115.216  1.00 21.22           N  
ATOM   1255  CA  ASP A 163     154.758 178.718 115.835  1.00 21.22           C  
ATOM   1256  C   ASP A 163     154.761 178.676 117.355  1.00 21.22           C  
ATOM   1257  O   ASP A 163     154.214 179.586 117.983  1.00 21.22           O  
ATOM   1258  CB  ASP A 163     153.366 178.331 115.330  1.00 21.22           C  
ATOM   1259  CG  ASP A 163     153.206 178.571 113.848  1.00 21.22           C  
ATOM   1260  OD1 ASP A 163     153.827 179.522 113.334  1.00 21.22           O  
ATOM   1261  OD2 ASP A 163     152.462 177.811 113.195  1.00 21.22           O  
ATOM   1262  N   ILE A 164     155.340 177.651 117.970  1.00 16.15           N  
ATOM   1263  CA  ILE A 164     155.291 177.513 119.417  1.00 16.15           C  
ATOM   1264  C   ILE A 164     156.642 177.033 119.930  1.00 16.15           C  
ATOM   1265  O   ILE A 164     157.396 176.359 119.222  1.00 16.15           O  
ATOM   1266  CB  ILE A 164     154.155 176.559 119.839  1.00 16.15           C  
ATOM   1267  CG1 ILE A 164     153.638 176.920 121.224  1.00 16.15           C  
ATOM   1268  CG2 ILE A 164     154.626 175.129 119.831  1.00 16.15           C  
ATOM   1269  CD1 ILE A 164     152.407 176.152 121.622  1.00 16.15           C  
ATOM   1270  N   GLU A 165     156.960 177.414 121.166  1.00 22.80           N  
ATOM   1271  CA  GLU A 165     158.189 177.011 121.837  1.00 22.80           C  
ATOM   1272  C   GLU A 165     157.867 176.584 123.259  1.00 22.80           C  
ATOM   1273  O   GLU A 165     157.093 177.250 123.951  1.00 22.80           O  
ATOM   1274  CB  GLU A 165     159.211 178.148 121.870  1.00 22.80           C  
ATOM   1275  CG  GLU A 165     159.552 178.728 120.514  1.00 22.80           C  
ATOM   1276  CD  GLU A 165     160.470 177.834 119.713  1.00 22.80           C  
ATOM   1277  OE1 GLU A 165     160.936 176.815 120.262  1.00 22.80           O  
ATOM   1278  OE2 GLU A 165     160.731 178.154 118.534  1.00 22.80           O  
ATOM   1279  N   PHE A 166     158.466 175.484 123.701  1.00 15.63           N  
ATOM   1280  CA  PHE A 166     158.237 174.953 125.036  1.00 15.63           C  
ATOM   1281  C   PHE A 166     159.528 175.008 125.836  1.00 15.63           C  
ATOM   1282  O   PHE A 166     160.584 174.604 125.342  1.00 15.63           O  
ATOM   1283  CB  PHE A 166     157.713 173.518 124.978  1.00 15.63           C  
ATOM   1284  CG  PHE A 166     156.265 173.419 124.605  1.00 15.63           C  
ATOM   1285  CD1 PHE A 166     155.462 174.536 124.617  1.00 15.63           C  
ATOM   1286  CD2 PHE A 166     155.707 172.208 124.255  1.00 15.63           C  
ATOM   1287  CE1 PHE A 166     154.135 174.449 124.282  1.00 15.63           C  
ATOM   1288  CE2 PHE A 166     154.378 172.118 123.924  1.00 15.63           C  
ATOM   1289  CZ  PHE A 166     153.594 173.240 123.936  1.00 15.63           C  
ATOM   1290  N   TYR A 167     159.440 175.504 127.067  1.00 19.80           N  
ATOM   1291  CA  TYR A 167     160.596 175.592 127.942  1.00 19.80           C  
ATOM   1292  C   TYR A 167     160.121 175.691 129.381  1.00 19.80           C  
ATOM   1293  O   TYR A 167     159.096 176.314 129.667  1.00 19.80           O  
ATOM   1294  CB  TYR A 167     161.474 176.798 127.595  1.00 19.80           C  
ATOM   1295  CG  TYR A 167     160.852 178.125 127.953  1.00 19.80           C  
ATOM   1296  CD1 TYR A 167     159.907 178.711 127.133  1.00 19.80           C  
ATOM   1297  CD2 TYR A 167     161.215 178.794 129.111  1.00 19.80           C  
ATOM   1298  CE1 TYR A 167     159.336 179.923 127.454  1.00 19.80           C  
ATOM   1299  CE2 TYR A 167     160.649 180.005 129.441  1.00 19.80           C  
ATOM   1300  CZ  TYR A 167     159.711 180.566 128.608  1.00 19.80           C  
ATOM   1301  OH  TYR A 167     159.144 181.774 128.933  1.00 19.80           O  
ATOM   1302  N   TRP A 168     160.874 175.077 130.286  1.00 20.82           N  
ATOM   1303  CA  TRP A 168     160.539 175.127 131.699  1.00 20.82           C  
ATOM   1304  C   TRP A 168     160.880 176.494 132.280  1.00 20.82           C  
ATOM   1305  O   TRP A 168     161.796 177.177 131.816  1.00 20.82           O  
ATOM   1306  CB  TRP A 168     161.285 174.037 132.462  1.00 20.82           C  
ATOM   1307  CG  TRP A 168     161.124 172.680 131.871  1.00 20.82           C  
ATOM   1308  CD1 TRP A 168     161.883 172.125 130.893  1.00 20.82           C  
ATOM   1309  CD2 TRP A 168     160.149 171.698 132.230  1.00 20.82           C  
ATOM   1310  NE1 TRP A 168     161.440 170.858 130.614  1.00 20.82           N  
ATOM   1311  CE2 TRP A 168     160.375 170.573 131.424  1.00 20.82           C  
ATOM   1312  CE3 TRP A 168     159.103 171.664 133.151  1.00 20.82           C  
ATOM   1313  CZ2 TRP A 168     159.594 169.429 131.508  1.00 20.82           C  
ATOM   1314  CZ3 TRP A 168     158.331 170.525 133.235  1.00 20.82           C  
ATOM   1315  CH2 TRP A 168     158.580 169.425 132.421  1.00 20.82           C  
ATOM   1316  N   ARG A 169     160.129 176.892 133.305  1.00 28.74           N  
ATOM   1317  CA  ARG A 169     160.344 178.180 133.969  1.00 28.74           C  
ATOM   1318  C   ARG A 169     161.280 177.990 135.162  1.00 28.74           C  
ATOM   1319  O   ARG A 169     160.885 178.030 136.327  1.00 28.74           O  
ATOM   1320  CB  ARG A 169     159.017 178.789 134.396  1.00 28.74           C  
ATOM   1321  CG  ARG A 169     158.080 179.092 133.251  1.00 28.74           C  
ATOM   1322  CD  ARG A 169     156.748 179.596 133.765  1.00 28.74           C  
ATOM   1323  NE  ARG A 169     156.885 180.840 134.510  1.00 28.74           N  
ATOM   1324  CZ  ARG A 169     155.879 181.450 135.122  1.00 28.74           C  
ATOM   1325  NH1 ARG A 169     154.666 180.923 135.081  1.00 28.74           N  
ATOM   1326  NH2 ARG A 169     156.086 182.582 135.779  1.00 28.74           N  
ATOM   1327  N   GLY A 170     162.551 177.778 134.840  1.00 40.22           N  
ATOM   1328  CA  GLY A 170     163.552 177.513 135.852  1.00 40.22           C  
ATOM   1329  C   GLY A 170     163.761 176.024 136.011  1.00 40.22           C  
ATOM   1330  O   GLY A 170     162.942 175.341 136.634  1.00 40.22           O  
ATOM   1331  N   ASP A 171     164.863 175.511 135.463  1.00 47.91           N  
ATOM   1332  CA  ASP A 171     165.035 174.066 135.364  1.00 47.91           C  
ATOM   1333  C   ASP A 171     165.121 173.415 136.737  1.00 47.91           C  
ATOM   1334  O   ASP A 171     164.640 172.294 136.932  1.00 47.91           O  
ATOM   1335  CB  ASP A 171     166.279 173.750 134.539  1.00 47.91           C  
ATOM   1336  CG  ASP A 171     166.365 174.585 133.280  1.00 47.91           C  
ATOM   1337  OD1 ASP A 171     165.326 175.136 132.863  1.00 47.91           O  
ATOM   1338  OD2 ASP A 171     167.470 174.693 132.707  1.00 47.91           O  
ATOM   1339  N   ASP A 172     165.735 174.098 137.701  1.00 59.61           N  
ATOM   1340  CA  ASP A 172     165.841 173.528 139.038  1.00 59.61           C  
ATOM   1341  C   ASP A 172     164.493 173.525 139.746  1.00 59.61           C  
ATOM   1342  O   ASP A 172     164.189 172.604 140.512  1.00 59.61           O  
ATOM   1343  CB  ASP A 172     166.877 174.299 139.855  1.00 59.61           C  
ATOM   1344  CG  ASP A 172     168.258 174.255 139.233  1.00 59.61           C  
ATOM   1345  OD1 ASP A 172     168.589 173.236 138.590  1.00 59.61           O  
ATOM   1346  OD2 ASP A 172     169.014 175.238 139.385  1.00 59.61           O  
ATOM   1347  N   ASN A 173     163.670 174.541 139.500  1.00 56.14           N  
ATOM   1348  CA  ASN A 173     162.407 174.710 140.202  1.00 56.14           C  
ATOM   1349  C   ASN A 173     161.195 174.443 139.320  1.00 56.14           C  
ATOM   1350  O   ASN A 173     160.090 174.880 139.657  1.00 56.14           O  
ATOM   1351  CB  ASN A 173     162.325 176.119 140.788  1.00 56.14           C  
ATOM   1352  CG  ASN A 173     163.491 176.435 141.696  1.00 56.14           C  
ATOM   1353  OD1 ASN A 173     163.988 175.565 142.410  1.00 56.14           O  
ATOM   1354  ND2 ASN A 173     163.942 177.684 141.671  1.00 56.14           N  
ATOM   1355  N   ALA A 174     161.370 173.745 138.200  1.00 34.47           N  
ATOM   1356  CA  ALA A 174     160.232 173.460 137.336  1.00 34.47           C  
ATOM   1357  C   ALA A 174     159.298 172.439 137.972  1.00 34.47           C  
ATOM   1358  O   ALA A 174     158.088 172.663 138.060  1.00 34.47           O  
ATOM   1359  CB  ALA A 174     160.716 172.973 135.973  1.00 34.47           C  
ATOM   1360  N   VAL A 175     159.840 171.317 138.430  1.00 26.68           N  
ATOM   1361  CA  VAL A 175     159.054 170.244 139.025  1.00 26.68           C  
ATOM   1362  C   VAL A 175     159.308 170.242 140.523  1.00 26.68           C  
ATOM   1363  O   VAL A 175     160.463 170.270 140.961  1.00 26.68           O  
ATOM   1364  CB  VAL A 175     159.406 168.882 138.409  1.00 26.68           C  
ATOM   1365  CG1 VAL A 175     158.510 167.804 138.977  1.00 26.68           C  
ATOM   1366  CG2 VAL A 175     159.287 168.940 136.904  1.00 26.68           C  
ATOM   1367  N   THR A 176     158.236 170.208 141.305  1.00 25.03           N  
ATOM   1368  CA  THR A 176     158.326 170.265 142.755  1.00 25.03           C  
ATOM   1369  C   THR A 176     157.639 169.050 143.357  1.00 25.03           C  
ATOM   1370  O   THR A 176     157.112 168.188 142.651  1.00 25.03           O  
ATOM   1371  CB  THR A 176     157.687 171.542 143.312  1.00 25.03           C  
ATOM   1372  OG1 THR A 176     156.263 171.404 143.304  1.00 25.03           O  
ATOM   1373  CG2 THR A 176     158.073 172.741 142.468  1.00 25.03           C  
ATOM   1374  N   GLY A 177     157.665 168.984 144.683  1.00 32.52           N  
ATOM   1375  CA  GLY A 177     156.954 167.961 145.415  1.00 32.52           C  
ATOM   1376  C   GLY A 177     157.465 166.550 145.238  1.00 32.52           C  
ATOM   1377  O   GLY A 177     156.844 165.620 145.765  1.00 32.52           O  
ATOM   1378  N   VAL A 178     158.573 166.353 144.522  1.00 39.15           N  
ATOM   1379  CA  VAL A 178     159.068 165.000 144.287  1.00 39.15           C  
ATOM   1380  C   VAL A 178     159.608 164.393 145.574  1.00 39.15           C  
ATOM   1381  O   VAL A 178     159.430 163.197 145.832  1.00 39.15           O  
ATOM   1382  CB  VAL A 178     160.131 165.006 143.176  1.00 39.15           C  
ATOM   1383  CG1 VAL A 178     160.638 163.604 142.922  1.00 39.15           C  
ATOM   1384  CG2 VAL A 178     159.552 165.590 141.910  1.00 39.15           C  
ATOM   1385  N   THR A 179     160.278 165.198 146.400  1.00 40.67           N  
ATOM   1386  CA  THR A 179     160.835 164.676 147.644  1.00 40.67           C  
ATOM   1387  C   THR A 179     159.744 164.126 148.551  1.00 40.67           C  
ATOM   1388  O   THR A 179     159.922 163.079 149.184  1.00 40.67           O  
ATOM   1389  CB  THR A 179     161.622 165.765 148.366  1.00 40.67           C  
ATOM   1390  OG1 THR A 179     160.734 166.825 148.740  1.00 40.67           O  
ATOM   1391  CG2 THR A 179     162.710 166.318 147.463  1.00 40.67           C  
ATOM   1392  N   LYS A 180     158.605 164.813 148.623  1.00 43.95           N  
ATOM   1393  CA  LYS A 180     157.518 164.367 149.486  1.00 43.95           C  
ATOM   1394  C   LYS A 180     156.825 163.122 148.951  1.00 43.95           C  
ATOM   1395  O   LYS A 180     156.101 162.464 149.704  1.00 43.95           O  
ATOM   1396  CB  LYS A 180     156.508 165.497 149.673  1.00 43.95           C  
ATOM   1397  CG  LYS A 180     157.139 166.779 150.183  1.00 43.95           C  
ATOM   1398  CD  LYS A 180     156.123 167.893 150.331  1.00 43.95           C  
ATOM   1399  CE  LYS A 180     156.786 169.157 150.850  1.00 43.95           C  
ATOM   1400  NZ  LYS A 180     155.829 170.289 150.963  1.00 43.95           N  
ATOM   1401  N   ILE A 181     157.024 162.788 147.674  1.00 43.55           N  
ATOM   1402  CA  ILE A 181     156.422 161.586 147.113  1.00 43.55           C  
ATOM   1403  C   ILE A 181     156.974 160.365 147.829  1.00 43.55           C  
ATOM   1404  O   ILE A 181     158.186 160.242 148.040  1.00 43.55           O  
ATOM   1405  CB  ILE A 181     156.683 161.511 145.604  1.00 43.55           C  
ATOM   1406  CG1 ILE A 181     156.049 162.705 144.904  1.00 43.55           C  
ATOM   1407  CG2 ILE A 181     156.137 160.224 145.034  1.00 43.55           C  
ATOM   1408  CD1 ILE A 181     154.593 162.875 145.229  1.00 43.55           C  
ATOM   1409  N   GLU A 182     156.082 159.454 148.211  1.00 49.73           N  
ATOM   1410  CA  GLU A 182     156.455 158.246 148.944  1.00 49.73           C  
ATOM   1411  C   GLU A 182     155.733 157.058 148.319  1.00 49.73           C  
ATOM   1412  O   GLU A 182     154.583 156.769 148.657  1.00 49.73           O  
ATOM   1413  CB  GLU A 182     156.130 158.387 150.426  1.00 49.73           C  
ATOM   1414  CG  GLU A 182     156.517 157.181 151.266  1.00 49.73           C  
ATOM   1415  CD  GLU A 182     158.017 157.035 151.436  1.00 49.73           C  
ATOM   1416  OE1 GLU A 182     158.754 157.990 151.112  1.00 49.73           O  
ATOM   1417  OE2 GLU A 182     158.459 155.963 151.899  1.00 49.73           O  
ATOM   1418  N   LEU A 183     156.405 156.380 147.400  1.00 47.74           N  
ATOM   1419  CA  LEU A 183     155.866 155.144 146.861  1.00 47.74           C  
ATOM   1420  C   LEU A 183     155.943 154.043 147.914  1.00 47.74           C  
ATOM   1421  O   LEU A 183     156.906 153.986 148.686  1.00 47.74           O  
ATOM   1422  CB  LEU A 183     156.627 154.726 145.608  1.00 47.74           C  
ATOM   1423  CG  LEU A 183     156.228 155.477 144.343  1.00 47.74           C  
ATOM   1424  CD1 LEU A 183     157.133 155.105 143.193  1.00 47.74           C  
ATOM   1425  CD2 LEU A 183     154.787 155.166 144.008  1.00 47.74           C  
ATOM   1426  N   PRO A 184     154.948 153.158 147.976  1.00 47.12           N  
ATOM   1427  CA  PRO A 184     154.964 152.127 149.028  1.00 47.12           C  
ATOM   1428  C   PRO A 184     156.059 151.094 148.835  1.00 47.12           C  
ATOM   1429  O   PRO A 184     156.747 150.728 149.796  1.00 47.12           O  
ATOM   1430  CB  PRO A 184     153.563 151.514 148.920  1.00 47.12           C  
ATOM   1431  CG  PRO A 184     153.190 151.704 147.485  1.00 47.12           C  
ATOM   1432  CD  PRO A 184     153.792 153.019 147.074  1.00 47.12           C  
ATOM   1433  N   GLN A 185     156.242 150.618 147.607  1.00 51.36           N  
ATOM   1434  CA  GLN A 185     157.167 149.535 147.313  1.00 51.36           C  
ATOM   1435  C   GLN A 185     158.455 150.005 146.655  1.00 51.36           C  
ATOM   1436  O   GLN A 185     159.473 149.314 146.759  1.00 51.36           O  
ATOM   1437  CB  GLN A 185     156.473 148.514 146.409  1.00 51.36           C  
ATOM   1438  CG  GLN A 185     157.154 147.180 146.294  1.00 51.36           C  
ATOM   1439  CD  GLN A 185     156.319 146.207 145.493  1.00 51.36           C  
ATOM   1440  OE1 GLN A 185     155.135 146.443 145.257  1.00 51.36           O  
ATOM   1441  NE2 GLN A 185     156.928 145.114 145.064  1.00 51.36           N  
ATOM   1442  N   PHE A 186     158.437 151.154 145.990  1.00 47.27           N  
ATOM   1443  CA  PHE A 186     159.614 151.738 145.368  1.00 47.27           C  
ATOM   1444  C   PHE A 186     160.070 152.953 146.162  1.00 47.27           C  
ATOM   1445  O   PHE A 186     159.466 153.337 147.166  1.00 47.27           O  
ATOM   1446  CB  PHE A 186     159.326 152.142 143.919  1.00 47.27           C  
ATOM   1447  CG  PHE A 186     159.005 150.992 143.018  1.00 47.27           C  
ATOM   1448  CD1 PHE A 186     159.549 149.746 143.241  1.00 47.27           C  
ATOM   1449  CD2 PHE A 186     158.157 151.160 141.944  1.00 47.27           C  
ATOM   1450  CE1 PHE A 186     159.253 148.690 142.406  1.00 47.27           C  
ATOM   1451  CE2 PHE A 186     157.858 150.107 141.109  1.00 47.27           C  
ATOM   1452  CZ  PHE A 186     158.406 148.872 141.339  1.00 47.27           C  
ATOM   1453  N   SER A 187     161.161 153.556 145.701  1.00 46.09           N  
ATOM   1454  CA  SER A 187     161.667 154.790 146.278  1.00 46.09           C  
ATOM   1455  C   SER A 187     162.317 155.612 145.179  1.00 46.09           C  
ATOM   1456  O   SER A 187     163.045 155.074 144.341  1.00 46.09           O  
ATOM   1457  CB  SER A 187     162.671 154.517 147.401  1.00 46.09           C  
ATOM   1458  OG  SER A 187     163.816 153.850 146.903  1.00 46.09           O  
ATOM   1459  N   ILE A 188     162.048 156.917 145.185  1.00 41.97           N  
ATOM   1460  CA  ILE A 188     162.585 157.793 144.154  1.00 41.97           C  
ATOM   1461  C   ILE A 188     164.090 157.945 144.341  1.00 41.97           C  
ATOM   1462  O   ILE A 188     164.616 157.857 145.457  1.00 41.97           O  
ATOM   1463  CB  ILE A 188     161.879 159.160 144.189  1.00 41.97           C  
ATOM   1464  CG1 ILE A 188     160.384 158.975 144.427  1.00 41.97           C  
ATOM   1465  CG2 ILE A 188     162.092 159.895 142.886  1.00 41.97           C  
ATOM   1466  CD1 ILE A 188     159.674 158.293 143.292  1.00 41.97           C  
ATOM   1467  N   VAL A 189     164.796 158.164 143.232  1.00 45.31           N  
ATOM   1468  CA  VAL A 189     166.240 158.358 143.236  1.00 45.31           C  
ATOM   1469  C   VAL A 189     166.626 159.690 142.603  1.00 45.31           C  
ATOM   1470  O   VAL A 189     167.361 160.482 143.200  1.00 45.31           O  
ATOM   1471  CB  VAL A 189     166.966 157.192 142.534  1.00 45.31           C  
ATOM   1472  CG1 VAL A 189     168.445 157.494 142.408  1.00 45.31           C  
ATOM   1473  CG2 VAL A 189     166.755 155.907 143.308  1.00 45.31           C  
ATOM   1474  N   ASP A 190     166.133 159.957 141.397  1.00 47.07           N  
ATOM   1475  CA  ASP A 190     166.501 161.177 140.693  1.00 47.07           C  
ATOM   1476  C   ASP A 190     165.498 161.425 139.578  1.00 47.07           C  
ATOM   1477  O   ASP A 190     164.770 160.521 139.160  1.00 47.07           O  
ATOM   1478  CB  ASP A 190     167.922 161.085 140.131  1.00 47.07           C  
ATOM   1479  CG  ASP A 190     168.447 162.420 139.657  1.00 47.07           C  
ATOM   1480  OD1 ASP A 190     167.725 163.427 139.806  1.00 47.07           O  
ATOM   1481  OD2 ASP A 190     169.581 162.462 139.136  1.00 47.07           O  
ATOM   1482  N   TYR A 191     165.461 162.672 139.111  1.00 33.74           N  
ATOM   1483  CA  TYR A 191     164.614 163.058 137.994  1.00 33.74           C  
ATOM   1484  C   TYR A 191     165.363 164.034 137.101  1.00 33.74           C  
ATOM   1485  O   TYR A 191     166.261 164.748 137.551  1.00 33.74           O  
ATOM   1486  CB  TYR A 191     163.297 163.682 138.463  1.00 33.74           C  
ATOM   1487  CG  TYR A 191     163.451 164.950 139.261  1.00 33.74           C  
ATOM   1488  CD1 TYR A 191     163.541 166.181 138.633  1.00 33.74           C  
ATOM   1489  CD2 TYR A 191     163.481 164.920 140.644  1.00 33.74           C  
ATOM   1490  CE1 TYR A 191     163.674 167.345 139.359  1.00 33.74           C  
ATOM   1491  CE2 TYR A 191     163.612 166.079 141.380  1.00 33.74           C  
ATOM   1492  CZ  TYR A 191     163.708 167.288 140.731  1.00 33.74           C  
ATOM   1493  OH  TYR A 191     163.839 168.448 141.456  1.00 33.74           O  
ATOM   1494  N   LYS A 192     164.975 164.065 135.829  1.00 30.45           N  
ATOM   1495  CA  LYS A 192     165.615 164.911 134.837  1.00 30.45           C  
ATOM   1496  C   LYS A 192     164.564 165.553 133.946  1.00 30.45           C  
ATOM   1497  O   LYS A 192     163.483 164.995 133.720  1.00 30.45           O  
ATOM   1498  CB  LYS A 192     166.605 164.127 133.972  1.00 30.45           C  
ATOM   1499  CG  LYS A 192     167.851 163.683 134.702  1.00 30.45           C  
ATOM   1500  CD  LYS A 192     168.866 163.112 133.732  1.00 30.45           C  
ATOM   1501  CE  LYS A 192     170.181 162.808 134.425  1.00 30.45           C  
ATOM   1502  NZ  LYS A 192     171.203 162.305 133.467  1.00 30.45           N  
ATOM   1503  N   LEU A 193     164.905 166.736 133.440  1.00 23.13           N  
ATOM   1504  CA  LEU A 193     164.058 167.504 132.541  1.00 23.13           C  
ATOM   1505  C   LEU A 193     164.793 167.683 131.221  1.00 23.13           C  
ATOM   1506  O   LEU A 193     165.977 168.031 131.211  1.00 23.13           O  
ATOM   1507  CB  LEU A 193     163.713 168.864 133.144  1.00 23.13           C  
ATOM   1508  CG  LEU A 193     163.398 168.861 134.638  1.00 23.13           C  
ATOM   1509  CD1 LEU A 193     163.012 170.249 135.083  1.00 23.13           C  
ATOM   1510  CD2 LEU A 193     162.290 167.882 134.956  1.00 23.13           C  
ATOM   1511  N   ILE A 194     164.095 167.443 130.115  1.00 22.07           N  
ATOM   1512  CA  ILE A 194     164.695 167.450 128.788  1.00 22.07           C  
ATOM   1513  C   ILE A 194     163.823 168.276 127.857  1.00 22.07           C  
ATOM   1514  O   ILE A 194     162.594 168.267 127.977  1.00 22.07           O  
ATOM   1515  CB  ILE A 194     164.861 166.017 128.244  1.00 22.07           C  
ATOM   1516  CG1 ILE A 194     165.646 165.158 129.232  1.00 22.07           C  
ATOM   1517  CG2 ILE A 194     165.563 166.026 126.904  1.00 22.07           C  
ATOM   1518  CD1 ILE A 194     165.795 163.725 128.797  1.00 22.07           C  
ATOM   1519  N   THR A 195     164.457 168.989 126.929  1.00 16.90           N  
ATOM   1520  CA  THR A 195     163.766 169.735 125.886  1.00 16.90           C  
ATOM   1521  C   THR A 195     164.274 169.266 124.532  1.00 16.90           C  
ATOM   1522  O   THR A 195     165.487 169.226 124.307  1.00 16.90           O  
ATOM   1523  CB  THR A 195     163.997 171.236 126.041  1.00 16.90           C  
ATOM   1524  OG1 THR A 195     163.556 171.654 127.336  1.00 16.90           O  
ATOM   1525  CG2 THR A 195     163.240 172.000 124.977  1.00 16.90           C  
ATOM   1526  N   LYS A 196     163.360 168.911 123.630  1.00 20.21           N  
ATOM   1527  CA  LYS A 196     163.750 168.327 122.355  1.00 20.21           C  
ATOM   1528  C   LYS A 196     162.824 168.802 121.247  1.00 20.21           C  
ATOM   1529  O   LYS A 196     161.814 169.472 121.486  1.00 20.21           O  
ATOM   1530  CB  LYS A 196     163.733 166.797 122.414  1.00 20.21           C  
ATOM   1531  CG  LYS A 196     164.814 166.187 123.261  1.00 20.21           C  
ATOM   1532  CD  LYS A 196     164.813 164.686 123.112  1.00 20.21           C  
ATOM   1533  CE  LYS A 196     163.481 164.101 123.522  1.00 20.21           C  
ATOM   1534  NZ  LYS A 196     163.483 162.617 123.426  1.00 20.21           N  
ATOM   1535  N   LYS A 197     163.186 168.437 120.015  1.00 20.96           N  
ATOM   1536  CA  LYS A 197     162.337 168.579 118.839  1.00 20.96           C  
ATOM   1537  C   LYS A 197     162.254 167.229 118.147  1.00 20.96           C  
ATOM   1538  O   LYS A 197     163.281 166.592 117.903  1.00 20.96           O  
ATOM   1539  CB  LYS A 197     162.878 169.634 117.874  1.00 20.96           C  
ATOM   1540  CG  LYS A 197     162.896 171.028 118.449  1.00 20.96           C  
ATOM   1541  CD  LYS A 197     163.470 172.021 117.459  1.00 20.96           C  
ATOM   1542  CE  LYS A 197     163.505 173.420 118.049  1.00 20.96           C  
ATOM   1543  NZ  LYS A 197     164.085 174.407 117.100  1.00 20.96           N  
ATOM   1544  N   VAL A 198     161.040 166.793 117.831  1.00 20.95           N  
ATOM   1545  CA  VAL A 198     160.804 165.489 117.229  1.00 20.95           C  
ATOM   1546  C   VAL A 198     160.330 165.691 115.801  1.00 20.95           C  
ATOM   1547  O   VAL A 198     159.445 166.515 115.547  1.00 20.95           O  
ATOM   1548  CB  VAL A 198     159.775 164.680 118.032  1.00 20.95           C  
ATOM   1549  CG1 VAL A 198     159.542 163.342 117.372  1.00 20.95           C  
ATOM   1550  CG2 VAL A 198     160.254 164.492 119.447  1.00 20.95           C  
ATOM   1551  N   VAL A 199     160.906 164.938 114.871  1.00 23.46           N  
ATOM   1552  CA  VAL A 199     160.518 165.014 113.469  1.00 23.46           C  
ATOM   1553  C   VAL A 199     159.455 163.961 113.198  1.00 23.46           C  
ATOM   1554  O   VAL A 199     159.691 162.763 113.388  1.00 23.46           O  
ATOM   1555  CB  VAL A 199     161.723 164.819 112.540  1.00 23.46           C  
ATOM   1556  CG1 VAL A 199     161.281 164.898 111.086  1.00 23.46           C  
ATOM   1557  CG2 VAL A 199     162.785 165.854 112.836  1.00 23.46           C  
ATOM   1558  N   PHE A 200     158.289 164.404 112.759  1.00 28.40           N  
ATOM   1559  CA  PHE A 200     157.263 163.527 112.234  1.00 28.40           C  
ATOM   1560  C   PHE A 200     157.059 163.841 110.756  1.00 28.40           C  
ATOM   1561  O   PHE A 200     157.572 164.833 110.226  1.00 28.40           O  
ATOM   1562  CB  PHE A 200     155.954 163.678 113.013  1.00 28.40           C  
ATOM   1563  CG  PHE A 200     156.007 163.146 114.418  1.00 28.40           C  
ATOM   1564  CD1 PHE A 200     156.191 161.800 114.660  1.00 28.40           C  
ATOM   1565  CD2 PHE A 200     155.841 163.992 115.496  1.00 28.40           C  
ATOM   1566  CE1 PHE A 200     156.230 161.315 115.951  1.00 28.40           C  
ATOM   1567  CE2 PHE A 200     155.859 163.510 116.785  1.00 28.40           C  
ATOM   1568  CZ  PHE A 200     156.062 162.170 117.012  1.00 28.40           C  
ATOM   1569  N   SER A 201     156.254 163.006 110.102  1.00 35.33           N  
ATOM   1570  CA  SER A 201     156.071 163.102 108.660  1.00 35.33           C  
ATOM   1571  C   SER A 201     155.470 164.432 108.224  1.00 35.33           C  
ATOM   1572  O   SER A 201     155.527 164.758 107.034  1.00 35.33           O  
ATOM   1573  CB  SER A 201     155.200 161.943 108.182  1.00 35.33           C  
ATOM   1574  OG  SER A 201     155.773 160.702 108.562  1.00 35.33           O  
ATOM   1575  N   THR A 202     154.799 165.190 109.148  1.00 30.90           N  
ATOM   1576  CA  THR A 202     154.220 166.476 108.783  1.00 30.90           C  
ATOM   1577  C   THR A 202     155.073 167.667 109.199  1.00 30.90           C  
ATOM   1578  O   THR A 202     154.745 168.798 108.828  1.00 30.90           O  
ATOM   1579  CB  THR A 202     152.826 166.626 109.382  1.00 30.90           C  
ATOM   1580  OG1 THR A 202     152.873 166.323 110.781  1.00 30.90           O  
ATOM   1581  CG2 THR A 202     151.858 165.688 108.697  1.00 30.90           C  
ATOM   1582  N   GLY A 203     156.136 167.459 109.960  1.00 27.61           N  
ATOM   1583  CA  GLY A 203     157.001 168.560 110.324  1.00 27.61           C  
ATOM   1584  C   GLY A 203     157.819 168.234 111.557  1.00 27.61           C  
ATOM   1585  O   GLY A 203     158.024 167.073 111.904  1.00 27.61           O  
ATOM   1586  N   SER A 204     158.295 169.298 112.199  1.00 23.90           N  
ATOM   1587  CA  SER A 204     159.082 169.210 113.420  1.00 23.90           C  
ATOM   1588  C   SER A 204     158.287 169.828 114.563  1.00 23.90           C  
ATOM   1589  O   SER A 204     157.896 170.996 114.486  1.00 23.90           O  
ATOM   1590  CB  SER A 204     160.422 169.923 113.251  1.00 23.90           C  
ATOM   1591  OG  SER A 204     161.071 170.074 114.498  1.00 23.90           O  
ATOM   1592  N   TYR A 205     158.055 169.047 115.625  1.00 22.40           N  
ATOM   1593  CA  TYR A 205     157.235 169.486 116.744  1.00 22.40           C  
ATOM   1594  C   TYR A 205     158.045 169.540 118.033  1.00 22.40           C  
ATOM   1595  O   TYR A 205     158.811 168.616 118.320  1.00 22.40           O  
ATOM   1596  CB  TYR A 205     156.040 168.550 116.942  1.00 22.40           C  
ATOM   1597  CG  TYR A 205     155.091 168.505 115.771  1.00 22.40           C  
ATOM   1598  CD1 TYR A 205     155.418 167.821 114.616  1.00 22.40           C  
ATOM   1599  CD2 TYR A 205     153.863 169.137 115.826  1.00 22.40           C  
ATOM   1600  CE1 TYR A 205     154.554 167.776 113.549  1.00 22.40           C  
ATOM   1601  CE2 TYR A 205     152.991 169.096 114.764  1.00 22.40           C  
ATOM   1602  CZ  TYR A 205     153.341 168.412 113.629  1.00 22.40           C  
ATOM   1603  OH  TYR A 205     152.477 168.369 112.564  1.00 22.40           O  
ATOM   1604  N   PRO A 206     157.884 170.592 118.833  1.00 16.77           N  
ATOM   1605  CA  PRO A 206     158.659 170.709 120.072  1.00 16.77           C  
ATOM   1606  C   PRO A 206     158.145 169.746 121.121  1.00 16.77           C  
ATOM   1607  O   PRO A 206     157.029 169.236 121.020  1.00 16.77           O  
ATOM   1608  CB  PRO A 206     158.417 172.156 120.494  1.00 16.77           C  
ATOM   1609  CG  PRO A 206     157.054 172.425 119.999  1.00 16.77           C  
ATOM   1610  CD  PRO A 206     156.930 171.699 118.687  1.00 16.77           C  
ATOM   1611  N   ARG A 207     158.963 169.501 122.142  1.00 16.47           N  
ATOM   1612  CA  ARG A 207     158.530 168.600 123.198  1.00 16.47           C  
ATOM   1613  C   ARG A 207     159.380 168.790 124.442  1.00 16.47           C  
ATOM   1614  O   ARG A 207     160.544 169.194 124.367  1.00 16.47           O  
ATOM   1615  CB  ARG A 207     158.604 167.137 122.756  1.00 16.47           C  
ATOM   1616  CG  ARG A 207     159.863 166.437 123.212  1.00 16.47           C  
ATOM   1617  CD  ARG A 207     159.906 165.012 122.740  1.00 16.47           C  
ATOM   1618  NE  ARG A 207     158.664 164.316 123.027  1.00 16.47           N  
ATOM   1619  CZ  ARG A 207     158.461 163.034 122.766  1.00 16.47           C  
ATOM   1620  NH1 ARG A 207     159.421 162.308 122.211  1.00 16.47           N  
ATOM   1621  NH2 ARG A 207     157.299 162.480 123.060  1.00 16.47           N  
ATOM   1622  N   LEU A 208     158.777 168.481 125.585  1.00 16.46           N  
ATOM   1623  CA  LEU A 208     159.471 168.374 126.856  1.00 16.46           C  
ATOM   1624  C   LEU A 208     159.339 166.953 127.384  1.00 16.46           C  
ATOM   1625  O   LEU A 208     158.422 166.215 127.012  1.00 16.46           O  
ATOM   1626  CB  LEU A 208     158.913 169.357 127.886  1.00 16.46           C  
ATOM   1627  CG  LEU A 208     158.871 170.828 127.487  1.00 16.46           C  
ATOM   1628  CD1 LEU A 208     158.616 171.678 128.706  1.00 16.46           C  
ATOM   1629  CD2 LEU A 208     160.164 171.234 126.835  1.00 16.46           C  
ATOM   1630  N   SER A 209     160.266 166.573 128.254  1.00 19.68           N  
ATOM   1631  CA  SER A 209     160.258 165.251 128.860  1.00 19.68           C  
ATOM   1632  C   SER A 209     160.619 165.372 130.329  1.00 19.68           C  
ATOM   1633  O   SER A 209     161.638 165.980 130.670  1.00 19.68           O  
ATOM   1634  CB  SER A 209     161.235 164.314 128.147  1.00 19.68           C  
ATOM   1635  OG  SER A 209     161.280 163.045 128.773  1.00 19.68           O  
ATOM   1636  N   LEU A 210     159.791 164.792 131.191  1.00 20.46           N  
ATOM   1637  CA  LEU A 210     160.057 164.724 132.624  1.00 20.46           C  
ATOM   1638  C   LEU A 210     160.227 163.255 132.974  1.00 20.46           C  
ATOM   1639  O   LEU A 210     159.266 162.486 132.900  1.00 20.46           O  
ATOM   1640  CB  LEU A 210     158.918 165.359 133.420  1.00 20.46           C  
ATOM   1641  CG  LEU A 210     158.662 164.883 134.850  1.00 20.46           C  
ATOM   1642  CD1 LEU A 210     159.778 165.314 135.766  1.00 20.46           C  
ATOM   1643  CD2 LEU A 210     157.334 165.404 135.358  1.00 20.46           C  
ATOM   1644  N   SER A 211     161.439 162.848 133.341  1.00 31.93           N  
ATOM   1645  CA  SER A 211     161.737 161.426 133.473  1.00 31.93           C  
ATOM   1646  C   SER A 211     162.406 161.165 134.808  1.00 31.93           C  
ATOM   1647  O   SER A 211     163.439 161.768 135.105  1.00 31.93           O  
ATOM   1648  CB  SER A 211     162.639 160.962 132.332  1.00 31.93           C  
ATOM   1649  OG  SER A 211     162.138 161.406 131.085  1.00 31.93           O  
ATOM   1650  N   PHE A 212     161.851 160.249 135.602  1.00 36.61           N  
ATOM   1651  CA  PHE A 212     162.443 159.983 136.907  1.00 36.61           C  
ATOM   1652  C   PHE A 212     162.643 158.492 137.117  1.00 36.61           C  
ATOM   1653  O   PHE A 212     161.840 157.676 136.661  1.00 36.61           O  
ATOM   1654  CB  PHE A 212     161.607 160.570 138.054  1.00 36.61           C  
ATOM   1655  CG  PHE A 212     160.137 160.322 137.939  1.00 36.61           C  
ATOM   1656  CD1 PHE A 212     159.606 159.082 138.227  1.00 36.61           C  
ATOM   1657  CD2 PHE A 212     159.282 161.340 137.569  1.00 36.61           C  
ATOM   1658  CE1 PHE A 212     158.253 158.856 138.132  1.00 36.61           C  
ATOM   1659  CE2 PHE A 212     157.928 161.121 137.473  1.00 36.61           C  
ATOM   1660  CZ  PHE A 212     157.412 159.877 137.756  1.00 36.61           C  
ATOM   1661  N   LYS A 213     163.726 158.150 137.809  1.00 49.16           N  
ATOM   1662  CA  LYS A 213     164.057 156.758 138.059  1.00 49.16           C  
ATOM   1663  C   LYS A 213     163.230 156.197 139.207  1.00 49.16           C  
ATOM   1664  O   LYS A 213     162.662 156.926 140.021  1.00 49.16           O  
ATOM   1665  CB  LYS A 213     165.541 156.596 138.381  1.00 49.16           C  
ATOM   1666  CG  LYS A 213     166.449 156.651 137.175  1.00 49.16           C  
ATOM   1667  CD  LYS A 213     167.907 156.510 137.570  1.00 49.16           C  
ATOM   1668  CE  LYS A 213     168.193 155.130 138.130  1.00 49.16           C  
ATOM   1669  NZ  LYS A 213     168.023 154.073 137.098  1.00 49.16           N  
ATOM   1670  N   LEU A 214     163.168 154.873 139.257  1.00 48.94           N  
ATOM   1671  CA  LEU A 214     162.515 154.148 140.335  1.00 48.94           C  
ATOM   1672  C   LEU A 214     163.377 152.951 140.697  1.00 48.94           C  
ATOM   1673  O   LEU A 214     163.759 152.174 139.818  1.00 48.94           O  
ATOM   1674  CB  LEU A 214     161.112 153.685 139.934  1.00 48.94           C  
ATOM   1675  CG  LEU A 214     160.076 154.763 139.623  1.00 48.94           C  
ATOM   1676  CD1 LEU A 214     158.778 154.135 139.154  1.00 48.94           C  
ATOM   1677  CD2 LEU A 214     159.836 155.617 140.841  1.00 48.94           C  
ATOM   1678  N   LYS A 215     163.686 152.805 141.980  1.00 48.13           N  
ATOM   1679  CA  LYS A 215     164.481 151.688 142.467  1.00 48.13           C  
ATOM   1680  C   LYS A 215     163.645 150.877 143.443  1.00 48.13           C  
ATOM   1681  O   LYS A 215     162.985 151.444 144.320  1.00 48.13           O  
ATOM   1682  CB  LYS A 215     165.764 152.171 143.142  1.00 48.13           C  
ATOM   1683  CG  LYS A 215     166.663 151.049 143.612  1.00 48.13           C  
ATOM   1684  CD  LYS A 215     167.932 151.589 144.242  1.00 48.13           C  
ATOM   1685  CE  LYS A 215     168.875 150.461 144.623  1.00 48.13           C  
ATOM   1686  NZ  LYS A 215     170.142 150.979 145.206  1.00 48.13           N  
ATOM   1687  N   ARG A 216     163.670 149.559 143.288  1.00 47.66           N  
ATOM   1688  CA  ARG A 216     162.882 148.695 144.147  1.00 47.66           C  
ATOM   1689  C   ARG A 216     163.602 148.457 145.470  1.00 47.66           C  
ATOM   1690  O   ARG A 216     164.829 148.530 145.563  1.00 47.66           O  
ATOM   1691  CB  ARG A 216     162.602 147.366 143.449  1.00 47.66           C  
ATOM   1692  CG  ARG A 216     161.507 146.542 144.094  1.00 47.66           C  
ATOM   1693  CD  ARG A 216     161.278 145.255 143.335  1.00 47.66           C  
ATOM   1694  NE  ARG A 216     160.978 145.498 141.928  1.00 47.66           N  
ATOM   1695  CZ  ARG A 216     159.749 145.593 141.434  1.00 47.66           C  
ATOM   1696  NH1 ARG A 216     158.702 145.467 142.235  1.00 47.66           N  
ATOM   1697  NH2 ARG A 216     159.566 145.816 140.142  1.00 47.66           N  
ATOM   1698  N   ASN A 217     162.817 148.175 146.506  1.00 57.04           N  
ATOM   1699  CA  ASN A 217     163.356 147.849 147.819  1.00 57.04           C  
ATOM   1700  C   ASN A 217     163.593 146.347 147.904  1.00 57.04           C  
ATOM   1701  O   ASN A 217     162.663 145.554 147.724  1.00 57.04           O  
ATOM   1702  CB  ASN A 217     162.415 148.307 148.928  1.00 57.04           C  
ATOM   1703  CG  ASN A 217     162.408 149.805 149.095  1.00 57.04           C  
ATOM   1704  OD1 ASN A 217     163.341 150.489 148.677  1.00 57.04           O  
ATOM   1705  ND2 ASN A 217     161.358 150.327 149.714  1.00 57.04           N  
ATOM   1706  N   ILE A 218     164.838 145.962 148.186  1.00 59.26           N  
ATOM   1707  CA  ILE A 218     165.200 144.550 148.191  1.00 59.26           C  
ATOM   1708  C   ILE A 218     164.771 143.873 149.488  1.00 59.26           C  
ATOM   1709  O   ILE A 218     164.499 142.666 149.504  1.00 59.26           O  
ATOM   1710  CB  ILE A 218     166.712 144.406 147.944  1.00 59.26           C  
ATOM   1711  CG1 ILE A 218     167.119 142.934 147.927  1.00 59.26           C  
ATOM   1712  CG2 ILE A 218     167.499 145.177 148.995  1.00 59.26           C  
ATOM   1713  CD1 ILE A 218     166.306 142.092 146.972  1.00 59.26           C  
ATOM   1714  N   GLY A 219     164.683 144.630 150.583  1.00 64.78           N  
ATOM   1715  CA  GLY A 219     164.520 144.015 151.892  1.00 64.78           C  
ATOM   1716  C   GLY A 219     163.289 143.136 152.007  1.00 64.78           C  
ATOM   1717  O   GLY A 219     163.310 142.111 152.693  1.00 64.78           O  
ATOM   1718  N   TYR A 220     162.201 143.517 151.338  1.00 72.63           N  
ATOM   1719  CA  TYR A 220     160.939 142.810 151.529  1.00 72.63           C  
ATOM   1720  C   TYR A 220     160.930 141.469 150.805  1.00 72.63           C  
ATOM   1721  O   TYR A 220     160.533 140.448 151.378  1.00 72.63           O  
ATOM   1722  CB  TYR A 220     159.774 143.677 151.060  1.00 72.63           C  
ATOM   1723  CG  TYR A 220     158.429 143.003 151.208  1.00 72.63           C  
ATOM   1724  CD1 TYR A 220     157.820 142.896 152.452  1.00 72.63           C  
ATOM   1725  CD2 TYR A 220     157.767 142.476 150.107  1.00 72.63           C  
ATOM   1726  CE1 TYR A 220     156.590 142.283 152.596  1.00 72.63           C  
ATOM   1727  CE2 TYR A 220     156.536 141.861 150.240  1.00 72.63           C  
ATOM   1728  CZ  TYR A 220     155.952 141.767 151.488  1.00 72.63           C  
ATOM   1729  OH  TYR A 220     154.727 141.156 151.628  1.00 72.63           O  
ATOM   1730  N   PHE A 221     161.354 141.454 149.539  1.00 65.56           N  
ATOM   1731  CA  PHE A 221     161.196 140.256 148.720  1.00 65.56           C  
ATOM   1732  C   PHE A 221     162.038 139.095 149.225  1.00 65.56           C  
ATOM   1733  O   PHE A 221     161.671 137.933 149.014  1.00 65.56           O  
ATOM   1734  CB  PHE A 221     161.554 140.559 147.269  1.00 65.56           C  
ATOM   1735  CG  PHE A 221     160.437 141.176 146.495  1.00 65.56           C  
ATOM   1736  CD1 PHE A 221     160.202 142.534 146.564  1.00 65.56           C  
ATOM   1737  CD2 PHE A 221     159.613 140.394 145.706  1.00 65.56           C  
ATOM   1738  CE1 PHE A 221     159.172 143.103 145.855  1.00 65.56           C  
ATOM   1739  CE2 PHE A 221     158.578 140.958 144.993  1.00 65.56           C  
ATOM   1740  CZ  PHE A 221     158.357 142.314 145.068  1.00 65.56           C  
ATOM   1741  N   ILE A 222     163.166 139.384 149.871  1.00 62.20           N  
ATOM   1742  CA  ILE A 222     164.060 138.323 150.324  1.00 62.20           C  
ATOM   1743  C   ILE A 222     163.323 137.373 151.259  1.00 62.20           C  
ATOM   1744  O   ILE A 222     163.155 136.185 150.957  1.00 62.20           O  
ATOM   1745  CB  ILE A 222     165.306 138.922 150.994  1.00 62.20           C  
ATOM   1746  CG1 ILE A 222     166.127 139.698 149.966  1.00 62.20           C  
ATOM   1747  CG2 ILE A 222     166.143 137.830 151.631  1.00 62.20           C  
ATOM   1748  CD1 ILE A 222     166.537 138.870 148.777  1.00 62.20           C  
ATOM   1749  N   LEU A 223     162.836 137.901 152.385  1.00 60.62           N  
ATOM   1750  CA  LEU A 223     162.200 137.065 153.399  1.00 60.62           C  
ATOM   1751  C   LEU A 223     161.023 136.289 152.827  1.00 60.62           C  
ATOM   1752  O   LEU A 223     160.780 135.141 153.213  1.00 60.62           O  
ATOM   1753  CB  LEU A 223     161.740 137.929 154.574  1.00 60.62           C  
ATOM   1754  CG  LEU A 223     162.702 139.005 155.081  1.00 60.62           C  
ATOM   1755  CD1 LEU A 223     162.095 139.738 156.266  1.00 60.62           C  
ATOM   1756  CD2 LEU A 223     164.051 138.410 155.448  1.00 60.62           C  
ATOM   1757  N   GLN A 224     160.279 136.898 151.905  1.00 60.66           N  
ATOM   1758  CA  GLN A 224     159.076 136.254 151.392  1.00 60.66           C  
ATOM   1759  C   GLN A 224     159.416 135.135 150.416  1.00 60.66           C  
ATOM   1760  O   GLN A 224     158.839 134.044 150.485  1.00 60.66           O  
ATOM   1761  CB  GLN A 224     158.169 137.290 150.728  1.00 60.66           C  
ATOM   1762  CG  GLN A 224     157.643 138.355 151.677  1.00 60.66           C  
ATOM   1763  CD  GLN A 224     156.711 137.790 152.729  1.00 60.66           C  
ATOM   1764  OE1 GLN A 224     156.640 138.298 153.847  1.00 60.66           O  
ATOM   1765  NE2 GLN A 224     155.983 136.739 152.373  1.00 60.66           N  
ATOM   1766  N   THR A 225     160.354 135.379 149.502  1.00 56.09           N  
ATOM   1767  CA  THR A 225     160.582 134.466 148.390  1.00 56.09           C  
ATOM   1768  C   THR A 225     161.798 133.569 148.580  1.00 56.09           C  
ATOM   1769  O   THR A 225     161.685 132.346 148.467  1.00 56.09           O  
ATOM   1770  CB  THR A 225     160.735 135.262 147.091  1.00 56.09           C  
ATOM   1771  OG1 THR A 225     161.847 136.155 147.213  1.00 56.09           O  
ATOM   1772  CG2 THR A 225     159.482 136.069 146.815  1.00 56.09           C  
ATOM   1773  N   TYR A 226     162.966 134.146 148.862  1.00 58.42           N  
ATOM   1774  CA  TYR A 226     164.192 133.363 148.775  1.00 58.42           C  
ATOM   1775  C   TYR A 226     164.398 132.457 149.981  1.00 58.42           C  
ATOM   1776  O   TYR A 226     164.982 131.377 149.842  1.00 58.42           O  
ATOM   1777  CB  TYR A 226     165.392 134.291 148.600  1.00 58.42           C  
ATOM   1778  CG  TYR A 226     165.474 134.908 147.226  1.00 58.42           C  
ATOM   1779  CD1 TYR A 226     166.016 134.205 146.165  1.00 58.42           C  
ATOM   1780  CD2 TYR A 226     165.007 136.191 146.989  1.00 58.42           C  
ATOM   1781  CE1 TYR A 226     166.093 134.760 144.907  1.00 58.42           C  
ATOM   1782  CE2 TYR A 226     165.081 136.756 145.732  1.00 58.42           C  
ATOM   1783  CZ  TYR A 226     165.626 136.034 144.696  1.00 58.42           C  
ATOM   1784  OH  TYR A 226     165.702 136.589 143.442  1.00 58.42           O  
ATOM   1785  N   MET A 227     163.934 132.866 151.159  1.00 61.99           N  
ATOM   1786  CA  MET A 227     164.179 132.065 152.355  1.00 61.99           C  
ATOM   1787  C   MET A 227     163.574 130.666 152.299  1.00 61.99           C  
ATOM   1788  O   MET A 227     164.277 129.716 152.681  1.00 61.99           O  
ATOM   1789  CB  MET A 227     163.690 132.818 153.598  1.00 61.99           C  
ATOM   1790  CG  MET A 227     164.705 133.798 154.152  1.00 61.99           C  
ATOM   1791  SD  MET A 227     164.256 134.416 155.784  1.00 61.99           S  
ATOM   1792  CE  MET A 227     165.761 135.273 156.245  1.00 61.99           C  
ATOM   1793  N   PRO A 228     162.322 130.454 151.870  1.00 58.24           N  
ATOM   1794  CA  PRO A 228     161.804 129.074 151.849  1.00 58.24           C  
ATOM   1795  C   PRO A 228     162.604 128.141 150.957  1.00 58.24           C  
ATOM   1796  O   PRO A 228     162.897 127.003 151.353  1.00 58.24           O  
ATOM   1797  CB  PRO A 228     160.367 129.251 151.342  1.00 58.24           C  
ATOM   1798  CG  PRO A 228     160.011 130.632 151.714  1.00 58.24           C  
ATOM   1799  CD  PRO A 228     161.266 131.425 151.533  1.00 58.24           C  
ATOM   1800  N   SER A 229     162.973 128.595 149.759  1.00 55.41           N  
ATOM   1801  CA  SER A 229     163.730 127.742 148.850  1.00 55.41           C  
ATOM   1802  C   SER A 229     165.090 127.387 149.434  1.00 55.41           C  
ATOM   1803  O   SER A 229     165.509 126.225 149.385  1.00 55.41           O  
ATOM   1804  CB  SER A 229     163.888 128.433 147.500  1.00 55.41           C  
ATOM   1805  OG  SER A 229     162.624 128.782 146.968  1.00 55.41           O  
ATOM   1806  N   ILE A 230     165.789 128.372 149.999  1.00 55.89           N  
ATOM   1807  CA  ILE A 230     167.099 128.106 150.583  1.00 55.89           C  
ATOM   1808  C   ILE A 230     166.974 127.175 151.782  1.00 55.89           C  
ATOM   1809  O   ILE A 230     167.805 126.280 151.977  1.00 55.89           O  
ATOM   1810  CB  ILE A 230     167.792 129.428 150.955  1.00 55.89           C  
ATOM   1811  CG1 ILE A 230     168.139 130.212 149.693  1.00 55.89           C  
ATOM   1812  CG2 ILE A 230     169.042 129.166 151.770  1.00 55.89           C  
ATOM   1813  CD1 ILE A 230     168.926 131.471 149.961  1.00 55.89           C  
ATOM   1814  N   LEU A 231     165.934 127.360 152.598  1.00 56.89           N  
ATOM   1815  CA  LEU A 231     165.737 126.481 153.745  1.00 56.89           C  
ATOM   1816  C   LEU A 231     165.508 125.044 153.303  1.00 56.89           C  
ATOM   1817  O   LEU A 231     166.084 124.113 153.876  1.00 56.89           O  
ATOM   1818  CB  LEU A 231     164.564 126.966 154.593  1.00 56.89           C  
ATOM   1819  CG  LEU A 231     164.792 128.213 155.444  1.00 56.89           C  
ATOM   1820  CD1 LEU A 231     163.567 128.489 156.296  1.00 56.89           C  
ATOM   1821  CD2 LEU A 231     166.024 128.046 156.310  1.00 56.89           C  
ATOM   1822  N   ILE A 232     164.676 124.841 152.280  1.00 53.98           N  
ATOM   1823  CA  ILE A 232     164.425 123.482 151.811  1.00 53.98           C  
ATOM   1824  C   ILE A 232     165.686 122.885 151.201  1.00 53.98           C  
ATOM   1825  O   ILE A 232     165.998 121.707 151.413  1.00 53.98           O  
ATOM   1826  CB  ILE A 232     163.250 123.464 150.820  1.00 53.98           C  
ATOM   1827  CG1 ILE A 232     161.974 123.928 151.516  1.00 53.98           C  
ATOM   1828  CG2 ILE A 232     163.061 122.072 150.251  1.00 53.98           C  
ATOM   1829  CD1 ILE A 232     161.581 123.070 152.687  1.00 53.98           C  
ATOM   1830  N   THR A 233     166.443 123.688 150.452  1.00 56.08           N  
ATOM   1831  CA  THR A 233     167.679 123.192 149.858  1.00 56.08           C  
ATOM   1832  C   THR A 233     168.676 122.766 150.928  1.00 56.08           C  
ATOM   1833  O   THR A 233     169.318 121.717 150.806  1.00 56.08           O  
ATOM   1834  CB  THR A 233     168.288 124.261 148.957  1.00 56.08           C  
ATOM   1835  OG1 THR A 233     167.440 124.465 147.821  1.00 56.08           O  
ATOM   1836  CG2 THR A 233     169.669 123.841 148.490  1.00 56.08           C  
ATOM   1837  N   ILE A 234     168.811 123.559 151.992  1.00 58.92           N  
ATOM   1838  CA  ILE A 234     169.751 123.212 153.052  1.00 58.92           C  
ATOM   1839  C   ILE A 234     169.269 121.986 153.813  1.00 58.92           C  
ATOM   1840  O   ILE A 234     170.054 121.082 154.125  1.00 58.92           O  
ATOM   1841  CB  ILE A 234     169.967 124.412 153.988  1.00 58.92           C  
ATOM   1842  CG1 ILE A 234     170.648 125.550 153.232  1.00 58.92           C  
ATOM   1843  CG2 ILE A 234     170.804 124.011 155.184  1.00 58.92           C  
ATOM   1844  CD1 ILE A 234     170.937 126.762 154.085  1.00 58.92           C  
ATOM   1845  N   LEU A 235     167.972 121.927 154.116  1.00 59.04           N  
ATOM   1846  CA  LEU A 235     167.423 120.791 154.839  1.00 59.04           C  
ATOM   1847  C   LEU A 235     167.470 119.514 154.016  1.00 59.04           C  
ATOM   1848  O   LEU A 235     167.409 118.420 154.585  1.00 59.04           O  
ATOM   1849  CB  LEU A 235     165.989 121.094 155.268  1.00 59.04           C  
ATOM   1850  CG  LEU A 235     165.778 121.773 156.623  1.00 59.04           C  
ATOM   1851  CD1 LEU A 235     166.866 122.792 156.940  1.00 59.04           C  
ATOM   1852  CD2 LEU A 235     164.398 122.418 156.661  1.00 59.04           C  
ATOM   1853  N   SER A 236     167.572 119.628 152.692  1.00 60.56           N  
ATOM   1854  CA  SER A 236     167.753 118.439 151.871  1.00 60.56           C  
ATOM   1855  C   SER A 236     169.097 117.778 152.135  1.00 60.56           C  
ATOM   1856  O   SER A 236     169.246 116.570 151.928  1.00 60.56           O  
ATOM   1857  CB  SER A 236     167.631 118.801 150.395  1.00 60.56           C  
ATOM   1858  OG  SER A 236     168.655 119.702 150.018  1.00 60.56           O  
ATOM   1859  N   TRP A 237     170.084 118.552 152.586  1.00 66.83           N  
ATOM   1860  CA  TRP A 237     171.421 118.017 152.806  1.00 66.83           C  
ATOM   1861  C   TRP A 237     171.501 117.104 154.022  1.00 66.83           C  
ATOM   1862  O   TRP A 237     172.424 116.287 154.104  1.00 66.83           O  
ATOM   1863  CB  TRP A 237     172.418 119.162 152.952  1.00 66.83           C  
ATOM   1864  CG  TRP A 237     172.517 120.014 151.732  1.00 66.83           C  
ATOM   1865  CD1 TRP A 237     172.000 119.744 150.501  1.00 66.83           C  
ATOM   1866  CD2 TRP A 237     173.174 121.279 151.623  1.00 66.83           C  
ATOM   1867  NE1 TRP A 237     172.295 120.763 149.631  1.00 66.83           N  
ATOM   1868  CE2 TRP A 237     173.016 121.718 150.296  1.00 66.83           C  
ATOM   1869  CE3 TRP A 237     173.881 122.082 152.520  1.00 66.83           C  
ATOM   1870  CZ2 TRP A 237     173.538 122.923 149.844  1.00 66.83           C  
ATOM   1871  CZ3 TRP A 237     174.399 123.277 152.070  1.00 66.83           C  
ATOM   1872  CH2 TRP A 237     174.226 123.687 150.745  1.00 66.83           C  
ATOM   1873  N   VAL A 238     170.563 117.221 154.966  1.00 70.46           N  
ATOM   1874  CA  VAL A 238     170.563 116.344 156.131  1.00 70.46           C  
ATOM   1875  C   VAL A 238     170.416 114.887 155.718  1.00 70.46           C  
ATOM   1876  O   VAL A 238     170.708 113.983 156.507  1.00 70.46           O  
ATOM   1877  CB  VAL A 238     169.449 116.766 157.112  1.00 70.46           C  
ATOM   1878  CG1 VAL A 238     169.639 116.102 158.466  1.00 70.46           C  
ATOM   1879  CG2 VAL A 238     169.422 118.280 157.263  1.00 70.46           C  
ATOM   1880  N   SER A 239     169.981 114.637 154.483  1.00 72.14           N  
ATOM   1881  CA  SER A 239     169.904 113.273 153.979  1.00 72.14           C  
ATOM   1882  C   SER A 239     171.261 112.582 154.020  1.00 72.14           C  
ATOM   1883  O   SER A 239     171.339 111.368 154.237  1.00 72.14           O  
ATOM   1884  CB  SER A 239     169.355 113.279 152.554  1.00 72.14           C  
ATOM   1885  OG  SER A 239     169.920 112.227 151.796  1.00 72.14           O  
ATOM   1886  N   PHE A 240     172.342 113.338 153.825  1.00 78.39           N  
ATOM   1887  CA  PHE A 240     173.660 112.720 153.729  1.00 78.39           C  
ATOM   1888  C   PHE A 240     174.122 112.165 155.070  1.00 78.39           C  
ATOM   1889  O   PHE A 240     174.769 111.113 155.122  1.00 78.39           O  
ATOM   1890  CB  PHE A 240     174.673 113.726 153.190  1.00 78.39           C  
ATOM   1891  CG  PHE A 240     174.443 114.107 151.760  1.00 78.39           C  
ATOM   1892  CD1 PHE A 240     174.559 113.165 150.754  1.00 78.39           C  
ATOM   1893  CD2 PHE A 240     174.123 115.408 151.418  1.00 78.39           C  
ATOM   1894  CE1 PHE A 240     174.353 113.510 149.437  1.00 78.39           C  
ATOM   1895  CE2 PHE A 240     173.916 115.760 150.102  1.00 78.39           C  
ATOM   1896  CZ  PHE A 240     174.032 114.809 149.110  1.00 78.39           C  
ATOM   1897  N   TRP A 241     173.801 112.852 156.166  1.00 93.77           N  
ATOM   1898  CA  TRP A 241     174.299 112.429 157.469  1.00 93.77           C  
ATOM   1899  C   TRP A 241     173.662 111.132 157.950  1.00 93.77           C  
ATOM   1900  O   TRP A 241     174.234 110.464 158.817  1.00 93.77           O  
ATOM   1901  CB  TRP A 241     174.077 113.535 158.499  1.00 93.77           C  
ATOM   1902  CG  TRP A 241     174.877 114.767 158.224  1.00 93.77           C  
ATOM   1903  CD1 TRP A 241     174.434 115.921 157.651  1.00 93.77           C  
ATOM   1904  CD2 TRP A 241     176.266 114.964 158.499  1.00 93.77           C  
ATOM   1905  NE1 TRP A 241     175.459 116.829 157.559  1.00 93.77           N  
ATOM   1906  CE2 TRP A 241     176.596 116.264 158.074  1.00 93.77           C  
ATOM   1907  CE3 TRP A 241     177.263 114.169 159.069  1.00 93.77           C  
ATOM   1908  CZ2 TRP A 241     177.879 116.786 158.198  1.00 93.77           C  
ATOM   1909  CZ3 TRP A 241     178.536 114.688 159.193  1.00 93.77           C  
ATOM   1910  CH2 TRP A 241     178.833 115.985 158.760  1.00 93.77           C  
ATOM   1911  N   ILE A 242     172.499 110.760 157.416  1.00 85.45           N  
ATOM   1912  CA  ILE A 242     171.875 109.502 157.802  1.00 85.45           C  
ATOM   1913  C   ILE A 242     172.698 108.341 157.261  1.00 85.45           C  
ATOM   1914  O   ILE A 242     173.290 108.426 156.177  1.00 85.45           O  
ATOM   1915  CB  ILE A 242     170.425 109.440 157.296  1.00 85.45           C  
ATOM   1916  CG1 ILE A 242     169.671 110.711 157.682  1.00 85.45           C  
ATOM   1917  CG2 ILE A 242     169.708 108.235 157.874  1.00 85.45           C  
ATOM   1918  CD1 ILE A 242     168.220 110.709 157.252  1.00 85.45           C  
ATOM   1919  N   ASN A 243     172.751 107.251 158.024  1.00 82.67           N  
ATOM   1920  CA  ASN A 243     173.472 106.065 157.584  1.00 82.67           C  
ATOM   1921  C   ASN A 243     172.783 105.439 156.377  1.00 82.67           C  
ATOM   1922  O   ASN A 243     171.554 105.437 156.275  1.00 82.67           O  
ATOM   1923  CB  ASN A 243     173.567 105.052 158.725  1.00 82.67           C  
ATOM   1924  CG  ASN A 243     174.455 103.873 158.384  1.00 82.67           C  
ATOM   1925  OD1 ASN A 243     175.225 103.917 157.425  1.00 82.67           O  
ATOM   1926  ND2 ASN A 243     174.358 102.810 159.175  1.00 82.67           N  
ATOM   1927  N   TYR A 244     173.588 104.901 155.457  1.00 83.12           N  
ATOM   1928  CA  TYR A 244     173.063 104.349 154.213  1.00 83.12           C  
ATOM   1929  C   TYR A 244     172.230 103.091 154.418  1.00 83.12           C  
ATOM   1930  O   TYR A 244     171.659 102.586 153.446  1.00 83.12           O  
ATOM   1931  CB  TYR A 244     174.209 104.057 153.243  1.00 83.12           C  
ATOM   1932  CG  TYR A 244     175.335 103.256 153.847  1.00 83.12           C  
ATOM   1933  CD1 TYR A 244     175.257 101.874 153.939  1.00 83.12           C  
ATOM   1934  CD2 TYR A 244     176.481 103.881 154.319  1.00 83.12           C  
ATOM   1935  CE1 TYR A 244     176.285 101.136 154.489  1.00 83.12           C  
ATOM   1936  CE2 TYR A 244     177.515 103.152 154.870  1.00 83.12           C  
ATOM   1937  CZ  TYR A 244     177.412 101.779 154.952  1.00 83.12           C  
ATOM   1938  OH  TYR A 244     178.438 101.044 155.500  1.00 83.12           O  
ATOM   1939  N   ASP A 245     172.152 102.572 155.643  1.00 84.55           N  
ATOM   1940  CA  ASP A 245     171.329 101.394 155.893  1.00 84.55           C  
ATOM   1941  C   ASP A 245     169.845 101.741 155.853  1.00 84.55           C  
ATOM   1942  O   ASP A 245     169.043 100.999 155.274  1.00 84.55           O  
ATOM   1943  CB  ASP A 245     171.705 100.773 157.238  1.00 84.55           C  
ATOM   1944  CG  ASP A 245     171.093  99.404 157.440  1.00 84.55           C  
ATOM   1945  OD1 ASP A 245     170.469  98.880 156.495  1.00 84.55           O  
ATOM   1946  OD2 ASP A 245     171.239  98.848 158.548  1.00 84.55           O  
ATOM   1947  N   ALA A 246     169.462 102.864 156.455  1.00 76.34           N  
ATOM   1948  CA  ALA A 246     168.063 103.286 156.498  1.00 76.34           C  
ATOM   1949  C   ALA A 246     167.704 103.898 155.152  1.00 76.34           C  
ATOM   1950  O   ALA A 246     167.832 105.103 154.933  1.00 76.34           O  
ATOM   1951  CB  ALA A 246     167.832 104.268 157.640  1.00 76.34           C  
ATOM   1952  N   SER A 247     167.241 103.048 154.234  1.00 75.72           N  
ATOM   1953  CA  SER A 247     166.926 103.515 152.888  1.00 75.72           C  
ATOM   1954  C   SER A 247     165.618 104.293 152.866  1.00 75.72           C  
ATOM   1955  O   SER A 247     165.546 105.390 152.299  1.00 75.72           O  
ATOM   1956  CB  SER A 247     166.865 102.332 151.922  1.00 75.72           C  
ATOM   1957  OG  SER A 247     165.793 101.466 152.246  1.00 75.72           O  
ATOM   1958  N   ALA A 248     164.568 103.737 153.475  1.00 71.88           N  
ATOM   1959  CA  ALA A 248     163.259 104.378 153.426  1.00 71.88           C  
ATOM   1960  C   ALA A 248     163.283 105.744 154.098  1.00 71.88           C  
ATOM   1961  O   ALA A 248     162.688 106.703 153.592  1.00 71.88           O  
ATOM   1962  CB  ALA A 248     162.212 103.478 154.080  1.00 71.88           C  
ATOM   1963  N   ALA A 249     163.959 105.850 155.242  1.00 71.00           N  
ATOM   1964  CA  ALA A 249     164.049 107.124 155.944  1.00 71.00           C  
ATOM   1965  C   ALA A 249     164.665 108.198 155.054  1.00 71.00           C  
ATOM   1966  O   ALA A 249     164.146 109.314 154.950  1.00 71.00           O  
ATOM   1967  CB  ALA A 249     164.856 106.953 157.232  1.00 71.00           C  
ATOM   1968  N   ARG A 250     165.782 107.873 154.403  1.00 73.62           N  
ATOM   1969  CA  ARG A 250     166.452 108.860 153.563  1.00 73.62           C  
ATOM   1970  C   ARG A 250     165.625 109.192 152.327  1.00 73.62           C  
ATOM   1971  O   ARG A 250     165.582 110.349 151.892  1.00 73.62           O  
ATOM   1972  CB  ARG A 250     167.836 108.354 153.162  1.00 73.62           C  
ATOM   1973  CG  ARG A 250     168.759 109.466 152.715  1.00 73.62           C  
ATOM   1974  CD  ARG A 250     169.979 108.933 152.004  1.00 73.62           C  
ATOM   1975  NE  ARG A 250     170.766 108.048 152.853  1.00 73.62           N  
ATOM   1976  CZ  ARG A 250     171.889 108.409 153.461  1.00 73.62           C  
ATOM   1977  NH1 ARG A 250     172.364 109.635 153.307  1.00 73.62           N  
ATOM   1978  NH2 ARG A 250     172.543 107.545 154.217  1.00 73.62           N  
ATOM   1979  N   VAL A 251     164.975 108.186 151.737  1.00 65.72           N  
ATOM   1980  CA  VAL A 251     164.133 108.438 150.573  1.00 65.72           C  
ATOM   1981  C   VAL A 251     162.960 109.332 150.949  1.00 65.72           C  
ATOM   1982  O   VAL A 251     162.487 110.127 150.128  1.00 65.72           O  
ATOM   1983  CB  VAL A 251     163.673 107.105 149.955  1.00 65.72           C  
ATOM   1984  CG1 VAL A 251     162.572 107.327 148.938  1.00 65.72           C  
ATOM   1985  CG2 VAL A 251     164.846 106.403 149.300  1.00 65.72           C  
ATOM   1986  N   ALA A 252     162.495 109.248 152.196  1.00 62.74           N  
ATOM   1987  CA  ALA A 252     161.441 110.149 152.652  1.00 62.74           C  
ATOM   1988  C   ALA A 252     161.854 111.606 152.480  1.00 62.74           C  
ATOM   1989  O   ALA A 252     161.107 112.412 151.914  1.00 62.74           O  
ATOM   1990  CB  ALA A 252     161.090 109.855 154.110  1.00 62.74           C  
ATOM   1991  N   LEU A 253     163.050 111.959 152.954  1.00 64.36           N  
ATOM   1992  CA  LEU A 253     163.541 113.323 152.787  1.00 64.36           C  
ATOM   1993  C   LEU A 253     163.793 113.641 151.319  1.00 64.36           C  
ATOM   1994  O   LEU A 253     163.399 114.704 150.823  1.00 64.36           O  
ATOM   1995  CB  LEU A 253     164.817 113.522 153.601  1.00 64.36           C  
ATOM   1996  CG  LEU A 253     164.684 113.407 155.115  1.00 64.36           C  
ATOM   1997  CD1 LEU A 253     166.025 113.652 155.783  1.00 64.36           C  
ATOM   1998  CD2 LEU A 253     163.641 114.381 155.626  1.00 64.36           C  
ATOM   1999  N   GLY A 254     164.466 112.730 150.610  1.00 58.43           N  
ATOM   2000  CA  GLY A 254     164.765 112.964 149.206  1.00 58.43           C  
ATOM   2001  C   GLY A 254     163.528 113.190 148.362  1.00 58.43           C  
ATOM   2002  O   GLY A 254     163.605 113.777 147.280  1.00 58.43           O  
ATOM   2003  N   ILE A 255     162.380 112.709 148.828  1.00 61.18           N  
ATOM   2004  CA  ILE A 255     161.129 112.923 148.115  1.00 61.18           C  
ATOM   2005  C   ILE A 255     160.437 114.191 148.598  1.00 61.18           C  
ATOM   2006  O   ILE A 255     159.941 114.993 147.794  1.00 61.18           O  
ATOM   2007  CB  ILE A 255     160.229 111.687 148.280  1.00 61.18           C  
ATOM   2008  CG1 ILE A 255     160.508 110.680 147.165  1.00 61.18           C  
ATOM   2009  CG2 ILE A 255     158.769 112.090 148.346  1.00 61.18           C  
ATOM   2010  CD1 ILE A 255     159.891 109.330 147.408  1.00 61.18           C  
ATOM   2011  N   THR A 256     160.371 114.375 149.920  1.00 61.66           N  
ATOM   2012  CA  THR A 256     159.644 115.508 150.473  1.00 61.66           C  
ATOM   2013  C   THR A 256     160.277 116.824 150.062  1.00 61.66           C  
ATOM   2014  O   THR A 256     159.564 117.804 149.822  1.00 61.66           O  
ATOM   2015  CB  THR A 256     159.583 115.401 151.996  1.00 61.66           C  
ATOM   2016  OG1 THR A 256     159.060 114.119 152.364  1.00 61.66           O  
ATOM   2017  CG2 THR A 256     158.686 116.484 152.568  1.00 61.66           C  
ATOM   2018  N   THR A 257     161.605 116.868 149.961  1.00 62.49           N  
ATOM   2019  CA  THR A 257     162.261 118.097 149.531  1.00 62.49           C  
ATOM   2020  C   THR A 257     161.818 118.489 148.126  1.00 62.49           C  
ATOM   2021  O   THR A 257     161.482 119.651 147.872  1.00 62.49           O  
ATOM   2022  CB  THR A 257     163.777 117.931 149.594  1.00 62.49           C  
ATOM   2023  OG1 THR A 257     164.161 116.774 148.842  1.00 62.49           O  
ATOM   2024  CG2 THR A 257     164.226 117.766 151.032  1.00 62.49           C  
ATOM   2025  N   VAL A 258     161.797 117.526 147.203  1.00 55.58           N  
ATOM   2026  CA  VAL A 258     161.395 117.818 145.830  1.00 55.58           C  
ATOM   2027  C   VAL A 258     159.932 118.235 145.775  1.00 55.58           C  
ATOM   2028  O   VAL A 258     159.566 119.190 145.074  1.00 55.58           O  
ATOM   2029  CB  VAL A 258     161.674 116.604 144.928  1.00 55.58           C  
ATOM   2030  CG1 VAL A 258     160.989 116.768 143.585  1.00 55.58           C  
ATOM   2031  CG2 VAL A 258     163.167 116.428 144.739  1.00 55.58           C  
ATOM   2032  N   LEU A 259     159.071 117.531 146.513  1.00 54.41           N  
ATOM   2033  CA  LEU A 259     157.655 117.883 146.495  1.00 54.41           C  
ATOM   2034  C   LEU A 259     157.436 119.288 147.042  1.00 54.41           C  
ATOM   2035  O   LEU A 259     156.658 120.071 146.481  1.00 54.41           O  
ATOM   2036  CB  LEU A 259     156.848 116.859 147.290  1.00 54.41           C  
ATOM   2037  CG  LEU A 259     155.344 116.879 147.025  1.00 54.41           C  
ATOM   2038  CD1 LEU A 259     155.077 116.677 145.548  1.00 54.41           C  
ATOM   2039  CD2 LEU A 259     154.645 115.812 147.844  1.00 54.41           C  
ATOM   2040  N   THR A 260     158.136 119.635 148.123  1.00 54.63           N  
ATOM   2041  CA  THR A 260     157.995 120.964 148.701  1.00 54.63           C  
ATOM   2042  C   THR A 260     158.539 122.033 147.765  1.00 54.63           C  
ATOM   2043  O   THR A 260     157.969 123.124 147.669  1.00 54.63           O  
ATOM   2044  CB  THR A 260     158.701 121.023 150.052  1.00 54.63           C  
ATOM   2045  OG1 THR A 260     158.159 120.015 150.914  1.00 54.63           O  
ATOM   2046  CG2 THR A 260     158.506 122.385 150.695  1.00 54.63           C  
ATOM   2047  N   MET A 261     159.639 121.742 147.068  1.00 57.93           N  
ATOM   2048  CA  MET A 261     160.160 122.693 146.093  1.00 57.93           C  
ATOM   2049  C   MET A 261     159.146 122.956 144.990  1.00 57.93           C  
ATOM   2050  O   MET A 261     158.923 124.110 144.604  1.00 57.93           O  
ATOM   2051  CB  MET A 261     161.472 122.182 145.503  1.00 57.93           C  
ATOM   2052  CG  MET A 261     162.662 122.363 146.418  1.00 57.93           C  
ATOM   2053  SD  MET A 261     162.945 124.099 146.792  1.00 57.93           S  
ATOM   2054  CE  MET A 261     163.193 124.751 145.147  1.00 57.93           C  
ATOM   2055  N   THR A 262     158.512 121.899 144.480  1.00 52.80           N  
ATOM   2056  CA  THR A 262     157.506 122.090 143.439  1.00 52.80           C  
ATOM   2057  C   THR A 262     156.321 122.900 143.955  1.00 52.80           C  
ATOM   2058  O   THR A 262     155.828 123.805 143.267  1.00 52.80           O  
ATOM   2059  CB  THR A 262     157.042 120.739 142.902  1.00 52.80           C  
ATOM   2060  OG1 THR A 262     158.174 119.999 142.431  1.00 52.80           O  
ATOM   2061  CG2 THR A 262     156.069 120.934 141.755  1.00 52.80           C  
ATOM   2062  N   THR A 263     155.856 122.598 145.170  1.00 54.22           N  
ATOM   2063  CA  THR A 263     154.721 123.337 145.717  1.00 54.22           C  
ATOM   2064  C   THR A 263     155.062 124.807 145.931  1.00 54.22           C  
ATOM   2065  O   THR A 263     154.244 125.689 145.643  1.00 54.22           O  
ATOM   2066  CB  THR A 263     154.256 122.711 147.028  1.00 54.22           C  
ATOM   2067  OG1 THR A 263     155.351 122.672 147.950  1.00 54.22           O  
ATOM   2068  CG2 THR A 263     153.738 121.304 146.790  1.00 54.22           C  
ATOM   2069  N   ILE A 264     156.258 125.091 146.452  1.00 52.58           N  
ATOM   2070  CA  ILE A 264     156.664 126.477 146.662  1.00 52.58           C  
ATOM   2071  C   ILE A 264     156.787 127.198 145.330  1.00 52.58           C  
ATOM   2072  O   ILE A 264     156.429 128.375 145.209  1.00 52.58           O  
ATOM   2073  CB  ILE A 264     157.976 126.539 147.464  1.00 52.58           C  
ATOM   2074  CG1 ILE A 264     157.762 126.006 148.877  1.00 52.58           C  
ATOM   2075  CG2 ILE A 264     158.497 127.961 147.526  1.00 52.58           C  
ATOM   2076  CD1 ILE A 264     159.016 126.006 149.716  1.00 52.58           C  
ATOM   2077  N   ASN A 265     157.290 126.504 144.307  1.00 56.04           N  
ATOM   2078  CA  ASN A 265     157.357 127.097 142.977  1.00 56.04           C  
ATOM   2079  C   ASN A 265     155.969 127.490 142.488  1.00 56.04           C  
ATOM   2080  O   ASN A 265     155.763 128.607 141.999  1.00 56.04           O  
ATOM   2081  CB  ASN A 265     158.021 126.117 142.009  1.00 56.04           C  
ATOM   2082  CG  ASN A 265     158.216 126.703 140.627  1.00 56.04           C  
ATOM   2083  OD1 ASN A 265     158.171 127.919 140.443  1.00 56.04           O  
ATOM   2084  ND2 ASN A 265     158.439 125.837 139.643  1.00 56.04           N  
ATOM   2085  N   THR A 266     154.997 126.587 142.634  1.00 55.92           N  
ATOM   2086  CA  THR A 266     153.640 126.897 142.187  1.00 55.92           C  
ATOM   2087  C   THR A 266     153.043 128.059 142.973  1.00 55.92           C  
ATOM   2088  O   THR A 266     152.409 128.951 142.394  1.00 55.92           O  
ATOM   2089  CB  THR A 266     152.745 125.666 142.306  1.00 55.92           C  
ATOM   2090  OG1 THR A 266     152.706 125.233 143.670  1.00 55.92           O  
ATOM   2091  CG2 THR A 266     153.271 124.544 141.433  1.00 55.92           C  
ATOM   2092  N   HIS A 267     153.223 128.061 144.295  1.00 55.75           N  
ATOM   2093  CA  HIS A 267     152.686 129.147 145.109  1.00 55.75           C  
ATOM   2094  C   HIS A 267     153.295 130.482 144.711  1.00 55.75           C  
ATOM   2095  O   HIS A 267     152.587 131.486 144.565  1.00 55.75           O  
ATOM   2096  CB  HIS A 267     152.939 128.875 146.590  1.00 55.75           C  
ATOM   2097  CG  HIS A 267     152.547 130.011 147.481  1.00 55.75           C  
ATOM   2098  ND1 HIS A 267     151.260 130.499 147.540  1.00 55.75           N  
ATOM   2099  CD2 HIS A 267     153.273 130.760 148.344  1.00 55.75           C  
ATOM   2100  CE1 HIS A 267     151.208 131.495 148.405  1.00 55.75           C  
ATOM   2101  NE2 HIS A 267     152.417 131.675 148.906  1.00 55.75           N  
ATOM   2102  N   LEU A 268     154.616 130.513 144.534  1.00 56.18           N  
ATOM   2103  CA  LEU A 268     155.281 131.755 144.173  1.00 56.18           C  
ATOM   2104  C   LEU A 268     154.888 132.206 142.777  1.00 56.18           C  
ATOM   2105  O   LEU A 268     154.885 133.407 142.492  1.00 56.18           O  
ATOM   2106  CB  LEU A 268     156.793 131.583 144.277  1.00 56.18           C  
ATOM   2107  CG  LEU A 268     157.569 132.872 144.516  1.00 56.18           C  
ATOM   2108  CD1 LEU A 268     157.010 133.583 145.728  1.00 56.18           C  
ATOM   2109  CD2 LEU A 268     159.037 132.564 144.715  1.00 56.18           C  
ATOM   2110  N   ARG A 269     154.546 131.265 141.897  1.00 55.07           N  
ATOM   2111  CA  ARG A 269     154.028 131.650 140.591  1.00 55.07           C  
ATOM   2112  C   ARG A 269     152.643 132.266 140.716  1.00 55.07           C  
ATOM   2113  O   ARG A 269     152.317 133.227 140.011  1.00 55.07           O  
ATOM   2114  CB  ARG A 269     153.993 130.443 139.662  1.00 55.07           C  
ATOM   2115  CG  ARG A 269     153.583 130.780 138.247  1.00 55.07           C  
ATOM   2116  CD  ARG A 269     154.038 129.699 137.295  1.00 55.07           C  
ATOM   2117  NE  ARG A 269     155.351 129.179 137.670  1.00 55.07           N  
ATOM   2118  CZ  ARG A 269     156.503 129.799 137.431  1.00 55.07           C  
ATOM   2119  NH1 ARG A 269     156.514 130.973 136.815  1.00 55.07           N  
ATOM   2120  NH2 ARG A 269     157.646 129.246 137.810  1.00 55.07           N  
ATOM   2121  N   GLU A 270     151.814 131.717 141.602  1.00 57.67           N  
ATOM   2122  CA  GLU A 270     150.491 132.292 141.823  1.00 57.67           C  
ATOM   2123  C   GLU A 270     150.572 133.684 142.436  1.00 57.67           C  
ATOM   2124  O   GLU A 270     149.745 134.547 142.123  1.00 57.67           O  
ATOM   2125  CB  GLU A 270     149.659 131.376 142.718  1.00 57.67           C  
ATOM   2126  CG  GLU A 270     149.238 130.076 142.063  1.00 57.67           C  
ATOM   2127  CD  GLU A 270     148.171 130.277 141.008  1.00 57.67           C  
ATOM   2128  OE1 GLU A 270     147.523 131.344 141.012  1.00 57.67           O  
ATOM   2129  OE2 GLU A 270     147.980 129.367 140.175  1.00 57.67           O  
ATOM   2130  N   THR A 271     151.553 133.924 143.307  1.00 55.11           N  
ATOM   2131  CA  THR A 271     151.606 135.195 144.025  1.00 55.11           C  
ATOM   2132  C   THR A 271     152.204 136.310 143.174  1.00 55.11           C  
ATOM   2133  O   THR A 271     151.638 137.405 143.094  1.00 55.11           O  
ATOM   2134  CB  THR A 271     152.405 135.038 145.317  1.00 55.11           C  
ATOM   2135  OG1 THR A 271     153.701 134.508 145.013  1.00 55.11           O  
ATOM   2136  CG2 THR A 271     151.690 134.103 146.269  1.00 55.11           C  
ATOM   2137  N   LEU A 272     153.348 136.055 142.544  1.00 55.13           N  
ATOM   2138  CA  LEU A 272     154.055 137.098 141.817  1.00 55.13           C  
ATOM   2139  C   LEU A 272     153.213 137.616 140.652  1.00 55.13           C  
ATOM   2140  O   LEU A 272     152.366 136.895 140.119  1.00 55.13           O  
ATOM   2141  CB  LEU A 272     155.386 136.574 141.291  1.00 55.13           C  
ATOM   2142  CG  LEU A 272     156.422 136.181 142.341  1.00 55.13           C  
ATOM   2143  CD1 LEU A 272     157.704 135.726 141.671  1.00 55.13           C  
ATOM   2144  CD2 LEU A 272     156.686 137.337 143.284  1.00 55.13           C  
ATOM   2145  N   PRO A 273     153.424 138.868 140.242  1.00 57.50           N  
ATOM   2146  CA  PRO A 273     152.683 139.410 139.093  1.00 57.50           C  
ATOM   2147  C   PRO A 273     153.066 138.676 137.817  1.00 57.50           C  
ATOM   2148  O   PRO A 273     154.240 138.621 137.446  1.00 57.50           O  
ATOM   2149  CB  PRO A 273     153.114 140.880 139.056  1.00 57.50           C  
ATOM   2150  CG  PRO A 273     154.430 140.901 139.750  1.00 57.50           C  
ATOM   2151  CD  PRO A 273     154.334 139.866 140.826  1.00 57.50           C  
ATOM   2152  N   LYS A 274     152.063 138.115 137.148  1.00 67.57           N  
ATOM   2153  CA  LYS A 274     152.304 137.250 136.002  1.00 67.57           C  
ATOM   2154  C   LYS A 274     152.940 138.029 134.860  1.00 67.57           C  
ATOM   2155  O   LYS A 274     152.384 139.024 134.387  1.00 67.57           O  
ATOM   2156  CB  LYS A 274     150.992 136.613 135.552  1.00 67.57           C  
ATOM   2157  CG  LYS A 274     151.153 135.544 134.489  1.00 67.57           C  
ATOM   2158  CD  LYS A 274     149.816 134.906 134.149  1.00 67.57           C  
ATOM   2159  CE  LYS A 274     149.967 133.831 133.086  1.00 67.57           C  
ATOM   2160  NZ  LYS A 274     148.652 133.242 132.708  1.00 67.57           N  
ATOM   2161  N   ILE A 275     154.109 137.575 134.423  1.00 55.31           N  
ATOM   2162  CA  ILE A 275     154.830 138.186 133.310  1.00 55.31           C  
ATOM   2163  C   ILE A 275     155.429 137.072 132.462  1.00 55.31           C  
ATOM   2164  O   ILE A 275     156.313 136.340 132.929  1.00 55.31           O  
ATOM   2165  CB  ILE A 275     155.903 139.160 133.814  1.00 55.31           C  
ATOM   2166  CG1 ILE A 275     156.517 138.635 135.111  1.00 55.31           C  
ATOM   2167  CG2 ILE A 275     155.305 140.533 134.032  1.00 55.31           C  
ATOM   2168  CD1 ILE A 275     157.443 139.610 135.784  1.00 55.31           C  
ATOM   2169  N   PRO A 276     154.996 136.911 131.233  1.00 51.80           N  
ATOM   2170  CA  PRO A 276     155.313 135.714 130.445  1.00 51.80           C  
ATOM   2171  C   PRO A 276     156.652 135.754 129.709  1.00 51.80           C  
ATOM   2172  O   PRO A 276     156.719 135.559 128.496  1.00 51.80           O  
ATOM   2173  CB  PRO A 276     154.143 135.647 129.461  1.00 51.80           C  
ATOM   2174  CG  PRO A 276     153.793 137.072 129.238  1.00 51.80           C  
ATOM   2175  CD  PRO A 276     154.023 137.778 130.550  1.00 51.80           C  
ATOM   2176  N   TYR A 277     157.730 135.997 130.452  1.00 52.68           N  
ATOM   2177  CA  TYR A 277     159.070 135.841 129.903  1.00 52.68           C  
ATOM   2178  C   TYR A 277     160.061 135.679 131.046  1.00 52.68           C  
ATOM   2179  O   TYR A 277     159.753 135.962 132.205  1.00 52.68           O  
ATOM   2180  CB  TYR A 277     159.463 137.008 128.988  1.00 52.68           C  
ATOM   2181  CG  TYR A 277     159.498 138.362 129.646  1.00 52.68           C  
ATOM   2182  CD1 TYR A 277     158.329 139.040 129.945  1.00 52.68           C  
ATOM   2183  CD2 TYR A 277     160.703 138.978 129.938  1.00 52.68           C  
ATOM   2184  CE1 TYR A 277     158.359 140.282 130.535  1.00 52.68           C  
ATOM   2185  CE2 TYR A 277     160.742 140.219 130.525  1.00 52.68           C  
ATOM   2186  CZ  TYR A 277     159.568 140.867 130.821  1.00 52.68           C  
ATOM   2187  OH  TYR A 277     159.605 142.107 131.410  1.00 52.68           O  
ATOM   2188  N   VAL A 278     161.261 135.208 130.696  1.00 51.88           N  
ATOM   2189  CA  VAL A 278     162.221 134.759 131.699  1.00 51.88           C  
ATOM   2190  C   VAL A 278     162.601 135.904 132.623  1.00 51.88           C  
ATOM   2191  O   VAL A 278     162.827 137.037 132.181  1.00 51.88           O  
ATOM   2192  CB  VAL A 278     163.462 134.168 131.017  1.00 51.88           C  
ATOM   2193  CG1 VAL A 278     164.428 133.631 132.053  1.00 51.88           C  
ATOM   2194  CG2 VAL A 278     163.058 133.078 130.045  1.00 51.88           C  
ATOM   2195  N   LYS A 279     162.669 135.611 133.918  1.00 51.99           N  
ATOM   2196  CA  LYS A 279     163.129 136.549 134.928  1.00 51.99           C  
ATOM   2197  C   LYS A 279     164.102 135.838 135.861  1.00 51.99           C  
ATOM   2198  O   LYS A 279     164.299 134.623 135.782  1.00 51.99           O  
ATOM   2199  CB  LYS A 279     161.953 137.153 135.705  1.00 51.99           C  
ATOM   2200  CG  LYS A 279     160.819 136.188 135.971  1.00 51.99           C  
ATOM   2201  CD  LYS A 279     159.653 136.894 136.637  1.00 51.99           C  
ATOM   2202  CE  LYS A 279     158.533 135.922 136.951  1.00 51.99           C  
ATOM   2203  NZ  LYS A 279     158.043 135.227 135.732  1.00 51.99           N  
ATOM   2204  N   ALA A 280     164.716 136.615 136.754  1.00 53.20           N  
ATOM   2205  CA  ALA A 280     165.817 136.097 137.561  1.00 53.20           C  
ATOM   2206  C   ALA A 280     165.344 135.080 138.592  1.00 53.20           C  
ATOM   2207  O   ALA A 280     165.967 134.021 138.764  1.00 53.20           O  
ATOM   2208  CB  ALA A 280     166.531 137.253 138.252  1.00 53.20           C  
ATOM   2209  N   ILE A 281     164.261 135.391 139.304  1.00 53.55           N  
ATOM   2210  CA  ILE A 281     163.825 134.524 140.391  1.00 53.55           C  
ATOM   2211  C   ILE A 281     163.478 133.137 139.866  1.00 53.55           C  
ATOM   2212  O   ILE A 281     163.665 132.134 140.567  1.00 53.55           O  
ATOM   2213  CB  ILE A 281     162.651 135.173 141.147  1.00 53.55           C  
ATOM   2214  CG1 ILE A 281     162.348 134.404 142.429  1.00 53.55           C  
ATOM   2215  CG2 ILE A 281     161.419 135.256 140.269  1.00 53.55           C  
ATOM   2216  CD1 ILE A 281     161.315 135.071 143.294  1.00 53.55           C  
ATOM   2217  N   ASP A 282     163.005 133.049 138.621  1.00 60.70           N  
ATOM   2218  CA  ASP A 282     162.777 131.742 138.018  1.00 60.70           C  
ATOM   2219  C   ASP A 282     164.085 130.984 137.846  1.00 60.70           C  
ATOM   2220  O   ASP A 282     164.144 129.777 138.104  1.00 60.70           O  
ATOM   2221  CB  ASP A 282     162.064 131.891 136.677  1.00 60.70           C  
ATOM   2222  CG  ASP A 282     160.601 132.243 136.834  1.00 60.70           C  
ATOM   2223  OD1 ASP A 282     160.004 131.860 137.862  1.00 60.70           O  
ATOM   2224  OD2 ASP A 282     160.046 132.900 135.930  1.00 60.70           O  
ATOM   2225  N   MET A 283     165.143 131.673 137.416  1.00 58.66           N  
ATOM   2226  CA  MET A 283     166.449 131.030 137.312  1.00 58.66           C  
ATOM   2227  C   MET A 283     166.895 130.487 138.662  1.00 58.66           C  
ATOM   2228  O   MET A 283     167.381 129.354 138.761  1.00 58.66           O  
ATOM   2229  CB  MET A 283     167.479 132.017 136.765  1.00 58.66           C  
ATOM   2230  CG  MET A 283     167.277 132.396 135.310  1.00 58.66           C  
ATOM   2231  SD  MET A 283     167.494 130.990 134.205  1.00 58.66           S  
ATOM   2232  CE  MET A 283     167.563 131.815 132.618  1.00 58.66           C  
ATOM   2233  N   TYR A 284     166.722 131.280 139.719  1.00 56.44           N  
ATOM   2234  CA  TYR A 284     167.171 130.846 141.040  1.00 56.44           C  
ATOM   2235  C   TYR A 284     166.383 129.632 141.525  1.00 56.44           C  
ATOM   2236  O   TYR A 284     166.962 128.656 142.031  1.00 56.44           O  
ATOM   2237  CB  TYR A 284     167.049 131.999 142.031  1.00 56.44           C  
ATOM   2238  CG  TYR A 284     167.806 131.791 143.316  1.00 56.44           C  
ATOM   2239  CD1 TYR A 284     169.184 131.924 143.358  1.00 56.44           C  
ATOM   2240  CD2 TYR A 284     167.142 131.478 144.490  1.00 56.44           C  
ATOM   2241  CE1 TYR A 284     169.879 131.741 144.530  1.00 56.44           C  
ATOM   2242  CE2 TYR A 284     167.829 131.295 145.668  1.00 56.44           C  
ATOM   2243  CZ  TYR A 284     169.196 131.428 145.683  1.00 56.44           C  
ATOM   2244  OH  TYR A 284     169.886 131.244 146.857  1.00 56.44           O  
ATOM   2245  N   LEU A 285     165.056 129.678 141.388  1.00 52.40           N  
ATOM   2246  CA  LEU A 285     164.241 128.550 141.821  1.00 52.40           C  
ATOM   2247  C   LEU A 285     164.566 127.301 141.016  1.00 52.40           C  
ATOM   2248  O   LEU A 285     164.612 126.195 141.566  1.00 52.40           O  
ATOM   2249  CB  LEU A 285     162.759 128.894 141.706  1.00 52.40           C  
ATOM   2250  CG  LEU A 285     162.311 130.101 142.527  1.00 52.40           C  
ATOM   2251  CD1 LEU A 285     160.810 130.298 142.415  1.00 52.40           C  
ATOM   2252  CD2 LEU A 285     162.733 129.953 143.975  1.00 52.40           C  
ATOM   2253  N   MET A 286     164.805 127.458 139.711  1.00 54.31           N  
ATOM   2254  CA  MET A 286     165.177 126.313 138.891  1.00 54.31           C  
ATOM   2255  C   MET A 286     166.512 125.736 139.337  1.00 54.31           C  
ATOM   2256  O   MET A 286     166.692 124.514 139.358  1.00 54.31           O  
ATOM   2257  CB  MET A 286     165.228 126.718 137.419  1.00 54.31           C  
ATOM   2258  CG  MET A 286     165.305 125.545 136.467  1.00 54.31           C  
ATOM   2259  SD  MET A 286     163.832 124.513 136.545  1.00 54.31           S  
ATOM   2260  CE  MET A 286     164.306 123.174 135.456  1.00 54.31           C  
ATOM   2261  N   GLY A 287     167.456 126.599 139.714  1.00 54.12           N  
ATOM   2262  CA  GLY A 287     168.728 126.105 140.216  1.00 54.12           C  
ATOM   2263  C   GLY A 287     168.567 125.269 141.471  1.00 54.12           C  
ATOM   2264  O   GLY A 287     169.123 124.171 141.581  1.00 54.12           O  
ATOM   2265  N   CYS A 288     167.796 125.775 142.436  1.00 53.60           N  
ATOM   2266  CA  CYS A 288     167.591 125.017 143.670  1.00 53.60           C  
ATOM   2267  C   CYS A 288     166.861 123.703 143.401  1.00 53.60           C  
ATOM   2268  O   CYS A 288     167.184 122.658 143.994  1.00 53.60           O  
ATOM   2269  CB  CYS A 288     166.830 125.864 144.687  1.00 53.60           C  
ATOM   2270  SG  CYS A 288     167.810 127.200 145.405  1.00 53.60           S  
ATOM   2271  N   PHE A 289     165.868 123.738 142.511  1.00 50.13           N  
ATOM   2272  CA  PHE A 289     165.161 122.521 142.135  1.00 50.13           C  
ATOM   2273  C   PHE A 289     166.122 121.499 141.546  1.00 50.13           C  
ATOM   2274  O   PHE A 289     166.064 120.309 141.883  1.00 50.13           O  
ATOM   2275  CB  PHE A 289     164.053 122.864 141.142  1.00 50.13           C  
ATOM   2276  CG  PHE A 289     163.205 121.697 140.745  1.00 50.13           C  
ATOM   2277  CD1 PHE A 289     162.115 121.335 141.509  1.00 50.13           C  
ATOM   2278  CD2 PHE A 289     163.487 120.970 139.602  1.00 50.13           C  
ATOM   2279  CE1 PHE A 289     161.326 120.266 141.149  1.00 50.13           C  
ATOM   2280  CE2 PHE A 289     162.698 119.898 139.238  1.00 50.13           C  
ATOM   2281  CZ  PHE A 289     161.617 119.547 140.014  1.00 50.13           C  
ATOM   2282  N   VAL A 290     167.029 121.951 140.679  1.00 54.28           N  
ATOM   2283  CA  VAL A 290     168.004 121.043 140.086  1.00 54.28           C  
ATOM   2284  C   VAL A 290     168.927 120.480 141.155  1.00 54.28           C  
ATOM   2285  O   VAL A 290     169.319 119.310 141.099  1.00 54.28           O  
ATOM   2286  CB  VAL A 290     168.787 121.756 138.970  1.00 54.28           C  
ATOM   2287  CG1 VAL A 290     170.010 120.950 138.576  1.00 54.28           C  
ATOM   2288  CG2 VAL A 290     167.891 121.968 137.765  1.00 54.28           C  
ATOM   2289  N   PHE A 291     169.272 121.291 142.156  1.00 58.66           N  
ATOM   2290  CA  PHE A 291     170.149 120.806 143.221  1.00 58.66           C  
ATOM   2291  C   PHE A 291     169.505 119.665 144.001  1.00 58.66           C  
ATOM   2292  O   PHE A 291     170.132 118.621 144.232  1.00 58.66           O  
ATOM   2293  CB  PHE A 291     170.521 121.946 144.164  1.00 58.66           C  
ATOM   2294  CG  PHE A 291     171.864 122.536 143.889  1.00 58.66           C  
ATOM   2295  CD1 PHE A 291     172.579 122.161 142.766  1.00 58.66           C  
ATOM   2296  CD2 PHE A 291     172.422 123.452 144.757  1.00 58.66           C  
ATOM   2297  CE1 PHE A 291     173.819 122.701 142.510  1.00 58.66           C  
ATOM   2298  CE2 PHE A 291     173.662 123.993 144.506  1.00 58.66           C  
ATOM   2299  CZ  PHE A 291     174.361 123.618 143.383  1.00 58.66           C  
ATOM   2300  N   VAL A 292     168.257 119.848 144.433  1.00 56.13           N  
ATOM   2301  CA  VAL A 292     167.623 118.780 145.206  1.00 56.13           C  
ATOM   2302  C   VAL A 292     167.394 117.551 144.330  1.00 56.13           C  
ATOM   2303  O   VAL A 292     167.534 116.404 144.786  1.00 56.13           O  
ATOM   2304  CB  VAL A 292     166.324 119.268 145.870  1.00 56.13           C  
ATOM   2305  CG1 VAL A 292     166.642 120.274 146.962  1.00 56.13           C  
ATOM   2306  CG2 VAL A 292     165.383 119.869 144.855  1.00 56.13           C  
ATOM   2307  N   PHE A 293     167.065 117.768 143.054  1.00 58.86           N  
ATOM   2308  CA  PHE A 293     166.921 116.652 142.126  1.00 58.86           C  
ATOM   2309  C   PHE A 293     168.222 115.869 141.997  1.00 58.86           C  
ATOM   2310  O   PHE A 293     168.214 114.633 141.965  1.00 58.86           O  
ATOM   2311  CB  PHE A 293     166.457 117.180 140.772  1.00 58.86           C  
ATOM   2312  CG  PHE A 293     166.629 116.213 139.642  1.00 58.86           C  
ATOM   2313  CD1 PHE A 293     165.709 115.205 139.434  1.00 58.86           C  
ATOM   2314  CD2 PHE A 293     167.697 116.329 138.768  1.00 58.86           C  
ATOM   2315  CE1 PHE A 293     165.857 114.320 138.389  1.00 58.86           C  
ATOM   2316  CE2 PHE A 293     167.850 115.447 137.721  1.00 58.86           C  
ATOM   2317  CZ  PHE A 293     166.928 114.442 137.532  1.00 58.86           C  
ATOM   2318  N   MET A 294     169.356 116.571 141.937  1.00 64.38           N  
ATOM   2319  CA  MET A 294     170.638 115.889 141.798  1.00 64.38           C  
ATOM   2320  C   MET A 294     171.004 115.144 143.072  1.00 64.38           C  
ATOM   2321  O   MET A 294     171.625 114.078 143.018  1.00 64.38           O  
ATOM   2322  CB  MET A 294     171.732 116.888 141.425  1.00 64.38           C  
ATOM   2323  CG  MET A 294     171.627 117.416 140.006  1.00 64.38           C  
ATOM   2324  SD  MET A 294     171.583 116.100 138.780  1.00 64.38           S  
ATOM   2325  CE  MET A 294     173.138 115.286 139.125  1.00 64.38           C  
ATOM   2326  N   ALA A 295     170.641 115.698 144.230  1.00 58.07           N  
ATOM   2327  CA  ALA A 295     170.830 114.966 145.479  1.00 58.07           C  
ATOM   2328  C   ALA A 295     170.070 113.644 145.452  1.00 58.07           C  
ATOM   2329  O   ALA A 295     170.620 112.580 145.781  1.00 58.07           O  
ATOM   2330  CB  ALA A 295     170.382 115.823 146.662  1.00 58.07           C  
ATOM   2331  N   LEU A 296     168.799 113.694 145.051  1.00 61.07           N  
ATOM   2332  CA  LEU A 296     168.021 112.464 144.951  1.00 61.07           C  
ATOM   2333  C   LEU A 296     168.652 111.492 143.962  1.00 61.07           C  
ATOM   2334  O   LEU A 296     168.712 110.283 144.218  1.00 61.07           O  
ATOM   2335  CB  LEU A 296     166.582 112.777 144.547  1.00 61.07           C  
ATOM   2336  CG  LEU A 296     165.644 111.572 144.578  1.00 61.07           C  
ATOM   2337  CD1 LEU A 296     165.576 111.012 145.985  1.00 61.07           C  
ATOM   2338  CD2 LEU A 296     164.258 111.942 144.079  1.00 61.07           C  
ATOM   2339  N   LEU A 297     169.138 112.004 142.829  1.00 63.46           N  
ATOM   2340  CA  LEU A 297     169.741 111.139 141.821  1.00 63.46           C  
ATOM   2341  C   LEU A 297     170.991 110.449 142.352  1.00 63.46           C  
ATOM   2342  O   LEU A 297     171.193 109.247 142.134  1.00 63.46           O  
ATOM   2343  CB  LEU A 297     170.074 111.942 140.566  1.00 63.46           C  
ATOM   2344  CG  LEU A 297     169.048 111.837 139.441  1.00 63.46           C  
ATOM   2345  CD1 LEU A 297     169.640 112.332 138.132  1.00 63.46           C  
ATOM   2346  CD2 LEU A 297     168.565 110.404 139.311  1.00 63.46           C  
ATOM   2347  N   GLU A 298     171.858 111.202 143.032  1.00 69.42           N  
ATOM   2348  CA  GLU A 298     173.090 110.606 143.535  1.00 69.42           C  
ATOM   2349  C   GLU A 298     172.791 109.563 144.601  1.00 69.42           C  
ATOM   2350  O   GLU A 298     173.446 108.514 144.649  1.00 69.42           O  
ATOM   2351  CB  GLU A 298     174.039 111.688 144.062  1.00 69.42           C  
ATOM   2352  CG  GLU A 298     173.668 112.312 145.400  1.00 69.42           C  
ATOM   2353  CD  GLU A 298     174.245 111.561 146.585  1.00 69.42           C  
ATOM   2354  OE1 GLU A 298     175.472 111.337 146.608  1.00 69.42           O  
ATOM   2355  OE2 GLU A 298     173.469 111.188 147.489  1.00 69.42           O  
ATOM   2356  N   TYR A 299     171.785 109.807 145.447  1.00 70.34           N  
ATOM   2357  CA  TYR A 299     171.453 108.770 146.417  1.00 70.34           C  
ATOM   2358  C   TYR A 299     170.862 107.539 145.741  1.00 70.34           C  
ATOM   2359  O   TYR A 299     171.128 106.413 146.174  1.00 70.34           O  
ATOM   2360  CB  TYR A 299     170.493 109.288 147.482  1.00 70.34           C  
ATOM   2361  CG  TYR A 299     170.078 108.188 148.428  1.00 70.34           C  
ATOM   2362  CD1 TYR A 299     171.032 107.406 149.066  1.00 70.34           C  
ATOM   2363  CD2 TYR A 299     168.741 107.918 148.671  1.00 70.34           C  
ATOM   2364  CE1 TYR A 299     170.667 106.390 149.919  1.00 70.34           C  
ATOM   2365  CE2 TYR A 299     168.365 106.906 149.529  1.00 70.34           C  
ATOM   2366  CZ  TYR A 299     169.333 106.146 150.150  1.00 70.34           C  
ATOM   2367  OH  TYR A 299     168.970 105.136 151.006  1.00 70.34           O  
ATOM   2368  N   ALA A 300     170.063 107.724 144.689  1.00 69.95           N  
ATOM   2369  CA  ALA A 300     169.541 106.573 143.960  1.00 69.95           C  
ATOM   2370  C   ALA A 300     170.674 105.745 143.369  1.00 69.95           C  
ATOM   2371  O   ALA A 300     170.666 104.509 143.442  1.00 69.95           O  
ATOM   2372  CB  ALA A 300     168.582 107.036 142.865  1.00 69.95           C  
ATOM   2373  N   LEU A 301     171.668 106.414 142.784  1.00 71.66           N  
ATOM   2374  CA  LEU A 301     172.802 105.691 142.215  1.00 71.66           C  
ATOM   2375  C   LEU A 301     173.596 104.967 143.297  1.00 71.66           C  
ATOM   2376  O   LEU A 301     174.042 103.829 143.094  1.00 71.66           O  
ATOM   2377  CB  LEU A 301     173.699 106.651 141.437  1.00 71.66           C  
ATOM   2378  CG  LEU A 301     174.859 106.013 140.677  1.00 71.66           C  
ATOM   2379  CD1 LEU A 301     174.346 104.961 139.709  1.00 71.66           C  
ATOM   2380  CD2 LEU A 301     175.647 107.081 139.942  1.00 71.66           C  
ATOM   2381  N   VAL A 302     173.786 105.613 144.451  1.00 74.53           N  
ATOM   2382  CA  VAL A 302     174.448 104.954 145.574  1.00 74.53           C  
ATOM   2383  C   VAL A 302     173.695 103.688 145.959  1.00 74.53           C  
ATOM   2384  O   VAL A 302     174.284 102.610 146.100  1.00 74.53           O  
ATOM   2385  CB  VAL A 302     174.571 105.917 146.767  1.00 74.53           C  
ATOM   2386  CG1 VAL A 302     174.834 105.143 148.048  1.00 74.53           C  
ATOM   2387  CG2 VAL A 302     175.677 106.923 146.521  1.00 74.53           C  
ATOM   2388  N   ASN A 303     172.376 103.803 146.122  1.00 75.17           N  
ATOM   2389  CA  ASN A 303     171.565 102.651 146.497  1.00 75.17           C  
ATOM   2390  C   ASN A 303     171.637 101.550 145.448  1.00 75.17           C  
ATOM   2391  O   ASN A 303     171.518 100.366 145.782  1.00 75.17           O  
ATOM   2392  CB  ASN A 303     170.118 103.087 146.719  1.00 75.17           C  
ATOM   2393  CG  ASN A 303     169.331 102.094 147.543  1.00 75.17           C  
ATOM   2394  OD1 ASN A 303     169.041 102.339 148.715  1.00 75.17           O  
ATOM   2395  ND2 ASN A 303     168.971 100.972 146.932  1.00 75.17           N  
ATOM   2396  N   TYR A 304     171.817 101.917 144.178  1.00 78.00           N  
ATOM   2397  CA  TYR A 304     171.948 100.901 143.138  1.00 78.00           C  
ATOM   2398  C   TYR A 304     173.279 100.169 143.243  1.00 78.00           C  
ATOM   2399  O   TYR A 304     173.323  98.935 143.209  1.00 78.00           O  
ATOM   2400  CB  TYR A 304     171.795 101.527 141.753  1.00 78.00           C  
ATOM   2401  CG  TYR A 304     172.037 100.548 140.624  1.00 78.00           C  
ATOM   2402  CD1 TYR A 304     171.118  99.548 140.340  1.00 78.00           C  
ATOM   2403  CD2 TYR A 304     173.183 100.624 139.843  1.00 78.00           C  
ATOM   2404  CE1 TYR A 304     171.332  98.650 139.311  1.00 78.00           C  
ATOM   2405  CE2 TYR A 304     173.405  99.731 138.811  1.00 78.00           C  
ATOM   2406  CZ  TYR A 304     172.476  98.746 138.549  1.00 78.00           C  
ATOM   2407  OH  TYR A 304     172.690  97.853 137.523  1.00 78.00           O  
ATOM   2408  N   ILE A 305     174.378 100.911 143.369  1.00 80.06           N  
ATOM   2409  CA  ILE A 305     175.701 100.293 143.327  1.00 80.06           C  
ATOM   2410  C   ILE A 305     176.150  99.902 144.727  1.00 80.06           C  
ATOM   2411  O   ILE A 305     177.328  99.597 144.948  1.00 80.06           O  
ATOM   2412  CB  ILE A 305     176.738 101.223 142.670  1.00 80.06           C  
ATOM   2413  CG1 ILE A 305     176.966 102.463 143.534  1.00 80.06           C  
ATOM   2414  CG2 ILE A 305     176.296 101.608 141.269  1.00 80.06           C  
ATOM   2415  CD1 ILE A 305     178.077 103.356 143.031  1.00 80.06           C  
ATOM   2416  N   PHE A 306     175.220  99.900 145.681  1.00 84.49           N  
ATOM   2417  CA  PHE A 306     175.597  99.626 147.063  1.00 84.49           C  
ATOM   2418  C   PHE A 306     175.907  98.151 147.283  1.00 84.49           C  
ATOM   2419  O   PHE A 306     176.867  97.812 147.985  1.00 84.49           O  
ATOM   2420  CB  PHE A 306     174.490 100.079 148.012  1.00 84.49           C  
ATOM   2421  CG  PHE A 306     174.706  99.651 149.431  1.00 84.49           C  
ATOM   2422  CD1 PHE A 306     175.818 100.080 150.133  1.00 84.49           C  
ATOM   2423  CD2 PHE A 306     173.798  98.820 150.064  1.00 84.49           C  
ATOM   2424  CE1 PHE A 306     176.025  99.685 151.437  1.00 84.49           C  
ATOM   2425  CE2 PHE A 306     173.997  98.425 151.372  1.00 84.49           C  
ATOM   2426  CZ  PHE A 306     175.113  98.859 152.059  1.00 84.49           C  
ATOM   2427  N   PHE A 307     175.106  97.259 146.696  1.00 85.70           N  
ATOM   2428  CA  PHE A 307     175.220  95.840 147.016  1.00 85.70           C  
ATOM   2429  C   PHE A 307     176.568  95.263 146.603  1.00 85.70           C  
ATOM   2430  O   PHE A 307     177.064  94.334 147.250  1.00 85.70           O  
ATOM   2431  CB  PHE A 307     174.087  95.063 146.349  1.00 85.70           C  
ATOM   2432  CG  PHE A 307     173.962  93.648 146.828  1.00 85.70           C  
ATOM   2433  CD1 PHE A 307     173.301  93.361 148.012  1.00 85.70           C  
ATOM   2434  CD2 PHE A 307     174.501  92.602 146.096  1.00 85.70           C  
ATOM   2435  CE1 PHE A 307     173.181  92.059 148.458  1.00 85.70           C  
ATOM   2436  CE2 PHE A 307     174.384  91.298 146.536  1.00 85.70           C  
ATOM   2437  CZ  PHE A 307     173.724  91.026 147.718  1.00 85.70           C  
ATOM   2438  N   SER A 308     177.172  95.793 145.540  1.00 84.37           N  
ATOM   2439  CA  SER A 308     178.438  95.246 145.064  1.00 84.37           C  
ATOM   2440  C   SER A 308     179.595  95.666 145.963  1.00 84.37           C  
ATOM   2441  O   SER A 308     180.380  94.825 146.416  1.00 84.37           O  
ATOM   2442  CB  SER A 308     178.692  95.685 143.623  1.00 84.37           C  
ATOM   2443  OG  SER A 308     178.880  97.087 143.546  1.00 84.37           O  
ATOM   2444  N   GLN A 309     179.718  96.967 146.233  1.00 86.06           N  
ATOM   2445  CA  GLN A 309     180.850  97.491 146.978  1.00 86.06           C  
ATOM   2446  C   GLN A 309     180.395  98.590 147.932  1.00 86.06           C  
ATOM   2447  O   GLN A 309     179.905  99.640 147.479  1.00 86.06           O  
ATOM   2448  CB  GLN A 309     181.916  98.021 146.014  1.00 86.06           C  
ATOM   2449  CG  GLN A 309     181.353  98.793 144.828  1.00 86.06           C  
ATOM   2450  CD  GLN A 309     182.396  99.080 143.769  1.00 86.06           C  
ATOM   2451  OE1 GLN A 309     183.462  98.467 143.750  1.00 86.06           O  
ATOM   2452  NE2 GLN A 309     182.095 100.017 142.880  1.00 86.06           N  
ATOM   2453  N   PRO A 310     180.539  98.392 149.243  1.00 85.78           N  
ATOM   2454  CA  PRO A 310     180.125  99.430 150.197  1.00 85.78           C  
ATOM   2455  C   PRO A 310     181.122 100.575 150.302  1.00 85.78           C  
ATOM   2456  O   PRO A 310     180.745 101.716 150.606  1.00 85.78           O  
ATOM   2457  CB  PRO A 310     180.020  98.659 151.519  1.00 85.78           C  
ATOM   2458  CG  PRO A 310     180.985  97.530 151.363  1.00 85.78           C  
ATOM   2459  CD  PRO A 310     180.932  97.141 149.913  1.00 85.78           C  
ATOM   2460  N   ALA A 311     182.403 100.276 150.064  1.00 76.81           N  
ATOM   2461  CA  ALA A 311     183.430 101.308 150.158  1.00 76.81           C  
ATOM   2462  C   ALA A 311     183.182 102.427 149.159  1.00 76.81           C  
ATOM   2463  O   ALA A 311     183.385 103.606 149.480  1.00 76.81           O  
ATOM   2464  CB  ALA A 311     184.810 100.696 149.943  1.00 76.81           C  
ATOM   2465  N   ARG A 312     182.741 102.078 147.949  1.00 85.70           N  
ATOM   2466  CA  ARG A 312     182.363 103.093 146.973  1.00 85.70           C  
ATOM   2467  C   ARG A 312     181.243 103.975 147.507  1.00 85.70           C  
ATOM   2468  O   ARG A 312     181.247 105.192 147.293  1.00 85.70           O  
ATOM   2469  CB  ARG A 312     181.943 102.428 145.663  1.00 85.70           C  
ATOM   2470  CG  ARG A 312     181.775 103.393 144.506  1.00 85.70           C  
ATOM   2471  CD  ARG A 312     183.115 103.966 144.092  1.00 85.70           C  
ATOM   2472  NE  ARG A 312     184.093 102.912 143.840  1.00 85.70           N  
ATOM   2473  CZ  ARG A 312     185.348 103.133 143.465  1.00 85.70           C  
ATOM   2474  NH1 ARG A 312     185.782 104.374 143.294  1.00 85.70           N  
ATOM   2475  NH2 ARG A 312     186.169 102.114 143.260  1.00 85.70           N  
ATOM   2476  N   ALA A 313     180.283 103.380 148.219  1.00 79.95           N  
ATOM   2477  CA  ALA A 313     179.178 104.162 148.763  1.00 79.95           C  
ATOM   2478  C   ALA A 313     179.666 105.145 149.817  1.00 79.95           C  
ATOM   2479  O   ALA A 313     179.284 106.323 149.799  1.00 79.95           O  
ATOM   2480  CB  ALA A 313     178.115 103.236 149.350  1.00 79.95           C  
ATOM   2481  N   ALA A 314     180.506 104.681 150.746  1.00 77.16           N  
ATOM   2482  CA  ALA A 314     181.037 105.583 151.765  1.00 77.16           C  
ATOM   2483  C   ALA A 314     181.877 106.692 151.144  1.00 77.16           C  
ATOM   2484  O   ALA A 314     181.813 107.850 151.586  1.00 77.16           O  
ATOM   2485  CB  ALA A 314     181.863 104.799 152.783  1.00 77.16           C  
ATOM   2486  N   ALA A 315     182.643 106.368 150.101  1.00 80.72           N  
ATOM   2487  CA  ALA A 315     183.453 107.383 149.437  1.00 80.72           C  
ATOM   2488  C   ALA A 315     182.576 108.418 148.747  1.00 80.72           C  
ATOM   2489  O   ALA A 315     182.843 109.623 148.825  1.00 80.72           O  
ATOM   2490  CB  ALA A 315     184.404 106.725 148.438  1.00 80.72           C  
ATOM   2491  N   ILE A 316     181.520 107.969 148.065  1.00 84.24           N  
ATOM   2492  CA  ILE A 316     180.631 108.906 147.387  1.00 84.24           C  
ATOM   2493  C   ILE A 316     179.910 109.785 148.399  1.00 84.24           C  
ATOM   2494  O   ILE A 316     179.706 110.981 148.168  1.00 84.24           O  
ATOM   2495  CB  ILE A 316     179.644 108.152 146.477  1.00 84.24           C  
ATOM   2496  CG1 ILE A 316     180.378 107.587 145.262  1.00 84.24           C  
ATOM   2497  CG2 ILE A 316     178.523 109.068 146.026  1.00 84.24           C  
ATOM   2498  CD1 ILE A 316     179.460 107.041 144.194  1.00 84.24           C  
ATOM   2499  N   ASP A 317     179.527 109.215 149.543  1.00 86.80           N  
ATOM   2500  CA  ASP A 317     178.890 110.025 150.575  1.00 86.80           C  
ATOM   2501  C   ASP A 317     179.836 111.103 151.086  1.00 86.80           C  
ATOM   2502  O   ASP A 317     179.437 112.263 151.253  1.00 86.80           O  
ATOM   2503  CB  ASP A 317     178.405 109.140 151.720  1.00 86.80           C  
ATOM   2504  CG  ASP A 317     176.974 108.686 151.532  1.00 86.80           C  
ATOM   2505  OD1 ASP A 317     176.223 109.382 150.819  1.00 86.80           O  
ATOM   2506  OD2 ASP A 317     176.596 107.640 152.097  1.00 86.80           O  
ATOM   2507  N   ARG A 318     181.097 110.741 151.334  1.00 91.63           N  
ATOM   2508  CA  ARG A 318     182.062 111.736 151.790  1.00 91.63           C  
ATOM   2509  C   ARG A 318     182.277 112.821 150.740  1.00 91.63           C  
ATOM   2510  O   ARG A 318     182.326 114.017 151.070  1.00 91.63           O  
ATOM   2511  CB  ARG A 318     183.385 111.060 152.136  1.00 91.63           C  
ATOM   2512  CG  ARG A 318     184.387 111.984 152.795  1.00 91.63           C  
ATOM   2513  CD  ARG A 318     183.862 112.478 154.130  1.00 91.63           C  
ATOM   2514  NE  ARG A 318     184.876 113.217 154.875  1.00 91.63           N  
ATOM   2515  CZ  ARG A 318     184.678 113.756 156.073  1.00 91.63           C  
ATOM   2516  NH1 ARG A 318     183.498 113.641 156.667  1.00 91.63           N  
ATOM   2517  NH2 ARG A 318     185.659 114.412 156.679  1.00 91.63           N  
ATOM   2518  N   TRP A 319     182.404 112.421 149.471  1.00 95.26           N  
ATOM   2519  CA  TRP A 319     182.582 113.395 148.399  1.00 95.26           C  
ATOM   2520  C   TRP A 319     181.395 114.343 148.316  1.00 95.26           C  
ATOM   2521  O   TRP A 319     181.570 115.554 148.147  1.00 95.26           O  
ATOM   2522  CB  TRP A 319     182.780 112.691 147.058  1.00 95.26           C  
ATOM   2523  CG  TRP A 319     184.138 112.107 146.850  1.00 95.26           C  
ATOM   2524  CD1 TRP A 319     184.438 110.792 146.659  1.00 95.26           C  
ATOM   2525  CD2 TRP A 319     185.384 112.814 146.797  1.00 95.26           C  
ATOM   2526  NE1 TRP A 319     185.792 110.633 146.497  1.00 95.26           N  
ATOM   2527  CE2 TRP A 319     186.395 111.859 146.577  1.00 95.26           C  
ATOM   2528  CE3 TRP A 319     185.742 114.160 146.917  1.00 95.26           C  
ATOM   2529  CZ2 TRP A 319     187.740 112.206 146.474  1.00 95.26           C  
ATOM   2530  CZ3 TRP A 319     187.079 114.502 146.814  1.00 95.26           C  
ATOM   2531  CH2 TRP A 319     188.061 113.529 146.595  1.00 95.26           C  
ATOM   2532  N   SER A 320     180.178 113.810 148.427  1.00 89.89           N  
ATOM   2533  CA  SER A 320     178.995 114.658 148.357  1.00 89.89           C  
ATOM   2534  C   SER A 320     178.960 115.639 149.519  1.00 89.89           C  
ATOM   2535  O   SER A 320     178.706 116.836 149.322  1.00 89.89           O  
ATOM   2536  CB  SER A 320     177.731 113.802 148.339  1.00 89.89           C  
ATOM   2537  OG  SER A 320     177.666 113.014 147.164  1.00 89.89           O  
ATOM   2538  N   ARG A 321     179.216 115.149 150.735  1.00 90.31           N  
ATOM   2539  CA  ARG A 321     179.248 116.030 151.895  1.00 90.31           C  
ATOM   2540  C   ARG A 321     180.218 117.183 151.689  1.00 90.31           C  
ATOM   2541  O   ARG A 321     179.884 118.341 151.963  1.00 90.31           O  
ATOM   2542  CB  ARG A 321     179.630 115.243 153.148  1.00 90.31           C  
ATOM   2543  CG  ARG A 321     178.581 114.257 153.619  1.00 90.31           C  
ATOM   2544  CD  ARG A 321     179.109 113.435 154.782  1.00 90.31           C  
ATOM   2545  NE  ARG A 321     178.127 112.476 155.274  1.00 90.31           N  
ATOM   2546  CZ  ARG A 321     178.368 111.593 156.236  1.00 90.31           C  
ATOM   2547  NH1 ARG A 321     179.563 111.546 156.808  1.00 90.31           N  
ATOM   2548  NH2 ARG A 321     177.416 110.757 156.624  1.00 90.31           N  
ATOM   2549  N   ILE A 322     181.418 116.893 151.193  1.00 91.48           N  
ATOM   2550  CA  ILE A 322     182.414 117.954 151.093  1.00 91.48           C  
ATOM   2551  C   ILE A 322     182.245 118.807 149.837  1.00 91.48           C  
ATOM   2552  O   ILE A 322     182.845 119.883 149.741  1.00 91.48           O  
ATOM   2553  CB  ILE A 322     183.835 117.375 151.177  1.00 91.48           C  
ATOM   2554  CG1 ILE A 322     184.081 116.379 150.044  1.00 91.48           C  
ATOM   2555  CG2 ILE A 322     184.059 116.729 152.533  1.00 91.48           C  
ATOM   2556  CD1 ILE A 322     185.444 115.718 150.101  1.00 91.48           C  
ATOM   2557  N   PHE A 323     181.453 118.358 148.860  1.00 91.82           N  
ATOM   2558  CA  PHE A 323     181.357 119.118 147.618  1.00 91.82           C  
ATOM   2559  C   PHE A 323     180.092 119.968 147.534  1.00 91.82           C  
ATOM   2560  O   PHE A 323     180.150 121.103 147.046  1.00 91.82           O  
ATOM   2561  CB  PHE A 323     181.444 118.177 146.418  1.00 91.82           C  
ATOM   2562  CG  PHE A 323     182.852 117.840 146.016  1.00 91.82           C  
ATOM   2563  CD1 PHE A 323     183.925 118.289 146.767  1.00 91.82           C  
ATOM   2564  CD2 PHE A 323     183.103 117.090 144.879  1.00 91.82           C  
ATOM   2565  CE1 PHE A 323     185.223 117.983 146.398  1.00 91.82           C  
ATOM   2566  CE2 PHE A 323     184.398 116.783 144.504  1.00 91.82           C  
ATOM   2567  CZ  PHE A 323     185.459 117.230 145.263  1.00 91.82           C  
ATOM   2568  N   PHE A 324     178.942 119.448 147.980  1.00 78.41           N  
ATOM   2569  CA  PHE A 324     177.675 120.134 147.720  1.00 78.41           C  
ATOM   2570  C   PHE A 324     177.625 121.556 148.269  1.00 78.41           C  
ATOM   2571  O   PHE A 324     177.327 122.488 147.497  1.00 78.41           O  
ATOM   2572  CB  PHE A 324     176.513 119.288 148.246  1.00 78.41           C  
ATOM   2573  CG  PHE A 324     175.803 118.512 147.182  1.00 78.41           C  
ATOM   2574  CD1 PHE A 324     176.293 118.474 145.891  1.00 78.41           C  
ATOM   2575  CD2 PHE A 324     174.636 117.831 147.471  1.00 78.41           C  
ATOM   2576  CE1 PHE A 324     175.638 117.759 144.911  1.00 78.41           C  
ATOM   2577  CE2 PHE A 324     173.976 117.116 146.495  1.00 78.41           C  
ATOM   2578  CZ  PHE A 324     174.477 117.080 145.213  1.00 78.41           C  
ATOM   2579  N   PRO A 325     177.877 121.804 149.562  1.00 80.63           N  
ATOM   2580  CA  PRO A 325     177.763 123.187 150.057  1.00 80.63           C  
ATOM   2581  C   PRO A 325     178.714 124.150 149.371  1.00 80.63           C  
ATOM   2582  O   PRO A 325     178.374 125.324 149.191  1.00 80.63           O  
ATOM   2583  CB  PRO A 325     178.072 123.049 151.555  1.00 80.63           C  
ATOM   2584  CG  PRO A 325     177.826 121.616 151.867  1.00 80.63           C  
ATOM   2585  CD  PRO A 325     178.263 120.884 150.645  1.00 80.63           C  
ATOM   2586  N   VAL A 326     179.898 123.683 148.973  1.00 83.47           N  
ATOM   2587  CA  VAL A 326     180.845 124.559 148.289  1.00 83.47           C  
ATOM   2588  C   VAL A 326     180.280 125.003 146.947  1.00 83.47           C  
ATOM   2589  O   VAL A 326     180.330 126.188 146.592  1.00 83.47           O  
ATOM   2590  CB  VAL A 326     182.203 123.855 148.124  1.00 83.47           C  
ATOM   2591  CG1 VAL A 326     183.161 124.732 147.335  1.00 83.47           C  
ATOM   2592  CG2 VAL A 326     182.786 123.507 149.484  1.00 83.47           C  
ATOM   2593  N   VAL A 327     179.735 124.057 146.180  1.00 79.59           N  
ATOM   2594  CA  VAL A 327     179.143 124.399 144.890  1.00 79.59           C  
ATOM   2595  C   VAL A 327     177.968 125.347 145.080  1.00 79.59           C  
ATOM   2596  O   VAL A 327     177.794 126.307 144.317  1.00 79.59           O  
ATOM   2597  CB  VAL A 327     178.725 123.122 144.138  1.00 79.59           C  
ATOM   2598  CG1 VAL A 327     178.111 123.474 142.795  1.00 79.59           C  
ATOM   2599  CG2 VAL A 327     179.919 122.205 143.956  1.00 79.59           C  
ATOM   2600  N   PHE A 328     177.148 125.101 146.105  1.00 73.67           N  
ATOM   2601  CA  PHE A 328     175.998 125.969 146.339  1.00 73.67           C  
ATOM   2602  C   PHE A 328     176.437 127.384 146.699  1.00 73.67           C  
ATOM   2603  O   PHE A 328     175.863 128.366 146.208  1.00 73.67           O  
ATOM   2604  CB  PHE A 328     175.115 125.380 147.436  1.00 73.67           C  
ATOM   2605  CG  PHE A 328     173.872 126.171 147.698  1.00 73.67           C  
ATOM   2606  CD1 PHE A 328     172.917 126.327 146.712  1.00 73.67           C  
ATOM   2607  CD2 PHE A 328     173.654 126.750 148.932  1.00 73.67           C  
ATOM   2608  CE1 PHE A 328     171.770 127.051 146.949  1.00 73.67           C  
ATOM   2609  CE2 PHE A 328     172.508 127.472 149.177  1.00 73.67           C  
ATOM   2610  CZ  PHE A 328     171.565 127.623 148.183  1.00 73.67           C  
ATOM   2611  N   SER A 329     177.457 127.509 147.550  1.00 75.07           N  
ATOM   2612  CA  SER A 329     177.953 128.829 147.919  1.00 75.07           C  
ATOM   2613  C   SER A 329     178.556 129.544 146.718  1.00 75.07           C  
ATOM   2614  O   SER A 329     178.366 130.754 146.549  1.00 75.07           O  
ATOM   2615  CB  SER A 329     178.980 128.709 149.043  1.00 75.07           C  
ATOM   2616  OG  SER A 329     178.409 128.109 150.191  1.00 75.07           O  
ATOM   2617  N   PHE A 330     179.284 128.814 145.872  1.00 74.62           N  
ATOM   2618  CA  PHE A 330     179.848 129.419 144.670  1.00 74.62           C  
ATOM   2619  C   PHE A 330     178.747 129.936 143.755  1.00 74.62           C  
ATOM   2620  O   PHE A 330     178.832 131.052 143.224  1.00 74.62           O  
ATOM   2621  CB  PHE A 330     180.726 128.402 143.942  1.00 74.62           C  
ATOM   2622  CG  PHE A 330     181.245 128.882 142.617  1.00 74.62           C  
ATOM   2623  CD1 PHE A 330     182.322 129.748 142.553  1.00 74.62           C  
ATOM   2624  CD2 PHE A 330     180.664 128.456 141.435  1.00 74.62           C  
ATOM   2625  CE1 PHE A 330     182.804 130.188 141.336  1.00 74.62           C  
ATOM   2626  CE2 PHE A 330     181.142 128.891 140.215  1.00 74.62           C  
ATOM   2627  CZ  PHE A 330     182.214 129.758 140.166  1.00 74.62           C  
ATOM   2628  N   PHE A 331     177.700 129.132 143.559  1.00 74.83           N  
ATOM   2629  CA  PHE A 331     176.578 129.551 142.728  1.00 74.83           C  
ATOM   2630  C   PHE A 331     175.923 130.809 143.283  1.00 74.83           C  
ATOM   2631  O   PHE A 331     175.669 131.769 142.544  1.00 74.83           O  
ATOM   2632  CB  PHE A 331     175.566 128.412 142.620  1.00 74.83           C  
ATOM   2633  CG  PHE A 331     174.265 128.807 141.987  1.00 74.83           C  
ATOM   2634  CD1 PHE A 331     174.163 128.954 140.616  1.00 74.83           C  
ATOM   2635  CD2 PHE A 331     173.138 129.009 142.763  1.00 74.83           C  
ATOM   2636  CE1 PHE A 331     172.962 129.308 140.032  1.00 74.83           C  
ATOM   2637  CE2 PHE A 331     171.936 129.364 142.184  1.00 74.83           C  
ATOM   2638  CZ  PHE A 331     171.849 129.513 140.816  1.00 74.83           C  
ATOM   2639  N   ASN A 332     175.643 130.823 144.589  1.00 71.09           N  
ATOM   2640  CA  ASN A 332     175.009 131.993 145.190  1.00 71.09           C  
ATOM   2641  C   ASN A 332     175.889 133.229 145.068  1.00 71.09           C  
ATOM   2642  O   ASN A 332     175.391 134.332 144.807  1.00 71.09           O  
ATOM   2643  CB  ASN A 332     174.679 131.725 146.656  1.00 71.09           C  
ATOM   2644  CG  ASN A 332     173.447 130.874 146.824  1.00 71.09           C  
ATOM   2645  OD1 ASN A 332     172.622 130.770 145.919  1.00 71.09           O  
ATOM   2646  ND2 ASN A 332     173.309 130.264 147.992  1.00 71.09           N  
ATOM   2647  N   ILE A 333     177.200 133.071 145.264  1.00 68.68           N  
ATOM   2648  CA  ILE A 333     178.102 134.215 145.188  1.00 68.68           C  
ATOM   2649  C   ILE A 333     178.122 134.779 143.775  1.00 68.68           C  
ATOM   2650  O   ILE A 333     178.010 135.995 143.574  1.00 68.68           O  
ATOM   2651  CB  ILE A 333     179.512 133.823 145.665  1.00 68.68           C  
ATOM   2652  CG1 ILE A 333     179.531 133.679 147.188  1.00 68.68           C  
ATOM   2653  CG2 ILE A 333     180.533 134.849 145.210  1.00 68.68           C  
ATOM   2654  CD1 ILE A 333     180.881 133.290 147.751  1.00 68.68           C  
ATOM   2655  N   VAL A 334     178.254 133.905 142.773  1.00 68.49           N  
ATOM   2656  CA  VAL A 334     178.247 134.369 141.388  1.00 68.49           C  
ATOM   2657  C   VAL A 334     176.938 135.081 141.073  1.00 68.49           C  
ATOM   2658  O   VAL A 334     176.929 136.151 140.452  1.00 68.49           O  
ATOM   2659  CB  VAL A 334     178.497 133.195 140.425  1.00 68.49           C  
ATOM   2660  CG1 VAL A 334     178.318 133.646 138.988  1.00 68.49           C  
ATOM   2661  CG2 VAL A 334     179.888 132.631 140.631  1.00 68.49           C  
ATOM   2662  N   TYR A 335     175.817 134.513 141.519  1.00 66.81           N  
ATOM   2663  CA  TYR A 335     174.510 135.115 141.277  1.00 66.81           C  
ATOM   2664  C   TYR A 335     174.431 136.522 141.859  1.00 66.81           C  
ATOM   2665  O   TYR A 335     174.192 137.501 141.138  1.00 66.81           O  
ATOM   2666  CB  TYR A 335     173.434 134.212 141.878  1.00 66.81           C  
ATOM   2667  CG  TYR A 335     172.011 134.664 141.683  1.00 66.81           C  
ATOM   2668  CD1 TYR A 335     171.278 134.245 140.585  1.00 66.81           C  
ATOM   2669  CD2 TYR A 335     171.386 135.476 142.616  1.00 66.81           C  
ATOM   2670  CE1 TYR A 335     169.971 134.638 140.411  1.00 66.81           C  
ATOM   2671  CE2 TYR A 335     170.079 135.877 142.449  1.00 66.81           C  
ATOM   2672  CZ  TYR A 335     169.376 135.456 141.344  1.00 66.81           C  
ATOM   2673  OH  TYR A 335     168.071 135.854 141.173  1.00 66.81           O  
ATOM   2674  N   TRP A 336     174.636 136.641 143.173  1.00 64.42           N  
ATOM   2675  CA  TRP A 336     174.453 137.928 143.834  1.00 64.42           C  
ATOM   2676  C   TRP A 336     175.497 138.949 143.403  1.00 64.42           C  
ATOM   2677  O   TRP A 336     175.247 140.155 143.493  1.00 64.42           O  
ATOM   2678  CB  TRP A 336     174.477 137.759 145.349  1.00 64.42           C  
ATOM   2679  CG  TRP A 336     173.295 137.022 145.879  1.00 64.42           C  
ATOM   2680  CD1 TRP A 336     173.293 135.789 146.453  1.00 64.42           C  
ATOM   2681  CD2 TRP A 336     171.936 137.465 145.875  1.00 64.42           C  
ATOM   2682  NE1 TRP A 336     172.017 135.438 146.816  1.00 64.42           N  
ATOM   2683  CE2 TRP A 336     171.165 136.452 146.471  1.00 64.42           C  
ATOM   2684  CE3 TRP A 336     171.297 138.624 145.432  1.00 64.42           C  
ATOM   2685  CZ2 TRP A 336     169.789 136.559 146.631  1.00 64.42           C  
ATOM   2686  CZ3 TRP A 336     169.929 138.730 145.593  1.00 64.42           C  
ATOM   2687  CH2 TRP A 336     169.190 137.704 146.187  1.00 64.42           C  
ATOM   2688  N   LEU A 337     176.667 138.504 142.941  1.00 67.71           N  
ATOM   2689  CA  LEU A 337     177.644 139.462 142.440  1.00 67.71           C  
ATOM   2690  C   LEU A 337     177.285 139.932 141.038  1.00 67.71           C  
ATOM   2691  O   LEU A 337     177.504 141.100 140.697  1.00 67.71           O  
ATOM   2692  CB  LEU A 337     179.045 138.857 142.464  1.00 67.71           C  
ATOM   2693  CG  LEU A 337     179.673 138.738 143.851  1.00 67.71           C  
ATOM   2694  CD1 LEU A 337     181.099 138.224 143.749  1.00 67.71           C  
ATOM   2695  CD2 LEU A 337     179.627 140.075 144.572  1.00 67.71           C  
ATOM   2696  N   TYR A 338     176.734 139.043 140.208  1.00 73.97           N  
ATOM   2697  CA  TYR A 338     176.360 139.454 138.861  1.00 73.97           C  
ATOM   2698  C   TYR A 338     175.160 140.387 138.880  1.00 73.97           C  
ATOM   2699  O   TYR A 338     175.089 141.329 138.082  1.00 73.97           O  
ATOM   2700  CB  TYR A 338     176.064 138.236 137.992  1.00 73.97           C  
ATOM   2701  CG  TYR A 338     175.646 138.608 136.589  1.00 73.97           C  
ATOM   2702  CD1 TYR A 338     176.592 138.839 135.604  1.00 73.97           C  
ATOM   2703  CD2 TYR A 338     174.306 138.737 136.253  1.00 73.97           C  
ATOM   2704  CE1 TYR A 338     176.218 139.182 134.323  1.00 73.97           C  
ATOM   2705  CE2 TYR A 338     173.923 139.081 134.977  1.00 73.97           C  
ATOM   2706  CZ  TYR A 338     174.882 139.303 134.015  1.00 73.97           C  
ATOM   2707  OH  TYR A 338     174.503 139.645 132.739  1.00 73.97           O  
ATOM   2708  N   TYR A 339     174.198 140.141 139.770  1.00 66.26           N  
ATOM   2709  CA  TYR A 339     173.000 140.974 139.759  1.00 66.26           C  
ATOM   2710  C   TYR A 339     173.206 142.276 140.524  1.00 66.26           C  
ATOM   2711  O   TYR A 339     173.161 143.360 139.933  1.00 66.26           O  
ATOM   2712  CB  TYR A 339     171.814 140.192 140.312  1.00 66.26           C  
ATOM   2713  CG  TYR A 339     171.173 139.334 139.257  1.00 66.26           C  
ATOM   2714  CD1 TYR A 339     171.299 139.657 137.915  1.00 66.26           C  
ATOM   2715  CD2 TYR A 339     170.452 138.204 139.593  1.00 66.26           C  
ATOM   2716  CE1 TYR A 339     170.721 138.884 136.940  1.00 66.26           C  
ATOM   2717  CE2 TYR A 339     169.875 137.423 138.623  1.00 66.26           C  
ATOM   2718  CZ  TYR A 339     170.009 137.768 137.298  1.00 66.26           C  
ATOM   2719  OH  TYR A 339     169.427 136.988 136.329  1.00 66.26           O  
ATOM   2720  N   VAL A 340     173.439 142.195 141.828  1.00 60.41           N  
ATOM   2721  CA  VAL A 340     173.662 143.401 142.613  1.00 60.41           C  
ATOM   2722  C   VAL A 340     174.996 144.020 142.221  1.00 60.41           C  
ATOM   2723  O   VAL A 340     176.057 143.554 142.634  1.00 60.41           O  
ATOM   2724  CB  VAL A 340     173.616 143.109 144.117  1.00 60.41           C  
ATOM   2725  CG1 VAL A 340     173.780 144.396 144.908  1.00 60.41           C  
ATOM   2726  CG2 VAL A 340     172.318 142.420 144.479  1.00 60.41           C  
TER    2727      VAL A 340                                                      
ATOM   2728  N   THR B  13     143.198 190.634 111.787  1.00 62.38           N  
ATOM   2729  CA  THR B  13     142.754 191.771 110.992  1.00 62.38           C  
ATOM   2730  C   THR B  13     142.327 191.329 109.598  1.00 62.38           C  
ATOM   2731  O   THR B  13     141.140 191.313 109.279  1.00 62.38           O  
ATOM   2732  CB  THR B  13     143.855 192.832 110.866  1.00 62.38           C  
ATOM   2733  OG1 THR B  13     144.310 193.209 112.172  1.00 62.38           O  
ATOM   2734  CG2 THR B  13     143.325 194.060 110.150  1.00 62.38           C  
ATOM   2735  N   VAL B  14     143.310 190.983 108.766  1.00 55.53           N  
ATOM   2736  CA  VAL B  14     143.010 190.476 107.432  1.00 55.53           C  
ATOM   2737  C   VAL B  14     142.585 189.015 107.500  1.00 55.53           C  
ATOM   2738  O   VAL B  14     141.672 188.580 106.783  1.00 55.53           O  
ATOM   2739  CB  VAL B  14     144.227 190.666 106.511  1.00 55.53           C  
ATOM   2740  CG1 VAL B  14     143.907 190.189 105.109  1.00 55.53           C  
ATOM   2741  CG2 VAL B  14     144.652 192.120 106.500  1.00 55.53           C  
ATOM   2742  N   PHE B  15     143.236 188.238 108.367  1.00 49.33           N  
ATOM   2743  CA  PHE B  15     142.940 186.815 108.450  1.00 49.33           C  
ATOM   2744  C   PHE B  15     141.519 186.563 108.921  1.00 49.33           C  
ATOM   2745  O   PHE B  15     140.903 185.577 108.512  1.00 49.33           O  
ATOM   2746  CB  PHE B  15     143.932 186.123 109.377  1.00 49.33           C  
ATOM   2747  CG  PHE B  15     145.354 186.273 108.950  1.00 49.33           C  
ATOM   2748  CD1 PHE B  15     145.898 185.418 108.013  1.00 49.33           C  
ATOM   2749  CD2 PHE B  15     146.145 187.275 109.478  1.00 49.33           C  
ATOM   2750  CE1 PHE B  15     147.206 185.557 107.615  1.00 49.33           C  
ATOM   2751  CE2 PHE B  15     147.455 187.418 109.084  1.00 49.33           C  
ATOM   2752  CZ  PHE B  15     147.987 186.557 108.151  1.00 49.33           C  
ATOM   2753  N   THR B  16     140.980 187.435 109.773  1.00 48.72           N  
ATOM   2754  CA  THR B  16     139.597 187.269 110.203  1.00 48.72           C  
ATOM   2755  C   THR B  16     138.640 187.365 109.023  1.00 48.72           C  
ATOM   2756  O   THR B  16     137.698 186.574 108.913  1.00 48.72           O  
ATOM   2757  CB  THR B  16     139.247 188.305 111.266  1.00 48.72           C  
ATOM   2758  OG1 THR B  16     140.120 188.145 112.390  1.00 48.72           O  
ATOM   2759  CG2 THR B  16     137.813 188.127 111.722  1.00 48.72           C  
ATOM   2760  N   ARG B  17     138.871 188.320 108.122  1.00 56.45           N  
ATOM   2761  CA  ARG B  17     138.037 188.415 106.929  1.00 56.45           C  
ATOM   2762  C   ARG B  17     138.229 187.198 106.035  1.00 56.45           C  
ATOM   2763  O   ARG B  17     137.253 186.611 105.552  1.00 56.45           O  
ATOM   2764  CB  ARG B  17     138.351 189.698 106.163  1.00 56.45           C  
ATOM   2765  CG  ARG B  17     138.033 190.968 106.926  1.00 56.45           C  
ATOM   2766  CD  ARG B  17     138.562 192.187 106.196  1.00 56.45           C  
ATOM   2767  NE  ARG B  17     138.360 193.412 106.964  1.00 56.45           N  
ATOM   2768  CZ  ARG B  17     138.883 194.589 106.637  1.00 56.45           C  
ATOM   2769  NH1 ARG B  17     138.648 195.654 107.392  1.00 56.45           N  
ATOM   2770  NH2 ARG B  17     139.644 194.699 105.557  1.00 56.45           N  
ATOM   2771  N   ILE B  18     139.486 186.803 105.809  1.00 46.68           N  
ATOM   2772  CA  ILE B  18     139.757 185.640 104.964  1.00 46.68           C  
ATOM   2773  C   ILE B  18     139.063 184.402 105.516  1.00 46.68           C  
ATOM   2774  O   ILE B  18     138.569 183.557 104.760  1.00 46.68           O  
ATOM   2775  CB  ILE B  18     141.274 185.422 104.826  1.00 46.68           C  
ATOM   2776  CG1 ILE B  18     141.899 186.557 104.016  1.00 46.68           C  
ATOM   2777  CG2 ILE B  18     141.570 184.090 104.173  1.00 46.68           C  
ATOM   2778  CD1 ILE B  18     143.376 186.377 103.762  1.00 46.68           C  
ATOM   2779  N   LEU B  19     138.989 184.287 106.839  1.00 41.36           N  
ATOM   2780  CA  LEU B  19     138.430 183.093 107.455  1.00 41.36           C  
ATOM   2781  C   LEU B  19     136.912 183.129 107.502  1.00 41.36           C  
ATOM   2782  O   LEU B  19     136.268 182.097 107.294  1.00 41.36           O  
ATOM   2783  CB  LEU B  19     138.997 182.928 108.862  1.00 41.36           C  
ATOM   2784  CG  LEU B  19     139.344 181.507 109.289  1.00 41.36           C  
ATOM   2785  CD1 LEU B  19     139.652 180.652 108.079  1.00 41.36           C  
ATOM   2786  CD2 LEU B  19     140.538 181.545 110.215  1.00 41.36           C  
ATOM   2787  N   ASP B  20     136.322 184.294 107.767  1.00 50.19           N  
ATOM   2788  CA  ASP B  20     134.869 184.382 107.779  1.00 50.19           C  
ATOM   2789  C   ASP B  20     134.292 184.272 106.379  1.00 50.19           C  
ATOM   2790  O   ASP B  20     133.166 183.792 106.213  1.00 50.19           O  
ATOM   2791  CB  ASP B  20     134.421 185.689 108.429  1.00 50.19           C  
ATOM   2792  CG  ASP B  20     134.728 185.736 109.908  1.00 50.19           C  
ATOM   2793  OD1 ASP B  20     134.729 184.666 110.550  1.00 50.19           O  
ATOM   2794  OD2 ASP B  20     134.968 186.844 110.431  1.00 50.19           O  
ATOM   2795  N   ARG B  21     135.036 184.710 105.361  1.00 48.86           N  
ATOM   2796  CA  ARG B  21     134.509 184.655 104.002  1.00 48.86           C  
ATOM   2797  C   ARG B  21     134.322 183.216 103.539  1.00 48.86           C  
ATOM   2798  O   ARG B  21     133.390 182.917 102.784  1.00 48.86           O  
ATOM   2799  CB  ARG B  21     135.431 185.408 103.049  1.00 48.86           C  
ATOM   2800  CG  ARG B  21     134.825 185.653 101.685  1.00 48.86           C  
ATOM   2801  CD  ARG B  21     135.831 186.304 100.761  1.00 48.86           C  
ATOM   2802  NE  ARG B  21     136.997 185.454 100.556  1.00 48.86           N  
ATOM   2803  CZ  ARG B  21     138.059 185.805  99.840  1.00 48.86           C  
ATOM   2804  NH1 ARG B  21     139.076 184.966  99.705  1.00 48.86           N  
ATOM   2805  NH2 ARG B  21     138.105 186.996  99.261  1.00 48.86           N  
ATOM   2806  N   LEU B  22     135.197 182.309 103.978  1.00 40.23           N  
ATOM   2807  CA  LEU B  22     135.072 180.910 103.583  1.00 40.23           C  
ATOM   2808  C   LEU B  22     133.803 180.294 104.153  1.00 40.23           C  
ATOM   2809  O   LEU B  22     132.973 179.755 103.414  1.00 40.23           O  
ATOM   2810  CB  LEU B  22     136.295 180.119 104.043  1.00 40.23           C  
ATOM   2811  CG  LEU B  22     137.657 180.643 103.606  1.00 40.23           C  
ATOM   2812  CD1 LEU B  22     138.757 179.757 104.154  1.00 40.23           C  
ATOM   2813  CD2 LEU B  22     137.725 180.719 102.097  1.00 40.23           C  
ATOM   2814  N   LEU B  23     133.636 180.366 105.473  1.00 37.46           N  
ATOM   2815  CA  LEU B  23     132.480 179.751 106.111  1.00 37.46           C  
ATOM   2816  C   LEU B  23     131.173 180.433 105.738  1.00 37.46           C  
ATOM   2817  O   LEU B  23     130.105 179.849 105.946  1.00 37.46           O  
ATOM   2818  CB  LEU B  23     132.657 179.756 107.625  1.00 37.46           C  
ATOM   2819  CG  LEU B  23     133.900 179.009 108.097  1.00 37.46           C  
ATOM   2820  CD1 LEU B  23     133.973 178.998 109.609  1.00 37.46           C  
ATOM   2821  CD2 LEU B  23     133.896 177.601 107.546  1.00 37.46           C  
ATOM   2822  N   ASP B  24     131.226 181.649 105.204  1.00 48.86           N  
ATOM   2823  CA  ASP B  24     130.010 182.299 104.739  1.00 48.86           C  
ATOM   2824  C   ASP B  24     129.445 181.542 103.547  1.00 48.86           C  
ATOM   2825  O   ASP B  24     130.150 181.282 102.569  1.00 48.86           O  
ATOM   2826  CB  ASP B  24     130.298 183.750 104.359  1.00 48.86           C  
ATOM   2827  CG  ASP B  24     129.043 184.515 103.994  1.00 48.86           C  
ATOM   2828  OD1 ASP B  24     127.935 184.015 104.281  1.00 48.86           O  
ATOM   2829  OD2 ASP B  24     129.163 185.617 103.418  1.00 48.86           O  
ATOM   2830  N   GLY B  25     128.165 181.192 103.627  1.00 46.65           N  
ATOM   2831  CA  GLY B  25     127.547 180.419 102.564  1.00 46.65           C  
ATOM   2832  C   GLY B  25     128.109 179.024 102.419  1.00 46.65           C  
ATOM   2833  O   GLY B  25     128.193 178.508 101.300  1.00 46.65           O  
ATOM   2834  N   TYR B  26     128.502 178.400 103.523  1.00 36.11           N  
ATOM   2835  CA  TYR B  26     129.041 177.048 103.521  1.00 36.11           C  
ATOM   2836  C   TYR B  26     128.160 176.176 104.400  1.00 36.11           C  
ATOM   2837  O   TYR B  26     127.882 176.531 105.550  1.00 36.11           O  
ATOM   2838  CB  TYR B  26     130.487 177.036 104.022  1.00 36.11           C  
ATOM   2839  CG  TYR B  26     131.176 175.700 103.910  1.00 36.11           C  
ATOM   2840  CD1 TYR B  26     131.112 174.778 104.937  1.00 36.11           C  
ATOM   2841  CD2 TYR B  26     131.898 175.369 102.779  1.00 36.11           C  
ATOM   2842  CE1 TYR B  26     131.740 173.563 104.840  1.00 36.11           C  
ATOM   2843  CE2 TYR B  26     132.531 174.156 102.673  1.00 36.11           C  
ATOM   2844  CZ  TYR B  26     132.449 173.256 103.705  1.00 36.11           C  
ATOM   2845  OH  TYR B  26     133.080 172.039 103.599  1.00 36.11           O  
ATOM   2846  N   ASP B  27     127.717 175.045 103.860  1.00 38.47           N  
ATOM   2847  CA  ASP B  27     126.820 174.137 104.561  1.00 38.47           C  
ATOM   2848  C   ASP B  27     127.539 172.817 104.791  1.00 38.47           C  
ATOM   2849  O   ASP B  27     127.909 172.134 103.832  1.00 38.47           O  
ATOM   2850  CB  ASP B  27     125.535 173.922 103.765  1.00 38.47           C  
ATOM   2851  CG  ASP B  27     124.414 173.379 104.617  1.00 38.47           C  
ATOM   2852  OD1 ASP B  27     124.651 173.130 105.816  1.00 38.47           O  
ATOM   2853  OD2 ASP B  27     123.292 173.208 104.096  1.00 38.47           O  
ATOM   2854  N   ASN B  28     127.726 172.456 106.061  1.00 31.64           N  
ATOM   2855  CA  ASN B  28     128.526 171.284 106.388  1.00 31.64           C  
ATOM   2856  C   ASN B  28     127.835 169.977 106.036  1.00 31.64           C  
ATOM   2857  O   ASN B  28     128.507 168.948 105.927  1.00 31.64           O  
ATOM   2858  CB  ASN B  28     128.878 171.285 107.873  1.00 31.64           C  
ATOM   2859  CG  ASN B  28     127.656 171.336 108.761  1.00 31.64           C  
ATOM   2860  OD1 ASN B  28     126.533 171.130 108.308  1.00 31.64           O  
ATOM   2861  ND2 ASN B  28     127.870 171.611 110.040  1.00 31.64           N  
ATOM   2862  N   ARG B  29     126.515 169.988 105.869  1.00 29.77           N  
ATOM   2863  CA  ARG B  29     125.781 168.742 105.703  1.00 29.77           C  
ATOM   2864  C   ARG B  29     126.096 168.039 104.390  1.00 29.77           C  
ATOM   2865  O   ARG B  29     125.899 166.824 104.293  1.00 29.77           O  
ATOM   2866  CB  ARG B  29     124.281 169.007 105.802  1.00 29.77           C  
ATOM   2867  CG  ARG B  29     123.831 169.506 107.159  1.00 29.77           C  
ATOM   2868  CD  ARG B  29     122.352 169.833 107.155  1.00 29.77           C  
ATOM   2869  NE  ARG B  29     122.058 170.999 106.332  1.00 29.77           N  
ATOM   2870  CZ  ARG B  29     121.901 172.227 106.813  1.00 29.77           C  
ATOM   2871  NH1 ARG B  29     122.007 172.448 108.114  1.00 29.77           N  
ATOM   2872  NH2 ARG B  29     121.637 173.232 105.993  1.00 29.77           N  
ATOM   2873  N   LEU B  30     126.581 168.759 103.386  1.00 30.73           N  
ATOM   2874  CA  LEU B  30     126.768 168.217 102.048  1.00 30.73           C  
ATOM   2875  C   LEU B  30     128.249 168.026 101.760  1.00 30.73           C  
ATOM   2876  O   LEU B  30     129.022 168.987 101.808  1.00 30.73           O  
ATOM   2877  CB  LEU B  30     126.149 169.142 101.001  1.00 30.73           C  
ATOM   2878  CG  LEU B  30     124.662 169.004 100.680  1.00 30.73           C  
ATOM   2879  CD1 LEU B  30     123.809 169.002 101.927  1.00 30.73           C  
ATOM   2880  CD2 LEU B  30     124.237 170.131  99.763  1.00 30.73           C  
ATOM   2881  N   ARG B  31     128.637 166.793 101.446  1.00 25.16           N  
ATOM   2882  CA  ARG B  31     130.019 166.503 101.110  1.00 25.16           C  
ATOM   2883  C   ARG B  31     130.376 167.125  99.761  1.00 25.16           C  
ATOM   2884  O   ARG B  31     129.495 167.397  98.945  1.00 25.16           O  
ATOM   2885  CB  ARG B  31     130.245 164.994 101.093  1.00 25.16           C  
ATOM   2886  CG  ARG B  31     129.287 164.218 100.220  1.00 25.16           C  
ATOM   2887  CD  ARG B  31     129.923 163.854  98.898  1.00 25.16           C  
ATOM   2888  NE  ARG B  31     129.114 162.888  98.168  1.00 25.16           N  
ATOM   2889  CZ  ARG B  31     129.321 162.552  96.901  1.00 25.16           C  
ATOM   2890  NH1 ARG B  31     130.312 163.108  96.222  1.00 25.16           N  
ATOM   2891  NH2 ARG B  31     128.534 161.666  96.312  1.00 25.16           N  
ATOM   2892  N   PRO B  32     131.663 167.373  99.508  1.00 26.61           N  
ATOM   2893  CA  PRO B  32     132.048 168.081  98.282  1.00 26.61           C  
ATOM   2894  C   PRO B  32     131.647 167.313  97.035  1.00 26.61           C  
ATOM   2895  O   PRO B  32     131.866 166.106  96.928  1.00 26.61           O  
ATOM   2896  CB  PRO B  32     133.570 168.194  98.402  1.00 26.61           C  
ATOM   2897  CG  PRO B  32     133.954 167.105  99.319  1.00 26.61           C  
ATOM   2898  CD  PRO B  32     132.843 167.022 100.311  1.00 26.61           C  
ATOM   2899  N   GLY B  33     131.058 168.033  96.086  1.00 31.76           N  
ATOM   2900  CA  GLY B  33     130.614 167.430  94.847  1.00 31.76           C  
ATOM   2901  C   GLY B  33     129.498 166.430  95.051  1.00 31.76           C  
ATOM   2902  O   GLY B  33     129.688 165.230  94.841  1.00 31.76           O  
ATOM   2903  N   LEU B  34     128.326 166.910  95.471  1.00 32.59           N  
ATOM   2904  CA  LEU B  34     127.216 165.998  95.712  1.00 32.59           C  
ATOM   2905  C   LEU B  34     126.658 165.455  94.405  1.00 32.59           C  
ATOM   2906  O   LEU B  34     126.431 164.247  94.276  1.00 32.59           O  
ATOM   2907  CB  LEU B  34     126.124 166.695  96.517  1.00 32.59           C  
ATOM   2908  CG  LEU B  34     125.005 165.772  96.997  1.00 32.59           C  
ATOM   2909  CD1 LEU B  34     125.574 164.482  97.549  1.00 32.59           C  
ATOM   2910  CD2 LEU B  34     124.176 166.458  98.055  1.00 32.59           C  
ATOM   2911  N   GLY B  35     126.428 166.327  93.427  1.00 42.57           N  
ATOM   2912  CA  GLY B  35     126.056 165.889  92.098  1.00 42.57           C  
ATOM   2913  C   GLY B  35     127.209 165.743  91.136  1.00 42.57           C  
ATOM   2914  O   GLY B  35     127.026 165.238  90.026  1.00 42.57           O  
ATOM   2915  N   GLU B  36     128.397 166.168  91.544  1.00 48.72           N  
ATOM   2916  CA  GLU B  36     129.586 166.130  90.708  1.00 48.72           C  
ATOM   2917  C   GLU B  36     130.314 164.803  90.932  1.00 48.72           C  
ATOM   2918  O   GLU B  36     129.740 163.851  91.465  1.00 48.72           O  
ATOM   2919  CB  GLU B  36     130.459 167.353  90.999  1.00 48.72           C  
ATOM   2920  CG  GLU B  36     129.726 168.675  90.835  1.00 48.72           C  
ATOM   2921  CD  GLU B  36     130.592 169.874  91.164  1.00 48.72           C  
ATOM   2922  OE1 GLU B  36     131.821 169.705  91.302  1.00 48.72           O  
ATOM   2923  OE2 GLU B  36     130.040 170.987  91.285  1.00 48.72           O  
ATOM   2924  N   ARG B  37     131.572 164.721  90.507  1.00 37.54           N  
ATOM   2925  CA  ARG B  37     132.327 163.478  90.572  1.00 37.54           C  
ATOM   2926  C   ARG B  37     132.438 162.966  92.007  1.00 37.54           C  
ATOM   2927  O   ARG B  37     132.184 163.681  92.978  1.00 37.54           O  
ATOM   2928  CB  ARG B  37     133.725 163.668  89.984  1.00 37.54           C  
ATOM   2929  CG  ARG B  37     134.733 164.317  90.925  1.00 37.54           C  
ATOM   2930  CD  ARG B  37     134.589 165.829  90.976  1.00 37.54           C  
ATOM   2931  NE  ARG B  37     135.706 166.452  91.680  1.00 37.54           N  
ATOM   2932  CZ  ARG B  37     135.721 166.702  92.985  1.00 37.54           C  
ATOM   2933  NH1 ARG B  37     134.676 166.384  93.732  1.00 37.54           N  
ATOM   2934  NH2 ARG B  37     136.779 167.269  93.542  1.00 37.54           N  
ATOM   2935  N   VAL B  38     132.825 161.694  92.124  1.00 25.38           N  
ATOM   2936  CA  VAL B  38     132.971 161.073  93.431  1.00 25.38           C  
ATOM   2937  C   VAL B  38     134.115 161.732  94.192  1.00 25.38           C  
ATOM   2938  O   VAL B  38     135.044 162.296  93.602  1.00 25.38           O  
ATOM   2939  CB  VAL B  38     133.206 159.561  93.283  1.00 25.38           C  
ATOM   2940  CG1 VAL B  38     132.420 159.029  92.104  1.00 25.38           C  
ATOM   2941  CG2 VAL B  38     134.683 159.260  93.113  1.00 25.38           C  
ATOM   2942  N   THR B  39     134.038 161.679  95.517  1.00 25.46           N  
ATOM   2943  CA  THR B  39     135.090 162.214  96.368  1.00 25.46           C  
ATOM   2944  C   THR B  39     136.116 161.134  96.674  1.00 25.46           C  
ATOM   2945  O   THR B  39     135.759 160.002  97.006  1.00 25.46           O  
ATOM   2946  CB  THR B  39     134.509 162.755  97.671  1.00 25.46           C  
ATOM   2947  OG1 THR B  39     133.722 163.917  97.395  1.00 25.46           O  
ATOM   2948  CG2 THR B  39     135.615 163.120  98.635  1.00 25.46           C  
ATOM   2949  N   GLU B  40     137.393 161.490  96.570  1.00 25.86           N  
ATOM   2950  CA  GLU B  40     138.485 160.552  96.791  1.00 25.86           C  
ATOM   2951  C   GLU B  40     139.278 161.003  98.006  1.00 25.86           C  
ATOM   2952  O   GLU B  40     139.925 162.053  97.971  1.00 25.86           O  
ATOM   2953  CB  GLU B  40     139.384 160.463  95.559  1.00 25.86           C  
ATOM   2954  CG  GLU B  40     140.417 159.356  95.623  1.00 25.86           C  
ATOM   2955  CD  GLU B  40     141.086 159.107  94.284  1.00 25.86           C  
ATOM   2956  OE1 GLU B  40     140.630 159.679  93.272  1.00 25.86           O  
ATOM   2957  OE2 GLU B  40     142.069 158.338  94.241  1.00 25.86           O  
ATOM   2958  N   VAL B  41     139.236 160.206  99.069  1.00 18.78           N  
ATOM   2959  CA  VAL B  41     139.896 160.513 100.331  1.00 18.78           C  
ATOM   2960  C   VAL B  41     141.113 159.612 100.475  1.00 18.78           C  
ATOM   2961  O   VAL B  41     141.006 158.390 100.332  1.00 18.78           O  
ATOM   2962  CB  VAL B  41     138.940 160.325 101.519  1.00 18.78           C  
ATOM   2963  CG1 VAL B  41     139.693 160.416 102.818  1.00 18.78           C  
ATOM   2964  CG2 VAL B  41     137.846 161.355 101.469  1.00 18.78           C  
ATOM   2965  N   LYS B  42     142.263 160.211 100.764  1.00 20.43           N  
ATOM   2966  CA  LYS B  42     143.506 159.486 100.965  1.00 20.43           C  
ATOM   2967  C   LYS B  42     143.750 159.305 102.454  1.00 20.43           C  
ATOM   2968  O   LYS B  42     143.454 160.201 103.248  1.00 20.43           O  
ATOM   2969  CB  LYS B  42     144.673 160.238 100.331  1.00 20.43           C  
ATOM   2970  CG  LYS B  42     144.449 160.604  98.880  1.00 20.43           C  
ATOM   2971  CD  LYS B  42     145.661 161.306  98.305  1.00 20.43           C  
ATOM   2972  CE  LYS B  42     145.434 161.688  96.859  1.00 20.43           C  
ATOM   2973  NZ  LYS B  42     144.329 162.671  96.723  1.00 20.43           N  
ATOM   2974  N   THR B  43     144.302 158.152 102.827  1.00 20.65           N  
ATOM   2975  CA  THR B  43     144.432 157.757 104.223  1.00 20.65           C  
ATOM   2976  C   THR B  43     145.855 157.308 104.517  1.00 20.65           C  
ATOM   2977  O   THR B  43     146.513 156.710 103.664  1.00 20.65           O  
ATOM   2978  CB  THR B  43     143.449 156.633 104.556  1.00 20.65           C  
ATOM   2979  OG1 THR B  43     142.115 157.076 104.285  1.00 20.65           O  
ATOM   2980  CG2 THR B  43     143.547 156.240 106.010  1.00 20.65           C  
ATOM   2981  N   ASP B  44     146.333 157.618 105.720  1.00 28.78           N  
ATOM   2982  CA  ASP B  44     147.634 157.170 106.189  1.00 28.78           C  
ATOM   2983  C   ASP B  44     147.554 156.923 107.688  1.00 28.78           C  
ATOM   2984  O   ASP B  44     146.783 157.574 108.397  1.00 28.78           O  
ATOM   2985  CB  ASP B  44     148.727 158.191 105.870  1.00 28.78           C  
ATOM   2986  CG  ASP B  44     150.113 157.679 106.191  1.00 28.78           C  
ATOM   2987  OD1 ASP B  44     150.227 156.530 106.665  1.00 28.78           O  
ATOM   2988  OD2 ASP B  44     151.092 158.423 105.969  1.00 28.78           O  
ATOM   2989  N   ILE B  45     148.351 155.974 108.168  1.00 39.51           N  
ATOM   2990  CA  ILE B  45     148.344 155.570 109.568  1.00 39.51           C  
ATOM   2991  C   ILE B  45     149.767 155.612 110.099  1.00 39.51           C  
ATOM   2992  O   ILE B  45     150.714 155.285 109.379  1.00 39.51           O  
ATOM   2993  CB  ILE B  45     147.739 154.164 109.747  1.00 39.51           C  
ATOM   2994  CG1 ILE B  45     146.319 154.126 109.200  1.00 39.51           C  
ATOM   2995  CG2 ILE B  45     147.724 153.765 111.200  1.00 39.51           C  
ATOM   2996  CD1 ILE B  45     145.611 152.829 109.474  1.00 39.51           C  
ATOM   2997  N   PHE B  46     149.920 156.028 111.353  1.00 39.51           N  
ATOM   2998  CA  PHE B  46     151.206 155.979 112.040  1.00 39.51           C  
ATOM   2999  C   PHE B  46     150.990 155.313 113.390  1.00 39.51           C  
ATOM   3000  O   PHE B  46     150.514 155.954 114.329  1.00 39.51           O  
ATOM   3001  CB  PHE B  46     151.790 157.379 112.209  1.00 39.51           C  
ATOM   3002  CG  PHE B  46     153.194 157.394 112.727  1.00 39.51           C  
ATOM   3003  CD1 PHE B  46     153.448 157.409 114.082  1.00 39.51           C  
ATOM   3004  CD2 PHE B  46     154.263 157.415 111.856  1.00 39.51           C  
ATOM   3005  CE1 PHE B  46     154.738 157.434 114.555  1.00 39.51           C  
ATOM   3006  CE2 PHE B  46     155.555 157.439 112.326  1.00 39.51           C  
ATOM   3007  CZ  PHE B  46     155.791 157.448 113.676  1.00 39.51           C  
ATOM   3008  N   VAL B  47     151.334 154.032 113.494  1.00 39.51           N  
ATOM   3009  CA  VAL B  47     151.082 153.263 114.709  1.00 39.51           C  
ATOM   3010  C   VAL B  47     152.147 153.653 115.730  1.00 39.51           C  
ATOM   3011  O   VAL B  47     153.282 153.185 115.661  1.00 39.51           O  
ATOM   3012  CB  VAL B  47     151.084 151.758 114.439  1.00 39.51           C  
ATOM   3013  CG1 VAL B  47     150.954 150.994 115.730  1.00 39.51           C  
ATOM   3014  CG2 VAL B  47     149.960 151.396 113.498  1.00 39.51           C  
ATOM   3015  N   THR B  48     151.783 154.507 116.690  1.00 29.24           N  
ATOM   3016  CA  THR B  48     152.759 154.988 117.663  1.00 29.24           C  
ATOM   3017  C   THR B  48     153.254 153.859 118.550  1.00 29.24           C  
ATOM   3018  O   THR B  48     154.463 153.681 118.729  1.00 29.24           O  
ATOM   3019  CB  THR B  48     152.153 156.097 118.520  1.00 29.24           C  
ATOM   3020  OG1 THR B  48     152.143 157.320 117.779  1.00 29.24           O  
ATOM   3021  CG2 THR B  48     152.964 156.294 119.784  1.00 29.24           C  
ATOM   3022  N   SER B  49     152.336 153.087 119.118  1.00 26.20           N  
ATOM   3023  CA  SER B  49     152.719 151.985 119.984  1.00 26.20           C  
ATOM   3024  C   SER B  49     151.656 150.907 119.892  1.00 26.20           C  
ATOM   3025  O   SER B  49     150.462 151.199 119.952  1.00 26.20           O  
ATOM   3026  CB  SER B  49     152.887 152.443 121.433  1.00 26.20           C  
ATOM   3027  OG  SER B  49     151.657 152.899 121.963  1.00 26.20           O  
ATOM   3028  N   PHE B  50     152.102 149.667 119.760  1.00 19.46           N  
ATOM   3029  CA  PHE B  50     151.227 148.522 119.568  1.00 19.46           C  
ATOM   3030  C   PHE B  50     150.882 147.943 120.931  1.00 19.46           C  
ATOM   3031  O   PHE B  50     151.754 147.402 121.614  1.00 19.46           O  
ATOM   3032  CB  PHE B  50     151.918 147.485 118.689  1.00 19.46           C  
ATOM   3033  CG  PHE B  50     151.004 146.438 118.152  1.00 19.46           C  
ATOM   3034  CD1 PHE B  50     150.674 145.338 118.910  1.00 19.46           C  
ATOM   3035  CD2 PHE B  50     150.492 146.543 116.879  1.00 19.46           C  
ATOM   3036  CE1 PHE B  50     149.838 144.368 118.412  1.00 19.46           C  
ATOM   3037  CE2 PHE B  50     149.657 145.577 116.378  1.00 19.46           C  
ATOM   3038  CZ  PHE B  50     149.329 144.488 117.145  1.00 19.46           C  
ATOM   3039  N   GLY B  51     149.618 148.053 121.324  1.00 22.29           N  
ATOM   3040  CA  GLY B  51     149.200 147.705 122.661  1.00 22.29           C  
ATOM   3041  C   GLY B  51     149.344 146.232 122.973  1.00 22.29           C  
ATOM   3042  O   GLY B  51     149.691 145.421 122.112  1.00 22.29           O  
ATOM   3043  N   PRO B  52     149.082 145.858 124.225  1.00 22.59           N  
ATOM   3044  CA  PRO B  52     149.265 144.460 124.640  1.00 22.59           C  
ATOM   3045  C   PRO B  52     148.127 143.583 124.144  1.00 22.59           C  
ATOM   3046  O   PRO B  52     146.961 143.822 124.458  1.00 22.59           O  
ATOM   3047  CB  PRO B  52     149.286 144.548 126.169  1.00 22.59           C  
ATOM   3048  CG  PRO B  52     148.483 145.751 126.475  1.00 22.59           C  
ATOM   3049  CD  PRO B  52     148.719 146.726 125.355  1.00 22.59           C  
ATOM   3050  N   VAL B  53     148.476 142.554 123.373  1.00 22.88           N  
ATOM   3051  CA  VAL B  53     147.478 141.609 122.893  1.00 22.88           C  
ATOM   3052  C   VAL B  53     147.005 140.743 124.050  1.00 22.88           C  
ATOM   3053  O   VAL B  53     147.780 140.414 124.958  1.00 22.88           O  
ATOM   3054  CB  VAL B  53     148.061 140.751 121.759  1.00 22.88           C  
ATOM   3055  CG1 VAL B  53     146.988 139.881 121.144  1.00 22.88           C  
ATOM   3056  CG2 VAL B  53     148.693 141.631 120.707  1.00 22.88           C  
ATOM   3057  N   SER B  54     145.728 140.367 124.030  1.00 42.32           N  
ATOM   3058  CA  SER B  54     145.153 139.493 125.038  1.00 42.32           C  
ATOM   3059  C   SER B  54     144.673 138.212 124.378  1.00 42.32           C  
ATOM   3060  O   SER B  54     144.295 138.212 123.204  1.00 42.32           O  
ATOM   3061  CB  SER B  54     143.993 140.172 125.763  1.00 42.32           C  
ATOM   3062  OG  SER B  54     143.321 139.255 126.608  1.00 42.32           O  
ATOM   3063  N   ASP B  55     144.704 137.118 125.132  1.00 54.06           N  
ATOM   3064  CA  ASP B  55     144.256 135.830 124.624  1.00 54.06           C  
ATOM   3065  C   ASP B  55     142.902 135.407 125.168  1.00 54.06           C  
ATOM   3066  O   ASP B  55     142.203 134.629 124.513  1.00 54.06           O  
ATOM   3067  CB  ASP B  55     145.289 134.747 124.946  1.00 54.06           C  
ATOM   3068  CG  ASP B  55     146.551 134.888 124.122  1.00 54.06           C  
ATOM   3069  OD1 ASP B  55     146.449 135.322 122.957  1.00 54.06           O  
ATOM   3070  OD2 ASP B  55     147.643 134.568 124.634  1.00 54.06           O  
ATOM   3071  N   HIS B  56     142.513 135.894 126.347  1.00 62.38           N  
ATOM   3072  CA  HIS B  56     141.245 135.468 126.930  1.00 62.38           C  
ATOM   3073  C   HIS B  56     140.060 136.054 126.175  1.00 62.38           C  
ATOM   3074  O   HIS B  56     139.037 135.383 126.000  1.00 62.38           O  
ATOM   3075  CB  HIS B  56     141.187 135.850 128.407  1.00 62.38           C  
ATOM   3076  CG  HIS B  56     142.156 135.098 129.264  1.00 62.38           C  
ATOM   3077  ND1 HIS B  56     143.461 135.503 129.443  1.00 62.38           N  
ATOM   3078  CD2 HIS B  56     142.012 133.964 129.989  1.00 62.38           C  
ATOM   3079  CE1 HIS B  56     144.077 134.653 130.244  1.00 62.38           C  
ATOM   3080  NE2 HIS B  56     143.220 133.709 130.589  1.00 62.38           N  
ATOM   3081  N   ASP B  57     140.171 137.302 125.726  1.00 56.24           N  
ATOM   3082  CA  ASP B  57     139.099 137.955 124.988  1.00 56.24           C  
ATOM   3083  C   ASP B  57     139.392 138.087 123.502  1.00 56.24           C  
ATOM   3084  O   ASP B  57     138.514 138.518 122.750  1.00 56.24           O  
ATOM   3085  CB  ASP B  57     138.822 139.339 125.576  1.00 56.24           C  
ATOM   3086  CG  ASP B  57     138.265 139.271 126.975  1.00 56.24           C  
ATOM   3087  OD1 ASP B  57     137.688 138.223 127.330  1.00 56.24           O  
ATOM   3088  OD2 ASP B  57     138.399 140.263 127.720  1.00 56.24           O  
ATOM   3089  N   MET B  58     140.598 137.727 123.065  1.00 46.32           N  
ATOM   3090  CA  MET B  58     140.997 137.837 121.664  1.00 46.32           C  
ATOM   3091  C   MET B  58     140.858 139.274 121.166  1.00 46.32           C  
ATOM   3092  O   MET B  58     140.188 139.550 120.172  1.00 46.32           O  
ATOM   3093  CB  MET B  58     140.198 136.872 120.785  1.00 46.32           C  
ATOM   3094  CG  MET B  58     140.358 135.412 121.160  1.00 46.32           C  
ATOM   3095  SD  MET B  58     139.473 134.308 120.044  1.00 46.32           S  
ATOM   3096  CE  MET B  58     139.858 132.720 120.774  1.00 46.32           C  
ATOM   3097  N   GLU B  59     141.496 140.197 121.878  1.00 34.10           N  
ATOM   3098  CA  GLU B  59     141.485 141.603 121.512  1.00 34.10           C  
ATOM   3099  C   GLU B  59     142.876 142.193 121.687  1.00 34.10           C  
ATOM   3100  O   GLU B  59     143.646 141.772 122.554  1.00 34.10           O  
ATOM   3101  CB  GLU B  59     140.487 142.394 122.354  1.00 34.10           C  
ATOM   3102  CG  GLU B  59     140.885 142.519 123.808  1.00 34.10           C  
ATOM   3103  CD  GLU B  59     140.028 143.508 124.560  1.00 34.10           C  
ATOM   3104  OE1 GLU B  59     138.949 143.872 124.049  1.00 34.10           O  
ATOM   3105  OE2 GLU B  59     140.433 143.929 125.663  1.00 34.10           O  
ATOM   3106  N   TYR B  60     143.192 143.180 120.858  1.00 18.53           N  
ATOM   3107  CA  TYR B  60     144.459 143.881 120.975  1.00 18.53           C  
ATOM   3108  C   TYR B  60     144.228 145.381 120.917  1.00 18.53           C  
ATOM   3109  O   TYR B  60     143.442 145.870 120.101  1.00 18.53           O  
ATOM   3110  CB  TYR B  60     145.442 143.455 119.886  1.00 18.53           C  
ATOM   3111  CG  TYR B  60     145.103 143.956 118.511  1.00 18.53           C  
ATOM   3112  CD1 TYR B  60     144.232 143.262 117.700  1.00 18.53           C  
ATOM   3113  CD2 TYR B  60     145.668 145.117 118.019  1.00 18.53           C  
ATOM   3114  CE1 TYR B  60     143.924 143.711 116.443  1.00 18.53           C  
ATOM   3115  CE2 TYR B  60     145.365 145.575 116.764  1.00 18.53           C  
ATOM   3116  CZ  TYR B  60     144.492 144.869 115.981  1.00 18.53           C  
ATOM   3117  OH  TYR B  60     144.188 145.328 114.725  1.00 18.53           O  
ATOM   3118  N   THR B  61     144.907 146.097 121.805  1.00 17.62           N  
ATOM   3119  CA  THR B  61     144.891 147.548 121.817  1.00 17.62           C  
ATOM   3120  C   THR B  61     145.930 148.079 120.840  1.00 17.62           C  
ATOM   3121  O   THR B  61     146.932 147.422 120.557  1.00 17.62           O  
ATOM   3122  CB  THR B  61     145.180 148.063 123.227  1.00 17.62           C  
ATOM   3123  OG1 THR B  61     144.308 147.412 124.158  1.00 17.62           O  
ATOM   3124  CG2 THR B  61     144.964 149.560 123.324  1.00 17.62           C  
ATOM   3125  N   ILE B  62     145.674 149.268 120.301  1.00 15.60           N  
ATOM   3126  CA  ILE B  62     146.632 149.929 119.426  1.00 15.60           C  
ATOM   3127  C   ILE B  62     146.460 151.433 119.576  1.00 15.60           C  
ATOM   3128  O   ILE B  62     145.348 151.930 119.769  1.00 15.60           O  
ATOM   3129  CB  ILE B  62     146.458 149.476 117.959  1.00 15.60           C  
ATOM   3130  CG1 ILE B  62     147.566 150.038 117.081  1.00 15.60           C  
ATOM   3131  CG2 ILE B  62     145.115 149.896 117.425  1.00 15.60           C  
ATOM   3132  CD1 ILE B  62     147.449 149.613 115.645  1.00 15.60           C  
ATOM   3133  N   ASP B  63     147.574 152.158 119.507  1.00 27.98           N  
ATOM   3134  CA  ASP B  63     147.586 153.614 119.589  1.00 27.98           C  
ATOM   3135  C   ASP B  63     148.087 154.158 118.261  1.00 27.98           C  
ATOM   3136  O   ASP B  63     149.202 153.838 117.841  1.00 27.98           O  
ATOM   3137  CB  ASP B  63     148.473 154.090 120.739  1.00 27.98           C  
ATOM   3138  CG  ASP B  63     148.568 155.604 120.823  1.00 27.98           C  
ATOM   3139  OD1 ASP B  63     147.823 156.297 120.100  1.00 27.98           O  
ATOM   3140  OD2 ASP B  63     149.389 156.106 121.618  1.00 27.98           O  
ATOM   3141  N   VAL B  64     147.281 154.990 117.606  1.00 22.45           N  
ATOM   3142  CA  VAL B  64     147.569 155.391 116.237  1.00 22.45           C  
ATOM   3143  C   VAL B  64     147.422 156.894 116.073  1.00 22.45           C  
ATOM   3144  O   VAL B  64     146.659 157.550 116.787  1.00 22.45           O  
ATOM   3145  CB  VAL B  64     146.651 154.679 115.222  1.00 22.45           C  
ATOM   3146  CG1 VAL B  64     146.746 153.183 115.370  1.00 22.45           C  
ATOM   3147  CG2 VAL B  64     145.222 155.128 115.396  1.00 22.45           C  
ATOM   3148  N   PHE B  65     148.178 157.434 115.127  1.00 39.51           N  
ATOM   3149  CA  PHE B  65     147.874 158.699 114.479  1.00 39.51           C  
ATOM   3150  C   PHE B  65     147.178 158.358 113.173  1.00 39.51           C  
ATOM   3151  O   PHE B  65     147.616 157.451 112.461  1.00 39.51           O  
ATOM   3152  CB  PHE B  65     149.140 159.503 114.186  1.00 39.51           C  
ATOM   3153  CG  PHE B  65     149.750 160.166 115.382  1.00 39.51           C  
ATOM   3154  CD1 PHE B  65     150.251 159.423 116.429  1.00 39.51           C  
ATOM   3155  CD2 PHE B  65     149.872 161.537 115.430  1.00 39.51           C  
ATOM   3156  CE1 PHE B  65     150.829 160.038 117.513  1.00 39.51           C  
ATOM   3157  CE2 PHE B  65     150.450 162.152 116.510  1.00 39.51           C  
ATOM   3158  CZ  PHE B  65     150.928 161.401 117.553  1.00 39.51           C  
ATOM   3159  N   PHE B  66     146.117 159.084 112.850  1.00 39.51           N  
ATOM   3160  CA  PHE B  66     145.277 158.764 111.703  1.00 39.51           C  
ATOM   3161  C   PHE B  66     145.146 160.009 110.845  1.00 39.51           C  
ATOM   3162  O   PHE B  66     144.575 161.005 111.296  1.00 39.51           O  
ATOM   3163  CB  PHE B  66     143.906 158.285 112.178  1.00 39.51           C  
ATOM   3164  CG  PHE B  66     143.125 157.541 111.147  1.00 39.51           C  
ATOM   3165  CD1 PHE B  66     142.427 158.215 110.172  1.00 39.51           C  
ATOM   3166  CD2 PHE B  66     143.067 156.166 111.169  1.00 39.51           C  
ATOM   3167  CE1 PHE B  66     141.698 157.530 109.230  1.00 39.51           C  
ATOM   3168  CE2 PHE B  66     142.339 155.479 110.229  1.00 39.51           C  
ATOM   3169  CZ  PHE B  66     141.655 156.162 109.258  1.00 39.51           C  
ATOM   3170  N   ARG B  67     145.667 159.966 109.620  1.00 26.58           N  
ATOM   3171  CA  ARG B  67     145.709 161.130 108.745  1.00 26.58           C  
ATOM   3172  C   ARG B  67     144.833 160.903 107.523  1.00 26.58           C  
ATOM   3173  O   ARG B  67     144.911 159.849 106.888  1.00 26.58           O  
ATOM   3174  CB  ARG B  67     147.142 161.420 108.306  1.00 26.58           C  
ATOM   3175  CG  ARG B  67     148.102 161.584 109.455  1.00 26.58           C  
ATOM   3176  CD  ARG B  67     149.534 161.458 108.996  1.00 26.58           C  
ATOM   3177  NE  ARG B  67     150.465 161.561 110.111  1.00 26.58           N  
ATOM   3178  CZ  ARG B  67     151.712 161.111 110.077  1.00 26.58           C  
ATOM   3179  NH1 ARG B  67     152.494 161.245 111.136  1.00 26.58           N  
ATOM   3180  NH2 ARG B  67     152.171 160.518 108.986  1.00 26.58           N  
ATOM   3181  N   GLN B  68     144.021 161.898 107.185  1.00 39.51           N  
ATOM   3182  CA  GLN B  68     143.143 161.851 106.028  1.00 39.51           C  
ATOM   3183  C   GLN B  68     143.290 163.138 105.235  1.00 39.51           C  
ATOM   3184  O   GLN B  68     143.483 164.213 105.811  1.00 39.51           O  
ATOM   3185  CB  GLN B  68     141.691 161.672 106.450  1.00 39.51           C  
ATOM   3186  CG  GLN B  68     141.423 160.390 107.189  1.00 39.51           C  
ATOM   3187  CD  GLN B  68     140.131 160.437 107.966  1.00 39.51           C  
ATOM   3188  OE1 GLN B  68     139.800 161.449 108.577  1.00 39.51           O  
ATOM   3189  NE2 GLN B  68     139.385 159.342 107.941  1.00 39.51           N  
ATOM   3190  N   SER B  69     143.209 163.030 103.914  1.00 26.56           N  
ATOM   3191  CA  SER B  69     143.307 164.202 103.054  1.00 26.56           C  
ATOM   3192  C   SER B  69     142.370 164.063 101.867  1.00 26.56           C  
ATOM   3193  O   SER B  69     142.413 163.057 101.157  1.00 26.56           O  
ATOM   3194  CB  SER B  69     144.739 164.408 102.564  1.00 26.56           C  
ATOM   3195  OG  SER B  69     144.793 165.471 101.633  1.00 26.56           O  
ATOM   3196  N   TRP B  70     141.535 165.072 101.649  1.00 39.51           N  
ATOM   3197  CA  TRP B  70     140.631 165.095 100.512  1.00 39.51           C  
ATOM   3198  C   TRP B  70     140.669 166.477  99.887  1.00 39.51           C  
ATOM   3199  O   TRP B  70     141.053 167.455 100.528  1.00 39.51           O  
ATOM   3200  CB  TRP B  70     139.198 164.745 100.914  1.00 39.51           C  
ATOM   3201  CG  TRP B  70     138.601 165.709 101.873  1.00 39.51           C  
ATOM   3202  CD1 TRP B  70     137.784 166.752 101.579  1.00 39.51           C  
ATOM   3203  CD2 TRP B  70     138.770 165.717 103.290  1.00 39.51           C  
ATOM   3204  NE1 TRP B  70     137.430 167.413 102.727  1.00 39.51           N  
ATOM   3205  CE2 TRP B  70     138.026 166.795 103.792  1.00 39.51           C  
ATOM   3206  CE3 TRP B  70     139.477 164.914 104.183  1.00 39.51           C  
ATOM   3207  CZ2 TRP B  70     137.972 167.093 105.143  1.00 39.51           C  
ATOM   3208  CZ3 TRP B  70     139.423 165.213 105.522  1.00 39.51           C  
ATOM   3209  CH2 TRP B  70     138.679 166.294 105.991  1.00 39.51           C  
ATOM   3210  N   LYS B  71     140.268 166.554  98.625  1.00 30.39           N  
ATOM   3211  CA  LYS B  71     140.262 167.813  97.892  1.00 30.39           C  
ATOM   3212  C   LYS B  71     138.867 168.412  97.977  1.00 30.39           C  
ATOM   3213  O   LYS B  71     137.917 167.871  97.406  1.00 30.39           O  
ATOM   3214  CB  LYS B  71     140.682 167.609  96.440  1.00 30.39           C  
ATOM   3215  CG  LYS B  71     140.714 168.893  95.636  1.00 30.39           C  
ATOM   3216  CD  LYS B  71     141.246 168.661  94.238  1.00 30.39           C  
ATOM   3217  CE  LYS B  71     141.183 169.936  93.423  1.00 30.39           C  
ATOM   3218  NZ  LYS B  71     141.911 171.043  94.096  1.00 30.39           N  
ATOM   3219  N   ASP B  72     138.749 169.531  98.681  1.00 36.67           N  
ATOM   3220  CA  ASP B  72     137.487 170.240  98.839  1.00 36.67           C  
ATOM   3221  C   ASP B  72     137.570 171.533  98.045  1.00 36.67           C  
ATOM   3222  O   ASP B  72     138.400 172.397  98.342  1.00 36.67           O  
ATOM   3223  CB  ASP B  72     137.195 170.524 100.311  1.00 36.67           C  
ATOM   3224  CG  ASP B  72     135.781 171.000 100.540  1.00 36.67           C  
ATOM   3225  OD1 ASP B  72     135.042 171.170  99.551  1.00 36.67           O  
ATOM   3226  OD2 ASP B  72     135.404 171.196 101.713  1.00 36.67           O  
ATOM   3227  N   GLU B  73     136.703 171.663  97.043  1.00 36.82           N  
ATOM   3228  CA  GLU B  73     136.855 172.733  96.066  1.00 36.82           C  
ATOM   3229  C   GLU B  73     136.397 174.079  96.610  1.00 36.82           C  
ATOM   3230  O   GLU B  73     136.885 175.122  96.165  1.00 36.82           O  
ATOM   3231  CB  GLU B  73     136.083 172.377  94.798  1.00 36.82           C  
ATOM   3232  CG  GLU B  73     136.437 173.217  93.586  1.00 36.82           C  
ATOM   3233  CD  GLU B  73     135.878 172.636  92.300  1.00 36.82           C  
ATOM   3234  OE1 GLU B  73     135.482 171.452  92.308  1.00 36.82           O  
ATOM   3235  OE2 GLU B  73     135.832 173.360  91.283  1.00 36.82           O  
ATOM   3236  N   ARG B  74     135.474 174.081  97.572  1.00 31.70           N  
ATOM   3237  CA  ARG B  74     134.857 175.333  97.998  1.00 31.70           C  
ATOM   3238  C   ARG B  74     135.765 176.150  98.909  1.00 31.70           C  
ATOM   3239  O   ARG B  74     135.623 177.374  98.977  1.00 31.70           O  
ATOM   3240  CB  ARG B  74     133.530 175.044  98.695  1.00 31.70           C  
ATOM   3241  CG  ARG B  74     132.522 174.342  97.808  1.00 31.70           C  
ATOM   3242  CD  ARG B  74     131.387 173.762  98.624  1.00 31.70           C  
ATOM   3243  NE  ARG B  74     131.878 172.822  99.623  1.00 31.70           N  
ATOM   3244  CZ  ARG B  74     131.100 172.145 100.459  1.00 31.70           C  
ATOM   3245  NH1 ARG B  74     129.786 172.304 100.418  1.00 31.70           N  
ATOM   3246  NH2 ARG B  74     131.636 171.311 101.337  1.00 31.70           N  
ATOM   3247  N   LEU B  75     136.686 175.505  99.620  1.00 31.66           N  
ATOM   3248  CA  LEU B  75     137.511 176.209 100.593  1.00 31.66           C  
ATOM   3249  C   LEU B  75     138.746 176.862  99.994  1.00 31.66           C  
ATOM   3250  O   LEU B  75     139.598 177.328 100.754  1.00 31.66           O  
ATOM   3251  CB  LEU B  75     137.946 175.262 101.707  1.00 31.66           C  
ATOM   3252  CG  LEU B  75     136.820 174.612 102.501  1.00 31.66           C  
ATOM   3253  CD1 LEU B  75     137.363 173.982 103.766  1.00 31.66           C  
ATOM   3254  CD2 LEU B  75     135.753 175.630 102.824  1.00 31.66           C  
ATOM   3255  N   LYS B  76     138.883 176.906  98.673  1.00 38.19           N  
ATOM   3256  CA  LYS B  76     140.059 177.537  98.092  1.00 38.19           C  
ATOM   3257  C   LYS B  76     140.014 179.042  98.314  1.00 38.19           C  
ATOM   3258  O   LYS B  76     138.950 179.664  98.256  1.00 38.19           O  
ATOM   3259  CB  LYS B  76     140.161 177.219  96.602  1.00 38.19           C  
ATOM   3260  CG  LYS B  76     138.997 177.701  95.766  1.00 38.19           C  
ATOM   3261  CD  LYS B  76     139.210 177.335  94.308  1.00 38.19           C  
ATOM   3262  CE  LYS B  76     138.067 177.823  93.439  1.00 38.19           C  
ATOM   3263  NZ  LYS B  76     138.264 177.462  92.009  1.00 38.19           N  
ATOM   3264  N   PHE B  77     141.179 179.625  98.582  1.00 39.57           N  
ATOM   3265  CA  PHE B  77     141.295 181.049  98.854  1.00 39.57           C  
ATOM   3266  C   PHE B  77     142.609 181.555  98.281  1.00 39.57           C  
ATOM   3267  O   PHE B  77     143.372 180.810  97.662  1.00 39.57           O  
ATOM   3268  CB  PHE B  77     141.226 181.344 100.355  1.00 39.57           C  
ATOM   3269  CG  PHE B  77     142.378 180.783 101.133  1.00 39.57           C  
ATOM   3270  CD1 PHE B  77     142.335 179.493 101.618  1.00 39.57           C  
ATOM   3271  CD2 PHE B  77     143.503 181.545 101.380  1.00 39.57           C  
ATOM   3272  CE1 PHE B  77     143.390 178.976 102.332  1.00 39.57           C  
ATOM   3273  CE2 PHE B  77     144.559 181.029 102.093  1.00 39.57           C  
ATOM   3274  CZ  PHE B  77     144.503 179.745 102.569  1.00 39.57           C  
ATOM   3275  N   LYS B  78     142.870 182.842  98.495  1.00 50.95           N  
ATOM   3276  CA  LYS B  78     144.129 183.463  98.103  1.00 50.95           C  
ATOM   3277  C   LYS B  78     144.565 184.408  99.208  1.00 50.95           C  
ATOM   3278  O   LYS B  78     143.807 185.301  99.597  1.00 50.95           O  
ATOM   3279  CB  LYS B  78     143.988 184.212  96.779  1.00 50.95           C  
ATOM   3280  CG  LYS B  78     145.308 184.660  96.180  1.00 50.95           C  
ATOM   3281  CD  LYS B  78     145.083 185.376  94.862  1.00 50.95           C  
ATOM   3282  CE  LYS B  78     144.234 184.535  93.923  1.00 50.95           C  
ATOM   3283  NZ  LYS B  78     143.880 185.274  92.681  1.00 50.95           N  
ATOM   3284  N   GLY B  79     145.779 184.214  99.711  1.00 55.93           N  
ATOM   3285  CA  GLY B  79     146.294 185.030 100.783  1.00 55.93           C  
ATOM   3286  C   GLY B  79     147.801 184.956 100.896  1.00 55.93           C  
ATOM   3287  O   GLY B  79     148.472 184.245 100.143  1.00 55.93           O  
ATOM   3288  N   PRO B  80     148.367 185.705 101.845  1.00 54.35           N  
ATOM   3289  CA  PRO B  80     149.829 185.686 102.008  1.00 54.35           C  
ATOM   3290  C   PRO B  80     150.359 184.417 102.655  1.00 54.35           C  
ATOM   3291  O   PRO B  80     151.564 184.153 102.567  1.00 54.35           O  
ATOM   3292  CB  PRO B  80     150.095 186.919 102.880  1.00 54.35           C  
ATOM   3293  CG  PRO B  80     148.830 187.107 103.650  1.00 54.35           C  
ATOM   3294  CD  PRO B  80     147.718 186.683 102.733  1.00 54.35           C  
ATOM   3295  N   MET B  81     149.508 183.631 103.318  1.00 45.66           N  
ATOM   3296  CA  MET B  81     149.999 182.478 104.071  1.00 45.66           C  
ATOM   3297  C   MET B  81     150.367 181.317 103.154  1.00 45.66           C  
ATOM   3298  O   MET B  81     151.466 180.762 103.257  1.00 45.66           O  
ATOM   3299  CB  MET B  81     148.955 182.038 105.093  1.00 45.66           C  
ATOM   3300  CG  MET B  81     148.917 182.892 106.335  1.00 45.66           C  
ATOM   3301  SD  MET B  81     150.506 182.922 107.181  1.00 45.66           S  
ATOM   3302  CE  MET B  81     150.723 181.188 107.568  1.00 45.66           C  
ATOM   3303  N   THR B  82     149.439 180.917 102.280  1.00 41.22           N  
ATOM   3304  CA  THR B  82     149.546 179.775 101.369  1.00 41.22           C  
ATOM   3305  C   THR B  82     149.438 178.446 102.109  1.00 41.22           C  
ATOM   3306  O   THR B  82     149.397 177.391 101.472  1.00 41.22           O  
ATOM   3307  CB  THR B  82     150.840 179.799 100.548  1.00 41.22           C  
ATOM   3308  OG1 THR B  82     151.961 179.550 101.404  1.00 41.22           O  
ATOM   3309  CG2 THR B  82     151.017 181.141  99.856  1.00 41.22           C  
ATOM   3310  N   VAL B  83     149.392 178.487 103.439  1.00 28.61           N  
ATOM   3311  CA  VAL B  83     149.058 177.335 104.274  1.00 28.61           C  
ATOM   3312  C   VAL B  83     148.482 177.865 105.576  1.00 28.61           C  
ATOM   3313  O   VAL B  83     149.117 178.673 106.258  1.00 28.61           O  
ATOM   3314  CB  VAL B  83     150.270 176.426 104.566  1.00 28.61           C  
ATOM   3315  CG1 VAL B  83     150.071 175.693 105.876  1.00 28.61           C  
ATOM   3316  CG2 VAL B  83     150.470 175.414 103.465  1.00 28.61           C  
ATOM   3317  N   LEU B  84     147.282 177.422 105.924  1.00 22.89           N  
ATOM   3318  CA  LEU B  84     146.635 177.818 107.164  1.00 22.89           C  
ATOM   3319  C   LEU B  84     146.670 176.646 108.129  1.00 22.89           C  
ATOM   3320  O   LEU B  84     146.141 175.571 107.824  1.00 22.89           O  
ATOM   3321  CB  LEU B  84     145.196 178.262 106.920  1.00 22.89           C  
ATOM   3322  CG  LEU B  84     144.999 179.569 106.163  1.00 22.89           C  
ATOM   3323  CD1 LEU B  84     143.524 179.822 105.948  1.00 22.89           C  
ATOM   3324  CD2 LEU B  84     145.627 180.704 106.937  1.00 22.89           C  
ATOM   3325  N   ARG B  85     147.304 176.849 109.277  1.00 21.33           N  
ATOM   3326  CA  ARG B  85     147.224 175.924 110.395  1.00 21.33           C  
ATOM   3327  C   ARG B  85     146.179 176.464 111.358  1.00 21.33           C  
ATOM   3328  O   ARG B  85     146.417 177.467 112.037  1.00 21.33           O  
ATOM   3329  CB  ARG B  85     148.575 175.784 111.092  1.00 21.33           C  
ATOM   3330  CG  ARG B  85     149.723 175.493 110.156  1.00 21.33           C  
ATOM   3331  CD  ARG B  85     151.049 175.623 110.874  1.00 21.33           C  
ATOM   3332  NE  ARG B  85     152.168 175.264 110.012  1.00 21.33           N  
ATOM   3333  CZ  ARG B  85     152.826 176.126 109.245  1.00 21.33           C  
ATOM   3334  NH1 ARG B  85     153.833 175.708 108.491  1.00 21.33           N  
ATOM   3335  NH2 ARG B  85     152.478 177.404 109.231  1.00 21.33           N  
ATOM   3336  N   LEU B  86     145.029 175.809 111.411  1.00 16.36           N  
ATOM   3337  CA  LEU B  86     143.914 176.286 112.208  1.00 16.36           C  
ATOM   3338  C   LEU B  86     143.813 175.488 113.497  1.00 16.36           C  
ATOM   3339  O   LEU B  86     144.335 174.377 113.615  1.00 16.36           O  
ATOM   3340  CB  LEU B  86     142.601 176.184 111.432  1.00 16.36           C  
ATOM   3341  CG  LEU B  86     142.564 176.924 110.102  1.00 16.36           C  
ATOM   3342  CD1 LEU B  86     141.338 176.520 109.324  1.00 16.36           C  
ATOM   3343  CD2 LEU B  86     142.577 178.417 110.333  1.00 16.36           C  
ATOM   3344  N   ASN B  87     143.135 176.084 114.472  1.00 22.27           N  
ATOM   3345  CA  ASN B  87     142.850 175.399 115.718  1.00 22.27           C  
ATOM   3346  C   ASN B  87     141.931 174.211 115.456  1.00 22.27           C  
ATOM   3347  O   ASN B  87     141.323 174.079 114.391  1.00 22.27           O  
ATOM   3348  CB  ASN B  87     142.207 176.357 116.720  1.00 22.27           C  
ATOM   3349  CG  ASN B  87     142.709 176.150 118.136  1.00 22.27           C  
ATOM   3350  OD1 ASN B  87     142.696 177.071 118.951  1.00 22.27           O  
ATOM   3351  ND2 ASN B  87     143.167 174.942 118.432  1.00 22.27           N  
ATOM   3352  N   ASN B  88     141.831 173.333 116.450  1.00 20.08           N  
ATOM   3353  CA  ASN B  88     140.935 172.192 116.325  1.00 20.08           C  
ATOM   3354  C   ASN B  88     139.480 172.633 116.249  1.00 20.08           C  
ATOM   3355  O   ASN B  88     138.638 171.909 115.705  1.00 20.08           O  
ATOM   3356  CB  ASN B  88     141.149 171.247 117.501  1.00 20.08           C  
ATOM   3357  CG  ASN B  88     142.576 171.278 118.012  1.00 20.08           C  
ATOM   3358  OD1 ASN B  88     142.823 171.576 119.179  1.00 20.08           O  
ATOM   3359  ND2 ASN B  88     143.524 170.977 117.136  1.00 20.08           N  
ATOM   3360  N   LEU B  89     139.178 173.830 116.761  1.00 20.82           N  
ATOM   3361  CA  LEU B  89     137.796 174.293 116.854  1.00 20.82           C  
ATOM   3362  C   LEU B  89     137.120 174.331 115.491  1.00 20.82           C  
ATOM   3363  O   LEU B  89     135.937 173.998 115.371  1.00 20.82           O  
ATOM   3364  CB  LEU B  89     137.761 175.675 117.509  1.00 20.82           C  
ATOM   3365  CG  LEU B  89     136.419 176.363 117.778  1.00 20.82           C  
ATOM   3366  CD1 LEU B  89     135.940 177.172 116.581  1.00 20.82           C  
ATOM   3367  CD2 LEU B  89     135.369 175.349 118.196  1.00 20.82           C  
ATOM   3368  N   MET B  90     137.846 174.743 114.455  1.00 22.78           N  
ATOM   3369  CA  MET B  90     137.222 174.877 113.147  1.00 22.78           C  
ATOM   3370  C   MET B  90     136.997 173.530 112.473  1.00 22.78           C  
ATOM   3371  O   MET B  90     136.344 173.476 111.427  1.00 22.78           O  
ATOM   3372  CB  MET B  90     138.064 175.787 112.257  1.00 22.78           C  
ATOM   3373  CG  MET B  90     137.312 176.341 111.061  1.00 22.78           C  
ATOM   3374  SD  MET B  90     138.185 177.660 110.206  1.00 22.78           S  
ATOM   3375  CE  MET B  90     137.309 177.689 108.646  1.00 22.78           C  
ATOM   3376  N   ALA B  91     137.518 172.444 113.044  1.00 19.92           N  
ATOM   3377  CA  ALA B  91     137.316 171.131 112.442  1.00 19.92           C  
ATOM   3378  C   ALA B  91     135.840 170.764 112.372  1.00 19.92           C  
ATOM   3379  O   ALA B  91     135.419 170.030 111.473  1.00 19.92           O  
ATOM   3380  CB  ALA B  91     138.088 170.071 113.222  1.00 19.92           C  
ATOM   3381  N   SER B  92     135.038 171.255 113.317  1.00 20.52           N  
ATOM   3382  CA  SER B  92     133.638 170.847 113.373  1.00 20.52           C  
ATOM   3383  C   SER B  92     132.796 171.528 112.303  1.00 20.52           C  
ATOM   3384  O   SER B  92     131.714 171.037 111.969  1.00 20.52           O  
ATOM   3385  CB  SER B  92     133.055 171.144 114.751  1.00 20.52           C  
ATOM   3386  OG  SER B  92     132.806 172.528 114.904  1.00 20.52           O  
ATOM   3387  N   LYS B  93     133.258 172.657 111.768  1.00 21.42           N  
ATOM   3388  CA  LYS B  93     132.407 173.446 110.884  1.00 21.42           C  
ATOM   3389  C   LYS B  93     132.472 172.948 109.445  1.00 21.42           C  
ATOM   3390  O   LYS B  93     131.443 172.849 108.770  1.00 21.42           O  
ATOM   3391  CB  LYS B  93     132.787 174.920 110.976  1.00 21.42           C  
ATOM   3392  CG  LYS B  93     132.554 175.492 112.362  1.00 21.42           C  
ATOM   3393  CD  LYS B  93     132.741 176.990 112.398  1.00 21.42           C  
ATOM   3394  CE  LYS B  93     132.470 177.536 113.789  1.00 21.42           C  
ATOM   3395  NZ  LYS B  93     132.670 179.009 113.855  1.00 21.42           N  
ATOM   3396  N   ILE B  94     133.668 172.640 108.951  1.00 19.65           N  
ATOM   3397  CA  ILE B  94     133.815 172.108 107.601  1.00 19.65           C  
ATOM   3398  C   ILE B  94     133.333 170.667 107.577  1.00 19.65           C  
ATOM   3399  O   ILE B  94     133.111 170.059 108.629  1.00 19.65           O  
ATOM   3400  CB  ILE B  94     135.270 172.193 107.119  1.00 19.65           C  
ATOM   3401  CG1 ILE B  94     136.161 171.380 108.052  1.00 19.65           C  
ATOM   3402  CG2 ILE B  94     135.727 173.631 107.065  1.00 19.65           C  
ATOM   3403  CD1 ILE B  94     137.610 171.411 107.681  1.00 19.65           C  
ATOM   3404  N   TRP B  95     133.163 170.109 106.383  1.00 19.52           N  
ATOM   3405  CA  TRP B  95     132.817 168.699 106.276  1.00 19.52           C  
ATOM   3406  C   TRP B  95     133.978 167.838 106.753  1.00 19.52           C  
ATOM   3407  O   TRP B  95     135.145 168.212 106.619  1.00 19.52           O  
ATOM   3408  CB  TRP B  95     132.460 168.344 104.836  1.00 19.52           C  
ATOM   3409  CG  TRP B  95     132.056 166.919 104.663  1.00 19.52           C  
ATOM   3410  CD1 TRP B  95     130.920 166.332 105.123  1.00 19.52           C  
ATOM   3411  CD2 TRP B  95     132.780 165.899 103.971  1.00 19.52           C  
ATOM   3412  NE1 TRP B  95     130.892 165.008 104.768  1.00 19.52           N  
ATOM   3413  CE2 TRP B  95     132.025 164.719 104.057  1.00 19.52           C  
ATOM   3414  CE3 TRP B  95     133.997 165.869 103.291  1.00 19.52           C  
ATOM   3415  CZ2 TRP B  95     132.446 163.524 103.492  1.00 19.52           C  
ATOM   3416  CZ3 TRP B  95     134.408 164.683 102.725  1.00 19.52           C  
ATOM   3417  CH2 TRP B  95     133.637 163.527 102.830  1.00 19.52           C  
ATOM   3418  N   THR B  96     133.655 166.684 107.322  1.00 22.02           N  
ATOM   3419  CA  THR B  96     134.667 165.747 107.791  1.00 22.02           C  
ATOM   3420  C   THR B  96     134.221 164.318 107.516  1.00 22.02           C  
ATOM   3421  O   THR B  96     133.180 163.887 108.024  1.00 22.02           O  
ATOM   3422  CB  THR B  96     134.930 165.930 109.282  1.00 22.02           C  
ATOM   3423  OG1 THR B  96     133.688 166.144 109.961  1.00 22.02           O  
ATOM   3424  CG2 THR B  96     135.846 167.110 109.522  1.00 22.02           C  
ATOM   3425  N   PRO B  97     134.980 163.554 106.737  1.00 18.33           N  
ATOM   3426  CA  PRO B  97     134.556 162.191 106.411  1.00 18.33           C  
ATOM   3427  C   PRO B  97     134.486 161.332 107.660  1.00 18.33           C  
ATOM   3428  O   PRO B  97     135.365 161.383 108.521  1.00 18.33           O  
ATOM   3429  CB  PRO B  97     135.648 161.705 105.455  1.00 18.33           C  
ATOM   3430  CG  PRO B  97     136.839 162.480 105.853  1.00 18.33           C  
ATOM   3431  CD  PRO B  97     136.329 163.837 106.232  1.00 18.33           C  
ATOM   3432  N   ASP B  98     133.421 160.545 107.756  1.00 21.27           N  
ATOM   3433  CA  ASP B  98     133.219 159.637 108.874  1.00 21.27           C  
ATOM   3434  C   ASP B  98     133.834 158.295 108.521  1.00 21.27           C  
ATOM   3435  O   ASP B  98     133.327 157.584 107.650  1.00 21.27           O  
ATOM   3436  CB  ASP B  98     131.735 159.482 109.188  1.00 21.27           C  
ATOM   3437  CG  ASP B  98     130.891 159.406 107.946  1.00 21.27           C  
ATOM   3438  OD1 ASP B  98     131.464 159.489 106.841  1.00 21.27           O  
ATOM   3439  OD2 ASP B  98     129.657 159.269 108.072  1.00 21.27           O  
ATOM   3440  N   THR B  99     134.921 157.953 109.199  1.00 21.23           N  
ATOM   3441  CA  THR B  99     135.658 156.725 108.950  1.00 21.23           C  
ATOM   3442  C   THR B  99     135.633 155.898 110.220  1.00 21.23           C  
ATOM   3443  O   THR B  99     136.225 156.293 111.227  1.00 21.23           O  
ATOM   3444  CB  THR B  99     137.097 157.028 108.540  1.00 21.23           C  
ATOM   3445  OG1 THR B  99     137.115 157.565 107.214  1.00 21.23           O  
ATOM   3446  CG2 THR B  99     137.928 155.772 108.578  1.00 21.23           C  
ATOM   3447  N   PHE B 100     134.950 154.761 110.183  1.00 18.44           N  
ATOM   3448  CA  PHE B 100     134.812 153.940 111.373  1.00 18.44           C  
ATOM   3449  C   PHE B 100     135.528 152.616 111.173  1.00 18.44           C  
ATOM   3450  O   PHE B 100     135.664 152.133 110.041  1.00 18.44           O  
ATOM   3451  CB  PHE B 100     133.349 153.699 111.730  1.00 18.44           C  
ATOM   3452  CG  PHE B 100     132.695 152.632 110.918  1.00 18.44           C  
ATOM   3453  CD1 PHE B 100     132.171 152.921 109.679  1.00 18.44           C  
ATOM   3454  CD2 PHE B 100     132.585 151.344 111.399  1.00 18.44           C  
ATOM   3455  CE1 PHE B 100     131.562 151.947 108.930  1.00 18.44           C  
ATOM   3456  CE2 PHE B 100     131.976 150.365 110.651  1.00 18.44           C  
ATOM   3457  CZ  PHE B 100     131.464 150.667 109.415  1.00 18.44           C  
ATOM   3458  N   PHE B 101     135.986 152.042 112.283  1.00 15.87           N  
ATOM   3459  CA  PHE B 101     136.743 150.799 112.262  1.00 15.87           C  
ATOM   3460  C   PHE B 101     135.773 149.628 112.343  1.00 15.87           C  
ATOM   3461  O   PHE B 101     135.016 149.512 113.311  1.00 15.87           O  
ATOM   3462  CB  PHE B 101     137.741 150.767 113.416  1.00 15.87           C  
ATOM   3463  CG  PHE B 101     138.911 151.695 113.242  1.00 15.87           C  
ATOM   3464  CD1 PHE B 101     138.798 152.863 112.519  1.00 15.87           C  
ATOM   3465  CD2 PHE B 101     140.133 151.383 113.792  1.00 15.87           C  
ATOM   3466  CE1 PHE B 101     139.874 153.701 112.362  1.00 15.87           C  
ATOM   3467  CE2 PHE B 101     141.212 152.216 113.630  1.00 15.87           C  
ATOM   3468  CZ  PHE B 101     141.080 153.377 112.917  1.00 15.87           C  
ATOM   3469  N   HIS B 102     135.800 148.755 111.333  1.00 20.55           N  
ATOM   3470  CA  HIS B 102     134.771 147.729 111.196  1.00 20.55           C  
ATOM   3471  C   HIS B 102     134.757 146.728 112.343  1.00 20.55           C  
ATOM   3472  O   HIS B 102     133.729 146.083 112.563  1.00 20.55           O  
ATOM   3473  CB  HIS B 102     134.943 146.978 109.877  1.00 20.55           C  
ATOM   3474  CG  HIS B 102     134.268 147.635 108.716  1.00 20.55           C  
ATOM   3475  ND1 HIS B 102     132.914 147.535 108.491  1.00 20.55           N  
ATOM   3476  CD2 HIS B 102     134.761 148.395 107.710  1.00 20.55           C  
ATOM   3477  CE1 HIS B 102     132.600 148.208 107.399  1.00 20.55           C  
ATOM   3478  NE2 HIS B 102     133.703 148.740 106.906  1.00 20.55           N  
ATOM   3479  N   ASN B 103     135.858 146.565 113.068  1.00 20.94           N  
ATOM   3480  CA  ASN B 103     135.910 145.583 114.145  1.00 20.94           C  
ATOM   3481  C   ASN B 103     136.553 146.180 115.388  1.00 20.94           C  
ATOM   3482  O   ASN B 103     137.471 145.611 115.981  1.00 20.94           O  
ATOM   3483  CB  ASN B 103     136.636 144.319 113.701  1.00 20.94           C  
ATOM   3484  CG  ASN B 103     138.054 144.581 113.272  1.00 20.94           C  
ATOM   3485  OD1 ASN B 103     138.522 145.715 113.297  1.00 20.94           O  
ATOM   3486  ND2 ASN B 103     138.755 143.526 112.884  1.00 20.94           N  
ATOM   3487  N   GLY B 104     136.077 147.347 115.801  1.00 20.68           N  
ATOM   3488  CA  GLY B 104     136.568 147.953 117.021  1.00 20.68           C  
ATOM   3489  C   GLY B 104     135.604 147.767 118.170  1.00 20.68           C  
ATOM   3490  O   GLY B 104     134.454 148.200 118.088  1.00 20.68           O  
ATOM   3491  N   LYS B 105     136.050 147.119 119.245  1.00 26.65           N  
ATOM   3492  CA  LYS B 105     135.161 146.862 120.373  1.00 26.65           C  
ATOM   3493  C   LYS B 105     134.771 148.157 121.073  1.00 26.65           C  
ATOM   3494  O   LYS B 105     133.583 148.440 121.254  1.00 26.65           O  
ATOM   3495  CB  LYS B 105     135.819 145.888 121.351  1.00 26.65           C  
ATOM   3496  CG  LYS B 105     135.951 144.479 120.802  1.00 26.65           C  
ATOM   3497  CD  LYS B 105     136.528 143.521 121.826  1.00 26.65           C  
ATOM   3498  CE  LYS B 105     135.574 143.319 122.982  1.00 26.65           C  
ATOM   3499  NZ  LYS B 105     136.055 142.269 123.916  1.00 26.65           N  
ATOM   3500  N   LYS B 106     135.755 148.948 121.500  1.00 24.67           N  
ATOM   3501  CA  LYS B 106     135.468 150.252 122.101  1.00 24.67           C  
ATOM   3502  C   LYS B 106     136.717 151.120 121.997  1.00 24.67           C  
ATOM   3503  O   LYS B 106     137.654 150.956 122.782  1.00 24.67           O  
ATOM   3504  CB  LYS B 106     135.021 150.108 123.548  1.00 24.67           C  
ATOM   3505  CG  LYS B 106     134.887 151.436 124.266  1.00 24.67           C  
ATOM   3506  CD  LYS B 106     134.650 151.239 125.751  1.00 24.67           C  
ATOM   3507  CE  LYS B 106     134.765 152.555 126.505  1.00 24.67           C  
ATOM   3508  NZ  LYS B 106     133.797 153.576 126.018  1.00 24.67           N  
ATOM   3509  N   SER B 107     136.718 152.043 121.046  1.00 22.85           N  
ATOM   3510  CA  SER B 107     137.818 152.983 120.918  1.00 22.85           C  
ATOM   3511  C   SER B 107     137.518 154.255 121.701  1.00 22.85           C  
ATOM   3512  O   SER B 107     136.407 154.472 122.184  1.00 22.85           O  
ATOM   3513  CB  SER B 107     138.079 153.309 119.452  1.00 22.85           C  
ATOM   3514  OG  SER B 107     138.425 152.143 118.730  1.00 22.85           O  
ATOM   3515  N   VAL B 108     138.532 155.104 121.821  1.00 20.28           N  
ATOM   3516  CA  VAL B 108     138.412 156.374 122.524  1.00 20.28           C  
ATOM   3517  C   VAL B 108     139.312 157.390 121.842  1.00 20.28           C  
ATOM   3518  O   VAL B 108     140.516 157.160 121.699  1.00 20.28           O  
ATOM   3519  CB  VAL B 108     138.782 156.235 124.012  1.00 20.28           C  
ATOM   3520  CG1 VAL B 108     139.973 155.315 124.175  1.00 20.28           C  
ATOM   3521  CG2 VAL B 108     139.077 157.593 124.612  1.00 20.28           C  
ATOM   3522  N   ALA B 109     138.737 158.513 121.426  1.00 19.39           N  
ATOM   3523  CA  ALA B 109     139.495 159.581 120.784  1.00 19.39           C  
ATOM   3524  C   ALA B 109     139.976 160.544 121.859  1.00 19.39           C  
ATOM   3525  O   ALA B 109     139.176 161.275 122.447  1.00 19.39           O  
ATOM   3526  CB  ALA B 109     138.643 160.300 119.743  1.00 19.39           C  
ATOM   3527  N   HIS B 110     141.282 160.553 122.105  1.00 21.30           N  
ATOM   3528  CA  HIS B 110     141.832 161.335 123.202  1.00 21.30           C  
ATOM   3529  C   HIS B 110     141.569 162.820 123.012  1.00 21.30           C  
ATOM   3530  O   HIS B 110     141.729 163.361 121.916  1.00 21.30           O  
ATOM   3531  CB  HIS B 110     143.332 161.093 123.319  1.00 21.30           C  
ATOM   3532  CG  HIS B 110     143.684 159.768 123.907  1.00 21.30           C  
ATOM   3533  ND1 HIS B 110     144.642 158.943 123.361  1.00 21.30           N  
ATOM   3534  CD2 HIS B 110     143.210 159.125 124.998  1.00 21.30           C  
ATOM   3535  CE1 HIS B 110     144.741 157.846 124.089  1.00 21.30           C  
ATOM   3536  NE2 HIS B 110     143.882 157.932 125.089  1.00 21.30           N  
ATOM   3537  N   ASN B 111     141.152 163.480 124.096  1.00 27.90           N  
ATOM   3538  CA  ASN B 111     141.124 164.940 124.185  1.00 27.90           C  
ATOM   3539  C   ASN B 111     141.769 165.308 125.520  1.00 27.90           C  
ATOM   3540  O   ASN B 111     141.086 165.536 126.518  1.00 27.90           O  
ATOM   3541  CB  ASN B 111     139.708 165.479 124.056  1.00 27.90           C  
ATOM   3542  CG  ASN B 111     138.769 164.893 125.079  1.00 27.90           C  
ATOM   3543  OD1 ASN B 111     138.883 163.727 125.442  1.00 27.90           O  
ATOM   3544  ND2 ASN B 111     137.835 165.706 125.557  1.00 27.90           N  
ATOM   3545  N   MET B 112     143.099 165.361 125.534  1.00 26.20           N  
ATOM   3546  CA  MET B 112     143.827 165.586 126.777  1.00 26.20           C  
ATOM   3547  C   MET B 112     143.547 166.956 127.372  1.00 26.20           C  
ATOM   3548  O   MET B 112     142.959 167.063 128.451  1.00 26.20           O  
ATOM   3549  CB  MET B 112     145.325 165.433 126.556  1.00 26.20           C  
ATOM   3550  CG  MET B 112     146.109 165.623 127.827  1.00 26.20           C  
ATOM   3551  SD  MET B 112     145.552 164.483 129.105  1.00 26.20           S  
ATOM   3552  CE  MET B 112     144.929 165.616 130.340  1.00 26.20           C  
ATOM   3553  N   THR B 113     143.961 168.006 126.678  1.00 18.30           N  
ATOM   3554  CA  THR B 113     143.693 169.369 127.108  1.00 18.30           C  
ATOM   3555  C   THR B 113     142.887 170.158 126.094  1.00 18.30           C  
ATOM   3556  O   THR B 113     142.135 171.053 126.481  1.00 18.30           O  
ATOM   3557  CB  THR B 113     145.005 170.106 127.400  1.00 18.30           C  
ATOM   3558  OG1 THR B 113     145.816 170.124 126.222  1.00 18.30           O  
ATOM   3559  CG2 THR B 113     145.762 169.399 128.503  1.00 18.30           C  
ATOM   3560  N   MET B 114     143.027 169.847 124.817  1.00 26.41           N  
ATOM   3561  CA  MET B 114     142.118 170.258 123.762  1.00 26.41           C  
ATOM   3562  C   MET B 114     142.030 169.099 122.786  1.00 26.41           C  
ATOM   3563  O   MET B 114     142.961 168.292 122.693  1.00 26.41           O  
ATOM   3564  CB  MET B 114     142.594 171.532 123.052  1.00 26.41           C  
ATOM   3565  CG  MET B 114     142.372 172.804 123.846  1.00 26.41           C  
ATOM   3566  SD  MET B 114     142.738 174.283 122.885  1.00 26.41           S  
ATOM   3567  CE  MET B 114     141.518 174.159 121.581  1.00 26.41           C  
ATOM   3568  N   PRO B 115     140.923 168.975 122.058  1.00 21.33           N  
ATOM   3569  CA  PRO B 115     140.735 167.799 121.204  1.00 21.33           C  
ATOM   3570  C   PRO B 115     141.903 167.607 120.250  1.00 21.33           C  
ATOM   3571  O   PRO B 115     142.243 168.495 119.467  1.00 21.33           O  
ATOM   3572  CB  PRO B 115     139.436 168.113 120.459  1.00 21.33           C  
ATOM   3573  CG  PRO B 115     138.711 169.026 121.363  1.00 21.33           C  
ATOM   3574  CD  PRO B 115     139.757 169.870 122.015  1.00 21.33           C  
ATOM   3575  N   ASN B 116     142.528 166.432 120.329  1.00 20.12           N  
ATOM   3576  CA  ASN B 116     143.730 166.135 119.554  1.00 20.12           C  
ATOM   3577  C   ASN B 116     143.351 165.907 118.093  1.00 20.12           C  
ATOM   3578  O   ASN B 116     143.347 164.789 117.576  1.00 20.12           O  
ATOM   3579  CB  ASN B 116     144.452 164.929 120.129  1.00 20.12           C  
ATOM   3580  CG  ASN B 116     144.641 165.025 121.615  1.00 20.12           C  
ATOM   3581  OD1 ASN B 116     144.446 164.056 122.340  1.00 20.12           O  
ATOM   3582  ND2 ASN B 116     145.016 166.202 122.084  1.00 20.12           N  
ATOM   3583  N   LYS B 117     143.022 167.004 117.419  1.00 16.65           N  
ATOM   3584  CA  LYS B 117     142.695 166.964 116.000  1.00 16.65           C  
ATOM   3585  C   LYS B 117     143.380 168.136 115.321  1.00 16.65           C  
ATOM   3586  O   LYS B 117     143.095 169.291 115.643  1.00 16.65           O  
ATOM   3587  CB  LYS B 117     141.183 167.016 115.773  1.00 16.65           C  
ATOM   3588  CG  LYS B 117     140.421 165.886 116.446  1.00 16.65           C  
ATOM   3589  CD  LYS B 117     138.980 165.788 115.964  1.00 16.65           C  
ATOM   3590  CE  LYS B 117     138.032 166.666 116.765  1.00 16.65           C  
ATOM   3591  NZ  LYS B 117     138.199 168.116 116.484  1.00 16.65           N  
ATOM   3592  N   LEU B 118     144.270 167.838 114.385  1.00 16.55           N  
ATOM   3593  CA  LEU B 118     144.995 168.846 113.628  1.00 16.55           C  
ATOM   3594  C   LEU B 118     144.375 168.995 112.250  1.00 16.55           C  
ATOM   3595  O   LEU B 118     144.108 167.998 111.572  1.00 16.55           O  
ATOM   3596  CB  LEU B 118     146.467 168.468 113.490  1.00 16.55           C  
ATOM   3597  CG  LEU B 118     147.219 169.057 112.299  1.00 16.55           C  
ATOM   3598  CD1 LEU B 118     147.347 170.558 112.428  1.00 16.55           C  
ATOM   3599  CD2 LEU B 118     148.587 168.422 112.177  1.00 16.55           C  
ATOM   3600  N   LEU B 119     144.156 170.240 111.838  1.00 16.03           N  
ATOM   3601  CA  LEU B 119     143.590 170.552 110.535  1.00 16.03           C  
ATOM   3602  C   LEU B 119     144.480 171.558 109.827  1.00 16.03           C  
ATOM   3603  O   LEU B 119     144.898 172.552 110.423  1.00 16.03           O  
ATOM   3604  CB  LEU B 119     142.187 171.123 110.659  1.00 16.03           C  
ATOM   3605  CG  LEU B 119     141.513 171.431 109.329  1.00 16.03           C  
ATOM   3606  CD1 LEU B 119     140.914 170.178 108.749  1.00 16.03           C  
ATOM   3607  CD2 LEU B 119     140.459 172.485 109.521  1.00 16.03           C  
ATOM   3608  N   ARG B 120     144.762 171.302 108.553  1.00 19.31           N  
ATOM   3609  CA  ARG B 120     145.581 172.194 107.740  1.00 19.31           C  
ATOM   3610  C   ARG B 120     144.878 172.448 106.420  1.00 19.31           C  
ATOM   3611  O   ARG B 120     144.338 171.518 105.818  1.00 19.31           O  
ATOM   3612  CB  ARG B 120     146.965 171.609 107.469  1.00 19.31           C  
ATOM   3613  CG  ARG B 120     147.797 171.340 108.696  1.00 19.31           C  
ATOM   3614  CD  ARG B 120     149.215 171.001 108.290  1.00 19.31           C  
ATOM   3615  NE  ARG B 120     149.955 170.360 109.368  1.00 19.31           N  
ATOM   3616  CZ  ARG B 120     150.690 171.015 110.256  1.00 19.31           C  
ATOM   3617  NH1 ARG B 120     150.782 172.334 110.194  1.00 19.31           N  
ATOM   3618  NH2 ARG B 120     151.332 170.350 111.204  1.00 19.31           N  
ATOM   3619  N   ILE B 121     144.891 173.693 105.962  1.00 19.58           N  
ATOM   3620  CA  ILE B 121     144.262 174.064 104.700  1.00 19.58           C  
ATOM   3621  C   ILE B 121     145.330 174.617 103.771  1.00 19.58           C  
ATOM   3622  O   ILE B 121     146.036 175.567 104.122  1.00 19.58           O  
ATOM   3623  CB  ILE B 121     143.136 175.084 104.907  1.00 19.58           C  
ATOM   3624  CG1 ILE B 121     142.023 174.474 105.748  1.00 19.58           C  
ATOM   3625  CG2 ILE B 121     142.592 175.535 103.576  1.00 19.58           C  
ATOM   3626  CD1 ILE B 121     140.832 175.374 105.903  1.00 19.58           C  
ATOM   3627  N   THR B 122     145.447 174.033 102.588  1.00 31.23           N  
ATOM   3628  CA  THR B 122     146.367 174.550 101.590  1.00 31.23           C  
ATOM   3629  C   THR B 122     145.654 175.559 100.700  1.00 31.23           C  
ATOM   3630  O   THR B 122     144.426 175.649 100.681  1.00 31.23           O  
ATOM   3631  CB  THR B 122     146.949 173.419 100.746  1.00 31.23           C  
ATOM   3632  OG1 THR B 122     145.882 172.644 100.191  1.00 31.23           O  
ATOM   3633  CG2 THR B 122     147.823 172.520 101.597  1.00 31.23           C  
ATOM   3634  N   GLU B 123     146.450 176.331  99.958  1.00 45.53           N  
ATOM   3635  CA  GLU B 123     145.882 177.377  99.115  1.00 45.53           C  
ATOM   3636  C   GLU B 123     145.066 176.799  97.968  1.00 45.53           C  
ATOM   3637  O   GLU B 123     144.066 177.397  97.559  1.00 45.53           O  
ATOM   3638  CB  GLU B 123     146.995 178.273  98.576  1.00 45.53           C  
ATOM   3639  CG  GLU B 123     146.501 179.454  97.762  1.00 45.53           C  
ATOM   3640  CD  GLU B 123     147.620 180.394  97.356  1.00 45.53           C  
ATOM   3641  OE1 GLU B 123     148.793 180.090  97.658  1.00 45.53           O  
ATOM   3642  OE2 GLU B 123     147.328 181.439  96.736  1.00 45.53           O  
ATOM   3643  N   ASP B 124     145.473 175.647  97.437  1.00 45.98           N  
ATOM   3644  CA  ASP B 124     144.719 175.036  96.350  1.00 45.98           C  
ATOM   3645  C   ASP B 124     143.378 174.498  96.831  1.00 45.98           C  
ATOM   3646  O   ASP B 124     142.427 174.412  96.047  1.00 45.98           O  
ATOM   3647  CB  ASP B 124     145.543 173.919  95.710  1.00 45.98           C  
ATOM   3648  CG  ASP B 124     144.990 173.480  94.372  1.00 45.98           C  
ATOM   3649  OD1 ASP B 124     144.087 174.163  93.848  1.00 45.98           O  
ATOM   3650  OD2 ASP B 124     145.459 172.451  93.843  1.00 45.98           O  
ATOM   3651  N   GLY B 125     143.278 174.142  98.102  1.00 34.39           N  
ATOM   3652  CA  GLY B 125     142.075 173.577  98.659  1.00 34.39           C  
ATOM   3653  C   GLY B 125     142.189 172.151  99.157  1.00 34.39           C  
ATOM   3654  O   GLY B 125     141.156 171.506  99.359  1.00 34.39           O  
ATOM   3655  N   THR B 126     143.400 171.645  99.364  1.00 34.86           N  
ATOM   3656  CA  THR B 126     143.615 170.266  99.789  1.00 34.86           C  
ATOM   3657  C   THR B 126     143.696 170.239 101.309  1.00 34.86           C  
ATOM   3658  O   THR B 126     144.739 170.537 101.893  1.00 34.86           O  
ATOM   3659  CB  THR B 126     144.883 169.705  99.157  1.00 34.86           C  
ATOM   3660  OG1 THR B 126     144.761 169.736  97.731  1.00 34.86           O  
ATOM   3661  CG2 THR B 126     145.118 168.276  99.606  1.00 34.86           C  
ATOM   3662  N   LEU B 127     142.595 169.872 101.952  1.00 23.75           N  
ATOM   3663  CA  LEU B 127     142.562 169.819 103.403  1.00 23.75           C  
ATOM   3664  C   LEU B 127     143.411 168.662 103.917  1.00 23.75           C  
ATOM   3665  O   LEU B 127     143.718 167.711 103.197  1.00 23.75           O  
ATOM   3666  CB  LEU B 127     141.130 169.660 103.901  1.00 23.75           C  
ATOM   3667  CG  LEU B 127     140.203 170.871 103.925  1.00 23.75           C  
ATOM   3668  CD1 LEU B 127     139.997 171.458 102.550  1.00 23.75           C  
ATOM   3669  CD2 LEU B 127     138.880 170.451 104.507  1.00 23.75           C  
ATOM   3670  N   LEU B 128     143.795 168.758 105.187  1.00 39.51           N  
ATOM   3671  CA  LEU B 128     144.483 167.682 105.889  1.00 39.51           C  
ATOM   3672  C   LEU B 128     143.915 167.598 107.294  1.00 39.51           C  
ATOM   3673  O   LEU B 128     143.732 168.631 107.943  1.00 39.51           O  
ATOM   3674  CB  LEU B 128     145.994 167.918 105.946  1.00 39.51           C  
ATOM   3675  CG  LEU B 128     146.761 166.870 106.748  1.00 39.51           C  
ATOM   3676  CD1 LEU B 128     146.549 165.518 106.128  1.00 39.51           C  
ATOM   3677  CD2 LEU B 128     148.235 167.191 106.798  1.00 39.51           C  
ATOM   3678  N   TYR B 129     143.660 166.381 107.770  1.00 39.51           N  
ATOM   3679  CA  TYR B 129     142.904 166.175 108.999  1.00 39.51           C  
ATOM   3680  C   TYR B 129     143.457 164.955 109.712  1.00 39.51           C  
ATOM   3681  O   TYR B 129     143.336 163.840 109.203  1.00 39.51           O  
ATOM   3682  CB  TYR B 129     141.425 165.986 108.669  1.00 39.51           C  
ATOM   3683  CG  TYR B 129     140.494 165.909 109.844  1.00 39.51           C  
ATOM   3684  CD1 TYR B 129     140.071 167.053 110.488  1.00 39.51           C  
ATOM   3685  CD2 TYR B 129     140.001 164.694 110.279  1.00 39.51           C  
ATOM   3686  CE1 TYR B 129     139.204 166.991 111.546  1.00 39.51           C  
ATOM   3687  CE2 TYR B 129     139.132 164.620 111.337  1.00 39.51           C  
ATOM   3688  CZ  TYR B 129     138.738 165.772 111.967  1.00 39.51           C  
ATOM   3689  OH  TYR B 129     137.870 165.706 113.026  1.00 39.51           O  
ATOM   3690  N   THR B 130     144.064 165.152 110.875  1.00 25.71           N  
ATOM   3691  CA  THR B 130     144.672 164.048 111.600  1.00 25.71           C  
ATOM   3692  C   THR B 130     144.173 163.990 113.034  1.00 25.71           C  
ATOM   3693  O   THR B 130     144.006 165.016 113.697  1.00 25.71           O  
ATOM   3694  CB  THR B 130     146.191 164.150 111.611  1.00 25.71           C  
ATOM   3695  OG1 THR B 130     146.678 163.775 112.903  1.00 25.71           O  
ATOM   3696  CG2 THR B 130     146.626 165.559 111.305  1.00 25.71           C  
ATOM   3697  N   MET B 131     143.967 162.769 113.512  1.00 28.19           N  
ATOM   3698  CA  MET B 131     143.479 162.515 114.855  1.00 28.19           C  
ATOM   3699  C   MET B 131     144.435 161.571 115.566  1.00 28.19           C  
ATOM   3700  O   MET B 131     145.299 160.947 114.947  1.00 28.19           O  
ATOM   3701  CB  MET B 131     142.075 161.904 114.834  1.00 28.19           C  
ATOM   3702  CG  MET B 131     141.157 162.494 113.792  1.00 28.19           C  
ATOM   3703  SD  MET B 131     139.573 161.645 113.744  1.00 28.19           S  
ATOM   3704  CE  MET B 131     138.999 161.933 115.415  1.00 28.19           C  
ATOM   3705  N   ARG B 132     144.267 161.460 116.879  1.00 39.51           N  
ATOM   3706  CA  ARG B 132     144.969 160.468 117.680  1.00 39.51           C  
ATOM   3707  C   ARG B 132     143.939 159.524 118.274  1.00 39.51           C  
ATOM   3708  O   ARG B 132     142.951 159.975 118.857  1.00 39.51           O  
ATOM   3709  CB  ARG B 132     145.796 161.124 118.783  1.00 39.51           C  
ATOM   3710  CG  ARG B 132     146.724 160.159 119.489  1.00 39.51           C  
ATOM   3711  CD  ARG B 132     147.753 160.873 120.342  1.00 39.51           C  
ATOM   3712  NE  ARG B 132     147.195 161.343 121.602  1.00 39.51           N  
ATOM   3713  CZ  ARG B 132     147.190 160.630 122.721  1.00 39.51           C  
ATOM   3714  NH1 ARG B 132     147.714 159.414 122.732  1.00 39.51           N  
ATOM   3715  NH2 ARG B 132     146.659 161.130 123.827  1.00 39.51           N  
ATOM   3716  N   LEU B 133     144.161 158.221 118.126  1.00 19.98           N  
ATOM   3717  CA  LEU B 133     143.157 157.240 118.502  1.00 19.98           C  
ATOM   3718  C   LEU B 133     143.780 156.103 119.291  1.00 19.98           C  
ATOM   3719  O   LEU B 133     144.976 155.823 119.186  1.00 19.98           O  
ATOM   3720  CB  LEU B 133     142.448 156.657 117.280  1.00 19.98           C  
ATOM   3721  CG  LEU B 133     141.630 157.631 116.451  1.00 19.98           C  
ATOM   3722  CD1 LEU B 133     140.977 156.905 115.302  1.00 19.98           C  
ATOM   3723  CD2 LEU B 133     140.596 158.283 117.328  1.00 19.98           C  
ATOM   3724  N   THR B 134     142.936 155.442 120.076  1.00 14.59           N  
ATOM   3725  CA  THR B 134     143.261 154.186 120.735  1.00 14.59           C  
ATOM   3726  C   THR B 134     142.139 153.208 120.432  1.00 14.59           C  
ATOM   3727  O   THR B 134     140.999 153.424 120.852  1.00 14.59           O  
ATOM   3728  CB  THR B 134     143.415 154.371 122.243  1.00 14.59           C  
ATOM   3729  OG1 THR B 134     144.499 155.269 122.504  1.00 14.59           O  
ATOM   3730  CG2 THR B 134     143.689 153.041 122.911  1.00 14.59           C  
ATOM   3731  N   VAL B 135     142.455 152.138 119.713  1.00 13.82           N  
ATOM   3732  CA  VAL B 135     141.457 151.208 119.203  1.00 13.82           C  
ATOM   3733  C   VAL B 135     141.700 149.841 119.815  1.00 13.82           C  
ATOM   3734  O   VAL B 135     142.832 149.349 119.807  1.00 13.82           O  
ATOM   3735  CB  VAL B 135     141.503 151.125 117.670  1.00 13.82           C  
ATOM   3736  CG1 VAL B 135     140.507 150.112 117.172  1.00 13.82           C  
ATOM   3737  CG2 VAL B 135     141.230 152.480 117.080  1.00 13.82           C  
ATOM   3738  N   ARG B 136     140.643 149.229 120.341  1.00 20.20           N  
ATOM   3739  CA  ARG B 136     140.720 147.873 120.873  1.00 20.20           C  
ATOM   3740  C   ARG B 136     140.043 146.943 119.873  1.00 20.20           C  
ATOM   3741  O   ARG B 136     138.859 146.632 119.969  1.00 20.20           O  
ATOM   3742  CB  ARG B 136     140.076 147.795 122.248  1.00 20.20           C  
ATOM   3743  CG  ARG B 136     140.747 148.656 123.293  1.00 20.20           C  
ATOM   3744  CD  ARG B 136     139.961 148.626 124.583  1.00 20.20           C  
ATOM   3745  NE  ARG B 136     139.717 147.259 125.028  1.00 20.20           N  
ATOM   3746  CZ  ARG B 136     138.785 146.918 125.910  1.00 20.20           C  
ATOM   3747  NH1 ARG B 136     138.000 147.845 126.438  1.00 20.20           N  
ATOM   3748  NH2 ARG B 136     138.632 145.651 126.259  1.00 20.20           N  
ATOM   3749  N   ALA B 137     140.820 146.490 118.899  1.00 22.04           N  
ATOM   3750  CA  ALA B 137     140.243 145.654 117.862  1.00 22.04           C  
ATOM   3751  C   ALA B 137     140.153 144.209 118.333  1.00 22.04           C  
ATOM   3752  O   ALA B 137     140.812 143.799 119.291  1.00 22.04           O  
ATOM   3753  CB  ALA B 137     141.068 145.736 116.580  1.00 22.04           C  
ATOM   3754  N   GLU B 138     139.320 143.432 117.648  1.00 28.98           N  
ATOM   3755  CA  GLU B 138     139.176 142.011 117.925  1.00 28.98           C  
ATOM   3756  C   GLU B 138     139.636 141.208 116.718  1.00 28.98           C  
ATOM   3757  O   GLU B 138     139.275 141.521 115.580  1.00 28.98           O  
ATOM   3758  CB  GLU B 138     137.732 141.654 118.289  1.00 28.98           C  
ATOM   3759  CG  GLU B 138     136.717 141.858 117.182  1.00 28.98           C  
ATOM   3760  CD  GLU B 138     135.333 141.382 117.569  1.00 28.98           C  
ATOM   3761  OE1 GLU B 138     135.145 140.991 118.739  1.00 28.98           O  
ATOM   3762  OE2 GLU B 138     134.434 141.399 116.704  1.00 28.98           O  
ATOM   3763  N   CYS B 139     140.454 140.189 116.971  1.00 37.08           N  
ATOM   3764  CA  CYS B 139     140.905 139.270 115.934  1.00 37.08           C  
ATOM   3765  C   CYS B 139     140.653 137.852 116.419  1.00 37.08           C  
ATOM   3766  O   CYS B 139     141.133 137.479 117.508  1.00 37.08           O  
ATOM   3767  CB  CYS B 139     142.384 139.464 115.602  1.00 37.08           C  
ATOM   3768  SG  CYS B 139     143.452 139.933 116.975  1.00 37.08           S  
ATOM   3769  N   PRO B 140     139.923 137.034 115.669  1.00 49.42           N  
ATOM   3770  CA  PRO B 140     139.782 135.629 116.053  1.00 49.42           C  
ATOM   3771  C   PRO B 140     141.115 134.916 115.930  1.00 49.42           C  
ATOM   3772  O   PRO B 140     141.905 135.190 115.024  1.00 49.42           O  
ATOM   3773  CB  PRO B 140     138.758 135.089 115.051  1.00 49.42           C  
ATOM   3774  CG  PRO B 140     138.934 135.957 113.858  1.00 49.42           C  
ATOM   3775  CD  PRO B 140     139.252 137.325 114.392  1.00 49.42           C  
ATOM   3776  N   MET B 141     141.366 133.999 116.855  1.00 57.57           N  
ATOM   3777  CA  MET B 141     142.624 133.277 116.903  1.00 57.57           C  
ATOM   3778  C   MET B 141     142.374 131.782 116.794  1.00 57.57           C  
ATOM   3779  O   MET B 141     141.281 131.292 117.089  1.00 57.57           O  
ATOM   3780  CB  MET B 141     143.389 133.576 118.194  1.00 57.57           C  
ATOM   3781  CG  MET B 141     143.888 135.001 118.307  1.00 57.57           C  
ATOM   3782  SD  MET B 141     144.857 135.271 119.800  1.00 57.57           S  
ATOM   3783  CE  MET B 141     145.235 137.011 119.639  1.00 57.57           C  
ATOM   3784  N   HIS B 142     143.402 131.064 116.358  1.00 67.57           N  
ATOM   3785  CA  HIS B 142     143.382 129.611 116.294  1.00 67.57           C  
ATOM   3786  C   HIS B 142     144.560 129.089 117.099  1.00 67.57           C  
ATOM   3787  O   HIS B 142     145.716 129.364 116.763  1.00 67.57           O  
ATOM   3788  CB  HIS B 142     143.442 129.124 114.847  1.00 67.57           C  
ATOM   3789  CG  HIS B 142     142.204 129.424 114.061  1.00 67.57           C  
ATOM   3790  ND1 HIS B 142     141.033 128.716 114.222  1.00 67.57           N  
ATOM   3791  CD2 HIS B 142     141.954 130.355 113.111  1.00 67.57           C  
ATOM   3792  CE1 HIS B 142     140.114 129.198 113.405  1.00 67.57           C  
ATOM   3793  NE2 HIS B 142     140.647 130.192 112.719  1.00 67.57           N  
ATOM   3794  N   LEU B 143     144.265 128.342 118.161  1.00 68.13           N  
ATOM   3795  CA  LEU B 143     145.276 127.901 119.110  1.00 68.13           C  
ATOM   3796  C   LEU B 143     145.625 126.426 118.968  1.00 68.13           C  
ATOM   3797  O   LEU B 143     146.190 125.843 119.899  1.00 68.13           O  
ATOM   3798  CB  LEU B 143     144.810 128.194 120.536  1.00 68.13           C  
ATOM   3799  CG  LEU B 143     144.509 129.665 120.805  1.00 68.13           C  
ATOM   3800  CD1 LEU B 143     144.206 129.888 122.273  1.00 68.13           C  
ATOM   3801  CD2 LEU B 143     145.672 130.528 120.356  1.00 68.13           C  
ATOM   3802  N   GLU B 144     145.305 125.805 117.831  1.00 74.11           N  
ATOM   3803  CA  GLU B 144     145.678 124.409 117.633  1.00 74.11           C  
ATOM   3804  C   GLU B 144     147.187 124.225 117.663  1.00 74.11           C  
ATOM   3805  O   GLU B 144     147.672 123.122 117.933  1.00 74.11           O  
ATOM   3806  CB  GLU B 144     145.110 123.887 116.314  1.00 74.11           C  
ATOM   3807  CG  GLU B 144     143.595 123.851 116.256  1.00 74.11           C  
ATOM   3808  CD  GLU B 144     143.001 125.169 115.816  1.00 74.11           C  
ATOM   3809  OE1 GLU B 144     143.748 125.994 115.253  1.00 74.11           O  
ATOM   3810  OE2 GLU B 144     141.790 125.380 116.032  1.00 74.11           O  
ATOM   3811  N   ASP B 145     147.942 125.282 117.385  1.00 67.08           N  
ATOM   3812  CA  ASP B 145     149.395 125.231 117.411  1.00 67.08           C  
ATOM   3813  C   ASP B 145     149.990 125.809 118.685  1.00 67.08           C  
ATOM   3814  O   ASP B 145     151.215 125.910 118.783  1.00 67.08           O  
ATOM   3815  CB  ASP B 145     149.971 125.968 116.201  1.00 67.08           C  
ATOM   3816  CG  ASP B 145     149.743 125.223 114.908  1.00 67.08           C  
ATOM   3817  OD1 ASP B 145     149.615 123.983 114.955  1.00 67.08           O  
ATOM   3818  OD2 ASP B 145     149.697 125.874 113.845  1.00 67.08           O  
ATOM   3819  N   PHE B 146     149.164 126.205 119.646  1.00 58.24           N  
ATOM   3820  CA  PHE B 146     149.677 126.765 120.888  1.00 58.24           C  
ATOM   3821  C   PHE B 146     150.628 125.775 121.551  1.00 58.24           C  
ATOM   3822  O   PHE B 146     150.307 124.584 121.641  1.00 58.24           O  
ATOM   3823  CB  PHE B 146     148.528 127.101 121.835  1.00 58.24           C  
ATOM   3824  CG  PHE B 146     148.972 127.684 123.142  1.00 58.24           C  
ATOM   3825  CD1 PHE B 146     149.169 129.044 123.273  1.00 58.24           C  
ATOM   3826  CD2 PHE B 146     149.190 126.875 124.238  1.00 58.24           C  
ATOM   3827  CE1 PHE B 146     149.577 129.583 124.471  1.00 58.24           C  
ATOM   3828  CE2 PHE B 146     149.598 127.409 125.437  1.00 58.24           C  
ATOM   3829  CZ  PHE B 146     149.791 128.764 125.554  1.00 58.24           C  
ATOM   3830  N   PRO B 147     151.792 126.220 122.039  1.00 55.37           N  
ATOM   3831  CA  PRO B 147     152.250 127.607 122.029  1.00 55.37           C  
ATOM   3832  C   PRO B 147     153.134 127.970 120.843  1.00 55.37           C  
ATOM   3833  O   PRO B 147     153.801 128.999 120.886  1.00 55.37           O  
ATOM   3834  CB  PRO B 147     153.049 127.696 123.320  1.00 55.37           C  
ATOM   3835  CG  PRO B 147     153.666 126.356 123.431  1.00 55.37           C  
ATOM   3836  CD  PRO B 147     152.671 125.374 122.863  1.00 55.37           C  
ATOM   3837  N   MET B 148     153.154 127.141 119.807  1.00 66.97           N  
ATOM   3838  CA  MET B 148     153.928 127.429 118.609  1.00 66.97           C  
ATOM   3839  C   MET B 148     153.145 128.251 117.593  1.00 66.97           C  
ATOM   3840  O   MET B 148     153.559 128.337 116.433  1.00 66.97           O  
ATOM   3841  CB  MET B 148     154.404 126.126 117.965  1.00 66.97           C  
ATOM   3842  CG  MET B 148     154.917 125.091 118.954  1.00 66.97           C  
ATOM   3843  SD  MET B 148     156.714 124.944 119.008  1.00 66.97           S  
ATOM   3844  CE  MET B 148     157.183 126.511 119.735  1.00 66.97           C  
ATOM   3845  N   ASP B 149     152.031 128.851 118.002  1.00 61.19           N  
ATOM   3846  CA  ASP B 149     151.131 129.504 117.062  1.00 61.19           C  
ATOM   3847  C   ASP B 149     151.747 130.770 116.486  1.00 61.19           C  
ATOM   3848  O   ASP B 149     152.536 131.455 117.142  1.00 61.19           O  
ATOM   3849  CB  ASP B 149     149.810 129.843 117.746  1.00 61.19           C  
ATOM   3850  CG  ASP B 149     149.981 130.826 118.882  1.00 61.19           C  
ATOM   3851  OD1 ASP B 149     151.068 130.841 119.494  1.00 61.19           O  
ATOM   3852  OD2 ASP B 149     149.029 131.582 119.164  1.00 61.19           O  
ATOM   3853  N   ALA B 150     151.381 131.073 115.244  1.00 47.99           N  
ATOM   3854  CA  ALA B 150     151.722 132.331 114.592  1.00 47.99           C  
ATOM   3855  C   ALA B 150     150.508 132.784 113.801  1.00 47.99           C  
ATOM   3856  O   ALA B 150     150.106 132.114 112.844  1.00 47.99           O  
ATOM   3857  CB  ALA B 150     152.939 132.177 113.677  1.00 47.99           C  
ATOM   3858  N   HIS B 151     149.927 133.913 114.193  1.00 37.38           N  
ATOM   3859  CA  HIS B 151     148.682 134.376 113.602  1.00 37.38           C  
ATOM   3860  C   HIS B 151     148.768 135.867 113.326  1.00 37.38           C  
ATOM   3861  O   HIS B 151     149.651 136.563 113.832  1.00 37.38           O  
ATOM   3862  CB  HIS B 151     147.494 134.072 114.514  1.00 37.38           C  
ATOM   3863  CG  HIS B 151     147.764 134.345 115.958  1.00 37.38           C  
ATOM   3864  ND1 HIS B 151     147.421 135.531 116.568  1.00 37.38           N  
ATOM   3865  CD2 HIS B 151     148.354 133.588 116.912  1.00 37.38           C  
ATOM   3866  CE1 HIS B 151     147.781 135.490 117.838  1.00 37.38           C  
ATOM   3867  NE2 HIS B 151     148.350 134.322 118.072  1.00 37.38           N  
ATOM   3868  N   ALA B 152     147.831 136.352 112.516  1.00 23.82           N  
ATOM   3869  CA  ALA B 152     147.803 137.740 112.079  1.00 23.82           C  
ATOM   3870  C   ALA B 152     146.509 138.396 112.532  1.00 23.82           C  
ATOM   3871  O   ALA B 152     145.424 137.852 112.308  1.00 23.82           O  
ATOM   3872  CB  ALA B 152     147.936 137.837 110.559  1.00 23.82           C  
ATOM   3873  N   CYS B 153     146.626 139.565 113.159  1.00 23.38           N  
ATOM   3874  CA  CYS B 153     145.424 140.264 113.595  1.00 23.38           C  
ATOM   3875  C   CYS B 153     145.089 141.386 112.629  1.00 23.38           C  
ATOM   3876  O   CYS B 153     145.977 142.174 112.266  1.00 23.38           O  
ATOM   3877  CB  CYS B 153     145.603 140.816 115.006  1.00 23.38           C  
ATOM   3878  SG  CYS B 153     145.328 139.562 116.283  1.00 23.38           S  
ATOM   3879  N   PRO B 154     143.841 141.460 112.163  1.00 17.73           N  
ATOM   3880  CA  PRO B 154     143.474 142.477 111.176  1.00 17.73           C  
ATOM   3881  C   PRO B 154     142.870 143.726 111.788  1.00 17.73           C  
ATOM   3882  O   PRO B 154     142.293 143.686 112.876  1.00 17.73           O  
ATOM   3883  CB  PRO B 154     142.450 141.744 110.310  1.00 17.73           C  
ATOM   3884  CG  PRO B 154     141.753 140.876 111.282  1.00 17.73           C  
ATOM   3885  CD  PRO B 154     142.789 140.441 112.294  1.00 17.73           C  
ATOM   3886  N   LEU B 155     142.997 144.839 111.072  1.00 15.30           N  
ATOM   3887  CA  LEU B 155     142.366 146.109 111.408  1.00 15.30           C  
ATOM   3888  C   LEU B 155     141.754 146.641 110.121  1.00 15.30           C  
ATOM   3889  O   LEU B 155     142.483 146.973 109.182  1.00 15.30           O  
ATOM   3890  CB  LEU B 155     143.385 147.093 111.978  1.00 15.30           C  
ATOM   3891  CG  LEU B 155     142.916 148.518 112.240  1.00 15.30           C  
ATOM   3892  CD1 LEU B 155     142.078 148.545 113.488  1.00 15.30           C  
ATOM   3893  CD2 LEU B 155     144.098 149.453 112.368  1.00 15.30           C  
ATOM   3894  N   LYS B 156     140.428 146.691 110.055  1.00 15.86           N  
ATOM   3895  CA  LYS B 156     139.728 147.107 108.848  1.00 15.86           C  
ATOM   3896  C   LYS B 156     138.924 148.362 109.134  1.00 15.86           C  
ATOM   3897  O   LYS B 156     138.165 148.406 110.106  1.00 15.86           O  
ATOM   3898  CB  LYS B 156     138.803 146.002 108.336  1.00 15.86           C  
ATOM   3899  CG  LYS B 156     139.505 144.694 108.055  1.00 15.86           C  
ATOM   3900  CD  LYS B 156     138.656 143.754 107.214  1.00 15.86           C  
ATOM   3901  CE  LYS B 156     137.839 142.810 108.071  1.00 15.86           C  
ATOM   3902  NZ  LYS B 156     136.752 143.506 108.798  1.00 15.86           N  
ATOM   3903  N   PHE B 157     139.074 149.373 108.284  1.00 18.39           N  
ATOM   3904  CA  PHE B 157     138.321 150.608 108.443  1.00 18.39           C  
ATOM   3905  C   PHE B 157     137.688 151.011 107.125  1.00 18.39           C  
ATOM   3906  O   PHE B 157     138.229 150.732 106.051  1.00 18.39           O  
ATOM   3907  CB  PHE B 157     139.193 151.745 108.974  1.00 18.39           C  
ATOM   3908  CG  PHE B 157     140.314 152.139 108.067  1.00 18.39           C  
ATOM   3909  CD1 PHE B 157     140.131 153.099 107.094  1.00 18.39           C  
ATOM   3910  CD2 PHE B 157     141.565 151.581 108.215  1.00 18.39           C  
ATOM   3911  CE1 PHE B 157     141.167 153.474 106.271  1.00 18.39           C  
ATOM   3912  CE2 PHE B 157     142.604 151.952 107.395  1.00 18.39           C  
ATOM   3913  CZ  PHE B 157     142.404 152.900 106.423  1.00 18.39           C  
ATOM   3914  N   GLY B 158     136.535 151.668 107.218  1.00 39.51           N  
ATOM   3915  CA  GLY B 158     135.807 152.056 106.029  1.00 39.51           C  
ATOM   3916  C   GLY B 158     134.842 153.179 106.330  1.00 39.51           C  
ATOM   3917  O   GLY B 158     134.665 153.590 107.481  1.00 39.51           O  
ATOM   3918  N   SER B 159     134.211 153.671 105.270  1.00 20.06           N  
ATOM   3919  CA  SER B 159     133.248 154.744 105.424  1.00 20.06           C  
ATOM   3920  C   SER B 159     131.927 154.209 105.958  1.00 20.06           C  
ATOM   3921  O   SER B 159     131.668 153.005 105.970  1.00 20.06           O  
ATOM   3922  CB  SER B 159     133.012 155.455 104.098  1.00 20.06           C  
ATOM   3923  OG  SER B 159     132.008 156.442 104.240  1.00 20.06           O  
ATOM   3924  N   TYR B 160     131.088 155.134 106.407  1.00 18.96           N  
ATOM   3925  CA  TYR B 160     129.758 154.832 106.907  1.00 18.96           C  
ATOM   3926  C   TYR B 160     128.774 155.767 106.231  1.00 18.96           C  
ATOM   3927  O   TYR B 160     129.056 156.958 106.072  1.00 18.96           O  
ATOM   3928  CB  TYR B 160     129.684 154.994 108.423  1.00 18.96           C  
ATOM   3929  CG  TYR B 160     128.576 154.209 109.071  1.00 18.96           C  
ATOM   3930  CD1 TYR B 160     128.306 152.915 108.678  1.00 18.96           C  
ATOM   3931  CD2 TYR B 160     127.818 154.754 110.092  1.00 18.96           C  
ATOM   3932  CE1 TYR B 160     127.302 152.188 109.267  1.00 18.96           C  
ATOM   3933  CE2 TYR B 160     126.812 154.034 110.689  1.00 18.96           C  
ATOM   3934  CZ  TYR B 160     126.558 152.750 110.270  1.00 18.96           C  
ATOM   3935  OH  TYR B 160     125.557 152.014 110.854  1.00 18.96           O  
ATOM   3936  N   ALA B 161     127.630 155.225 105.820  1.00 18.21           N  
ATOM   3937  CA  ALA B 161     126.599 156.009 105.144  1.00 18.21           C  
ATOM   3938  C   ALA B 161     127.131 156.650 103.868  1.00 18.21           C  
ATOM   3939  O   ALA B 161     126.807 157.792 103.549  1.00 18.21           O  
ATOM   3940  CB  ALA B 161     126.015 157.075 106.069  1.00 18.21           C  
ATOM   3941  N   TYR B 162     127.969 155.920 103.139  1.00 17.53           N  
ATOM   3942  CA  TYR B 162     128.432 156.375 101.833  1.00 17.53           C  
ATOM   3943  C   TYR B 162     128.753 155.155 100.988  1.00 17.53           C  
ATOM   3944  O   TYR B 162     129.642 154.377 101.338  1.00 17.53           O  
ATOM   3945  CB  TYR B 162     129.656 157.281 101.960  1.00 17.53           C  
ATOM   3946  CG  TYR B 162     129.355 158.666 102.481  1.00 17.53           C  
ATOM   3947  CD1 TYR B 162     128.651 159.577 101.714  1.00 17.53           C  
ATOM   3948  CD2 TYR B 162     129.781 159.063 103.735  1.00 17.53           C  
ATOM   3949  CE1 TYR B 162     128.377 160.842 102.183  1.00 17.53           C  
ATOM   3950  CE2 TYR B 162     129.513 160.327 104.210  1.00 17.53           C  
ATOM   3951  CZ  TYR B 162     128.810 161.210 103.431  1.00 17.53           C  
ATOM   3952  OH  TYR B 162     128.539 162.470 103.903  1.00 17.53           O  
ATOM   3953  N   THR B 163     128.039 154.989  99.881  1.00 18.48           N  
ATOM   3954  CA  THR B 163     128.300 153.852  99.019  1.00 18.48           C  
ATOM   3955  C   THR B 163     129.604 154.059  98.259  1.00 18.48           C  
ATOM   3956  O   THR B 163     130.282 155.079  98.399  1.00 18.48           O  
ATOM   3957  CB  THR B 163     127.153 153.645  98.036  1.00 18.48           C  
ATOM   3958  OG1 THR B 163     127.306 154.545  96.935  1.00 18.48           O  
ATOM   3959  CG2 THR B 163     125.827 153.916  98.712  1.00 18.48           C  
ATOM   3960  N   ARG B 164     129.960 153.068  97.441  1.00 19.99           N  
ATOM   3961  CA  ARG B 164     131.166 153.199  96.630  1.00 19.99           C  
ATOM   3962  C   ARG B 164     131.047 154.349  95.642  1.00 19.99           C  
ATOM   3963  O   ARG B 164     132.061 154.910  95.217  1.00 19.99           O  
ATOM   3964  CB  ARG B 164     131.449 151.895  95.890  1.00 19.99           C  
ATOM   3965  CG  ARG B 164     132.750 151.900  95.112  1.00 19.99           C  
ATOM   3966  CD  ARG B 164     132.896 150.640  94.289  1.00 19.99           C  
ATOM   3967  NE  ARG B 164     131.761 150.450  93.395  1.00 19.99           N  
ATOM   3968  CZ  ARG B 164     131.604 149.397  92.601  1.00 19.99           C  
ATOM   3969  NH1 ARG B 164     130.537 149.308  91.821  1.00 19.99           N  
ATOM   3970  NH2 ARG B 164     132.512 148.432  92.587  1.00 19.99           N  
ATOM   3971  N   ALA B 165     129.822 154.721  95.277  1.00 18.31           N  
ATOM   3972  CA  ALA B 165     129.635 155.802  94.319  1.00 18.31           C  
ATOM   3973  C   ALA B 165     130.017 157.149  94.916  1.00 18.31           C  
ATOM   3974  O   ALA B 165     130.266 158.109  94.181  1.00 18.31           O  
ATOM   3975  CB  ALA B 165     128.189 155.822  93.827  1.00 18.31           C  
ATOM   3976  N   GLU B 166     130.048 157.252  96.241  1.00 23.40           N  
ATOM   3977  CA  GLU B 166     130.191 158.564  96.858  1.00 23.40           C  
ATOM   3978  C   GLU B 166     131.577 158.824  97.438  1.00 23.40           C  
ATOM   3979  O   GLU B 166     132.121 159.917  97.249  1.00 23.40           O  
ATOM   3980  CB  GLU B 166     129.122 158.736  97.935  1.00 23.40           C  
ATOM   3981  CG  GLU B 166     127.714 158.750  97.365  1.00 23.40           C  
ATOM   3982  CD  GLU B 166     126.646 158.598  98.426  1.00 23.40           C  
ATOM   3983  OE1 GLU B 166     126.970 158.113  99.529  1.00 23.40           O  
ATOM   3984  OE2 GLU B 166     125.481 158.958  98.156  1.00 23.40           O  
ATOM   3985  N   VAL B 167     132.167 157.865  98.146  1.00 19.87           N  
ATOM   3986  CA  VAL B 167     133.452 158.068  98.807  1.00 19.87           C  
ATOM   3987  C   VAL B 167     134.346 156.872  98.520  1.00 19.87           C  
ATOM   3988  O   VAL B 167     133.916 155.724  98.658  1.00 19.87           O  
ATOM   3989  CB  VAL B 167     133.290 158.262 100.325  1.00 19.87           C  
ATOM   3990  CG1 VAL B 167     134.637 158.277 100.999  1.00 19.87           C  
ATOM   3991  CG2 VAL B 167     132.555 159.548 100.611  1.00 19.87           C  
ATOM   3992  N   VAL B 168     135.590 157.138  98.131  1.00 19.63           N  
ATOM   3993  CA  VAL B 168     136.557 156.100  97.805  1.00 19.63           C  
ATOM   3994  C   VAL B 168     137.827 156.353  98.598  1.00 19.63           C  
ATOM   3995  O   VAL B 168     138.327 157.482  98.638  1.00 19.63           O  
ATOM   3996  CB  VAL B 168     136.868 156.067  96.297  1.00 19.63           C  
ATOM   3997  CG1 VAL B 168     137.870 154.976  95.992  1.00 19.63           C  
ATOM   3998  CG2 VAL B 168     135.603 155.856  95.507  1.00 19.63           C  
ATOM   3999  N   TYR B 169     138.360 155.302  99.211  1.00 20.60           N  
ATOM   4000  CA  TYR B 169     139.568 155.395 100.015  1.00 20.60           C  
ATOM   4001  C   TYR B 169     140.778 154.942  99.213  1.00 20.60           C  
ATOM   4002  O   TYR B 169     140.691 154.013  98.408  1.00 20.60           O  
ATOM   4003  CB  TYR B 169     139.443 154.558 101.284  1.00 20.60           C  
ATOM   4004  CG  TYR B 169     138.596 155.210 102.339  1.00 20.60           C  
ATOM   4005  CD1 TYR B 169     138.834 156.513 102.733  1.00 20.60           C  
ATOM   4006  CD2 TYR B 169     137.550 154.532 102.930  1.00 20.60           C  
ATOM   4007  CE1 TYR B 169     138.062 157.116 103.693  1.00 20.60           C  
ATOM   4008  CE2 TYR B 169     136.774 155.126 103.890  1.00 20.60           C  
ATOM   4009  CZ  TYR B 169     137.033 156.418 104.266  1.00 20.60           C  
ATOM   4010  OH  TYR B 169     136.259 157.017 105.225  1.00 20.60           O  
ATOM   4011  N   GLU B 170     141.897 155.629  99.411  1.00 32.62           N  
ATOM   4012  CA  GLU B 170     143.172 155.266  98.816  1.00 32.62           C  
ATOM   4013  C   GLU B 170     144.268 155.484  99.846  1.00 32.62           C  
ATOM   4014  O   GLU B 170     144.058 156.124 100.878  1.00 32.62           O  
ATOM   4015  CB  GLU B 170     143.463 156.086  97.555  1.00 32.62           C  
ATOM   4016  CG  GLU B 170     142.508 155.837  96.409  1.00 32.62           C  
ATOM   4017  CD  GLU B 170     142.725 154.490  95.758  1.00 32.62           C  
ATOM   4018  OE1 GLU B 170     143.691 153.795  96.133  1.00 32.62           O  
ATOM   4019  OE2 GLU B 170     141.931 154.126  94.866  1.00 32.62           O  
ATOM   4020  N   TRP B 171     145.453 154.958  99.561  1.00 39.51           N  
ATOM   4021  CA  TRP B 171     146.592 155.156 100.443  1.00 39.51           C  
ATOM   4022  C   TRP B 171     147.425 156.333  99.960  1.00 39.51           C  
ATOM   4023  O   TRP B 171     147.686 156.476  98.763  1.00 39.51           O  
ATOM   4024  CB  TRP B 171     147.445 153.894 100.517  1.00 39.51           C  
ATOM   4025  CG  TRP B 171     146.690 152.707 100.994  1.00 39.51           C  
ATOM   4026  CD1 TRP B 171     146.052 151.788 100.227  1.00 39.51           C  
ATOM   4027  CD2 TRP B 171     146.495 152.304 102.351  1.00 39.51           C  
ATOM   4028  NE1 TRP B 171     145.469 150.835 101.019  1.00 39.51           N  
ATOM   4029  CE2 TRP B 171     145.727 151.131 102.330  1.00 39.51           C  
ATOM   4030  CE3 TRP B 171     146.892 152.824 103.581  1.00 39.51           C  
ATOM   4031  CZ2 TRP B 171     145.351 150.469 103.486  1.00 39.51           C  
ATOM   4032  CZ3 TRP B 171     146.518 152.163 104.727  1.00 39.51           C  
ATOM   4033  CH2 TRP B 171     145.754 151.002 104.674  1.00 39.51           C  
ATOM   4034  N   THR B 172     147.842 157.177 100.905  1.00 26.56           N  
ATOM   4035  CA  THR B 172     148.482 158.439 100.547  1.00 26.56           C  
ATOM   4036  C   THR B 172     149.816 158.211  99.854  1.00 26.56           C  
ATOM   4037  O   THR B 172     150.212 158.992  98.984  1.00 26.56           O  
ATOM   4038  CB  THR B 172     148.668 159.304 101.792  1.00 26.56           C  
ATOM   4039  OG1 THR B 172     147.466 159.290 102.570  1.00 26.56           O  
ATOM   4040  CG2 THR B 172     148.976 160.734 101.397  1.00 26.56           C  
ATOM   4041  N   ARG B 173     150.520 157.153 100.221  1.00 29.93           N  
ATOM   4042  CA  ARG B 173     151.805 156.822  99.627  1.00 29.93           C  
ATOM   4043  C   ARG B 173     151.744 155.401  99.076  1.00 29.93           C  
ATOM   4044  O   ARG B 173     150.673 154.800  98.975  1.00 29.93           O  
ATOM   4045  CB  ARG B 173     152.930 156.989 100.649  1.00 29.93           C  
ATOM   4046  CG  ARG B 173     153.026 158.384 101.230  1.00 29.93           C  
ATOM   4047  CD  ARG B 173     154.276 158.551 102.070  1.00 29.93           C  
ATOM   4048  NE  ARG B 173     154.251 157.738 103.281  1.00 29.93           N  
ATOM   4049  CZ  ARG B 173     153.766 158.150 104.446  1.00 29.93           C  
ATOM   4050  NH1 ARG B 173     153.253 159.366 104.559  1.00 29.93           N  
ATOM   4051  NH2 ARG B 173     153.789 157.346 105.498  1.00 29.93           N  
ATOM   4052  N   GLU B 174     152.898 154.875  98.698  1.00 33.16           N  
ATOM   4053  CA  GLU B 174     152.963 153.500  98.231  1.00 33.16           C  
ATOM   4054  C   GLU B 174     152.486 152.560  99.332  1.00 33.16           C  
ATOM   4055  O   GLU B 174     152.980 152.640 100.464  1.00 33.16           O  
ATOM   4056  CB  GLU B 174     154.386 153.160  97.807  1.00 33.16           C  
ATOM   4057  CG  GLU B 174     154.870 154.018  96.661  1.00 33.16           C  
ATOM   4058  CD  GLU B 174     156.374 154.109  96.592  1.00 33.16           C  
ATOM   4059  OE1 GLU B 174     157.044 153.669  97.549  1.00 33.16           O  
ATOM   4060  OE2 GLU B 174     156.886 154.630  95.580  1.00 33.16           O  
ATOM   4061  N   PRO B 175     151.533 151.673  99.050  1.00 39.51           N  
ATOM   4062  CA  PRO B 175     150.901 150.891 100.124  1.00 39.51           C  
ATOM   4063  C   PRO B 175     151.869 150.147 101.026  1.00 39.51           C  
ATOM   4064  O   PRO B 175     151.585 149.984 102.217  1.00 39.51           O  
ATOM   4065  CB  PRO B 175     149.999 149.929  99.347  1.00 39.51           C  
ATOM   4066  CG  PRO B 175     149.662 150.674  98.120  1.00 39.51           C  
ATOM   4067  CD  PRO B 175     150.900 151.426  97.748  1.00 39.51           C  
ATOM   4068  N   ALA B 176     153.001 149.684 100.501  1.00 25.74           N  
ATOM   4069  CA  ALA B 176     153.974 149.019 101.359  1.00 25.74           C  
ATOM   4070  C   ALA B 176     154.533 149.966 102.408  1.00 25.74           C  
ATOM   4071  O   ALA B 176     154.939 149.526 103.488  1.00 25.74           O  
ATOM   4072  CB  ALA B 176     155.106 148.434 100.520  1.00 25.74           C  
ATOM   4073  N   ARG B 177     154.566 151.262 102.111  1.00 31.78           N  
ATOM   4074  CA  ARG B 177     155.143 152.256 103.003  1.00 31.78           C  
ATOM   4075  C   ARG B 177     154.098 153.116 103.700  1.00 31.78           C  
ATOM   4076  O   ARG B 177     154.454 154.141 104.285  1.00 31.78           O  
ATOM   4077  CB  ARG B 177     156.105 153.159 102.234  1.00 31.78           C  
ATOM   4078  CG  ARG B 177     157.285 152.447 101.617  1.00 31.78           C  
ATOM   4079  CD  ARG B 177     158.116 153.431 100.824  1.00 31.78           C  
ATOM   4080  NE  ARG B 177     158.373 154.642 101.596  1.00 31.78           N  
ATOM   4081  CZ  ARG B 177     158.923 155.742 101.097  1.00 31.78           C  
ATOM   4082  NH1 ARG B 177     159.272 155.787  99.820  1.00 31.78           N  
ATOM   4083  NH2 ARG B 177     159.120 156.799 101.873  1.00 31.78           N  
ATOM   4084  N   SER B 178     152.819 152.746 103.637  1.00 25.65           N  
ATOM   4085  CA  SER B 178     151.795 153.568 104.273  1.00 25.65           C  
ATOM   4086  C   SER B 178     151.789 153.375 105.782  1.00 25.65           C  
ATOM   4087  O   SER B 178     152.081 154.305 106.540  1.00 25.65           O  
ATOM   4088  CB  SER B 178     150.424 153.250 103.689  1.00 25.65           C  
ATOM   4089  OG  SER B 178     150.240 153.930 102.464  1.00 25.65           O  
ATOM   4090  N   VAL B 179     151.469 152.171 106.240  1.00 17.96           N  
ATOM   4091  CA  VAL B 179     151.361 151.910 107.670  1.00 17.96           C  
ATOM   4092  C   VAL B 179     152.769 151.792 108.239  1.00 17.96           C  
ATOM   4093  O   VAL B 179     153.458 150.796 108.012  1.00 17.96           O  
ATOM   4094  CB  VAL B 179     150.544 150.647 107.947  1.00 17.96           C  
ATOM   4095  CG1 VAL B 179     150.328 150.481 109.431  1.00 17.96           C  
ATOM   4096  CG2 VAL B 179     149.225 150.723 107.225  1.00 17.96           C  
ATOM   4097  N   VAL B 180     153.192 152.798 108.996  1.00 22.55           N  
ATOM   4098  CA  VAL B 180     154.534 152.857 109.557  1.00 22.55           C  
ATOM   4099  C   VAL B 180     154.429 152.720 111.066  1.00 22.55           C  
ATOM   4100  O   VAL B 180     153.647 153.430 111.705  1.00 22.55           O  
ATOM   4101  CB  VAL B 180     155.246 154.167 109.185  1.00 22.55           C  
ATOM   4102  CG1 VAL B 180     156.646 154.181 109.756  1.00 22.55           C  
ATOM   4103  CG2 VAL B 180     155.279 154.331 107.686  1.00 22.55           C  
ATOM   4104  N   VAL B 181     155.220 151.816 111.634  1.00 27.62           N  
ATOM   4105  CA  VAL B 181     155.218 151.552 113.067  1.00 27.62           C  
ATOM   4106  C   VAL B 181     156.501 152.111 113.661  1.00 27.62           C  
ATOM   4107  O   VAL B 181     157.589 151.903 113.114  1.00 27.62           O  
ATOM   4108  CB  VAL B 181     155.080 150.049 113.360  1.00 27.62           C  
ATOM   4109  CG1 VAL B 181     156.077 149.256 112.539  1.00 27.62           C  
ATOM   4110  CG2 VAL B 181     155.276 149.779 114.834  1.00 27.62           C  
ATOM   4111  N   ALA B 182     156.373 152.836 114.768  1.00 38.03           N  
ATOM   4112  CA  ALA B 182     157.547 153.350 115.455  1.00 38.03           C  
ATOM   4113  C   ALA B 182     158.324 152.204 116.088  1.00 38.03           C  
ATOM   4114  O   ALA B 182     157.741 151.288 116.672  1.00 38.03           O  
ATOM   4115  CB  ALA B 182     157.143 154.366 116.520  1.00 38.03           C  
ATOM   4116  N   GLU B 183     159.651 152.261 115.969  1.00 65.23           N  
ATOM   4117  CA  GLU B 183     160.484 151.152 116.424  1.00 65.23           C  
ATOM   4118  C   GLU B 183     160.501 151.052 117.944  1.00 65.23           C  
ATOM   4119  O   GLU B 183     160.369 149.960 118.505  1.00 65.23           O  
ATOM   4120  CB  GLU B 183     161.902 151.307 115.876  1.00 65.23           C  
ATOM   4121  CG  GLU B 183     161.997 151.155 114.368  1.00 65.23           C  
ATOM   4122  CD  GLU B 183     163.406 151.357 113.847  1.00 65.23           C  
ATOM   4123  OE1 GLU B 183     164.256 151.861 114.610  1.00 65.23           O  
ATOM   4124  OE2 GLU B 183     163.664 151.009 112.676  1.00 65.23           O  
ATOM   4125  N   ASP B 184     160.671 152.182 118.629  1.00 60.60           N  
ATOM   4126  CA  ASP B 184     160.774 152.143 120.083  1.00 60.60           C  
ATOM   4127  C   ASP B 184     159.419 151.900 120.733  1.00 60.60           C  
ATOM   4128  O   ASP B 184     159.330 151.216 121.758  1.00 60.60           O  
ATOM   4129  CB  ASP B 184     161.391 153.443 120.598  1.00 60.60           C  
ATOM   4130  CG  ASP B 184     160.611 154.673 120.167  1.00 60.60           C  
ATOM   4131  OD1 ASP B 184     159.648 154.529 119.389  1.00 60.60           O  
ATOM   4132  OD2 ASP B 184     160.963 155.787 120.609  1.00 60.60           O  
ATOM   4133  N   GLY B 185     158.353 152.449 120.150  1.00 48.50           N  
ATOM   4134  CA  GLY B 185     157.058 152.409 120.804  1.00 48.50           C  
ATOM   4135  C   GLY B 185     156.441 151.028 120.867  1.00 48.50           C  
ATOM   4136  O   GLY B 185     155.732 150.707 121.825  1.00 48.50           O  
ATOM   4137  N   SER B 186     156.698 150.193 119.862  1.00 38.32           N  
ATOM   4138  CA  SER B 186     156.054 148.889 119.780  1.00 38.32           C  
ATOM   4139  C   SER B 186     156.429 148.012 120.964  1.00 38.32           C  
ATOM   4140  O   SER B 186     157.557 147.518 121.043  1.00 38.32           O  
ATOM   4141  CB  SER B 186     156.431 148.194 118.474  1.00 38.32           C  
ATOM   4142  OG  SER B 186     156.151 146.810 118.543  1.00 38.32           O  
ATOM   4143  N   ARG B 187     155.491 147.804 121.886  1.00 35.50           N  
ATOM   4144  CA  ARG B 187     155.736 147.005 123.079  1.00 35.50           C  
ATOM   4145  C   ARG B 187     154.739 145.857 123.131  1.00 35.50           C  
ATOM   4146  O   ARG B 187     153.526 146.072 123.068  1.00 35.50           O  
ATOM   4147  CB  ARG B 187     155.668 147.861 124.351  1.00 35.50           C  
ATOM   4148  CG  ARG B 187     154.288 148.241 124.878  1.00 35.50           C  
ATOM   4149  CD  ARG B 187     153.632 149.302 124.025  1.00 35.50           C  
ATOM   4150  NE  ARG B 187     152.454 149.877 124.666  1.00 35.50           N  
ATOM   4151  CZ  ARG B 187     152.413 151.094 125.199  1.00 35.50           C  
ATOM   4152  NH1 ARG B 187     151.296 151.537 125.757  1.00 35.50           N  
ATOM   4153  NH2 ARG B 187     153.485 151.872 125.165  1.00 35.50           N  
ATOM   4154  N   LEU B 188     155.256 144.638 123.216  1.00 34.32           N  
ATOM   4155  CA  LEU B 188     154.439 143.445 123.370  1.00 34.32           C  
ATOM   4156  C   LEU B 188     155.024 142.611 124.494  1.00 34.32           C  
ATOM   4157  O   LEU B 188     156.215 142.286 124.475  1.00 34.32           O  
ATOM   4158  CB  LEU B 188     154.379 142.637 122.075  1.00 34.32           C  
ATOM   4159  CG  LEU B 188     153.493 143.231 120.989  1.00 34.32           C  
ATOM   4160  CD1 LEU B 188     153.494 142.346 119.764  1.00 34.32           C  
ATOM   4161  CD2 LEU B 188     152.098 143.381 121.530  1.00 34.32           C  
ATOM   4162  N   ASN B 189     154.191 142.281 125.478  1.00 43.51           N  
ATOM   4163  CA  ASN B 189     154.676 141.522 126.623  1.00 43.51           C  
ATOM   4164  C   ASN B 189     155.115 140.127 126.204  1.00 43.51           C  
ATOM   4165  O   ASN B 189     156.234 139.698 126.504  1.00 43.51           O  
ATOM   4166  CB  ASN B 189     153.589 141.444 127.692  1.00 43.51           C  
ATOM   4167  CG  ASN B 189     154.153 141.372 129.090  1.00 43.51           C  
ATOM   4168  OD1 ASN B 189     153.534 141.838 130.045  1.00 43.51           O  
ATOM   4169  ND2 ASN B 189     155.343 140.800 129.220  1.00 43.51           N  
ATOM   4170  N   GLN B 190     154.252 139.415 125.486  1.00 41.58           N  
ATOM   4171  CA  GLN B 190     154.447 138.005 125.185  1.00 41.58           C  
ATOM   4172  C   GLN B 190     154.771 137.747 123.723  1.00 41.58           C  
ATOM   4173  O   GLN B 190     155.679 136.970 123.421  1.00 41.58           O  
ATOM   4174  CB  GLN B 190     153.191 137.224 125.587  1.00 41.58           C  
ATOM   4175  CG  GLN B 190     153.373 135.729 125.649  1.00 41.58           C  
ATOM   4176  CD  GLN B 190     152.166 135.036 126.238  1.00 41.58           C  
ATOM   4177  OE1 GLN B 190     151.129 135.659 126.463  1.00 41.58           O  
ATOM   4178  NE2 GLN B 190     152.293 133.741 126.496  1.00 41.58           N  
ATOM   4179  N   TYR B 191     154.053 138.382 122.805  1.00 32.20           N  
ATOM   4180  CA  TYR B 191     154.241 138.140 121.382  1.00 32.20           C  
ATOM   4181  C   TYR B 191     155.473 138.886 120.878  1.00 32.20           C  
ATOM   4182  O   TYR B 191     156.312 139.353 121.651  1.00 32.20           O  
ATOM   4183  CB  TYR B 191     152.992 138.539 120.610  1.00 32.20           C  
ATOM   4184  CG  TYR B 191     151.834 137.615 120.848  1.00 32.20           C  
ATOM   4185  CD1 TYR B 191     151.921 136.275 120.518  1.00 32.20           C  
ATOM   4186  CD2 TYR B 191     150.646 138.082 121.377  1.00 32.20           C  
ATOM   4187  CE1 TYR B 191     150.868 135.422 120.729  1.00 32.20           C  
ATOM   4188  CE2 TYR B 191     149.586 137.238 121.587  1.00 32.20           C  
ATOM   4189  CZ  TYR B 191     149.702 135.908 121.259  1.00 32.20           C  
ATOM   4190  OH  TYR B 191     148.648 135.053 121.465  1.00 32.20           O  
ATOM   4191  N   ASP B 192     155.601 138.981 119.557  1.00 30.88           N  
ATOM   4192  CA  ASP B 192     156.726 139.673 118.935  1.00 30.88           C  
ATOM   4193  C   ASP B 192     156.284 140.135 117.555  1.00 30.88           C  
ATOM   4194  O   ASP B 192     156.020 139.305 116.683  1.00 30.88           O  
ATOM   4195  CB  ASP B 192     157.942 138.762 118.844  1.00 30.88           C  
ATOM   4196  CG  ASP B 192     159.167 139.481 118.332  1.00 30.88           C  
ATOM   4197  OD1 ASP B 192     159.104 140.716 118.157  1.00 30.88           O  
ATOM   4198  OD2 ASP B 192     160.196 138.811 118.106  1.00 30.88           O  
ATOM   4199  N   LEU B 193     156.213 141.450 117.359  1.00 25.12           N  
ATOM   4200  CA  LEU B 193     155.752 141.994 116.090  1.00 25.12           C  
ATOM   4201  C   LEU B 193     156.690 141.589 114.961  1.00 25.12           C  
ATOM   4202  O   LEU B 193     157.912 141.584 115.118  1.00 25.12           O  
ATOM   4203  CB  LEU B 193     155.653 143.515 116.176  1.00 25.12           C  
ATOM   4204  CG  LEU B 193     155.110 144.219 114.937  1.00 25.12           C  
ATOM   4205  CD1 LEU B 193     153.803 143.589 114.524  1.00 25.12           C  
ATOM   4206  CD2 LEU B 193     154.921 145.696 115.209  1.00 25.12           C  
ATOM   4207  N   LEU B 194     156.108 141.236 113.818  1.00 25.76           N  
ATOM   4208  CA  LEU B 194     156.875 140.724 112.690  1.00 25.76           C  
ATOM   4209  C   LEU B 194     156.774 141.604 111.454  1.00 25.76           C  
ATOM   4210  O   LEU B 194     157.804 142.005 110.904  1.00 25.76           O  
ATOM   4211  CB  LEU B 194     156.418 139.296 112.362  1.00 25.76           C  
ATOM   4212  CG  LEU B 194     157.420 138.427 111.608  1.00 25.76           C  
ATOM   4213  CD1 LEU B 194     158.712 138.328 112.393  1.00 25.76           C  
ATOM   4214  CD2 LEU B 194     156.846 137.046 111.352  1.00 25.76           C  
ATOM   4215  N   GLY B 195     155.564 141.922 110.998  1.00 24.11           N  
ATOM   4216  CA  GLY B 195     155.425 142.693 109.776  1.00 24.11           C  
ATOM   4217  C   GLY B 195     154.014 143.194 109.565  1.00 24.11           C  
ATOM   4218  O   GLY B 195     153.080 142.834 110.286  1.00 24.11           O  
ATOM   4219  N   GLN B 196     153.876 144.036 108.542  1.00 20.21           N  
ATOM   4220  CA  GLN B 196     152.621 144.694 108.208  1.00 20.21           C  
ATOM   4221  C   GLN B 196     152.224 144.369 106.777  1.00 20.21           C  
ATOM   4222  O   GLN B 196     153.082 144.183 105.911  1.00 20.21           O  
ATOM   4223  CB  GLN B 196     152.730 146.208 108.365  1.00 20.21           C  
ATOM   4224  CG  GLN B 196     152.904 146.674 109.789  1.00 20.21           C  
ATOM   4225  CD  GLN B 196     154.288 146.405 110.320  1.00 20.21           C  
ATOM   4226  OE1 GLN B 196     155.194 146.053 109.567  1.00 20.21           O  
ATOM   4227  NE2 GLN B 196     154.461 146.561 111.625  1.00 20.21           N  
ATOM   4228  N   THR B 197     150.920 144.304 106.534  1.00 18.35           N  
ATOM   4229  CA  THR B 197     150.397 144.045 105.202  1.00 18.35           C  
ATOM   4230  C   THR B 197     149.132 144.864 105.007  1.00 18.35           C  
ATOM   4231  O   THR B 197     148.341 145.013 105.938  1.00 18.35           O  
ATOM   4232  CB  THR B 197     150.113 142.553 105.015  1.00 18.35           C  
ATOM   4233  OG1 THR B 197     151.351 141.834 105.012  1.00 18.35           O  
ATOM   4234  CG2 THR B 197     149.385 142.300 103.718  1.00 18.35           C  
ATOM   4235  N   VAL B 198     148.946 145.408 103.809  1.00 16.74           N  
ATOM   4236  CA  VAL B 198     147.798 146.257 103.524  1.00 16.74           C  
ATOM   4237  C   VAL B 198     147.029 145.674 102.351  1.00 16.74           C  
ATOM   4238  O   VAL B 198     147.571 144.920 101.540  1.00 16.74           O  
ATOM   4239  CB  VAL B 198     148.227 147.703 103.228  1.00 16.74           C  
ATOM   4240  CG1 VAL B 198     148.819 148.325 104.465  1.00 16.74           C  
ATOM   4241  CG2 VAL B 198     149.232 147.712 102.112  1.00 16.74           C  
ATOM   4242  N   ASP B 199     145.750 146.030 102.268  1.00 19.69           N  
ATOM   4243  CA  ASP B 199     144.884 145.513 101.221  1.00 19.69           C  
ATOM   4244  C   ASP B 199     143.670 146.418 101.083  1.00 19.69           C  
ATOM   4245  O   ASP B 199     143.267 147.088 102.035  1.00 19.69           O  
ATOM   4246  CB  ASP B 199     144.452 144.078 101.531  1.00 19.69           C  
ATOM   4247  CG  ASP B 199     143.685 143.440 100.396  1.00 19.69           C  
ATOM   4248  OD1 ASP B 199     143.496 144.102  99.356  1.00 19.69           O  
ATOM   4249  OD2 ASP B 199     143.271 142.271 100.542  1.00 19.69           O  
ATOM   4250  N   SER B 200     143.086 146.427  99.891  1.00 17.87           N  
ATOM   4251  CA  SER B 200     141.869 147.176  99.618  1.00 17.87           C  
ATOM   4252  C   SER B 200     140.806 146.225  99.097  1.00 17.87           C  
ATOM   4253  O   SER B 200     141.108 145.322  98.314  1.00 17.87           O  
ATOM   4254  CB  SER B 200     142.120 148.284  98.601  1.00 17.87           C  
ATOM   4255  OG  SER B 200     143.177 149.126  99.025  1.00 17.87           O  
ATOM   4256  N   GLY B 201     139.561 146.419  99.524  1.00 17.87           N  
ATOM   4257  CA  GLY B 201     138.513 145.524  99.090  1.00 17.87           C  
ATOM   4258  C   GLY B 201     137.166 146.208  99.064  1.00 17.87           C  
ATOM   4259  O   GLY B 201     137.023 147.366  99.459  1.00 17.87           O  
ATOM   4260  N   ILE B 202     136.165 145.465  98.603  1.00 19.19           N  
ATOM   4261  CA  ILE B 202     134.787 145.932  98.549  1.00 19.19           C  
ATOM   4262  C   ILE B 202     133.920 144.950  99.319  1.00 19.19           C  
ATOM   4263  O   ILE B 202     133.896 143.756  99.003  1.00 19.19           O  
ATOM   4264  CB  ILE B 202     134.296 146.075  97.100  1.00 19.19           C  
ATOM   4265  CG1 ILE B 202     135.024 147.227  96.414  1.00 19.19           C  
ATOM   4266  CG2 ILE B 202     132.800 146.294  97.068  1.00 19.19           C  
ATOM   4267  CD1 ILE B 202     134.579 147.465  94.995  1.00 19.19           C  
ATOM   4268  N   VAL B 203     133.211 145.450 100.327  1.00 23.68           N  
ATOM   4269  CA  VAL B 203     132.338 144.640 101.164  1.00 23.68           C  
ATOM   4270  C   VAL B 203     130.902 145.049 100.884  1.00 23.68           C  
ATOM   4271  O   VAL B 203     130.578 146.241 100.883  1.00 23.68           O  
ATOM   4272  CB  VAL B 203     132.674 144.804 102.654  1.00 23.68           C  
ATOM   4273  CG1 VAL B 203     131.549 144.269 103.513  1.00 23.68           C  
ATOM   4274  CG2 VAL B 203     133.970 144.093 102.977  1.00 23.68           C  
ATOM   4275  N   GLN B 204     130.043 144.066 100.651  1.00 39.69           N  
ATOM   4276  CA  GLN B 204     128.646 144.310 100.332  1.00 39.69           C  
ATOM   4277  C   GLN B 204     127.777 143.938 101.523  1.00 39.69           C  
ATOM   4278  O   GLN B 204     127.843 142.809 102.016  1.00 39.69           O  
ATOM   4279  CB  GLN B 204     128.225 143.516  99.097  1.00 39.69           C  
ATOM   4280  CG  GLN B 204     126.794 143.761  98.680  1.00 39.69           C  
ATOM   4281  CD  GLN B 204     126.502 143.231  97.297  1.00 39.69           C  
ATOM   4282  OE1 GLN B 204     127.387 142.708  96.620  1.00 39.69           O  
ATOM   4283  NE2 GLN B 204     125.254 143.363  96.866  1.00 39.69           N  
ATOM   4284  N   SER B 205     126.966 144.888 101.978  1.00 39.75           N  
ATOM   4285  CA  SER B 205     126.034 144.673 103.075  1.00 39.75           C  
ATOM   4286  C   SER B 205     124.643 145.110 102.632  1.00 39.75           C  
ATOM   4287  O   SER B 205     124.401 145.387 101.454  1.00 39.75           O  
ATOM   4288  CB  SER B 205     126.468 145.423 104.339  1.00 39.75           C  
ATOM   4289  OG  SER B 205     126.272 146.815 104.193  1.00 39.75           O  
ATOM   4290  N   SER B 206     123.723 145.175 103.596  1.00 40.60           N  
ATOM   4291  CA  SER B 206     122.321 145.417 103.271  1.00 40.60           C  
ATOM   4292  C   SER B 206     122.117 146.775 102.612  1.00 40.60           C  
ATOM   4293  O   SER B 206     121.273 146.917 101.721  1.00 40.60           O  
ATOM   4294  CB  SER B 206     121.467 145.306 104.532  1.00 40.60           C  
ATOM   4295  OG  SER B 206     121.534 144.000 105.072  1.00 40.60           O  
ATOM   4296  N   THR B 207     122.876 147.785 103.034  1.00 38.59           N  
ATOM   4297  CA  THR B 207     122.631 149.134 102.534  1.00 38.59           C  
ATOM   4298  C   THR B 207     123.256 149.349 101.160  1.00 38.59           C  
ATOM   4299  O   THR B 207     122.689 150.059 100.322  1.00 38.59           O  
ATOM   4300  CB  THR B 207     123.155 150.163 103.529  1.00 38.59           C  
ATOM   4301  OG1 THR B 207     124.562 149.972 103.717  1.00 38.59           O  
ATOM   4302  CG2 THR B 207     122.447 150.009 104.860  1.00 38.59           C  
ATOM   4303  N   GLY B 208     124.417 148.755 100.907  1.00 37.75           N  
ATOM   4304  CA  GLY B 208     125.061 148.925  99.618  1.00 37.75           C  
ATOM   4305  C   GLY B 208     126.447 148.313  99.618  1.00 37.75           C  
ATOM   4306  O   GLY B 208     126.729 147.384 100.375  1.00 37.75           O  
ATOM   4307  N   GLU B 209     127.300 148.848  98.749  1.00 33.49           N  
ATOM   4308  CA  GLU B 209     128.676 148.393  98.599  1.00 33.49           C  
ATOM   4309  C   GLU B 209     129.612 149.440  99.183  1.00 33.49           C  
ATOM   4310  O   GLU B 209     129.622 150.587  98.727  1.00 33.49           O  
ATOM   4311  CB  GLU B 209     129.007 148.148  97.129  1.00 33.49           C  
ATOM   4312  CG  GLU B 209     128.061 147.193  96.437  1.00 33.49           C  
ATOM   4313  CD  GLU B 209     128.377 147.029  94.966  1.00 33.49           C  
ATOM   4314  OE1 GLU B 209     129.207 147.803  94.447  1.00 33.49           O  
ATOM   4315  OE2 GLU B 209     127.797 146.125  94.328  1.00 33.49           O  
ATOM   4316  N   TYR B 210     130.404 149.048 100.177  1.00 19.01           N  
ATOM   4317  CA  TYR B 210     131.330 149.949 100.843  1.00 19.01           C  
ATOM   4318  C   TYR B 210     132.758 149.539 100.525  1.00 19.01           C  
ATOM   4319  O   TYR B 210     133.051 148.350 100.374  1.00 19.01           O  
ATOM   4320  CB  TYR B 210     131.134 149.939 102.359  1.00 19.01           C  
ATOM   4321  CG  TYR B 210     129.783 150.408 102.833  1.00 19.01           C  
ATOM   4322  CD1 TYR B 210     128.907 151.053 101.980  1.00 19.01           C  
ATOM   4323  CD2 TYR B 210     129.389 150.212 104.146  1.00 19.01           C  
ATOM   4324  CE1 TYR B 210     127.677 151.480 102.419  1.00 19.01           C  
ATOM   4325  CE2 TYR B 210     128.164 150.638 104.593  1.00 19.01           C  
ATOM   4326  CZ  TYR B 210     127.312 151.270 103.725  1.00 19.01           C  
ATOM   4327  OH  TYR B 210     126.084 151.697 104.165  1.00 19.01           O  
ATOM   4328  N   VAL B 211     133.643 150.516 100.410  1.00 13.92           N  
ATOM   4329  CA  VAL B 211     135.057 150.216 100.232  1.00 13.92           C  
ATOM   4330  C   VAL B 211     135.701 150.071 101.602  1.00 13.92           C  
ATOM   4331  O   VAL B 211     135.386 150.817 102.533  1.00 13.92           O  
ATOM   4332  CB  VAL B 211     135.740 151.304  99.389  1.00 13.92           C  
ATOM   4333  CG1 VAL B 211     135.648 152.643 100.079  1.00 13.92           C  
ATOM   4334  CG2 VAL B 211     137.178 150.933  99.115  1.00 13.92           C  
ATOM   4335  N   VAL B 212     136.590 149.093 101.743  1.00 15.91           N  
ATOM   4336  CA  VAL B 212     137.153 148.732 103.036  1.00 15.91           C  
ATOM   4337  C   VAL B 212     138.660 148.611 102.902  1.00 15.91           C  
ATOM   4338  O   VAL B 212     139.154 147.871 102.044  1.00 15.91           O  
ATOM   4339  CB  VAL B 212     136.560 147.414 103.562  1.00 15.91           C  
ATOM   4340  CG1 VAL B 212     137.420 146.855 104.668  1.00 15.91           C  
ATOM   4341  CG2 VAL B 212     135.148 147.634 104.051  1.00 15.91           C  
ATOM   4342  N   MET B 213     139.390 149.321 103.754  1.00 21.18           N  
ATOM   4343  CA  MET B 213     140.837 149.215 103.808  1.00 21.18           C  
ATOM   4344  C   MET B 213     141.217 148.283 104.947  1.00 21.18           C  
ATOM   4345  O   MET B 213     140.727 148.436 106.070  1.00 21.18           O  
ATOM   4346  CB  MET B 213     141.469 150.590 104.001  1.00 21.18           C  
ATOM   4347  CG  MET B 213     141.304 151.488 102.808  1.00 21.18           C  
ATOM   4348  SD  MET B 213     142.121 150.770 101.381  1.00 21.18           S  
ATOM   4349  CE  MET B 213     141.116 151.432 100.066  1.00 21.18           C  
ATOM   4350  N   THR B 214     142.090 147.324 104.659  1.00 17.85           N  
ATOM   4351  CA  THR B 214     142.463 146.280 105.595  1.00 17.85           C  
ATOM   4352  C   THR B 214     143.955 146.354 105.858  1.00 17.85           C  
ATOM   4353  O   THR B 214     144.740 146.590 104.937  1.00 17.85           O  
ATOM   4354  CB  THR B 214     142.111 144.901 105.037  1.00 17.85           C  
ATOM   4355  OG1 THR B 214     140.712 144.847 104.743  1.00 17.85           O  
ATOM   4356  CG2 THR B 214     142.448 143.817 106.035  1.00 17.85           C  
ATOM   4357  N   THR B 215     144.348 146.140 107.109  1.00 17.81           N  
ATOM   4358  CA  THR B 215     145.753 146.096 107.483  1.00 17.81           C  
ATOM   4359  C   THR B 215     145.958 144.942 108.448  1.00 17.81           C  
ATOM   4360  O   THR B 215     145.410 144.954 109.551  1.00 17.81           O  
ATOM   4361  CB  THR B 215     146.189 147.412 108.122  1.00 17.81           C  
ATOM   4362  OG1 THR B 215     145.706 148.501 107.331  1.00 17.81           O  
ATOM   4363  CG2 THR B 215     147.695 147.485 108.195  1.00 17.81           C  
ATOM   4364  N   HIS B 216     146.742 143.954 108.039  1.00 21.69           N  
ATOM   4365  CA  HIS B 216     147.092 142.827 108.890  1.00 21.69           C  
ATOM   4366  C   HIS B 216     148.428 143.095 109.563  1.00 21.69           C  
ATOM   4367  O   HIS B 216     149.398 143.471 108.896  1.00 21.69           O  
ATOM   4368  CB  HIS B 216     147.174 141.533 108.084  1.00 21.69           C  
ATOM   4369  CG  HIS B 216     145.883 141.129 107.450  1.00 21.69           C  
ATOM   4370  ND1 HIS B 216     145.550 141.470 106.158  1.00 21.69           N  
ATOM   4371  CD2 HIS B 216     144.846 140.402 107.927  1.00 21.69           C  
ATOM   4372  CE1 HIS B 216     144.361 140.974 105.867  1.00 21.69           C  
ATOM   4373  NE2 HIS B 216     143.912 140.323 106.924  1.00 21.69           N  
ATOM   4374  N   PHE B 217     148.478 142.903 110.879  1.00 19.05           N  
ATOM   4375  CA  PHE B 217     149.727 142.908 111.628  1.00 19.05           C  
ATOM   4376  C   PHE B 217     150.041 141.471 112.007  1.00 19.05           C  
ATOM   4377  O   PHE B 217     149.215 140.804 112.639  1.00 19.05           O  
ATOM   4378  CB  PHE B 217     149.625 143.772 112.881  1.00 19.05           C  
ATOM   4379  CG  PHE B 217     149.310 145.209 112.611  1.00 19.05           C  
ATOM   4380  CD1 PHE B 217     150.320 146.131 112.439  1.00 19.05           C  
ATOM   4381  CD2 PHE B 217     148.004 145.642 112.559  1.00 19.05           C  
ATOM   4382  CE1 PHE B 217     150.031 147.452 112.206  1.00 19.05           C  
ATOM   4383  CE2 PHE B 217     147.713 146.962 112.327  1.00 19.05           C  
ATOM   4384  CZ  PHE B 217     148.727 147.867 112.150  1.00 19.05           C  
ATOM   4385  N   HIS B 218     151.220 140.992 111.624  1.00 22.29           N  
ATOM   4386  CA  HIS B 218     151.599 139.614 111.900  1.00 22.29           C  
ATOM   4387  C   HIS B 218     152.224 139.501 113.282  1.00 22.29           C  
ATOM   4388  O   HIS B 218     152.961 140.388 113.718  1.00 22.29           O  
ATOM   4389  CB  HIS B 218     152.566 139.100 110.838  1.00 22.29           C  
ATOM   4390  CG  HIS B 218     151.949 138.957 109.484  1.00 22.29           C  
ATOM   4391  ND1 HIS B 218     151.027 137.977 109.189  1.00 22.29           N  
ATOM   4392  CD2 HIS B 218     152.122 139.667 108.345  1.00 22.29           C  
ATOM   4393  CE1 HIS B 218     150.658 138.090 107.926  1.00 22.29           C  
ATOM   4394  NE2 HIS B 218     151.307 139.108 107.392  1.00 22.29           N  
ATOM   4395  N   LEU B 219     151.921 138.404 113.973  1.00 27.56           N  
ATOM   4396  CA  LEU B 219     152.399 138.174 115.327  1.00 27.56           C  
ATOM   4397  C   LEU B 219     152.910 136.749 115.459  1.00 27.56           C  
ATOM   4398  O   LEU B 219     152.323 135.816 114.904  1.00 27.56           O  
ATOM   4399  CB  LEU B 219     151.293 138.424 116.353  1.00 27.56           C  
ATOM   4400  CG  LEU B 219     150.788 139.863 116.430  1.00 27.56           C  
ATOM   4401  CD1 LEU B 219     149.668 139.997 117.442  1.00 27.56           C  
ATOM   4402  CD2 LEU B 219     151.931 140.786 116.778  1.00 27.56           C  
ATOM   4403  N   LYS B 220     154.010 136.587 116.189  1.00 35.49           N  
ATOM   4404  CA  LYS B 220     154.572 135.280 116.498  1.00 35.49           C  
ATOM   4405  C   LYS B 220     154.876 135.219 117.986  1.00 35.49           C  
ATOM   4406  O   LYS B 220     155.354 136.197 118.566  1.00 35.49           O  
ATOM   4407  CB  LYS B 220     155.839 135.011 115.688  1.00 35.49           C  
ATOM   4408  CG  LYS B 220     156.462 133.656 115.951  1.00 35.49           C  
ATOM   4409  CD  LYS B 220     157.739 133.468 115.151  1.00 35.49           C  
ATOM   4410  CE  LYS B 220     158.363 132.113 115.429  1.00 35.49           C  
ATOM   4411  NZ  LYS B 220     159.625 131.915 114.667  1.00 35.49           N  
ATOM   4412  N   ARG B 221     154.591 134.077 118.602  1.00 34.42           N  
ATOM   4413  CA  ARG B 221     154.700 133.960 120.049  1.00 34.42           C  
ATOM   4414  C   ARG B 221     156.129 133.645 120.472  1.00 34.42           C  
ATOM   4415  O   ARG B 221     156.850 132.905 119.801  1.00 34.42           O  
ATOM   4416  CB  ARG B 221     153.757 132.877 120.569  1.00 34.42           C  
ATOM   4417  CG  ARG B 221     153.716 132.760 122.079  1.00 34.42           C  
ATOM   4418  CD  ARG B 221     152.723 131.703 122.511  1.00 34.42           C  
ATOM   4419  NE  ARG B 221     151.368 132.023 122.079  1.00 34.42           N  
ATOM   4420  CZ  ARG B 221     150.446 132.563 122.866  1.00 34.42           C  
ATOM   4421  NH1 ARG B 221     150.732 132.836 124.128  1.00 34.42           N  
ATOM   4422  NH2 ARG B 221     149.237 132.823 122.394  1.00 34.42           N  
ATOM   4423  N   LYS B 222     156.531 134.216 121.604  1.00 36.20           N  
ATOM   4424  CA  LYS B 222     157.801 133.882 122.232  1.00 36.20           C  
ATOM   4425  C   LYS B 222     157.636 132.585 123.010  1.00 36.20           C  
ATOM   4426  O   LYS B 222     156.604 132.368 123.651  1.00 36.20           O  
ATOM   4427  CB  LYS B 222     158.268 134.996 123.167  1.00 36.20           C  
ATOM   4428  CG  LYS B 222     158.731 136.254 122.470  1.00 36.20           C  
ATOM   4429  CD  LYS B 222     159.978 135.997 121.650  1.00 36.20           C  
ATOM   4430  CE  LYS B 222     160.520 137.291 121.060  1.00 36.20           C  
ATOM   4431  NZ  LYS B 222     161.677 137.057 120.152  1.00 36.20           N  
ATOM   4432  N   ILE B 223     158.656 131.727 122.956  1.00 38.04           N  
ATOM   4433  CA  ILE B 223     158.567 130.399 123.551  1.00 38.04           C  
ATOM   4434  C   ILE B 223     159.499 130.220 124.741  1.00 38.04           C  
ATOM   4435  O   ILE B 223     159.358 129.232 125.480  1.00 38.04           O  
ATOM   4436  CB  ILE B 223     158.850 129.314 122.491  1.00 38.04           C  
ATOM   4437  CG1 ILE B 223     158.298 127.967 122.940  1.00 38.04           C  
ATOM   4438  CG2 ILE B 223     160.334 129.223 122.214  1.00 38.04           C  
ATOM   4439  CD1 ILE B 223     156.850 128.026 123.325  1.00 38.04           C  
ATOM   4440  N   GLY B 224     160.426 131.152 124.969  1.00 45.60           N  
ATOM   4441  CA  GLY B 224     161.435 130.961 125.998  1.00 45.60           C  
ATOM   4442  C   GLY B 224     160.875 130.722 127.386  1.00 45.60           C  
ATOM   4443  O   GLY B 224     161.570 130.190 128.254  1.00 45.60           O  
ATOM   4444  N   TYR B 225     159.626 131.115 127.623  1.00 49.24           N  
ATOM   4445  CA  TYR B 225     159.065 130.982 128.963  1.00 49.24           C  
ATOM   4446  C   TYR B 225     158.518 129.584 129.215  1.00 49.24           C  
ATOM   4447  O   TYR B 225     158.778 128.992 130.268  1.00 49.24           O  
ATOM   4448  CB  TYR B 225     157.971 132.026 129.171  1.00 49.24           C  
ATOM   4449  CG  TYR B 225     157.369 132.032 130.556  1.00 49.24           C  
ATOM   4450  CD1 TYR B 225     158.030 132.630 131.618  1.00 49.24           C  
ATOM   4451  CD2 TYR B 225     156.132 131.455 130.798  1.00 49.24           C  
ATOM   4452  CE1 TYR B 225     157.480 132.644 132.882  1.00 49.24           C  
ATOM   4453  CE2 TYR B 225     155.575 131.465 132.057  1.00 49.24           C  
ATOM   4454  CZ  TYR B 225     156.253 132.060 133.095  1.00 49.24           C  
ATOM   4455  OH  TYR B 225     155.701 132.072 134.355  1.00 49.24           O  
ATOM   4456  N   PHE B 226     157.772 129.034 128.256  1.00 51.68           N  
ATOM   4457  CA  PHE B 226     157.109 127.754 128.479  1.00 51.68           C  
ATOM   4458  C   PHE B 226     158.085 126.588 128.489  1.00 51.68           C  
ATOM   4459  O   PHE B 226     157.702 125.482 128.883  1.00 51.68           O  
ATOM   4460  CB  PHE B 226     156.033 127.525 127.423  1.00 51.68           C  
ATOM   4461  CG  PHE B 226     154.946 128.555 127.439  1.00 51.68           C  
ATOM   4462  CD1 PHE B 226     154.683 129.285 128.582  1.00 51.68           C  
ATOM   4463  CD2 PHE B 226     154.190 128.796 126.313  1.00 51.68           C  
ATOM   4464  CE1 PHE B 226     153.687 130.236 128.599  1.00 51.68           C  
ATOM   4465  CE2 PHE B 226     153.191 129.744 126.324  1.00 51.68           C  
ATOM   4466  CZ  PHE B 226     152.940 130.465 127.469  1.00 51.68           C  
ATOM   4467  N   VAL B 227     159.328 126.803 128.059  1.00 51.65           N  
ATOM   4468  CA  VAL B 227     160.338 125.756 128.172  1.00 51.65           C  
ATOM   4469  C   VAL B 227     160.618 125.456 129.638  1.00 51.65           C  
ATOM   4470  O   VAL B 227     160.403 124.338 130.116  1.00 51.65           O  
ATOM   4471  CB  VAL B 227     161.619 126.157 127.424  1.00 51.65           C  
ATOM   4472  CG1 VAL B 227     162.723 125.159 127.711  1.00 51.65           C  
ATOM   4473  CG2 VAL B 227     161.350 126.235 125.935  1.00 51.65           C  
ATOM   4474  N   ILE B 228     161.095 126.460 130.379  1.00 49.39           N  
ATOM   4475  CA  ILE B 228     161.354 126.267 131.803  1.00 49.39           C  
ATOM   4476  C   ILE B 228     160.091 126.328 132.640  1.00 49.39           C  
ATOM   4477  O   ILE B 228     160.152 126.092 133.852  1.00 49.39           O  
ATOM   4478  CB  ILE B 228     162.341 127.305 132.367  1.00 49.39           C  
ATOM   4479  CG1 ILE B 228     161.633 128.631 132.626  1.00 49.39           C  
ATOM   4480  CG2 ILE B 228     163.501 127.506 131.418  1.00 49.39           C  
ATOM   4481  CD1 ILE B 228     162.508 129.654 133.305  1.00 49.39           C  
ATOM   4482  N   GLN B 229     158.947 126.644 132.037  1.00 53.42           N  
ATOM   4483  CA  GLN B 229     157.719 126.721 132.815  1.00 53.42           C  
ATOM   4484  C   GLN B 229     157.131 125.340 133.075  1.00 53.42           C  
ATOM   4485  O   GLN B 229     157.009 124.912 134.227  1.00 53.42           O  
ATOM   4486  CB  GLN B 229     156.701 127.607 132.099  1.00 53.42           C  
ATOM   4487  CG  GLN B 229     155.360 127.670 132.796  1.00 53.42           C  
ATOM   4488  CD  GLN B 229     155.489 128.117 134.232  1.00 53.42           C  
ATOM   4489  OE1 GLN B 229     154.828 127.583 135.122  1.00 53.42           O  
ATOM   4490  NE2 GLN B 229     156.343 129.105 134.469  1.00 53.42           N  
ATOM   4491  N   THR B 230     156.760 124.630 132.015  1.00 57.40           N  
ATOM   4492  CA  THR B 230     156.055 123.359 132.138  1.00 57.40           C  
ATOM   4493  C   THR B 230     156.812 122.183 131.544  1.00 57.40           C  
ATOM   4494  O   THR B 230     156.842 121.111 132.149  1.00 57.40           O  
ATOM   4495  CB  THR B 230     154.675 123.459 131.477  1.00 57.40           C  
ATOM   4496  OG1 THR B 230     153.926 124.515 132.090  1.00 57.40           O  
ATOM   4497  CG2 THR B 230     153.910 122.161 131.632  1.00 57.40           C  
ATOM   4498  N   TYR B 231     157.437 122.358 130.379  1.00 55.99           N  
ATOM   4499  CA  TYR B 231     158.049 121.226 129.690  1.00 55.99           C  
ATOM   4500  C   TYR B 231     159.198 120.635 130.499  1.00 55.99           C  
ATOM   4501  O   TYR B 231     159.336 119.409 130.599  1.00 55.99           O  
ATOM   4502  CB  TYR B 231     158.523 121.655 128.304  1.00 55.99           C  
ATOM   4503  CG  TYR B 231     157.394 121.927 127.339  1.00 55.99           C  
ATOM   4504  CD1 TYR B 231     156.098 121.531 127.630  1.00 55.99           C  
ATOM   4505  CD2 TYR B 231     157.624 122.573 126.136  1.00 55.99           C  
ATOM   4506  CE1 TYR B 231     155.064 121.776 126.752  1.00 55.99           C  
ATOM   4507  CE2 TYR B 231     156.594 122.822 125.251  1.00 55.99           C  
ATOM   4508  CZ  TYR B 231     155.317 122.419 125.564  1.00 55.99           C  
ATOM   4509  OH  TYR B 231     154.287 122.663 124.687  1.00 55.99           O  
ATOM   4510  N   LEU B 232     160.036 121.491 131.088  1.00 55.96           N  
ATOM   4511  CA  LEU B 232     161.175 120.974 131.846  1.00 55.96           C  
ATOM   4512  C   LEU B 232     160.754 120.224 133.101  1.00 55.96           C  
ATOM   4513  O   LEU B 232     161.316 119.146 133.361  1.00 55.96           O  
ATOM   4514  CB  LEU B 232     162.150 122.106 132.166  1.00 55.96           C  
ATOM   4515  CG  LEU B 232     163.098 122.472 131.032  1.00 55.96           C  
ATOM   4516  CD1 LEU B 232     164.143 123.423 131.556  1.00 55.96           C  
ATOM   4517  CD2 LEU B 232     163.738 121.225 130.455  1.00 55.96           C  
ATOM   4518  N   PRO B 233     159.832 120.722 133.935  1.00 55.09           N  
ATOM   4519  CA  PRO B 233     159.383 119.892 135.064  1.00 55.09           C  
ATOM   4520  C   PRO B 233     158.785 118.570 134.623  1.00 55.09           C  
ATOM   4521  O   PRO B 233     159.013 117.544 135.277  1.00 55.09           O  
ATOM   4522  CB  PRO B 233     158.352 120.785 135.763  1.00 55.09           C  
ATOM   4523  CG  PRO B 233     158.791 122.154 135.450  1.00 55.09           C  
ATOM   4524  CD  PRO B 233     159.299 122.092 134.039  1.00 55.09           C  
ATOM   4525  N   CYS B 234     158.044 118.561 133.513  1.00 61.37           N  
ATOM   4526  CA  CYS B 234     157.478 117.310 133.023  1.00 61.37           C  
ATOM   4527  C   CYS B 234     158.573 116.328 132.632  1.00 61.37           C  
ATOM   4528  O   CYS B 234     158.525 115.153 133.017  1.00 61.37           O  
ATOM   4529  CB  CYS B 234     156.550 117.575 131.839  1.00 61.37           C  
ATOM   4530  SG  CYS B 234     154.873 116.946 132.076  1.00 61.37           S  
ATOM   4531  N   ILE B 235     159.577 116.791 131.886  1.00 55.11           N  
ATOM   4532  CA  ILE B 235     160.650 115.897 131.461  1.00 55.11           C  
ATOM   4533  C   ILE B 235     161.443 115.399 132.662  1.00 55.11           C  
ATOM   4534  O   ILE B 235     161.820 114.222 132.731  1.00 55.11           O  
ATOM   4535  CB  ILE B 235     161.555 116.599 130.435  1.00 55.11           C  
ATOM   4536  CG1 ILE B 235     160.758 116.938 129.179  1.00 55.11           C  
ATOM   4537  CG2 ILE B 235     162.737 115.722 130.080  1.00 55.11           C  
ATOM   4538  CD1 ILE B 235     161.563 117.669 128.139  1.00 55.11           C  
ATOM   4539  N   MET B 236     161.702 116.278 133.634  1.00 59.16           N  
ATOM   4540  CA  MET B 236     162.471 115.864 134.802  1.00 59.16           C  
ATOM   4541  C   MET B 236     161.708 114.841 135.630  1.00 59.16           C  
ATOM   4542  O   MET B 236     162.290 113.862 136.107  1.00 59.16           O  
ATOM   4543  CB  MET B 236     162.840 117.078 135.654  1.00 59.16           C  
ATOM   4544  CG  MET B 236     163.824 118.020 134.987  1.00 59.16           C  
ATOM   4545  SD  MET B 236     164.345 119.353 136.078  1.00 59.16           S  
ATOM   4546  CE  MET B 236     165.197 118.423 137.345  1.00 59.16           C  
ATOM   4547  N   THR B 237     160.399 115.033 135.795  1.00 56.62           N  
ATOM   4548  CA  THR B 237     159.628 114.063 136.562  1.00 56.62           C  
ATOM   4549  C   THR B 237     159.470 112.749 135.802  1.00 56.62           C  
ATOM   4550  O   THR B 237     159.403 111.681 136.421  1.00 56.62           O  
ATOM   4551  CB  THR B 237     158.272 114.653 136.937  1.00 56.62           C  
ATOM   4552  OG1 THR B 237     158.457 115.979 137.444  1.00 56.62           O  
ATOM   4553  CG2 THR B 237     157.610 113.817 138.016  1.00 56.62           C  
ATOM   4554  N   VAL B 238     159.445 112.795 134.468  1.00 58.19           N  
ATOM   4555  CA  VAL B 238     159.441 111.554 133.698  1.00 58.19           C  
ATOM   4556  C   VAL B 238     160.762 110.811 133.872  1.00 58.19           C  
ATOM   4557  O   VAL B 238     160.784 109.586 134.041  1.00 58.19           O  
ATOM   4558  CB  VAL B 238     159.140 111.841 132.217  1.00 58.19           C  
ATOM   4559  CG1 VAL B 238     159.425 110.613 131.372  1.00 58.19           C  
ATOM   4560  CG2 VAL B 238     157.694 112.262 132.054  1.00 58.19           C  
ATOM   4561  N   ILE B 239     161.882 111.536 133.843  1.00 57.63           N  
ATOM   4562  CA  ILE B 239     163.173 110.895 134.083  1.00 57.63           C  
ATOM   4563  C   ILE B 239     163.241 110.343 135.502  1.00 57.63           C  
ATOM   4564  O   ILE B 239     163.877 109.313 135.750  1.00 57.63           O  
ATOM   4565  CB  ILE B 239     164.321 111.881 133.795  1.00 57.63           C  
ATOM   4566  CG1 ILE B 239     164.307 112.290 132.323  1.00 57.63           C  
ATOM   4567  CG2 ILE B 239     165.663 111.267 134.146  1.00 57.63           C  
ATOM   4568  CD1 ILE B 239     165.431 113.224 131.939  1.00 57.63           C  
ATOM   4569  N   LEU B 240     162.573 111.001 136.452  1.00 60.20           N  
ATOM   4570  CA  LEU B 240     162.511 110.469 137.810  1.00 60.20           C  
ATOM   4571  C   LEU B 240     161.707 109.176 137.856  1.00 60.20           C  
ATOM   4572  O   LEU B 240     162.093 108.217 138.537  1.00 60.20           O  
ATOM   4573  CB  LEU B 240     161.908 111.512 138.749  1.00 60.20           C  
ATOM   4574  CG  LEU B 240     162.437 111.524 140.181  1.00 60.20           C  
ATOM   4575  CD1 LEU B 240     163.922 111.819 140.185  1.00 60.20           C  
ATOM   4576  CD2 LEU B 240     161.689 112.548 141.012  1.00 60.20           C  
ATOM   4577  N   SER B 241     160.583 109.132 137.141  1.00 62.37           N  
ATOM   4578  CA  SER B 241     159.831 107.887 137.023  1.00 62.37           C  
ATOM   4579  C   SER B 241     160.682 106.796 136.390  1.00 62.37           C  
ATOM   4580  O   SER B 241     160.527 105.612 136.705  1.00 62.37           O  
ATOM   4581  CB  SER B 241     158.562 108.113 136.206  1.00 62.37           C  
ATOM   4582  OG  SER B 241     158.880 108.365 134.849  1.00 62.37           O  
ATOM   4583  N   GLN B 242     161.576 107.178 135.477  1.00 68.47           N  
ATOM   4584  CA  GLN B 242     162.494 106.208 134.888  1.00 68.47           C  
ATOM   4585  C   GLN B 242     163.492 105.692 135.918  1.00 68.47           C  
ATOM   4586  O   GLN B 242     163.756 104.486 135.989  1.00 68.47           O  
ATOM   4587  CB  GLN B 242     163.228 106.836 133.706  1.00 68.47           C  
ATOM   4588  CG  GLN B 242     162.324 107.195 132.550  1.00 68.47           C  
ATOM   4589  CD  GLN B 242     161.650 105.983 131.958  1.00 68.47           C  
ATOM   4590  OE1 GLN B 242     162.202 104.883 131.974  1.00 68.47           O  
ATOM   4591  NE2 GLN B 242     160.446 106.172 131.435  1.00 68.47           N  
ATOM   4592  N   VAL B 243     164.062 106.596 136.716  1.00 70.40           N  
ATOM   4593  CA  VAL B 243     164.996 106.200 137.767  1.00 70.40           C  
ATOM   4594  C   VAL B 243     164.308 105.300 138.781  1.00 70.40           C  
ATOM   4595  O   VAL B 243     164.952 104.452 139.411  1.00 70.40           O  
ATOM   4596  CB  VAL B 243     165.605 107.449 138.433  1.00 70.40           C  
ATOM   4597  CG1 VAL B 243     166.492 107.064 139.601  1.00 70.40           C  
ATOM   4598  CG2 VAL B 243     166.395 108.250 137.416  1.00 70.40           C  
ATOM   4599  N   SER B 244     162.993 105.462 138.949  1.00 73.75           N  
ATOM   4600  CA  SER B 244     162.239 104.593 139.849  1.00 73.75           C  
ATOM   4601  C   SER B 244     162.471 103.115 139.552  1.00 73.75           C  
ATOM   4602  O   SER B 244     162.364 102.277 140.454  1.00 73.75           O  
ATOM   4603  CB  SER B 244     160.747 104.913 139.761  1.00 73.75           C  
ATOM   4604  OG  SER B 244     160.003 104.138 140.684  1.00 73.75           O  
ATOM   4605  N   PHE B 245     162.792 102.774 138.301  1.00 78.96           N  
ATOM   4606  CA  PHE B 245     163.062 101.380 137.967  1.00 78.96           C  
ATOM   4607  C   PHE B 245     164.370 100.891 138.578  1.00 78.96           C  
ATOM   4608  O   PHE B 245     164.488  99.709 138.919  1.00 78.96           O  
ATOM   4609  CB  PHE B 245     163.097 101.197 136.450  1.00 78.96           C  
ATOM   4610  CG  PHE B 245     161.770 101.405 135.782  1.00 78.96           C  
ATOM   4611  CD1 PHE B 245     160.800 100.420 135.820  1.00 78.96           C  
ATOM   4612  CD2 PHE B 245     161.495 102.580 135.105  1.00 78.96           C  
ATOM   4613  CE1 PHE B 245     159.578 100.607 135.204  1.00 78.96           C  
ATOM   4614  CE2 PHE B 245     160.274 102.772 134.485  1.00 78.96           C  
ATOM   4615  CZ  PHE B 245     159.315 101.783 134.536  1.00 78.96           C  
ATOM   4616  N   TRP B 246     165.357 101.777 138.725  1.00 82.64           N  
ATOM   4617  CA  TRP B 246     166.671 101.347 139.194  1.00 82.64           C  
ATOM   4618  C   TRP B 246     166.664 100.978 140.670  1.00 82.64           C  
ATOM   4619  O   TRP B 246     167.544 100.235 141.119  1.00 82.64           O  
ATOM   4620  CB  TRP B 246     167.707 102.438 138.938  1.00 82.64           C  
ATOM   4621  CG  TRP B 246     168.070 102.588 137.504  1.00 82.64           C  
ATOM   4622  CD1 TRP B 246     167.698 103.594 136.665  1.00 82.64           C  
ATOM   4623  CD2 TRP B 246     168.877 101.697 136.731  1.00 82.64           C  
ATOM   4624  NE1 TRP B 246     168.226 103.387 135.416  1.00 82.64           N  
ATOM   4625  CE2 TRP B 246     168.954 102.227 135.431  1.00 82.64           C  
ATOM   4626  CE3 TRP B 246     169.543 100.502 137.012  1.00 82.64           C  
ATOM   4627  CZ2 TRP B 246     169.671 101.607 134.416  1.00 82.64           C  
ATOM   4628  CZ3 TRP B 246     170.254  99.886 136.002  1.00 82.64           C  
ATOM   4629  CH2 TRP B 246     170.312 100.438 134.719  1.00 82.64           C  
ATOM   4630  N   LEU B 247     165.706 101.494 141.438  1.00 85.27           N  
ATOM   4631  CA  LEU B 247     165.675 101.232 142.871  1.00 85.27           C  
ATOM   4632  C   LEU B 247     165.628  99.736 143.148  1.00 85.27           C  
ATOM   4633  O   LEU B 247     165.054  98.961 142.378  1.00 85.27           O  
ATOM   4634  CB  LEU B 247     164.469 101.917 143.512  1.00 85.27           C  
ATOM   4635  CG  LEU B 247     164.566 103.428 143.718  1.00 85.27           C  
ATOM   4636  CD1 LEU B 247     163.313 103.954 144.399  1.00 85.27           C  
ATOM   4637  CD2 LEU B 247     165.803 103.773 144.528  1.00 85.27           C  
ATOM   4638  N   ASN B 248     166.256  99.331 144.250  1.00 87.87           N  
ATOM   4639  CA  ASN B 248     166.234  97.932 144.651  1.00 87.87           C  
ATOM   4640  C   ASN B 248     164.805  97.490 144.931  1.00 87.87           C  
ATOM   4641  O   ASN B 248     164.061  98.164 145.649  1.00 87.87           O  
ATOM   4642  CB  ASN B 248     167.108  97.721 145.887  1.00 87.87           C  
ATOM   4643  CG  ASN B 248     167.153  96.272 146.329  1.00 87.87           C  
ATOM   4644  OD1 ASN B 248     166.850  95.364 145.553  1.00 87.87           O  
ATOM   4645  ND2 ASN B 248     167.535  96.047 147.580  1.00 87.87           N  
ATOM   4646  N   ARG B 249     164.424  96.348 144.357  1.00 89.21           N  
ATOM   4647  CA  ARG B 249     163.060  95.856 144.503  1.00 89.21           C  
ATOM   4648  C   ARG B 249     162.721  95.496 145.943  1.00 89.21           C  
ATOM   4649  O   ARG B 249     161.536  95.396 146.280  1.00 89.21           O  
ATOM   4650  CB  ARG B 249     162.848  94.647 143.592  1.00 89.21           C  
ATOM   4651  CG  ARG B 249     163.868  93.539 143.794  1.00 89.21           C  
ATOM   4652  CD  ARG B 249     163.748  92.478 142.712  1.00 89.21           C  
ATOM   4653  NE  ARG B 249     164.074  93.009 141.392  1.00 89.21           N  
ATOM   4654  CZ  ARG B 249     163.987  92.316 140.261  1.00 89.21           C  
ATOM   4655  NH1 ARG B 249     164.308  92.887 139.109  1.00 89.21           N  
ATOM   4656  NH2 ARG B 249     163.577  91.054 140.278  1.00 89.21           N  
ATOM   4657  N   GLU B 250     163.729  95.304 146.796  1.00 95.03           N  
ATOM   4658  CA  GLU B 250     163.472  94.893 148.172  1.00 95.03           C  
ATOM   4659  C   GLU B 250     162.747  95.981 148.954  1.00 95.03           C  
ATOM   4660  O   GLU B 250     161.767  95.703 149.655  1.00 95.03           O  
ATOM   4661  CB  GLU B 250     164.785  94.521 148.857  1.00 95.03           C  
ATOM   4662  CG  GLU B 250     165.538  93.397 148.167  1.00 95.03           C  
ATOM   4663  CD  GLU B 250     166.857  93.080 148.840  1.00 95.03           C  
ATOM   4664  OE1 GLU B 250     167.173  93.724 149.862  1.00 95.03           O  
ATOM   4665  OE2 GLU B 250     167.580  92.188 148.348  1.00 95.03           O  
ATOM   4666  N   SER B 251     163.207  97.228 148.846  1.00 86.60           N  
ATOM   4667  CA  SER B 251     162.598  98.343 149.573  1.00 86.60           C  
ATOM   4668  C   SER B 251     161.257  98.690 148.924  1.00 86.60           C  
ATOM   4669  O   SER B 251     161.089  99.705 148.244  1.00 86.60           O  
ATOM   4670  CB  SER B 251     163.536  99.541 149.603  1.00 86.60           C  
ATOM   4671  OG  SER B 251     164.719  99.243 150.323  1.00 86.60           O  
ATOM   4672  N   VAL B 252     160.285  97.808 149.157  1.00 84.84           N  
ATOM   4673  CA  VAL B 252     158.973  97.966 148.529  1.00 84.84           C  
ATOM   4674  C   VAL B 252     158.256  99.231 148.990  1.00 84.84           C  
ATOM   4675  O   VAL B 252     157.758  99.977 148.131  1.00 84.84           O  
ATOM   4676  CB  VAL B 252     158.132  96.694 148.738  1.00 84.84           C  
ATOM   4677  CG1 VAL B 252     156.724  96.896 148.210  1.00 84.84           C  
ATOM   4678  CG2 VAL B 252     158.798  95.509 148.057  1.00 84.84           C  
ATOM   4679  N   PRO B 253     158.145  99.530 150.293  1.00 78.92           N  
ATOM   4680  CA  PRO B 253     157.457 100.777 150.677  1.00 78.92           C  
ATOM   4681  C   PRO B 253     158.126 102.028 150.132  1.00 78.92           C  
ATOM   4682  O   PRO B 253     157.433 102.968 149.714  1.00 78.92           O  
ATOM   4683  CB  PRO B 253     157.490 100.734 152.211  1.00 78.92           C  
ATOM   4684  CG  PRO B 253     157.609  99.296 152.541  1.00 78.92           C  
ATOM   4685  CD  PRO B 253     158.496  98.729 151.479  1.00 78.92           C  
ATOM   4686  N   ALA B 254     159.460 102.068 150.131  1.00 78.23           N  
ATOM   4687  CA  ALA B 254     160.161 103.196 149.530  1.00 78.23           C  
ATOM   4688  C   ALA B 254     159.825 103.323 148.050  1.00 78.23           C  
ATOM   4689  O   ALA B 254     159.634 104.433 147.541  1.00 78.23           O  
ATOM   4690  CB  ALA B 254     161.668 103.044 149.729  1.00 78.23           C  
ATOM   4691  N   ARG B 255     159.730 102.194 147.347  1.00 79.52           N  
ATOM   4692  CA  ARG B 255     159.378 102.233 145.932  1.00 79.52           C  
ATOM   4693  C   ARG B 255     157.949 102.720 145.728  1.00 79.52           C  
ATOM   4694  O   ARG B 255     157.677 103.468 144.780  1.00 79.52           O  
ATOM   4695  CB  ARG B 255     159.577 100.848 145.319  1.00 79.52           C  
ATOM   4696  CG  ARG B 255     159.867 100.839 143.830  1.00 79.52           C  
ATOM   4697  CD  ARG B 255     160.467  99.502 143.426  1.00 79.52           C  
ATOM   4698  NE  ARG B 255     160.426  99.278 141.985  1.00 79.52           N  
ATOM   4699  CZ  ARG B 255     161.445  99.503 141.165  1.00 79.52           C  
ATOM   4700  NH1 ARG B 255     162.592  99.966 141.641  1.00 79.52           N  
ATOM   4701  NH2 ARG B 255     161.318  99.266 139.867  1.00 79.52           N  
ATOM   4702  N   THR B 256     157.031 102.329 146.613  1.00 75.04           N  
ATOM   4703  CA  THR B 256     155.657 102.815 146.523  1.00 75.04           C  
ATOM   4704  C   THR B 256     155.598 104.324 146.724  1.00 75.04           C  
ATOM   4705  O   THR B 256     154.886 105.032 146.003  1.00 75.04           O  
ATOM   4706  CB  THR B 256     154.776 102.112 147.555  1.00 75.04           C  
ATOM   4707  OG1 THR B 256     155.280 102.373 148.870  1.00 75.04           O  
ATOM   4708  CG2 THR B 256     154.752 100.616 147.314  1.00 75.04           C  
ATOM   4709  N   VAL B 257     156.328 104.831 147.719  1.00 70.05           N  
ATOM   4710  CA  VAL B 257     156.354 106.274 147.948  1.00 70.05           C  
ATOM   4711  C   VAL B 257     156.962 106.989 146.749  1.00 70.05           C  
ATOM   4712  O   VAL B 257     156.490 108.056 146.332  1.00 70.05           O  
ATOM   4713  CB  VAL B 257     157.110 106.599 149.249  1.00 70.05           C  
ATOM   4714  CG1 VAL B 257     157.175 108.100 149.462  1.00 70.05           C  
ATOM   4715  CG2 VAL B 257     156.435 105.928 150.432  1.00 70.05           C  
ATOM   4716  N   PHE B 258     158.014 106.407 146.170  1.00 69.45           N  
ATOM   4717  CA  PHE B 258     158.642 106.995 144.992  1.00 69.45           C  
ATOM   4718  C   PHE B 258     157.666 107.056 143.825  1.00 69.45           C  
ATOM   4719  O   PHE B 258     157.675 108.015 143.044  1.00 69.45           O  
ATOM   4720  CB  PHE B 258     159.885 106.187 144.623  1.00 69.45           C  
ATOM   4721  CG  PHE B 258     160.932 106.973 143.891  1.00 69.45           C  
ATOM   4722  CD1 PHE B 258     161.796 107.809 144.577  1.00 69.45           C  
ATOM   4723  CD2 PHE B 258     161.066 106.860 142.522  1.00 69.45           C  
ATOM   4724  CE1 PHE B 258     162.766 108.527 143.905  1.00 69.45           C  
ATOM   4725  CE2 PHE B 258     162.034 107.572 141.845  1.00 69.45           C  
ATOM   4726  CZ  PHE B 258     162.884 108.408 142.538  1.00 69.45           C  
ATOM   4727  N   GLY B 259     156.814 106.039 143.692  1.00 64.08           N  
ATOM   4728  CA  GLY B 259     155.825 106.053 142.626  1.00 64.08           C  
ATOM   4729  C   GLY B 259     154.707 107.050 142.867  1.00 64.08           C  
ATOM   4730  O   GLY B 259     154.238 107.706 141.933  1.00 64.08           O  
ATOM   4731  N   VAL B 260     154.260 107.176 144.119  1.00 63.12           N  
ATOM   4732  CA  VAL B 260     153.159 108.087 144.429  1.00 63.12           C  
ATOM   4733  C   VAL B 260     153.601 109.542 144.316  1.00 63.12           C  
ATOM   4734  O   VAL B 260     152.805 110.421 143.944  1.00 63.12           O  
ATOM   4735  CB  VAL B 260     152.597 107.777 145.829  1.00 63.12           C  
ATOM   4736  CG1 VAL B 260     151.541 108.794 146.227  1.00 63.12           C  
ATOM   4737  CG2 VAL B 260     152.017 106.377 145.863  1.00 63.12           C  
ATOM   4738  N   THR B 261     154.865 109.826 144.636  1.00 62.40           N  
ATOM   4739  CA  THR B 261     155.342 111.203 144.593  1.00 62.40           C  
ATOM   4740  C   THR B 261     155.298 111.765 143.179  1.00 62.40           C  
ATOM   4741  O   THR B 261     154.921 112.926 142.976  1.00 62.40           O  
ATOM   4742  CB  THR B 261     156.759 111.275 145.150  1.00 62.40           C  
ATOM   4743  OG1 THR B 261     156.769 110.728 146.473  1.00 62.40           O  
ATOM   4744  CG2 THR B 261     157.240 112.714 145.187  1.00 62.40           C  
ATOM   4745  N   THR B 262     155.694 110.962 142.190  1.00 63.96           N  
ATOM   4746  CA  THR B 262     155.644 111.424 140.808  1.00 63.96           C  
ATOM   4747  C   THR B 262     154.218 111.762 140.397  1.00 63.96           C  
ATOM   4748  O   THR B 262     153.985 112.761 139.711  1.00 63.96           O  
ATOM   4749  CB  THR B 262     156.236 110.369 139.874  1.00 63.96           C  
ATOM   4750  OG1 THR B 262     155.577 109.115 140.087  1.00 63.96           O  
ATOM   4751  CG2 THR B 262     157.725 110.203 140.133  1.00 63.96           C  
ATOM   4752  N   VAL B 263     153.246 110.958 140.830  1.00 63.94           N  
ATOM   4753  CA  VAL B 263     151.857 111.222 140.471  1.00 63.94           C  
ATOM   4754  C   VAL B 263     151.370 112.508 141.125  1.00 63.94           C  
ATOM   4755  O   VAL B 263     150.675 113.316 140.495  1.00 63.94           O  
ATOM   4756  CB  VAL B 263     150.970 110.024 140.852  1.00 63.94           C  
ATOM   4757  CG1 VAL B 263     149.545 110.249 140.372  1.00 63.94           C  
ATOM   4758  CG2 VAL B 263     151.537 108.743 140.272  1.00 63.94           C  
ATOM   4759  N   LEU B 264     151.721 112.720 142.395  1.00 62.22           N  
ATOM   4760  CA  LEU B 264     151.310 113.954 143.061  1.00 62.22           C  
ATOM   4761  C   LEU B 264     151.928 115.175 142.388  1.00 62.22           C  
ATOM   4762  O   LEU B 264     151.255 116.198 142.184  1.00 62.22           O  
ATOM   4763  CB  LEU B 264     151.686 113.906 144.541  1.00 62.22           C  
ATOM   4764  CG  LEU B 264     150.878 112.938 145.406  1.00 62.22           C  
ATOM   4765  CD1 LEU B 264     151.293 113.046 146.865  1.00 62.22           C  
ATOM   4766  CD2 LEU B 264     149.389 113.199 145.248  1.00 62.22           C  
ATOM   4767  N   THR B 265     153.210 115.083 142.028  1.00 62.82           N  
ATOM   4768  CA  THR B 265     153.868 116.192 141.349  1.00 62.82           C  
ATOM   4769  C   THR B 265     153.244 116.447 139.983  1.00 62.82           C  
ATOM   4770  O   THR B 265     153.081 117.603 139.578  1.00 62.82           O  
ATOM   4771  CB  THR B 265     155.364 115.911 141.213  1.00 62.82           C  
ATOM   4772  OG1 THR B 265     155.906 115.577 142.496  1.00 62.82           O  
ATOM   4773  CG2 THR B 265     156.087 117.132 140.673  1.00 62.82           C  
ATOM   4774  N   MET B 266     152.887 115.382 139.260  1.00 65.08           N  
ATOM   4775  CA  MET B 266     152.215 115.550 137.977  1.00 65.08           C  
ATOM   4776  C   MET B 266     150.874 116.245 138.145  1.00 65.08           C  
ATOM   4777  O   MET B 266     150.518 117.117 137.348  1.00 65.08           O  
ATOM   4778  CB  MET B 266     152.021 114.199 137.295  1.00 65.08           C  
ATOM   4779  CG  MET B 266     153.292 113.575 136.781  1.00 65.08           C  
ATOM   4780  SD  MET B 266     154.129 114.616 135.582  1.00 65.08           S  
ATOM   4781  CE  MET B 266     155.454 113.520 135.092  1.00 65.08           C  
ATOM   4782  N   THR B 267     150.111 115.866 139.170  1.00 64.39           N  
ATOM   4783  CA  THR B 267     148.828 116.518 139.411  1.00 64.39           C  
ATOM   4784  C   THR B 267     149.012 118.008 139.675  1.00 64.39           C  
ATOM   4785  O   THR B 267     148.328 118.850 139.076  1.00 64.39           O  
ATOM   4786  CB  THR B 267     148.113 115.851 140.585  1.00 64.39           C  
ATOM   4787  OG1 THR B 267     147.759 114.510 140.228  1.00 64.39           O  
ATOM   4788  CG2 THR B 267     146.858 116.623 140.951  1.00 64.39           C  
ATOM   4789  N   THR B 268     149.940 118.352 140.572  1.00 68.21           N  
ATOM   4790  CA  THR B 268     150.172 119.759 140.892  1.00 68.21           C  
ATOM   4791  C   THR B 268     150.628 120.537 139.661  1.00 68.21           C  
ATOM   4792  O   THR B 268     150.131 121.638 139.382  1.00 68.21           O  
ATOM   4793  CB  THR B 268     151.200 119.881 142.015  1.00 68.21           C  
ATOM   4794  OG1 THR B 268     152.413 119.226 141.626  1.00 68.21           O  
ATOM   4795  CG2 THR B 268     150.673 119.244 143.290  1.00 68.21           C  
ATOM   4796  N   LEU B 269     151.577 119.974 138.909  1.00 64.94           N  
ATOM   4797  CA  LEU B 269     152.093 120.646 137.724  1.00 64.94           C  
ATOM   4798  C   LEU B 269     151.007 120.826 136.673  1.00 64.94           C  
ATOM   4799  O   LEU B 269     150.926 121.876 136.024  1.00 64.94           O  
ATOM   4800  CB  LEU B 269     153.263 119.847 137.154  1.00 64.94           C  
ATOM   4801  CG  LEU B 269     154.081 120.505 136.050  1.00 64.94           C  
ATOM   4802  CD1 LEU B 269     154.886 121.657 136.623  1.00 64.94           C  
ATOM   4803  CD2 LEU B 269     154.984 119.483 135.383  1.00 64.94           C  
ATOM   4804  N   SER B 270     150.156 119.814 136.494  1.00 69.51           N  
ATOM   4805  CA  SER B 270     149.086 119.909 135.512  1.00 69.51           C  
ATOM   4806  C   SER B 270     148.074 120.974 135.903  1.00 69.51           C  
ATOM   4807  O   SER B 270     147.595 121.721 135.046  1.00 69.51           O  
ATOM   4808  CB  SER B 270     148.403 118.554 135.350  1.00 69.51           C  
ATOM   4809  OG  SER B 270     147.303 118.646 134.463  1.00 69.51           O  
ATOM   4810  N   ILE B 271     147.732 121.059 137.191  1.00 71.16           N  
ATOM   4811  CA  ILE B 271     146.806 122.102 137.628  1.00 71.16           C  
ATOM   4812  C   ILE B 271     147.415 123.482 137.408  1.00 71.16           C  
ATOM   4813  O   ILE B 271     146.741 124.410 136.933  1.00 71.16           O  
ATOM   4814  CB  ILE B 271     146.406 121.882 139.098  1.00 71.16           C  
ATOM   4815  CG1 ILE B 271     145.527 120.637 139.218  1.00 71.16           C  
ATOM   4816  CG2 ILE B 271     145.688 123.104 139.645  1.00 71.16           C  
ATOM   4817  CD1 ILE B 271     145.056 120.355 140.623  1.00 71.16           C  
ATOM   4818  N   SER B 272     148.700 123.639 137.736  1.00 70.29           N  
ATOM   4819  CA  SER B 272     149.359 124.922 137.510  1.00 70.29           C  
ATOM   4820  C   SER B 272     149.375 125.283 136.029  1.00 70.29           C  
ATOM   4821  O   SER B 272     149.203 126.453 135.666  1.00 70.29           O  
ATOM   4822  CB  SER B 272     150.778 124.891 138.071  1.00 70.29           C  
ATOM   4823  OG  SER B 272     150.758 124.704 139.474  1.00 70.29           O  
ATOM   4824  N   ALA B 273     149.578 124.293 135.159  1.00 67.74           N  
ATOM   4825  CA  ALA B 273     149.581 124.568 133.726  1.00 67.74           C  
ATOM   4826  C   ALA B 273     148.188 124.929 133.228  1.00 67.74           C  
ATOM   4827  O   ALA B 273     148.037 125.811 132.376  1.00 67.74           O  
ATOM   4828  CB  ALA B 273     150.128 123.365 132.962  1.00 67.74           C  
ATOM   4829  N   ARG B 274     147.159 124.256 133.746  1.00 79.82           N  
ATOM   4830  CA  ARG B 274     145.791 124.569 133.343  1.00 79.82           C  
ATOM   4831  C   ARG B 274     145.393 125.969 133.784  1.00 79.82           C  
ATOM   4832  O   ARG B 274     144.581 126.626 133.123  1.00 79.82           O  
ATOM   4833  CB  ARG B 274     144.816 123.543 133.921  1.00 79.82           C  
ATOM   4834  CG  ARG B 274     145.010 122.121 133.425  1.00 79.82           C  
ATOM   4835  CD  ARG B 274     144.593 121.960 131.977  1.00 79.82           C  
ATOM   4836  NE  ARG B 274     144.681 120.566 131.557  1.00 79.82           N  
ATOM   4837  CZ  ARG B 274     144.305 120.119 130.364  1.00 79.82           C  
ATOM   4838  NH1 ARG B 274     143.812 120.960 129.465  1.00 79.82           N  
ATOM   4839  NH2 ARG B 274     144.421 118.831 130.069  1.00 79.82           N  
ATOM   4840  N   ASN B 275     145.940 126.434 134.910  1.00 77.43           N  
ATOM   4841  CA  ASN B 275     145.560 127.749 135.420  1.00 77.43           C  
ATOM   4842  C   ASN B 275     145.888 128.861 134.427  1.00 77.43           C  
ATOM   4843  O   ASN B 275     145.167 129.863 134.348  1.00 77.43           O  
ATOM   4844  CB  ASN B 275     146.242 128.005 136.762  1.00 77.43           C  
ATOM   4845  CG  ASN B 275     145.624 127.204 137.890  1.00 77.43           C  
ATOM   4846  OD1 ASN B 275     144.405 127.040 137.953  1.00 77.43           O  
ATOM   4847  ND2 ASN B 275     146.461 126.695 138.787  1.00 77.43           N  
ATOM   4848  N   SER B 276     146.970 128.708 133.663  1.00 79.59           N  
ATOM   4849  CA  SER B 276     147.382 129.764 132.742  1.00 79.59           C  
ATOM   4850  C   SER B 276     146.865 129.544 131.324  1.00 79.59           C  
ATOM   4851  O   SER B 276     146.787 130.499 130.544  1.00 79.59           O  
ATOM   4852  CB  SER B 276     148.907 129.879 132.727  1.00 79.59           C  
ATOM   4853  OG  SER B 276     149.504 128.686 132.252  1.00 79.59           O  
ATOM   4854  N   LEU B 277     146.524 128.310 130.973  1.00 74.38           N  
ATOM   4855  CA  LEU B 277     146.116 128.004 129.610  1.00 74.38           C  
ATOM   4856  C   LEU B 277     144.780 128.676 129.292  1.00 74.38           C  
ATOM   4857  O   LEU B 277     143.867 128.665 130.122  1.00 74.38           O  
ATOM   4858  CB  LEU B 277     146.009 126.490 129.433  1.00 74.38           C  
ATOM   4859  CG  LEU B 277     146.179 125.860 128.052  1.00 74.38           C  
ATOM   4860  CD1 LEU B 277     146.574 124.404 128.209  1.00 74.38           C  
ATOM   4861  CD2 LEU B 277     144.902 125.960 127.245  1.00 74.38           C  
ATOM   4862  N   PRO B 278     144.636 129.269 128.107  1.00 65.12           N  
ATOM   4863  CA  PRO B 278     143.377 129.941 127.766  1.00 65.12           C  
ATOM   4864  C   PRO B 278     142.275 128.949 127.433  1.00 65.12           C  
ATOM   4865  O   PRO B 278     142.494 127.954 126.739  1.00 65.12           O  
ATOM   4866  CB  PRO B 278     143.750 130.780 126.540  1.00 65.12           C  
ATOM   4867  CG  PRO B 278     144.868 130.024 125.915  1.00 65.12           C  
ATOM   4868  CD  PRO B 278     145.652 129.435 127.055  1.00 65.12           C  
ATOM   4869  N   LYS B 279     141.072 129.246 127.917  1.00 73.61           N  
ATOM   4870  CA  LYS B 279     139.947 128.323 127.804  1.00 73.61           C  
ATOM   4871  C   LYS B 279     139.437 128.308 126.369  1.00 73.61           C  
ATOM   4872  O   LYS B 279     138.890 129.304 125.886  1.00 73.61           O  
ATOM   4873  CB  LYS B 279     138.840 128.716 128.776  1.00 73.61           C  
ATOM   4874  CG  LYS B 279     139.254 128.635 130.233  1.00 73.61           C  
ATOM   4875  CD  LYS B 279     138.082 128.890 131.161  1.00 73.61           C  
ATOM   4876  CE  LYS B 279     138.487 128.716 132.615  1.00 73.61           C  
ATOM   4877  NZ  LYS B 279     137.328 128.887 133.534  1.00 73.61           N  
ATOM   4878  N   VAL B 280     139.611 127.174 125.691  1.00 71.04           N  
ATOM   4879  CA  VAL B 280     139.142 126.985 124.324  1.00 71.04           C  
ATOM   4880  C   VAL B 280     138.604 125.569 124.184  1.00 71.04           C  
ATOM   4881  O   VAL B 280     139.015 124.654 124.901  1.00 71.04           O  
ATOM   4882  CB  VAL B 280     140.255 127.233 123.287  1.00 71.04           C  
ATOM   4883  CG1 VAL B 280     140.621 128.707 123.237  1.00 71.04           C  
ATOM   4884  CG2 VAL B 280     141.470 126.383 123.613  1.00 71.04           C  
ATOM   4885  N   ALA B 281     137.674 125.394 123.243  1.00 68.44           N  
ATOM   4886  CA  ALA B 281     137.109 124.071 123.000  1.00 68.44           C  
ATOM   4887  C   ALA B 281     138.118 123.137 122.343  1.00 68.44           C  
ATOM   4888  O   ALA B 281     138.047 121.918 122.535  1.00 68.44           O  
ATOM   4889  CB  ALA B 281     135.853 124.186 122.138  1.00 68.44           C  
ATOM   4890  N   TYR B 282     139.049 123.681 121.564  1.00 73.18           N  
ATOM   4891  CA  TYR B 282     140.049 122.855 120.904  1.00 73.18           C  
ATOM   4892  C   TYR B 282     140.978 122.210 121.923  1.00 73.18           C  
ATOM   4893  O   TYR B 282     141.128 122.684 123.052  1.00 73.18           O  
ATOM   4894  CB  TYR B 282     140.865 123.691 119.919  1.00 73.18           C  
ATOM   4895  CG  TYR B 282     140.071 124.176 118.735  1.00 73.18           C  
ATOM   4896  CD1 TYR B 282     139.855 123.354 117.639  1.00 73.18           C  
ATOM   4897  CD2 TYR B 282     139.537 125.456 118.712  1.00 73.18           C  
ATOM   4898  CE1 TYR B 282     139.125 123.791 116.551  1.00 73.18           C  
ATOM   4899  CE2 TYR B 282     138.807 125.904 117.628  1.00 73.18           C  
ATOM   4900  CZ  TYR B 282     138.604 125.067 116.550  1.00 73.18           C  
ATOM   4901  OH  TYR B 282     137.879 125.506 115.468  1.00 73.18           O  
ATOM   4902  N   ALA B 283     141.596 121.104 121.519  1.00 58.95           N  
ATOM   4903  CA  ALA B 283     142.642 120.466 122.307  1.00 58.95           C  
ATOM   4904  C   ALA B 283     143.979 121.068 121.895  1.00 58.95           C  
ATOM   4905  O   ALA B 283     144.457 120.834 120.781  1.00 58.95           O  
ATOM   4906  CB  ALA B 283     142.629 118.954 122.104  1.00 58.95           C  
ATOM   4907  N   THR B 284     144.581 121.845 122.790  1.00 62.40           N  
ATOM   4908  CA  THR B 284     145.813 122.542 122.461  1.00 62.40           C  
ATOM   4909  C   THR B 284     146.952 121.552 122.243  1.00 62.40           C  
ATOM   4910  O   THR B 284     146.934 120.421 122.731  1.00 62.40           O  
ATOM   4911  CB  THR B 284     146.191 123.521 123.568  1.00 62.40           C  
ATOM   4912  OG1 THR B 284     146.717 122.795 124.683  1.00 62.40           O  
ATOM   4913  CG2 THR B 284     144.973 124.297 124.019  1.00 62.40           C  
ATOM   4914  N   ALA B 285     147.960 122.000 121.494  1.00 60.67           N  
ATOM   4915  CA  ALA B 285     149.099 121.139 121.203  1.00 60.67           C  
ATOM   4916  C   ALA B 285     149.902 120.826 122.455  1.00 60.67           C  
ATOM   4917  O   ALA B 285     150.602 119.809 122.503  1.00 60.67           O  
ATOM   4918  CB  ALA B 285     149.991 121.789 120.149  1.00 60.67           C  
ATOM   4919  N   MET B 286     149.826 121.683 123.474  1.00 64.34           N  
ATOM   4920  CA  MET B 286     150.544 121.401 124.711  1.00 64.34           C  
ATOM   4921  C   MET B 286     149.857 120.310 125.522  1.00 64.34           C  
ATOM   4922  O   MET B 286     150.525 119.564 126.249  1.00 64.34           O  
ATOM   4923  CB  MET B 286     150.685 122.673 125.545  1.00 64.34           C  
ATOM   4924  CG  MET B 286     151.622 122.525 126.730  1.00 64.34           C  
ATOM   4925  SD  MET B 286     151.838 124.048 127.663  1.00 64.34           S  
ATOM   4926  CE  MET B 286     150.193 124.264 128.323  1.00 64.34           C  
ATOM   4927  N   ASP B 287     148.532 120.196 125.412  1.00 69.91           N  
ATOM   4928  CA  ASP B 287     147.823 119.213 126.221  1.00 69.91           C  
ATOM   4929  C   ASP B 287     148.147 117.789 125.797  1.00 69.91           C  
ATOM   4930  O   ASP B 287     148.091 116.880 126.625  1.00 69.91           O  
ATOM   4931  CB  ASP B 287     146.318 119.460 126.166  1.00 69.91           C  
ATOM   4932  CG  ASP B 287     145.879 120.568 127.103  1.00 69.91           C  
ATOM   4933  OD1 ASP B 287     146.651 120.908 128.024  1.00 69.91           O  
ATOM   4934  OD2 ASP B 287     144.763 121.096 126.925  1.00 69.91           O  
ATOM   4935  N   TRP B 288     148.504 117.568 124.532  1.00 62.84           N  
ATOM   4936  CA  TRP B 288     148.913 116.226 124.127  1.00 62.84           C  
ATOM   4937  C   TRP B 288     150.239 115.837 124.768  1.00 62.84           C  
ATOM   4938  O   TRP B 288     150.395 114.710 125.261  1.00 62.84           O  
ATOM   4939  CB  TRP B 288     148.996 116.135 122.607  1.00 62.84           C  
ATOM   4940  CG  TRP B 288     147.671 115.891 121.976  1.00 62.84           C  
ATOM   4941  CD1 TRP B 288     146.479 115.736 122.616  1.00 62.84           C  
ATOM   4942  CD2 TRP B 288     147.396 115.768 120.579  1.00 62.84           C  
ATOM   4943  NE1 TRP B 288     145.476 115.526 121.705  1.00 62.84           N  
ATOM   4944  CE2 TRP B 288     146.014 115.541 120.445  1.00 62.84           C  
ATOM   4945  CE3 TRP B 288     148.185 115.829 119.428  1.00 62.84           C  
ATOM   4946  CZ2 TRP B 288     145.403 115.375 119.207  1.00 62.84           C  
ATOM   4947  CZ3 TRP B 288     147.576 115.665 118.199  1.00 62.84           C  
ATOM   4948  CH2 TRP B 288     146.199 115.440 118.098  1.00 62.84           C  
ATOM   4949  N   PHE B 289     151.208 116.752 124.765  1.00 63.59           N  
ATOM   4950  CA  PHE B 289     152.455 116.497 125.475  1.00 63.59           C  
ATOM   4951  C   PHE B 289     152.198 116.275 126.959  1.00 63.59           C  
ATOM   4952  O   PHE B 289     152.823 115.408 127.582  1.00 63.59           O  
ATOM   4953  CB  PHE B 289     153.430 117.653 125.265  1.00 63.59           C  
ATOM   4954  CG  PHE B 289     154.784 117.416 125.865  1.00 63.59           C  
ATOM   4955  CD1 PHE B 289     155.777 116.789 125.135  1.00 63.59           C  
ATOM   4956  CD2 PHE B 289     155.063 117.815 127.160  1.00 63.59           C  
ATOM   4957  CE1 PHE B 289     157.022 116.568 125.682  1.00 63.59           C  
ATOM   4958  CE2 PHE B 289     156.305 117.596 127.712  1.00 63.59           C  
ATOM   4959  CZ  PHE B 289     157.287 116.971 126.972  1.00 63.59           C  
ATOM   4960  N   ILE B 290     151.280 117.048 127.542  1.00 64.05           N  
ATOM   4961  CA  ILE B 290     150.954 116.863 128.954  1.00 64.05           C  
ATOM   4962  C   ILE B 290     150.347 115.486 129.186  1.00 64.05           C  
ATOM   4963  O   ILE B 290     150.670 114.809 130.167  1.00 64.05           O  
ATOM   4964  CB  ILE B 290     150.021 117.984 129.446  1.00 64.05           C  
ATOM   4965  CG1 ILE B 290     150.815 119.269 129.670  1.00 64.05           C  
ATOM   4966  CG2 ILE B 290     149.318 117.574 130.726  1.00 64.05           C  
ATOM   4967  CD1 ILE B 290     150.029 120.351 130.372  1.00 64.05           C  
ATOM   4968  N   ALA B 291     149.475 115.042 128.280  1.00 64.69           N  
ATOM   4969  CA  ALA B 291     148.851 113.732 128.429  1.00 64.69           C  
ATOM   4970  C   ALA B 291     149.882 112.616 128.343  1.00 64.69           C  
ATOM   4971  O   ALA B 291     149.825 111.654 129.114  1.00 64.69           O  
ATOM   4972  CB  ALA B 291     147.766 113.542 127.370  1.00 64.69           C  
ATOM   4973  N   VAL B 292     150.839 112.730 127.423  1.00 65.21           N  
ATOM   4974  CA  VAL B 292     151.873 111.702 127.321  1.00 65.21           C  
ATOM   4975  C   VAL B 292     152.762 111.703 128.563  1.00 65.21           C  
ATOM   4976  O   VAL B 292     153.068 110.641 129.133  1.00 65.21           O  
ATOM   4977  CB  VAL B 292     152.687 111.902 126.034  1.00 65.21           C  
ATOM   4978  CG1 VAL B 292     154.007 111.164 126.122  1.00 65.21           C  
ATOM   4979  CG2 VAL B 292     151.886 111.419 124.842  1.00 65.21           C  
ATOM   4980  N   CYS B 293     153.203 112.890 128.990  1.00 74.43           N  
ATOM   4981  CA  CYS B 293     154.034 113.006 130.183  1.00 74.43           C  
ATOM   4982  C   CYS B 293     153.306 112.501 131.422  1.00 74.43           C  
ATOM   4983  O   CYS B 293     153.940 112.006 132.360  1.00 74.43           O  
ATOM   4984  CB  CYS B 293     154.467 114.464 130.356  1.00 74.43           C  
ATOM   4985  SG  CYS B 293     155.059 114.923 131.996  1.00 74.43           S  
ATOM   4986  N   TYR B 294     151.980 112.606 131.437  1.00 71.00           N  
ATOM   4987  CA  TYR B 294     151.186 112.137 132.562  1.00 71.00           C  
ATOM   4988  C   TYR B 294     150.898 110.645 132.471  1.00 71.00           C  
ATOM   4989  O   TYR B 294     150.675 109.996 133.498  1.00 71.00           O  
ATOM   4990  CB  TYR B 294     149.886 112.939 132.621  1.00 71.00           C  
ATOM   4991  CG  TYR B 294     148.958 112.586 133.752  1.00 71.00           C  
ATOM   4992  CD1 TYR B 294     149.203 113.031 135.041  1.00 71.00           C  
ATOM   4993  CD2 TYR B 294     147.818 111.833 133.523  1.00 71.00           C  
ATOM   4994  CE1 TYR B 294     148.348 112.719 136.077  1.00 71.00           C  
ATOM   4995  CE2 TYR B 294     146.956 111.517 134.549  1.00 71.00           C  
ATOM   4996  CZ  TYR B 294     147.225 111.961 135.825  1.00 71.00           C  
ATOM   4997  OH  TYR B 294     146.365 111.645 136.852  1.00 71.00           O  
ATOM   4998  N   ALA B 295     150.892 110.091 131.258  1.00 64.84           N  
ATOM   4999  CA  ALA B 295     150.604 108.672 131.086  1.00 64.84           C  
ATOM   5000  C   ALA B 295     151.829 107.805 131.339  1.00 64.84           C  
ATOM   5001  O   ALA B 295     151.690 106.656 131.776  1.00 64.84           O  
ATOM   5002  CB  ALA B 295     150.058 108.417 129.682  1.00 64.84           C  
ATOM   5003  N   PHE B 296     153.027 108.317 131.048  1.00 63.36           N  
ATOM   5004  CA  PHE B 296     154.223 107.507 131.276  1.00 63.36           C  
ATOM   5005  C   PHE B 296     154.390 107.156 132.753  1.00 63.36           C  
ATOM   5006  O   PHE B 296     154.833 106.049 133.091  1.00 63.36           O  
ATOM   5007  CB  PHE B 296     155.464 108.220 130.745  1.00 63.36           C  
ATOM   5008  CG  PHE B 296     155.816 107.839 129.338  1.00 63.36           C  
ATOM   5009  CD1 PHE B 296     154.938 107.086 128.577  1.00 63.36           C  
ATOM   5010  CD2 PHE B 296     157.026 108.209 128.782  1.00 63.36           C  
ATOM   5011  CE1 PHE B 296     155.254 106.725 127.286  1.00 63.36           C  
ATOM   5012  CE2 PHE B 296     157.347 107.847 127.489  1.00 63.36           C  
ATOM   5013  CZ  PHE B 296     156.461 107.104 126.741  1.00 63.36           C  
ATOM   5014  N   VAL B 297     154.023 108.075 133.648  1.00 65.60           N  
ATOM   5015  CA  VAL B 297     154.148 107.805 135.078  1.00 65.60           C  
ATOM   5016  C   VAL B 297     153.196 106.692 135.499  1.00 65.60           C  
ATOM   5017  O   VAL B 297     153.568 105.793 136.265  1.00 65.60           O  
ATOM   5018  CB  VAL B 297     153.912 109.093 135.887  1.00 65.60           C  
ATOM   5019  CG1 VAL B 297     153.739 108.774 137.358  1.00 65.60           C  
ATOM   5020  CG2 VAL B 297     155.072 110.042 135.694  1.00 65.60           C  
ATOM   5021  N   PHE B 298     151.956 106.730 135.009  1.00 66.96           N  
ATOM   5022  CA  PHE B 298     151.025 105.651 135.317  1.00 66.96           C  
ATOM   5023  C   PHE B 298     151.487 104.327 134.724  1.00 66.96           C  
ATOM   5024  O   PHE B 298     151.276 103.272 135.332  1.00 66.96           O  
ATOM   5025  CB  PHE B 298     149.623 106.000 134.821  1.00 66.96           C  
ATOM   5026  CG  PHE B 298     148.858 106.892 135.753  1.00 66.96           C  
ATOM   5027  CD1 PHE B 298     149.267 107.054 137.064  1.00 66.96           C  
ATOM   5028  CD2 PHE B 298     147.727 107.564 135.322  1.00 66.96           C  
ATOM   5029  CE1 PHE B 298     148.566 107.872 137.927  1.00 66.96           C  
ATOM   5030  CE2 PHE B 298     147.022 108.383 136.181  1.00 66.96           C  
ATOM   5031  CZ  PHE B 298     147.443 108.537 137.486  1.00 66.96           C  
ATOM   5032  N   SER B 299     152.125 104.359 133.552  1.00 70.22           N  
ATOM   5033  CA  SER B 299     152.668 103.128 132.984  1.00 70.22           C  
ATOM   5034  C   SER B 299     153.757 102.545 133.878  1.00 70.22           C  
ATOM   5035  O   SER B 299     153.789 101.332 134.128  1.00 70.22           O  
ATOM   5036  CB  SER B 299     153.212 103.390 131.581  1.00 70.22           C  
ATOM   5037  OG  SER B 299     154.352 104.226 131.633  1.00 70.22           O  
ATOM   5038  N   ALA B 300     154.659 103.397 134.372  1.00 69.81           N  
ATOM   5039  CA  ALA B 300     155.693 102.923 135.287  1.00 69.81           C  
ATOM   5040  C   ALA B 300     155.084 102.380 136.575  1.00 69.81           C  
ATOM   5041  O   ALA B 300     155.555 101.373 137.120  1.00 69.81           O  
ATOM   5042  CB  ALA B 300     156.682 104.046 135.594  1.00 69.81           C  
ATOM   5043  N   LEU B 301     154.031 103.030 137.073  1.00 68.93           N  
ATOM   5044  CA  LEU B 301     153.377 102.549 138.286  1.00 68.93           C  
ATOM   5045  C   LEU B 301     152.739 101.182 138.064  1.00 68.93           C  
ATOM   5046  O   LEU B 301     152.819 100.304 138.932  1.00 68.93           O  
ATOM   5047  CB  LEU B 301     152.330 103.556 138.754  1.00 68.93           C  
ATOM   5048  CG  LEU B 301     151.711 103.266 140.121  1.00 68.93           C  
ATOM   5049  CD1 LEU B 301     152.731 103.498 141.223  1.00 68.93           C  
ATOM   5050  CD2 LEU B 301     150.469 104.108 140.346  1.00 68.93           C  
ATOM   5051  N   ILE B 302     152.105 100.986 136.907  1.00 72.50           N  
ATOM   5052  CA  ILE B 302     151.510  99.691 136.588  1.00 72.50           C  
ATOM   5053  C   ILE B 302     152.588  98.622 136.486  1.00 72.50           C  
ATOM   5054  O   ILE B 302     152.404  97.484 136.939  1.00 72.50           O  
ATOM   5055  CB  ILE B 302     150.683  99.794 135.293  1.00 72.50           C  
ATOM   5056  CG1 ILE B 302     149.401 100.589 135.545  1.00 72.50           C  
ATOM   5057  CG2 ILE B 302     150.366  98.416 134.738  1.00 72.50           C  
ATOM   5058  CD1 ILE B 302     148.520 100.725 134.327  1.00 72.50           C  
ATOM   5059  N   GLU B 303     153.734  98.970 135.897  1.00 75.64           N  
ATOM   5060  CA  GLU B 303     154.838  98.018 135.831  1.00 75.64           C  
ATOM   5061  C   GLU B 303     155.302  97.626 137.229  1.00 75.64           C  
ATOM   5062  O   GLU B 303     155.532  96.445 137.516  1.00 75.64           O  
ATOM   5063  CB  GLU B 303     155.992  98.607 135.020  1.00 75.64           C  
ATOM   5064  CG  GLU B 303     157.138  97.640 134.774  1.00 75.64           C  
ATOM   5065  CD  GLU B 303     158.149  97.616 135.907  1.00 75.64           C  
ATOM   5066  OE1 GLU B 303     158.058  98.477 136.806  1.00 75.64           O  
ATOM   5067  OE2 GLU B 303     159.036  96.736 135.899  1.00 75.64           O  
ATOM   5068  N   PHE B 304     155.462  98.614 138.110  1.00 78.23           N  
ATOM   5069  CA  PHE B 304     155.891  98.315 139.473  1.00 78.23           C  
ATOM   5070  C   PHE B 304     154.874  97.437 140.192  1.00 78.23           C  
ATOM   5071  O   PHE B 304     155.247  96.528 140.946  1.00 78.23           O  
ATOM   5072  CB  PHE B 304     156.123  99.606 140.250  1.00 78.23           C  
ATOM   5073  CG  PHE B 304     156.110  99.419 141.733  1.00 78.23           C  
ATOM   5074  CD1 PHE B 304     157.163  98.790 142.372  1.00 78.23           C  
ATOM   5075  CD2 PHE B 304     155.040  99.862 142.489  1.00 78.23           C  
ATOM   5076  CE1 PHE B 304     157.149  98.610 143.737  1.00 78.23           C  
ATOM   5077  CE2 PHE B 304     155.023  99.687 143.853  1.00 78.23           C  
ATOM   5078  CZ  PHE B 304     156.080  99.061 144.478  1.00 78.23           C  
ATOM   5079  N   ALA B 305     153.585  97.699 139.979  1.00 78.43           N  
ATOM   5080  CA  ALA B 305     152.554  96.874 140.599  1.00 78.43           C  
ATOM   5081  C   ALA B 305     152.628  95.438 140.093  1.00 78.43           C  
ATOM   5082  O   ALA B 305     152.524  94.484 140.875  1.00 78.43           O  
ATOM   5083  CB  ALA B 305     151.173  97.475 140.337  1.00 78.43           C  
ATOM   5084  N   THR B 306     152.814  95.261 138.783  1.00 83.38           N  
ATOM   5085  CA  THR B 306     152.904  93.908 138.249  1.00 83.38           C  
ATOM   5086  C   THR B 306     154.155  93.198 138.757  1.00 83.38           C  
ATOM   5087  O   THR B 306     154.141  91.975 138.942  1.00 83.38           O  
ATOM   5088  CB  THR B 306     152.852  93.926 136.714  1.00 83.38           C  
ATOM   5089  OG1 THR B 306     152.141  92.774 136.245  1.00 83.38           O  
ATOM   5090  CG2 THR B 306     154.245  93.919 136.099  1.00 83.38           C  
ATOM   5091  N   VAL B 307     155.225  93.945 139.036  1.00 86.88           N  
ATOM   5092  CA  VAL B 307     156.426  93.329 139.599  1.00 86.88           C  
ATOM   5093  C   VAL B 307     156.175  92.889 141.034  1.00 86.88           C  
ATOM   5094  O   VAL B 307     156.582  91.795 141.449  1.00 86.88           O  
ATOM   5095  CB  VAL B 307     157.620  94.294 139.508  1.00 86.88           C  
ATOM   5096  CG1 VAL B 307     158.786  93.774 140.332  1.00 86.88           C  
ATOM   5097  CG2 VAL B 307     158.033  94.481 138.063  1.00 86.88           C  
ATOM   5098  N   ASN B 308     155.518  93.745 141.818  1.00 90.57           N  
ATOM   5099  CA  ASN B 308     155.184  93.388 143.193  1.00 90.57           C  
ATOM   5100  C   ASN B 308     154.262  92.176 143.232  1.00 90.57           C  
ATOM   5101  O   ASN B 308     154.289  91.395 144.189  1.00 90.57           O  
ATOM   5102  CB  ASN B 308     154.543  94.578 143.898  1.00 90.57           C  
ATOM   5103  CG  ASN B 308     154.747  94.547 145.399  1.00 90.57           C  
ATOM   5104  OD1 ASN B 308     154.735  95.584 146.060  1.00 90.57           O  
ATOM   5105  ND2 ASN B 308     154.948  93.353 145.944  1.00 90.57           N  
ATOM   5106  N   TYR B 309     153.422  92.017 142.208  1.00 93.14           N  
ATOM   5107  CA  TYR B 309     152.573  90.833 142.131  1.00 93.14           C  
ATOM   5108  C   TYR B 309     153.379  89.592 141.758  1.00 93.14           C  
ATOM   5109  O   TYR B 309     153.213  88.528 142.367  1.00 93.14           O  
ATOM   5110  CB  TYR B 309     151.444  91.065 141.125  1.00 93.14           C  
ATOM   5111  CG  TYR B 309     150.844  89.800 140.555  1.00 93.14           C  
ATOM   5112  CD1 TYR B 309     149.948  89.037 141.291  1.00 93.14           C  
ATOM   5113  CD2 TYR B 309     151.166  89.375 139.274  1.00 93.14           C  
ATOM   5114  CE1 TYR B 309     149.397  87.883 140.770  1.00 93.14           C  
ATOM   5115  CE2 TYR B 309     150.622  88.226 138.745  1.00 93.14           C  
ATOM   5116  CZ  TYR B 309     149.738  87.484 139.495  1.00 93.14           C  
ATOM   5117  OH  TYR B 309     149.195  86.337 138.966  1.00 93.14           O  
ATOM   5118  N   PHE B 310     154.257  89.712 140.762  1.00 94.44           N  
ATOM   5119  CA  PHE B 310     154.956  88.547 140.231  1.00 94.44           C  
ATOM   5120  C   PHE B 310     156.062  88.061 141.166  1.00 94.44           C  
ATOM   5121  O   PHE B 310     156.476  86.898 141.080  1.00 94.44           O  
ATOM   5122  CB  PHE B 310     155.516  88.861 138.849  1.00 94.44           C  
ATOM   5123  CG  PHE B 310     154.936  88.020 137.749  1.00 94.44           C  
ATOM   5124  CD1 PHE B 310     155.386  86.728 137.542  1.00 94.44           C  
ATOM   5125  CD2 PHE B 310     153.940  88.515 136.925  1.00 94.44           C  
ATOM   5126  CE1 PHE B 310     154.855  85.945 136.535  1.00 94.44           C  
ATOM   5127  CE2 PHE B 310     153.405  87.736 135.914  1.00 94.44           C  
ATOM   5128  CZ  PHE B 310     153.865  86.450 135.719  1.00 94.44           C  
ATOM   5129  N   THR B 311     156.563  88.929 142.053  1.00 95.33           N  
ATOM   5130  CA  THR B 311     157.765  88.586 142.816  1.00 95.33           C  
ATOM   5131  C   THR B 311     157.581  87.329 143.663  1.00 95.33           C  
ATOM   5132  O   THR B 311     158.542  86.582 143.884  1.00 95.33           O  
ATOM   5133  CB  THR B 311     158.194  89.761 143.700  1.00 95.33           C  
ATOM   5134  OG1 THR B 311     159.402  89.418 144.388  1.00 95.33           O  
ATOM   5135  CG2 THR B 311     157.120  90.106 144.719  1.00 95.33           C  
ATOM   5136  N   LYS B 312     156.364  87.073 144.147  1.00 96.67           N  
ATOM   5137  CA  LYS B 312     156.148  85.921 145.019  1.00 96.67           C  
ATOM   5138  C   LYS B 312     156.254  84.612 144.245  1.00 96.67           C  
ATOM   5139  O   LYS B 312     156.981  83.696 144.647  1.00 96.67           O  
ATOM   5140  CB  LYS B 312     154.787  86.026 145.708  1.00 96.67           C  
ATOM   5141  CG  LYS B 312     154.674  87.174 146.698  1.00 96.67           C  
ATOM   5142  CD  LYS B 312     153.291  87.219 147.337  1.00 96.67           C  
ATOM   5143  CE  LYS B 312     153.166  88.358 148.339  1.00 96.67           C  
ATOM   5144  NZ  LYS B 312     151.806  88.410 148.948  1.00 96.67           N  
ATOM   5145  N   SER B 313     155.532  84.504 143.127  1.00 97.89           N  
ATOM   5146  CA  SER B 313     155.503  83.245 142.386  1.00 97.89           C  
ATOM   5147  C   SER B 313     156.827  82.977 141.682  1.00 97.89           C  
ATOM   5148  O   SER B 313     157.386  81.881 141.802  1.00 97.89           O  
ATOM   5149  CB  SER B 313     154.351  83.248 141.379  1.00 97.89           C  
ATOM   5150  OG  SER B 313     154.543  84.231 140.374  1.00 97.89           O  
ATOM   5151  N   GLN B 314     157.346  83.959 140.944  1.00 94.67           N  
ATOM   5152  CA  GLN B 314     158.575  83.758 140.186  1.00 94.67           C  
ATOM   5153  C   GLN B 314     159.455  84.999 140.237  1.00 94.67           C  
ATOM   5154  O   GLN B 314     158.994  86.104 139.928  1.00 94.67           O  
ATOM   5155  CB  GLN B 314     158.268  83.413 138.727  1.00 94.67           C  
ATOM   5156  CG  GLN B 314     157.550  82.095 138.516  1.00 94.67           C  
ATOM   5157  CD  GLN B 314     157.334  81.791 137.049  1.00 94.67           C  
ATOM   5158  OE1 GLN B 314     158.111  82.216 136.195  1.00 94.67           O  
ATOM   5159  NE2 GLN B 314     156.270  81.058 136.748  1.00 94.67           N  
ATOM   5160  N   PRO B 315     160.722  84.859 140.618  1.00 91.95           N  
ATOM   5161  CA  PRO B 315     161.633  86.009 140.576  1.00 91.95           C  
ATOM   5162  C   PRO B 315     162.196  86.244 139.184  1.00 91.95           C  
ATOM   5163  O   PRO B 315     162.587  87.367 138.842  1.00 91.95           O  
ATOM   5164  CB  PRO B 315     162.730  85.615 141.571  1.00 91.95           C  
ATOM   5165  CG  PRO B 315     162.766  84.125 141.492  1.00 91.95           C  
ATOM   5166  CD  PRO B 315     161.340  83.685 141.261  1.00 91.95           C  
ATOM   5167  N   ALA B 316     162.244  85.181 138.375  1.00 87.06           N  
ATOM   5168  CA  ALA B 316     162.817  85.293 137.036  1.00 87.06           C  
ATOM   5169  C   ALA B 316     162.030  86.270 136.175  1.00 87.06           C  
ATOM   5170  O   ALA B 316     162.613  87.159 135.545  1.00 87.06           O  
ATOM   5171  CB  ALA B 316     162.867  83.917 136.373  1.00 87.06           C  
ATOM   5172  N   ARG B 317     160.704  86.124 136.137  1.00 90.44           N  
ATOM   5173  CA  ARG B 317     159.899  87.029 135.325  1.00 90.44           C  
ATOM   5174  C   ARG B 317     159.915  88.441 135.894  1.00 90.44           C  
ATOM   5175  O   ARG B 317     159.844  89.415 135.140  1.00 90.44           O  
ATOM   5176  CB  ARG B 317     158.473  86.501 135.194  1.00 90.44           C  
ATOM   5177  CG  ARG B 317     158.261  85.675 133.930  1.00 90.44           C  
ATOM   5178  CD  ARG B 317     157.004  84.832 134.006  1.00 90.44           C  
ATOM   5179  NE  ARG B 317     156.806  84.032 132.801  1.00 90.44           N  
ATOM   5180  CZ  ARG B 317     155.967  83.005 132.718  1.00 90.44           C  
ATOM   5181  NH1 ARG B 317     155.251  82.645 133.774  1.00 90.44           N  
ATOM   5182  NH2 ARG B 317     155.846  82.333 131.582  1.00 90.44           N  
ATOM   5183  N   ALA B 318     160.032  88.577 137.216  1.00 87.45           N  
ATOM   5184  CA  ALA B 318     160.165  89.905 137.809  1.00 87.45           C  
ATOM   5185  C   ALA B 318     161.432  90.597 137.319  1.00 87.45           C  
ATOM   5186  O   ALA B 318     161.394  91.752 136.873  1.00 87.45           O  
ATOM   5187  CB  ALA B 318     160.162  89.799 139.334  1.00 87.45           C  
ATOM   5188  N   ALA B 319     162.569  89.900 137.395  1.00 84.69           N  
ATOM   5189  CA  ALA B 319     163.823  90.473 136.919  1.00 84.69           C  
ATOM   5190  C   ALA B 319     163.765  90.763 135.424  1.00 84.69           C  
ATOM   5191  O   ALA B 319     164.277  91.791 134.961  1.00 84.69           O  
ATOM   5192  CB  ALA B 319     164.983  89.533 137.241  1.00 84.69           C  
ATOM   5193  N   LYS B 320     163.139  89.871 134.653  1.00 79.43           N  
ATOM   5194  CA  LYS B 320     163.037  90.090 133.215  1.00 79.43           C  
ATOM   5195  C   LYS B 320     162.183  91.314 132.901  1.00 79.43           C  
ATOM   5196  O   LYS B 320     162.527  92.106 132.017  1.00 79.43           O  
ATOM   5197  CB  LYS B 320     162.471  88.844 132.535  1.00 79.43           C  
ATOM   5198  CG  LYS B 320     162.457  88.927 131.021  1.00 79.43           C  
ATOM   5199  CD  LYS B 320     161.966  87.636 130.395  1.00 79.43           C  
ATOM   5200  CE  LYS B 320     162.011  87.716 128.878  1.00 79.43           C  
ATOM   5201  NZ  LYS B 320     163.382  88.015 128.381  1.00 79.43           N  
ATOM   5202  N   ILE B 321     161.075  91.492 133.624  1.00 80.95           N  
ATOM   5203  CA  ILE B 321     160.227  92.661 133.422  1.00 80.95           C  
ATOM   5204  C   ILE B 321     160.979  93.932 133.786  1.00 80.95           C  
ATOM   5205  O   ILE B 321     160.900  94.939 133.075  1.00 80.95           O  
ATOM   5206  CB  ILE B 321     158.923  92.520 134.229  1.00 80.95           C  
ATOM   5207  CG1 ILE B 321     157.956  91.571 133.520  1.00 80.95           C  
ATOM   5208  CG2 ILE B 321     158.272  93.876 134.451  1.00 80.95           C  
ATOM   5209  CD1 ILE B 321     156.606  91.464 134.196  1.00 80.95           C  
ATOM   5210  N   ASP B 322     161.721  93.907 134.896  1.00 86.24           N  
ATOM   5211  CA  ASP B 322     162.530  95.063 135.270  1.00 86.24           C  
ATOM   5212  C   ASP B 322     163.515  95.420 134.162  1.00 86.24           C  
ATOM   5213  O   ASP B 322     163.604  96.582 133.739  1.00 86.24           O  
ATOM   5214  CB  ASP B 322     163.267  94.780 136.579  1.00 86.24           C  
ATOM   5215  CG  ASP B 322     164.007  95.994 137.111  1.00 86.24           C  
ATOM   5216  OD1 ASP B 322     163.777  97.111 136.602  1.00 86.24           O  
ATOM   5217  OD2 ASP B 322     164.822  95.830 138.043  1.00 86.24           O  
ATOM   5218  N   ARG B 323     164.259  94.424 133.676  1.00 84.03           N  
ATOM   5219  CA  ARG B 323     165.266  94.674 132.650  1.00 84.03           C  
ATOM   5220  C   ARG B 323     164.633  95.219 131.375  1.00 84.03           C  
ATOM   5221  O   ARG B 323     165.123  96.194 130.788  1.00 84.03           O  
ATOM   5222  CB  ARG B 323     166.036  93.386 132.365  1.00 84.03           C  
ATOM   5223  CG  ARG B 323     167.207  93.546 131.416  1.00 84.03           C  
ATOM   5224  CD  ARG B 323     168.014  92.259 131.317  1.00 84.03           C  
ATOM   5225  NE  ARG B 323     168.522  91.829 132.617  1.00 84.03           N  
ATOM   5226  CZ  ARG B 323     168.000  90.841 133.338  1.00 84.03           C  
ATOM   5227  NH1 ARG B 323     166.951  90.169 132.884  1.00 84.03           N  
ATOM   5228  NH2 ARG B 323     168.528  90.525 134.511  1.00 84.03           N  
ATOM   5229  N   LEU B 324     163.532  94.605 130.937  1.00 80.24           N  
ATOM   5230  CA  LEU B 324     162.894  95.033 129.698  1.00 80.24           C  
ATOM   5231  C   LEU B 324     162.302  96.431 129.828  1.00 80.24           C  
ATOM   5232  O   LEU B 324     162.395  97.232 128.893  1.00 80.24           O  
ATOM   5233  CB  LEU B 324     161.823  94.027 129.286  1.00 80.24           C  
ATOM   5234  CG  LEU B 324     162.376  92.653 128.916  1.00 80.24           C  
ATOM   5235  CD1 LEU B 324     161.275  91.758 128.374  1.00 80.24           C  
ATOM   5236  CD2 LEU B 324     163.515  92.789 127.919  1.00 80.24           C  
ATOM   5237  N   SER B 325     161.694  96.749 130.973  1.00 78.79           N  
ATOM   5238  CA  SER B 325     161.172  98.096 131.171  1.00 78.79           C  
ATOM   5239  C   SER B 325     162.294  99.122 131.139  1.00 78.79           C  
ATOM   5240  O   SER B 325     162.164 100.175 130.499  1.00 78.79           O  
ATOM   5241  CB  SER B 325     160.408  98.174 132.490  1.00 78.79           C  
ATOM   5242  OG  SER B 325     159.316  97.274 132.491  1.00 78.79           O  
ATOM   5243  N   ARG B 326     163.410  98.825 131.811  1.00 81.67           N  
ATOM   5244  CA  ARG B 326     164.543  99.745 131.795  1.00 81.67           C  
ATOM   5245  C   ARG B 326     165.036  99.980 130.373  1.00 81.67           C  
ATOM   5246  O   ARG B 326     165.291 101.121 129.975  1.00 81.67           O  
ATOM   5247  CB  ARG B 326     165.674  99.212 132.677  1.00 81.67           C  
ATOM   5248  CG  ARG B 326     166.875 100.150 132.776  1.00 81.67           C  
ATOM   5249  CD  ARG B 326     167.997  99.745 131.823  1.00 81.67           C  
ATOM   5250  NE  ARG B 326     168.937 100.836 131.571  1.00 81.67           N  
ATOM   5251  CZ  ARG B 326     170.065 100.709 130.877  1.00 81.67           C  
ATOM   5252  NH1 ARG B 326     170.860 101.755 130.699  1.00 81.67           N  
ATOM   5253  NH2 ARG B 326     170.399  99.535 130.361  1.00 81.67           N  
ATOM   5254  N   ILE B 327     165.180  98.909 129.589  1.00 78.27           N  
ATOM   5255  CA  ILE B 327     165.710  99.087 128.242  1.00 78.27           C  
ATOM   5256  C   ILE B 327     164.665  99.635 127.280  1.00 78.27           C  
ATOM   5257  O   ILE B 327     165.018 100.073 126.181  1.00 78.27           O  
ATOM   5258  CB  ILE B 327     166.293  97.774 127.689  1.00 78.27           C  
ATOM   5259  CG1 ILE B 327     165.174  96.783 127.363  1.00 78.27           C  
ATOM   5260  CG2 ILE B 327     167.293  97.180 128.669  1.00 78.27           C  
ATOM   5261  CD1 ILE B 327     165.653  95.539 126.653  1.00 78.27           C  
ATOM   5262  N   ALA B 328     163.384  99.621 127.652  1.00 76.42           N  
ATOM   5263  CA  ALA B 328     162.338  99.986 126.706  1.00 76.42           C  
ATOM   5264  C   ALA B 328     161.779 101.392 126.895  1.00 76.42           C  
ATOM   5265  O   ALA B 328     161.504 102.069 125.896  1.00 76.42           O  
ATOM   5266  CB  ALA B 328     161.189  98.978 126.785  1.00 76.42           C  
ATOM   5267  N   PHE B 329     161.591 101.852 128.132  1.00 75.95           N  
ATOM   5268  CA  PHE B 329     160.886 103.117 128.342  1.00 75.95           C  
ATOM   5269  C   PHE B 329     161.581 104.335 127.730  1.00 75.95           C  
ATOM   5270  O   PHE B 329     160.922 105.072 126.970  1.00 75.95           O  
ATOM   5271  CB  PHE B 329     160.658 103.334 129.844  1.00 75.95           C  
ATOM   5272  CG  PHE B 329     159.328 102.846 130.338  1.00 75.95           C  
ATOM   5273  CD1 PHE B 329     158.803 101.649 129.891  1.00 75.95           C  
ATOM   5274  CD2 PHE B 329     158.612 103.581 131.269  1.00 75.95           C  
ATOM   5275  CE1 PHE B 329     157.581 101.199 130.351  1.00 75.95           C  
ATOM   5276  CE2 PHE B 329     157.392 103.136 131.733  1.00 75.95           C  
ATOM   5277  CZ  PHE B 329     156.875 101.944 131.274  1.00 75.95           C  
ATOM   5278  N   PRO B 330     162.869 104.614 128.005  1.00 68.02           N  
ATOM   5279  CA  PRO B 330     163.463 105.865 127.513  1.00 68.02           C  
ATOM   5280  C   PRO B 330     163.548 105.929 125.997  1.00 68.02           C  
ATOM   5281  O   PRO B 330     163.510 107.020 125.422  1.00 68.02           O  
ATOM   5282  CB  PRO B 330     164.858 105.867 128.152  1.00 68.02           C  
ATOM   5283  CG  PRO B 330     164.756 104.925 129.301  1.00 68.02           C  
ATOM   5284  CD  PRO B 330     163.827 103.861 128.830  1.00 68.02           C  
ATOM   5285  N   LEU B 331     163.655 104.775 125.340  1.00 68.85           N  
ATOM   5286  CA  LEU B 331     163.702 104.764 123.882  1.00 68.85           C  
ATOM   5287  C   LEU B 331     162.426 105.351 123.289  1.00 68.85           C  
ATOM   5288  O   LEU B 331     162.474 106.275 122.465  1.00 68.85           O  
ATOM   5289  CB  LEU B 331     163.924 103.339 123.379  1.00 68.85           C  
ATOM   5290  CG  LEU B 331     163.879 103.157 121.863  1.00 68.85           C  
ATOM   5291  CD1 LEU B 331     164.946 104.007 121.194  1.00 68.85           C  
ATOM   5292  CD2 LEU B 331     164.045 101.692 121.500  1.00 68.85           C  
ATOM   5293  N   LEU B 332     161.271 104.828 123.705  1.00 69.12           N  
ATOM   5294  CA  LEU B 332     160.005 105.355 123.207  1.00 69.12           C  
ATOM   5295  C   LEU B 332     159.797 106.794 123.652  1.00 69.12           C  
ATOM   5296  O   LEU B 332     159.240 107.608 122.903  1.00 69.12           O  
ATOM   5297  CB  LEU B 332     158.847 104.475 123.674  1.00 69.12           C  
ATOM   5298  CG  LEU B 332     158.780 103.078 123.059  1.00 69.12           C  
ATOM   5299  CD1 LEU B 332     157.683 102.254 123.715  1.00 69.12           C  
ATOM   5300  CD2 LEU B 332     158.557 103.174 121.559  1.00 69.12           C  
ATOM   5301  N   PHE B 333     160.238 107.131 124.869  1.00 67.59           N  
ATOM   5302  CA  PHE B 333     160.128 108.514 125.323  1.00 67.59           C  
ATOM   5303  C   PHE B 333     160.864 109.462 124.381  1.00 67.59           C  
ATOM   5304  O   PHE B 333     160.317 110.485 123.951  1.00 67.59           O  
ATOM   5305  CB  PHE B 333     160.667 108.640 126.748  1.00 67.59           C  
ATOM   5306  CG  PHE B 333     160.551 110.021 127.321  1.00 67.59           C  
ATOM   5307  CD1 PHE B 333     159.311 110.614 127.487  1.00 67.59           C  
ATOM   5308  CD2 PHE B 333     161.679 110.722 127.707  1.00 67.59           C  
ATOM   5309  CE1 PHE B 333     159.197 111.883 128.017  1.00 67.59           C  
ATOM   5310  CE2 PHE B 333     161.572 111.992 128.239  1.00 67.59           C  
ATOM   5311  CZ  PHE B 333     160.329 112.573 128.394  1.00 67.59           C  
ATOM   5312  N   GLY B 334     162.108 109.124 124.039  1.00 62.53           N  
ATOM   5313  CA  GLY B 334     162.880 109.974 123.149  1.00 62.53           C  
ATOM   5314  C   GLY B 334     162.315 110.018 121.743  1.00 62.53           C  
ATOM   5315  O   GLY B 334     162.332 111.067 121.092  1.00 62.53           O  
ATOM   5316  N   ILE B 335     161.812 108.883 121.251  1.00 62.83           N  
ATOM   5317  CA  ILE B 335     161.196 108.875 119.927  1.00 62.83           C  
ATOM   5318  C   ILE B 335     160.004 109.821 119.892  1.00 62.83           C  
ATOM   5319  O   ILE B 335     159.842 110.613 118.951  1.00 62.83           O  
ATOM   5320  CB  ILE B 335     160.794 107.444 119.528  1.00 62.83           C  
ATOM   5321  CG1 ILE B 335     162.036 106.567 119.375  1.00 62.83           C  
ATOM   5322  CG2 ILE B 335     159.995 107.458 118.237  1.00 62.83           C  
ATOM   5323  CD1 ILE B 335     161.724 105.117 119.091  1.00 62.83           C  
ATOM   5324  N   PHE B 336     159.157 109.768 120.923  1.00 64.08           N  
ATOM   5325  CA  PHE B 336     158.001 110.656 120.960  1.00 64.08           C  
ATOM   5326  C   PHE B 336     158.423 112.114 121.068  1.00 64.08           C  
ATOM   5327  O   PHE B 336     157.816 112.987 120.440  1.00 64.08           O  
ATOM   5328  CB  PHE B 336     157.077 110.296 122.119  1.00 64.08           C  
ATOM   5329  CG  PHE B 336     155.987 111.300 122.335  1.00 64.08           C  
ATOM   5330  CD1 PHE B 336     154.853 111.284 121.544  1.00 64.08           C  
ATOM   5331  CD2 PHE B 336     156.106 112.274 123.309  1.00 64.08           C  
ATOM   5332  CE1 PHE B 336     153.854 112.210 121.730  1.00 64.08           C  
ATOM   5333  CE2 PHE B 336     155.111 113.203 123.497  1.00 64.08           C  
ATOM   5334  CZ  PHE B 336     153.984 113.171 122.707  1.00 64.08           C  
ATOM   5335  N   ASN B 337     159.435 112.405 121.891  1.00 64.93           N  
ATOM   5336  CA  ASN B 337     159.914 113.780 121.991  1.00 64.93           C  
ATOM   5337  C   ASN B 337     160.402 114.289 120.643  1.00 64.93           C  
ATOM   5338  O   ASN B 337     160.106 115.427 120.252  1.00 64.93           O  
ATOM   5339  CB  ASN B 337     161.024 113.883 123.035  1.00 64.93           C  
ATOM   5340  CG  ASN B 337     160.487 114.031 124.440  1.00 64.93           C  
ATOM   5341  OD1 ASN B 337     160.626 113.132 125.268  1.00 64.93           O  
ATOM   5342  ND2 ASN B 337     159.872 115.174 124.719  1.00 64.93           N  
ATOM   5343  N   LEU B 338     161.147 113.456 119.914  1.00 63.48           N  
ATOM   5344  CA  LEU B 338     161.616 113.852 118.592  1.00 63.48           C  
ATOM   5345  C   LEU B 338     160.445 114.135 117.661  1.00 63.48           C  
ATOM   5346  O   LEU B 338     160.431 115.151 116.957  1.00 63.48           O  
ATOM   5347  CB  LEU B 338     162.518 112.766 118.008  1.00 63.48           C  
ATOM   5348  CG  LEU B 338     163.078 113.083 116.622  1.00 63.48           C  
ATOM   5349  CD1 LEU B 338     163.920 114.348 116.666  1.00 63.48           C  
ATOM   5350  CD2 LEU B 338     163.889 111.913 116.093  1.00 63.48           C  
ATOM   5351  N   VAL B 339     159.446 113.249 117.652  1.00 61.69           N  
ATOM   5352  CA  VAL B 339     158.292 113.448 116.775  1.00 61.69           C  
ATOM   5353  C   VAL B 339     157.572 114.747 117.119  1.00 61.69           C  
ATOM   5354  O   VAL B 339     157.228 115.542 116.234  1.00 61.69           O  
ATOM   5355  CB  VAL B 339     157.341 112.241 116.860  1.00 61.69           C  
ATOM   5356  CG1 VAL B 339     156.058 112.524 116.098  1.00 61.69           C  
ATOM   5357  CG2 VAL B 339     158.016 110.997 116.318  1.00 61.69           C  
ATOM   5358  N   TYR B 340     157.340 114.983 118.411  1.00 64.56           N  
ATOM   5359  CA  TYR B 340     156.598 116.162 118.842  1.00 64.56           C  
ATOM   5360  C   TYR B 340     157.332 117.440 118.467  1.00 64.56           C  
ATOM   5361  O   TYR B 340     156.737 118.372 117.917  1.00 64.56           O  
ATOM   5362  CB  TYR B 340     156.363 116.094 120.351  1.00 64.56           C  
ATOM   5363  CG  TYR B 340     155.565 117.237 120.929  1.00 64.56           C  
ATOM   5364  CD1 TYR B 340     156.190 118.394 121.370  1.00 64.56           C  
ATOM   5365  CD2 TYR B 340     154.188 117.150 121.056  1.00 64.56           C  
ATOM   5366  CE1 TYR B 340     155.466 119.435 121.907  1.00 64.56           C  
ATOM   5367  CE2 TYR B 340     153.456 118.186 121.594  1.00 64.56           C  
ATOM   5368  CZ  TYR B 340     154.100 119.327 122.017  1.00 64.56           C  
ATOM   5369  OH  TYR B 340     153.375 120.365 122.553  1.00 64.56           O  
ATOM   5370  N   TRP B 341     158.633 117.502 118.753  1.00 66.83           N  
ATOM   5371  CA  TRP B 341     159.370 118.727 118.468  1.00 66.83           C  
ATOM   5372  C   TRP B 341     159.631 118.903 116.980  1.00 66.83           C  
ATOM   5373  O   TRP B 341     159.901 120.022 116.532  1.00 66.83           O  
ATOM   5374  CB  TRP B 341     160.679 118.748 119.248  1.00 66.83           C  
ATOM   5375  CG  TRP B 341     160.466 118.949 120.704  1.00 66.83           C  
ATOM   5376  CD1 TRP B 341     160.674 118.043 121.698  1.00 66.83           C  
ATOM   5377  CD2 TRP B 341     159.975 120.133 121.336  1.00 66.83           C  
ATOM   5378  NE1 TRP B 341     160.355 118.593 122.915  1.00 66.83           N  
ATOM   5379  CE2 TRP B 341     159.922 119.877 122.718  1.00 66.83           C  
ATOM   5380  CE3 TRP B 341     159.581 121.387 120.867  1.00 66.83           C  
ATOM   5381  CZ2 TRP B 341     159.491 120.829 123.636  1.00 66.83           C  
ATOM   5382  CZ3 TRP B 341     159.154 122.329 121.778  1.00 66.83           C  
ATOM   5383  CH2 TRP B 341     159.114 122.047 123.146  1.00 66.83           C  
ATOM   5384  N   ALA B 342     159.564 117.826 116.196  1.00 64.64           N  
ATOM   5385  CA  ALA B 342     159.776 117.971 114.761  1.00 64.64           C  
ATOM   5386  C   ALA B 342     158.494 118.381 114.049  1.00 64.64           C  
ATOM   5387  O   ALA B 342     158.542 119.081 113.031  1.00 64.64           O  
ATOM   5388  CB  ALA B 342     160.323 116.670 114.179  1.00 64.64           C  
ATOM   5389  N   THR B 343     157.340 117.956 114.566  1.00 68.23           N  
ATOM   5390  CA  THR B 343     156.085 118.190 113.857  1.00 68.23           C  
ATOM   5391  C   THR B 343     155.744 119.675 113.780  1.00 68.23           C  
ATOM   5392  O   THR B 343     155.354 120.177 112.720  1.00 68.23           O  
ATOM   5393  CB  THR B 343     154.952 117.424 114.537  1.00 68.23           C  
ATOM   5394  OG1 THR B 343     155.351 116.064 114.740  1.00 68.23           O  
ATOM   5395  CG2 THR B 343     153.703 117.458 113.673  1.00 68.23           C  
ATOM   5396  N   TYR B 344     155.878 120.393 114.895  1.00 67.22           N  
ATOM   5397  CA  TYR B 344     155.326 121.741 114.981  1.00 67.22           C  
ATOM   5398  C   TYR B 344     156.241 122.784 114.353  1.00 67.22           C  
ATOM   5399  O   TYR B 344     155.822 123.522 113.455  1.00 67.22           O  
ATOM   5400  CB  TYR B 344     155.035 122.082 116.439  1.00 67.22           C  
ATOM   5401  CG  TYR B 344     153.887 121.280 116.986  1.00 67.22           C  
ATOM   5402  CD1 TYR B 344     152.876 120.836 116.148  1.00 67.22           C  
ATOM   5403  CD2 TYR B 344     153.816 120.956 118.328  1.00 67.22           C  
ATOM   5404  CE1 TYR B 344     151.822 120.100 116.632  1.00 67.22           C  
ATOM   5405  CE2 TYR B 344     152.765 120.217 118.823  1.00 67.22           C  
ATOM   5406  CZ  TYR B 344     151.770 119.793 117.969  1.00 67.22           C  
ATOM   5407  OH  TYR B 344     150.716 119.056 118.453  1.00 67.22           O  
ATOM   5408  N   LEU B 345     157.484 122.867 114.811  1.00 68.89           N  
ATOM   5409  CA  LEU B 345     158.407 123.873 114.302  1.00 68.89           C  
ATOM   5410  C   LEU B 345     158.686 123.676 112.815  1.00 68.89           C  
ATOM   5411  O   LEU B 345     158.328 124.514 111.989  1.00 68.89           O  
ATOM   5412  CB  LEU B 345     159.715 123.842 115.088  1.00 68.89           C  
ATOM   5413  CG  LEU B 345     160.834 124.707 114.509  1.00 68.89           C  
ATOM   5414  CD1 LEU B 345     160.432 126.174 114.508  1.00 68.89           C  
ATOM   5415  CD2 LEU B 345     162.128 124.497 115.279  1.00 68.89           C  
TER    5416      LEU B 345                                                      
ATOM   5417  N   ASN C   8     123.130 169.659  90.343  1.00 58.74           N  
ATOM   5418  CA  ASN C   8     123.881 170.843  90.743  1.00 58.74           C  
ATOM   5419  C   ASN C   8     124.010 170.894  92.262  1.00 58.74           C  
ATOM   5420  O   ASN C   8     123.354 170.134  92.970  1.00 58.74           O  
ATOM   5421  CB  ASN C   8     123.205 172.109  90.214  1.00 58.74           C  
ATOM   5422  CG  ASN C   8     124.116 173.319  90.256  1.00 58.74           C  
ATOM   5423  OD1 ASN C   8     125.307 173.202  90.541  1.00 58.74           O  
ATOM   5424  ND2 ASN C   8     123.561 174.489  89.965  1.00 58.74           N  
ATOM   5425  N   MET C   9     124.870 171.783  92.760  1.00 57.71           N  
ATOM   5426  CA  MET C   9     125.090 171.881  94.198  1.00 57.71           C  
ATOM   5427  C   MET C   9     124.115 172.850  94.859  1.00 57.71           C  
ATOM   5428  O   MET C   9     123.542 172.539  95.912  1.00 57.71           O  
ATOM   5429  CB  MET C   9     126.528 172.312  94.473  1.00 57.71           C  
ATOM   5430  CG  MET C   9     126.896 172.329  95.936  1.00 57.71           C  
ATOM   5431  SD  MET C   9     126.871 170.681  96.650  1.00 57.71           S  
ATOM   5432  CE  MET C   9     127.549 171.028  98.266  1.00 57.71           C  
ATOM   5433  N   SER C  10     123.922 174.027  94.259  1.00 55.80           N  
ATOM   5434  CA  SER C  10     123.070 175.044  94.868  1.00 55.80           C  
ATOM   5435  C   SER C  10     121.631 174.562  94.993  1.00 55.80           C  
ATOM   5436  O   SER C  10     120.933 174.919  95.949  1.00 55.80           O  
ATOM   5437  CB  SER C  10     123.132 176.333  94.054  1.00 55.80           C  
ATOM   5438  OG  SER C  10     124.468 176.779  93.913  1.00 55.80           O  
ATOM   5439  N   LEU C  11     121.167 173.762  94.032  1.00 51.98           N  
ATOM   5440  CA  LEU C  11     119.820 173.212  94.117  1.00 51.98           C  
ATOM   5441  C   LEU C  11     119.648 172.393  95.387  1.00 51.98           C  
ATOM   5442  O   LEU C  11     118.687 172.587  96.140  1.00 51.98           O  
ATOM   5443  CB  LEU C  11     119.520 172.356  92.889  1.00 51.98           C  
ATOM   5444  CG  LEU C  11     119.548 173.066  91.540  1.00 51.98           C  
ATOM   5445  CD1 LEU C  11     119.092 172.122  90.445  1.00 51.98           C  
ATOM   5446  CD2 LEU C  11     118.680 174.309  91.576  1.00 51.98           C  
ATOM   5447  N   VAL C  12     120.578 171.472  95.643  1.00 47.87           N  
ATOM   5448  CA  VAL C  12     120.473 170.638  96.834  1.00 47.87           C  
ATOM   5449  C   VAL C  12     120.622 171.483  98.089  1.00 47.87           C  
ATOM   5450  O   VAL C  12     119.933 171.255  99.091  1.00 47.87           O  
ATOM   5451  CB  VAL C  12     121.510 169.505  96.788  1.00 47.87           C  
ATOM   5452  CG1 VAL C  12     121.330 168.599  97.982  1.00 47.87           C  
ATOM   5453  CG2 VAL C  12     121.372 168.722  95.500  1.00 47.87           C  
ATOM   5454  N   LYS C  13     121.516 172.474  98.056  1.00 48.78           N  
ATOM   5455  CA  LYS C  13     121.683 173.346  99.213  1.00 48.78           C  
ATOM   5456  C   LYS C  13     120.372 174.030  99.574  1.00 48.78           C  
ATOM   5457  O   LYS C  13     119.909 173.950 100.719  1.00 48.78           O  
ATOM   5458  CB  LYS C  13     122.767 174.386  98.942  1.00 48.78           C  
ATOM   5459  CG  LYS C  13     123.012 175.323 100.111  1.00 48.78           C  
ATOM   5460  CD  LYS C  13     123.874 176.504  99.704  1.00 48.78           C  
ATOM   5461  CE  LYS C  13     124.195 177.380 100.902  1.00 48.78           C  
ATOM   5462  NZ  LYS C  13     122.971 177.731 101.673  1.00 48.78           N  
ATOM   5463  N   GLU C  14     119.747 174.695  98.600  1.00 49.85           N  
ATOM   5464  CA  GLU C  14     118.513 175.414  98.888  1.00 49.85           C  
ATOM   5465  C   GLU C  14     117.377 174.461  99.237  1.00 49.85           C  
ATOM   5466  O   GLU C  14     116.537 174.790 100.081  1.00 49.85           O  
ATOM   5467  CB  GLU C  14     118.127 176.311  97.710  1.00 49.85           C  
ATOM   5468  CG  GLU C  14     117.733 175.574  96.444  1.00 49.85           C  
ATOM   5469  CD  GLU C  14     117.478 176.512  95.281  1.00 49.85           C  
ATOM   5470  OE1 GLU C  14     117.857 177.698  95.379  1.00 49.85           O  
ATOM   5471  OE2 GLU C  14     116.897 176.066  94.269  1.00 49.85           O  
ATOM   5472  N   THR C  15     117.349 173.270  98.634  1.00 46.90           N  
ATOM   5473  CA  THR C  15     116.301 172.310  98.960  1.00 46.90           C  
ATOM   5474  C   THR C  15     116.396 171.867 100.414  1.00 46.90           C  
ATOM   5475  O   THR C  15     115.397 171.878 101.143  1.00 46.90           O  
ATOM   5476  CB  THR C  15     116.376 171.108  98.021  1.00 46.90           C  
ATOM   5477  OG1 THR C  15     115.947 171.500  96.712  1.00 46.90           O  
ATOM   5478  CG2 THR C  15     115.481 169.997  98.518  1.00 46.90           C  
ATOM   5479  N   VAL C  16     117.592 171.473 100.857  1.00 45.02           N  
ATOM   5480  CA  VAL C  16     117.754 171.056 102.247  1.00 45.02           C  
ATOM   5481  C   VAL C  16     117.468 172.217 103.190  1.00 45.02           C  
ATOM   5482  O   VAL C  16     116.826 172.046 104.239  1.00 45.02           O  
ATOM   5483  CB  VAL C  16     119.161 170.476 102.470  1.00 45.02           C  
ATOM   5484  CG1 VAL C  16     119.373 170.151 103.933  1.00 45.02           C  
ATOM   5485  CG2 VAL C  16     119.354 169.236 101.625  1.00 45.02           C  
ATOM   5486  N   ASP C  17     117.912 173.422 102.824  1.00 51.07           N  
ATOM   5487  CA  ASP C  17     117.715 174.567 103.704  1.00 51.07           C  
ATOM   5488  C   ASP C  17     116.239 174.909 103.851  1.00 51.07           C  
ATOM   5489  O   ASP C  17     115.801 175.320 104.931  1.00 51.07           O  
ATOM   5490  CB  ASP C  17     118.493 175.774 103.183  1.00 51.07           C  
ATOM   5491  CG  ASP C  17     119.992 175.597 103.309  1.00 51.07           C  
ATOM   5492  OD1 ASP C  17     120.429 174.894 104.244  1.00 51.07           O  
ATOM   5493  OD2 ASP C  17     120.734 176.158 102.474  1.00 51.07           O  
ATOM   5494  N   ARG C  18     115.454 174.748 102.785  1.00 49.36           N  
ATOM   5495  CA  ARG C  18     114.032 175.046 102.893  1.00 49.36           C  
ATOM   5496  C   ARG C  18     113.259 173.892 103.517  1.00 49.36           C  
ATOM   5497  O   ARG C  18     112.173 174.107 104.064  1.00 49.36           O  
ATOM   5498  CB  ARG C  18     113.454 175.396 101.522  1.00 49.36           C  
ATOM   5499  CG  ARG C  18     113.042 174.206 100.686  1.00 49.36           C  
ATOM   5500  CD  ARG C  18     111.534 174.136 100.549  1.00 49.36           C  
ATOM   5501  NE  ARG C  18     111.131 173.098  99.609  1.00 49.36           N  
ATOM   5502  CZ  ARG C  18     111.081 173.267  98.293  1.00 49.36           C  
ATOM   5503  NH1 ARG C  18     110.702 172.269  97.508  1.00 49.36           N  
ATOM   5504  NH2 ARG C  18     111.412 174.435  97.762  1.00 49.36           N  
ATOM   5505  N   LEU C  19     113.793 172.671 103.447  1.00 44.81           N  
ATOM   5506  CA  LEU C  19     113.171 171.559 104.156  1.00 44.81           C  
ATOM   5507  C   LEU C  19     113.285 171.744 105.659  1.00 44.81           C  
ATOM   5508  O   LEU C  19     112.279 171.736 106.376  1.00 44.81           O  
ATOM   5509  CB  LEU C  19     113.809 170.235 103.745  1.00 44.81           C  
ATOM   5510  CG  LEU C  19     113.387 169.619 102.420  1.00 44.81           C  
ATOM   5511  CD1 LEU C  19     113.906 168.198 102.342  1.00 44.81           C  
ATOM   5512  CD2 LEU C  19     111.879 169.661 102.282  1.00 44.81           C  
ATOM   5513  N   LEU C  20     114.511 171.912 106.156  1.00 41.00           N  
ATOM   5514  CA  LEU C  20     114.704 171.950 107.602  1.00 41.00           C  
ATOM   5515  C   LEU C  20     114.131 173.218 108.221  1.00 41.00           C  
ATOM   5516  O   LEU C  20     113.859 173.248 109.427  1.00 41.00           O  
ATOM   5517  CB  LEU C  20     116.185 171.806 107.938  1.00 41.00           C  
ATOM   5518  CG  LEU C  20     116.714 170.385 108.149  1.00 41.00           C  
ATOM   5519  CD1 LEU C  20     116.284 169.440 107.043  1.00 41.00           C  
ATOM   5520  CD2 LEU C  20     118.221 170.425 108.239  1.00 41.00           C  
ATOM   5521  N   LYS C  21     113.947 174.270 107.430  1.00 47.65           N  
ATOM   5522  CA  LYS C  21     113.306 175.476 107.937  1.00 47.65           C  
ATOM   5523  C   LYS C  21     111.800 175.270 108.040  1.00 47.65           C  
ATOM   5524  O   LYS C  21     111.170 174.707 107.141  1.00 47.65           O  
ATOM   5525  CB  LYS C  21     113.616 176.664 107.030  1.00 47.65           C  
ATOM   5526  CG  LYS C  21     113.100 177.993 107.549  1.00 47.65           C  
ATOM   5527  CD  LYS C  21     113.509 179.124 106.627  1.00 47.65           C  
ATOM   5528  CE  LYS C  21     113.021 180.463 107.146  1.00 47.65           C  
ATOM   5529  NZ  LYS C  21     113.402 181.571 106.231  1.00 47.65           N  
ATOM   5530  N   GLY C  22     111.221 175.736 109.141  1.00 47.75           N  
ATOM   5531  CA  GLY C  22     109.807 175.517 109.372  1.00 47.75           C  
ATOM   5532  C   GLY C  22     109.463 174.086 109.707  1.00 47.75           C  
ATOM   5533  O   GLY C  22     108.383 173.611 109.345  1.00 47.75           O  
ATOM   5534  N   TYR C  23     110.359 173.383 110.393  1.00 33.64           N  
ATOM   5535  CA  TYR C  23     110.184 171.978 110.737  1.00 33.64           C  
ATOM   5536  C   TYR C  23     110.184 171.858 112.253  1.00 33.64           C  
ATOM   5537  O   TYR C  23     111.160 172.238 112.907  1.00 33.64           O  
ATOM   5538  CB  TYR C  23     111.297 171.133 110.116  1.00 33.64           C  
ATOM   5539  CG  TYR C  23     111.224 169.663 110.428  1.00 33.64           C  
ATOM   5540  CD1 TYR C  23     110.367 168.832 109.734  1.00 33.64           C  
ATOM   5541  CD2 TYR C  23     112.023 169.105 111.408  1.00 33.64           C  
ATOM   5542  CE1 TYR C  23     110.302 167.490 110.013  1.00 33.64           C  
ATOM   5543  CE2 TYR C  23     111.963 167.763 111.693  1.00 33.64           C  
ATOM   5544  CZ  TYR C  23     111.099 166.960 110.994  1.00 33.64           C  
ATOM   5545  OH  TYR C  23     111.031 165.617 111.273  1.00 33.64           O  
ATOM   5546  N   ASP C  24     109.096 171.332 112.808  1.00 30.13           N  
ATOM   5547  CA  ASP C  24     108.889 171.291 114.251  1.00 30.13           C  
ATOM   5548  C   ASP C  24     109.263 169.905 114.759  1.00 30.13           C  
ATOM   5549  O   ASP C  24     108.613 168.914 114.417  1.00 30.13           O  
ATOM   5550  CB  ASP C  24     107.443 171.633 114.595  1.00 30.13           C  
ATOM   5551  CG  ASP C  24     107.294 172.179 115.996  1.00 30.13           C  
ATOM   5552  OD1 ASP C  24     108.292 172.179 116.746  1.00 30.13           O  
ATOM   5553  OD2 ASP C  24     106.180 172.617 116.349  1.00 30.13           O  
ATOM   5554  N   ILE C  25     110.309 169.840 115.584  1.00 23.69           N  
ATOM   5555  CA  ILE C  25     110.857 168.550 115.985  1.00 23.69           C  
ATOM   5556  C   ILE C  25     110.006 167.893 117.064  1.00 23.69           C  
ATOM   5557  O   ILE C  25     110.063 166.672 117.246  1.00 23.69           O  
ATOM   5558  CB  ILE C  25     112.315 168.719 116.443  1.00 23.69           C  
ATOM   5559  CG1 ILE C  25     112.984 167.358 116.610  1.00 23.69           C  
ATOM   5560  CG2 ILE C  25     112.377 169.487 117.739  1.00 23.69           C  
ATOM   5561  CD1 ILE C  25     114.399 167.436 117.113  1.00 23.69           C  
ATOM   5562  N   ARG C  26     109.205 168.671 117.794  1.00 27.25           N  
ATOM   5563  CA  ARG C  26     108.472 168.112 118.926  1.00 27.25           C  
ATOM   5564  C   ARG C  26     107.461 167.062 118.482  1.00 27.25           C  
ATOM   5565  O   ARG C  26     107.274 166.046 119.161  1.00 27.25           O  
ATOM   5566  CB  ARG C  26     107.772 169.222 119.710  1.00 27.25           C  
ATOM   5567  CG  ARG C  26     108.687 170.059 120.583  1.00 27.25           C  
ATOM   5568  CD  ARG C  26     109.270 171.215 119.807  1.00 27.25           C  
ATOM   5569  NE  ARG C  26     108.237 172.140 119.361  1.00 27.25           N  
ATOM   5570  CZ  ARG C  26     107.958 173.287 119.967  1.00 27.25           C  
ATOM   5571  NH1 ARG C  26     108.638 173.649 121.044  1.00 27.25           N  
ATOM   5572  NH2 ARG C  26     107.003 174.074 119.495  1.00 27.25           N  
ATOM   5573  N   LEU C  27     106.799 167.284 117.353  1.00 26.27           N  
ATOM   5574  CA  LEU C  27     105.683 166.450 116.928  1.00 26.27           C  
ATOM   5575  C   LEU C  27     106.105 165.510 115.808  1.00 26.27           C  
ATOM   5576  O   LEU C  27     106.782 165.924 114.862  1.00 26.27           O  
ATOM   5577  CB  LEU C  27     104.507 167.314 116.475  1.00 26.27           C  
ATOM   5578  CG  LEU C  27     103.908 168.212 117.556  1.00 26.27           C  
ATOM   5579  CD1 LEU C  27     104.615 169.553 117.604  1.00 26.27           C  
ATOM   5580  CD2 LEU C  27     102.425 168.400 117.327  1.00 26.27           C  
ATOM   5581  N   ARG C  28     105.692 164.254 115.915  1.00 22.70           N  
ATOM   5582  CA  ARG C  28     106.015 163.229 114.941  1.00 22.70           C  
ATOM   5583  C   ARG C  28     105.112 163.353 113.715  1.00 22.70           C  
ATOM   5584  O   ARG C  28     104.103 164.059 113.751  1.00 22.70           O  
ATOM   5585  CB  ARG C  28     105.881 161.856 115.592  1.00 22.70           C  
ATOM   5586  CG  ARG C  28     104.605 161.642 116.377  1.00 22.70           C  
ATOM   5587  CD  ARG C  28     103.534 161.021 115.514  1.00 22.70           C  
ATOM   5588  NE  ARG C  28     102.415 160.529 116.304  1.00 22.70           N  
ATOM   5589  CZ  ARG C  28     101.294 160.056 115.779  1.00 22.70           C  
ATOM   5590  NH1 ARG C  28     101.145 160.017 114.464  1.00 22.70           N  
ATOM   5591  NH2 ARG C  28     100.322 159.626 116.566  1.00 22.70           N  
ATOM   5592  N   PRO C  29     105.458 162.689 112.606  1.00 28.52           N  
ATOM   5593  CA  PRO C  29     104.638 162.812 111.397  1.00 28.52           C  
ATOM   5594  C   PRO C  29     103.231 162.288 111.620  1.00 28.52           C  
ATOM   5595  O   PRO C  29     103.015 161.329 112.362  1.00 28.52           O  
ATOM   5596  CB  PRO C  29     105.388 161.959 110.370  1.00 28.52           C  
ATOM   5597  CG  PRO C  29     106.170 161.012 111.182  1.00 28.52           C  
ATOM   5598  CD  PRO C  29     106.605 161.797 112.373  1.00 28.52           C  
ATOM   5599  N   ASP C  30     102.272 162.930 110.958  1.00 34.83           N  
ATOM   5600  CA  ASP C  30     100.857 162.601 111.092  1.00 34.83           C  
ATOM   5601  C   ASP C  30     100.439 162.645 112.560  1.00 34.83           C  
ATOM   5602  O   ASP C  30     100.074 161.639 113.167  1.00 34.83           O  
ATOM   5603  CB  ASP C  30     100.552 161.236 110.471  1.00 34.83           C  
ATOM   5604  CG  ASP C  30     100.934 161.166 109.010  1.00 34.83           C  
ATOM   5605  OD1 ASP C  30     100.841 162.204 108.324  1.00 34.83           O  
ATOM   5606  OD2 ASP C  30     101.331 160.077 108.546  1.00 34.83           O  
ATOM   5607  N   PHE C  31     100.520 163.846 113.132  1.00 32.68           N  
ATOM   5608  CA  PHE C  31     100.236 163.995 114.554  1.00 32.68           C  
ATOM   5609  C   PHE C  31      98.760 163.777 114.853  1.00 32.68           C  
ATOM   5610  O   PHE C  31      98.410 163.191 115.883  1.00 32.68           O  
ATOM   5611  CB  PHE C  31     100.676 165.373 115.037  1.00 32.68           C  
ATOM   5612  CG  PHE C  31     100.594 165.544 116.523  1.00 32.68           C  
ATOM   5613  CD1 PHE C  31     101.549 164.983 117.349  1.00 32.68           C  
ATOM   5614  CD2 PHE C  31      99.563 166.262 117.095  1.00 32.68           C  
ATOM   5615  CE1 PHE C  31     101.480 165.137 118.712  1.00 32.68           C  
ATOM   5616  CE2 PHE C  31      99.491 166.419 118.461  1.00 32.68           C  
ATOM   5617  CZ  PHE C  31     100.451 165.855 119.268  1.00 32.68           C  
ATOM   5618  N   GLY C  32      97.879 164.243 113.970  1.00 38.66           N  
ATOM   5619  CA  GLY C  32      96.457 164.162 114.258  1.00 38.66           C  
ATOM   5620  C   GLY C  32      95.872 162.790 113.982  1.00 38.66           C  
ATOM   5621  O   GLY C  32      95.189 162.212 114.830  1.00 38.66           O  
ATOM   5622  N   GLY C  33      96.141 162.245 112.799  1.00 42.22           N  
ATOM   5623  CA  GLY C  33      95.403 161.106 112.309  1.00 42.22           C  
ATOM   5624  C   GLY C  33      96.053 159.762 112.560  1.00 42.22           C  
ATOM   5625  O   GLY C  33      96.343 159.382 113.698  1.00 42.22           O  
ATOM   5626  N   PRO C  34      96.290 159.015 111.488  1.00 36.55           N  
ATOM   5627  CA  PRO C  34      96.669 157.607 111.621  1.00 36.55           C  
ATOM   5628  C   PRO C  34      98.059 157.460 112.211  1.00 36.55           C  
ATOM   5629  O   PRO C  34      98.835 158.425 112.243  1.00 36.55           O  
ATOM   5630  CB  PRO C  34      96.621 157.100 110.173  1.00 36.55           C  
ATOM   5631  CG  PRO C  34      96.906 158.308 109.358  1.00 36.55           C  
ATOM   5632  CD  PRO C  34      96.255 159.449 110.083  1.00 36.55           C  
ATOM   5633  N   PRO C  35      98.408 156.271 112.692  1.00 22.94           N  
ATOM   5634  CA  PRO C  35      99.741 156.065 113.259  1.00 22.94           C  
ATOM   5635  C   PRO C  35     100.799 155.860 112.189  1.00 22.94           C  
ATOM   5636  O   PRO C  35     100.518 155.425 111.071  1.00 22.94           O  
ATOM   5637  CB  PRO C  35      99.565 154.798 114.101  1.00 22.94           C  
ATOM   5638  CG  PRO C  35      98.499 154.054 113.403  1.00 22.94           C  
ATOM   5639  CD  PRO C  35      97.547 155.093 112.884  1.00 22.94           C  
ATOM   5640  N   VAL C  36     102.037 156.174 112.560  1.00 19.32           N  
ATOM   5641  CA  VAL C  36     103.163 156.044 111.645  1.00 19.32           C  
ATOM   5642  C   VAL C  36     103.632 154.592 111.602  1.00 19.32           C  
ATOM   5643  O   VAL C  36     103.351 153.791 112.497  1.00 19.32           O  
ATOM   5644  CB  VAL C  36     104.302 156.991 112.060  1.00 19.32           C  
ATOM   5645  CG1 VAL C  36     105.153 156.352 113.137  1.00 19.32           C  
ATOM   5646  CG2 VAL C  36     105.137 157.376 110.863  1.00 19.32           C  
ATOM   5647  N   ALA C  37     104.350 154.246 110.539  1.00 16.12           N  
ATOM   5648  CA  ALA C  37     104.863 152.898 110.339  1.00 16.12           C  
ATOM   5649  C   ALA C  37     106.381 152.909 110.431  1.00 16.12           C  
ATOM   5650  O   ALA C  37     107.040 153.677 109.727  1.00 16.12           O  
ATOM   5651  CB  ALA C  37     104.425 152.342 108.985  1.00 16.12           C  
ATOM   5652  N   VAL C  38     106.931 152.050 111.284  1.00 10.81           N  
ATOM   5653  CA  VAL C  38     108.368 151.981 111.523  1.00 10.81           C  
ATOM   5654  C   VAL C  38     108.832 150.552 111.292  1.00 10.81           C  
ATOM   5655  O   VAL C  38     108.286 149.616 111.886  1.00 10.81           O  
ATOM   5656  CB  VAL C  38     108.724 152.437 112.947  1.00 10.81           C  
ATOM   5657  CG1 VAL C  38     110.146 152.064 113.273  1.00 10.81           C  
ATOM   5658  CG2 VAL C  38     108.527 153.926 113.084  1.00 10.81           C  
ATOM   5659  N   GLY C  39     109.838 150.382 110.441  1.00 15.18           N  
ATOM   5660  CA  GLY C  39     110.381 149.060 110.198  1.00 15.18           C  
ATOM   5661  C   GLY C  39     111.813 148.931 110.669  1.00 15.18           C  
ATOM   5662  O   GLY C  39     112.656 149.761 110.320  1.00 15.18           O  
ATOM   5663  N   MET C  40     112.102 147.899 111.457  1.00 15.28           N  
ATOM   5664  CA  MET C  40     113.412 147.712 112.060  1.00 15.28           C  
ATOM   5665  C   MET C  40     114.110 146.507 111.449  1.00 15.28           C  
ATOM   5666  O   MET C  40     113.481 145.480 111.185  1.00 15.28           O  
ATOM   5667  CB  MET C  40     113.293 147.550 113.574  1.00 15.28           C  
ATOM   5668  CG  MET C  40     113.067 148.867 114.279  1.00 15.28           C  
ATOM   5669  SD  MET C  40     112.914 148.742 116.063  1.00 15.28           S  
ATOM   5670  CE  MET C  40     111.211 148.244 116.217  1.00 15.28           C  
ATOM   5671  N   ASN C  41     115.415 146.643 111.223  1.00 20.86           N  
ATOM   5672  CA  ASN C  41     116.210 145.651 110.502  1.00 20.86           C  
ATOM   5673  C   ASN C  41     117.551 145.487 111.211  1.00 20.86           C  
ATOM   5674  O   ASN C  41     118.514 146.188 110.898  1.00 20.86           O  
ATOM   5675  CB  ASN C  41     116.385 146.088 109.055  1.00 20.86           C  
ATOM   5676  CG  ASN C  41     117.199 145.114 108.247  1.00 20.86           C  
ATOM   5677  OD1 ASN C  41     117.354 143.957 108.625  1.00 20.86           O  
ATOM   5678  ND2 ASN C  41     117.723 145.577 107.118  1.00 20.86           N  
ATOM   5679  N   ILE C  42     117.620 144.554 112.150  1.00 18.52           N  
ATOM   5680  CA  ILE C  42     118.838 144.327 112.917  1.00 18.52           C  
ATOM   5681  C   ILE C  42     119.838 143.566 112.061  1.00 18.52           C  
ATOM   5682  O   ILE C  42     119.457 142.790 111.180  1.00 18.52           O  
ATOM   5683  CB  ILE C  42     118.518 143.564 114.213  1.00 18.52           C  
ATOM   5684  CG1 ILE C  42     117.443 144.301 115.003  1.00 18.52           C  
ATOM   5685  CG2 ILE C  42     119.754 143.402 115.065  1.00 18.52           C  
ATOM   5686  CD1 ILE C  42     117.020 143.583 116.257  1.00 18.52           C  
ATOM   5687  N   ASP C  43     121.126 143.806 112.295  1.00 23.24           N  
ATOM   5688  CA  ASP C  43     122.196 143.028 111.678  1.00 23.24           C  
ATOM   5689  C   ASP C  43     123.271 142.791 112.730  1.00 23.24           C  
ATOM   5690  O   ASP C  43     124.008 143.715 113.083  1.00 23.24           O  
ATOM   5691  CB  ASP C  43     122.770 143.745 110.459  1.00 23.24           C  
ATOM   5692  CG  ASP C  43     123.799 142.914 109.726  1.00 23.24           C  
ATOM   5693  OD1 ASP C  43     123.992 141.739 110.095  1.00 23.24           O  
ATOM   5694  OD2 ASP C  43     124.418 143.436 108.776  1.00 23.24           O  
ATOM   5695  N   ILE C  44     123.367 141.559 113.218  1.00 16.35           N  
ATOM   5696  CA  ILE C  44     124.254 141.228 114.328  1.00 16.35           C  
ATOM   5697  C   ILE C  44     125.675 141.066 113.808  1.00 16.35           C  
ATOM   5698  O   ILE C  44     125.902 140.374 112.812  1.00 16.35           O  
ATOM   5699  CB  ILE C  44     123.784 139.955 115.040  1.00 16.35           C  
ATOM   5700  CG1 ILE C  44     122.521 140.236 115.846  1.00 16.35           C  
ATOM   5701  CG2 ILE C  44     124.876 139.398 115.923  1.00 16.35           C  
ATOM   5702  CD1 ILE C  44     122.045 139.059 116.649  1.00 16.35           C  
ATOM   5703  N   ALA C  45     126.637 141.701 114.480  1.00 19.54           N  
ATOM   5704  CA  ALA C  45     128.031 141.576 114.076  1.00 19.54           C  
ATOM   5705  C   ALA C  45     128.734 140.459 114.834  1.00 19.54           C  
ATOM   5706  O   ALA C  45     129.469 139.667 114.237  1.00 19.54           O  
ATOM   5707  CB  ALA C  45     128.763 142.900 114.285  1.00 19.54           C  
ATOM   5708  N   SER C  46     128.535 140.391 116.148  1.00 24.62           N  
ATOM   5709  CA  SER C  46     129.210 139.395 116.969  1.00 24.62           C  
ATOM   5710  C   SER C  46     128.626 139.423 118.370  1.00 24.62           C  
ATOM   5711  O   SER C  46     128.206 140.475 118.856  1.00 24.62           O  
ATOM   5712  CB  SER C  46     130.717 139.651 117.036  1.00 24.62           C  
ATOM   5713  OG  SER C  46     130.981 140.869 117.704  1.00 24.62           O  
ATOM   5714  N   ILE C  47     128.622 138.263 119.014  1.00 21.88           N  
ATOM   5715  CA  ILE C  47     128.258 138.135 120.418  1.00 21.88           C  
ATOM   5716  C   ILE C  47     129.563 137.963 121.182  1.00 21.88           C  
ATOM   5717  O   ILE C  47     130.140 136.872 121.204  1.00 21.88           O  
ATOM   5718  CB  ILE C  47     127.303 136.964 120.661  1.00 21.88           C  
ATOM   5719  CG1 ILE C  47     126.062 137.112 119.789  1.00 21.88           C  
ATOM   5720  CG2 ILE C  47     126.915 136.899 122.114  1.00 21.88           C  
ATOM   5721  CD1 ILE C  47     125.064 136.008 119.978  1.00 21.88           C  
ATOM   5722  N   ASP C  48     130.034 139.041 121.808  1.00 35.96           N  
ATOM   5723  CA  ASP C  48     131.378 139.047 122.375  1.00 35.96           C  
ATOM   5724  C   ASP C  48     131.527 137.996 123.468  1.00 35.96           C  
ATOM   5725  O   ASP C  48     132.343 137.076 123.354  1.00 35.96           O  
ATOM   5726  CB  ASP C  48     131.715 140.439 122.912  1.00 35.96           C  
ATOM   5727  CG  ASP C  48     131.838 141.478 121.813  1.00 35.96           C  
ATOM   5728  OD1 ASP C  48     132.175 141.103 120.670  1.00 35.96           O  
ATOM   5729  OD2 ASP C  48     131.600 142.671 122.093  1.00 35.96           O  
ATOM   5730  N   MET C  49     130.739 138.108 124.532  1.00 38.34           N  
ATOM   5731  CA  MET C  49     130.927 137.207 125.658  1.00 38.34           C  
ATOM   5732  C   MET C  49     129.592 136.943 126.332  1.00 38.34           C  
ATOM   5733  O   MET C  49     128.721 137.817 126.390  1.00 38.34           O  
ATOM   5734  CB  MET C  49     131.935 137.772 126.664  1.00 38.34           C  
ATOM   5735  CG  MET C  49     131.498 139.058 127.335  1.00 38.34           C  
ATOM   5736  SD  MET C  49     132.808 139.801 128.323  1.00 38.34           S  
ATOM   5737  CE  MET C  49     133.266 138.424 129.370  1.00 38.34           C  
ATOM   5738  N   VAL C  50     129.454 135.724 126.844  1.00 35.47           N  
ATOM   5739  CA  VAL C  50     128.242 135.255 127.502  1.00 35.47           C  
ATOM   5740  C   VAL C  50     128.651 134.769 128.883  1.00 35.47           C  
ATOM   5741  O   VAL C  50     129.202 133.670 129.019  1.00 35.47           O  
ATOM   5742  CB  VAL C  50     127.549 134.138 126.713  1.00 35.47           C  
ATOM   5743  CG1 VAL C  50     126.291 133.702 127.419  1.00 35.47           C  
ATOM   5744  CG2 VAL C  50     127.233 134.605 125.310  1.00 35.47           C  
ATOM   5745  N   SER C  51     128.381 135.575 129.903  1.00 42.11           N  
ATOM   5746  CA  SER C  51     128.857 135.328 131.255  1.00 42.11           C  
ATOM   5747  C   SER C  51     127.721 134.801 132.119  1.00 42.11           C  
ATOM   5748  O   SER C  51     126.622 135.373 132.126  1.00 42.11           O  
ATOM   5749  CB  SER C  51     129.433 136.609 131.861  1.00 42.11           C  
ATOM   5750  OG  SER C  51     129.816 136.411 133.208  1.00 42.11           O  
ATOM   5751  N   GLU C  52     127.993 133.710 132.844  1.00 47.76           N  
ATOM   5752  CA  GLU C  52     127.014 133.151 133.769  1.00 47.76           C  
ATOM   5753  C   GLU C  52     127.100 133.810 135.140  1.00 47.76           C  
ATOM   5754  O   GLU C  52     126.108 133.839 135.876  1.00 47.76           O  
ATOM   5755  CB  GLU C  52     127.206 131.641 133.909  1.00 47.76           C  
ATOM   5756  CG  GLU C  52     127.297 130.883 132.605  1.00 47.76           C  
ATOM   5757  CD  GLU C  52     128.716 130.470 132.284  1.00 47.76           C  
ATOM   5758  OE1 GLU C  52     129.644 130.995 132.932  1.00 47.76           O  
ATOM   5759  OE2 GLU C  52     128.905 129.616 131.392  1.00 47.76           O  
ATOM   5760  N   VAL C  53     128.275 134.326 135.506  1.00 39.01           N  
ATOM   5761  CA  VAL C  53     128.431 134.978 136.805  1.00 39.01           C  
ATOM   5762  C   VAL C  53     127.455 136.140 136.937  1.00 39.01           C  
ATOM   5763  O   VAL C  53     126.733 136.257 137.934  1.00 39.01           O  
ATOM   5764  CB  VAL C  53     129.884 135.441 137.004  1.00 39.01           C  
ATOM   5765  CG1 VAL C  53     130.045 136.098 138.365  1.00 39.01           C  
ATOM   5766  CG2 VAL C  53     130.839 134.270 136.857  1.00 39.01           C  
ATOM   5767  N   ASN C  54     127.422 137.019 135.937  1.00 34.63           N  
ATOM   5768  CA  ASN C  54     126.460 138.114 135.916  1.00 34.63           C  
ATOM   5769  C   ASN C  54     125.205 137.778 135.128  1.00 34.63           C  
ATOM   5770  O   ASN C  54     124.221 138.522 135.211  1.00 34.63           O  
ATOM   5771  CB  ASN C  54     127.094 139.370 135.318  1.00 34.63           C  
ATOM   5772  CG  ASN C  54     128.386 139.750 135.999  1.00 34.63           C  
ATOM   5773  OD1 ASN C  54     128.498 139.688 137.221  1.00 34.63           O  
ATOM   5774  ND2 ASN C  54     129.374 140.144 135.208  1.00 34.63           N  
ATOM   5775  N   MET C  55     125.226 136.686 134.364  1.00 41.48           N  
ATOM   5776  CA  MET C  55     124.114 136.291 133.505  1.00 41.48           C  
ATOM   5777  C   MET C  55     123.797 137.383 132.485  1.00 41.48           C  
ATOM   5778  O   MET C  55     122.706 137.954 132.469  1.00 41.48           O  
ATOM   5779  CB  MET C  55     122.878 135.929 134.330  1.00 41.48           C  
ATOM   5780  CG  MET C  55     123.056 134.693 135.187  1.00 41.48           C  
ATOM   5781  SD  MET C  55     121.574 134.275 136.119  1.00 41.48           S  
ATOM   5782  CE  MET C  55     122.111 132.792 136.964  1.00 41.48           C  
ATOM   5783  N   ASP C  56     124.771 137.672 131.625  1.00 34.10           N  
ATOM   5784  CA  ASP C  56     124.603 138.709 130.617  1.00 34.10           C  
ATOM   5785  C   ASP C  56     125.402 138.351 129.375  1.00 34.10           C  
ATOM   5786  O   ASP C  56     126.415 137.654 129.443  1.00 34.10           O  
ATOM   5787  CB  ASP C  56     125.046 140.078 131.140  1.00 34.10           C  
ATOM   5788  CG  ASP C  56     126.482 140.076 131.607  1.00 34.10           C  
ATOM   5789  OD1 ASP C  56     126.942 139.018 132.082  1.00 34.10           O  
ATOM   5790  OD2 ASP C  56     127.152 141.125 131.498  1.00 34.10           O  
ATOM   5791  N   TYR C  57     124.960 138.871 128.235  1.00 24.09           N  
ATOM   5792  CA  TYR C  57     125.594 138.562 126.958  1.00 24.09           C  
ATOM   5793  C   TYR C  57     125.789 139.845 126.163  1.00 24.09           C  
ATOM   5794  O   TYR C  57     124.816 140.491 125.765  1.00 24.09           O  
ATOM   5795  CB  TYR C  57     124.774 137.537 126.173  1.00 24.09           C  
ATOM   5796  CG  TYR C  57     123.479 138.052 125.606  1.00 24.09           C  
ATOM   5797  CD1 TYR C  57     122.455 138.469 126.434  1.00 24.09           C  
ATOM   5798  CD2 TYR C  57     123.281 138.122 124.240  1.00 24.09           C  
ATOM   5799  CE1 TYR C  57     121.273 138.939 125.919  1.00 24.09           C  
ATOM   5800  CE2 TYR C  57     122.103 138.589 123.715  1.00 24.09           C  
ATOM   5801  CZ  TYR C  57     121.101 138.999 124.558  1.00 24.09           C  
ATOM   5802  OH  TYR C  57     119.917 139.468 124.042  1.00 24.09           O  
ATOM   5803  N   THR C  58     127.046 140.216 125.940  1.00 24.93           N  
ATOM   5804  CA  THR C  58     127.344 141.414 125.167  1.00 24.93           C  
ATOM   5805  C   THR C  58     127.145 141.143 123.683  1.00 24.93           C  
ATOM   5806  O   THR C  58     127.493 140.068 123.191  1.00 24.93           O  
ATOM   5807  CB  THR C  58     128.781 141.861 125.433  1.00 24.93           C  
ATOM   5808  OG1 THR C  58     128.901 142.300 126.790  1.00 24.93           O  
ATOM   5809  CG2 THR C  58     129.186 142.986 124.504  1.00 24.93           C  
ATOM   5810  N   LEU C  59     126.580 142.113 122.962  1.00 18.62           N  
ATOM   5811  CA  LEU C  59     126.400 141.931 121.528  1.00 18.62           C  
ATOM   5812  C   LEU C  59     126.467 143.267 120.806  1.00 18.62           C  
ATOM   5813  O   LEU C  59     126.034 144.290 121.334  1.00 18.62           O  
ATOM   5814  CB  LEU C  59     125.077 141.229 121.224  1.00 18.62           C  
ATOM   5815  CG  LEU C  59     123.838 142.098 121.070  1.00 18.62           C  
ATOM   5816  CD1 LEU C  59     123.516 142.250 119.607  1.00 18.62           C  
ATOM   5817  CD2 LEU C  59     122.681 141.474 121.802  1.00 18.62           C  
ATOM   5818  N   THR C  60     127.005 143.243 119.591  1.00 23.56           N  
ATOM   5819  CA  THR C  60     127.177 144.426 118.759  1.00 23.56           C  
ATOM   5820  C   THR C  60     126.301 144.305 117.520  1.00 23.56           C  
ATOM   5821  O   THR C  60     126.219 143.233 116.916  1.00 23.56           O  
ATOM   5822  CB  THR C  60     128.644 144.582 118.357  1.00 23.56           C  
ATOM   5823  OG1 THR C  60     129.430 144.859 119.521  1.00 23.56           O  
ATOM   5824  CG2 THR C  60     128.817 145.702 117.360  1.00 23.56           C  
ATOM   5825  N   MET C  61     125.647 145.396 117.130  1.00 39.51           N  
ATOM   5826  CA  MET C  61     124.667 145.290 116.064  1.00 39.51           C  
ATOM   5827  C   MET C  61     124.563 146.586 115.278  1.00 39.51           C  
ATOM   5828  O   MET C  61     124.766 147.677 115.814  1.00 39.51           O  
ATOM   5829  CB  MET C  61     123.294 144.924 116.622  1.00 39.51           C  
ATOM   5830  CG  MET C  61     122.834 145.846 117.716  1.00 39.51           C  
ATOM   5831  SD  MET C  61     121.048 145.867 117.899  1.00 39.51           S  
ATOM   5832  CE  MET C  61     120.767 144.227 118.536  1.00 39.51           C  
ATOM   5833  N   TYR C  62     124.243 146.450 113.993  1.00 22.47           N  
ATOM   5834  CA  TYR C  62     123.810 147.571 113.173  1.00 22.47           C  
ATOM   5835  C   TYR C  62     122.290 147.603 113.209  1.00 22.47           C  
ATOM   5836  O   TYR C  62     121.635 146.626 112.834  1.00 22.47           O  
ATOM   5837  CB  TYR C  62     124.301 147.441 111.733  1.00 22.47           C  
ATOM   5838  CG  TYR C  62     125.786 147.219 111.575  1.00 22.47           C  
ATOM   5839  CD1 TYR C  62     126.684 147.653 112.532  1.00 22.47           C  
ATOM   5840  CD2 TYR C  62     126.287 146.577 110.458  1.00 22.47           C  
ATOM   5841  CE1 TYR C  62     128.036 147.449 112.381  1.00 22.47           C  
ATOM   5842  CE2 TYR C  62     127.634 146.370 110.299  1.00 22.47           C  
ATOM   5843  CZ  TYR C  62     128.502 146.805 111.264  1.00 22.47           C  
ATOM   5844  OH  TYR C  62     129.847 146.599 111.109  1.00 22.47           O  
ATOM   5845  N   PHE C  63     121.733 148.718 113.655  1.00 17.84           N  
ATOM   5846  CA  PHE C  63     120.313 148.836 113.953  1.00 17.84           C  
ATOM   5847  C   PHE C  63     119.723 149.898 113.040  1.00 17.84           C  
ATOM   5848  O   PHE C  63     120.124 151.061 113.105  1.00 17.84           O  
ATOM   5849  CB  PHE C  63     120.127 149.202 115.423  1.00 17.84           C  
ATOM   5850  CG  PHE C  63     118.714 149.172 115.891  1.00 17.84           C  
ATOM   5851  CD1 PHE C  63     118.143 147.995 116.322  1.00 17.84           C  
ATOM   5852  CD2 PHE C  63     117.967 150.329 115.943  1.00 17.84           C  
ATOM   5853  CE1 PHE C  63     116.848 147.969 116.767  1.00 17.84           C  
ATOM   5854  CE2 PHE C  63     116.675 150.307 116.391  1.00 17.84           C  
ATOM   5855  CZ  PHE C  63     116.116 149.126 116.804  1.00 17.84           C  
ATOM   5856  N   GLN C  64     118.778 149.505 112.192  1.00 17.82           N  
ATOM   5857  CA  GLN C  64     118.283 150.379 111.138  1.00 17.82           C  
ATOM   5858  C   GLN C  64     116.771 150.492 111.217  1.00 17.82           C  
ATOM   5859  O   GLN C  64     116.076 149.478 111.319  1.00 17.82           O  
ATOM   5860  CB  GLN C  64     118.697 149.854 109.766  1.00 17.82           C  
ATOM   5861  CG  GLN C  64     120.187 149.658 109.619  1.00 17.82           C  
ATOM   5862  CD  GLN C  64     120.554 148.995 108.313  1.00 17.82           C  
ATOM   5863  OE1 GLN C  64     119.699 148.770 107.460  1.00 17.82           O  
ATOM   5864  NE2 GLN C  64     121.831 148.674 108.150  1.00 17.82           N  
ATOM   5865  N   GLN C  65     116.267 151.721 111.151  1.00 17.30           N  
ATOM   5866  CA  GLN C  65     114.841 151.998 111.223  1.00 17.30           C  
ATOM   5867  C   GLN C  65     114.441 152.826 110.015  1.00 17.30           C  
ATOM   5868  O   GLN C  65     115.101 153.818 109.694  1.00 17.30           O  
ATOM   5869  CB  GLN C  65     114.495 152.739 112.513  1.00 17.30           C  
ATOM   5870  CG  GLN C  65     114.926 152.001 113.759  1.00 17.30           C  
ATOM   5871  CD  GLN C  65     114.766 152.827 115.012  1.00 17.30           C  
ATOM   5872  OE1 GLN C  65     115.476 153.810 115.217  1.00 17.30           O  
ATOM   5873  NE2 GLN C  65     113.835 152.426 115.864  1.00 17.30           N  
ATOM   5874  N   ALA C  66     113.367 152.420 109.348  1.00 17.94           N  
ATOM   5875  CA  ALA C  66     112.875 153.106 108.162  1.00 17.94           C  
ATOM   5876  C   ALA C  66     111.433 153.529 108.386  1.00 17.94           C  
ATOM   5877  O   ALA C  66     110.624 152.739 108.883  1.00 17.94           O  
ATOM   5878  CB  ALA C  66     112.975 152.212 106.928  1.00 17.94           C  
ATOM   5879  N   TRP C  67     111.113 154.771 108.029  1.00 39.51           N  
ATOM   5880  CA  TRP C  67     109.742 155.237 108.193  1.00 39.51           C  
ATOM   5881  C   TRP C  67     109.446 156.365 107.220  1.00 39.51           C  
ATOM   5882  O   TRP C  67     110.345 157.102 106.811  1.00 39.51           O  
ATOM   5883  CB  TRP C  67     109.469 155.703 109.626  1.00 39.51           C  
ATOM   5884  CG  TRP C  67     110.052 157.027 109.962  1.00 39.51           C  
ATOM   5885  CD1 TRP C  67     109.480 158.244 109.764  1.00 39.51           C  
ATOM   5886  CD2 TRP C  67     111.317 157.273 110.574  1.00 39.51           C  
ATOM   5887  NE1 TRP C  67     110.314 159.236 110.206  1.00 39.51           N  
ATOM   5888  CE2 TRP C  67     111.450 158.663 110.710  1.00 39.51           C  
ATOM   5889  CE3 TRP C  67     112.352 156.452 111.021  1.00 39.51           C  
ATOM   5890  CZ2 TRP C  67     112.572 159.251 111.267  1.00 39.51           C  
ATOM   5891  CZ3 TRP C  67     113.466 157.038 111.571  1.00 39.51           C  
ATOM   5892  CH2 TRP C  67     113.568 158.422 111.691  1.00 39.51           C  
ATOM   5893  N   ARG C  68     108.170 156.511 106.873  1.00 29.46           N  
ATOM   5894  CA  ARG C  68     107.745 157.515 105.906  1.00 29.46           C  
ATOM   5895  C   ARG C  68     107.361 158.795 106.634  1.00 29.46           C  
ATOM   5896  O   ARG C  68     106.446 158.793 107.462  1.00 29.46           O  
ATOM   5897  CB  ARG C  68     106.573 157.012 105.067  1.00 29.46           C  
ATOM   5898  CG  ARG C  68     106.141 157.996 103.992  1.00 29.46           C  
ATOM   5899  CD  ARG C  68     105.130 157.395 103.035  1.00 29.46           C  
ATOM   5900  NE  ARG C  68     104.916 158.258 101.877  1.00 29.46           N  
ATOM   5901  CZ  ARG C  68     104.024 159.242 101.832  1.00 29.46           C  
ATOM   5902  NH1 ARG C  68     103.255 159.490 102.881  1.00 29.46           N  
ATOM   5903  NH2 ARG C  68     103.899 159.978 100.737  1.00 29.46           N  
ATOM   5904  N   ASP C  69     108.056 159.883 106.318  1.00 30.15           N  
ATOM   5905  CA  ASP C  69     107.803 161.193 106.904  1.00 30.15           C  
ATOM   5906  C   ASP C  69     107.404 162.141 105.784  1.00 30.15           C  
ATOM   5907  O   ASP C  69     108.189 162.375 104.861  1.00 30.15           O  
ATOM   5908  CB  ASP C  69     109.039 161.704 107.643  1.00 30.15           C  
ATOM   5909  CG  ASP C  69     108.736 162.879 108.540  1.00 30.15           C  
ATOM   5910  OD1 ASP C  69     107.572 163.321 108.564  1.00 30.15           O  
ATOM   5911  OD2 ASP C  69     109.662 163.363 109.223  1.00 30.15           O  
ATOM   5912  N   LYS C  70     106.189 162.684 105.864  1.00 24.28           N  
ATOM   5913  CA  LYS C  70     105.662 163.465 104.750  1.00 24.28           C  
ATOM   5914  C   LYS C  70     106.318 164.835 104.657  1.00 24.28           C  
ATOM   5915  O   LYS C  70     106.514 165.358 103.555  1.00 24.28           O  
ATOM   5916  CB  LYS C  70     104.149 163.608 104.877  1.00 24.28           C  
ATOM   5917  CG  LYS C  70     103.403 162.294 104.788  1.00 24.28           C  
ATOM   5918  CD  LYS C  70     101.913 162.494 104.988  1.00 24.28           C  
ATOM   5919  CE  LYS C  70     101.169 161.169 104.973  1.00 24.28           C  
ATOM   5920  NZ  LYS C  70      99.706 161.353 105.181  1.00 24.28           N  
ATOM   5921  N   ARG C  71     106.662 165.436 105.797  1.00 22.72           N  
ATOM   5922  CA  ARG C  71     107.193 166.794 105.771  1.00 22.72           C  
ATOM   5923  C   ARG C  71     108.547 166.858 105.077  1.00 22.72           C  
ATOM   5924  O   ARG C  71     108.965 167.932 104.635  1.00 22.72           O  
ATOM   5925  CB  ARG C  71     107.289 167.345 107.192  1.00 22.72           C  
ATOM   5926  CG  ARG C  71     105.967 167.340 107.935  1.00 22.72           C  
ATOM   5927  CD  ARG C  71     106.085 168.043 109.270  1.00 22.72           C  
ATOM   5928  NE  ARG C  71     107.164 167.480 110.069  1.00 22.72           N  
ATOM   5929  CZ  ARG C  71     107.014 166.467 110.910  1.00 22.72           C  
ATOM   5930  NH1 ARG C  71     105.825 165.908 111.065  1.00 22.72           N  
ATOM   5931  NH2 ARG C  71     108.050 166.010 111.595  1.00 22.72           N  
ATOM   5932  N   LEU C  72     109.249 165.732 104.985  1.00 27.26           N  
ATOM   5933  CA  LEU C  72     110.524 165.667 104.272  1.00 27.26           C  
ATOM   5934  C   LEU C  72     110.301 165.077 102.880  1.00 27.26           C  
ATOM   5935  O   LEU C  72     110.702 163.956 102.566  1.00 27.26           O  
ATOM   5936  CB  LEU C  72     111.535 164.850 105.063  1.00 27.26           C  
ATOM   5937  CG  LEU C  72     111.845 165.358 106.466  1.00 27.26           C  
ATOM   5938  CD1 LEU C  72     112.810 164.425 107.166  1.00 27.26           C  
ATOM   5939  CD2 LEU C  72     112.413 166.756 106.390  1.00 27.26           C  
ATOM   5940  N   SER C  73     109.647 165.866 102.033  1.00 31.17           N  
ATOM   5941  CA  SER C  73     109.319 165.443 100.677  1.00 31.17           C  
ATOM   5942  C   SER C  73     109.840 166.480  99.698  1.00 31.17           C  
ATOM   5943  O   SER C  73     109.435 167.645  99.752  1.00 31.17           O  
ATOM   5944  CB  SER C  73     107.811 165.252 100.510  1.00 31.17           C  
ATOM   5945  OG  SER C  73     107.511 164.719  99.235  1.00 31.17           O  
ATOM   5946  N   TYR C  74     110.730 166.058  98.805  1.00 37.11           N  
ATOM   5947  CA  TYR C  74     111.349 166.939  97.826  1.00 37.11           C  
ATOM   5948  C   TYR C  74     111.276 166.285  96.456  1.00 37.11           C  
ATOM   5949  O   TYR C  74     111.307 165.056  96.348  1.00 37.11           O  
ATOM   5950  CB  TYR C  74     112.803 167.235  98.191  1.00 37.11           C  
ATOM   5951  CG  TYR C  74     113.719 166.054  98.002  1.00 37.11           C  
ATOM   5952  CD1 TYR C  74     113.743 165.018  98.917  1.00 37.11           C  
ATOM   5953  CD2 TYR C  74     114.560 165.975  96.907  1.00 37.11           C  
ATOM   5954  CE1 TYR C  74     114.577 163.939  98.743  1.00 37.11           C  
ATOM   5955  CE2 TYR C  74     115.397 164.899  96.728  1.00 37.11           C  
ATOM   5956  CZ  TYR C  74     115.399 163.885  97.647  1.00 37.11           C  
ATOM   5957  OH  TYR C  74     116.232 162.809  97.470  1.00 37.11           O  
ATOM   5958  N   ASN C  75     111.180 167.106  95.410  1.00 50.56           N  
ATOM   5959  CA  ASN C  75     110.975 166.604  94.059  1.00 50.56           C  
ATOM   5960  C   ASN C  75     111.934 167.167  93.021  1.00 50.56           C  
ATOM   5961  O   ASN C  75     111.848 166.769  91.854  1.00 50.56           O  
ATOM   5962  CB  ASN C  75     109.538 166.892  93.601  1.00 50.56           C  
ATOM   5963  CG  ASN C  75     108.504 166.303  94.536  1.00 50.56           C  
ATOM   5964  OD1 ASN C  75     108.706 165.229  95.103  1.00 50.56           O  
ATOM   5965  ND2 ASN C  75     107.390 167.004  94.705  1.00 50.56           N  
ATOM   5966  N   VAL C  76     112.833 168.076  93.396  1.00 58.07           N  
ATOM   5967  CA  VAL C  76     113.688 168.716  92.403  1.00 58.07           C  
ATOM   5968  C   VAL C  76     114.890 167.842  92.066  1.00 58.07           C  
ATOM   5969  O   VAL C  76     115.320 167.779  90.910  1.00 58.07           O  
ATOM   5970  CB  VAL C  76     114.120 170.107  92.896  1.00 58.07           C  
ATOM   5971  CG1 VAL C  76     114.842 170.859  91.792  1.00 58.07           C  
ATOM   5972  CG2 VAL C  76     112.913 170.890  93.380  1.00 58.07           C  
ATOM   5973  N   ILE C  77     115.451 167.161  93.053  1.00 53.83           N  
ATOM   5974  CA  ILE C  77     116.666 166.369  92.879  1.00 53.83           C  
ATOM   5975  C   ILE C  77     116.277 164.898  92.798  1.00 53.83           C  
ATOM   5976  O   ILE C  77     115.569 164.410  93.688  1.00 53.83           O  
ATOM   5977  CB  ILE C  77     117.664 166.603  94.027  1.00 53.83           C  
ATOM   5978  CG1 ILE C  77     118.033 168.083  94.126  1.00 53.83           C  
ATOM   5979  CG2 ILE C  77     118.906 165.753  93.832  1.00 53.83           C  
ATOM   5980  CD1 ILE C  77     117.200 168.862  95.119  1.00 53.83           C  
ATOM   5981  N   PRO C  78     116.701 164.167  91.763  1.00 55.00           N  
ATOM   5982  CA  PRO C  78     116.399 162.730  91.711  1.00 55.00           C  
ATOM   5983  C   PRO C  78     117.292 161.877  92.595  1.00 55.00           C  
ATOM   5984  O   PRO C  78     116.965 160.705  92.823  1.00 55.00           O  
ATOM   5985  CB  PRO C  78     116.606 162.386  90.232  1.00 55.00           C  
ATOM   5986  CG  PRO C  78     117.629 163.369  89.774  1.00 55.00           C  
ATOM   5987  CD  PRO C  78     117.356 164.642  90.533  1.00 55.00           C  
ATOM   5988  N   LEU C  79     118.407 162.415  93.082  1.00 47.37           N  
ATOM   5989  CA  LEU C  79     119.336 161.629  93.882  1.00 47.37           C  
ATOM   5990  C   LEU C  79     118.721 161.240  95.220  1.00 47.37           C  
ATOM   5991  O   LEU C  79     117.790 161.878  95.714  1.00 47.37           O  
ATOM   5992  CB  LEU C  79     120.624 162.414  94.121  1.00 47.37           C  
ATOM   5993  CG  LEU C  79     121.484 162.674  92.889  1.00 47.37           C  
ATOM   5994  CD1 LEU C  79     122.713 163.477  93.266  1.00 47.37           C  
ATOM   5995  CD2 LEU C  79     121.876 161.357  92.247  1.00 47.37           C  
ATOM   5996  N   ASN C  80     119.254 160.171  95.803  1.00 39.39           N  
ATOM   5997  CA  ASN C  80     118.944 159.810  97.180  1.00 39.39           C  
ATOM   5998  C   ASN C  80     119.911 160.550  98.093  1.00 39.39           C  
ATOM   5999  O   ASN C  80     121.079 160.167  98.210  1.00 39.39           O  
ATOM   6000  CB  ASN C  80     119.048 158.303  97.380  1.00 39.39           C  
ATOM   6001  CG  ASN C  80     118.033 157.540  96.568  1.00 39.39           C  
ATOM   6002  OD1 ASN C  80     117.176 158.132  95.915  1.00 39.39           O  
ATOM   6003  ND2 ASN C  80     118.116 156.218  96.606  1.00 39.39           N  
ATOM   6004  N   LEU C  81     119.433 161.609  98.735  1.00 25.38           N  
ATOM   6005  CA  LEU C  81     120.298 162.425  99.572  1.00 25.38           C  
ATOM   6006  C   LEU C  81     120.833 161.619 100.746  1.00 25.38           C  
ATOM   6007  O   LEU C  81     120.120 160.810 101.347  1.00 25.38           O  
ATOM   6008  CB  LEU C  81     119.542 163.646 100.082  1.00 25.38           C  
ATOM   6009  CG  LEU C  81     119.060 164.590  98.988  1.00 25.38           C  
ATOM   6010  CD1 LEU C  81     118.248 165.722  99.577  1.00 25.38           C  
ATOM   6011  CD2 LEU C  81     120.251 165.123  98.229  1.00 25.38           C  
ATOM   6012  N   THR C  82     122.104 161.844 101.069  1.00 19.22           N  
ATOM   6013  CA  THR C  82     122.764 161.206 102.204  1.00 19.22           C  
ATOM   6014  C   THR C  82     123.430 162.311 103.012  1.00 19.22           C  
ATOM   6015  O   THR C  82     124.608 162.613 102.812  1.00 19.22           O  
ATOM   6016  CB  THR C  82     123.765 160.168 101.744  1.00 19.22           C  
ATOM   6017  OG1 THR C  82     123.164 159.346 100.738  1.00 19.22           O  
ATOM   6018  CG2 THR C  82     124.168 159.300 102.906  1.00 19.22           C  
ATOM   6019  N   LEU C  83     122.676 162.906 103.928  1.00 17.87           N  
ATOM   6020  CA  LEU C  83     123.171 164.037 104.688  1.00 17.87           C  
ATOM   6021  C   LEU C  83     124.207 163.584 105.713  1.00 17.87           C  
ATOM   6022  O   LEU C  83     124.357 162.396 106.007  1.00 17.87           O  
ATOM   6023  CB  LEU C  83     122.019 164.749 105.387  1.00 17.87           C  
ATOM   6024  CG  LEU C  83     120.791 165.012 104.524  1.00 17.87           C  
ATOM   6025  CD1 LEU C  83     119.717 165.706 105.338  1.00 17.87           C  
ATOM   6026  CD2 LEU C  83     121.166 165.843 103.317  1.00 17.87           C  
ATOM   6027  N   ASP C  84     124.927 164.556 106.262  1.00 22.42           N  
ATOM   6028  CA  ASP C  84     125.875 164.273 107.325  1.00 22.42           C  
ATOM   6029  C   ASP C  84     125.133 163.787 108.566  1.00 22.42           C  
ATOM   6030  O   ASP C  84     123.915 163.924 108.685  1.00 22.42           O  
ATOM   6031  CB  ASP C  84     126.697 165.519 107.650  1.00 22.42           C  
ATOM   6032  CG  ASP C  84     128.027 165.190 108.293  1.00 22.42           C  
ATOM   6033  OD1 ASP C  84     128.879 164.576 107.621  1.00 22.42           O  
ATOM   6034  OD2 ASP C  84     128.226 165.554 109.470  1.00 22.42           O  
ATOM   6035  N   ASN C  85     125.883 163.205 109.501  1.00 16.27           N  
ATOM   6036  CA  ASN C  85     125.239 162.637 110.680  1.00 16.27           C  
ATOM   6037  C   ASN C  85     124.684 163.715 111.601  1.00 16.27           C  
ATOM   6038  O   ASN C  85     123.717 163.462 112.328  1.00 16.27           O  
ATOM   6039  CB  ASN C  85     126.216 161.745 111.440  1.00 16.27           C  
ATOM   6040  CG  ASN C  85     127.466 162.478 111.855  1.00 16.27           C  
ATOM   6041  OD1 ASN C  85     127.588 163.685 111.662  1.00 16.27           O  
ATOM   6042  ND2 ASN C  85     128.407 161.751 112.433  1.00 16.27           N  
ATOM   6043  N   ARG C  86     125.273 164.914 111.583  1.00 17.97           N  
ATOM   6044  CA  ARG C  86     124.825 165.975 112.481  1.00 17.97           C  
ATOM   6045  C   ARG C  86     123.340 166.258 112.315  1.00 17.97           C  
ATOM   6046  O   ARG C  86     122.636 166.515 113.299  1.00 17.97           O  
ATOM   6047  CB  ARG C  86     125.632 167.249 112.242  1.00 17.97           C  
ATOM   6048  CG  ARG C  86     126.604 167.599 113.355  1.00 17.97           C  
ATOM   6049  CD  ARG C  86     127.912 166.848 113.211  1.00 17.97           C  
ATOM   6050  NE  ARG C  86     128.503 167.049 111.892  1.00 17.97           N  
ATOM   6051  CZ  ARG C  86     129.248 168.095 111.559  1.00 17.97           C  
ATOM   6052  NH1 ARG C  86     129.496 169.045 112.448  1.00 17.97           N  
ATOM   6053  NH2 ARG C  86     129.742 168.193 110.334  1.00 17.97           N  
ATOM   6054  N   VAL C  87     122.837 166.196 111.080  1.00 16.58           N  
ATOM   6055  CA  VAL C  87     121.439 166.494 110.813  1.00 16.58           C  
ATOM   6056  C   VAL C  87     120.496 165.602 111.601  1.00 16.58           C  
ATOM   6057  O   VAL C  87     119.316 165.930 111.736  1.00 16.58           O  
ATOM   6058  CB  VAL C  87     121.135 166.374 109.304  1.00 16.58           C  
ATOM   6059  CG1 VAL C  87     120.875 164.934 108.929  1.00 16.58           C  
ATOM   6060  CG2 VAL C  87     119.952 167.233 108.932  1.00 16.58           C  
ATOM   6061  N   ALA C  88     120.988 164.489 112.145  1.00 17.54           N  
ATOM   6062  CA  ALA C  88     120.135 163.619 112.941  1.00 17.54           C  
ATOM   6063  C   ALA C  88     119.675 164.274 114.232  1.00 17.54           C  
ATOM   6064  O   ALA C  88     118.768 163.748 114.882  1.00 17.54           O  
ATOM   6065  CB  ALA C  88     120.862 162.314 113.258  1.00 17.54           C  
ATOM   6066  N   ASP C  89     120.275 165.395 114.624  1.00 25.97           N  
ATOM   6067  CA  ASP C  89     119.829 166.088 115.824  1.00 25.97           C  
ATOM   6068  C   ASP C  89     118.666 167.032 115.561  1.00 25.97           C  
ATOM   6069  O   ASP C  89     118.121 167.598 116.513  1.00 25.97           O  
ATOM   6070  CB  ASP C  89     120.988 166.865 116.451  1.00 25.97           C  
ATOM   6071  CG  ASP C  89     122.004 165.959 117.119  1.00 25.97           C  
ATOM   6072  OD1 ASP C  89     121.610 164.879 117.608  1.00 25.97           O  
ATOM   6073  OD2 ASP C  89     123.197 166.328 117.158  1.00 25.97           O  
ATOM   6074  N   GLN C  90     118.282 167.229 114.302  1.00 23.95           N  
ATOM   6075  CA  GLN C  90     117.190 168.133 113.961  1.00 23.95           C  
ATOM   6076  C   GLN C  90     115.937 167.410 113.487  1.00 23.95           C  
ATOM   6077  O   GLN C  90     114.827 167.831 113.819  1.00 23.95           O  
ATOM   6078  CB  GLN C  90     117.648 169.126 112.893  1.00 23.95           C  
ATOM   6079  CG  GLN C  90     118.875 169.915 113.300  1.00 23.95           C  
ATOM   6080  CD  GLN C  90     119.355 170.845 112.212  1.00 23.95           C  
ATOM   6081  OE1 GLN C  90     118.574 171.290 111.374  1.00 23.95           O  
ATOM   6082  NE2 GLN C  90     120.648 171.141 112.213  1.00 23.95           N  
ATOM   6083  N   LEU C  91     116.081 166.335 112.719  1.00 18.98           N  
ATOM   6084  CA  LEU C  91     114.923 165.562 112.307  1.00 18.98           C  
ATOM   6085  C   LEU C  91     114.312 164.840 113.503  1.00 18.98           C  
ATOM   6086  O   LEU C  91     114.962 164.621 114.526  1.00 18.98           O  
ATOM   6087  CB  LEU C  91     115.308 164.538 111.243  1.00 18.98           C  
ATOM   6088  CG  LEU C  91     116.091 165.018 110.027  1.00 18.98           C  
ATOM   6089  CD1 LEU C  91     116.258 163.878 109.044  1.00 18.98           C  
ATOM   6090  CD2 LEU C  91     115.404 166.194 109.372  1.00 18.98           C  
ATOM   6091  N   TRP C  92     113.043 164.471 113.369  1.00 18.82           N  
ATOM   6092  CA  TRP C  92     112.428 163.622 114.377  1.00 18.82           C  
ATOM   6093  C   TRP C  92     112.996 162.215 114.278  1.00 18.82           C  
ATOM   6094  O   TRP C  92     113.365 161.755 113.196  1.00 18.82           O  
ATOM   6095  CB  TRP C  92     110.912 163.581 114.210  1.00 18.82           C  
ATOM   6096  CG  TRP C  92     110.248 162.694 115.213  1.00 18.82           C  
ATOM   6097  CD1 TRP C  92     110.078 162.948 116.538  1.00 18.82           C  
ATOM   6098  CD2 TRP C  92     109.670 161.407 114.976  1.00 18.82           C  
ATOM   6099  NE1 TRP C  92     109.429 161.903 117.142  1.00 18.82           N  
ATOM   6100  CE2 TRP C  92     109.169 160.943 116.203  1.00 18.82           C  
ATOM   6101  CE3 TRP C  92     109.528 160.603 113.847  1.00 18.82           C  
ATOM   6102  CZ2 TRP C  92     108.538 159.714 116.333  1.00 18.82           C  
ATOM   6103  CZ3 TRP C  92     108.901 159.384 113.979  1.00 18.82           C  
ATOM   6104  CH2 TRP C  92     108.414 158.951 115.211  1.00 18.82           C  
ATOM   6105  N   VAL C  93     113.077 161.533 115.414  1.00 19.01           N  
ATOM   6106  CA  VAL C  93     113.565 160.158 115.446  1.00 19.01           C  
ATOM   6107  C   VAL C  93     112.790 159.380 116.501  1.00 19.01           C  
ATOM   6108  O   VAL C  93     112.653 159.850 117.638  1.00 19.01           O  
ATOM   6109  CB  VAL C  93     115.073 160.114 115.717  1.00 19.01           C  
ATOM   6110  CG1 VAL C  93     115.836 160.186 114.415  1.00 19.01           C  
ATOM   6111  CG2 VAL C  93     115.471 161.262 116.623  1.00 19.01           C  
ATOM   6112  N   PRO C  94     112.275 158.197 116.180  1.00 17.07           N  
ATOM   6113  CA  PRO C  94     111.457 157.468 117.150  1.00 17.07           C  
ATOM   6114  C   PRO C  94     112.300 156.968 118.308  1.00 17.07           C  
ATOM   6115  O   PRO C  94     113.338 156.333 118.115  1.00 17.07           O  
ATOM   6116  CB  PRO C  94     110.891 156.308 116.330  1.00 17.07           C  
ATOM   6117  CG  PRO C  94     111.915 156.075 115.297  1.00 17.07           C  
ATOM   6118  CD  PRO C  94     112.476 157.422 114.947  1.00 17.07           C  
ATOM   6119  N   ASP C  95     111.844 157.264 119.520  1.00 18.95           N  
ATOM   6120  CA  ASP C  95     112.542 156.823 120.718  1.00 18.95           C  
ATOM   6121  C   ASP C  95     112.285 155.339 120.926  1.00 18.95           C  
ATOM   6122  O   ASP C  95     111.134 154.912 121.044  1.00 18.95           O  
ATOM   6123  CB  ASP C  95     112.093 157.629 121.930  1.00 18.95           C  
ATOM   6124  CG  ASP C  95     110.616 157.911 121.915  1.00 18.95           C  
ATOM   6125  OD1 ASP C  95     109.944 157.464 120.964  1.00 18.95           O  
ATOM   6126  OD2 ASP C  95     110.127 158.585 122.845  1.00 18.95           O  
ATOM   6127  N   THR C  96     113.358 154.558 120.962  1.00 14.26           N  
ATOM   6128  CA  THR C  96     113.275 153.110 121.044  1.00 14.26           C  
ATOM   6129  C   THR C  96     114.316 152.619 122.033  1.00 14.26           C  
ATOM   6130  O   THR C  96     115.516 152.795 121.808  1.00 14.26           O  
ATOM   6131  CB  THR C  96     113.498 152.480 119.675  1.00 14.26           C  
ATOM   6132  OG1 THR C  96     112.388 152.785 118.825  1.00 14.26           O  
ATOM   6133  CG2 THR C  96     113.627 151.001 119.810  1.00 14.26           C  
ATOM   6134  N   TYR C  97     113.864 152.004 123.117  1.00 14.71           N  
ATOM   6135  CA  TYR C  97     114.745 151.551 124.178  1.00 14.71           C  
ATOM   6136  C   TYR C  97     114.648 150.043 124.315  1.00 14.71           C  
ATOM   6137  O   TYR C  97     113.562 149.470 124.208  1.00 14.71           O  
ATOM   6138  CB  TYR C  97     114.385 152.200 125.507  1.00 14.71           C  
ATOM   6139  CG  TYR C  97     113.168 151.587 126.149  1.00 14.71           C  
ATOM   6140  CD1 TYR C  97     111.905 151.831 125.649  1.00 14.71           C  
ATOM   6141  CD2 TYR C  97     113.284 150.752 127.245  1.00 14.71           C  
ATOM   6142  CE1 TYR C  97     110.793 151.271 126.225  1.00 14.71           C  
ATOM   6143  CE2 TYR C  97     112.176 150.186 127.826  1.00 14.71           C  
ATOM   6144  CZ  TYR C  97     110.934 150.450 127.313  1.00 14.71           C  
ATOM   6145  OH  TYR C  97     109.823 149.888 127.888  1.00 14.71           O  
ATOM   6146  N   PHE C  98     115.785 149.401 124.547  1.00 16.09           N  
ATOM   6147  CA  PHE C  98     115.778 147.981 124.863  1.00 16.09           C  
ATOM   6148  C   PHE C  98     115.314 147.789 126.298  1.00 16.09           C  
ATOM   6149  O   PHE C  98     115.627 148.595 127.176  1.00 16.09           O  
ATOM   6150  CB  PHE C  98     117.165 147.387 124.665  1.00 16.09           C  
ATOM   6151  CG  PHE C  98     117.737 147.623 123.301  1.00 16.09           C  
ATOM   6152  CD1 PHE C  98     116.916 147.786 122.206  1.00 16.09           C  
ATOM   6153  CD2 PHE C  98     119.099 147.680 123.116  1.00 16.09           C  
ATOM   6154  CE1 PHE C  98     117.446 148.003 120.959  1.00 16.09           C  
ATOM   6155  CE2 PHE C  98     119.629 147.896 121.872  1.00 16.09           C  
ATOM   6156  CZ  PHE C  98     118.802 148.058 120.793  1.00 16.09           C  
ATOM   6157  N   LEU C  99     114.555 146.722 126.541  1.00 17.10           N  
ATOM   6158  CA  LEU C  99     113.917 146.587 127.845  1.00 17.10           C  
ATOM   6159  C   LEU C  99     114.862 146.014 128.891  1.00 17.10           C  
ATOM   6160  O   LEU C  99     114.877 146.482 130.034  1.00 17.10           O  
ATOM   6161  CB  LEU C  99     112.669 145.715 127.748  1.00 17.10           C  
ATOM   6162  CG  LEU C  99     111.935 145.614 129.085  1.00 17.10           C  
ATOM   6163  CD1 LEU C  99     111.334 146.952 129.445  1.00 17.10           C  
ATOM   6164  CD2 LEU C  99     110.872 144.542 129.055  1.00 17.10           C  
ATOM   6165  N   ASN C 100     115.652 145.005 128.534  1.00 20.69           N  
ATOM   6166  CA  ASN C 100     116.463 144.288 129.509  1.00 20.69           C  
ATOM   6167  C   ASN C 100     117.960 144.495 129.302  1.00 20.69           C  
ATOM   6168  O   ASN C 100     118.738 143.547 129.408  1.00 20.69           O  
ATOM   6169  CB  ASN C 100     116.128 142.800 129.489  1.00 20.69           C  
ATOM   6170  CG  ASN C 100     116.254 142.196 128.112  1.00 20.69           C  
ATOM   6171  OD1 ASN C 100     116.783 142.816 127.197  1.00 20.69           O  
ATOM   6172  ND2 ASN C 100     115.765 140.974 127.960  1.00 20.69           N  
ATOM   6173  N   ASP C 101     118.378 145.714 128.995  1.00 17.97           N  
ATOM   6174  CA  ASP C 101     119.795 146.023 128.909  1.00 17.97           C  
ATOM   6175  C   ASP C 101     120.274 146.635 130.216  1.00 17.97           C  
ATOM   6176  O   ASP C 101     119.497 147.237 130.958  1.00 17.97           O  
ATOM   6177  CB  ASP C 101     120.068 146.977 127.750  1.00 17.97           C  
ATOM   6178  CG  ASP C 101     119.479 148.346 127.977  1.00 17.97           C  
ATOM   6179  OD1 ASP C 101     120.063 149.126 128.754  1.00 17.97           O  
ATOM   6180  OD2 ASP C 101     118.432 148.651 127.373  1.00 17.97           O  
ATOM   6181  N   LYS C 102     121.562 146.466 130.501  1.00 18.24           N  
ATOM   6182  CA  LYS C 102     122.169 147.037 131.695  1.00 18.24           C  
ATOM   6183  C   LYS C 102     123.092 148.205 131.374  1.00 18.24           C  
ATOM   6184  O   LYS C 102     123.142 149.179 132.127  1.00 18.24           O  
ATOM   6185  CB  LYS C 102     122.935 145.955 132.461  1.00 18.24           C  
ATOM   6186  CG  LYS C 102     122.076 144.761 132.823  1.00 18.24           C  
ATOM   6187  CD  LYS C 102     122.909 143.571 133.262  1.00 18.24           C  
ATOM   6188  CE  LYS C 102     123.475 143.768 134.648  1.00 18.24           C  
ATOM   6189  NZ  LYS C 102     124.112 142.521 135.144  1.00 18.24           N  
ATOM   6190  N   LYS C 103     123.828 148.125 130.268  1.00 22.73           N  
ATOM   6191  CA  LYS C 103     124.794 149.160 129.914  1.00 22.73           C  
ATOM   6192  C   LYS C 103     125.071 149.081 128.422  1.00 22.73           C  
ATOM   6193  O   LYS C 103     125.631 148.088 127.952  1.00 22.73           O  
ATOM   6194  CB  LYS C 103     126.081 148.989 130.710  1.00 22.73           C  
ATOM   6195  CG  LYS C 103     127.170 149.970 130.336  1.00 22.73           C  
ATOM   6196  CD  LYS C 103     128.459 149.640 131.058  1.00 22.73           C  
ATOM   6197  CE  LYS C 103     128.239 149.548 132.556  1.00 22.73           C  
ATOM   6198  NZ  LYS C 103     129.479 149.144 133.270  1.00 22.73           N  
ATOM   6199  N   SER C 104     124.684 150.113 127.679  1.00 22.31           N  
ATOM   6200  CA  SER C 104     124.966 150.180 126.253  1.00 22.31           C  
ATOM   6201  C   SER C 104     125.384 151.591 125.876  1.00 22.31           C  
ATOM   6202  O   SER C 104     125.074 152.555 126.580  1.00 22.31           O  
ATOM   6203  CB  SER C 104     123.763 149.767 125.421  1.00 22.31           C  
ATOM   6204  OG  SER C 104     123.124 148.635 125.978  1.00 22.31           O  
ATOM   6205  N   PHE C 105     126.094 151.704 124.757  1.00 21.18           N  
ATOM   6206  CA  PHE C 105     126.616 152.988 124.319  1.00 21.18           C  
ATOM   6207  C   PHE C 105     126.884 152.945 122.825  1.00 21.18           C  
ATOM   6208  O   PHE C 105     127.453 151.971 122.328  1.00 21.18           O  
ATOM   6209  CB  PHE C 105     127.898 153.339 125.078  1.00 21.18           C  
ATOM   6210  CG  PHE C 105     129.048 152.419 124.791  1.00 21.18           C  
ATOM   6211  CD1 PHE C 105     129.103 151.160 125.352  1.00 21.18           C  
ATOM   6212  CD2 PHE C 105     130.082 152.823 123.973  1.00 21.18           C  
ATOM   6213  CE1 PHE C 105     130.161 150.319 125.093  1.00 21.18           C  
ATOM   6214  CE2 PHE C 105     131.141 151.984 123.712  1.00 21.18           C  
ATOM   6215  CZ  PHE C 105     131.179 150.732 124.271  1.00 21.18           C  
ATOM   6216  N   VAL C 106     126.475 153.998 122.117  1.00 39.51           N  
ATOM   6217  CA  VAL C 106     126.760 154.100 120.693  1.00 39.51           C  
ATOM   6218  C   VAL C 106     128.240 154.385 120.489  1.00 39.51           C  
ATOM   6219  O   VAL C 106     128.834 155.209 121.194  1.00 39.51           O  
ATOM   6220  CB  VAL C 106     125.899 155.198 120.054  1.00 39.51           C  
ATOM   6221  CG1 VAL C 106     126.166 155.273 118.576  1.00 39.51           C  
ATOM   6222  CG2 VAL C 106     124.437 154.937 120.323  1.00 39.51           C  
ATOM   6223  N   HIS C 107     128.843 153.711 119.516  1.00 23.83           N  
ATOM   6224  CA  HIS C 107     130.270 153.866 119.273  1.00 23.83           C  
ATOM   6225  C   HIS C 107     130.582 155.251 118.726  1.00 23.83           C  
ATOM   6226  O   HIS C 107     129.888 155.758 117.843  1.00 23.83           O  
ATOM   6227  CB  HIS C 107     130.757 152.805 118.296  1.00 23.83           C  
ATOM   6228  CG  HIS C 107     130.701 151.417 118.840  1.00 23.83           C  
ATOM   6229  ND1 HIS C 107     131.520 150.986 119.859  1.00 23.83           N  
ATOM   6230  CD2 HIS C 107     129.926 150.360 118.507  1.00 23.83           C  
ATOM   6231  CE1 HIS C 107     131.249 149.724 120.132  1.00 23.83           C  
ATOM   6232  NE2 HIS C 107     130.288 149.319 119.325  1.00 23.83           N  
ATOM   6233  N   GLY C 108     131.638 155.860 119.256  1.00 20.34           N  
ATOM   6234  CA  GLY C 108     132.063 157.179 118.829  1.00 20.34           C  
ATOM   6235  C   GLY C 108     133.518 157.233 118.414  1.00 20.34           C  
ATOM   6236  O   GLY C 108     134.227 158.179 118.768  1.00 20.34           O  
ATOM   6237  N   VAL C 109     133.974 156.223 117.669  1.00 21.22           N  
ATOM   6238  CA  VAL C 109     135.398 156.094 117.361  1.00 21.22           C  
ATOM   6239  C   VAL C 109     135.907 157.325 116.629  1.00 21.22           C  
ATOM   6240  O   VAL C 109     136.919 157.920 117.014  1.00 21.22           O  
ATOM   6241  CB  VAL C 109     135.662 154.819 116.547  1.00 21.22           C  
ATOM   6242  CG1 VAL C 109     137.137 154.719 116.222  1.00 21.22           C  
ATOM   6243  CG2 VAL C 109     135.193 153.598 117.311  1.00 21.22           C  
ATOM   6244  N   THR C 110     135.235 157.714 115.557  1.00 18.95           N  
ATOM   6245  CA  THR C 110     135.574 158.950 114.863  1.00 18.95           C  
ATOM   6246  C   THR C 110     134.437 159.953 114.852  1.00 18.95           C  
ATOM   6247  O   THR C 110     134.669 161.142 115.071  1.00 18.95           O  
ATOM   6248  CB  THR C 110     136.003 158.655 113.428  1.00 18.95           C  
ATOM   6249  OG1 THR C 110     135.365 157.456 112.983  1.00 18.95           O  
ATOM   6250  CG2 THR C 110     137.501 158.480 113.358  1.00 18.95           C  
ATOM   6251  N   VAL C 111     133.212 159.505 114.597  1.00 20.17           N  
ATOM   6252  CA  VAL C 111     132.008 160.297 114.802  1.00 20.17           C  
ATOM   6253  C   VAL C 111     130.960 159.374 115.405  1.00 20.17           C  
ATOM   6254  O   VAL C 111     131.125 158.156 115.443  1.00 20.17           O  
ATOM   6255  CB  VAL C 111     131.472 160.918 113.500  1.00 20.17           C  
ATOM   6256  CG1 VAL C 111     132.530 161.778 112.831  1.00 20.17           C  
ATOM   6257  CG2 VAL C 111     130.995 159.822 112.580  1.00 20.17           C  
ATOM   6258  N   LYS C 112     129.871 159.963 115.881  1.00 19.38           N  
ATOM   6259  CA  LYS C 112     128.750 159.143 116.311  1.00 19.38           C  
ATOM   6260  C   LYS C 112     128.213 158.380 115.112  1.00 19.38           C  
ATOM   6261  O   LYS C 112     127.710 158.980 114.158  1.00 19.38           O  
ATOM   6262  CB  LYS C 112     127.663 160.006 116.938  1.00 19.38           C  
ATOM   6263  CG  LYS C 112     128.078 160.647 118.238  1.00 19.38           C  
ATOM   6264  CD  LYS C 112     126.890 161.281 118.925  1.00 19.38           C  
ATOM   6265  CE  LYS C 112     125.875 160.235 119.338  1.00 19.38           C  
ATOM   6266  NZ  LYS C 112     126.446 159.299 120.339  1.00 19.38           N  
ATOM   6267  N   ASN C 113     128.329 157.056 115.155  1.00 18.22           N  
ATOM   6268  CA  ASN C 113     128.050 156.220 113.990  1.00 18.22           C  
ATOM   6269  C   ASN C 113     126.543 156.116 113.765  1.00 18.22           C  
ATOM   6270  O   ASN C 113     125.899 155.111 114.067  1.00 18.22           O  
ATOM   6271  CB  ASN C 113     128.673 154.846 114.168  1.00 18.22           C  
ATOM   6272  CG  ASN C 113     130.143 154.915 114.482  1.00 18.22           C  
ATOM   6273  OD1 ASN C 113     130.606 154.347 115.467  1.00 18.22           O  
ATOM   6274  ND2 ASN C 113     130.890 155.611 113.643  1.00 18.22           N  
ATOM   6275  N   ARG C 114     125.974 157.185 113.219  1.00 18.76           N  
ATOM   6276  CA  ARG C 114     124.598 157.151 112.752  1.00 18.76           C  
ATOM   6277  C   ARG C 114     124.549 157.534 111.283  1.00 18.76           C  
ATOM   6278  O   ARG C 114     125.253 158.445 110.843  1.00 18.76           O  
ATOM   6279  CB  ARG C 114     123.679 158.066 113.571  1.00 18.76           C  
ATOM   6280  CG  ARG C 114     124.096 159.510 113.674  1.00 18.76           C  
ATOM   6281  CD  ARG C 114     124.605 159.797 115.067  1.00 18.76           C  
ATOM   6282  NE  ARG C 114     124.418 161.188 115.461  1.00 18.76           N  
ATOM   6283  CZ  ARG C 114     123.485 161.595 116.311  1.00 18.76           C  
ATOM   6284  NH1 ARG C 114     122.659 160.715 116.852  1.00 18.76           N  
ATOM   6285  NH2 ARG C 114     123.381 162.877 116.624  1.00 18.76           N  
ATOM   6286  N   MET C 115     123.716 156.825 110.532  1.00 22.85           N  
ATOM   6287  CA  MET C 115     123.529 157.054 109.109  1.00 22.85           C  
ATOM   6288  C   MET C 115     122.144 157.630 108.878  1.00 22.85           C  
ATOM   6289  O   MET C 115     121.157 157.085 109.374  1.00 22.85           O  
ATOM   6290  CB  MET C 115     123.686 155.752 108.322  1.00 22.85           C  
ATOM   6291  CG  MET C 115     122.881 155.707 107.035  1.00 22.85           C  
ATOM   6292  SD  MET C 115     123.213 154.261 106.011  1.00 22.85           S  
ATOM   6293  CE  MET C 115     122.876 152.937 107.164  1.00 22.85           C  
ATOM   6294  N   ILE C 116     122.073 158.722 108.127  1.00 15.58           N  
ATOM   6295  CA  ILE C 116     120.808 159.336 107.747  1.00 15.58           C  
ATOM   6296  C   ILE C 116     120.730 159.335 106.231  1.00 15.58           C  
ATOM   6297  O   ILE C 116     121.573 159.943 105.562  1.00 15.58           O  
ATOM   6298  CB  ILE C 116     120.675 160.759 108.299  1.00 15.58           C  
ATOM   6299  CG1 ILE C 116     120.316 160.719 109.779  1.00 15.58           C  
ATOM   6300  CG2 ILE C 116     119.611 161.514 107.542  1.00 15.58           C  
ATOM   6301  CD1 ILE C 116     118.851 160.490 110.029  1.00 15.58           C  
ATOM   6302  N   ARG C 117     119.725 158.656 105.687  1.00 16.52           N  
ATOM   6303  CA  ARG C 117     119.554 158.546 104.242  1.00 16.52           C  
ATOM   6304  C   ARG C 117     118.121 158.923 103.903  1.00 16.52           C  
ATOM   6305  O   ARG C 117     117.181 158.257 104.351  1.00 16.52           O  
ATOM   6306  CB  ARG C 117     119.879 157.135 103.762  1.00 16.52           C  
ATOM   6307  CG  ARG C 117     120.033 157.012 102.265  1.00 16.52           C  
ATOM   6308  CD  ARG C 117     120.381 155.589 101.860  1.00 16.52           C  
ATOM   6309  NE  ARG C 117     121.534 155.077 102.591  1.00 16.52           N  
ATOM   6310  CZ  ARG C 117     122.794 155.308 102.247  1.00 16.52           C  
ATOM   6311  NH1 ARG C 117     123.066 156.051 101.186  1.00 16.52           N  
ATOM   6312  NH2 ARG C 117     123.781 154.802 102.967  1.00 16.52           N  
ATOM   6313  N   LEU C 118     117.947 159.994 103.132  1.00 17.85           N  
ATOM   6314  CA  LEU C 118     116.615 160.433 102.755  1.00 17.85           C  
ATOM   6315  C   LEU C 118     116.179 159.732 101.471  1.00 17.85           C  
ATOM   6316  O   LEU C 118     116.837 158.815 100.977  1.00 17.85           O  
ATOM   6317  CB  LEU C 118     116.575 161.949 102.599  1.00 17.85           C  
ATOM   6318  CG  LEU C 118     116.771 162.744 103.887  1.00 17.85           C  
ATOM   6319  CD1 LEU C 118     116.727 164.229 103.615  1.00 17.85           C  
ATOM   6320  CD2 LEU C 118     115.716 162.373 104.892  1.00 17.85           C  
ATOM   6321  N   HIS C 119     115.044 160.157 100.934  1.00 26.94           N  
ATOM   6322  CA  HIS C 119     114.485 159.574  99.725  1.00 26.94           C  
ATOM   6323  C   HIS C 119     113.574 160.602  99.079  1.00 26.94           C  
ATOM   6324  O   HIS C 119     113.076 161.506  99.759  1.00 26.94           O  
ATOM   6325  CB  HIS C 119     113.712 158.285 100.031  1.00 26.94           C  
ATOM   6326  CG  HIS C 119     114.549 157.047  99.968  1.00 26.94           C  
ATOM   6327  ND1 HIS C 119     115.612 156.823 100.814  1.00 26.94           N  
ATOM   6328  CD2 HIS C 119     114.475 155.963  99.162  1.00 26.94           C  
ATOM   6329  CE1 HIS C 119     116.158 155.654 100.532  1.00 26.94           C  
ATOM   6330  NE2 HIS C 119     115.488 155.112  99.532  1.00 26.94           N  
ATOM   6331  N   PRO C 120     113.328 160.492  97.772  1.00 31.25           N  
ATOM   6332  CA  PRO C 120     112.483 161.497  97.112  1.00 31.25           C  
ATOM   6333  C   PRO C 120     111.051 161.510  97.610  1.00 31.25           C  
ATOM   6334  O   PRO C 120     110.393 162.554  97.538  1.00 31.25           O  
ATOM   6335  CB  PRO C 120     112.562 161.100  95.633  1.00 31.25           C  
ATOM   6336  CG  PRO C 120     112.906 159.656  95.651  1.00 31.25           C  
ATOM   6337  CD  PRO C 120     113.816 159.480  96.822  1.00 31.25           C  
ATOM   6338  N   ASP C 121     110.542 160.389  98.110  1.00 31.78           N  
ATOM   6339  CA  ASP C 121     109.181 160.338  98.624  1.00 31.78           C  
ATOM   6340  C   ASP C 121     109.107 160.504 100.134  1.00 31.78           C  
ATOM   6341  O   ASP C 121     108.002 160.536 100.682  1.00 31.78           O  
ATOM   6342  CB  ASP C 121     108.508 159.023  98.220  1.00 31.78           C  
ATOM   6343  CG  ASP C 121     109.265 157.806  98.705  1.00 31.78           C  
ATOM   6344  OD1 ASP C 121     110.389 157.969  99.222  1.00 31.78           O  
ATOM   6345  OD2 ASP C 121     108.736 156.683  98.570  1.00 31.78           O  
ATOM   6346  N   GLY C 122     110.242 160.604 100.817  1.00 25.48           N  
ATOM   6347  CA  GLY C 122     110.245 160.825 102.247  1.00 25.48           C  
ATOM   6348  C   GLY C 122     110.410 159.592 103.101  1.00 25.48           C  
ATOM   6349  O   GLY C 122     109.981 159.601 104.260  1.00 25.48           O  
ATOM   6350  N   THR C 123     111.016 158.532 102.578  1.00 24.61           N  
ATOM   6351  CA  THR C 123     111.228 157.308 103.348  1.00 24.61           C  
ATOM   6352  C   THR C 123     112.569 157.431 104.055  1.00 24.61           C  
ATOM   6353  O   THR C 123     113.597 156.962 103.570  1.00 24.61           O  
ATOM   6354  CB  THR C 123     111.181 156.085 102.444  1.00 24.61           C  
ATOM   6355  OG1 THR C 123     109.993 156.128 101.648  1.00 24.61           O  
ATOM   6356  CG2 THR C 123     111.175 154.816 103.271  1.00 24.61           C  
ATOM   6357  N   VAL C 124     112.557 158.076 105.219  1.00 18.81           N  
ATOM   6358  CA  VAL C 124     113.789 158.288 105.964  1.00 18.81           C  
ATOM   6359  C   VAL C 124     114.326 156.953 106.459  1.00 18.81           C  
ATOM   6360  O   VAL C 124     113.560 156.071 106.882  1.00 18.81           O  
ATOM   6361  CB  VAL C 124     113.541 159.256 107.132  1.00 18.81           C  
ATOM   6362  CG1 VAL C 124     114.785 159.408 107.974  1.00 18.81           C  
ATOM   6363  CG2 VAL C 124     113.096 160.599 106.610  1.00 18.81           C  
ATOM   6364  N   LEU C 125     115.648 156.793 106.398  1.00 17.91           N  
ATOM   6365  CA  LEU C 125     116.334 155.617 106.914  1.00 17.91           C  
ATOM   6366  C   LEU C 125     117.418 156.067 107.883  1.00 17.91           C  
ATOM   6367  O   LEU C 125     118.240 156.925 107.544  1.00 17.91           O  
ATOM   6368  CB  LEU C 125     116.927 154.796 105.772  1.00 17.91           C  
ATOM   6369  CG  LEU C 125     117.868 153.642 106.100  1.00 17.91           C  
ATOM   6370  CD1 LEU C 125     117.262 152.732 107.133  1.00 17.91           C  
ATOM   6371  CD2 LEU C 125     118.167 152.865 104.838  1.00 17.91           C  
ATOM   6372  N   TYR C 126     117.424 155.479 109.078  1.00 39.51           N  
ATOM   6373  CA  TYR C 126     118.209 155.965 110.204  1.00 39.51           C  
ATOM   6374  C   TYR C 126     118.914 154.789 110.855  1.00 39.51           C  
ATOM   6375  O   TYR C 126     118.268 153.809 111.232  1.00 39.51           O  
ATOM   6376  CB  TYR C 126     117.293 156.681 111.197  1.00 39.51           C  
ATOM   6377  CG  TYR C 126     117.899 157.046 112.526  1.00 39.51           C  
ATOM   6378  CD1 TYR C 126     118.636 158.205 112.679  1.00 39.51           C  
ATOM   6379  CD2 TYR C 126     117.696 156.250 113.639  1.00 39.51           C  
ATOM   6380  CE1 TYR C 126     119.172 158.549 113.895  1.00 39.51           C  
ATOM   6381  CE2 TYR C 126     118.228 156.587 114.860  1.00 39.51           C  
ATOM   6382  CZ  TYR C 126     118.965 157.737 114.982  1.00 39.51           C  
ATOM   6383  OH  TYR C 126     119.503 158.081 116.198  1.00 39.51           O  
ATOM   6384  N   GLY C 127     120.223 154.882 110.993  1.00 32.16           N  
ATOM   6385  CA  GLY C 127     121.031 153.732 111.371  1.00 32.16           C  
ATOM   6386  C   GLY C 127     121.998 154.023 112.496  1.00 32.16           C  
ATOM   6387  O   GLY C 127     122.552 155.116 112.589  1.00 32.16           O  
ATOM   6388  N   LEU C 128     122.212 153.017 113.340  1.00 39.51           N  
ATOM   6389  CA  LEU C 128     123.097 153.116 114.488  1.00 39.51           C  
ATOM   6390  C   LEU C 128     123.977 151.879 114.556  1.00 39.51           C  
ATOM   6391  O   LEU C 128     123.667 150.843 113.968  1.00 39.51           O  
ATOM   6392  CB  LEU C 128     122.309 153.246 115.790  1.00 39.51           C  
ATOM   6393  CG  LEU C 128     121.615 154.573 116.050  1.00 39.51           C  
ATOM   6394  CD1 LEU C 128     120.760 154.459 117.285  1.00 39.51           C  
ATOM   6395  CD2 LEU C 128     122.644 155.659 116.225  1.00 39.51           C  
ATOM   6396  N   ARG C 129     125.076 151.991 115.297  1.00 39.51           N  
ATOM   6397  CA  ARG C 129     125.954 150.861 115.592  1.00 39.51           C  
ATOM   6398  C   ARG C 129     126.060 150.759 117.107  1.00 39.51           C  
ATOM   6399  O   ARG C 129     126.813 151.510 117.730  1.00 39.51           O  
ATOM   6400  CB  ARG C 129     127.319 151.038 114.948  1.00 39.51           C  
ATOM   6401  CG  ARG C 129     128.282 149.918 115.255  1.00 39.51           C  
ATOM   6402  CD  ARG C 129     129.492 149.971 114.344  1.00 39.51           C  
ATOM   6403  NE  ARG C 129     130.358 148.820 114.551  1.00 39.51           N  
ATOM   6404  CZ  ARG C 129     131.393 148.813 115.378  1.00 39.51           C  
ATOM   6405  NH1 ARG C 129     132.124 147.718 115.514  1.00 39.51           N  
ATOM   6406  NH2 ARG C 129     131.698 149.904 116.063  1.00 39.51           N  
ATOM   6407  N   ILE C 130     125.325 149.825 117.699  1.00 39.51           N  
ATOM   6408  CA  ILE C 130     125.114 149.783 119.140  1.00 39.51           C  
ATOM   6409  C   ILE C 130     125.787 148.556 119.729  1.00 39.51           C  
ATOM   6410  O   ILE C 130     125.731 147.466 119.153  1.00 39.51           O  
ATOM   6411  CB  ILE C 130     123.614 149.772 119.472  1.00 39.51           C  
ATOM   6412  CG1 ILE C 130     122.917 150.926 118.773  1.00 39.51           C  
ATOM   6413  CG2 ILE C 130     123.403 149.868 120.954  1.00 39.51           C  
ATOM   6414  CD1 ILE C 130     121.455 151.003 119.078  1.00 39.51           C  
ATOM   6415  N   THR C 131     126.403 148.726 120.890  1.00 20.96           N  
ATOM   6416  CA  THR C 131     126.916 147.611 121.673  1.00 20.96           C  
ATOM   6417  C   THR C 131     126.099 147.520 122.948  1.00 20.96           C  
ATOM   6418  O   THR C 131     126.186 148.401 123.805  1.00 20.96           O  
ATOM   6419  CB  THR C 131     128.394 147.784 122.004  1.00 20.96           C  
ATOM   6420  OG1 THR C 131     129.170 147.638 120.811  1.00 20.96           O  
ATOM   6421  CG2 THR C 131     128.826 146.739 123.017  1.00 20.96           C  
ATOM   6422  N   THR C 132     125.324 146.452 123.076  1.00 22.92           N  
ATOM   6423  CA  THR C 132     124.366 146.292 124.157  1.00 22.92           C  
ATOM   6424  C   THR C 132     124.776 145.132 125.046  1.00 22.92           C  
ATOM   6425  O   THR C 132     125.045 144.031 124.553  1.00 22.92           O  
ATOM   6426  CB  THR C 132     122.966 146.043 123.604  1.00 22.92           C  
ATOM   6427  OG1 THR C 132     122.496 147.230 122.962  1.00 22.92           O  
ATOM   6428  CG2 THR C 132     122.013 145.660 124.717  1.00 22.92           C  
ATOM   6429  N   THR C 133     124.825 145.378 126.347  1.00 20.06           N  
ATOM   6430  CA  THR C 133     125.017 144.319 127.329  1.00 20.06           C  
ATOM   6431  C   THR C 133     123.657 144.029 127.943  1.00 20.06           C  
ATOM   6432  O   THR C 133     123.228 144.703 128.880  1.00 20.06           O  
ATOM   6433  CB  THR C 133     126.035 144.721 128.387  1.00 20.06           C  
ATOM   6434  OG1 THR C 133     127.306 144.940 127.766  1.00 20.06           O  
ATOM   6435  CG2 THR C 133     126.171 143.623 129.419  1.00 20.06           C  
ATOM   6436  N   ALA C 134     122.982 143.022 127.416  1.00 23.49           N  
ATOM   6437  CA  ALA C 134     121.670 142.635 127.905  1.00 23.49           C  
ATOM   6438  C   ALA C 134     121.795 141.461 128.864  1.00 23.49           C  
ATOM   6439  O   ALA C 134     122.792 140.736 128.870  1.00 23.49           O  
ATOM   6440  CB  ALA C 134     120.743 142.274 126.746  1.00 23.49           C  
ATOM   6441  N   ALA C 135     120.773 141.292 129.695  1.00 25.61           N  
ATOM   6442  CA  ALA C 135     120.762 140.269 130.729  1.00 25.61           C  
ATOM   6443  C   ALA C 135     119.614 139.300 130.489  1.00 25.61           C  
ATOM   6444  O   ALA C 135     118.450 139.709 130.454  1.00 25.61           O  
ATOM   6445  CB  ALA C 135     120.638 140.900 132.115  1.00 25.61           C  
ATOM   6446  N   CYS C 136     119.942 138.020 130.329  1.00 47.57           N  
ATOM   6447  CA  CYS C 136     118.952 136.965 130.178  1.00 47.57           C  
ATOM   6448  C   CYS C 136     119.092 135.979 131.324  1.00 47.57           C  
ATOM   6449  O   CYS C 136     120.193 135.501 131.611  1.00 47.57           O  
ATOM   6450  CB  CYS C 136     119.099 136.229 128.839  1.00 47.57           C  
ATOM   6451  SG  CYS C 136     120.788 135.801 128.364  1.00 47.57           S  
ATOM   6452  N   MET C 137     117.974 135.686 131.982  1.00 64.29           N  
ATOM   6453  CA  MET C 137     117.979 134.735 133.084  1.00 64.29           C  
ATOM   6454  C   MET C 137     118.357 133.347 132.589  1.00 64.29           C  
ATOM   6455  O   MET C 137     117.782 132.842 131.621  1.00 64.29           O  
ATOM   6456  CB  MET C 137     116.614 134.699 133.762  1.00 64.29           C  
ATOM   6457  CG  MET C 137     116.421 135.813 134.753  1.00 64.29           C  
ATOM   6458  SD  MET C 137     117.838 135.904 135.856  1.00 64.29           S  
ATOM   6459  CE  MET C 137     117.769 134.290 136.625  1.00 64.29           C  
ATOM   6460  N   MET C 138     119.320 132.727 133.261  1.00 62.08           N  
ATOM   6461  CA  MET C 138     119.837 131.428 132.867  1.00 62.08           C  
ATOM   6462  C   MET C 138     119.530 130.405 133.946  1.00 62.08           C  
ATOM   6463  O   MET C 138     119.687 130.686 135.139  1.00 62.08           O  
ATOM   6464  CB  MET C 138     121.341 131.492 132.611  1.00 62.08           C  
ATOM   6465  CG  MET C 138     121.703 132.260 131.362  1.00 62.08           C  
ATOM   6466  SD  MET C 138     123.333 131.827 130.740  1.00 62.08           S  
ATOM   6467  CE  MET C 138     123.377 132.822 129.257  1.00 62.08           C  
ATOM   6468  N   ASP C 139     119.087 129.225 133.525  1.00 66.14           N  
ATOM   6469  CA  ASP C 139     118.834 128.112 134.428  1.00 66.14           C  
ATOM   6470  C   ASP C 139     120.005 127.145 134.327  1.00 66.14           C  
ATOM   6471  O   ASP C 139     120.309 126.645 133.239  1.00 66.14           O  
ATOM   6472  CB  ASP C 139     117.520 127.414 134.077  1.00 66.14           C  
ATOM   6473  CG  ASP C 139     117.203 126.265 135.011  1.00 66.14           C  
ATOM   6474  OD1 ASP C 139     117.922 126.097 136.017  1.00 66.14           O  
ATOM   6475  OD2 ASP C 139     116.232 125.530 134.741  1.00 66.14           O  
ATOM   6476  N   LEU C 140     120.659 126.883 135.456  1.00 65.84           N  
ATOM   6477  CA  LEU C 140     121.811 125.992 135.485  1.00 65.84           C  
ATOM   6478  C   LEU C 140     121.520 124.700 136.237  1.00 65.84           C  
ATOM   6479  O   LEU C 140     122.446 124.072 136.758  1.00 65.84           O  
ATOM   6480  CB  LEU C 140     123.020 126.698 136.093  1.00 65.84           C  
ATOM   6481  CG  LEU C 140     123.433 127.981 135.381  1.00 65.84           C  
ATOM   6482  CD1 LEU C 140     124.660 128.585 136.040  1.00 65.84           C  
ATOM   6483  CD2 LEU C 140     123.688 127.694 133.916  1.00 65.84           C  
ATOM   6484  N   ARG C 141     120.252 124.295 136.316  1.00 68.98           N  
ATOM   6485  CA  ARG C 141     119.925 123.016 136.937  1.00 68.98           C  
ATOM   6486  C   ARG C 141     120.578 121.862 136.189  1.00 68.98           C  
ATOM   6487  O   ARG C 141     121.123 120.936 136.800  1.00 68.98           O  
ATOM   6488  CB  ARG C 141     118.409 122.835 137.004  1.00 68.98           C  
ATOM   6489  CG  ARG C 141     117.749 123.671 138.085  1.00 68.98           C  
ATOM   6490  CD  ARG C 141     116.249 123.467 138.123  1.00 68.98           C  
ATOM   6491  NE  ARG C 141     115.607 124.391 139.054  1.00 68.98           N  
ATOM   6492  CZ  ARG C 141     114.297 124.447 139.268  1.00 68.98           C  
ATOM   6493  NH1 ARG C 141     113.481 123.630 138.616  1.00 68.98           N  
ATOM   6494  NH2 ARG C 141     113.802 125.322 140.133  1.00 68.98           N  
ATOM   6495  N   ARG C 142     120.541 121.905 134.861  1.00 58.74           N  
ATOM   6496  CA  ARG C 142     121.086 120.838 134.036  1.00 58.74           C  
ATOM   6497  C   ARG C 142     122.519 121.101 133.603  1.00 58.74           C  
ATOM   6498  O   ARG C 142     122.990 120.481 132.646  1.00 58.74           O  
ATOM   6499  CB  ARG C 142     120.195 120.614 132.817  1.00 58.74           C  
ATOM   6500  CG  ARG C 142     118.831 120.065 133.172  1.00 58.74           C  
ATOM   6501  CD  ARG C 142     118.004 119.771 131.937  1.00 58.74           C  
ATOM   6502  NE  ARG C 142     116.678 119.277 132.294  1.00 58.74           N  
ATOM   6503  CZ  ARG C 142     116.383 117.994 132.472  1.00 58.74           C  
ATOM   6504  NH1 ARG C 142     117.322 117.070 132.321  1.00 58.74           N  
ATOM   6505  NH2 ARG C 142     115.150 117.635 132.798  1.00 58.74           N  
ATOM   6506  N   TYR C 143     123.213 122.008 134.277  1.00 57.36           N  
ATOM   6507  CA  TYR C 143     124.599 122.291 133.941  1.00 57.36           C  
ATOM   6508  C   TYR C 143     125.427 121.011 134.029  1.00 57.36           C  
ATOM   6509  O   TYR C 143     125.205 120.194 134.928  1.00 57.36           O  
ATOM   6510  CB  TYR C 143     125.152 123.348 134.894  1.00 57.36           C  
ATOM   6511  CG  TYR C 143     126.557 123.802 134.598  1.00 57.36           C  
ATOM   6512  CD1 TYR C 143     127.646 123.146 135.142  1.00 57.36           C  
ATOM   6513  CD2 TYR C 143     126.792 124.898 133.785  1.00 57.36           C  
ATOM   6514  CE1 TYR C 143     128.930 123.562 134.881  1.00 57.36           C  
ATOM   6515  CE2 TYR C 143     128.075 125.323 133.520  1.00 57.36           C  
ATOM   6516  CZ  TYR C 143     129.140 124.650 134.069  1.00 57.36           C  
ATOM   6517  OH  TYR C 143     130.424 125.068 133.807  1.00 57.36           O  
ATOM   6518  N   PRO C 144     126.381 120.795 133.111  1.00 59.73           N  
ATOM   6519  CA  PRO C 144     126.708 121.651 131.970  1.00 59.73           C  
ATOM   6520  C   PRO C 144     125.811 121.422 130.754  1.00 59.73           C  
ATOM   6521  O   PRO C 144     125.723 122.299 129.897  1.00 59.73           O  
ATOM   6522  CB  PRO C 144     128.150 121.259 131.657  1.00 59.73           C  
ATOM   6523  CG  PRO C 144     128.207 119.824 132.013  1.00 59.73           C  
ATOM   6524  CD  PRO C 144     127.306 119.652 133.209  1.00 59.73           C  
ATOM   6525  N   LEU C 145     125.162 120.263 130.674  1.00 60.05           N  
ATOM   6526  CA  LEU C 145     124.312 119.938 129.530  1.00 60.05           C  
ATOM   6527  C   LEU C 145     123.028 120.749 129.628  1.00 60.05           C  
ATOM   6528  O   LEU C 145     122.022 120.279 130.162  1.00 60.05           O  
ATOM   6529  CB  LEU C 145     124.007 118.445 129.498  1.00 60.05           C  
ATOM   6530  CG  LEU C 145     125.116 117.451 129.847  1.00 60.05           C  
ATOM   6531  CD1 LEU C 145     125.194 117.206 131.349  1.00 60.05           C  
ATOM   6532  CD2 LEU C 145     124.886 116.145 129.107  1.00 60.05           C  
ATOM   6533  N   ASP C 146     123.039 121.960 129.077  1.00 60.51           N  
ATOM   6534  CA  ASP C 146     121.931 122.879 129.283  1.00 60.51           C  
ATOM   6535  C   ASP C 146     121.643 123.637 127.996  1.00 60.51           C  
ATOM   6536  O   ASP C 146     122.498 123.773 127.119  1.00 60.51           O  
ATOM   6537  CB  ASP C 146     122.223 123.853 130.431  1.00 60.51           C  
ATOM   6538  CG  ASP C 146     123.461 124.695 130.185  1.00 60.51           C  
ATOM   6539  OD1 ASP C 146     124.178 124.436 129.197  1.00 60.51           O  
ATOM   6540  OD2 ASP C 146     123.720 125.620 130.982  1.00 60.51           O  
ATOM   6541  N   GLU C 147     120.410 124.121 127.892  1.00 62.65           N  
ATOM   6542  CA  GLU C 147     119.978 124.968 126.793  1.00 62.65           C  
ATOM   6543  C   GLU C 147     119.518 126.299 127.359  1.00 62.65           C  
ATOM   6544  O   GLU C 147     118.676 126.335 128.260  1.00 62.65           O  
ATOM   6545  CB  GLU C 147     118.848 124.320 125.994  1.00 62.65           C  
ATOM   6546  CG  GLU C 147     119.269 123.101 125.206  1.00 62.65           C  
ATOM   6547  CD  GLU C 147     118.316 122.795 124.068  1.00 62.65           C  
ATOM   6548  OE1 GLU C 147     117.402 123.610 123.821  1.00 62.65           O  
ATOM   6549  OE2 GLU C 147     118.480 121.742 123.417  1.00 62.65           O  
ATOM   6550  N   GLN C 148     120.070 127.383 126.839  1.00 57.59           N  
ATOM   6551  CA  GLN C 148     119.661 128.716 127.240  1.00 57.59           C  
ATOM   6552  C   GLN C 148     118.766 129.317 126.168  1.00 57.59           C  
ATOM   6553  O   GLN C 148     118.895 129.005 124.983  1.00 57.59           O  
ATOM   6554  CB  GLN C 148     120.878 129.610 127.466  1.00 57.59           C  
ATOM   6555  CG  GLN C 148     121.961 128.977 128.313  1.00 57.59           C  
ATOM   6556  CD  GLN C 148     121.619 128.947 129.788  1.00 57.59           C  
ATOM   6557  OE1 GLN C 148     120.477 128.700 130.176  1.00 57.59           O  
ATOM   6558  NE2 GLN C 148     122.617 129.200 130.623  1.00 57.59           N  
ATOM   6559  N   ASN C 149     117.854 130.182 126.590  1.00 49.77           N  
ATOM   6560  CA  ASN C 149     116.964 130.877 125.672  1.00 49.77           C  
ATOM   6561  C   ASN C 149     117.097 132.376 125.933  1.00 49.77           C  
ATOM   6562  O   ASN C 149     116.281 132.980 126.628  1.00 49.77           O  
ATOM   6563  CB  ASN C 149     115.527 130.393 125.826  1.00 49.77           C  
ATOM   6564  CG  ASN C 149     114.575 131.104 124.896  1.00 49.77           C  
ATOM   6565  OD1 ASN C 149     114.989 131.729 123.923  1.00 49.77           O  
ATOM   6566  ND2 ASN C 149     113.291 131.010 125.188  1.00 49.77           N  
ATOM   6567  N   CYS C 150     118.137 132.973 125.356  1.00 39.85           N  
ATOM   6568  CA  CYS C 150     118.417 134.381 125.583  1.00 39.85           C  
ATOM   6569  C   CYS C 150     117.790 135.238 124.491  1.00 39.85           C  
ATOM   6570  O   CYS C 150     117.815 134.888 123.302  1.00 39.85           O  
ATOM   6571  CB  CYS C 150     119.924 134.619 125.669  1.00 39.85           C  
ATOM   6572  SG  CYS C 150     120.599 134.096 127.269  1.00 39.85           S  
ATOM   6573  N   THR C 151     117.223 136.367 124.914  1.00 28.74           N  
ATOM   6574  CA  THR C 151     116.364 137.201 124.090  1.00 28.74           C  
ATOM   6575  C   THR C 151     116.859 138.642 124.100  1.00 28.74           C  
ATOM   6576  O   THR C 151     117.801 139.003 124.807  1.00 28.74           O  
ATOM   6577  CB  THR C 151     114.915 137.164 124.588  1.00 28.74           C  
ATOM   6578  OG1 THR C 151     114.800 137.999 125.744  1.00 28.74           O  
ATOM   6579  CG2 THR C 151     114.507 135.755 124.968  1.00 28.74           C  
ATOM   6580  N   LEU C 152     116.197 139.462 123.289  1.00 20.37           N  
ATOM   6581  CA  LEU C 152     116.352 140.906 123.273  1.00 20.37           C  
ATOM   6582  C   LEU C 152     114.992 141.507 122.951  1.00 20.37           C  
ATOM   6583  O   LEU C 152     114.283 141.017 122.068  1.00 20.37           O  
ATOM   6584  CB  LEU C 152     117.392 141.346 122.240  1.00 20.37           C  
ATOM   6585  CG  LEU C 152     117.587 142.847 122.074  1.00 20.37           C  
ATOM   6586  CD1 LEU C 152     118.612 143.352 123.066  1.00 20.37           C  
ATOM   6587  CD2 LEU C 152     117.998 143.160 120.655  1.00 20.37           C  
ATOM   6588  N   GLU C 153     114.621 142.564 123.668  1.00 19.61           N  
ATOM   6589  CA  GLU C 153     113.279 143.120 123.554  1.00 19.61           C  
ATOM   6590  C   GLU C 153     113.345 144.598 123.208  1.00 19.61           C  
ATOM   6591  O   GLU C 153     114.167 145.335 123.754  1.00 19.61           O  
ATOM   6592  CB  GLU C 153     112.487 142.918 124.844  1.00 19.61           C  
ATOM   6593  CG  GLU C 153     112.352 141.460 125.238  1.00 19.61           C  
ATOM   6594  CD  GLU C 153     111.513 141.262 126.480  1.00 19.61           C  
ATOM   6595  OE1 GLU C 153     110.711 142.160 126.804  1.00 19.61           O  
ATOM   6596  OE2 GLU C 153     111.659 140.209 127.135  1.00 19.61           O  
ATOM   6597  N   ILE C 154     112.460 145.029 122.314  1.00 12.62           N  
ATOM   6598  CA  ILE C 154     112.481 146.370 121.748  1.00 12.62           C  
ATOM   6599  C   ILE C 154     111.100 146.978 121.917  1.00 12.62           C  
ATOM   6600  O   ILE C 154     110.103 146.370 121.516  1.00 12.62           O  
ATOM   6601  CB  ILE C 154     112.869 146.334 120.261  1.00 12.62           C  
ATOM   6602  CG1 ILE C 154     114.281 145.782 120.084  1.00 12.62           C  
ATOM   6603  CG2 ILE C 154     112.723 147.692 119.646  1.00 12.62           C  
ATOM   6604  CD1 ILE C 154     114.675 145.598 118.648  1.00 12.62           C  
ATOM   6605  N   GLU C 155     111.037 148.177 122.491  1.00 16.98           N  
ATOM   6606  CA  GLU C 155     109.755 148.821 122.736  1.00 16.98           C  
ATOM   6607  C   GLU C 155     109.868 150.318 122.512  1.00 16.98           C  
ATOM   6608  O   GLU C 155     110.913 150.920 122.759  1.00 16.98           O  
ATOM   6609  CB  GLU C 155     109.246 148.569 124.155  1.00 16.98           C  
ATOM   6610  CG  GLU C 155     108.644 147.202 124.363  1.00 16.98           C  
ATOM   6611  CD  GLU C 155     107.920 147.092 125.686  1.00 16.98           C  
ATOM   6612  OE1 GLU C 155     108.142 147.959 126.555  1.00 16.98           O  
ATOM   6613  OE2 GLU C 155     107.121 146.148 125.853  1.00 16.98           O  
ATOM   6614  N   SER C 156     108.773 150.912 122.054  1.00 20.08           N  
ATOM   6615  CA  SER C 156     108.679 152.357 121.898  1.00 20.08           C  
ATOM   6616  C   SER C 156     108.276 152.970 123.231  1.00 20.08           C  
ATOM   6617  O   SER C 156     107.211 152.654 123.765  1.00 20.08           O  
ATOM   6618  CB  SER C 156     107.668 152.714 120.814  1.00 20.08           C  
ATOM   6619  OG  SER C 156     107.342 154.089 120.861  1.00 20.08           O  
ATOM   6620  N   TYR C 157     109.125 153.845 123.766  1.00 18.40           N  
ATOM   6621  CA  TYR C 157     108.942 154.308 125.136  1.00 18.40           C  
ATOM   6622  C   TYR C 157     107.898 155.399 125.284  1.00 18.40           C  
ATOM   6623  O   TYR C 157     107.292 155.505 126.354  1.00 18.40           O  
ATOM   6624  CB  TYR C 157     110.253 154.829 125.710  1.00 18.40           C  
ATOM   6625  CG  TYR C 157     110.177 155.060 127.195  1.00 18.40           C  
ATOM   6626  CD1 TYR C 157     109.519 154.161 128.015  1.00 18.40           C  
ATOM   6627  CD2 TYR C 157     110.768 156.166 127.778  1.00 18.40           C  
ATOM   6628  CE1 TYR C 157     109.446 154.358 129.369  1.00 18.40           C  
ATOM   6629  CE2 TYR C 157     110.702 156.369 129.133  1.00 18.40           C  
ATOM   6630  CZ  TYR C 157     110.040 155.460 129.924  1.00 18.40           C  
ATOM   6631  OH  TYR C 157     109.968 155.658 131.281  1.00 18.40           O  
ATOM   6632  N   GLY C 158     107.679 156.220 124.266  1.00 19.75           N  
ATOM   6633  CA  GLY C 158     106.846 157.390 124.458  1.00 19.75           C  
ATOM   6634  C   GLY C 158     105.542 157.415 123.693  1.00 19.75           C  
ATOM   6635  O   GLY C 158     104.719 158.308 123.907  1.00 19.75           O  
ATOM   6636  N   TYR C 159     105.326 156.449 122.806  1.00 17.39           N  
ATOM   6637  CA  TYR C 159     104.153 156.447 121.944  1.00 17.39           C  
ATOM   6638  C   TYR C 159     103.430 155.119 122.074  1.00 17.39           C  
ATOM   6639  O   TYR C 159     104.053 154.059 121.975  1.00 17.39           O  
ATOM   6640  CB  TYR C 159     104.547 156.697 120.488  1.00 17.39           C  
ATOM   6641  CG  TYR C 159     105.310 157.981 120.263  1.00 17.39           C  
ATOM   6642  CD1 TYR C 159     104.645 159.184 120.082  1.00 17.39           C  
ATOM   6643  CD2 TYR C 159     106.693 157.988 120.221  1.00 17.39           C  
ATOM   6644  CE1 TYR C 159     105.338 160.356 119.873  1.00 17.39           C  
ATOM   6645  CE2 TYR C 159     107.392 159.154 120.013  1.00 17.39           C  
ATOM   6646  CZ  TYR C 159     106.712 160.334 119.840  1.00 17.39           C  
ATOM   6647  OH  TYR C 159     107.414 161.495 119.633  1.00 17.39           O  
ATOM   6648  N   THR C 160     102.120 155.177 122.288  1.00 18.75           N  
ATOM   6649  CA  THR C 160     101.315 153.974 122.417  1.00 18.75           C  
ATOM   6650  C   THR C 160     101.013 153.396 121.039  1.00 18.75           C  
ATOM   6651  O   THR C 160     101.370 153.963 120.005  1.00 18.75           O  
ATOM   6652  CB  THR C 160     100.020 154.272 123.159  1.00 18.75           C  
ATOM   6653  OG1 THR C 160      99.112 154.931 122.271  1.00 18.75           O  
ATOM   6654  CG2 THR C 160     100.288 155.177 124.337  1.00 18.75           C  
ATOM   6655  N   THR C 161     100.324 152.255 121.021  1.00 19.73           N  
ATOM   6656  CA  THR C 161      99.990 151.617 119.755  1.00 19.73           C  
ATOM   6657  C   THR C 161      99.036 152.455 118.921  1.00 19.73           C  
ATOM   6658  O   THR C 161      98.811 152.137 117.750  1.00 19.73           O  
ATOM   6659  CB  THR C 161      99.380 150.242 119.992  1.00 19.73           C  
ATOM   6660  OG1 THR C 161      99.238 149.566 118.738  1.00 19.73           O  
ATOM   6661  CG2 THR C 161      98.017 150.378 120.639  1.00 19.73           C  
ATOM   6662  N   ASP C 162      98.449 153.500 119.502  1.00 23.12           N  
ATOM   6663  CA  ASP C 162      97.645 154.422 118.711  1.00 23.12           C  
ATOM   6664  C   ASP C 162      98.517 155.351 117.880  1.00 23.12           C  
ATOM   6665  O   ASP C 162      98.005 156.052 117.003  1.00 23.12           O  
ATOM   6666  CB  ASP C 162      96.723 155.233 119.617  1.00 23.12           C  
ATOM   6667  CG  ASP C 162      95.757 154.362 120.392  1.00 23.12           C  
ATOM   6668  OD1 ASP C 162      95.494 153.226 119.944  1.00 23.12           O  
ATOM   6669  OD2 ASP C 162      95.256 154.812 121.444  1.00 23.12           O  
ATOM   6670  N   ASP C 163      99.818 155.396 118.156  1.00 20.82           N  
ATOM   6671  CA  ASP C 163     100.711 156.340 117.497  1.00 20.82           C  
ATOM   6672  C   ASP C 163     101.764 155.684 116.615  1.00 20.82           C  
ATOM   6673  O   ASP C 163     102.087 156.220 115.553  1.00 20.82           O  
ATOM   6674  CB  ASP C 163     101.401 157.221 118.536  1.00 20.82           C  
ATOM   6675  CG  ASP C 163     100.426 158.086 119.296  1.00 20.82           C  
ATOM   6676  OD1 ASP C 163      99.318 158.320 118.770  1.00 20.82           O  
ATOM   6677  OD2 ASP C 163     100.760 158.532 120.412  1.00 20.82           O  
ATOM   6678  N   ILE C 164     102.319 154.547 117.021  1.00 17.47           N  
ATOM   6679  CA  ILE C 164     103.457 153.962 116.327  1.00 17.47           C  
ATOM   6680  C   ILE C 164     103.196 152.482 116.083  1.00 17.47           C  
ATOM   6681  O   ILE C 164     102.425 151.838 116.800  1.00 17.47           O  
ATOM   6682  CB  ILE C 164     104.762 154.173 117.121  1.00 17.47           C  
ATOM   6683  CG1 ILE C 164     105.966 154.226 116.188  1.00 17.47           C  
ATOM   6684  CG2 ILE C 164     104.961 153.066 118.124  1.00 17.47           C  
ATOM   6685  CD1 ILE C 164     107.282 154.420 116.912  1.00 17.47           C  
ATOM   6686  N   GLU C 165     103.839 151.944 115.049  1.00 21.45           N  
ATOM   6687  CA  GLU C 165     103.695 150.549 114.656  1.00 21.45           C  
ATOM   6688  C   GLU C 165     105.066 149.950 114.385  1.00 21.45           C  
ATOM   6689  O   GLU C 165     105.949 150.626 113.854  1.00 21.45           O  
ATOM   6690  CB  GLU C 165     102.822 150.410 113.409  1.00 21.45           C  
ATOM   6691  CG  GLU C 165     101.379 150.810 113.609  1.00 21.45           C  
ATOM   6692  CD  GLU C 165     100.581 149.749 114.331  1.00 21.45           C  
ATOM   6693  OE1 GLU C 165     101.146 148.676 114.624  1.00 21.45           O  
ATOM   6694  OE2 GLU C 165      99.385 149.984 114.599  1.00 21.45           O  
ATOM   6695  N   PHE C 166     105.238 148.680 114.733  1.00 15.42           N  
ATOM   6696  CA  PHE C 166     106.513 147.994 114.574  1.00 15.42           C  
ATOM   6697  C   PHE C 166     106.319 146.730 113.754  1.00 15.42           C  
ATOM   6698  O   PHE C 166     105.411 145.941 114.029  1.00 15.42           O  
ATOM   6699  CB  PHE C 166     107.126 147.644 115.930  1.00 15.42           C  
ATOM   6700  CG  PHE C 166     107.847 148.785 116.586  1.00 15.42           C  
ATOM   6701  CD1 PHE C 166     108.166 149.920 115.875  1.00 15.42           C  
ATOM   6702  CD2 PHE C 166     108.215 148.716 117.915  1.00 15.42           C  
ATOM   6703  CE1 PHE C 166     108.834 150.964 116.476  1.00 15.42           C  
ATOM   6704  CE2 PHE C 166     108.882 149.758 118.517  1.00 15.42           C  
ATOM   6705  CZ  PHE C 166     109.190 150.882 117.796  1.00 15.42           C  
ATOM   6706  N   TYR C 167     107.175 146.540 112.755  1.00 18.33           N  
ATOM   6707  CA  TYR C 167     107.145 145.337 111.939  1.00 18.33           C  
ATOM   6708  C   TYR C 167     108.498 145.178 111.267  1.00 18.33           C  
ATOM   6709  O   TYR C 167     109.081 146.159 110.804  1.00 18.33           O  
ATOM   6710  CB  TYR C 167     106.032 145.394 110.889  1.00 18.33           C  
ATOM   6711  CG  TYR C 167     106.273 146.402 109.792  1.00 18.33           C  
ATOM   6712  CD1 TYR C 167     105.911 147.727 109.952  1.00 18.33           C  
ATOM   6713  CD2 TYR C 167     106.861 146.025 108.595  1.00 18.33           C  
ATOM   6714  CE1 TYR C 167     106.130 148.650 108.954  1.00 18.33           C  
ATOM   6715  CE2 TYR C 167     107.084 146.940 107.593  1.00 18.33           C  
ATOM   6716  CZ  TYR C 167     106.718 148.251 107.777  1.00 18.33           C  
ATOM   6717  OH  TYR C 167     106.940 149.166 106.777  1.00 18.33           O  
ATOM   6718  N   TRP C 168     108.991 143.945 111.221  1.00 19.32           N  
ATOM   6719  CA  TRP C 168     110.265 143.679 110.573  1.00 19.32           C  
ATOM   6720  C   TRP C 168     110.116 143.761 109.058  1.00 19.32           C  
ATOM   6721  O   TRP C 168     109.044 143.509 108.505  1.00 19.32           O  
ATOM   6722  CB  TRP C 168     110.790 142.305 110.979  1.00 19.32           C  
ATOM   6723  CG  TRP C 168     110.791 142.091 112.450  1.00 19.32           C  
ATOM   6724  CD1 TRP C 168     109.723 141.764 113.222  1.00 19.32           C  
ATOM   6725  CD2 TRP C 168     111.913 142.177 113.332  1.00 19.32           C  
ATOM   6726  NE1 TRP C 168     110.106 141.646 114.532  1.00 19.32           N  
ATOM   6727  CE2 TRP C 168     111.448 141.894 114.624  1.00 19.32           C  
ATOM   6728  CE3 TRP C 168     113.265 142.465 113.154  1.00 19.32           C  
ATOM   6729  CZ2 TRP C 168     112.283 141.896 115.732  1.00 19.32           C  
ATOM   6730  CZ3 TRP C 168     114.092 142.464 114.256  1.00 19.32           C  
ATOM   6731  CH2 TRP C 168     113.599 142.183 115.526  1.00 19.32           C  
ATOM   6732  N   ARG C 169     111.205 144.124 108.386  1.00 24.96           N  
ATOM   6733  CA  ARG C 169     111.191 144.300 106.933  1.00 24.96           C  
ATOM   6734  C   ARG C 169     111.451 142.969 106.226  1.00 24.96           C  
ATOM   6735  O   ARG C 169     112.433 142.785 105.512  1.00 24.96           O  
ATOM   6736  CB  ARG C 169     112.211 145.353 106.521  1.00 24.96           C  
ATOM   6737  CG  ARG C 169     111.931 146.728 107.083  1.00 24.96           C  
ATOM   6738  CD  ARG C 169     113.094 147.664 106.834  1.00 24.96           C  
ATOM   6739  NE  ARG C 169     113.278 147.942 105.416  1.00 24.96           N  
ATOM   6740  CZ  ARG C 169     114.352 148.536 104.910  1.00 24.96           C  
ATOM   6741  NH1 ARG C 169     115.343 148.903 105.710  1.00 24.96           N  
ATOM   6742  NH2 ARG C 169     114.438 148.754 103.607  1.00 24.96           N  
ATOM   6743  N   GLY C 170     110.534 142.030 106.442  1.00 39.93           N  
ATOM   6744  CA  GLY C 170     110.667 140.695 105.892  1.00 39.93           C  
ATOM   6745  C   GLY C 170     111.319 139.763 106.889  1.00 39.93           C  
ATOM   6746  O   GLY C 170     112.521 139.875 107.147  1.00 39.93           O  
ATOM   6747  N   ASP C 171     110.543 138.832 107.447  1.00 45.64           N  
ATOM   6748  CA  ASP C 171     111.025 138.050 108.582  1.00 45.64           C  
ATOM   6749  C   ASP C 171     112.258 137.235 108.217  1.00 45.64           C  
ATOM   6750  O   ASP C 171     113.265 137.263 108.933  1.00 45.64           O  
ATOM   6751  CB  ASP C 171     109.912 137.145 109.105  1.00 45.64           C  
ATOM   6752  CG  ASP C 171     108.715 137.929 109.595  1.00 45.64           C  
ATOM   6753  OD1 ASP C 171     108.558 139.094 109.173  1.00 45.64           O  
ATOM   6754  OD2 ASP C 171     107.937 137.387 110.407  1.00 45.64           O  
ATOM   6755  N   ASP C 172     112.204 136.515 107.095  1.00 57.29           N  
ATOM   6756  CA  ASP C 172     113.333 135.675 106.708  1.00 57.29           C  
ATOM   6757  C   ASP C 172     114.605 136.490 106.521  1.00 57.29           C  
ATOM   6758  O   ASP C 172     115.709 135.976 106.734  1.00 57.29           O  
ATOM   6759  CB  ASP C 172     113.001 134.907 105.430  1.00 57.29           C  
ATOM   6760  CG  ASP C 172     111.823 133.968 105.604  1.00 57.29           C  
ATOM   6761  OD1 ASP C 172     111.533 133.581 106.756  1.00 57.29           O  
ATOM   6762  OD2 ASP C 172     111.190 133.614 104.588  1.00 57.29           O  
ATOM   6763  N   ASN C 173     114.477 137.754 106.129  1.00 49.80           N  
ATOM   6764  CA  ASN C 173     115.618 138.645 105.996  1.00 49.80           C  
ATOM   6765  C   ASN C 173     115.633 139.737 107.056  1.00 49.80           C  
ATOM   6766  O   ASN C 173     116.270 140.774 106.853  1.00 49.80           O  
ATOM   6767  CB  ASN C 173     115.638 139.265 104.600  1.00 49.80           C  
ATOM   6768  CG  ASN C 173     115.831 138.233 103.515  1.00 49.80           C  
ATOM   6769  OD1 ASN C 173     116.418 137.176 103.747  1.00 49.80           O  
ATOM   6770  ND2 ASN C 173     115.340 138.532 102.318  1.00 49.80           N  
ATOM   6771  N   ALA C 174     114.943 139.534 108.178  1.00 31.74           N  
ATOM   6772  CA  ALA C 174     114.926 140.561 109.211  1.00 31.74           C  
ATOM   6773  C   ALA C 174     116.261 140.646 109.933  1.00 31.74           C  
ATOM   6774  O   ALA C 174     116.805 141.739 110.114  1.00 31.74           O  
ATOM   6775  CB  ALA C 174     113.802 140.290 110.204  1.00 31.74           C  
ATOM   6776  N   VAL C 175     116.803 139.511 110.358  1.00 22.69           N  
ATOM   6777  CA  VAL C 175     118.051 139.462 111.106  1.00 22.69           C  
ATOM   6778  C   VAL C 175     119.028 138.592 110.336  1.00 22.69           C  
ATOM   6779  O   VAL C 175     118.706 137.452 109.988  1.00 22.69           O  
ATOM   6780  CB  VAL C 175     117.838 138.914 112.526  1.00 22.69           C  
ATOM   6781  CG1 VAL C 175     119.115 139.024 113.322  1.00 22.69           C  
ATOM   6782  CG2 VAL C 175     116.712 139.654 113.211  1.00 22.69           C  
ATOM   6783  N   THR C 176     120.216 139.123 110.080  1.00 25.93           N  
ATOM   6784  CA  THR C 176     121.216 138.439 109.277  1.00 25.93           C  
ATOM   6785  C   THR C 176     122.490 138.272 110.089  1.00 25.93           C  
ATOM   6786  O   THR C 176     122.582 138.705 111.239  1.00 25.93           O  
ATOM   6787  CB  THR C 176     121.517 139.205 107.985  1.00 25.93           C  
ATOM   6788  OG1 THR C 176     122.174 140.436 108.305  1.00 25.93           O  
ATOM   6789  CG2 THR C 176     120.233 139.513 107.238  1.00 25.93           C  
ATOM   6790  N   GLY C 177     123.476 137.621 109.482  1.00 31.50           N  
ATOM   6791  CA  GLY C 177     124.781 137.510 110.093  1.00 31.50           C  
ATOM   6792  C   GLY C 177     124.865 136.587 111.285  1.00 31.50           C  
ATOM   6793  O   GLY C 177     125.848 136.658 112.030  1.00 31.50           O  
ATOM   6794  N   VAL C 178     123.867 135.729 111.500  1.00 38.84           N  
ATOM   6795  CA  VAL C 178     123.911 134.827 112.645  1.00 38.84           C  
ATOM   6796  C   VAL C 178     124.778 133.612 112.352  1.00 38.84           C  
ATOM   6797  O   VAL C 178     125.412 133.059 113.259  1.00 38.84           O  
ATOM   6798  CB  VAL C 178     122.486 134.415 113.050  1.00 38.84           C  
ATOM   6799  CG1 VAL C 178     122.509 133.627 114.345  1.00 38.84           C  
ATOM   6800  CG2 VAL C 178     121.610 135.639 113.191  1.00 38.84           C  
ATOM   6801  N   THR C 179     124.828 133.175 111.093  1.00 43.44           N  
ATOM   6802  CA  THR C 179     125.586 131.974 110.755  1.00 43.44           C  
ATOM   6803  C   THR C 179     127.079 132.166 110.991  1.00 43.44           C  
ATOM   6804  O   THR C 179     127.745 131.274 111.527  1.00 43.44           O  
ATOM   6805  CB  THR C 179     125.328 131.583 109.302  1.00 43.44           C  
ATOM   6806  OG1 THR C 179     125.913 132.562 108.435  1.00 43.44           O  
ATOM   6807  CG2 THR C 179     123.838 131.508 109.032  1.00 43.44           C  
ATOM   6808  N   LYS C 180     127.623 133.318 110.596  1.00 52.79           N  
ATOM   6809  CA  LYS C 180     129.057 133.553 110.726  1.00 52.79           C  
ATOM   6810  C   LYS C 180     129.507 133.672 112.176  1.00 52.79           C  
ATOM   6811  O   LYS C 180     130.711 133.601 112.443  1.00 52.79           O  
ATOM   6812  CB  LYS C 180     129.458 134.811 109.960  1.00 52.79           C  
ATOM   6813  CG  LYS C 180     129.243 134.714 108.464  1.00 52.79           C  
ATOM   6814  CD  LYS C 180     129.654 135.997 107.768  1.00 52.79           C  
ATOM   6815  CE  LYS C 180     129.435 135.907 106.267  1.00 52.79           C  
ATOM   6816  NZ  LYS C 180     129.821 137.167 105.576  1.00 52.79           N  
ATOM   6817  N   ILE C 181     128.578 133.863 113.114  1.00 49.41           N  
ATOM   6818  CA  ILE C 181     128.959 134.007 114.513  1.00 49.41           C  
ATOM   6819  C   ILE C 181     129.531 132.696 115.021  1.00 49.41           C  
ATOM   6820  O   ILE C 181     128.911 131.633 114.890  1.00 49.41           O  
ATOM   6821  CB  ILE C 181     127.756 134.452 115.353  1.00 49.41           C  
ATOM   6822  CG1 ILE C 181     127.204 135.764 114.809  1.00 49.41           C  
ATOM   6823  CG2 ILE C 181     128.157 134.604 116.803  1.00 49.41           C  
ATOM   6824  CD1 ILE C 181     128.273 136.779 114.521  1.00 49.41           C  
ATOM   6825  N   GLU C 182     130.721 132.766 115.612  1.00 62.84           N  
ATOM   6826  CA  GLU C 182     131.416 131.591 116.132  1.00 62.84           C  
ATOM   6827  C   GLU C 182     131.719 131.852 117.604  1.00 62.84           C  
ATOM   6828  O   GLU C 182     132.791 132.356 117.945  1.00 62.84           O  
ATOM   6829  CB  GLU C 182     132.682 131.307 115.332  1.00 62.84           C  
ATOM   6830  CG  GLU C 182     133.354 129.987 115.673  1.00 62.84           C  
ATOM   6831  CD  GLU C 182     132.573 128.782 115.178  1.00 62.84           C  
ATOM   6832  OE1 GLU C 182     131.742 128.942 114.259  1.00 62.84           O  
ATOM   6833  OE2 GLU C 182     132.790 127.673 115.711  1.00 62.84           O  
ATOM   6834  N   LEU C 183     130.770 131.514 118.471  1.00 49.21           N  
ATOM   6835  CA  LEU C 183     130.986 131.677 119.896  1.00 49.21           C  
ATOM   6836  C   LEU C 183     132.117 130.764 120.367  1.00 49.21           C  
ATOM   6837  O   LEU C 183     132.302 129.665 119.837  1.00 49.21           O  
ATOM   6838  CB  LEU C 183     129.711 131.370 120.673  1.00 49.21           C  
ATOM   6839  CG  LEU C 183     128.686 132.498 120.718  1.00 49.21           C  
ATOM   6840  CD1 LEU C 183     127.545 132.137 121.644  1.00 49.21           C  
ATOM   6841  CD2 LEU C 183     129.359 133.772 121.169  1.00 49.21           C  
ATOM   6842  N   PRO C 184     132.897 131.202 121.358  1.00 46.71           N  
ATOM   6843  CA  PRO C 184     134.011 130.364 121.821  1.00 46.71           C  
ATOM   6844  C   PRO C 184     133.562 129.135 122.587  1.00 46.71           C  
ATOM   6845  O   PRO C 184     134.245 128.106 122.533  1.00 46.71           O  
ATOM   6846  CB  PRO C 184     134.815 131.318 122.712  1.00 46.71           C  
ATOM   6847  CG  PRO C 184     133.800 132.284 123.215  1.00 46.71           C  
ATOM   6848  CD  PRO C 184     132.819 132.476 122.092  1.00 46.71           C  
ATOM   6849  N   GLN C 185     132.438 129.205 123.295  1.00 50.32           N  
ATOM   6850  CA  GLN C 185     131.996 128.126 124.167  1.00 50.32           C  
ATOM   6851  C   GLN C 185     130.664 127.524 123.749  1.00 50.32           C  
ATOM   6852  O   GLN C 185     130.544 126.300 123.652  1.00 50.32           O  
ATOM   6853  CB  GLN C 185     131.907 128.636 125.609  1.00 50.32           C  
ATOM   6854  CG  GLN C 185     131.508 127.588 126.622  1.00 50.32           C  
ATOM   6855  CD  GLN C 185     131.487 128.142 128.029  1.00 50.32           C  
ATOM   6856  OE1 GLN C 185     132.221 129.076 128.349  1.00 50.32           O  
ATOM   6857  NE2 GLN C 185     130.634 127.578 128.876  1.00 50.32           N  
ATOM   6858  N   PHE C 186     129.658 128.354 123.496  1.00 45.31           N  
ATOM   6859  CA  PHE C 186     128.324 127.874 123.178  1.00 45.31           C  
ATOM   6860  C   PHE C 186     128.202 127.590 121.682  1.00 45.31           C  
ATOM   6861  O   PHE C 186     129.181 127.605 120.934  1.00 45.31           O  
ATOM   6862  CB  PHE C 186     127.266 128.885 123.620  1.00 45.31           C  
ATOM   6863  CG  PHE C 186     127.056 128.952 125.109  1.00 45.31           C  
ATOM   6864  CD1 PHE C 186     128.056 128.598 125.993  1.00 45.31           C  
ATOM   6865  CD2 PHE C 186     125.842 129.366 125.621  1.00 45.31           C  
ATOM   6866  CE1 PHE C 186     127.852 128.664 127.356  1.00 45.31           C  
ATOM   6867  CE2 PHE C 186     125.632 129.431 126.981  1.00 45.31           C  
ATOM   6868  CZ  PHE C 186     126.637 129.080 127.849  1.00 45.31           C  
ATOM   6869  N   SER C 187     126.978 127.318 121.241  1.00 42.54           N  
ATOM   6870  CA  SER C 187     126.698 127.106 119.826  1.00 42.54           C  
ATOM   6871  C   SER C 187     125.272 127.544 119.530  1.00 42.54           C  
ATOM   6872  O   SER C 187     124.343 127.172 120.255  1.00 42.54           O  
ATOM   6873  CB  SER C 187     126.904 125.643 119.437  1.00 42.54           C  
ATOM   6874  OG  SER C 187     126.077 124.795 120.211  1.00 42.54           O  
ATOM   6875  N   ILE C 188     125.110 128.356 118.483  1.00 34.64           N  
ATOM   6876  CA  ILE C 188     123.787 128.814 118.076  1.00 34.64           C  
ATOM   6877  C   ILE C 188     122.996 127.648 117.507  1.00 34.64           C  
ATOM   6878  O   ILE C 188     123.550 126.765 116.843  1.00 34.64           O  
ATOM   6879  CB  ILE C 188     123.912 129.953 117.054  1.00 34.64           C  
ATOM   6880  CG1 ILE C 188     124.735 131.100 117.633  1.00 34.64           C  
ATOM   6881  CG2 ILE C 188     122.545 130.459 116.649  1.00 34.64           C  
ATOM   6882  CD1 ILE C 188     124.066 131.803 118.776  1.00 34.64           C  
ATOM   6883  N   VAL C 189     121.694 127.633 117.769  1.00 35.62           N  
ATOM   6884  CA  VAL C 189     120.793 126.616 117.247  1.00 35.62           C  
ATOM   6885  C   VAL C 189     119.725 127.222 116.345  1.00 35.62           C  
ATOM   6886  O   VAL C 189     119.543 126.788 115.207  1.00 35.62           O  
ATOM   6887  CB  VAL C 189     120.151 125.802 118.391  1.00 35.62           C  
ATOM   6888  CG1 VAL C 189     119.020 124.947 117.857  1.00 35.62           C  
ATOM   6889  CG2 VAL C 189     121.195 124.940 119.066  1.00 35.62           C  
ATOM   6890  N   ASP C 190     119.018 128.238 116.832  1.00 35.05           N  
ATOM   6891  CA  ASP C 190     117.852 128.750 116.127  1.00 35.05           C  
ATOM   6892  C   ASP C 190     117.502 130.124 116.678  1.00 35.05           C  
ATOM   6893  O   ASP C 190     117.756 130.415 117.848  1.00 35.05           O  
ATOM   6894  CB  ASP C 190     116.668 127.790 116.278  1.00 35.05           C  
ATOM   6895  CG  ASP C 190     115.497 128.157 115.397  1.00 35.05           C  
ATOM   6896  OD1 ASP C 190     115.594 129.148 114.644  1.00 35.05           O  
ATOM   6897  OD2 ASP C 190     114.474 127.444 115.457  1.00 35.05           O  
ATOM   6898  N   TYR C 191     116.910 130.961 115.827  1.00 22.93           N  
ATOM   6899  CA  TYR C 191     116.494 132.296 116.225  1.00 22.93           C  
ATOM   6900  C   TYR C 191     115.095 132.579 115.698  1.00 22.93           C  
ATOM   6901  O   TYR C 191     114.729 132.153 114.601  1.00 22.93           O  
ATOM   6902  CB  TYR C 191     117.476 133.365 115.725  1.00 22.93           C  
ATOM   6903  CG  TYR C 191     117.535 133.512 114.225  1.00 22.93           C  
ATOM   6904  CD1 TYR C 191     118.398 132.741 113.467  1.00 22.93           C  
ATOM   6905  CD2 TYR C 191     116.733 134.432 113.569  1.00 22.93           C  
ATOM   6906  CE1 TYR C 191     118.455 132.877 112.095  1.00 22.93           C  
ATOM   6907  CE2 TYR C 191     116.781 134.575 112.201  1.00 22.93           C  
ATOM   6908  CZ  TYR C 191     117.644 133.796 111.468  1.00 22.93           C  
ATOM   6909  OH  TYR C 191     117.692 133.940 110.103  1.00 22.93           O  
ATOM   6910  N   LYS C 192     114.313 133.306 116.496  1.00 25.68           N  
ATOM   6911  CA  LYS C 192     112.933 133.616 116.154  1.00 25.68           C  
ATOM   6912  C   LYS C 192     112.637 135.082 116.430  1.00 25.68           C  
ATOM   6913  O   LYS C 192     113.239 135.707 117.311  1.00 25.68           O  
ATOM   6914  CB  LYS C 192     111.947 132.741 116.930  1.00 25.68           C  
ATOM   6915  CG  LYS C 192     111.974 131.282 116.536  1.00 25.68           C  
ATOM   6916  CD  LYS C 192     110.966 130.470 117.330  1.00 25.68           C  
ATOM   6917  CE  LYS C 192     111.019 129.007 116.923  1.00 25.68           C  
ATOM   6918  NZ  LYS C 192     110.082 128.158 117.705  1.00 25.68           N  
ATOM   6919  N   LEU C 193     111.680 135.613 115.670  1.00 21.95           N  
ATOM   6920  CA  LEU C 193     111.297 137.019 115.710  1.00 21.95           C  
ATOM   6921  C   LEU C 193     109.802 137.105 115.977  1.00 21.95           C  
ATOM   6922  O   LEU C 193     109.003 136.524 115.236  1.00 21.95           O  
ATOM   6923  CB  LEU C 193     111.647 137.711 114.396  1.00 21.95           C  
ATOM   6924  CG  LEU C 193     112.698 136.980 113.562  1.00 21.95           C  
ATOM   6925  CD1 LEU C 193     112.627 137.422 112.118  1.00 21.95           C  
ATOM   6926  CD2 LEU C 193     114.087 137.209 114.121  1.00 21.95           C  
ATOM   6927  N   ILE C 194     109.427 137.837 117.020  1.00 22.75           N  
ATOM   6928  CA  ILE C 194     108.059 137.861 117.516  1.00 22.75           C  
ATOM   6929  C   ILE C 194     107.584 139.303 117.594  1.00 22.75           C  
ATOM   6930  O   ILE C 194     108.367 140.206 117.903  1.00 22.75           O  
ATOM   6931  CB  ILE C 194     107.957 137.184 118.897  1.00 22.75           C  
ATOM   6932  CG1 ILE C 194     108.736 135.871 118.905  1.00 22.75           C  
ATOM   6933  CG2 ILE C 194     106.511 136.936 119.260  1.00 22.75           C  
ATOM   6934  CD1 ILE C 194     108.893 135.270 120.277  1.00 22.75           C  
ATOM   6935  N   THR C 195     106.302 139.519 117.315  1.00 16.61           N  
ATOM   6936  CA  THR C 195     105.675 140.829 117.438  1.00 16.61           C  
ATOM   6937  C   THR C 195     104.563 140.733 118.469  1.00 16.61           C  
ATOM   6938  O   THR C 195     103.641 139.927 118.312  1.00 16.61           O  
ATOM   6939  CB  THR C 195     105.110 141.298 116.098  1.00 16.61           C  
ATOM   6940  OG1 THR C 195     106.136 141.244 115.102  1.00 16.61           O  
ATOM   6941  CG2 THR C 195     104.598 142.718 116.213  1.00 16.61           C  
ATOM   6942  N   LYS C 196     104.636 141.554 119.514  1.00 21.29           N  
ATOM   6943  CA  LYS C 196     103.642 141.509 120.574  1.00 21.29           C  
ATOM   6944  C   LYS C 196     103.188 142.919 120.914  1.00 21.29           C  
ATOM   6945  O   LYS C 196     103.758 143.912 120.455  1.00 21.29           O  
ATOM   6946  CB  LYS C 196     104.185 140.829 121.834  1.00 21.29           C  
ATOM   6947  CG  LYS C 196     104.738 139.439 121.618  1.00 21.29           C  
ATOM   6948  CD  LYS C 196     105.186 138.831 122.931  1.00 21.29           C  
ATOM   6949  CE  LYS C 196     106.248 139.685 123.596  1.00 21.29           C  
ATOM   6950  NZ  LYS C 196     106.764 139.038 124.830  1.00 21.29           N  
ATOM   6951  N   LYS C 197     102.149 142.995 121.739  1.00 21.90           N  
ATOM   6952  CA  LYS C 197     101.696 144.241 122.341  1.00 21.90           C  
ATOM   6953  C   LYS C 197     101.641 144.042 123.846  1.00 21.90           C  
ATOM   6954  O   LYS C 197     100.943 143.146 124.330  1.00 21.90           O  
ATOM   6955  CB  LYS C 197     100.331 144.658 121.801  1.00 21.90           C  
ATOM   6956  CG  LYS C 197     100.374 145.167 120.379  1.00 21.90           C  
ATOM   6957  CD  LYS C 197      99.011 145.652 119.932  1.00 21.90           C  
ATOM   6958  CE  LYS C 197      99.059 146.199 118.516  1.00 21.90           C  
ATOM   6959  NZ  LYS C 197      97.718 146.660 118.065  1.00 21.90           N  
ATOM   6960  N   VAL C 198     102.376 144.868 124.579  1.00 19.53           N  
ATOM   6961  CA  VAL C 198     102.485 144.758 126.026  1.00 19.53           C  
ATOM   6962  C   VAL C 198     101.617 145.835 126.651  1.00 19.53           C  
ATOM   6963  O   VAL C 198     101.669 147.000 126.239  1.00 19.53           O  
ATOM   6964  CB  VAL C 198     103.943 144.888 126.484  1.00 19.53           C  
ATOM   6965  CG1 VAL C 198     104.021 144.885 127.990  1.00 19.53           C  
ATOM   6966  CG2 VAL C 198     104.754 143.756 125.915  1.00 19.53           C  
ATOM   6967  N   VAL C 199     100.821 145.451 127.641  1.00 21.49           N  
ATOM   6968  CA  VAL C 199      99.909 146.366 128.314  1.00 21.49           C  
ATOM   6969  C   VAL C 199     100.533 146.789 129.634  1.00 21.49           C  
ATOM   6970  O   VAL C 199     100.726 145.961 130.532  1.00 21.49           O  
ATOM   6971  CB  VAL C 199      98.536 145.721 128.541  1.00 21.49           C  
ATOM   6972  CG1 VAL C 199      97.641 146.671 129.307  1.00 21.49           C  
ATOM   6973  CG2 VAL C 199      97.911 145.345 127.217  1.00 21.49           C  
ATOM   6974  N   PHE C 200     100.834 148.073 129.758  1.00 24.58           N  
ATOM   6975  CA  PHE C 200     101.302 148.664 131.001  1.00 24.58           C  
ATOM   6976  C   PHE C 200     100.175 149.484 131.622  1.00 24.58           C  
ATOM   6977  O   PHE C 200      99.040 149.489 131.140  1.00 24.58           O  
ATOM   6978  CB  PHE C 200     102.549 149.518 130.765  1.00 24.58           C  
ATOM   6979  CG  PHE C 200     103.732 148.734 130.287  1.00 24.58           C  
ATOM   6980  CD1 PHE C 200     104.540 148.068 131.186  1.00 24.58           C  
ATOM   6981  CD2 PHE C 200     104.043 148.669 128.943  1.00 24.58           C  
ATOM   6982  CE1 PHE C 200     105.630 147.347 130.752  1.00 24.58           C  
ATOM   6983  CE2 PHE C 200     105.133 147.950 128.507  1.00 24.58           C  
ATOM   6984  CZ  PHE C 200     105.926 147.288 129.412  1.00 24.58           C  
ATOM   6985  N   SER C 201     100.497 150.177 132.712  1.00 27.94           N  
ATOM   6986  CA  SER C 201      99.473 150.930 133.426  1.00 27.94           C  
ATOM   6987  C   SER C 201      98.961 152.103 132.600  1.00 27.94           C  
ATOM   6988  O   SER C 201      97.769 152.425 132.648  1.00 27.94           O  
ATOM   6989  CB  SER C 201     100.021 151.418 134.764  1.00 27.94           C  
ATOM   6990  OG  SER C 201     100.505 150.335 135.536  1.00 27.94           O  
ATOM   6991  N   THR C 202      99.842 152.754 131.838  1.00 25.58           N  
ATOM   6992  CA  THR C 202      99.456 153.967 131.127  1.00 25.58           C  
ATOM   6993  C   THR C 202      98.796 153.670 129.786  1.00 25.58           C  
ATOM   6994  O   THR C 202      97.895 154.403 129.365  1.00 25.58           O  
ATOM   6995  CB  THR C 202     100.672 154.867 130.921  1.00 25.58           C  
ATOM   6996  OG1 THR C 202     101.634 154.189 130.106  1.00 25.58           O  
ATOM   6997  CG2 THR C 202     101.300 155.206 132.254  1.00 25.58           C  
ATOM   6998  N   GLY C 203      99.225 152.621 129.097  1.00 23.76           N  
ATOM   6999  CA  GLY C 203      98.627 152.307 127.812  1.00 23.76           C  
ATOM   7000  C   GLY C 203      99.167 151.011 127.252  1.00 23.76           C  
ATOM   7001  O   GLY C 203      99.816 150.230 127.949  1.00 23.76           O  
ATOM   7002  N   SER C 204      98.873 150.790 125.975  1.00 22.13           N  
ATOM   7003  CA  SER C 204      99.309 149.602 125.253  1.00 22.13           C  
ATOM   7004  C   SER C 204     100.452 149.976 124.319  1.00 22.13           C  
ATOM   7005  O   SER C 204     100.301 150.868 123.479  1.00 22.13           O  
ATOM   7006  CB  SER C 204      98.152 148.996 124.463  1.00 22.13           C  
ATOM   7007  OG  SER C 204      98.620 147.983 123.594  1.00 22.13           O  
ATOM   7008  N   TYR C 205     101.594 149.292 124.461  1.00 20.26           N  
ATOM   7009  CA  TYR C 205     102.773 149.640 123.688  1.00 20.26           C  
ATOM   7010  C   TYR C 205     103.208 148.483 122.802  1.00 20.26           C  
ATOM   7011  O   TYR C 205     103.097 147.320 123.201  1.00 20.26           O  
ATOM   7012  CB  TYR C 205     103.934 150.025 124.606  1.00 20.26           C  
ATOM   7013  CG  TYR C 205     103.623 151.185 125.508  1.00 20.26           C  
ATOM   7014  CD1 TYR C 205     102.909 151.002 126.675  1.00 20.26           C  
ATOM   7015  CD2 TYR C 205     104.036 152.466 125.191  1.00 20.26           C  
ATOM   7016  CE1 TYR C 205     102.618 152.062 127.505  1.00 20.26           C  
ATOM   7017  CE2 TYR C 205     103.753 153.530 126.015  1.00 20.26           C  
ATOM   7018  CZ  TYR C 205     103.044 153.324 127.170  1.00 20.26           C  
ATOM   7019  OH  TYR C 205     102.760 154.390 127.989  1.00 20.26           O  
ATOM   7020  N   PRO C 206     103.719 148.766 121.611  1.00 15.65           N  
ATOM   7021  CA  PRO C 206     104.201 147.695 120.740  1.00 15.65           C  
ATOM   7022  C   PRO C 206     105.524 147.148 121.235  1.00 15.65           C  
ATOM   7023  O   PRO C 206     106.252 147.803 121.982  1.00 15.65           O  
ATOM   7024  CB  PRO C 206     104.375 148.400 119.394  1.00 15.65           C  
ATOM   7025  CG  PRO C 206     104.715 149.783 119.777  1.00 15.65           C  
ATOM   7026  CD  PRO C 206     103.876 150.085 120.983  1.00 15.65           C  
ATOM   7027  N   ARG C 207     105.833 145.926 120.814  1.00 14.85           N  
ATOM   7028  CA  ARG C 207     107.094 145.312 121.185  1.00 14.85           C  
ATOM   7029  C   ARG C 207     107.538 144.335 120.112  1.00 14.85           C  
ATOM   7030  O   ARG C 207     106.726 143.589 119.561  1.00 14.85           O  
ATOM   7031  CB  ARG C 207     106.988 144.578 122.523  1.00 14.85           C  
ATOM   7032  CG  ARG C 207     108.164 143.666 122.796  1.00 14.85           C  
ATOM   7033  CD  ARG C 207     108.036 142.941 124.114  1.00 14.85           C  
ATOM   7034  NE  ARG C 207     108.041 143.857 125.245  1.00 14.85           N  
ATOM   7035  CZ  ARG C 207     108.047 143.469 126.515  1.00 14.85           C  
ATOM   7036  NH1 ARG C 207     108.049 142.179 126.818  1.00 14.85           N  
ATOM   7037  NH2 ARG C 207     108.045 144.375 127.480  1.00 14.85           N  
ATOM   7038  N   LEU C 208     108.834 144.338 119.834  1.00 15.26           N  
ATOM   7039  CA  LEU C 208     109.457 143.315 119.015  1.00 15.26           C  
ATOM   7040  C   LEU C 208     110.380 142.489 119.895  1.00 15.26           C  
ATOM   7041  O   LEU C 208     110.986 143.012 120.833  1.00 15.26           O  
ATOM   7042  CB  LEU C 208     110.238 143.924 117.856  1.00 15.26           C  
ATOM   7043  CG  LEU C 208     109.438 144.775 116.876  1.00 15.26           C  
ATOM   7044  CD1 LEU C 208     110.207 144.918 115.570  1.00 15.26           C  
ATOM   7045  CD2 LEU C 208     108.051 144.187 116.653  1.00 15.26           C  
ATOM   7046  N   SER C 209     110.466 141.197 119.618  1.00 19.04           N  
ATOM   7047  CA  SER C 209     111.327 140.308 120.379  1.00 19.04           C  
ATOM   7048  C   SER C 209     112.188 139.500 119.426  1.00 19.04           C  
ATOM   7049  O   SER C 209     111.689 138.965 118.433  1.00 19.04           O  
ATOM   7050  CB  SER C 209     110.505 139.373 121.265  1.00 19.04           C  
ATOM   7051  OG  SER C 209     111.339 138.625 122.127  1.00 19.04           O  
ATOM   7052  N   LEU C 210     113.478 139.410 119.730  1.00 18.55           N  
ATOM   7053  CA  LEU C 210     114.418 138.615 118.950  1.00 18.55           C  
ATOM   7054  C   LEU C 210     115.097 137.648 119.902  1.00 18.55           C  
ATOM   7055  O   LEU C 210     115.817 138.080 120.803  1.00 18.55           O  
ATOM   7056  CB  LEU C 210     115.449 139.508 118.263  1.00 18.55           C  
ATOM   7057  CG  LEU C 210     116.782 138.863 117.900  1.00 18.55           C  
ATOM   7058  CD1 LEU C 210     116.600 137.915 116.744  1.00 18.55           C  
ATOM   7059  CD2 LEU C 210     117.812 139.920 117.571  1.00 18.55           C  
ATOM   7060  N   SER C 211     114.869 136.351 119.723  1.00 27.75           N  
ATOM   7061  CA  SER C 211     115.329 135.380 120.709  1.00 27.75           C  
ATOM   7062  C   SER C 211     116.064 134.244 120.024  1.00 27.75           C  
ATOM   7063  O   SER C 211     115.524 133.633 119.099  1.00 27.75           O  
ATOM   7064  CB  SER C 211     114.155 134.825 121.511  1.00 27.75           C  
ATOM   7065  OG  SER C 211     113.328 135.871 121.985  1.00 27.75           O  
ATOM   7066  N   PHE C 212     117.277 133.939 120.484  1.00 28.50           N  
ATOM   7067  CA  PHE C 212     118.038 132.836 119.910  1.00 28.50           C  
ATOM   7068  C   PHE C 212     118.466 131.863 120.995  1.00 28.50           C  
ATOM   7069  O   PHE C 212     118.941 132.276 122.056  1.00 28.50           O  
ATOM   7070  CB  PHE C 212     119.261 133.315 119.119  1.00 28.50           C  
ATOM   7071  CG  PHE C 212     119.860 134.590 119.619  1.00 28.50           C  
ATOM   7072  CD1 PHE C 212     120.417 134.664 120.876  1.00 28.50           C  
ATOM   7073  CD2 PHE C 212     119.897 135.709 118.809  1.00 28.50           C  
ATOM   7074  CE1 PHE C 212     120.976 135.835 121.326  1.00 28.50           C  
ATOM   7075  CE2 PHE C 212     120.456 136.880 119.254  1.00 28.50           C  
ATOM   7076  CZ  PHE C 212     120.995 136.944 120.514  1.00 28.50           C  
ATOM   7077  N   LYS C 213     118.283 130.573 120.722  1.00 40.78           N  
ATOM   7078  CA  LYS C 213     118.714 129.521 121.628  1.00 40.78           C  
ATOM   7079  C   LYS C 213     120.232 129.460 121.702  1.00 40.78           C  
ATOM   7080  O   LYS C 213     120.940 129.961 120.828  1.00 40.78           O  
ATOM   7081  CB  LYS C 213     118.181 128.169 121.163  1.00 40.78           C  
ATOM   7082  CG  LYS C 213     116.906 127.717 121.840  1.00 40.78           C  
ATOM   7083  CD  LYS C 213     116.425 126.407 121.239  1.00 40.78           C  
ATOM   7084  CE  LYS C 213     115.338 125.767 122.084  1.00 40.78           C  
ATOM   7085  NZ  LYS C 213     115.842 125.367 123.428  1.00 40.78           N  
ATOM   7086  N   LEU C 214     120.730 128.840 122.765  1.00 46.07           N  
ATOM   7087  CA  LEU C 214     122.154 128.585 122.922  1.00 46.07           C  
ATOM   7088  C   LEU C 214     122.341 127.193 123.496  1.00 46.07           C  
ATOM   7089  O   LEU C 214     121.791 126.880 124.556  1.00 46.07           O  
ATOM   7090  CB  LEU C 214     122.809 129.625 123.831  1.00 46.07           C  
ATOM   7091  CG  LEU C 214     122.948 131.029 123.248  1.00 46.07           C  
ATOM   7092  CD1 LEU C 214     123.229 132.033 124.346  1.00 46.07           C  
ATOM   7093  CD2 LEU C 214     124.051 131.058 122.217  1.00 46.07           C  
ATOM   7094  N   LYS C 215     123.107 126.359 122.801  1.00 48.23           N  
ATOM   7095  CA  LYS C 215     123.413 125.020 123.272  1.00 48.23           C  
ATOM   7096  C   LYS C 215     124.851 124.973 123.768  1.00 48.23           C  
ATOM   7097  O   LYS C 215     125.711 125.735 123.318  1.00 48.23           O  
ATOM   7098  CB  LYS C 215     123.197 123.985 122.162  1.00 48.23           C  
ATOM   7099  CG  LYS C 215     123.133 122.545 122.640  1.00 48.23           C  
ATOM   7100  CD  LYS C 215     123.006 121.586 121.465  1.00 48.23           C  
ATOM   7101  CE  LYS C 215     122.934 120.141 121.931  1.00 48.23           C  
ATOM   7102  NZ  LYS C 215     122.825 119.194 120.787  1.00 48.23           N  
ATOM   7103  N   ARG C 216     125.103 124.067 124.702  1.00 51.80           N  
ATOM   7104  CA  ARG C 216     126.417 123.931 125.308  1.00 51.80           C  
ATOM   7105  C   ARG C 216     127.254 122.914 124.541  1.00 51.80           C  
ATOM   7106  O   ARG C 216     126.726 121.973 123.943  1.00 51.80           O  
ATOM   7107  CB  ARG C 216     126.285 123.503 126.769  1.00 51.80           C  
ATOM   7108  CG  ARG C 216     127.569 123.598 127.555  1.00 51.80           C  
ATOM   7109  CD  ARG C 216     127.980 125.041 127.701  1.00 51.80           C  
ATOM   7110  NE  ARG C 216     127.036 125.779 128.531  1.00 51.80           N  
ATOM   7111  CZ  ARG C 216     127.241 126.065 129.811  1.00 51.80           C  
ATOM   7112  NH1 ARG C 216     128.361 125.678 130.403  1.00 51.80           N  
ATOM   7113  NH2 ARG C 216     126.331 126.741 130.496  1.00 51.80           N  
ATOM   7114  N   ASN C 217     128.571 123.120 124.556  1.00 62.68           N  
ATOM   7115  CA  ASN C 217     129.522 122.177 123.967  1.00 62.68           C  
ATOM   7116  C   ASN C 217     129.965 121.215 125.059  1.00 62.68           C  
ATOM   7117  O   ASN C 217     130.937 121.470 125.776  1.00 62.68           O  
ATOM   7118  CB  ASN C 217     130.711 122.903 123.352  1.00 62.68           C  
ATOM   7119  CG  ASN C 217     130.374 123.555 122.036  1.00 62.68           C  
ATOM   7120  OD1 ASN C 217     129.476 123.111 121.323  1.00 62.68           O  
ATOM   7121  ND2 ASN C 217     131.095 124.616 121.702  1.00 62.68           N  
ATOM   7122  N   ILE C 218     129.249 120.097 125.176  1.00 73.65           N  
ATOM   7123  CA  ILE C 218     129.505 119.153 126.255  1.00 73.65           C  
ATOM   7124  C   ILE C 218     130.844 118.458 126.060  1.00 73.65           C  
ATOM   7125  O   ILE C 218     131.417 117.911 127.014  1.00 73.65           O  
ATOM   7126  CB  ILE C 218     128.344 118.147 126.341  1.00 73.65           C  
ATOM   7127  CG1 ILE C 218     128.469 117.294 127.601  1.00 73.65           C  
ATOM   7128  CG2 ILE C 218     128.309 117.275 125.099  1.00 73.65           C  
ATOM   7129  CD1 ILE C 218     128.624 118.106 128.871  1.00 73.65           C  
ATOM   7130  N   GLY C 219     131.375 118.485 124.836  1.00 79.01           N  
ATOM   7131  CA  GLY C 219     132.584 117.733 124.541  1.00 79.01           C  
ATOM   7132  C   GLY C 219     133.767 118.161 125.387  1.00 79.01           C  
ATOM   7133  O   GLY C 219     134.387 117.342 126.069  1.00 79.01           O  
ATOM   7134  N   TYR C 220     134.095 119.453 125.356  1.00 84.29           N  
ATOM   7135  CA  TYR C 220     135.230 119.932 126.136  1.00 84.29           C  
ATOM   7136  C   TYR C 220     134.967 119.822 127.632  1.00 84.29           C  
ATOM   7137  O   TYR C 220     135.897 119.595 128.415  1.00 84.29           O  
ATOM   7138  CB  TYR C 220     135.558 121.376 125.764  1.00 84.29           C  
ATOM   7139  CG  TYR C 220     136.409 122.074 126.798  1.00 84.29           C  
ATOM   7140  CD1 TYR C 220     137.756 121.770 126.936  1.00 84.29           C  
ATOM   7141  CD2 TYR C 220     135.863 123.029 127.643  1.00 84.29           C  
ATOM   7142  CE1 TYR C 220     138.537 122.405 127.885  1.00 84.29           C  
ATOM   7143  CE2 TYR C 220     136.635 123.667 128.594  1.00 84.29           C  
ATOM   7144  CZ  TYR C 220     137.970 123.353 128.713  1.00 84.29           C  
ATOM   7145  OH  TYR C 220     138.732 123.994 129.663  1.00 84.29           O  
ATOM   7146  N   PHE C 221     133.710 119.975 128.051  1.00 82.95           N  
ATOM   7147  CA  PHE C 221     133.418 120.046 129.478  1.00 82.95           C  
ATOM   7148  C   PHE C 221     133.428 118.680 130.149  1.00 82.95           C  
ATOM   7149  O   PHE C 221     133.750 118.588 131.339  1.00 82.95           O  
ATOM   7150  CB  PHE C 221     132.077 120.739 129.706  1.00 82.95           C  
ATOM   7151  CG  PHE C 221     132.166 122.232 129.670  1.00 82.95           C  
ATOM   7152  CD1 PHE C 221     133.356 122.866 129.980  1.00 82.95           C  
ATOM   7153  CD2 PHE C 221     131.072 123.002 129.324  1.00 82.95           C  
ATOM   7154  CE1 PHE C 221     133.455 124.240 129.948  1.00 82.95           C  
ATOM   7155  CE2 PHE C 221     131.163 124.380 129.290  1.00 82.95           C  
ATOM   7156  CZ  PHE C 221     132.358 124.998 129.602  1.00 82.95           C  
ATOM   7157  N   ILE C 222     133.086 117.615 129.423  1.00 84.12           N  
ATOM   7158  CA  ILE C 222     133.171 116.280 130.010  1.00 84.12           C  
ATOM   7159  C   ILE C 222     134.618 115.939 130.346  1.00 84.12           C  
ATOM   7160  O   ILE C 222     134.936 115.513 131.464  1.00 84.12           O  
ATOM   7161  CB  ILE C 222     132.551 115.235 129.065  1.00 84.12           C  
ATOM   7162  CG1 ILE C 222     131.027 115.261 129.166  1.00 84.12           C  
ATOM   7163  CG2 ILE C 222     133.070 113.844 129.386  1.00 84.12           C  
ATOM   7164  CD1 ILE C 222     130.350 114.153 128.389  1.00 84.12           C  
ATOM   7165  N   LEU C 223     135.521 116.136 129.382  1.00 84.51           N  
ATOM   7166  CA  LEU C 223     136.880 115.618 129.514  1.00 84.51           C  
ATOM   7167  C   LEU C 223     137.618 116.251 130.687  1.00 84.51           C  
ATOM   7168  O   LEU C 223     138.481 115.615 131.304  1.00 84.51           O  
ATOM   7169  CB  LEU C 223     137.647 115.843 128.212  1.00 84.51           C  
ATOM   7170  CG  LEU C 223     136.915 115.404 126.944  1.00 84.51           C  
ATOM   7171  CD1 LEU C 223     137.809 115.569 125.728  1.00 84.51           C  
ATOM   7172  CD2 LEU C 223     136.432 113.969 127.066  1.00 84.51           C  
ATOM   7173  N   GLN C 224     137.293 117.500 131.015  1.00 87.76           N  
ATOM   7174  CA  GLN C 224     138.061 118.204 132.035  1.00 87.76           C  
ATOM   7175  C   GLN C 224     137.677 117.781 133.447  1.00 87.76           C  
ATOM   7176  O   GLN C 224     138.503 117.876 134.361  1.00 87.76           O  
ATOM   7177  CB  GLN C 224     137.887 119.711 131.869  1.00 87.76           C  
ATOM   7178  CG  GLN C 224     138.338 120.217 130.515  1.00 87.76           C  
ATOM   7179  CD  GLN C 224     139.771 119.829 130.194  1.00 87.76           C  
ATOM   7180  OE1 GLN C 224     140.060 119.317 129.113  1.00 87.76           O  
ATOM   7181  NE2 GLN C 224     140.676 120.076 131.135  1.00 87.76           N  
ATOM   7182  N   THR C 225     136.445 117.318 133.654  1.00 93.01           N  
ATOM   7183  CA  THR C 225     135.944 117.110 135.007  1.00 93.01           C  
ATOM   7184  C   THR C 225     135.443 115.704 135.299  1.00 93.01           C  
ATOM   7185  O   THR C 225     135.587 115.250 136.435  1.00 93.01           O  
ATOM   7186  CB  THR C 225     134.806 118.096 135.314  1.00 93.01           C  
ATOM   7187  OG1 THR C 225     133.727 117.886 134.395  1.00 93.01           O  
ATOM   7188  CG2 THR C 225     135.293 119.531 135.198  1.00 93.01           C  
ATOM   7189  N   TYR C 226     134.857 115.000 134.328  1.00 94.09           N  
ATOM   7190  CA  TYR C 226     134.189 113.742 134.647  1.00 94.09           C  
ATOM   7191  C   TYR C 226     135.157 112.575 134.815  1.00 94.09           C  
ATOM   7192  O   TYR C 226     134.809 111.581 135.462  1.00 94.09           O  
ATOM   7193  CB  TYR C 226     133.151 113.422 133.573  1.00 94.09           C  
ATOM   7194  CG  TYR C 226     131.856 114.174 133.765  1.00 94.09           C  
ATOM   7195  CD1 TYR C 226     131.542 114.740 134.992  1.00 94.09           C  
ATOM   7196  CD2 TYR C 226     130.947 114.316 132.727  1.00 94.09           C  
ATOM   7197  CE1 TYR C 226     130.362 115.428 135.181  1.00 94.09           C  
ATOM   7198  CE2 TYR C 226     129.761 115.004 132.908  1.00 94.09           C  
ATOM   7199  CZ  TYR C 226     129.476 115.557 134.138  1.00 94.09           C  
ATOM   7200  OH  TYR C 226     128.300 116.242 134.329  1.00 94.09           O  
ATOM   7201  N   MET C 227     136.352 112.660 134.245  1.00 90.10           N  
ATOM   7202  CA  MET C 227     137.320 111.574 134.365  1.00 90.10           C  
ATOM   7203  C   MET C 227     137.957 111.479 135.753  1.00 90.10           C  
ATOM   7204  O   MET C 227     138.102 110.362 136.272  1.00 90.10           O  
ATOM   7205  CB  MET C 227     138.404 111.711 133.293  1.00 90.10           C  
ATOM   7206  CG  MET C 227     137.880 111.549 131.878  1.00 90.10           C  
ATOM   7207  SD  MET C 227     139.187 111.538 130.639  1.00 90.10           S  
ATOM   7208  CE  MET C 227     138.233 111.235 129.156  1.00 90.10           C  
ATOM   7209  N   PRO C 228     138.371 112.597 136.382  1.00 87.21           N  
ATOM   7210  CA  PRO C 228     138.992 112.489 137.716  1.00 87.21           C  
ATOM   7211  C   PRO C 228     138.176 111.710 138.735  1.00 87.21           C  
ATOM   7212  O   PRO C 228     138.755 110.974 139.544  1.00 87.21           O  
ATOM   7213  CB  PRO C 228     139.159 113.956 138.132  1.00 87.21           C  
ATOM   7214  CG  PRO C 228     139.369 114.663 136.860  1.00 87.21           C  
ATOM   7215  CD  PRO C 228     138.478 113.976 135.862  1.00 87.21           C  
ATOM   7216  N   SER C 229     136.850 111.848 138.725  1.00 88.23           N  
ATOM   7217  CA  SER C 229     136.032 111.111 139.682  1.00 88.23           C  
ATOM   7218  C   SER C 229     136.119 109.608 139.443  1.00 88.23           C  
ATOM   7219  O   SER C 229     136.231 108.824 140.394  1.00 88.23           O  
ATOM   7220  CB  SER C 229     134.585 111.586 139.608  1.00 88.23           C  
ATOM   7221  OG  SER C 229     134.478 112.946 139.985  1.00 88.23           O  
ATOM   7222  N   ILE C 230     136.073 109.186 138.177  1.00 86.56           N  
ATOM   7223  CA  ILE C 230     136.219 107.768 137.862  1.00 86.56           C  
ATOM   7224  C   ILE C 230     137.591 107.269 138.292  1.00 86.56           C  
ATOM   7225  O   ILE C 230     137.726 106.170 138.848  1.00 86.56           O  
ATOM   7226  CB  ILE C 230     135.979 107.528 136.360  1.00 86.56           C  
ATOM   7227  CG1 ILE C 230     134.628 108.098 135.930  1.00 86.56           C  
ATOM   7228  CG2 ILE C 230     136.055 106.045 136.038  1.00 86.56           C  
ATOM   7229  CD1 ILE C 230     134.339 107.913 134.457  1.00 86.56           C  
ATOM   7230  N   LEU C 231     138.632 108.069 138.039  1.00 86.50           N  
ATOM   7231  CA  LEU C 231     139.985 107.659 138.404  1.00 86.50           C  
ATOM   7232  C   LEU C 231     140.134 107.522 139.914  1.00 86.50           C  
ATOM   7233  O   LEU C 231     140.826 106.619 140.396  1.00 86.50           O  
ATOM   7234  CB  LEU C 231     141.001 108.656 137.853  1.00 86.50           C  
ATOM   7235  CG  LEU C 231     140.927 108.865 136.342  1.00 86.50           C  
ATOM   7236  CD1 LEU C 231     142.044 109.783 135.872  1.00 86.50           C  
ATOM   7237  CD2 LEU C 231     140.968 107.530 135.611  1.00 86.50           C  
ATOM   7238  N   ILE C 232     139.498 108.413 140.676  1.00 86.65           N  
ATOM   7239  CA  ILE C 232     139.562 108.313 142.129  1.00 86.65           C  
ATOM   7240  C   ILE C 232     138.754 107.120 142.626  1.00 86.65           C  
ATOM   7241  O   ILE C 232     139.158 106.442 143.580  1.00 86.65           O  
ATOM   7242  CB  ILE C 232     139.094 109.629 142.777  1.00 86.65           C  
ATOM   7243  CG1 ILE C 232     140.022 110.776 142.377  1.00 86.65           C  
ATOM   7244  CG2 ILE C 232     139.048 109.496 144.291  1.00 86.65           C  
ATOM   7245  CD1 ILE C 232     141.479 110.508 142.670  1.00 86.65           C  
ATOM   7246  N   THR C 233     137.616 106.828 141.992  1.00 89.07           N  
ATOM   7247  CA  THR C 233     136.807 105.694 142.429  1.00 89.07           C  
ATOM   7248  C   THR C 233     137.492 104.364 142.132  1.00 89.07           C  
ATOM   7249  O   THR C 233     137.330 103.403 142.893  1.00 89.07           O  
ATOM   7250  CB  THR C 233     135.428 105.745 141.772  1.00 89.07           C  
ATOM   7251  OG1 THR C 233     134.898 107.071 141.883  1.00 89.07           O  
ATOM   7252  CG2 THR C 233     134.473 104.775 142.456  1.00 89.07           C  
ATOM   7253  N   ILE C 234     138.259 104.287 141.039  1.00 81.53           N  
ATOM   7254  CA  ILE C 234     139.000 103.064 140.728  1.00 81.53           C  
ATOM   7255  C   ILE C 234     139.973 102.716 141.851  1.00 81.53           C  
ATOM   7256  O   ILE C 234     140.294 101.538 142.071  1.00 81.53           O  
ATOM   7257  CB  ILE C 234     139.715 103.218 139.369  1.00 81.53           C  
ATOM   7258  CG1 ILE C 234     138.693 103.254 138.231  1.00 81.53           C  
ATOM   7259  CG2 ILE C 234     140.716 102.095 139.132  1.00 81.53           C  
ATOM   7260  CD1 ILE C 234     139.313 103.399 136.861  1.00 81.53           C  
ATOM   7261  N   LEU C 235     140.447 103.727 142.584  1.00 82.22           N  
ATOM   7262  CA  LEU C 235     141.354 103.477 143.698  1.00 82.22           C  
ATOM   7263  C   LEU C 235     140.703 102.618 144.777  1.00 82.22           C  
ATOM   7264  O   LEU C 235     141.392 101.842 145.445  1.00 82.22           O  
ATOM   7265  CB  LEU C 235     141.842 104.801 144.290  1.00 82.22           C  
ATOM   7266  CG  LEU C 235     143.166 105.380 143.777  1.00 82.22           C  
ATOM   7267  CD1 LEU C 235     143.164 105.540 142.266  1.00 82.22           C  
ATOM   7268  CD2 LEU C 235     143.464 106.711 144.451  1.00 82.22           C  
ATOM   7269  N   SER C 236     139.383 102.725 144.955  1.00 87.67           N  
ATOM   7270  CA  SER C 236     138.706 101.880 145.937  1.00 87.67           C  
ATOM   7271  C   SER C 236     138.752 100.411 145.528  1.00 87.67           C  
ATOM   7272  O   SER C 236     138.996  99.533 146.364  1.00 87.67           O  
ATOM   7273  CB  SER C 236     137.262 102.342 146.126  1.00 87.67           C  
ATOM   7274  OG  SER C 236     136.492 102.102 144.962  1.00 87.67           O  
ATOM   7275  N   TRP C 237     138.524 100.124 144.245  1.00 93.92           N  
ATOM   7276  CA  TRP C 237     138.652  98.753 143.759  1.00 93.92           C  
ATOM   7277  C   TRP C 237     140.083  98.253 143.915  1.00 93.92           C  
ATOM   7278  O   TRP C 237     140.316  97.113 144.337  1.00 93.92           O  
ATOM   7279  CB  TRP C 237     138.209  98.672 142.298  1.00 93.92           C  
ATOM   7280  CG  TRP C 237     136.803  99.132 142.058  1.00 93.92           C  
ATOM   7281  CD1 TRP C 237     135.832  99.337 142.996  1.00 93.92           C  
ATOM   7282  CD2 TRP C 237     136.212  99.451 140.795  1.00 93.92           C  
ATOM   7283  NE1 TRP C 237     134.673  99.760 142.394  1.00 93.92           N  
ATOM   7284  CE2 TRP C 237     134.880  99.839 141.042  1.00 93.92           C  
ATOM   7285  CE3 TRP C 237     136.679  99.445 139.478  1.00 93.92           C  
ATOM   7286  CZ2 TRP C 237     134.013 100.217 140.022  1.00 93.92           C  
ATOM   7287  CZ3 TRP C 237     135.816  99.820 138.467  1.00 93.92           C  
ATOM   7288  CH2 TRP C 237     134.498 100.201 138.744  1.00 93.92           C  
ATOM   7289  N   VAL C 238     141.059  99.098 143.565  1.00 93.48           N  
ATOM   7290  CA  VAL C 238     142.461  98.719 143.724  1.00 93.48           C  
ATOM   7291  C   VAL C 238     142.769  98.403 145.180  1.00 93.48           C  
ATOM   7292  O   VAL C 238     143.527  97.471 145.479  1.00 93.48           O  
ATOM   7293  CB  VAL C 238     143.379  99.829 143.177  1.00 93.48           C  
ATOM   7294  CG1 VAL C 238     144.840  99.512 143.465  1.00 93.48           C  
ATOM   7295  CG2 VAL C 238     143.154 100.008 141.685  1.00 93.48           C  
ATOM   7296  N   SER C 239     142.182  99.162 146.106  1.00 93.80           N  
ATOM   7297  CA  SER C 239     142.322  98.851 147.523  1.00 93.80           C  
ATOM   7298  C   SER C 239     141.672  97.515 147.856  1.00 93.80           C  
ATOM   7299  O   SER C 239     142.191  96.749 148.675  1.00 93.80           O  
ATOM   7300  CB  SER C 239     141.712  99.972 148.364  1.00 93.80           C  
ATOM   7301  OG  SER C 239     140.667  99.481 149.187  1.00 93.80           O  
ATOM   7302  N   PHE C 240     140.527  97.223 147.234  1.00 97.89           N  
ATOM   7303  CA  PHE C 240     139.883  95.930 147.446  1.00 97.89           C  
ATOM   7304  C   PHE C 240     140.782  94.783 147.002  1.00 97.89           C  
ATOM   7305  O   PHE C 240     140.779  93.709 147.616  1.00 97.89           O  
ATOM   7306  CB  PHE C 240     138.548  95.872 146.708  1.00 97.89           C  
ATOM   7307  CG  PHE C 240     137.412  96.478 147.471  1.00 97.89           C  
ATOM   7308  CD1 PHE C 240     137.473  96.601 148.848  1.00 97.89           C  
ATOM   7309  CD2 PHE C 240     136.280  96.923 146.812  1.00 97.89           C  
ATOM   7310  CE1 PHE C 240     136.426  97.160 149.553  1.00 97.89           C  
ATOM   7311  CE2 PHE C 240     135.230  97.483 147.512  1.00 97.89           C  
ATOM   7312  CZ  PHE C 240     135.304  97.602 148.884  1.00 97.89           C  
ATOM   7313  N   TRP C 241     141.557  94.988 145.940  1.00 99.59           N  
ATOM   7314  CA  TRP C 241     142.446  93.915 145.482  1.00 99.59           C  
ATOM   7315  C   TRP C 241     143.709  93.765 146.340  1.00 99.59           C  
ATOM   7316  O   TRP C 241     144.618  93.030 145.932  1.00 99.59           O  
ATOM   7317  CB  TRP C 241     142.829  94.137 144.018  1.00 99.59           C  
ATOM   7318  CG  TRP C 241     141.683  93.934 143.081  1.00 99.59           C  
ATOM   7319  CD1 TRP C 241     141.000  94.897 142.402  1.00 99.59           C  
ATOM   7320  CD2 TRP C 241     141.071  92.687 142.734  1.00 99.59           C  
ATOM   7321  NE1 TRP C 241     140.004  94.328 141.647  1.00 99.59           N  
ATOM   7322  CE2 TRP C 241     140.027  92.971 141.834  1.00 99.59           C  
ATOM   7323  CE3 TRP C 241     141.308  91.357 143.094  1.00 99.59           C  
ATOM   7324  CZ2 TRP C 241     139.220  91.976 141.288  1.00 99.59           C  
ATOM   7325  CZ3 TRP C 241     140.505  90.369 142.550  1.00 99.59           C  
ATOM   7326  CH2 TRP C 241     139.475  90.684 141.658  1.00 99.59           C  
ATOM   7327  N   ILE C 242     143.798  94.419 147.495  1.00 98.23           N  
ATOM   7328  CA  ILE C 242     144.946  94.302 148.387  1.00 98.23           C  
ATOM   7329  C   ILE C 242     144.720  93.135 149.338  1.00 98.23           C  
ATOM   7330  O   ILE C 242     143.584  92.809 149.698  1.00 98.23           O  
ATOM   7331  CB  ILE C 242     145.177  95.626 149.149  1.00 98.23           C  
ATOM   7332  CG1 ILE C 242     145.412  96.773 148.168  1.00 98.23           C  
ATOM   7333  CG2 ILE C 242     146.360  95.525 150.102  1.00 98.23           C  
ATOM   7334  CD1 ILE C 242     145.705  98.091 148.847  1.00 98.23           C  
ATOM   7335  N   ASN C 243     145.814  92.490 149.745  1.00106.96           N  
ATOM   7336  CA  ASN C 243     145.739  91.424 150.734  1.00106.96           C  
ATOM   7337  C   ASN C 243     145.179  91.959 152.049  1.00106.96           C  
ATOM   7338  O   ASN C 243     145.402  93.114 152.423  1.00106.96           O  
ATOM   7339  CB  ASN C 243     147.123  90.813 150.955  1.00106.96           C  
ATOM   7340  CG  ASN C 243     147.086  89.585 151.844  1.00106.96           C  
ATOM   7341  OD1 ASN C 243     146.035  88.973 152.032  1.00106.96           O  
ATOM   7342  ND2 ASN C 243     148.238  89.217 152.393  1.00106.96           N  
ATOM   7343  N   TYR C 244     144.446  91.098 152.759  1.00111.09           N  
ATOM   7344  CA  TYR C 244     143.754  91.537 153.967  1.00111.09           C  
ATOM   7345  C   TYR C 244     144.721  91.833 155.108  1.00111.09           C  
ATOM   7346  O   TYR C 244     144.371  92.572 156.036  1.00111.09           O  
ATOM   7347  CB  TYR C 244     142.727  90.487 154.397  1.00111.09           C  
ATOM   7348  CG  TYR C 244     143.311  89.119 154.673  1.00111.09           C  
ATOM   7349  CD1 TYR C 244     143.775  88.783 155.936  1.00111.09           C  
ATOM   7350  CD2 TYR C 244     143.393  88.160 153.671  1.00111.09           C  
ATOM   7351  CE1 TYR C 244     144.307  87.536 156.197  1.00111.09           C  
ATOM   7352  CE2 TYR C 244     143.925  86.909 153.921  1.00111.09           C  
ATOM   7353  CZ  TYR C 244     144.381  86.602 155.187  1.00111.09           C  
ATOM   7354  OH  TYR C 244     144.912  85.358 155.444  1.00111.09           O  
ATOM   7355  N   ASP C 245     145.933  91.271 155.062  1.00105.47           N  
ATOM   7356  CA  ASP C 245     146.883  91.472 156.153  1.00105.47           C  
ATOM   7357  C   ASP C 245     147.292  92.934 156.276  1.00105.47           C  
ATOM   7358  O   ASP C 245     147.260  93.504 157.373  1.00105.47           O  
ATOM   7359  CB  ASP C 245     148.111  90.585 155.947  1.00105.47           C  
ATOM   7360  CG  ASP C 245     147.806  89.114 156.140  1.00105.47           C  
ATOM   7361  OD1 ASP C 245     147.020  88.785 157.052  1.00105.47           O  
ATOM   7362  OD2 ASP C 245     148.352  88.287 155.379  1.00105.47           O  
ATOM   7363  N   ALA C 246     147.677  93.559 155.166  1.00101.04           N  
ATOM   7364  CA  ALA C 246     148.096  94.953 155.198  1.00101.04           C  
ATOM   7365  C   ALA C 246     146.914  95.853 155.534  1.00101.04           C  
ATOM   7366  O   ALA C 246     145.854  95.766 154.906  1.00101.04           O  
ATOM   7367  CB  ALA C 246     148.707  95.355 153.857  1.00101.04           C  
ATOM   7368  N   SER C 247     147.095  96.716 156.533  1.00 93.76           N  
ATOM   7369  CA  SER C 247     146.019  97.572 157.020  1.00 93.76           C  
ATOM   7370  C   SER C 247     146.327  99.049 156.829  1.00 93.76           C  
ATOM   7371  O   SER C 247     145.497  99.781 156.274  1.00 93.76           O  
ATOM   7372  CB  SER C 247     145.747  97.269 158.499  1.00 93.76           C  
ATOM   7373  OG  SER C 247     146.885  97.557 159.293  1.00 93.76           O  
ATOM   7374  N   ALA C 248     147.495  99.509 157.285  1.00 86.29           N  
ATOM   7375  CA  ALA C 248     147.822 100.929 157.220  1.00 86.29           C  
ATOM   7376  C   ALA C 248     147.815 101.437 155.786  1.00 86.29           C  
ATOM   7377  O   ALA C 248     147.344 102.546 155.516  1.00 86.29           O  
ATOM   7378  CB  ALA C 248     149.180 101.187 157.873  1.00 86.29           C  
ATOM   7379  N   ALA C 249     148.318 100.633 154.849  1.00 88.83           N  
ATOM   7380  CA  ALA C 249     148.399 101.079 153.463  1.00 88.83           C  
ATOM   7381  C   ALA C 249     147.013 101.299 152.869  1.00 88.83           C  
ATOM   7382  O   ALA C 249     146.749 102.334 152.246  1.00 88.83           O  
ATOM   7383  CB  ALA C 249     149.189 100.065 152.636  1.00 88.83           C  
ATOM   7384  N   ARG C 250     146.104 100.341 153.064  1.00 93.00           N  
ATOM   7385  CA  ARG C 250     144.773 100.480 152.480  1.00 93.00           C  
ATOM   7386  C   ARG C 250     143.965 101.563 153.188  1.00 93.00           C  
ATOM   7387  O   ARG C 250     143.186 102.282 152.549  1.00 93.00           O  
ATOM   7388  CB  ARG C 250     144.031  99.145 152.514  1.00 93.00           C  
ATOM   7389  CG  ARG C 250     142.810  99.135 151.614  1.00 93.00           C  
ATOM   7390  CD  ARG C 250     141.915  97.933 151.835  1.00 93.00           C  
ATOM   7391  NE  ARG C 250     142.516  96.674 151.411  1.00 93.00           N  
ATOM   7392  CZ  ARG C 250     141.862  95.517 151.379  1.00 93.00           C  
ATOM   7393  NH1 ARG C 250     140.587  95.466 151.741  1.00 93.00           N  
ATOM   7394  NH2 ARG C 250     142.476  94.414 150.980  1.00 93.00           N  
ATOM   7395  N   VAL C 251     144.134 101.698 154.507  1.00 85.43           N  
ATOM   7396  CA  VAL C 251     143.463 102.782 155.221  1.00 85.43           C  
ATOM   7397  C   VAL C 251     143.963 104.133 154.725  1.00 85.43           C  
ATOM   7398  O   VAL C 251     143.180 105.075 154.541  1.00 85.43           O  
ATOM   7399  CB  VAL C 251     143.656 102.622 156.741  1.00 85.43           C  
ATOM   7400  CG1 VAL C 251     143.211 103.875 157.468  1.00 85.43           C  
ATOM   7401  CG2 VAL C 251     142.881 101.416 157.244  1.00 85.43           C  
ATOM   7402  N   ALA C 252     145.272 104.246 154.483  1.00 79.06           N  
ATOM   7403  CA  ALA C 252     145.824 105.482 153.945  1.00 79.06           C  
ATOM   7404  C   ALA C 252     145.306 105.749 152.539  1.00 79.06           C  
ATOM   7405  O   ALA C 252     145.045 106.900 152.179  1.00 79.06           O  
ATOM   7406  CB  ALA C 252     147.352 105.422 153.953  1.00 79.06           C  
ATOM   7407  N   LEU C 253     145.143 104.698 151.733  1.00 83.31           N  
ATOM   7408  CA  LEU C 253     144.578 104.877 150.397  1.00 83.31           C  
ATOM   7409  C   LEU C 253     143.143 105.385 150.468  1.00 83.31           C  
ATOM   7410  O   LEU C 253     142.755 106.284 149.712  1.00 83.31           O  
ATOM   7411  CB  LEU C 253     144.644 103.566 149.613  1.00 83.31           C  
ATOM   7412  CG  LEU C 253     146.023 103.127 149.117  1.00 83.31           C  
ATOM   7413  CD1 LEU C 253     145.921 101.836 148.315  1.00 83.31           C  
ATOM   7414  CD2 LEU C 253     146.672 104.229 148.290  1.00 83.31           C  
ATOM   7415  N   GLY C 254     142.339 104.823 151.372  1.00 80.09           N  
ATOM   7416  CA  GLY C 254     140.972 105.301 151.528  1.00 80.09           C  
ATOM   7417  C   GLY C 254     140.906 106.744 151.993  1.00 80.09           C  
ATOM   7418  O   GLY C 254     140.112 107.542 151.478  1.00 80.09           O  
ATOM   7419  N   ILE C 255     141.738 107.101 152.975  1.00 77.95           N  
ATOM   7420  CA  ILE C 255     141.770 108.481 153.454  1.00 77.95           C  
ATOM   7421  C   ILE C 255     142.236 109.418 152.347  1.00 77.95           C  
ATOM   7422  O   ILE C 255     141.733 110.541 152.208  1.00 77.95           O  
ATOM   7423  CB  ILE C 255     142.658 108.589 154.708  1.00 77.95           C  
ATOM   7424  CG1 ILE C 255     142.044 107.795 155.862  1.00 77.95           C  
ATOM   7425  CG2 ILE C 255     142.848 110.039 155.111  1.00 77.95           C  
ATOM   7426  CD1 ILE C 255     142.834 107.878 157.145  1.00 77.95           C  
ATOM   7427  N   THR C 256     143.196 108.970 151.535  1.00 78.76           N  
ATOM   7428  CA  THR C 256     143.653 109.775 150.410  1.00 78.76           C  
ATOM   7429  C   THR C 256     142.534 109.991 149.402  1.00 78.76           C  
ATOM   7430  O   THR C 256     142.384 111.091 148.863  1.00 78.76           O  
ATOM   7431  CB  THR C 256     144.856 109.106 149.741  1.00 78.76           C  
ATOM   7432  OG1 THR C 256     145.912 108.951 150.697  1.00 78.76           O  
ATOM   7433  CG2 THR C 256     145.356 109.945 148.573  1.00 78.76           C  
ATOM   7434  N   THR C 257     141.736 108.954 149.137  1.00 81.16           N  
ATOM   7435  CA  THR C 257     140.608 109.114 148.222  1.00 81.16           C  
ATOM   7436  C   THR C 257     139.589 110.104 148.770  1.00 81.16           C  
ATOM   7437  O   THR C 257     139.058 110.935 148.023  1.00 81.16           O  
ATOM   7438  CB  THR C 257     139.941 107.766 147.951  1.00 81.16           C  
ATOM   7439  OG1 THR C 257     139.563 107.157 149.192  1.00 81.16           O  
ATOM   7440  CG2 THR C 257     140.885 106.845 147.192  1.00 81.16           C  
ATOM   7441  N   VAL C 258     139.302 110.031 150.071  1.00 80.20           N  
ATOM   7442  CA  VAL C 258     138.345 110.963 150.670  1.00 80.20           C  
ATOM   7443  C   VAL C 258     138.857 112.397 150.564  1.00 80.20           C  
ATOM   7444  O   VAL C 258     138.126 113.314 150.157  1.00 80.20           O  
ATOM   7445  CB  VAL C 258     138.057 110.575 152.132  1.00 80.20           C  
ATOM   7446  CG1 VAL C 258     137.216 111.647 152.809  1.00 80.20           C  
ATOM   7447  CG2 VAL C 258     137.357 109.224 152.195  1.00 80.20           C  
ATOM   7448  N   LEU C 259     140.125 112.610 150.926  1.00 78.86           N  
ATOM   7449  CA  LEU C 259     140.699 113.949 150.856  1.00 78.86           C  
ATOM   7450  C   LEU C 259     140.747 114.458 149.422  1.00 78.86           C  
ATOM   7451  O   LEU C 259     140.505 115.643 149.168  1.00 78.86           O  
ATOM   7452  CB  LEU C 259     142.097 113.953 151.473  1.00 78.86           C  
ATOM   7453  CG  LEU C 259     142.884 115.260 151.353  1.00 78.86           C  
ATOM   7454  CD1 LEU C 259     142.144 116.394 152.040  1.00 78.86           C  
ATOM   7455  CD2 LEU C 259     144.281 115.104 151.928  1.00 78.86           C  
ATOM   7456  N   THR C 260     141.047 113.575 148.467  1.00 82.50           N  
ATOM   7457  CA  THR C 260     141.118 113.990 147.072  1.00 82.50           C  
ATOM   7458  C   THR C 260     139.740 114.351 146.535  1.00 82.50           C  
ATOM   7459  O   THR C 260     139.605 115.308 145.770  1.00 82.50           O  
ATOM   7460  CB  THR C 260     141.755 112.889 146.225  1.00 82.50           C  
ATOM   7461  OG1 THR C 260     142.992 112.480 146.822  1.00 82.50           O  
ATOM   7462  CG2 THR C 260     142.028 113.396 144.817  1.00 82.50           C  
ATOM   7463  N   MET C 261     138.705 113.602 146.926  1.00 85.13           N  
ATOM   7464  CA  MET C 261     137.347 113.967 146.532  1.00 85.13           C  
ATOM   7465  C   MET C 261     136.954 115.321 147.107  1.00 85.13           C  
ATOM   7466  O   MET C 261     136.358 116.152 146.408  1.00 85.13           O  
ATOM   7467  CB  MET C 261     136.357 112.891 146.976  1.00 85.13           C  
ATOM   7468  CG  MET C 261     136.311 111.678 146.069  1.00 85.13           C  
ATOM   7469  SD  MET C 261     135.769 112.104 144.405  1.00 85.13           S  
ATOM   7470  CE  MET C 261     134.190 112.864 144.757  1.00 85.13           C  
ATOM   7471  N   THR C 262     137.281 115.564 148.379  1.00 89.96           N  
ATOM   7472  CA  THR C 262     136.969 116.862 148.973  1.00 89.96           C  
ATOM   7473  C   THR C 262     137.701 117.992 148.254  1.00 89.96           C  
ATOM   7474  O   THR C 262     137.105 119.033 147.945  1.00 89.96           O  
ATOM   7475  CB  THR C 262     137.316 116.861 150.462  1.00 89.96           C  
ATOM   7476  OG1 THR C 262     136.454 115.949 151.154  1.00 89.96           O  
ATOM   7477  CG2 THR C 262     137.150 118.254 151.050  1.00 89.96           C  
ATOM   7478  N   THR C 263     138.993 117.802 147.971  1.00 88.78           N  
ATOM   7479  CA  THR C 263     139.759 118.836 147.282  1.00 88.78           C  
ATOM   7480  C   THR C 263     139.250 119.051 145.863  1.00 88.78           C  
ATOM   7481  O   THR C 263     139.249 120.181 145.367  1.00 88.78           O  
ATOM   7482  CB  THR C 263     141.246 118.480 147.265  1.00 88.78           C  
ATOM   7483  OG1 THR C 263     141.423 117.167 146.719  1.00 88.78           O  
ATOM   7484  CG2 THR C 263     141.828 118.534 148.672  1.00 88.78           C  
ATOM   7485  N   ILE C 264     138.821 117.980 145.191  1.00 90.29           N  
ATOM   7486  CA  ILE C 264     138.258 118.117 143.852  1.00 90.29           C  
ATOM   7487  C   ILE C 264     136.975 118.928 143.901  1.00 90.29           C  
ATOM   7488  O   ILE C 264     136.752 119.814 143.068  1.00 90.29           O  
ATOM   7489  CB  ILE C 264     138.031 116.730 143.219  1.00 90.29           C  
ATOM   7490  CG1 ILE C 264     139.355 116.144 142.723  1.00 90.29           C  
ATOM   7491  CG2 ILE C 264     137.022 116.814 142.084  1.00 90.29           C  
ATOM   7492  CD1 ILE C 264     139.223 114.767 142.112  1.00 90.29           C  
ATOM   7493  N   ASN C 265     136.113 118.646 144.882  1.00 90.56           N  
ATOM   7494  CA  ASN C 265     134.893 119.431 145.036  1.00 90.56           C  
ATOM   7495  C   ASN C 265     135.218 120.903 145.263  1.00 90.56           C  
ATOM   7496  O   ASN C 265     134.640 121.786 144.616  1.00 90.56           O  
ATOM   7497  CB  ASN C 265     134.052 118.878 146.188  1.00 90.56           C  
ATOM   7498  CG  ASN C 265     132.718 119.588 146.330  1.00 90.56           C  
ATOM   7499  OD1 ASN C 265     132.230 120.211 145.387  1.00 90.56           O  
ATOM   7500  ND2 ASN C 265     132.120 119.495 147.512  1.00 90.56           N  
ATOM   7501  N   THR C 266     136.163 121.183 146.164  1.00 94.34           N  
ATOM   7502  CA  THR C 266     136.515 122.570 146.462  1.00 94.34           C  
ATOM   7503  C   THR C 266     137.081 123.275 145.234  1.00 94.34           C  
ATOM   7504  O   THR C 266     136.685 124.400 144.914  1.00 94.34           O  
ATOM   7505  CB  THR C 266     137.513 122.632 147.620  1.00 94.34           C  
ATOM   7506  OG1 THR C 266     138.678 121.862 147.298  1.00 94.34           O  
ATOM   7507  CG2 THR C 266     136.886 122.100 148.902  1.00 94.34           C  
ATOM   7508  N   HIS C 267     138.012 122.625 144.531  1.00 94.14           N  
ATOM   7509  CA  HIS C 267     138.642 123.251 143.373  1.00 94.14           C  
ATOM   7510  C   HIS C 267     137.634 123.482 142.256  1.00 94.14           C  
ATOM   7511  O   HIS C 267     137.618 124.548 141.627  1.00 94.14           O  
ATOM   7512  CB  HIS C 267     139.804 122.393 142.875  1.00 94.14           C  
ATOM   7513  CG  HIS C 267     140.371 122.850 141.568  1.00 94.14           C  
ATOM   7514  ND1 HIS C 267     141.037 124.048 141.424  1.00 94.14           N  
ATOM   7515  CD2 HIS C 267     140.361 122.275 140.342  1.00 94.14           C  
ATOM   7516  CE1 HIS C 267     141.419 124.189 140.167  1.00 94.14           C  
ATOM   7517  NE2 HIS C 267     141.022 123.127 139.490  1.00 94.14           N  
ATOM   7518  N   LEU C 268     136.790 122.485 141.983  1.00 95.41           N  
ATOM   7519  CA  LEU C 268     135.772 122.651 140.955  1.00 95.41           C  
ATOM   7520  C   LEU C 268     134.808 123.771 141.312  1.00 95.41           C  
ATOM   7521  O   LEU C 268     134.409 124.545 140.436  1.00 95.41           O  
ATOM   7522  CB  LEU C 268     135.019 121.339 140.747  1.00 95.41           C  
ATOM   7523  CG  LEU C 268     134.185 121.269 139.471  1.00 95.41           C  
ATOM   7524  CD1 LEU C 268     135.057 121.560 138.259  1.00 95.41           C  
ATOM   7525  CD2 LEU C 268     133.523 119.911 139.346  1.00 95.41           C  
ATOM   7526  N   ARG C 269     134.443 123.891 142.590  1.00 93.46           N  
ATOM   7527  CA  ARG C 269     133.602 125.006 143.006  1.00 93.46           C  
ATOM   7528  C   ARG C 269     134.320 126.335 142.815  1.00 93.46           C  
ATOM   7529  O   ARG C 269     133.699 127.334 142.433  1.00 93.46           O  
ATOM   7530  CB  ARG C 269     133.184 124.824 144.461  1.00 93.46           C  
ATOM   7531  CG  ARG C 269     132.248 125.893 144.972  1.00 93.46           C  
ATOM   7532  CD  ARG C 269     131.733 125.519 146.338  1.00 93.46           C  
ATOM   7533  NE  ARG C 269     131.269 124.136 146.369  1.00 93.46           N  
ATOM   7534  CZ  ARG C 269     130.065 123.742 145.967  1.00 93.46           C  
ATOM   7535  NH1 ARG C 269     129.196 124.628 145.499  1.00 93.46           N  
ATOM   7536  NH2 ARG C 269     129.730 122.461 146.031  1.00 93.46           N  
ATOM   7537  N   GLU C 270     135.629 126.364 143.073  1.00 95.48           N  
ATOM   7538  CA  GLU C 270     136.408 127.572 142.835  1.00 95.48           C  
ATOM   7539  C   GLU C 270     136.505 127.912 141.355  1.00 95.48           C  
ATOM   7540  O   GLU C 270     136.699 129.084 141.012  1.00 95.48           O  
ATOM   7541  CB  GLU C 270     137.813 127.424 143.425  1.00 95.48           C  
ATOM   7542  CG  GLU C 270     137.849 127.329 144.941  1.00 95.48           C  
ATOM   7543  CD  GLU C 270     137.391 128.605 145.617  1.00 95.48           C  
ATOM   7544  OE1 GLU C 270     137.569 129.691 145.027  1.00 95.48           O  
ATOM   7545  OE2 GLU C 270     136.851 128.521 146.740  1.00 95.48           O  
ATOM   7546  N   THR C 271     136.372 126.921 140.474  1.00 91.19           N  
ATOM   7547  CA  THR C 271     136.425 127.156 139.037  1.00 91.19           C  
ATOM   7548  C   THR C 271     135.051 127.282 138.392  1.00 91.19           C  
ATOM   7549  O   THR C 271     134.927 127.936 137.351  1.00 91.19           O  
ATOM   7550  CB  THR C 271     137.200 126.031 138.341  1.00 91.19           C  
ATOM   7551  OG1 THR C 271     136.575 124.773 138.620  1.00 91.19           O  
ATOM   7552  CG2 THR C 271     138.639 125.998 138.830  1.00 91.19           C  
ATOM   7553  N   LEU C 272     134.021 126.674 138.976  1.00 91.82           N  
ATOM   7554  CA  LEU C 272     132.694 126.717 138.383  1.00 91.82           C  
ATOM   7555  C   LEU C 272     132.019 128.065 138.645  1.00 91.82           C  
ATOM   7556  O   LEU C 272     132.386 128.784 139.578  1.00 91.82           O  
ATOM   7557  CB  LEU C 272     131.827 125.588 138.934  1.00 91.82           C  
ATOM   7558  CG  LEU C 272     132.079 124.188 138.372  1.00 91.82           C  
ATOM   7559  CD1 LEU C 272     131.114 123.191 138.988  1.00 91.82           C  
ATOM   7560  CD2 LEU C 272     131.964 124.186 136.857  1.00 91.82           C  
ATOM   7561  N   PRO C 273     131.035 128.434 137.824  1.00 76.82           N  
ATOM   7562  CA  PRO C 273     130.242 129.641 138.107  1.00 76.82           C  
ATOM   7563  C   PRO C 273     129.405 129.465 139.364  1.00 76.82           C  
ATOM   7564  O   PRO C 273     128.610 128.530 139.477  1.00 76.82           O  
ATOM   7565  CB  PRO C 273     129.367 129.784 136.858  1.00 76.82           C  
ATOM   7566  CG  PRO C 273     129.288 128.402 136.301  1.00 76.82           C  
ATOM   7567  CD  PRO C 273     130.632 127.801 136.558  1.00 76.82           C  
ATOM   7568  N   LYS C 274     129.584 130.383 140.311  1.00 78.02           N  
ATOM   7569  CA  LYS C 274     128.976 130.245 141.629  1.00 78.02           C  
ATOM   7570  C   LYS C 274     127.483 130.553 141.573  1.00 78.02           C  
ATOM   7571  O   LYS C 274     127.083 131.666 141.218  1.00 78.02           O  
ATOM   7572  CB  LYS C 274     129.677 131.165 142.625  1.00 78.02           C  
ATOM   7573  CG  LYS C 274     129.219 130.989 144.063  1.00 78.02           C  
ATOM   7574  CD  LYS C 274     130.082 131.802 145.015  1.00 78.02           C  
ATOM   7575  CE  LYS C 274     129.673 131.580 146.462  1.00 78.02           C  
ATOM   7576  NZ  LYS C 274     130.529 132.353 147.403  1.00 78.02           N  
ATOM   7577  N   ILE C 275     126.664 129.563 141.926  1.00 82.14           N  
ATOM   7578  CA  ILE C 275     125.213 129.737 142.022  1.00 82.14           C  
ATOM   7579  C   ILE C 275     124.701 128.985 143.235  1.00 82.14           C  
ATOM   7580  O   ILE C 275     125.258 127.957 143.642  1.00 82.14           O  
ATOM   7581  CB  ILE C 275     124.481 129.233 140.761  1.00 82.14           C  
ATOM   7582  CG1 ILE C 275     124.712 127.732 140.583  1.00 82.14           C  
ATOM   7583  CG2 ILE C 275     124.915 130.011 139.523  1.00 82.14           C  
ATOM   7584  CD1 ILE C 275     123.808 127.099 139.568  1.00 82.14           C  
ATOM   7585  N   PRO C 276     123.635 129.492 143.847  1.00 79.56           N  
ATOM   7586  CA  PRO C 276     123.102 128.855 145.061  1.00 79.56           C  
ATOM   7587  C   PRO C 276     122.532 127.458 144.864  1.00 79.56           C  
ATOM   7588  O   PRO C 276     122.941 126.522 145.557  1.00 79.56           O  
ATOM   7589  CB  PRO C 276     122.005 129.829 145.505  1.00 79.56           C  
ATOM   7590  CG  PRO C 276     122.416 131.130 144.923  1.00 79.56           C  
ATOM   7591  CD  PRO C 276     123.010 130.798 143.596  1.00 79.56           C  
ATOM   7592  N   TYR C 277     121.584 127.301 143.943  1.00 80.74           N  
ATOM   7593  CA  TYR C 277     120.858 126.041 143.830  1.00 80.74           C  
ATOM   7594  C   TYR C 277     121.772 124.915 143.354  1.00 80.74           C  
ATOM   7595  O   TYR C 277     122.760 125.137 142.650  1.00 80.74           O  
ATOM   7596  CB  TYR C 277     119.657 126.189 142.892  1.00 80.74           C  
ATOM   7597  CG  TYR C 277     119.968 126.728 141.514  1.00 80.74           C  
ATOM   7598  CD1 TYR C 277     120.212 128.080 141.314  1.00 80.74           C  
ATOM   7599  CD2 TYR C 277     119.981 125.891 140.409  1.00 80.74           C  
ATOM   7600  CE1 TYR C 277     120.485 128.578 140.060  1.00 80.74           C  
ATOM   7601  CE2 TYR C 277     120.251 126.380 139.149  1.00 80.74           C  
ATOM   7602  CZ  TYR C 277     120.501 127.725 138.981  1.00 80.74           C  
ATOM   7603  OH  TYR C 277     120.772 128.219 137.726  1.00 80.74           O  
ATOM   7604  N   VAL C 278     121.426 123.690 143.757  1.00 74.63           N  
ATOM   7605  CA  VAL C 278     122.301 122.545 143.540  1.00 74.63           C  
ATOM   7606  C   VAL C 278     122.317 122.168 142.066  1.00 74.63           C  
ATOM   7607  O   VAL C 278     121.272 122.117 141.404  1.00 74.63           O  
ATOM   7608  CB  VAL C 278     121.851 121.358 144.408  1.00 74.63           C  
ATOM   7609  CG1 VAL C 278     122.857 120.222 144.312  1.00 74.63           C  
ATOM   7610  CG2 VAL C 278     121.665 121.800 145.851  1.00 74.63           C  
ATOM   7611  N   LYS C 279     123.507 121.884 141.550  1.00 75.13           N  
ATOM   7612  CA  LYS C 279     123.704 121.559 140.147  1.00 75.13           C  
ATOM   7613  C   LYS C 279     123.767 120.050 139.942  1.00 75.13           C  
ATOM   7614  O   LYS C 279     123.621 119.256 140.873  1.00 75.13           O  
ATOM   7615  CB  LYS C 279     124.979 122.218 139.617  1.00 75.13           C  
ATOM   7616  CG  LYS C 279     125.009 123.722 139.785  1.00 75.13           C  
ATOM   7617  CD  LYS C 279     126.228 124.338 139.122  1.00 75.13           C  
ATOM   7618  CE  LYS C 279     127.447 124.296 140.030  1.00 75.13           C  
ATOM   7619  NZ  LYS C 279     127.999 122.928 140.218  1.00 75.13           N  
ATOM   7620  N   ALA C 280     123.981 119.663 138.683  1.00 76.41           N  
ATOM   7621  CA  ALA C 280     124.081 118.247 138.342  1.00 76.41           C  
ATOM   7622  C   ALA C 280     125.461 117.691 138.671  1.00 76.41           C  
ATOM   7623  O   ALA C 280     125.580 116.603 139.255  1.00 76.41           O  
ATOM   7624  CB  ALA C 280     123.768 118.054 136.861  1.00 76.41           C  
ATOM   7625  N   ILE C 281     126.515 118.420 138.299  1.00 76.94           N  
ATOM   7626  CA  ILE C 281     127.866 117.951 138.575  1.00 76.94           C  
ATOM   7627  C   ILE C 281     128.097 117.846 140.078  1.00 76.94           C  
ATOM   7628  O   ILE C 281     128.901 117.023 140.533  1.00 76.94           O  
ATOM   7629  CB  ILE C 281     128.890 118.874 137.887  1.00 76.94           C  
ATOM   7630  CG1 ILE C 281     130.213 118.147 137.672  1.00 76.94           C  
ATOM   7631  CG2 ILE C 281     129.116 120.132 138.699  1.00 76.94           C  
ATOM   7632  CD1 ILE C 281     131.158 118.889 136.760  1.00 76.94           C  
ATOM   7633  N   ASP C 282     127.376 118.642 140.874  1.00 87.07           N  
ATOM   7634  CA  ASP C 282     127.435 118.480 142.323  1.00 87.07           C  
ATOM   7635  C   ASP C 282     126.855 117.138 142.750  1.00 87.07           C  
ATOM   7636  O   ASP C 282     127.410 116.474 143.630  1.00 87.07           O  
ATOM   7637  CB  ASP C 282     126.699 119.627 143.018  1.00 87.07           C  
ATOM   7638  CG  ASP C 282     127.572 120.853 143.203  1.00 87.07           C  
ATOM   7639  OD1 ASP C 282     128.811 120.701 143.240  1.00 87.07           O  
ATOM   7640  OD2 ASP C 282     127.020 121.967 143.321  1.00 87.07           O  
ATOM   7641  N   MET C 283     125.744 116.720 142.135  1.00 86.03           N  
ATOM   7642  CA  MET C 283     125.189 115.403 142.431  1.00 86.03           C  
ATOM   7643  C   MET C 283     126.165 114.299 142.049  1.00 86.03           C  
ATOM   7644  O   MET C 283     126.330 113.319 142.787  1.00 86.03           O  
ATOM   7645  CB  MET C 283     123.858 115.213 141.704  1.00 86.03           C  
ATOM   7646  CG  MET C 283     122.742 116.115 142.203  1.00 86.03           C  
ATOM   7647  SD  MET C 283     122.365 115.868 143.949  1.00 86.03           S  
ATOM   7648  CE  MET C 283     120.971 116.974 144.160  1.00 86.03           C  
ATOM   7649  N   TYR C 284     126.832 114.448 140.905  1.00 84.02           N  
ATOM   7650  CA  TYR C 284     127.801 113.441 140.480  1.00 84.02           C  
ATOM   7651  C   TYR C 284     128.971 113.347 141.459  1.00 84.02           C  
ATOM   7652  O   TYR C 284     129.372 112.247 141.876  1.00 84.02           O  
ATOM   7653  CB  TYR C 284     128.292 113.769 139.072  1.00 84.02           C  
ATOM   7654  CG  TYR C 284     129.323 112.810 138.546  1.00 84.02           C  
ATOM   7655  CD1 TYR C 284     128.956 111.556 138.081  1.00 84.02           C  
ATOM   7656  CD2 TYR C 284     130.664 113.159 138.507  1.00 84.02           C  
ATOM   7657  CE1 TYR C 284     129.897 110.674 137.596  1.00 84.02           C  
ATOM   7658  CE2 TYR C 284     131.611 112.285 138.023  1.00 84.02           C  
ATOM   7659  CZ  TYR C 284     131.224 111.043 137.570  1.00 84.02           C  
ATOM   7660  OH  TYR C 284     132.168 110.167 137.087  1.00 84.02           O  
ATOM   7661  N   LEU C 285     129.536 114.498 141.834  1.00 84.65           N  
ATOM   7662  CA  LEU C 285     130.636 114.504 142.791  1.00 84.65           C  
ATOM   7663  C   LEU C 285     130.203 113.940 144.137  1.00 84.65           C  
ATOM   7664  O   LEU C 285     130.968 113.221 144.789  1.00 84.65           O  
ATOM   7665  CB  LEU C 285     131.184 115.919 142.960  1.00 84.65           C  
ATOM   7666  CG  LEU C 285     131.879 116.526 141.744  1.00 84.65           C  
ATOM   7667  CD1 LEU C 285     132.586 117.815 142.135  1.00 84.65           C  
ATOM   7668  CD2 LEU C 285     132.853 115.535 141.134  1.00 84.65           C  
ATOM   7669  N   MET C 286     128.984 114.263 144.577  1.00 91.70           N  
ATOM   7670  CA  MET C 286     128.492 113.720 145.837  1.00 91.70           C  
ATOM   7671  C   MET C 286     128.360 112.206 145.762  1.00 91.70           C  
ATOM   7672  O   MET C 286     128.666 111.501 146.730  1.00 91.70           O  
ATOM   7673  CB  MET C 286     127.152 114.360 146.200  1.00 91.70           C  
ATOM   7674  CG  MET C 286     126.659 114.019 147.598  1.00 91.70           C  
ATOM   7675  SD  MET C 286     127.716 114.704 148.890  1.00 91.70           S  
ATOM   7676  CE  MET C 286     126.928 114.059 150.364  1.00 91.70           C  
ATOM   7677  N   GLY C 287     127.913 111.687 144.617  1.00 85.33           N  
ATOM   7678  CA  GLY C 287     127.845 110.244 144.451  1.00 85.33           C  
ATOM   7679  C   GLY C 287     129.206 109.585 144.563  1.00 85.33           C  
ATOM   7680  O   GLY C 287     129.372 108.577 145.258  1.00 85.33           O  
ATOM   7681  N   CYS C 288     130.206 110.155 143.886  1.00 84.33           N  
ATOM   7682  CA  CYS C 288     131.548 109.576 143.958  1.00 84.33           C  
ATOM   7683  C   CYS C 288     132.126 109.676 145.370  1.00 84.33           C  
ATOM   7684  O   CYS C 288     132.803 108.750 145.845  1.00 84.33           O  
ATOM   7685  CB  CYS C 288     132.465 110.256 142.944  1.00 84.33           C  
ATOM   7686  SG  CYS C 288     131.920 110.049 141.236  1.00 84.33           S  
ATOM   7687  N   PHE C 289     131.861 110.790 146.057  1.00 92.28           N  
ATOM   7688  CA  PHE C 289     132.309 110.949 147.436  1.00 92.28           C  
ATOM   7689  C   PHE C 289     131.676 109.897 148.335  1.00 92.28           C  
ATOM   7690  O   PHE C 289     132.353 109.290 149.171  1.00 92.28           O  
ATOM   7691  CB  PHE C 289     131.973 112.359 147.928  1.00 92.28           C  
ATOM   7692  CG  PHE C 289     132.320 112.606 149.372  1.00 92.28           C  
ATOM   7693  CD1 PHE C 289     133.604 112.975 149.737  1.00 92.28           C  
ATOM   7694  CD2 PHE C 289     131.355 112.494 150.362  1.00 92.28           C  
ATOM   7695  CE1 PHE C 289     133.924 113.213 151.062  1.00 92.28           C  
ATOM   7696  CE2 PHE C 289     131.668 112.729 151.687  1.00 92.28           C  
ATOM   7697  CZ  PHE C 289     132.954 113.089 152.038  1.00 92.28           C  
ATOM   7698  N   VAL C 290     130.372 109.667 148.172  1.00 88.73           N  
ATOM   7699  CA  VAL C 290     129.694 108.653 148.973  1.00 88.73           C  
ATOM   7700  C   VAL C 290     130.270 107.275 148.683  1.00 88.73           C  
ATOM   7701  O   VAL C 290     130.431 106.453 149.591  1.00 88.73           O  
ATOM   7702  CB  VAL C 290     128.174 108.702 148.725  1.00 88.73           C  
ATOM   7703  CG1 VAL C 290     127.494 107.476 149.313  1.00 88.73           C  
ATOM   7704  CG2 VAL C 290     127.585 109.967 149.326  1.00 88.73           C  
ATOM   7705  N   PHE C 291     130.611 107.005 147.421  1.00 88.66           N  
ATOM   7706  CA  PHE C 291     131.168 105.698 147.082  1.00 88.66           C  
ATOM   7707  C   PHE C 291     132.516 105.473 147.760  1.00 88.66           C  
ATOM   7708  O   PHE C 291     132.745 104.428 148.385  1.00 88.66           O  
ATOM   7709  CB  PHE C 291     131.285 105.550 145.566  1.00 88.66           C  
ATOM   7710  CG  PHE C 291     130.003 105.138 144.903  1.00 88.66           C  
ATOM   7711  CD1 PHE C 291     128.914 104.750 145.664  1.00 88.66           C  
ATOM   7712  CD2 PHE C 291     129.887 105.132 143.525  1.00 88.66           C  
ATOM   7713  CE1 PHE C 291     127.732 104.368 145.063  1.00 88.66           C  
ATOM   7714  CE2 PHE C 291     128.705 104.751 142.917  1.00 88.66           C  
ATOM   7715  CZ  PHE C 291     127.627 104.369 143.688  1.00 88.66           C  
ATOM   7716  N   VAL C 292     133.427 106.444 147.650  1.00 87.88           N  
ATOM   7717  CA  VAL C 292     134.735 106.250 148.277  1.00 87.88           C  
ATOM   7718  C   VAL C 292     134.610 106.223 149.801  1.00 87.88           C  
ATOM   7719  O   VAL C 292     135.343 105.487 150.481  1.00 87.88           O  
ATOM   7720  CB  VAL C 292     135.739 107.317 147.799  1.00 87.88           C  
ATOM   7721  CG1 VAL C 292     136.026 107.142 146.316  1.00 87.88           C  
ATOM   7722  CG2 VAL C 292     135.225 108.714 148.080  1.00 87.88           C  
ATOM   7723  N   PHE C 293     133.668 106.987 150.361  1.00 93.42           N  
ATOM   7724  CA  PHE C 293     133.445 106.970 151.803  1.00 93.42           C  
ATOM   7725  C   PHE C 293     132.927 105.613 152.266  1.00 93.42           C  
ATOM   7726  O   PHE C 293     133.353 105.100 153.309  1.00 93.42           O  
ATOM   7727  CB  PHE C 293     132.471 108.088 152.173  1.00 93.42           C  
ATOM   7728  CG  PHE C 293     132.162 108.176 153.637  1.00 93.42           C  
ATOM   7729  CD1 PHE C 293     133.062 108.750 154.515  1.00 93.42           C  
ATOM   7730  CD2 PHE C 293     130.954 107.714 154.129  1.00 93.42           C  
ATOM   7731  CE1 PHE C 293     132.772 108.842 155.861  1.00 93.42           C  
ATOM   7732  CE2 PHE C 293     130.658 107.805 155.474  1.00 93.42           C  
ATOM   7733  CZ  PHE C 293     131.568 108.368 156.341  1.00 93.42           C  
ATOM   7734  N   MET C 294     132.014 105.014 151.499  1.00 94.96           N  
ATOM   7735  CA  MET C 294     131.534 103.679 151.830  1.00 94.96           C  
ATOM   7736  C   MET C 294     132.639 102.643 151.701  1.00 94.96           C  
ATOM   7737  O   MET C 294     132.688 101.699 152.493  1.00 94.96           O  
ATOM   7738  CB  MET C 294     130.348 103.303 150.941  1.00 94.96           C  
ATOM   7739  CG  MET C 294     129.073 104.067 151.252  1.00 94.96           C  
ATOM   7740  SD  MET C 294     128.535 103.847 152.958  1.00 94.96           S  
ATOM   7741  CE  MET C 294     128.281 102.075 153.008  1.00 94.96           C  
ATOM   7742  N   ALA C 295     133.537 102.804 150.727  1.00 86.11           N  
ATOM   7743  CA  ALA C 295     134.675 101.892 150.631  1.00 86.11           C  
ATOM   7744  C   ALA C 295     135.567 101.991 151.866  1.00 86.11           C  
ATOM   7745  O   ALA C 295     136.004 100.969 152.418  1.00 86.11           O  
ATOM   7746  CB  ALA C 295     135.477 102.182 149.364  1.00 86.11           C  
ATOM   7747  N   LEU C 296     135.846 103.217 152.315  1.00 88.47           N  
ATOM   7748  CA  LEU C 296     136.666 103.395 153.510  1.00 88.47           C  
ATOM   7749  C   LEU C 296     135.993 102.791 154.738  1.00 88.47           C  
ATOM   7750  O   LEU C 296     136.643 102.120 155.548  1.00 88.47           O  
ATOM   7751  CB  LEU C 296     136.961 104.877 153.736  1.00 88.47           C  
ATOM   7752  CG  LEU C 296     137.825 105.171 154.962  1.00 88.47           C  
ATOM   7753  CD1 LEU C 296     139.144 104.430 154.863  1.00 88.47           C  
ATOM   7754  CD2 LEU C 296     138.059 106.661 155.097  1.00 88.47           C  
ATOM   7755  N   LEU C 297     134.685 103.022 154.896  1.00 92.39           N  
ATOM   7756  CA  LEU C 297     133.969 102.439 156.029  1.00 92.39           C  
ATOM   7757  C   LEU C 297     133.955 100.918 155.951  1.00 92.39           C  
ATOM   7758  O   LEU C 297     134.052 100.233 156.978  1.00 92.39           O  
ATOM   7759  CB  LEU C 297     132.540 102.978 156.094  1.00 92.39           C  
ATOM   7760  CG  LEU C 297     132.339 104.340 156.756  1.00 92.39           C  
ATOM   7761  CD1 LEU C 297     130.858 104.603 156.973  1.00 92.39           C  
ATOM   7762  CD2 LEU C 297     133.099 104.419 158.070  1.00 92.39           C  
ATOM   7763  N   GLU C 298     133.832 100.371 154.741  1.00 97.52           N  
ATOM   7764  CA  GLU C 298     133.850  98.925 154.571  1.00 97.52           C  
ATOM   7765  C   GLU C 298     135.184  98.347 155.018  1.00 97.52           C  
ATOM   7766  O   GLU C 298     135.229  97.333 155.724  1.00 97.52           O  
ATOM   7767  CB  GLU C 298     133.557  98.572 153.112  1.00 97.52           C  
ATOM   7768  CG  GLU C 298     133.242  97.106 152.863  1.00 97.52           C  
ATOM   7769  CD  GLU C 298     134.445  96.320 152.384  1.00 97.52           C  
ATOM   7770  OE1 GLU C 298     135.577  96.840 152.479  1.00 97.52           O  
ATOM   7771  OE2 GLU C 298     134.259  95.182 151.906  1.00 97.52           O  
ATOM   7772  N   TYR C 299     136.291  98.987 154.630  1.00 97.92           N  
ATOM   7773  CA  TYR C 299     137.577  98.451 155.067  1.00 97.92           C  
ATOM   7774  C   TYR C 299     137.812  98.678 156.555  1.00 97.92           C  
ATOM   7775  O   TYR C 299     138.501  97.879 157.197  1.00 97.92           O  
ATOM   7776  CB  TYR C 299     138.740  99.037 154.277  1.00 97.92           C  
ATOM   7777  CG  TYR C 299     140.019  98.323 154.637  1.00 97.92           C  
ATOM   7778  CD1 TYR C 299     140.098  96.940 154.541  1.00 97.92           C  
ATOM   7779  CD2 TYR C 299     141.129  99.012 155.105  1.00 97.92           C  
ATOM   7780  CE1 TYR C 299     141.249  96.264 154.876  1.00 97.92           C  
ATOM   7781  CE2 TYR C 299     142.291  98.340 155.446  1.00 97.92           C  
ATOM   7782  CZ  TYR C 299     142.342  96.965 155.327  1.00 97.92           C  
ATOM   7783  OH  TYR C 299     143.484  96.278 155.659  1.00 97.92           O  
ATOM   7784  N   ALA C 300     137.263  99.753 157.121  1.00 92.02           N  
ATOM   7785  CA  ALA C 300     137.326  99.924 158.569  1.00 92.02           C  
ATOM   7786  C   ALA C 300     136.622  98.773 159.276  1.00 92.02           C  
ATOM   7787  O   ALA C 300     137.142  98.208 160.246  1.00 92.02           O  
ATOM   7788  CB  ALA C 300     136.711 101.265 158.970  1.00 92.02           C  
ATOM   7789  N   LEU C 301     135.434  98.408 158.792  1.00 95.06           N  
ATOM   7790  CA  LEU C 301     134.722  97.263 159.352  1.00 95.06           C  
ATOM   7791  C   LEU C 301     135.525  95.979 159.182  1.00 95.06           C  
ATOM   7792  O   LEU C 301     135.576  95.143 160.093  1.00 95.06           O  
ATOM   7793  CB  LEU C 301     133.349  97.131 158.694  1.00 95.06           C  
ATOM   7794  CG  LEU C 301     132.405  96.066 159.252  1.00 95.06           C  
ATOM   7795  CD1 LEU C 301     132.044  96.375 160.694  1.00 95.06           C  
ATOM   7796  CD2 LEU C 301     131.154  95.961 158.395  1.00 95.06           C  
ATOM   7797  N   VAL C 302     136.157  95.808 158.018  1.00 98.15           N  
ATOM   7798  CA  VAL C 302     136.985  94.628 157.775  1.00 98.15           C  
ATOM   7799  C   VAL C 302     138.110  94.546 158.801  1.00 98.15           C  
ATOM   7800  O   VAL C 302     138.347  93.496 159.410  1.00 98.15           O  
ATOM   7801  CB  VAL C 302     137.537  94.644 156.337  1.00 98.15           C  
ATOM   7802  CG1 VAL C 302     138.629  93.598 156.174  1.00 98.15           C  
ATOM   7803  CG2 VAL C 302     136.421  94.402 155.339  1.00 98.15           C  
ATOM   7804  N   ASN C 303     138.818  95.657 159.007  1.00 94.11           N  
ATOM   7805  CA  ASN C 303     139.907  95.673 159.977  1.00 94.11           C  
ATOM   7806  C   ASN C 303     139.396  95.449 161.393  1.00 94.11           C  
ATOM   7807  O   ASN C 303     140.105  94.859 162.217  1.00 94.11           O  
ATOM   7808  CB  ASN C 303     140.669  96.996 159.893  1.00 94.11           C  
ATOM   7809  CG  ASN C 303     142.092  96.892 160.421  1.00 94.11           C  
ATOM   7810  OD1 ASN C 303     142.972  97.643 160.005  1.00 94.11           O  
ATOM   7811  ND2 ASN C 303     142.325  95.953 161.331  1.00 94.11           N  
ATOM   7812  N   TYR C 304     138.180  95.903 161.699  1.00 97.98           N  
ATOM   7813  CA  TYR C 304     137.674  95.745 163.058  1.00 97.98           C  
ATOM   7814  C   TYR C 304     137.222  94.320 163.349  1.00 97.98           C  
ATOM   7815  O   TYR C 304     137.400  93.842 164.475  1.00 97.98           O  
ATOM   7816  CB  TYR C 304     136.520  96.711 163.320  1.00 97.98           C  
ATOM   7817  CG  TYR C 304     135.866  96.496 164.666  1.00 97.98           C  
ATOM   7818  CD1 TYR C 304     136.528  96.827 165.840  1.00 97.98           C  
ATOM   7819  CD2 TYR C 304     134.592  95.954 164.764  1.00 97.98           C  
ATOM   7820  CE1 TYR C 304     135.939  96.629 167.074  1.00 97.98           C  
ATOM   7821  CE2 TYR C 304     133.993  95.752 165.993  1.00 97.98           C  
ATOM   7822  CZ  TYR C 304     134.671  96.092 167.145  1.00 97.98           C  
ATOM   7823  OH  TYR C 304     134.081  95.894 168.372  1.00 97.98           O  
ATOM   7824  N   ILE C 305     136.647  93.629 162.371  1.00101.23           N  
ATOM   7825  CA  ILE C 305     136.159  92.272 162.584  1.00101.23           C  
ATOM   7826  C   ILE C 305     137.160  91.229 162.082  1.00101.23           C  
ATOM   7827  O   ILE C 305     136.805  90.063 161.910  1.00101.23           O  
ATOM   7828  CB  ILE C 305     134.774  92.063 161.954  1.00101.23           C  
ATOM   7829  CG1 ILE C 305     134.863  92.094 160.428  1.00101.23           C  
ATOM   7830  CG2 ILE C 305     133.801  93.118 162.455  1.00101.23           C  
ATOM   7831  CD1 ILE C 305     133.544  91.839 159.742  1.00101.23           C  
ATOM   7832  N   PHE C 306     138.413  91.627 161.861  1.00104.70           N  
ATOM   7833  CA  PHE C 306     139.407  90.697 161.338  1.00104.70           C  
ATOM   7834  C   PHE C 306     139.911  89.727 162.400  1.00104.70           C  
ATOM   7835  O   PHE C 306     140.273  88.592 162.071  1.00104.70           O  
ATOM   7836  CB  PHE C 306     140.579  91.469 160.731  1.00104.70           C  
ATOM   7837  CG  PHE C 306     141.716  90.595 160.294  1.00104.70           C  
ATOM   7838  CD1 PHE C 306     141.502  89.552 159.410  1.00104.70           C  
ATOM   7839  CD2 PHE C 306     142.999  90.819 160.760  1.00104.70           C  
ATOM   7840  CE1 PHE C 306     142.543  88.744 159.009  1.00104.70           C  
ATOM   7841  CE2 PHE C 306     144.047  90.015 160.357  1.00104.70           C  
ATOM   7842  CZ  PHE C 306     143.818  88.976 159.479  1.00104.70           C  
ATOM   7843  N   PHE C 307     139.936  90.140 163.670  1.00110.16           N  
ATOM   7844  CA  PHE C 307     140.468  89.271 164.714  1.00110.16           C  
ATOM   7845  C   PHE C 307     139.549  88.096 165.021  1.00110.16           C  
ATOM   7846  O   PHE C 307     140.019  87.080 165.544  1.00110.16           O  
ATOM   7847  CB  PHE C 307     140.727  90.073 165.990  1.00110.16           C  
ATOM   7848  CG  PHE C 307     141.322  89.259 167.105  1.00110.16           C  
ATOM   7849  CD1 PHE C 307     142.672  88.955 167.112  1.00110.16           C  
ATOM   7850  CD2 PHE C 307     140.530  88.797 168.143  1.00110.16           C  
ATOM   7851  CE1 PHE C 307     143.223  88.204 168.134  1.00110.16           C  
ATOM   7852  CE2 PHE C 307     141.075  88.046 169.168  1.00110.16           C  
ATOM   7853  CZ  PHE C 307     142.424  87.750 169.164  1.00110.16           C  
ATOM   7854  N   SER C 308     138.257  88.204 164.707  1.00104.65           N  
ATOM   7855  CA  SER C 308     137.342  87.099 164.977  1.00104.65           C  
ATOM   7856  C   SER C 308     137.625  85.920 164.056  1.00104.65           C  
ATOM   7857  O   SER C 308     137.829  84.791 164.518  1.00104.65           O  
ATOM   7858  CB  SER C 308     135.895  87.568 164.823  1.00104.65           C  
ATOM   7859  OG  SER C 308     135.620  87.934 163.482  1.00104.65           O  
ATOM   7860  N   GLN C 309     137.648  86.165 162.748  1.00103.12           N  
ATOM   7861  CA  GLN C 309     137.898  85.118 161.767  1.00103.12           C  
ATOM   7862  C   GLN C 309     138.326  85.735 160.442  1.00103.12           C  
ATOM   7863  O   GLN C 309     137.616  86.589 159.895  1.00103.12           O  
ATOM   7864  CB  GLN C 309     136.651  84.248 161.585  1.00103.12           C  
ATOM   7865  CG  GLN C 309     135.349  85.033 161.489  1.00103.12           C  
ATOM   7866  CD  GLN C 309     134.124  84.137 161.465  1.00103.12           C  
ATOM   7867  OE1 GLN C 309     134.237  82.911 161.458  1.00103.12           O  
ATOM   7868  NE2 GLN C 309     132.944  84.747 161.454  1.00103.12           N  
ATOM   7869  N   PRO C 310     139.479  85.335 159.895  1.00 97.56           N  
ATOM   7870  CA  PRO C 310     139.905  85.887 158.599  1.00 97.56           C  
ATOM   7871  C   PRO C 310     139.100  85.369 157.421  1.00 97.56           C  
ATOM   7872  O   PRO C 310     139.103  86.015 156.361  1.00 97.56           O  
ATOM   7873  CB  PRO C 310     141.374  85.453 158.499  1.00 97.56           C  
ATOM   7874  CG  PRO C 310     141.454  84.226 159.339  1.00 97.56           C  
ATOM   7875  CD  PRO C 310     140.488  84.433 160.473  1.00 97.56           C  
ATOM   7876  N   ALA C 311     138.424  84.226 157.564  1.00 89.25           N  
ATOM   7877  CA  ALA C 311     137.544  83.752 156.502  1.00 89.25           C  
ATOM   7878  C   ALA C 311     136.441  84.761 156.220  1.00 89.25           C  
ATOM   7879  O   ALA C 311     136.112  85.023 155.058  1.00 89.25           O  
ATOM   7880  CB  ALA C 311     136.951  82.394 156.875  1.00 89.25           C  
ATOM   7881  N   ARG C 312     135.868  85.348 157.274  1.00 87.75           N  
ATOM   7882  CA  ARG C 312     134.870  86.397 157.089  1.00 87.75           C  
ATOM   7883  C   ARG C 312     135.464  87.596 156.362  1.00 87.75           C  
ATOM   7884  O   ARG C 312     134.805  88.203 155.509  1.00 87.75           O  
ATOM   7885  CB  ARG C 312     134.296  86.817 158.442  1.00 87.75           C  
ATOM   7886  CG  ARG C 312     133.366  88.019 158.385  1.00 87.75           C  
ATOM   7887  CD  ARG C 312     132.106  87.719 157.591  1.00 87.75           C  
ATOM   7888  NE  ARG C 312     131.286  86.693 158.229  1.00 87.75           N  
ATOM   7889  CZ  ARG C 312     130.118  86.268 157.756  1.00 87.75           C  
ATOM   7890  NH1 ARG C 312     129.628  86.780 156.636  1.00 87.75           N  
ATOM   7891  NH2 ARG C 312     129.440  85.330 158.402  1.00 87.75           N  
ATOM   7892  N   ALA C 313     136.713  87.947 156.679  1.00 85.05           N  
ATOM   7893  CA  ALA C 313     137.358  89.078 156.019  1.00 85.05           C  
ATOM   7894  C   ALA C 313     137.518  88.821 154.526  1.00 85.05           C  
ATOM   7895  O   ALA C 313     137.168  89.670 153.695  1.00 85.05           O  
ATOM   7896  CB  ALA C 313     138.712  89.361 156.667  1.00 85.05           C  
ATOM   7897  N   ALA C 314     138.053  87.652 154.165  1.00 81.65           N  
ATOM   7898  CA  ALA C 314     138.217  87.323 152.752  1.00 81.65           C  
ATOM   7899  C   ALA C 314     136.869  87.246 152.045  1.00 81.65           C  
ATOM   7900  O   ALA C 314     136.742  87.659 150.884  1.00 81.65           O  
ATOM   7901  CB  ALA C 314     138.980  86.008 152.602  1.00 81.65           C  
ATOM   7902  N   ALA C 315     135.846  86.732 152.732  1.00 84.84           N  
ATOM   7903  CA  ALA C 315     134.518  86.655 152.137  1.00 84.84           C  
ATOM   7904  C   ALA C 315     133.968  88.045 151.844  1.00 84.84           C  
ATOM   7905  O   ALA C 315     133.426  88.294 150.762  1.00 84.84           O  
ATOM   7906  CB  ALA C 315     133.576  85.882 153.061  1.00 84.84           C  
ATOM   7907  N   ILE C 316     134.100  88.967 152.801  1.00 89.05           N  
ATOM   7908  CA  ILE C 316     133.610  90.328 152.596  1.00 89.05           C  
ATOM   7909  C   ILE C 316     134.390  91.014 151.481  1.00 89.05           C  
ATOM   7910  O   ILE C 316     133.824  91.766 150.676  1.00 89.05           O  
ATOM   7911  CB  ILE C 316     133.679  91.124 153.912  1.00 89.05           C  
ATOM   7912  CG1 ILE C 316     132.694  90.551 154.932  1.00 89.05           C  
ATOM   7913  CG2 ILE C 316     133.381  92.593 153.670  1.00 89.05           C  
ATOM   7914  CD1 ILE C 316     132.667  91.307 156.241  1.00 89.05           C  
ATOM   7915  N   ASP C 317     135.697  90.762 151.407  1.00 90.81           N  
ATOM   7916  CA  ASP C 317     136.493  91.327 150.323  1.00 90.81           C  
ATOM   7917  C   ASP C 317     135.993  90.837 148.966  1.00 90.81           C  
ATOM   7918  O   ASP C 317     135.816  91.628 148.030  1.00 90.81           O  
ATOM   7919  CB  ASP C 317     137.969  90.974 150.519  1.00 90.81           C  
ATOM   7920  CG  ASP C 317     138.656  91.868 151.534  1.00 90.81           C  
ATOM   7921  OD1 ASP C 317     138.024  92.838 151.998  1.00 90.81           O  
ATOM   7922  OD2 ASP C 317     139.824  91.586 151.878  1.00 90.81           O  
ATOM   7923  N   ARG C 318     135.757  89.528 148.844  1.00 95.77           N  
ATOM   7924  CA  ARG C 318     135.252  88.987 147.586  1.00 95.77           C  
ATOM   7925  C   ARG C 318     133.873  89.550 147.257  1.00 95.77           C  
ATOM   7926  O   ARG C 318     133.589  89.886 146.098  1.00 95.77           O  
ATOM   7927  CB  ARG C 318     135.209  87.461 147.652  1.00 95.77           C  
ATOM   7928  CG  ARG C 318     134.787  86.794 146.354  1.00 95.77           C  
ATOM   7929  CD  ARG C 318     135.722  87.169 145.215  1.00 95.77           C  
ATOM   7930  NE  ARG C 318     135.330  86.545 143.953  1.00 95.77           N  
ATOM   7931  CZ  ARG C 318     135.961  86.731 142.797  1.00 95.77           C  
ATOM   7932  NH1 ARG C 318     137.019  87.528 142.737  1.00 95.77           N  
ATOM   7933  NH2 ARG C 318     135.533  86.122 141.699  1.00 95.77           N  
ATOM   7934  N   TRP C 319     133.004  89.662 148.266  1.00 97.66           N  
ATOM   7935  CA  TRP C 319     131.676  90.228 148.054  1.00 97.66           C  
ATOM   7936  C   TRP C 319     131.768  91.645 147.508  1.00 97.66           C  
ATOM   7937  O   TRP C 319     131.079  92.000 146.547  1.00 97.66           O  
ATOM   7938  CB  TRP C 319     130.874  90.219 149.358  1.00 97.66           C  
ATOM   7939  CG  TRP C 319     130.275  88.896 149.717  1.00 97.66           C  
ATOM   7940  CD1 TRP C 319     130.481  88.190 150.865  1.00 97.66           C  
ATOM   7941  CD2 TRP C 319     129.364  88.122 148.928  1.00 97.66           C  
ATOM   7942  NE1 TRP C 319     129.759  87.023 150.839  1.00 97.66           N  
ATOM   7943  CE2 TRP C 319     129.065  86.957 149.661  1.00 97.66           C  
ATOM   7944  CE3 TRP C 319     128.774  88.300 147.674  1.00 97.66           C  
ATOM   7945  CZ2 TRP C 319     128.203  85.974 149.180  1.00 97.66           C  
ATOM   7946  CZ3 TRP C 319     127.920  87.323 147.198  1.00 97.66           C  
ATOM   7947  CH2 TRP C 319     127.642  86.175 147.949  1.00 97.66           C  
ATOM   7948  N   SER C 320     132.620  92.474 148.111  1.00 98.52           N  
ATOM   7949  CA  SER C 320     132.739  93.854 147.655  1.00 98.52           C  
ATOM   7950  C   SER C 320     133.329  93.926 146.251  1.00 98.52           C  
ATOM   7951  O   SER C 320     132.892  94.746 145.431  1.00 98.52           O  
ATOM   7952  CB  SER C 320     133.582  94.658 148.641  1.00 98.52           C  
ATOM   7953  OG  SER C 320     132.937  94.758 149.898  1.00 98.52           O  
ATOM   7954  N   ARG C 321     134.313  93.071 145.951  1.00 95.62           N  
ATOM   7955  CA  ARG C 321     134.913  93.080 144.620  1.00 95.62           C  
ATOM   7956  C   ARG C 321     133.902  92.684 143.552  1.00 95.62           C  
ATOM   7957  O   ARG C 321     133.938  93.206 142.432  1.00 95.62           O  
ATOM   7958  CB  ARG C 321     136.123  92.150 144.573  1.00 95.62           C  
ATOM   7959  CG  ARG C 321     137.291  92.596 145.429  1.00 95.62           C  
ATOM   7960  CD  ARG C 321     138.480  91.676 145.231  1.00 95.62           C  
ATOM   7961  NE  ARG C 321     139.423  91.754 146.340  1.00 95.62           N  
ATOM   7962  CZ  ARG C 321     139.436  90.909 147.364  1.00 95.62           C  
ATOM   7963  NH1 ARG C 321     138.556  89.918 147.417  1.00 95.62           N  
ATOM   7964  NH2 ARG C 321     140.331  91.050 148.330  1.00 95.62           N  
ATOM   7965  N   ILE C 322     132.998  91.751 143.871  1.00 95.99           N  
ATOM   7966  CA  ILE C 322     131.967  91.364 142.911  1.00 95.99           C  
ATOM   7967  C   ILE C 322     130.725  92.243 143.002  1.00 95.99           C  
ATOM   7968  O   ILE C 322     129.803  92.085 142.190  1.00 95.99           O  
ATOM   7969  CB  ILE C 322     131.577  89.880 143.080  1.00 95.99           C  
ATOM   7970  CG1 ILE C 322     130.887  89.644 144.424  1.00 95.99           C  
ATOM   7971  CG2 ILE C 322     132.803  88.989 142.950  1.00 95.99           C  
ATOM   7972  CD1 ILE C 322     130.552  88.190 144.679  1.00 95.99           C  
ATOM   7973  N   PHE C 323     130.673  93.164 143.964  1.00 99.88           N  
ATOM   7974  CA  PHE C 323     129.506  94.008 144.195  1.00 99.88           C  
ATOM   7975  C   PHE C 323     129.655  95.405 143.599  1.00 99.88           C  
ATOM   7976  O   PHE C 323     128.768  95.872 142.879  1.00 99.88           O  
ATOM   7977  CB  PHE C 323     129.251  94.087 145.708  1.00 99.88           C  
ATOM   7978  CG  PHE C 323     128.012  94.844 146.085  1.00 99.88           C  
ATOM   7979  CD1 PHE C 323     126.783  94.209 146.125  1.00 99.88           C  
ATOM   7980  CD2 PHE C 323     128.079  96.186 146.421  1.00 99.88           C  
ATOM   7981  CE1 PHE C 323     125.642  94.900 146.479  1.00 99.88           C  
ATOM   7982  CE2 PHE C 323     126.942  96.883 146.777  1.00 99.88           C  
ATOM   7983  CZ  PHE C 323     125.721  96.238 146.805  1.00 99.88           C  
ATOM   7984  N   PHE C 324     130.766  96.086 143.891  1.00 95.59           N  
ATOM   7985  CA  PHE C 324     130.889  97.502 143.533  1.00 95.59           C  
ATOM   7986  C   PHE C 324     130.910  97.776 142.030  1.00 95.59           C  
ATOM   7987  O   PHE C 324     130.199  98.698 141.586  1.00 95.59           O  
ATOM   7988  CB  PHE C 324     132.128  98.099 144.210  1.00 95.59           C  
ATOM   7989  CG  PHE C 324     131.841  98.764 145.526  1.00 95.59           C  
ATOM   7990  CD1 PHE C 324     130.574  98.708 146.086  1.00 95.59           C  
ATOM   7991  CD2 PHE C 324     132.832  99.461 146.196  1.00 95.59           C  
ATOM   7992  CE1 PHE C 324     130.307  99.324 147.296  1.00 95.59           C  
ATOM   7993  CE2 PHE C 324     132.571 100.079 147.406  1.00 95.59           C  
ATOM   7994  CZ  PHE C 324     131.307 100.011 147.956  1.00 95.59           C  
ATOM   7995  N   PRO C 325     131.704  97.078 141.205  1.00 91.19           N  
ATOM   7996  CA  PRO C 325     131.810  97.468 139.787  1.00 91.19           C  
ATOM   7997  C   PRO C 325     130.503  97.401 139.015  1.00 91.19           C  
ATOM   7998  O   PRO C 325     130.421  97.997 137.934  1.00 91.19           O  
ATOM   7999  CB  PRO C 325     132.833  96.474 139.222  1.00 91.19           C  
ATOM   8000  CG  PRO C 325     133.613  96.025 140.400  1.00 91.19           C  
ATOM   8001  CD  PRO C 325     132.627  95.973 141.522  1.00 91.19           C  
ATOM   8002  N   VAL C 326     129.490  96.706 139.522  1.00 89.65           N  
ATOM   8003  CA  VAL C 326     128.194  96.637 138.864  1.00 89.65           C  
ATOM   8004  C   VAL C 326     127.270  97.752 139.334  1.00 89.65           C  
ATOM   8005  O   VAL C 326     126.589  98.381 138.522  1.00 89.65           O  
ATOM   8006  CB  VAL C 326     127.550  95.253 139.089  1.00 89.65           C  
ATOM   8007  CG1 VAL C 326     126.213  95.169 138.374  1.00 89.65           C  
ATOM   8008  CG2 VAL C 326     128.482  94.151 138.614  1.00 89.65           C  
ATOM   8009  N   VAL C 327     127.249  98.016 140.642  1.00 93.45           N  
ATOM   8010  CA  VAL C 327     126.411  99.087 141.173  1.00 93.45           C  
ATOM   8011  C   VAL C 327     126.875 100.439 140.644  1.00 93.45           C  
ATOM   8012  O   VAL C 327     126.056 101.304 140.304  1.00 93.45           O  
ATOM   8013  CB  VAL C 327     126.410  99.051 142.712  1.00 93.45           C  
ATOM   8014  CG1 VAL C 327     125.493 100.129 143.270  1.00 93.45           C  
ATOM   8015  CG2 VAL C 327     125.994  97.675 143.208  1.00 93.45           C  
ATOM   8016  N   PHE C 328     128.193 100.642 140.562  1.00 92.51           N  
ATOM   8017  CA  PHE C 328     128.709 101.907 140.042  1.00 92.51           C  
ATOM   8018  C   PHE C 328     128.303 102.114 138.587  1.00 92.51           C  
ATOM   8019  O   PHE C 328     127.877 103.212 138.198  1.00 92.51           O  
ATOM   8020  CB  PHE C 328     130.228 101.945 140.192  1.00 92.51           C  
ATOM   8021  CG  PHE C 328     130.878 103.122 139.525  1.00 92.51           C  
ATOM   8022  CD1 PHE C 328     130.636 104.410 139.971  1.00 92.51           C  
ATOM   8023  CD2 PHE C 328     131.750 102.937 138.466  1.00 92.51           C  
ATOM   8024  CE1 PHE C 328     131.241 105.493 139.363  1.00 92.51           C  
ATOM   8025  CE2 PHE C 328     132.360 104.015 137.857  1.00 92.51           C  
ATOM   8026  CZ  PHE C 328     132.104 105.295 138.305  1.00 92.51           C  
ATOM   8027  N   SER C 329     128.420 101.068 137.769  1.00 91.89           N  
ATOM   8028  CA  SER C 329     128.028 101.179 136.370  1.00 91.89           C  
ATOM   8029  C   SER C 329     126.527 101.401 136.231  1.00 91.89           C  
ATOM   8030  O   SER C 329     126.087 102.153 135.356  1.00 91.89           O  
ATOM   8031  CB  SER C 329     128.468  99.935 135.602  1.00 91.89           C  
ATOM   8032  OG  SER C 329     129.880  99.817 135.598  1.00 91.89           O  
ATOM   8033  N   PHE C 330     125.724 100.768 137.090  1.00 89.79           N  
ATOM   8034  CA  PHE C 330     124.283 100.999 137.048  1.00 89.79           C  
ATOM   8035  C   PHE C 330     123.948 102.445 137.398  1.00 89.79           C  
ATOM   8036  O   PHE C 330     123.084 103.068 136.762  1.00 89.79           O  
ATOM   8037  CB  PHE C 330     123.570 100.038 137.998  1.00 89.79           C  
ATOM   8038  CG  PHE C 330     122.077 100.204 138.020  1.00 89.79           C  
ATOM   8039  CD1 PHE C 330     121.286  99.590 137.063  1.00 89.79           C  
ATOM   8040  CD2 PHE C 330     121.464 100.971 138.997  1.00 89.79           C  
ATOM   8041  CE1 PHE C 330     119.914  99.741 137.079  1.00 89.79           C  
ATOM   8042  CE2 PHE C 330     120.092 101.126 139.018  1.00 89.79           C  
ATOM   8043  CZ  PHE C 330     119.316 100.509 138.058  1.00 89.79           C  
ATOM   8044  N   PHE C 331     124.617 102.992 138.416  1.00 88.22           N  
ATOM   8045  CA  PHE C 331     124.406 104.390 138.772  1.00 88.22           C  
ATOM   8046  C   PHE C 331     124.772 105.310 137.617  1.00 88.22           C  
ATOM   8047  O   PHE C 331     124.040 106.260 137.317  1.00 88.22           O  
ATOM   8048  CB  PHE C 331     125.216 104.743 140.018  1.00 88.22           C  
ATOM   8049  CG  PHE C 331     125.146 106.195 140.395  1.00 88.22           C  
ATOM   8050  CD1 PHE C 331     124.052 106.693 141.083  1.00 88.22           C  
ATOM   8051  CD2 PHE C 331     126.177 107.061 140.069  1.00 88.22           C  
ATOM   8052  CE1 PHE C 331     123.984 108.029 141.433  1.00 88.22           C  
ATOM   8053  CE2 PHE C 331     126.115 108.397 140.416  1.00 88.22           C  
ATOM   8054  CZ  PHE C 331     125.017 108.882 141.100  1.00 88.22           C  
ATOM   8055  N   ASN C 332     125.902 105.045 136.955  1.00 86.53           N  
ATOM   8056  CA  ASN C 332     126.285 105.867 135.809  1.00 86.53           C  
ATOM   8057  C   ASN C 332     125.273 105.746 134.677  1.00 86.53           C  
ATOM   8058  O   ASN C 332     124.987 106.728 133.979  1.00 86.53           O  
ATOM   8059  CB  ASN C 332     127.676 105.475 135.319  1.00 86.53           C  
ATOM   8060  CG  ASN C 332     128.732 105.647 136.382  1.00 86.53           C  
ATOM   8061  OD1 ASN C 332     128.719 106.619 137.136  1.00 86.53           O  
ATOM   8062  ND2 ASN C 332     129.653 104.695 136.457  1.00 86.53           N  
ATOM   8063  N   ILE C 333     124.729 104.545 134.475  1.00 87.92           N  
ATOM   8064  CA  ILE C 333     123.703 104.345 133.455  1.00 87.92           C  
ATOM   8065  C   ILE C 333     122.499 105.233 133.738  1.00 87.92           C  
ATOM   8066  O   ILE C 333     122.027 105.969 132.863  1.00 87.92           O  
ATOM   8067  CB  ILE C 333     123.301 102.861 133.381  1.00 87.92           C  
ATOM   8068  CG1 ILE C 333     124.397 102.041 132.697  1.00 87.92           C  
ATOM   8069  CG2 ILE C 333     121.969 102.696 132.661  1.00 87.92           C  
ATOM   8070  CD1 ILE C 333     124.126 100.552 132.680  1.00 87.92           C  
ATOM   8071  N   VAL C 334     121.984 105.171 134.968  1.00 87.95           N  
ATOM   8072  CA  VAL C 334     120.822 105.986 135.321  1.00 87.95           C  
ATOM   8073  C   VAL C 334     121.148 107.468 135.184  1.00 87.95           C  
ATOM   8074  O   VAL C 334     120.333 108.257 134.692  1.00 87.95           O  
ATOM   8075  CB  VAL C 334     120.330 105.642 136.738  1.00 87.95           C  
ATOM   8076  CG1 VAL C 334     119.122 106.493 137.104  1.00 87.95           C  
ATOM   8077  CG2 VAL C 334     119.986 104.166 136.832  1.00 87.95           C  
ATOM   8078  N   TYR C 335     122.352 107.866 135.602  1.00 88.22           N  
ATOM   8079  CA  TYR C 335     122.773 109.261 135.514  1.00 88.22           C  
ATOM   8080  C   TYR C 335     122.727 109.764 134.076  1.00 88.22           C  
ATOM   8081  O   TYR C 335     122.066 110.766 133.768  1.00 88.22           O  
ATOM   8082  CB  TYR C 335     124.181 109.394 136.100  1.00 88.22           C  
ATOM   8083  CG  TYR C 335     124.851 110.739 135.926  1.00 88.22           C  
ATOM   8084  CD1 TYR C 335     125.626 111.012 134.806  1.00 88.22           C  
ATOM   8085  CD2 TYR C 335     124.740 111.720 136.899  1.00 88.22           C  
ATOM   8086  CE1 TYR C 335     126.251 112.232 134.651  1.00 88.22           C  
ATOM   8087  CE2 TYR C 335     125.364 112.942 136.754  1.00 88.22           C  
ATOM   8088  CZ  TYR C 335     126.116 113.194 135.627  1.00 88.22           C  
ATOM   8089  OH  TYR C 335     126.739 114.411 135.474  1.00 88.22           O  
ATOM   8090  N   TRP C 336     123.438 109.079 133.179  1.00 85.30           N  
ATOM   8091  CA  TRP C 336     123.532 109.547 131.802  1.00 85.30           C  
ATOM   8092  C   TRP C 336     122.214 109.395 131.055  1.00 85.30           C  
ATOM   8093  O   TRP C 336     121.964 110.137 130.100  1.00 85.30           O  
ATOM   8094  CB  TRP C 336     124.653 108.814 131.071  1.00 85.30           C  
ATOM   8095  CG  TRP C 336     126.011 109.217 131.543  1.00 85.30           C  
ATOM   8096  CD1 TRP C 336     126.817 108.532 132.401  1.00 85.30           C  
ATOM   8097  CD2 TRP C 336     126.717 110.410 131.195  1.00 85.30           C  
ATOM   8098  NE1 TRP C 336     127.987 109.222 132.605  1.00 85.30           N  
ATOM   8099  CE2 TRP C 336     127.950 110.379 131.874  1.00 85.30           C  
ATOM   8100  CE3 TRP C 336     126.429 111.500 130.372  1.00 85.30           C  
ATOM   8101  CZ2 TRP C 336     128.891 111.396 131.757  1.00 85.30           C  
ATOM   8102  CZ3 TRP C 336     127.366 112.508 130.256  1.00 85.30           C  
ATOM   8103  CH2 TRP C 336     128.582 112.449 130.944  1.00 85.30           C  
ATOM   8104  N   LEU C 337     121.359 108.452 131.459  1.00 83.49           N  
ATOM   8105  CA  LEU C 337     120.046 108.363 130.835  1.00 83.49           C  
ATOM   8106  C   LEU C 337     119.058 109.370 131.405  1.00 83.49           C  
ATOM   8107  O   LEU C 337     118.017 109.613 130.786  1.00 83.49           O  
ATOM   8108  CB  LEU C 337     119.483 106.947 130.974  1.00 83.49           C  
ATOM   8109  CG  LEU C 337     120.106 105.894 130.056  1.00 83.49           C  
ATOM   8110  CD1 LEU C 337     119.412 104.551 130.221  1.00 83.49           C  
ATOM   8111  CD2 LEU C 337     120.054 106.350 128.606  1.00 83.49           C  
ATOM   8112  N   TYR C 338     119.354 109.957 132.565  1.00 84.62           N  
ATOM   8113  CA  TYR C 338     118.474 110.967 133.136  1.00 84.62           C  
ATOM   8114  C   TYR C 338     118.850 112.380 132.709  1.00 84.62           C  
ATOM   8115  O   TYR C 338     117.966 113.221 132.511  1.00 84.62           O  
ATOM   8116  CB  TYR C 338     118.483 110.867 134.663  1.00 84.62           C  
ATOM   8117  CG  TYR C 338     117.379 111.651 135.333  1.00 84.62           C  
ATOM   8118  CD1 TYR C 338     116.135 111.077 135.560  1.00 84.62           C  
ATOM   8119  CD2 TYR C 338     117.579 112.963 135.741  1.00 84.62           C  
ATOM   8120  CE1 TYR C 338     115.123 111.786 136.172  1.00 84.62           C  
ATOM   8121  CE2 TYR C 338     116.572 113.679 136.354  1.00 84.62           C  
ATOM   8122  CZ  TYR C 338     115.346 113.085 136.567  1.00 84.62           C  
ATOM   8123  OH  TYR C 338     114.336 113.791 137.177  1.00 84.62           O  
ATOM   8124  N   TYR C 339     120.143 112.669 132.568  1.00 85.43           N  
ATOM   8125  CA  TYR C 339     120.569 114.003 132.159  1.00 85.43           C  
ATOM   8126  C   TYR C 339     120.685 114.168 130.651  1.00 85.43           C  
ATOM   8127  O   TYR C 339     121.077 115.246 130.192  1.00 85.43           O  
ATOM   8128  CB  TYR C 339     121.907 114.359 132.810  1.00 85.43           C  
ATOM   8129  CG  TYR C 339     121.768 114.787 134.246  1.00 85.43           C  
ATOM   8130  CD1 TYR C 339     120.630 115.451 134.681  1.00 85.43           C  
ATOM   8131  CD2 TYR C 339     122.766 114.520 135.168  1.00 85.43           C  
ATOM   8132  CE1 TYR C 339     120.494 115.842 135.995  1.00 85.43           C  
ATOM   8133  CE2 TYR C 339     122.637 114.902 136.483  1.00 85.43           C  
ATOM   8134  CZ  TYR C 339     121.501 115.565 136.892  1.00 85.43           C  
ATOM   8135  OH  TYR C 339     121.373 115.953 138.204  1.00 85.43           O  
ATOM   8136  N   VAL C 340     120.374 113.137 129.875  1.00 86.96           N  
ATOM   8137  CA  VAL C 340     120.402 113.241 128.424  1.00 86.96           C  
ATOM   8138  C   VAL C 340     119.104 112.686 127.853  1.00 86.96           C  
ATOM   8139  O   VAL C 340     118.481 113.289 126.979  1.00 86.96           O  
ATOM   8140  CB  VAL C 340     121.620 112.514 127.829  1.00 86.96           C  
ATOM   8141  CG1 VAL C 340     121.555 112.526 126.311  1.00 86.96           C  
ATOM   8142  CG2 VAL C 340     122.910 113.157 128.307  1.00 86.96           C  
TER    8143      VAL C 340                                                      
ATOM   8144  N   ASN D  11      96.310 170.632 109.698  1.00 73.43           N  
ATOM   8145  CA  ASN D  11      97.707 170.230 109.578  1.00 73.43           C  
ATOM   8146  C   ASN D  11      98.423 170.316 110.920  1.00 73.43           C  
ATOM   8147  O   ASN D  11      97.789 170.390 111.972  1.00 73.43           O  
ATOM   8148  CB  ASN D  11      98.427 171.099 108.547  1.00 73.43           C  
ATOM   8149  CG  ASN D  11      97.732 171.103 107.205  1.00 73.43           C  
ATOM   8150  OD1 ASN D  11      97.399 172.160 106.671  1.00 73.43           O  
ATOM   8151  ND2 ASN D  11      97.503 169.917 106.654  1.00 73.43           N  
ATOM   8152  N   THR D  12      99.755 170.299 110.874  1.00 67.69           N  
ATOM   8153  CA  THR D  12     100.552 170.439 112.085  1.00 67.69           C  
ATOM   8154  C   THR D  12     100.748 171.893 112.490  1.00 67.69           C  
ATOM   8155  O   THR D  12     101.215 172.153 113.605  1.00 67.69           O  
ATOM   8156  CB  THR D  12     101.915 169.773 111.900  1.00 67.69           C  
ATOM   8157  OG1 THR D  12     102.662 170.484 110.907  1.00 67.69           O  
ATOM   8158  CG2 THR D  12     101.741 168.333 111.454  1.00 67.69           C  
ATOM   8159  N   THR D  13     100.422 172.839 111.607  1.00 58.48           N  
ATOM   8160  CA  THR D  13     100.615 174.248 111.930  1.00 58.48           C  
ATOM   8161  C   THR D  13      99.725 174.676 113.089  1.00 58.48           C  
ATOM   8162  O   THR D  13     100.131 175.494 113.923  1.00 58.48           O  
ATOM   8163  CB  THR D  13     100.346 175.106 110.697  1.00 58.48           C  
ATOM   8164  OG1 THR D  13     101.162 174.646 109.614  1.00 58.48           O  
ATOM   8165  CG2 THR D  13     100.672 176.560 110.983  1.00 58.48           C  
ATOM   8166  N   VAL D  14      98.508 174.132 113.162  1.00 53.79           N  
ATOM   8167  CA  VAL D  14      97.625 174.433 114.286  1.00 53.79           C  
ATOM   8168  C   VAL D  14      98.288 174.035 115.597  1.00 53.79           C  
ATOM   8169  O   VAL D  14      98.339 174.817 116.556  1.00 53.79           O  
ATOM   8170  CB  VAL D  14      96.271 173.727 114.108  1.00 53.79           C  
ATOM   8171  CG1 VAL D  14      95.388 173.976 115.316  1.00 53.79           C  
ATOM   8172  CG2 VAL D  14      95.591 174.201 112.839  1.00 53.79           C  
ATOM   8173  N   PHE D  15      98.813 172.810 115.653  1.00 49.61           N  
ATOM   8174  CA  PHE D  15      99.438 172.332 116.879  1.00 49.61           C  
ATOM   8175  C   PHE D  15     100.700 173.118 117.200  1.00 49.61           C  
ATOM   8176  O   PHE D  15     100.983 173.392 118.371  1.00 49.61           O  
ATOM   8177  CB  PHE D  15      99.741 170.842 116.763  1.00 49.61           C  
ATOM   8178  CG  PHE D  15      98.517 169.987 116.688  1.00 49.61           C  
ATOM   8179  CD1 PHE D  15      97.868 169.585 117.840  1.00 49.61           C  
ATOM   8180  CD2 PHE D  15      98.009 169.589 115.466  1.00 49.61           C  
ATOM   8181  CE1 PHE D  15      96.737 168.800 117.776  1.00 49.61           C  
ATOM   8182  CE2 PHE D  15      96.878 168.803 115.395  1.00 49.61           C  
ATOM   8183  CZ  PHE D  15      96.241 168.408 116.553  1.00 49.61           C  
ATOM   8184  N   THR D  16     101.468 173.497 116.179  1.00 44.84           N  
ATOM   8185  CA  THR D  16     102.672 174.282 116.429  1.00 44.84           C  
ATOM   8186  C   THR D  16     102.327 175.650 117.000  1.00 44.84           C  
ATOM   8187  O   THR D  16     102.990 176.131 117.926  1.00 44.84           O  
ATOM   8188  CB  THR D  16     103.488 174.426 115.147  1.00 44.84           C  
ATOM   8189  OG1 THR D  16     103.968 173.140 114.744  1.00 44.84           O  
ATOM   8190  CG2 THR D  16     104.670 175.352 115.369  1.00 44.84           C  
ATOM   8191  N   ARG D  17     101.284 176.290 116.470  1.00 47.44           N  
ATOM   8192  CA  ARG D  17     100.867 177.577 117.013  1.00 47.44           C  
ATOM   8193  C   ARG D  17     100.367 177.430 118.442  1.00 47.44           C  
ATOM   8194  O   ARG D  17     100.681 178.261 119.305  1.00 47.44           O  
ATOM   8195  CB  ARG D  17      99.795 178.205 116.125  1.00 47.44           C  
ATOM   8196  CG  ARG D  17     100.336 178.718 114.804  1.00 47.44           C  
ATOM   8197  CD  ARG D  17      99.246 179.337 113.952  1.00 47.44           C  
ATOM   8198  NE  ARG D  17      99.774 179.861 112.697  1.00 47.44           N  
ATOM   8199  CZ  ARG D  17      99.038 180.467 111.773  1.00 47.44           C  
ATOM   8200  NH1 ARG D  17      99.603 180.914 110.661  1.00 47.44           N  
ATOM   8201  NH2 ARG D  17      97.735 180.628 111.960  1.00 47.44           N  
ATOM   8202  N   ILE D  18      99.595 176.377 118.715  1.00 42.65           N  
ATOM   8203  CA  ILE D  18      99.140 176.125 120.081  1.00 42.65           C  
ATOM   8204  C   ILE D  18     100.332 175.975 121.017  1.00 42.65           C  
ATOM   8205  O   ILE D  18     100.381 176.580 122.094  1.00 42.65           O  
ATOM   8206  CB  ILE D  18      98.229 174.886 120.126  1.00 42.65           C  
ATOM   8207  CG1 ILE D  18      96.797 175.265 119.751  1.00 42.65           C  
ATOM   8208  CG2 ILE D  18      98.265 174.244 121.497  1.00 42.65           C  
ATOM   8209  CD1 ILE D  18      95.821 174.114 119.837  1.00 42.65           C  
ATOM   8210  N   LEU D  19     101.323 175.183 120.606  1.00 33.84           N  
ATOM   8211  CA  LEU D  19     102.471 174.917 121.465  1.00 33.84           C  
ATOM   8212  C   LEU D  19     103.294 176.176 121.700  1.00 33.84           C  
ATOM   8213  O   LEU D  19     103.781 176.406 122.812  1.00 33.84           O  
ATOM   8214  CB  LEU D  19     103.339 173.826 120.846  1.00 33.84           C  
ATOM   8215  CG  LEU D  19     103.853 172.744 121.786  1.00 33.84           C  
ATOM   8216  CD1 LEU D  19     102.704 171.881 122.251  1.00 33.84           C  
ATOM   8217  CD2 LEU D  19     104.894 171.909 121.078  1.00 33.84           C  
ATOM   8218  N   ASP D  20     103.471 176.997 120.665  1.00 42.23           N  
ATOM   8219  CA  ASP D  20     104.271 178.205 120.826  1.00 42.23           C  
ATOM   8220  C   ASP D  20     103.551 179.236 121.681  1.00 42.23           C  
ATOM   8221  O   ASP D  20     104.189 179.960 122.452  1.00 42.23           O  
ATOM   8222  CB  ASP D  20     104.629 178.784 119.462  1.00 42.23           C  
ATOM   8223  CG  ASP D  20     105.620 177.924 118.715  1.00 42.23           C  
ATOM   8224  OD1 ASP D  20     106.443 177.262 119.381  1.00 42.23           O  
ATOM   8225  OD2 ASP D  20     105.576 177.903 117.468  1.00 42.23           O  
ATOM   8226  N   ARG D  21     102.225 179.329 121.559  1.00 45.56           N  
ATOM   8227  CA  ARG D  21     101.482 180.189 122.472  1.00 45.56           C  
ATOM   8228  C   ARG D  21     101.546 179.660 123.896  1.00 45.56           C  
ATOM   8229  O   ARG D  21     101.543 180.443 124.852  1.00 45.56           O  
ATOM   8230  CB  ARG D  21     100.030 180.315 122.020  1.00 45.56           C  
ATOM   8231  CG  ARG D  21      99.197 181.247 122.879  1.00 45.56           C  
ATOM   8232  CD  ARG D  21      97.735 181.213 122.473  1.00 45.56           C  
ATOM   8233  NE  ARG D  21      97.118 179.924 122.769  1.00 45.56           N  
ATOM   8234  CZ  ARG D  21      96.508 179.634 123.914  1.00 45.56           C  
ATOM   8235  NH1 ARG D  21      95.974 178.436 124.098  1.00 45.56           N  
ATOM   8236  NH2 ARG D  21      96.433 180.543 124.875  1.00 45.56           N  
ATOM   8237  N   LEU D  22     101.611 178.337 124.052  1.00 36.89           N  
ATOM   8238  CA  LEU D  22     101.671 177.736 125.379  1.00 36.89           C  
ATOM   8239  C   LEU D  22     103.003 178.025 126.062  1.00 36.89           C  
ATOM   8240  O   LEU D  22     103.036 178.539 127.185  1.00 36.89           O  
ATOM   8241  CB  LEU D  22     101.429 176.232 125.258  1.00 36.89           C  
ATOM   8242  CG  LEU D  22     101.494 175.340 126.489  1.00 36.89           C  
ATOM   8243  CD1 LEU D  22     100.487 174.226 126.335  1.00 36.89           C  
ATOM   8244  CD2 LEU D  22     102.884 174.762 126.644  1.00 36.89           C  
ATOM   8245  N   LEU D  23     104.114 177.701 125.397  1.00 33.71           N  
ATOM   8246  CA  LEU D  23     105.430 177.902 125.994  1.00 33.71           C  
ATOM   8247  C   LEU D  23     105.797 179.372 126.134  1.00 33.71           C  
ATOM   8248  O   LEU D  23     106.773 179.686 126.822  1.00 33.71           O  
ATOM   8249  CB  LEU D  23     106.508 177.195 125.178  1.00 33.71           C  
ATOM   8250  CG  LEU D  23     106.605 175.683 125.357  1.00 33.71           C  
ATOM   8251  CD1 LEU D  23     107.845 175.142 124.673  1.00 33.71           C  
ATOM   8252  CD2 LEU D  23     106.617 175.338 126.827  1.00 33.71           C  
ATOM   8253  N   ASP D  24     105.063 180.272 125.487  1.00 42.71           N  
ATOM   8254  CA  ASP D  24     105.364 181.692 125.602  1.00 42.71           C  
ATOM   8255  C   ASP D  24     105.068 182.187 127.012  1.00 42.71           C  
ATOM   8256  O   ASP D  24     103.982 181.957 127.549  1.00 42.71           O  
ATOM   8257  CB  ASP D  24     104.553 182.487 124.582  1.00 42.71           C  
ATOM   8258  CG  ASP D  24     104.933 183.952 124.550  1.00 42.71           C  
ATOM   8259  OD1 ASP D  24     105.941 184.320 125.189  1.00 42.71           O  
ATOM   8260  OD2 ASP D  24     104.225 184.737 123.885  1.00 42.71           O  
ATOM   8261  N   GLY D  25     106.042 182.868 127.609  1.00 37.67           N  
ATOM   8262  CA  GLY D  25     105.868 183.442 128.927  1.00 37.67           C  
ATOM   8263  C   GLY D  25     105.923 182.464 130.077  1.00 37.67           C  
ATOM   8264  O   GLY D  25     105.712 182.873 131.224  1.00 37.67           O  
ATOM   8265  N   TYR D  26     106.203 181.192 129.818  1.00 32.12           N  
ATOM   8266  CA  TYR D  26     106.274 180.175 130.859  1.00 32.12           C  
ATOM   8267  C   TYR D  26     107.685 180.183 131.435  1.00 32.12           C  
ATOM   8268  O   TYR D  26     108.639 179.785 130.760  1.00 32.12           O  
ATOM   8269  CB  TYR D  26     105.915 178.799 130.305  1.00 32.12           C  
ATOM   8270  CG  TYR D  26     105.892 177.715 131.348  1.00 32.12           C  
ATOM   8271  CD1 TYR D  26     104.741 177.445 132.064  1.00 32.12           C  
ATOM   8272  CD2 TYR D  26     107.019 176.964 131.619  1.00 32.12           C  
ATOM   8273  CE1 TYR D  26     104.713 176.458 133.020  1.00 32.12           C  
ATOM   8274  CE2 TYR D  26     107.000 175.976 132.575  1.00 32.12           C  
ATOM   8275  CZ  TYR D  26     105.844 175.727 133.273  1.00 32.12           C  
ATOM   8276  OH  TYR D  26     105.817 174.741 134.229  1.00 32.12           O  
ATOM   8277  N   ASP D  27     107.813 180.624 132.682  1.00 33.51           N  
ATOM   8278  CA  ASP D  27     109.106 180.756 133.342  1.00 33.51           C  
ATOM   8279  C   ASP D  27     109.366 179.490 134.147  1.00 33.51           C  
ATOM   8280  O   ASP D  27     108.663 179.211 135.123  1.00 33.51           O  
ATOM   8281  CB  ASP D  27     109.132 181.993 134.234  1.00 33.51           C  
ATOM   8282  CG  ASP D  27     110.533 182.502 134.480  1.00 33.51           C  
ATOM   8283  OD1 ASP D  27     111.484 181.932 133.906  1.00 33.51           O  
ATOM   8284  OD2 ASP D  27     110.686 183.476 135.243  1.00 33.51           O  
ATOM   8285  N   ASN D  28     110.385 178.731 133.745  1.00 27.65           N  
ATOM   8286  CA  ASN D  28     110.630 177.427 134.345  1.00 27.65           C  
ATOM   8287  C   ASN D  28     111.262 177.510 135.726  1.00 27.65           C  
ATOM   8288  O   ASN D  28     111.242 176.515 136.454  1.00 27.65           O  
ATOM   8289  CB  ASN D  28     111.518 176.593 133.433  1.00 27.65           C  
ATOM   8290  CG  ASN D  28     112.619 177.407 132.804  1.00 27.65           C  
ATOM   8291  OD1 ASN D  28     112.860 178.546 133.194  1.00 27.65           O  
ATOM   8292  ND2 ASN D  28     113.297 176.828 131.824  1.00 27.65           N  
ATOM   8293  N   ARG D  29     111.835 178.652 136.101  1.00 28.45           N  
ATOM   8294  CA  ARG D  29     112.450 178.755 137.420  1.00 28.45           C  
ATOM   8295  C   ARG D  29     111.403 178.716 138.524  1.00 28.45           C  
ATOM   8296  O   ARG D  29     111.682 178.253 139.635  1.00 28.45           O  
ATOM   8297  CB  ARG D  29     113.283 180.028 137.514  1.00 28.45           C  
ATOM   8298  CG  ARG D  29     114.508 180.015 136.633  1.00 28.45           C  
ATOM   8299  CD  ARG D  29     115.244 181.332 136.701  1.00 28.45           C  
ATOM   8300  NE  ARG D  29     114.419 182.433 136.221  1.00 28.45           N  
ATOM   8301  CZ  ARG D  29     114.326 182.792 134.947  1.00 28.45           C  
ATOM   8302  NH1 ARG D  29     115.005 182.132 134.022  1.00 28.45           N  
ATOM   8303  NH2 ARG D  29     113.550 183.806 134.599  1.00 28.45           N  
ATOM   8304  N   LEU D  30     110.202 179.207 138.245  1.00 29.08           N  
ATOM   8305  CA  LEU D  30     109.131 179.198 139.227  1.00 29.08           C  
ATOM   8306  C   LEU D  30     108.364 177.882 139.178  1.00 29.08           C  
ATOM   8307  O   LEU D  30     108.265 177.234 138.135  1.00 29.08           O  
ATOM   8308  CB  LEU D  30     108.167 180.358 138.986  1.00 29.08           C  
ATOM   8309  CG  LEU D  30     108.538 181.755 139.484  1.00 29.08           C  
ATOM   8310  CD1 LEU D  30     109.792 182.283 138.820  1.00 29.08           C  
ATOM   8311  CD2 LEU D  30     107.376 182.698 139.243  1.00 29.08           C  
ATOM   8312  N   ARG D  31     107.818 177.495 140.318  1.00 26.74           N  
ATOM   8313  CA  ARG D  31     106.966 176.320 140.415  1.00 26.74           C  
ATOM   8314  C   ARG D  31     105.516 176.715 140.191  1.00 26.74           C  
ATOM   8315  O   ARG D  31     105.165 177.893 140.245  1.00 26.74           O  
ATOM   8316  CB  ARG D  31     107.160 175.661 141.776  1.00 26.74           C  
ATOM   8317  CG  ARG D  31     106.843 176.559 142.945  1.00 26.74           C  
ATOM   8318  CD  ARG D  31     107.135 175.857 144.249  1.00 26.74           C  
ATOM   8319  NE  ARG D  31     106.836 176.708 145.391  1.00 26.74           N  
ATOM   8320  CZ  ARG D  31     105.653 176.754 145.987  1.00 26.74           C  
ATOM   8321  NH1 ARG D  31     104.663 175.994 145.545  1.00 26.74           N  
ATOM   8322  NH2 ARG D  31     105.459 177.558 147.021  1.00 26.74           N  
ATOM   8323  N   PRO D  32     104.632 175.753 139.921  1.00 30.15           N  
ATOM   8324  CA  PRO D  32     103.233 176.103 139.644  1.00 30.15           C  
ATOM   8325  C   PRO D  32     102.508 176.517 140.915  1.00 30.15           C  
ATOM   8326  O   PRO D  32     102.569 175.826 141.933  1.00 30.15           O  
ATOM   8327  CB  PRO D  32     102.653 174.808 139.067  1.00 30.15           C  
ATOM   8328  CG  PRO D  32     103.491 173.748 139.648  1.00 30.15           C  
ATOM   8329  CD  PRO D  32     104.873 174.316 139.722  1.00 30.15           C  
ATOM   8330  N   GLY D  33     101.818 177.652 140.849  1.00 36.01           N  
ATOM   8331  CA  GLY D  33     101.069 178.149 141.984  1.00 36.01           C  
ATOM   8332  C   GLY D  33     101.959 178.616 143.113  1.00 36.01           C  
ATOM   8333  O   GLY D  33     101.973 178.015 144.190  1.00 36.01           O  
ATOM   8334  N   LEU D  34     102.709 179.693 142.881  1.00 33.36           N  
ATOM   8335  CA  LEU D  34     103.681 180.142 143.870  1.00 33.36           C  
ATOM   8336  C   LEU D  34     102.994 180.802 145.060  1.00 33.36           C  
ATOM   8337  O   LEU D  34     103.087 180.319 146.193  1.00 33.36           O  
ATOM   8338  CB  LEU D  34     104.680 181.095 143.220  1.00 33.36           C  
ATOM   8339  CG  LEU D  34     105.824 181.546 144.123  1.00 33.36           C  
ATOM   8340  CD1 LEU D  34     106.482 180.346 144.766  1.00 33.36           C  
ATOM   8341  CD2 LEU D  34     106.834 182.325 143.320  1.00 33.36           C  
ATOM   8342  N   GLY D  35     102.294 181.912 144.822  1.00 41.29           N  
ATOM   8343  CA  GLY D  35     101.624 182.596 145.914  1.00 41.29           C  
ATOM   8344  C   GLY D  35     100.407 181.853 146.423  1.00 41.29           C  
ATOM   8345  O   GLY D  35      99.973 182.068 147.557  1.00 41.29           O  
ATOM   8346  N   GLU D  36      99.851 180.970 145.604  1.00 43.89           N  
ATOM   8347  CA  GLU D  36      98.652 180.213 145.929  1.00 43.89           C  
ATOM   8348  C   GLU D  36      99.047 178.927 146.659  1.00 43.89           C  
ATOM   8349  O   GLU D  36     100.146 178.820 147.206  1.00 43.89           O  
ATOM   8350  CB  GLU D  36      97.843 179.942 144.660  1.00 43.89           C  
ATOM   8351  CG  GLU D  36      97.276 181.184 144.012  1.00 43.89           C  
ATOM   8352  CD  GLU D  36      96.394 180.854 142.830  1.00 43.89           C  
ATOM   8353  OE1 GLU D  36      96.393 179.683 142.398  1.00 43.89           O  
ATOM   8354  OE2 GLU D  36      95.699 181.764 142.334  1.00 43.89           O  
ATOM   8355  N   ARG D  37      98.135 177.958 146.702  1.00 33.76           N  
ATOM   8356  CA  ARG D  37      98.320 176.698 147.412  1.00 33.76           C  
ATOM   8357  C   ARG D  37      99.598 175.972 147.019  1.00 33.76           C  
ATOM   8358  O   ARG D  37     100.211 176.271 145.990  1.00 33.76           O  
ATOM   8359  CB  ARG D  37      97.130 175.771 147.160  1.00 33.76           C  
ATOM   8360  CG  ARG D  37      97.193 175.004 145.838  1.00 33.76           C  
ATOM   8361  CD  ARG D  37      96.893 175.894 144.642  1.00 33.76           C  
ATOM   8362  NE  ARG D  37      96.789 175.133 143.400  1.00 33.76           N  
ATOM   8363  CZ  ARG D  37      97.772 175.003 142.516  1.00 33.76           C  
ATOM   8364  NH1 ARG D  37      98.940 175.587 142.730  1.00 33.76           N  
ATOM   8365  NH2 ARG D  37      97.586 174.293 141.413  1.00 33.76           N  
ATOM   8366  N   VAL D  38     100.001 175.013 147.843  1.00 25.68           N  
ATOM   8367  CA  VAL D  38     101.209 174.236 147.607  1.00 25.68           C  
ATOM   8368  C   VAL D  38     101.005 173.328 146.403  1.00 25.68           C  
ATOM   8369  O   VAL D  38      99.888 172.902 146.096  1.00 25.68           O  
ATOM   8370  CB  VAL D  38     101.569 173.427 148.867  1.00 25.68           C  
ATOM   8371  CG1 VAL D  38     101.333 174.266 150.099  1.00 25.68           C  
ATOM   8372  CG2 VAL D  38     100.748 172.154 148.940  1.00 25.68           C  
ATOM   8373  N   THR D  39     102.094 173.046 145.697  1.00 25.32           N  
ATOM   8374  CA  THR D  39     102.039 172.110 144.584  1.00 25.32           C  
ATOM   8375  C   THR D  39     102.116 170.685 145.109  1.00 25.32           C  
ATOM   8376  O   THR D  39     102.978 170.366 145.929  1.00 25.32           O  
ATOM   8377  CB  THR D  39     103.180 172.374 143.611  1.00 25.32           C  
ATOM   8378  OG1 THR D  39     102.879 173.533 142.827  1.00 25.32           O  
ATOM   8379  CG2 THR D  39     103.384 171.189 142.698  1.00 25.32           C  
ATOM   8380  N   GLU D  40     101.219 169.827 144.636  1.00 28.08           N  
ATOM   8381  CA  GLU D  40     101.128 168.454 145.109  1.00 28.08           C  
ATOM   8382  C   GLU D  40     101.512 167.504 143.987  1.00 28.08           C  
ATOM   8383  O   GLU D  40     100.912 167.537 142.911  1.00 28.08           O  
ATOM   8384  CB  GLU D  40      99.718 168.142 145.607  1.00 28.08           C  
ATOM   8385  CG  GLU D  40      99.583 166.777 146.236  1.00 28.08           C  
ATOM   8386  CD  GLU D  40      98.359 166.664 147.122  1.00 28.08           C  
ATOM   8387  OE1 GLU D  40      97.712 167.701 147.379  1.00 28.08           O  
ATOM   8388  OE2 GLU D  40      98.043 165.539 147.564  1.00 28.08           O  
ATOM   8389  N   VAL D  41     102.502 166.658 144.245  1.00 20.52           N  
ATOM   8390  CA  VAL D  41     103.035 165.729 143.258  1.00 20.52           C  
ATOM   8391  C   VAL D  41     102.636 164.315 143.648  1.00 20.52           C  
ATOM   8392  O   VAL D  41     102.743 163.935 144.818  1.00 20.52           O  
ATOM   8393  CB  VAL D  41     104.563 165.857 143.152  1.00 20.52           C  
ATOM   8394  CG1 VAL D  41     105.128 164.725 142.340  1.00 20.52           C  
ATOM   8395  CG2 VAL D  41     104.926 167.173 142.525  1.00 20.52           C  
ATOM   8396  N   LYS D  42     102.177 163.537 142.673  1.00 39.51           N  
ATOM   8397  CA  LYS D  42     101.761 162.161 142.894  1.00 39.51           C  
ATOM   8398  C   LYS D  42     102.765 161.224 142.243  1.00 39.51           C  
ATOM   8399  O   LYS D  42     103.098 161.392 141.067  1.00 39.51           O  
ATOM   8400  CB  LYS D  42     100.364 161.921 142.331  1.00 39.51           C  
ATOM   8401  CG  LYS D  42      99.314 162.815 142.941  1.00 39.51           C  
ATOM   8402  CD  LYS D  42      97.962 162.555 142.327  1.00 39.51           C  
ATOM   8403  CE  LYS D  42      96.904 163.435 142.952  1.00 39.51           C  
ATOM   8404  NZ  LYS D  42      95.564 163.134 142.389  1.00 39.51           N  
ATOM   8405  N   THR D  43     103.225 160.233 142.999  1.00 23.61           N  
ATOM   8406  CA  THR D  43     104.337 159.381 142.605  1.00 23.61           C  
ATOM   8407  C   THR D  43     103.868 157.944 142.429  1.00 23.61           C  
ATOM   8408  O   THR D  43     102.913 157.511 143.077  1.00 23.61           O  
ATOM   8409  CB  THR D  43     105.444 159.444 143.656  1.00 23.61           C  
ATOM   8410  OG1 THR D  43     105.796 160.811 143.885  1.00 23.61           O  
ATOM   8411  CG2 THR D  43     106.675 158.696 143.204  1.00 23.61           C  
ATOM   8412  N   ASP D  44     104.531 157.213 141.537  1.00 30.91           N  
ATOM   8413  CA  ASP D  44     104.277 155.792 141.363  1.00 30.91           C  
ATOM   8414  C   ASP D  44     105.564 155.100 140.940  1.00 30.91           C  
ATOM   8415  O   ASP D  44     106.400 155.681 140.242  1.00 30.91           O  
ATOM   8416  CB  ASP D  44     103.177 155.540 140.332  1.00 30.91           C  
ATOM   8417  CG  ASP D  44     102.765 154.088 140.269  1.00 30.91           C  
ATOM   8418  OD1 ASP D  44     103.325 153.281 141.037  1.00 30.91           O  
ATOM   8419  OD2 ASP D  44     101.879 153.752 139.455  1.00 30.91           O  
ATOM   8420  N   ILE D  45     105.711 153.846 141.360  1.00 39.51           N  
ATOM   8421  CA  ILE D  45     106.899 153.054 141.073  1.00 39.51           C  
ATOM   8422  C   ILE D  45     106.478 151.688 140.553  1.00 39.51           C  
ATOM   8423  O   ILE D  45     105.676 150.990 141.188  1.00 39.51           O  
ATOM   8424  CB  ILE D  45     107.799 152.906 142.312  1.00 39.51           C  
ATOM   8425  CG1 ILE D  45     108.457 154.237 142.638  1.00 39.51           C  
ATOM   8426  CG2 ILE D  45     108.856 151.858 142.082  1.00 39.51           C  
ATOM   8427  CD1 ILE D  45     109.475 154.139 143.734  1.00 39.51           C  
ATOM   8428  N   PHE D  46     107.024 151.310 139.403  1.00 21.42           N  
ATOM   8429  CA  PHE D  46     106.820 150.001 138.797  1.00 21.42           C  
ATOM   8430  C   PHE D  46     108.198 149.386 138.606  1.00 21.42           C  
ATOM   8431  O   PHE D  46     109.004 149.896 137.824  1.00 21.42           O  
ATOM   8432  CB  PHE D  46     106.063 150.138 137.476  1.00 21.42           C  
ATOM   8433  CG  PHE D  46     105.975 148.873 136.676  1.00 21.42           C  
ATOM   8434  CD1 PHE D  46     106.959 148.548 135.766  1.00 21.42           C  
ATOM   8435  CD2 PHE D  46     104.889 148.032 136.801  1.00 21.42           C  
ATOM   8436  CE1 PHE D  46     106.877 147.398 135.018  1.00 21.42           C  
ATOM   8437  CE2 PHE D  46     104.803 146.878 136.052  1.00 21.42           C  
ATOM   8438  CZ  PHE D  46     105.799 146.562 135.160  1.00 21.42           C  
ATOM   8439  N   VAL D  47     108.476 148.310 139.332  1.00 14.83           N  
ATOM   8440  CA  VAL D  47     109.800 147.698 139.353  1.00 14.83           C  
ATOM   8441  C   VAL D  47     109.859 146.639 138.261  1.00 14.83           C  
ATOM   8442  O   VAL D  47     109.213 145.596 138.362  1.00 14.83           O  
ATOM   8443  CB  VAL D  47     110.114 147.094 140.723  1.00 14.83           C  
ATOM   8444  CG1 VAL D  47     111.429 146.363 140.677  1.00 14.83           C  
ATOM   8445  CG2 VAL D  47     110.151 148.174 141.774  1.00 14.83           C  
ATOM   8446  N   THR D  48     110.641 146.902 137.215  1.00 23.11           N  
ATOM   8447  CA  THR D  48     110.747 145.938 136.127  1.00 23.11           C  
ATOM   8448  C   THR D  48     111.554 144.719 136.547  1.00 23.11           C  
ATOM   8449  O   THR D  48     111.211 143.590 136.186  1.00 23.11           O  
ATOM   8450  CB  THR D  48     111.371 146.593 134.896  1.00 23.11           C  
ATOM   8451  OG1 THR D  48     110.463 147.561 134.361  1.00 23.11           O  
ATOM   8452  CG2 THR D  48     111.662 145.556 133.831  1.00 23.11           C  
ATOM   8453  N   SER D  49     112.622 144.922 137.313  1.00 22.42           N  
ATOM   8454  CA  SER D  49     113.454 143.810 137.745  1.00 22.42           C  
ATOM   8455  C   SER D  49     114.232 144.218 138.983  1.00 22.42           C  
ATOM   8456  O   SER D  49     114.691 145.355 139.086  1.00 22.42           O  
ATOM   8457  CB  SER D  49     114.421 143.378 136.642  1.00 22.42           C  
ATOM   8458  OG  SER D  49     115.379 144.388 136.396  1.00 22.42           O  
ATOM   8459  N   PHE D  50     114.385 143.277 139.905  1.00 16.80           N  
ATOM   8460  CA  PHE D  50     115.081 143.501 141.164  1.00 16.80           C  
ATOM   8461  C   PHE D  50     116.479 142.907 141.040  1.00 16.80           C  
ATOM   8462  O   PHE D  50     116.644 141.685 141.057  1.00 16.80           O  
ATOM   8463  CB  PHE D  50     114.303 142.870 142.313  1.00 16.80           C  
ATOM   8464  CG  PHE D  50     114.624 143.445 143.649  1.00 16.80           C  
ATOM   8465  CD1 PHE D  50     115.783 143.095 144.302  1.00 16.80           C  
ATOM   8466  CD2 PHE D  50     113.763 144.333 144.257  1.00 16.80           C  
ATOM   8467  CE1 PHE D  50     116.079 143.616 145.535  1.00 16.80           C  
ATOM   8468  CE2 PHE D  50     114.057 144.858 145.491  1.00 16.80           C  
ATOM   8469  CZ  PHE D  50     115.218 144.501 146.129  1.00 16.80           C  
ATOM   8470  N   GLY D  51     117.483 143.773 140.925  1.00 19.24           N  
ATOM   8471  CA  GLY D  51     118.797 143.353 140.533  1.00 19.24           C  
ATOM   8472  C   GLY D  51     119.501 142.552 141.609  1.00 19.24           C  
ATOM   8473  O   GLY D  51     118.948 142.274 142.678  1.00 19.24           O  
ATOM   8474  N   PRO D  52     120.744 142.171 141.327  1.00 18.60           N  
ATOM   8475  CA  PRO D  52     121.499 141.360 142.285  1.00 18.60           C  
ATOM   8476  C   PRO D  52     121.865 142.160 143.523  1.00 18.60           C  
ATOM   8477  O   PRO D  52     122.329 143.298 143.435  1.00 18.60           O  
ATOM   8478  CB  PRO D  52     122.745 140.956 141.493  1.00 18.60           C  
ATOM   8479  CG  PRO D  52     122.916 142.054 140.507  1.00 18.60           C  
ATOM   8480  CD  PRO D  52     121.528 142.468 140.119  1.00 18.60           C  
ATOM   8481  N   VAL D  53     121.657 141.548 144.684  1.00 21.25           N  
ATOM   8482  CA  VAL D  53     121.965 142.164 145.968  1.00 21.25           C  
ATOM   8483  C   VAL D  53     123.342 141.697 146.408  1.00 21.25           C  
ATOM   8484  O   VAL D  53     123.568 140.496 146.593  1.00 21.25           O  
ATOM   8485  CB  VAL D  53     120.907 141.808 147.021  1.00 21.25           C  
ATOM   8486  CG1 VAL D  53     121.234 142.482 148.333  1.00 21.25           C  
ATOM   8487  CG2 VAL D  53     119.537 142.215 146.539  1.00 21.25           C  
ATOM   8488  N   SER D  54     124.263 142.639 146.579  1.00 35.32           N  
ATOM   8489  CA  SER D  54     125.647 142.334 146.903  1.00 35.32           C  
ATOM   8490  C   SER D  54     125.879 142.581 148.387  1.00 35.32           C  
ATOM   8491  O   SER D  54     125.693 143.706 148.873  1.00 35.32           O  
ATOM   8492  CB  SER D  54     126.596 143.181 146.058  1.00 35.32           C  
ATOM   8493  OG  SER D  54     127.944 142.819 146.291  1.00 35.32           O  
ATOM   8494  N   ASP D  55     126.279 141.527 149.102  1.00 45.93           N  
ATOM   8495  CA  ASP D  55     126.533 141.645 150.533  1.00 45.93           C  
ATOM   8496  C   ASP D  55     127.861 142.335 150.807  1.00 45.93           C  
ATOM   8497  O   ASP D  55     128.004 143.036 151.815  1.00 45.93           O  
ATOM   8498  CB  ASP D  55     126.516 140.265 151.183  1.00 45.93           C  
ATOM   8499  CG  ASP D  55     125.160 139.616 151.121  1.00 45.93           C  
ATOM   8500  OD1 ASP D  55     124.153 140.342 151.248  1.00 45.93           O  
ATOM   8501  OD2 ASP D  55     125.100 138.381 150.946  1.00 45.93           O  
ATOM   8502  N   HIS D  56     128.848 142.137 149.931  1.00 60.30           N  
ATOM   8503  CA  HIS D  56     130.174 142.693 150.177  1.00 60.30           C  
ATOM   8504  C   HIS D  56     130.143 144.213 150.180  1.00 60.30           C  
ATOM   8505  O   HIS D  56     130.817 144.852 150.996  1.00 60.30           O  
ATOM   8506  CB  HIS D  56     131.158 142.167 149.136  1.00 60.30           C  
ATOM   8507  CG  HIS D  56     131.220 140.673 149.077  1.00 60.30           C  
ATOM   8508  ND1 HIS D  56     131.926 139.922 149.992  1.00 60.30           N  
ATOM   8509  CD2 HIS D  56     130.651 139.789 148.224  1.00 60.30           C  
ATOM   8510  CE1 HIS D  56     131.795 138.640 149.701  1.00 60.30           C  
ATOM   8511  NE2 HIS D  56     131.027 138.533 148.632  1.00 60.30           N  
ATOM   8512  N   ASP D  57     129.366 144.810 149.285  1.00 46.52           N  
ATOM   8513  CA  ASP D  57     129.142 146.246 149.312  1.00 46.52           C  
ATOM   8514  C   ASP D  57     127.886 146.628 150.079  1.00 46.52           C  
ATOM   8515  O   ASP D  57     127.658 147.820 150.306  1.00 46.52           O  
ATOM   8516  CB  ASP D  57     129.053 146.793 147.887  1.00 46.52           C  
ATOM   8517  CG  ASP D  57     130.268 146.452 147.059  1.00 46.52           C  
ATOM   8518  OD1 ASP D  57     131.334 146.201 147.654  1.00 46.52           O  
ATOM   8519  OD2 ASP D  57     130.160 146.437 145.816  1.00 46.52           O  
ATOM   8520  N   MET D  58     127.078 145.647 150.480  1.00 37.13           N  
ATOM   8521  CA  MET D  58     125.818 145.894 151.177  1.00 37.13           C  
ATOM   8522  C   MET D  58     124.913 146.816 150.371  1.00 37.13           C  
ATOM   8523  O   MET D  58     124.327 147.761 150.899  1.00 37.13           O  
ATOM   8524  CB  MET D  58     126.062 146.460 152.577  1.00 37.13           C  
ATOM   8525  CG  MET D  58     126.321 145.402 153.626  1.00 37.13           C  
ATOM   8526  SD  MET D  58     126.297 146.054 155.301  1.00 37.13           S  
ATOM   8527  CE  MET D  58     126.068 144.540 156.228  1.00 37.13           C  
ATOM   8528  N   GLU D  59     124.799 146.546 149.074  1.00 29.39           N  
ATOM   8529  CA  GLU D  59     123.996 147.384 148.197  1.00 29.39           C  
ATOM   8530  C   GLU D  59     123.140 146.517 147.287  1.00 29.39           C  
ATOM   8531  O   GLU D  59     123.526 145.407 146.918  1.00 29.39           O  
ATOM   8532  CB  GLU D  59     124.872 148.310 147.352  1.00 29.39           C  
ATOM   8533  CG  GLU D  59     125.599 147.608 146.225  1.00 29.39           C  
ATOM   8534  CD  GLU D  59     126.440 148.553 145.396  1.00 29.39           C  
ATOM   8535  OE1 GLU D  59     126.612 149.717 145.810  1.00 29.39           O  
ATOM   8536  OE2 GLU D  59     126.930 148.130 144.329  1.00 29.39           O  
ATOM   8537  N   TYR D  60     121.976 147.036 146.908  1.00 17.67           N  
ATOM   8538  CA  TYR D  60     121.083 146.331 146.002  1.00 17.67           C  
ATOM   8539  C   TYR D  60     120.756 147.225 144.818  1.00 17.67           C  
ATOM   8540  O   TYR D  60     120.515 148.427 144.986  1.00 17.67           O  
ATOM   8541  CB  TYR D  60     119.809 145.875 146.712  1.00 17.67           C  
ATOM   8542  CG  TYR D  60     118.819 146.965 147.005  1.00 17.67           C  
ATOM   8543  CD1 TYR D  60     119.085 147.927 147.953  1.00 17.67           C  
ATOM   8544  CD2 TYR D  60     117.602 147.009 146.358  1.00 17.67           C  
ATOM   8545  CE1 TYR D  60     118.179 148.918 148.232  1.00 17.67           C  
ATOM   8546  CE2 TYR D  60     116.689 147.995 146.629  1.00 17.67           C  
ATOM   8547  CZ  TYR D  60     116.983 148.947 147.569  1.00 17.67           C  
ATOM   8548  OH  TYR D  60     116.080 149.941 147.850  1.00 17.67           O  
ATOM   8549  N   THR D  61     120.791 146.639 143.626  1.00 14.65           N  
ATOM   8550  CA  THR D  61     120.393 147.322 142.408  1.00 14.65           C  
ATOM   8551  C   THR D  61     118.927 147.040 142.115  1.00 14.65           C  
ATOM   8552  O   THR D  61     118.434 145.938 142.358  1.00 14.65           O  
ATOM   8553  CB  THR D  61     121.264 146.856 141.243  1.00 14.65           C  
ATOM   8554  OG1 THR D  61     122.637 147.148 141.528  1.00 14.65           O  
ATOM   8555  CG2 THR D  61     120.867 147.547 139.952  1.00 14.65           C  
ATOM   8556  N   ILE D  62     118.231 148.041 141.588  1.00 14.67           N  
ATOM   8557  CA  ILE D  62     116.819 147.936 141.257  1.00 14.67           C  
ATOM   8558  C   ILE D  62     116.604 148.680 139.949  1.00 14.67           C  
ATOM   8559  O   ILE D  62     117.351 149.602 139.614  1.00 14.67           O  
ATOM   8560  CB  ILE D  62     115.935 148.507 142.386  1.00 14.67           C  
ATOM   8561  CG1 ILE D  62     114.479 148.114 142.193  1.00 14.67           C  
ATOM   8562  CG2 ILE D  62     116.038 150.006 142.438  1.00 14.67           C  
ATOM   8563  CD1 ILE D  62     113.574 148.699 143.238  1.00 14.67           C  
ATOM   8564  N   ASP D  63     115.597 148.261 139.190  1.00 25.43           N  
ATOM   8565  CA  ASP D  63     115.267 148.884 137.912  1.00 25.43           C  
ATOM   8566  C   ASP D  63     113.815 149.332 137.953  1.00 25.43           C  
ATOM   8567  O   ASP D  63     112.911 148.498 138.058  1.00 25.43           O  
ATOM   8568  CB  ASP D  63     115.507 147.915 136.755  1.00 25.43           C  
ATOM   8569  CG  ASP D  63     115.274 148.551 135.403  1.00 25.43           C  
ATOM   8570  OD1 ASP D  63     114.858 149.727 135.360  1.00 25.43           O  
ATOM   8571  OD2 ASP D  63     115.511 147.875 134.378  1.00 25.43           O  
ATOM   8572  N   VAL D  64     113.587 150.640 137.843  1.00 21.59           N  
ATOM   8573  CA  VAL D  64     112.275 151.205 138.113  1.00 21.59           C  
ATOM   8574  C   VAL D  64     111.792 152.044 136.940  1.00 21.59           C  
ATOM   8575  O   VAL D  64     112.577 152.546 136.132  1.00 21.59           O  
ATOM   8576  CB  VAL D  64     112.275 152.059 139.395  1.00 21.59           C  
ATOM   8577  CG1 VAL D  64     112.593 151.208 140.593  1.00 21.59           C  
ATOM   8578  CG2 VAL D  64     113.276 153.179 139.276  1.00 21.59           C  
ATOM   8579  N   PHE D  65     110.472 152.214 136.887  1.00 39.51           N  
ATOM   8580  CA  PHE D  65     109.768 153.093 135.958  1.00 39.51           C  
ATOM   8581  C   PHE D  65     109.157 154.200 136.803  1.00 39.51           C  
ATOM   8582  O   PHE D  65     107.982 154.133 137.162  1.00 39.51           O  
ATOM   8583  CB  PHE D  65     108.680 152.343 135.212  1.00 39.51           C  
ATOM   8584  CG  PHE D  65     109.112 151.741 133.917  1.00 39.51           C  
ATOM   8585  CD1 PHE D  65     109.954 150.651 133.890  1.00 39.51           C  
ATOM   8586  CD2 PHE D  65     108.627 152.234 132.724  1.00 39.51           C  
ATOM   8587  CE1 PHE D  65     110.330 150.084 132.694  1.00 39.51           C  
ATOM   8588  CE2 PHE D  65     109.000 151.672 131.528  1.00 39.51           C  
ATOM   8589  CZ  PHE D  65     109.854 150.596 131.513  1.00 39.51           C  
ATOM   8590  N   PHE D  66     109.936 155.230 137.097  1.00 39.51           N  
ATOM   8591  CA  PHE D  66     109.476 156.258 138.021  1.00 39.51           C  
ATOM   8592  C   PHE D  66     108.449 157.146 137.336  1.00 39.51           C  
ATOM   8593  O   PHE D  66     108.728 157.718 136.282  1.00 39.51           O  
ATOM   8594  CB  PHE D  66     110.665 157.088 138.492  1.00 39.51           C  
ATOM   8595  CG  PHE D  66     110.496 157.682 139.850  1.00 39.51           C  
ATOM   8596  CD1 PHE D  66     110.588 156.895 140.974  1.00 39.51           C  
ATOM   8597  CD2 PHE D  66     110.284 159.033 140.004  1.00 39.51           C  
ATOM   8598  CE1 PHE D  66     110.447 157.439 142.224  1.00 39.51           C  
ATOM   8599  CE2 PHE D  66     110.146 159.582 141.253  1.00 39.51           C  
ATOM   8600  CZ  PHE D  66     110.226 158.784 142.365  1.00 39.51           C  
ATOM   8601  N   ARG D  67     107.259 157.275 137.922  1.00 28.37           N  
ATOM   8602  CA  ARG D  67     106.210 158.100 137.342  1.00 28.37           C  
ATOM   8603  C   ARG D  67     105.823 159.202 138.313  1.00 28.37           C  
ATOM   8604  O   ARG D  67     105.699 158.964 139.516  1.00 28.37           O  
ATOM   8605  CB  ARG D  67     104.967 157.279 137.009  1.00 28.37           C  
ATOM   8606  CG  ARG D  67     105.208 156.122 136.074  1.00 28.37           C  
ATOM   8607  CD  ARG D  67     103.983 155.243 136.003  1.00 28.37           C  
ATOM   8608  NE  ARG D  67     104.251 154.007 135.285  1.00 28.37           N  
ATOM   8609  CZ  ARG D  67     103.560 152.889 135.459  1.00 28.37           C  
ATOM   8610  NH1 ARG D  67     103.866 151.803 134.767  1.00 28.37           N  
ATOM   8611  NH2 ARG D  67     102.565 152.856 136.331  1.00 28.37           N  
ATOM   8612  N   GLN D  68     105.605 160.403 137.786  1.00 39.51           N  
ATOM   8613  CA  GLN D  68     105.150 161.520 138.594  1.00 39.51           C  
ATOM   8614  C   GLN D  68     104.073 162.275 137.836  1.00 39.51           C  
ATOM   8615  O   GLN D  68     104.048 162.285 136.604  1.00 39.51           O  
ATOM   8616  CB  GLN D  68     106.299 162.461 138.955  1.00 39.51           C  
ATOM   8617  CG  GLN D  68     107.368 161.810 139.793  1.00 39.51           C  
ATOM   8618  CD  GLN D  68     108.557 162.709 140.000  1.00 39.51           C  
ATOM   8619  OE1 GLN D  68     108.924 163.478 139.118  1.00 39.51           O  
ATOM   8620  NE2 GLN D  68     109.165 162.625 141.174  1.00 39.51           N  
ATOM   8621  N   SER D  69     103.169 162.889 138.587  1.00 26.94           N  
ATOM   8622  CA  SER D  69     102.057 163.624 138.004  1.00 26.94           C  
ATOM   8623  C   SER D  69     101.757 164.839 138.861  1.00 26.94           C  
ATOM   8624  O   SER D  69     101.707 164.733 140.087  1.00 26.94           O  
ATOM   8625  CB  SER D  69     100.813 162.744 137.898  1.00 26.94           C  
ATOM   8626  OG  SER D  69      99.652 163.542 137.782  1.00 26.94           O  
ATOM   8627  N   TRP D  70     101.556 165.988 138.226  1.00 39.51           N  
ATOM   8628  CA  TRP D  70     101.233 167.171 139.011  1.00 39.51           C  
ATOM   8629  C   TRP D  70     100.358 168.118 138.213  1.00 39.51           C  
ATOM   8630  O   TRP D  70     100.453 168.183 136.985  1.00 39.51           O  
ATOM   8631  CB  TRP D  70     102.491 167.900 139.488  1.00 39.51           C  
ATOM   8632  CG  TRP D  70     103.313 168.491 138.410  1.00 39.51           C  
ATOM   8633  CD1 TRP D  70     103.233 169.753 137.920  1.00 39.51           C  
ATOM   8634  CD2 TRP D  70     104.371 167.851 137.701  1.00 39.51           C  
ATOM   8635  NE1 TRP D  70     104.166 169.938 136.934  1.00 39.51           N  
ATOM   8636  CE2 TRP D  70     104.879 168.780 136.781  1.00 39.51           C  
ATOM   8637  CE3 TRP D  70     104.931 166.576 137.747  1.00 39.51           C  
ATOM   8638  CZ2 TRP D  70     105.918 168.476 135.917  1.00 39.51           C  
ATOM   8639  CZ3 TRP D  70     105.962 166.278 136.890  1.00 39.51           C  
ATOM   8640  CH2 TRP D  70     106.446 167.221 135.986  1.00 39.51           C  
ATOM   8641  N   LYS D  71      99.500 168.843 138.923  1.00 31.19           N  
ATOM   8642  CA  LYS D  71      98.593 169.783 138.284  1.00 31.19           C  
ATOM   8643  C   LYS D  71      99.281 171.124 138.089  1.00 31.19           C  
ATOM   8644  O   LYS D  71      99.913 171.651 139.006  1.00 31.19           O  
ATOM   8645  CB  LYS D  71      97.327 169.952 139.122  1.00 31.19           C  
ATOM   8646  CG  LYS D  71      96.205 170.700 138.425  1.00 31.19           C  
ATOM   8647  CD  LYS D  71      96.155 172.149 138.863  1.00 31.19           C  
ATOM   8648  CE  LYS D  71      94.975 172.874 138.242  1.00 31.19           C  
ATOM   8649  NZ  LYS D  71      93.677 172.292 138.674  1.00 31.19           N  
ATOM   8650  N   ASP D  72      99.152 171.674 136.887  1.00 38.71           N  
ATOM   8651  CA  ASP D  72      99.764 172.952 136.555  1.00 38.71           C  
ATOM   8652  C   ASP D  72      98.759 173.792 135.786  1.00 38.71           C  
ATOM   8653  O   ASP D  72      98.147 173.313 134.829  1.00 38.71           O  
ATOM   8654  CB  ASP D  72     101.040 172.758 135.736  1.00 38.71           C  
ATOM   8655  CG  ASP D  72     101.861 174.020 135.636  1.00 38.71           C  
ATOM   8656  OD1 ASP D  72     101.364 175.090 136.042  1.00 38.71           O  
ATOM   8657  OD2 ASP D  72     103.009 173.943 135.154  1.00 38.71           O  
ATOM   8658  N   GLU D  73      98.600 175.045 136.205  1.00 45.17           N  
ATOM   8659  CA  GLU D  73      97.541 175.889 135.670  1.00 45.17           C  
ATOM   8660  C   GLU D  73      97.913 176.517 134.334  1.00 45.17           C  
ATOM   8661  O   GLU D  73      97.042 176.694 133.475  1.00 45.17           O  
ATOM   8662  CB  GLU D  73      97.195 176.978 136.685  1.00 45.17           C  
ATOM   8663  CG  GLU D  73      96.071 177.912 136.264  1.00 45.17           C  
ATOM   8664  CD  GLU D  73      95.789 178.989 137.301  1.00 45.17           C  
ATOM   8665  OE1 GLU D  73      96.521 179.049 138.312  1.00 45.17           O  
ATOM   8666  OE2 GLU D  73      94.836 179.773 137.109  1.00 45.17           O  
ATOM   8667  N   ARG D  74      99.189 176.848 134.132  1.00 32.46           N  
ATOM   8668  CA  ARG D  74      99.566 177.657 132.978  1.00 32.46           C  
ATOM   8669  C   ARG D  74      99.526 176.868 131.676  1.00 32.46           C  
ATOM   8670  O   ARG D  74      99.419 177.464 130.601  1.00 32.46           O  
ATOM   8671  CB  ARG D  74     100.957 178.251 133.190  1.00 32.46           C  
ATOM   8672  CG  ARG D  74     101.063 179.138 134.417  1.00 32.46           C  
ATOM   8673  CD  ARG D  74     102.431 179.784 134.509  1.00 32.46           C  
ATOM   8674  NE  ARG D  74     103.479 178.798 134.741  1.00 32.46           N  
ATOM   8675  CZ  ARG D  74     104.025 178.556 135.926  1.00 32.46           C  
ATOM   8676  NH1 ARG D  74     103.629 179.235 136.990  1.00 32.46           N  
ATOM   8677  NH2 ARG D  74     104.972 177.638 136.046  1.00 32.46           N  
ATOM   8678  N   LEU D  75      99.623 175.545 131.741  1.00 36.03           N  
ATOM   8679  CA  LEU D  75      99.731 174.745 130.529  1.00 36.03           C  
ATOM   8680  C   LEU D  75      98.389 174.316 129.957  1.00 36.03           C  
ATOM   8681  O   LEU D  75      98.372 173.502 129.030  1.00 36.03           O  
ATOM   8682  CB  LEU D  75     100.591 173.509 130.785  1.00 36.03           C  
ATOM   8683  CG  LEU D  75     102.018 173.813 131.230  1.00 36.03           C  
ATOM   8684  CD1 LEU D  75     102.873 172.569 131.159  1.00 36.03           C  
ATOM   8685  CD2 LEU D  75     102.610 174.911 130.380  1.00 36.03           C  
ATOM   8686  N   LYS D  76      97.271 174.811 130.476  1.00 40.34           N  
ATOM   8687  CA  LYS D  76      95.985 174.423 129.917  1.00 40.34           C  
ATOM   8688  C   LYS D  76      95.753 175.120 128.584  1.00 40.34           C  
ATOM   8689  O   LYS D  76      96.199 176.248 128.365  1.00 40.34           O  
ATOM   8690  CB  LYS D  76      94.850 174.740 130.886  1.00 40.34           C  
ATOM   8691  CG  LYS D  76      94.590 176.212 131.116  1.00 40.34           C  
ATOM   8692  CD  LYS D  76      93.418 176.385 132.066  1.00 40.34           C  
ATOM   8693  CE  LYS D  76      93.173 177.840 132.401  1.00 40.34           C  
ATOM   8694  NZ  LYS D  76      92.059 177.979 133.375  1.00 40.34           N  
ATOM   8695  N   PHE D  77      95.051 174.432 127.687  1.00 43.37           N  
ATOM   8696  CA  PHE D  77      94.801 174.921 126.342  1.00 43.37           C  
ATOM   8697  C   PHE D  77      93.448 174.414 125.869  1.00 43.37           C  
ATOM   8698  O   PHE D  77      92.845 173.530 126.481  1.00 43.37           O  
ATOM   8699  CB  PHE D  77      95.891 174.466 125.369  1.00 43.37           C  
ATOM   8700  CG  PHE D  77      96.010 172.976 125.257  1.00 43.37           C  
ATOM   8701  CD1 PHE D  77      96.807 172.267 126.133  1.00 43.37           C  
ATOM   8702  CD2 PHE D  77      95.321 172.284 124.280  1.00 43.37           C  
ATOM   8703  CE1 PHE D  77      96.916 170.900 126.035  1.00 43.37           C  
ATOM   8704  CE2 PHE D  77      95.427 170.917 124.179  1.00 43.37           C  
ATOM   8705  CZ  PHE D  77      96.226 170.225 125.058  1.00 43.37           C  
ATOM   8706  N   LYS D  78      92.978 174.979 124.762  1.00 56.19           N  
ATOM   8707  CA  LYS D  78      91.735 174.555 124.130  1.00 56.19           C  
ATOM   8708  C   LYS D  78      92.031 174.127 122.701  1.00 56.19           C  
ATOM   8709  O   LYS D  78      92.385 174.961 121.862  1.00 56.19           O  
ATOM   8710  CB  LYS D  78      90.695 175.676 124.157  1.00 56.19           C  
ATOM   8711  CG  LYS D  78      89.370 175.302 123.516  1.00 56.19           C  
ATOM   8712  CD  LYS D  78      88.305 176.340 123.822  1.00 56.19           C  
ATOM   8713  CE  LYS D  78      88.030 176.415 125.314  1.00 56.19           C  
ATOM   8714  NZ  LYS D  78      87.593 175.102 125.864  1.00 56.19           N  
ATOM   8715  N   GLY D  79      91.880 172.836 122.427  1.00 55.56           N  
ATOM   8716  CA  GLY D  79      92.170 172.299 121.120  1.00 55.56           C  
ATOM   8717  C   GLY D  79      91.430 171.007 120.845  1.00 55.56           C  
ATOM   8718  O   GLY D  79      90.703 170.487 121.695  1.00 55.56           O  
ATOM   8719  N   PRO D  80      91.591 170.470 119.633  1.00 51.46           N  
ATOM   8720  CA  PRO D  80      90.860 169.244 119.282  1.00 51.46           C  
ATOM   8721  C   PRO D  80      91.491 167.975 119.827  1.00 51.46           C  
ATOM   8722  O   PRO D  80      90.788 166.970 119.984  1.00 51.46           O  
ATOM   8723  CB  PRO D  80      90.871 169.264 117.749  1.00 51.46           C  
ATOM   8724  CG  PRO D  80      92.120 170.001 117.408  1.00 51.46           C  
ATOM   8725  CD  PRO D  80      92.307 171.040 118.480  1.00 51.46           C  
ATOM   8726  N   MET D  81      92.795 167.980 120.112  1.00 47.49           N  
ATOM   8727  CA  MET D  81      93.476 166.731 120.445  1.00 47.49           C  
ATOM   8728  C   MET D  81      93.118 166.246 121.846  1.00 47.49           C  
ATOM   8729  O   MET D  81      92.902 165.047 122.054  1.00 47.49           O  
ATOM   8730  CB  MET D  81      94.985 166.910 120.299  1.00 47.49           C  
ATOM   8731  CG  MET D  81      95.768 165.618 120.405  1.00 47.49           C  
ATOM   8732  SD  MET D  81      95.118 164.321 119.339  1.00 47.49           S  
ATOM   8733  CE  MET D  81      95.266 165.093 117.730  1.00 47.49           C  
ATOM   8734  N   THR D  82      93.103 167.156 122.823  1.00 44.30           N  
ATOM   8735  CA  THR D  82      92.628 166.923 124.187  1.00 44.30           C  
ATOM   8736  C   THR D  82      93.580 166.061 125.014  1.00 44.30           C  
ATOM   8737  O   THR D  82      93.425 165.969 126.235  1.00 44.30           O  
ATOM   8738  CB  THR D  82      91.234 166.286 124.170  1.00 44.30           C  
ATOM   8739  OG1 THR D  82      90.461 166.866 123.114  1.00 44.30           O  
ATOM   8740  CG2 THR D  82      90.518 166.525 125.485  1.00 44.30           C  
ATOM   8741  N   VAL D  83      94.587 165.465 124.376  1.00 31.83           N  
ATOM   8742  CA  VAL D  83      95.675 164.779 125.070  1.00 31.83           C  
ATOM   8743  C   VAL D  83      96.916 164.875 124.197  1.00 31.83           C  
ATOM   8744  O   VAL D  83      96.913 164.415 123.051  1.00 31.83           O  
ATOM   8745  CB  VAL D  83      95.343 163.307 125.376  1.00 31.83           C  
ATOM   8746  CG1 VAL D  83      96.617 162.528 125.612  1.00 31.83           C  
ATOM   8747  CG2 VAL D  83      94.463 163.186 126.598  1.00 31.83           C  
ATOM   8748  N   LEU D  84      97.983 165.461 124.721  1.00 22.29           N  
ATOM   8749  CA  LEU D  84      99.206 165.666 123.959  1.00 22.29           C  
ATOM   8750  C   LEU D  84     100.289 164.732 124.476  1.00 22.29           C  
ATOM   8751  O   LEU D  84     100.691 164.829 125.639  1.00 22.29           O  
ATOM   8752  CB  LEU D  84      99.667 167.119 124.049  1.00 22.29           C  
ATOM   8753  CG  LEU D  84      98.749 168.153 123.405  1.00 22.29           C  
ATOM   8754  CD1 LEU D  84      99.378 169.525 123.488  1.00 22.29           C  
ATOM   8755  CD2 LEU D  84      98.470 167.783 121.966  1.00 22.29           C  
ATOM   8756  N   ARG D  85     100.753 163.831 123.616  1.00 19.43           N  
ATOM   8757  CA  ARG D  85     101.939 163.026 123.882  1.00 19.43           C  
ATOM   8758  C   ARG D  85     103.107 163.723 123.203  1.00 19.43           C  
ATOM   8759  O   ARG D  85     103.223 163.691 121.975  1.00 19.43           O  
ATOM   8760  CB  ARG D  85     101.781 161.601 123.360  1.00 19.43           C  
ATOM   8761  CG  ARG D  85     101.021 160.667 124.278  1.00 19.43           C  
ATOM   8762  CD  ARG D  85      99.532 160.886 124.171  1.00 19.43           C  
ATOM   8763  NE  ARG D  85      99.056 160.669 122.812  1.00 19.43           N  
ATOM   8764  CZ  ARG D  85      98.558 159.520 122.375  1.00 19.43           C  
ATOM   8765  NH1 ARG D  85      98.150 159.413 121.121  1.00 19.43           N  
ATOM   8766  NH2 ARG D  85      98.464 158.483 123.193  1.00 19.43           N  
ATOM   8767  N   LEU D  86     103.969 164.355 123.990  1.00 17.46           N  
ATOM   8768  CA  LEU D  86     105.014 165.187 123.423  1.00 17.46           C  
ATOM   8769  C   LEU D  86     106.355 164.471 123.471  1.00 17.46           C  
ATOM   8770  O   LEU D  86     106.538 163.489 124.194  1.00 17.46           O  
ATOM   8771  CB  LEU D  86     105.090 166.525 124.156  1.00 17.46           C  
ATOM   8772  CG  LEU D  86     103.783 167.287 123.990  1.00 17.46           C  
ATOM   8773  CD1 LEU D  86     103.716 168.472 124.919  1.00 17.46           C  
ATOM   8774  CD2 LEU D  86     103.647 167.731 122.555  1.00 17.46           C  
ATOM   8775  N   ASN D  87     107.292 164.977 122.676  1.00 22.79           N  
ATOM   8776  CA  ASN D  87     108.607 164.372 122.586  1.00 22.79           C  
ATOM   8777  C   ASN D  87     109.364 164.563 123.895  1.00 22.79           C  
ATOM   8778  O   ASN D  87     108.987 165.355 124.760  1.00 22.79           O  
ATOM   8779  CB  ASN D  87     109.390 164.970 121.418  1.00 22.79           C  
ATOM   8780  CG  ASN D  87     110.461 164.031 120.890  1.00 22.79           C  
ATOM   8781  OD1 ASN D  87     110.379 162.816 121.063  1.00 22.79           O  
ATOM   8782  ND2 ASN D  87     111.471 164.594 120.237  1.00 22.79           N  
ATOM   8783  N   ASN D  88     110.454 163.814 124.032  1.00 18.98           N  
ATOM   8784  CA  ASN D  88     111.196 163.812 125.286  1.00 18.98           C  
ATOM   8785  C   ASN D  88     111.906 165.141 125.513  1.00 18.98           C  
ATOM   8786  O   ASN D  88     111.971 165.636 126.644  1.00 18.98           O  
ATOM   8787  CB  ASN D  88     112.192 162.657 125.278  1.00 18.98           C  
ATOM   8788  CG  ASN D  88     111.654 161.435 124.555  1.00 18.98           C  
ATOM   8789  OD1 ASN D  88     112.288 160.915 123.641  1.00 18.98           O  
ATOM   8790  ND2 ASN D  88     110.476 160.979 124.959  1.00 18.98           N  
ATOM   8791  N   LEU D  89     112.430 165.743 124.443  1.00 21.51           N  
ATOM   8792  CA  LEU D  89     113.269 166.928 124.586  1.00 21.51           C  
ATOM   8793  C   LEU D  89     112.506 168.129 125.122  1.00 21.51           C  
ATOM   8794  O   LEU D  89     113.134 169.104 125.545  1.00 21.51           O  
ATOM   8795  CB  LEU D  89     113.916 167.286 123.248  1.00 21.51           C  
ATOM   8796  CG  LEU D  89     113.072 168.010 122.201  1.00 21.51           C  
ATOM   8797  CD1 LEU D  89     113.340 169.505 122.229  1.00 21.51           C  
ATOM   8798  CD2 LEU D  89     113.355 167.440 120.823  1.00 21.51           C  
ATOM   8799  N   MET D  90     111.175 168.100 125.096  1.00 21.78           N  
ATOM   8800  CA  MET D  90     110.420 169.202 125.673  1.00 21.78           C  
ATOM   8801  C   MET D  90     110.416 169.172 127.196  1.00 21.78           C  
ATOM   8802  O   MET D  90     110.035 170.170 127.816  1.00 21.78           O  
ATOM   8803  CB  MET D  90     108.986 169.187 125.149  1.00 21.78           C  
ATOM   8804  CG  MET D  90     108.247 170.487 125.368  1.00 21.78           C  
ATOM   8805  SD  MET D  90     106.548 170.438 124.802  1.00 21.78           S  
ATOM   8806  CE  MET D  90     105.965 172.029 125.374  1.00 21.78           C  
ATOM   8807  N   ALA D  91     110.849 168.069 127.810  1.00 20.87           N  
ATOM   8808  CA  ALA D  91     110.758 167.945 129.261  1.00 20.87           C  
ATOM   8809  C   ALA D  91     111.616 168.971 129.985  1.00 20.87           C  
ATOM   8810  O   ALA D  91     111.337 169.302 131.140  1.00 20.87           O  
ATOM   8811  CB  ALA D  91     111.156 166.535 129.690  1.00 20.87           C  
ATOM   8812  N   SER D  92     112.663 169.478 129.336  1.00 18.60           N  
ATOM   8813  CA  SER D  92     113.584 170.370 130.031  1.00 18.60           C  
ATOM   8814  C   SER D  92     113.043 171.789 130.133  1.00 18.60           C  
ATOM   8815  O   SER D  92     113.489 172.555 130.993  1.00 18.60           O  
ATOM   8816  CB  SER D  92     114.940 170.375 129.330  1.00 18.60           C  
ATOM   8817  OG  SER D  92     114.857 171.025 128.077  1.00 18.60           O  
ATOM   8818  N   LYS D  93     112.098 172.164 129.271  1.00 22.50           N  
ATOM   8819  CA  LYS D  93     111.637 173.548 129.251  1.00 22.50           C  
ATOM   8820  C   LYS D  93     110.624 173.824 130.354  1.00 22.50           C  
ATOM   8821  O   LYS D  93     110.671 174.882 130.989  1.00 22.50           O  
ATOM   8822  CB  LYS D  93     111.052 173.889 127.885  1.00 22.50           C  
ATOM   8823  CG  LYS D  93     112.092 173.981 126.787  1.00 22.50           C  
ATOM   8824  CD  LYS D  93     111.457 174.332 125.459  1.00 22.50           C  
ATOM   8825  CE  LYS D  93     112.486 174.333 124.346  1.00 22.50           C  
ATOM   8826  NZ  LYS D  93     111.854 174.581 123.023  1.00 22.50           N  
ATOM   8827  N   ILE D  94     109.693 172.905 130.588  1.00 20.55           N  
ATOM   8828  CA  ILE D  94     108.690 173.088 131.632  1.00 20.55           C  
ATOM   8829  C   ILE D  94     109.310 172.802 132.991  1.00 20.55           C  
ATOM   8830  O   ILE D  94     110.417 172.262 133.076  1.00 20.55           O  
ATOM   8831  CB  ILE D  94     107.472 172.185 131.395  1.00 20.55           C  
ATOM   8832  CG1 ILE D  94     107.878 170.725 131.550  1.00 20.55           C  
ATOM   8833  CG2 ILE D  94     106.900 172.421 130.017  1.00 20.55           C  
ATOM   8834  CD1 ILE D  94     106.741 169.759 131.380  1.00 20.55           C  
ATOM   8835  N   TRP D  95     108.609 173.160 134.060  1.00 20.66           N  
ATOM   8836  CA  TRP D  95     109.082 172.832 135.397  1.00 20.66           C  
ATOM   8837  C   TRP D  95     109.045 171.327 135.616  1.00 20.66           C  
ATOM   8838  O   TRP D  95     108.126 170.643 135.162  1.00 20.66           O  
ATOM   8839  CB  TRP D  95     108.229 173.524 136.453  1.00 20.66           C  
ATOM   8840  CG  TRP D  95     108.717 173.312 137.851  1.00 20.66           C  
ATOM   8841  CD1 TRP D  95     109.826 173.852 138.414  1.00 20.66           C  
ATOM   8842  CD2 TRP D  95     108.100 172.515 138.867  1.00 20.66           C  
ATOM   8843  NE1 TRP D  95     109.948 173.439 139.714  1.00 20.66           N  
ATOM   8844  CE2 TRP D  95     108.898 172.616 140.017  1.00 20.66           C  
ATOM   8845  CE3 TRP D  95     106.952 171.725 138.914  1.00 20.66           C  
ATOM   8846  CZ2 TRP D  95     108.587 171.960 141.198  1.00 20.66           C  
ATOM   8847  CZ3 TRP D  95     106.645 171.075 140.090  1.00 20.66           C  
ATOM   8848  CH2 TRP D  95     107.459 171.194 141.214  1.00 20.66           C  
ATOM   8849  N   THR D  96     110.053 170.811 136.308  1.00 21.44           N  
ATOM   8850  CA  THR D  96     110.096 169.400 136.665  1.00 21.44           C  
ATOM   8851  C   THR D  96     110.579 169.256 138.099  1.00 21.44           C  
ATOM   8852  O   THR D  96     111.684 169.707 138.425  1.00 21.44           O  
ATOM   8853  CB  THR D  96     111.013 168.621 135.727  1.00 21.44           C  
ATOM   8854  OG1 THR D  96     112.283 169.277 135.651  1.00 21.44           O  
ATOM   8855  CG2 THR D  96     110.408 168.533 134.341  1.00 21.44           C  
ATOM   8856  N   PRO D  97     109.804 168.632 138.978  1.00 18.73           N  
ATOM   8857  CA  PRO D  97     110.215 168.551 140.379  1.00 18.73           C  
ATOM   8858  C   PRO D  97     111.420 167.645 140.533  1.00 18.73           C  
ATOM   8859  O   PRO D  97     111.483 166.563 139.946  1.00 18.73           O  
ATOM   8860  CB  PRO D  97     108.983 167.965 141.071  1.00 18.73           C  
ATOM   8861  CG  PRO D  97     108.361 167.126 140.026  1.00 18.73           C  
ATOM   8862  CD  PRO D  97     108.589 167.846 138.721  1.00 18.73           C  
ATOM   8863  N   ASP D  98     112.383 168.097 141.326  1.00 20.05           N  
ATOM   8864  CA  ASP D  98     113.579 167.315 141.595  1.00 20.05           C  
ATOM   8865  C   ASP D  98     113.271 166.282 142.665  1.00 20.05           C  
ATOM   8866  O   ASP D  98     112.662 166.603 143.689  1.00 20.05           O  
ATOM   8867  CB  ASP D  98     114.730 168.212 142.036  1.00 20.05           C  
ATOM   8868  CG  ASP D  98     114.292 169.271 143.003  1.00 20.05           C  
ATOM   8869  OD1 ASP D  98     113.080 169.340 143.292  1.00 20.05           O  
ATOM   8870  OD2 ASP D  98     115.157 170.039 143.469  1.00 20.05           O  
ATOM   8871  N   THR D  99     113.680 165.043 142.420  1.00 15.89           N  
ATOM   8872  CA  THR D  99     113.390 163.937 143.324  1.00 15.89           C  
ATOM   8873  C   THR D  99     114.645 163.081 143.424  1.00 15.89           C  
ATOM   8874  O   THR D  99     114.876 162.218 142.575  1.00 15.89           O  
ATOM   8875  CB  THR D  99     112.209 163.124 142.819  1.00 15.89           C  
ATOM   8876  OG1 THR D  99     111.081 163.985 142.647  1.00 15.89           O  
ATOM   8877  CG2 THR D  99     111.861 162.040 143.802  1.00 15.89           C  
ATOM   8878  N   PHE D 100     115.459 163.341 144.448  1.00 16.80           N  
ATOM   8879  CA  PHE D 100     116.732 162.597 144.623  1.00 16.80           C  
ATOM   8880  C   PHE D 100     116.560 161.527 145.700  1.00 16.80           C  
ATOM   8881  O   PHE D 100     116.088 161.853 146.786  1.00 16.80           O  
ATOM   8882  CB  PHE D 100     117.839 163.560 145.050  1.00 16.80           C  
ATOM   8883  CG  PHE D 100     117.801 163.917 146.511  1.00 16.80           C  
ATOM   8884  CD1 PHE D 100     116.666 164.472 147.071  1.00 16.80           C  
ATOM   8885  CD2 PHE D 100     118.893 163.690 147.328  1.00 16.80           C  
ATOM   8886  CE1 PHE D 100     116.619 164.782 148.419  1.00 16.80           C  
ATOM   8887  CE2 PHE D 100     118.851 164.013 148.673  1.00 16.80           C  
ATOM   8888  CZ  PHE D 100     117.716 164.561 149.214  1.00 16.80           C  
ATOM   8889  N   PHE D 101     116.948 160.289 145.401  1.00 15.56           N  
ATOM   8890  CA  PHE D 101     116.852 159.207 146.371  1.00 15.56           C  
ATOM   8891  C   PHE D 101     117.825 159.454 147.514  1.00 15.56           C  
ATOM   8892  O   PHE D 101     119.030 159.592 147.294  1.00 15.56           O  
ATOM   8893  CB  PHE D 101     117.142 157.868 145.700  1.00 15.56           C  
ATOM   8894  CG  PHE D 101     116.284 157.597 144.506  1.00 15.56           C  
ATOM   8895  CD1 PHE D 101     114.927 157.419 144.641  1.00 15.56           C  
ATOM   8896  CD2 PHE D 101     116.836 157.512 143.251  1.00 15.56           C  
ATOM   8897  CE1 PHE D 101     114.140 157.176 143.547  1.00 15.56           C  
ATOM   8898  CE2 PHE D 101     116.052 157.270 142.156  1.00 15.56           C  
ATOM   8899  CZ  PHE D 101     114.703 157.101 142.305  1.00 15.56           C  
ATOM   8900  N   HIS D 102     117.276 159.573 148.726  1.00 19.87           N  
ATOM   8901  CA  HIS D 102     118.029 159.929 149.962  1.00 19.87           C  
ATOM   8902  C   HIS D 102     119.237 159.030 150.224  1.00 19.87           C  
ATOM   8903  O   HIS D 102     120.197 159.526 150.825  1.00 19.87           O  
ATOM   8904  CB  HIS D 102     117.098 159.949 151.177  1.00 19.87           C  
ATOM   8905  CG  HIS D 102     116.519 161.291 151.459  1.00 19.87           C  
ATOM   8906  ND1 HIS D 102     115.199 161.588 151.216  1.00 19.87           N  
ATOM   8907  CD2 HIS D 102     117.074 162.412 151.958  1.00 19.87           C  
ATOM   8908  CE1 HIS D 102     114.962 162.837 151.556  1.00 19.87           C  
ATOM   8909  NE2 HIS D 102     116.096 163.363 152.012  1.00 19.87           N  
ATOM   8910  N   ASN D 103     119.184 157.758 149.836  1.00 19.43           N  
ATOM   8911  CA  ASN D 103     120.306 156.869 150.104  1.00 19.43           C  
ATOM   8912  C   ASN D 103     120.751 156.111 148.861  1.00 19.43           C  
ATOM   8913  O   ASN D 103     120.964 154.897 148.913  1.00 19.43           O  
ATOM   8914  CB  ASN D 103     119.955 155.892 151.222  1.00 19.43           C  
ATOM   8915  CG  ASN D 103     118.749 155.056 150.902  1.00 19.43           C  
ATOM   8916  OD1 ASN D 103     118.205 155.127 149.805  1.00 19.43           O  
ATOM   8917  ND2 ASN D 103     118.327 154.244 151.858  1.00 19.43           N  
ATOM   8918  N   GLY D 104     120.890 156.810 147.742  1.00 18.69           N  
ATOM   8919  CA  GLY D 104     121.380 156.179 146.535  1.00 18.69           C  
ATOM   8920  C   GLY D 104     122.873 156.357 146.377  1.00 18.69           C  
ATOM   8921  O   GLY D 104     123.353 157.487 146.279  1.00 18.69           O  
ATOM   8922  N   LYS D 105     123.621 155.254 146.358  1.00 21.78           N  
ATOM   8923  CA  LYS D 105     125.067 155.360 146.211  1.00 21.78           C  
ATOM   8924  C   LYS D 105     125.447 155.917 144.847  1.00 21.78           C  
ATOM   8925  O   LYS D 105     126.261 156.841 144.755  1.00 21.78           O  
ATOM   8926  CB  LYS D 105     125.720 153.999 146.434  1.00 21.78           C  
ATOM   8927  CG  LYS D 105     125.604 153.479 147.851  1.00 21.78           C  
ATOM   8928  CD  LYS D 105     126.272 152.128 147.980  1.00 21.78           C  
ATOM   8929  CE  LYS D 105     127.731 152.206 147.577  1.00 21.78           C  
ATOM   8930  NZ  LYS D 105     128.370 150.864 147.558  1.00 21.78           N  
ATOM   8931  N   LYS D 106     124.872 155.373 143.778  1.00 20.26           N  
ATOM   8932  CA  LYS D 106     125.156 155.855 142.434  1.00 20.26           C  
ATOM   8933  C   LYS D 106     124.084 155.337 141.490  1.00 20.26           C  
ATOM   8934  O   LYS D 106     123.852 154.130 141.419  1.00 20.26           O  
ATOM   8935  CB  LYS D 106     126.541 155.398 141.962  1.00 20.26           C  
ATOM   8936  CG  LYS D 106     126.865 155.768 140.529  1.00 20.26           C  
ATOM   8937  CD  LYS D 106     128.230 155.237 140.130  1.00 20.26           C  
ATOM   8938  CE  LYS D 106     128.511 155.480 138.656  1.00 20.26           C  
ATOM   8939  NZ  LYS D 106     128.506 156.926 138.315  1.00 20.26           N  
ATOM   8940  N   SER D 107     123.463 156.247 140.746  1.00 17.24           N  
ATOM   8941  CA  SER D 107     122.365 155.897 139.861  1.00 17.24           C  
ATOM   8942  C   SER D 107     122.665 156.414 138.466  1.00 17.24           C  
ATOM   8943  O   SER D 107     123.519 157.281 138.274  1.00 17.24           O  
ATOM   8944  CB  SER D 107     121.032 156.467 140.352  1.00 17.24           C  
ATOM   8945  OG  SER D 107     120.762 156.038 141.671  1.00 17.24           O  
ATOM   8946  N   VAL D 108     121.947 155.871 137.490  1.00 16.35           N  
ATOM   8947  CA  VAL D 108     122.173 156.189 136.087  1.00 16.35           C  
ATOM   8948  C   VAL D 108     120.844 156.130 135.354  1.00 16.35           C  
ATOM   8949  O   VAL D 108     120.125 155.132 135.447  1.00 16.35           O  
ATOM   8950  CB  VAL D 108     123.187 155.222 135.451  1.00 16.35           C  
ATOM   8951  CG1 VAL D 108     122.946 153.813 135.946  1.00 16.35           C  
ATOM   8952  CG2 VAL D 108     123.087 155.272 133.945  1.00 16.35           C  
ATOM   8953  N   ALA D 109     120.517 157.193 134.626  1.00 16.50           N  
ATOM   8954  CA  ALA D 109     119.319 157.241 133.801  1.00 16.50           C  
ATOM   8955  C   ALA D 109     119.699 156.842 132.383  1.00 16.50           C  
ATOM   8956  O   ALA D 109     120.588 157.453 131.785  1.00 16.50           O  
ATOM   8957  CB  ALA D 109     118.692 158.633 133.820  1.00 16.50           C  
ATOM   8958  N   HIS D 110     119.033 155.821 131.853  1.00 18.93           N  
ATOM   8959  CA  HIS D 110     119.432 155.265 130.568  1.00 18.93           C  
ATOM   8960  C   HIS D 110     119.214 156.273 129.444  1.00 18.93           C  
ATOM   8961  O   HIS D 110     118.293 157.090 129.479  1.00 18.93           O  
ATOM   8962  CB  HIS D 110     118.656 153.982 130.285  1.00 18.93           C  
ATOM   8963  CG  HIS D 110     118.908 152.891 131.277  1.00 18.93           C  
ATOM   8964  ND1 HIS D 110     120.156 152.346 131.482  1.00 18.93           N  
ATOM   8965  CD2 HIS D 110     118.070 152.236 132.113  1.00 18.93           C  
ATOM   8966  CE1 HIS D 110     120.077 151.406 132.407  1.00 18.93           C  
ATOM   8967  NE2 HIS D 110     118.821 151.318 132.804  1.00 18.93           N  
ATOM   8968  N   ASN D 111     120.088 156.212 128.444  1.00 28.64           N  
ATOM   8969  CA  ASN D 111     120.074 157.115 127.296  1.00 28.64           C  
ATOM   8970  C   ASN D 111     120.294 156.315 126.019  1.00 28.64           C  
ATOM   8971  O   ASN D 111     121.138 156.650 125.188  1.00 28.64           O  
ATOM   8972  CB  ASN D 111     121.142 158.195 127.446  1.00 28.64           C  
ATOM   8973  CG  ASN D 111     120.821 159.451 126.668  1.00 28.64           C  
ATOM   8974  OD1 ASN D 111     119.680 159.671 126.265  1.00 28.64           O  
ATOM   8975  ND2 ASN D 111     121.834 160.291 126.457  1.00 28.64           N  
ATOM   8976  N   MET D 112     119.532 155.232 125.858  1.00 26.50           N  
ATOM   8977  CA  MET D 112     119.862 154.208 124.869  1.00 26.50           C  
ATOM   8978  C   MET D 112     119.877 154.765 123.451  1.00 26.50           C  
ATOM   8979  O   MET D 112     120.919 154.780 122.787  1.00 26.50           O  
ATOM   8980  CB  MET D 112     118.872 153.058 124.961  1.00 26.50           C  
ATOM   8981  CG  MET D 112     119.157 151.974 123.957  1.00 26.50           C  
ATOM   8982  SD  MET D 112     120.775 151.275 124.285  1.00 26.50           S  
ATOM   8983  CE  MET D 112     120.578 150.890 126.023  1.00 26.50           C  
ATOM   8984  N   THR D 113     118.720 155.198 122.956  1.00 17.33           N  
ATOM   8985  CA  THR D 113     118.617 155.793 121.635  1.00 17.33           C  
ATOM   8986  C   THR D 113     117.949 157.153 121.652  1.00 17.33           C  
ATOM   8987  O   THR D 113     117.931 157.829 120.618  1.00 17.33           O  
ATOM   8988  CB  THR D 113     117.846 154.874 120.678  1.00 17.33           C  
ATOM   8989  OG1 THR D 113     116.511 154.694 121.161  1.00 17.33           O  
ATOM   8990  CG2 THR D 113     118.527 153.527 120.581  1.00 17.33           C  
ATOM   8991  N   MET D 114     117.396 157.556 122.776  1.00 25.07           N  
ATOM   8992  CA  MET D 114     116.822 158.869 123.005  1.00 25.07           C  
ATOM   8993  C   MET D 114     116.523 158.933 124.494  1.00 25.07           C  
ATOM   8994  O   MET D 114     116.235 157.895 125.099  1.00 25.07           O  
ATOM   8995  CB  MET D 114     115.565 159.093 122.164  1.00 25.07           C  
ATOM   8996  CG  MET D 114     115.597 160.368 121.336  1.00 25.07           C  
ATOM   8997  SD  MET D 114     113.980 160.831 120.691  1.00 25.07           S  
ATOM   8998  CE  MET D 114     114.334 162.455 120.026  1.00 25.07           C  
ATOM   8999  N   PRO D 115     116.618 160.100 125.123  1.00 19.17           N  
ATOM   9000  CA  PRO D 115     116.427 160.171 126.573  1.00 19.17           C  
ATOM   9001  C   PRO D 115     115.127 159.505 126.987  1.00 19.17           C  
ATOM   9002  O   PRO D 115     114.053 159.836 126.485  1.00 19.17           O  
ATOM   9003  CB  PRO D 115     116.407 161.675 126.849  1.00 19.17           C  
ATOM   9004  CG  PRO D 115     117.138 162.271 125.721  1.00 19.17           C  
ATOM   9005  CD  PRO D 115     116.819 161.431 124.535  1.00 19.17           C  
ATOM   9006  N   ASN D 116     115.229 158.541 127.900  1.00 18.84           N  
ATOM   9007  CA  ASN D 116     114.064 157.778 128.338  1.00 18.84           C  
ATOM   9008  C   ASN D 116     113.211 158.665 129.236  1.00 18.84           C  
ATOM   9009  O   ASN D 116     113.287 158.632 130.466  1.00 18.84           O  
ATOM   9010  CB  ASN D 116     114.489 156.503 129.044  1.00 18.84           C  
ATOM   9011  CG  ASN D 116     115.073 155.495 128.099  1.00 18.84           C  
ATOM   9012  OD1 ASN D 116     116.041 154.814 128.417  1.00 18.84           O  
ATOM   9013  ND2 ASN D 116     114.490 155.399 126.918  1.00 18.84           N  
ATOM   9014  N   LYS D 117     112.383 159.480 128.594  1.00 17.85           N  
ATOM   9015  CA  LYS D 117     111.436 160.340 129.282  1.00 17.85           C  
ATOM   9016  C   LYS D 117     110.193 160.431 128.419  1.00 17.85           C  
ATOM   9017  O   LYS D 117     110.288 160.454 127.192  1.00 17.85           O  
ATOM   9018  CB  LYS D 117     112.005 161.739 129.527  1.00 17.85           C  
ATOM   9019  CG  LYS D 117     113.212 161.791 130.438  1.00 17.85           C  
ATOM   9020  CD  LYS D 117     113.689 163.217 130.587  1.00 17.85           C  
ATOM   9021  CE  LYS D 117     114.953 163.293 131.413  1.00 17.85           C  
ATOM   9022  NZ  LYS D 117     115.459 164.689 131.483  1.00 17.85           N  
ATOM   9023  N   LEU D 118     109.033 160.471 129.060  1.00 17.00           N  
ATOM   9024  CA  LEU D 118     107.771 160.615 128.354  1.00 17.00           C  
ATOM   9025  C   LEU D 118     106.993 161.742 129.006  1.00 17.00           C  
ATOM   9026  O   LEU D 118     106.918 161.817 130.235  1.00 17.00           O  
ATOM   9027  CB  LEU D 118     106.978 159.308 128.371  1.00 17.00           C  
ATOM   9028  CG  LEU D 118     105.768 159.156 129.285  1.00 17.00           C  
ATOM   9029  CD1 LEU D 118     104.512 159.573 128.551  1.00 17.00           C  
ATOM   9030  CD2 LEU D 118     105.654 157.724 129.745  1.00 17.00           C  
ATOM   9031  N   LEU D 119     106.448 162.634 128.192  1.00 13.98           N  
ATOM   9032  CA  LEU D 119     105.718 163.791 128.680  1.00 13.98           C  
ATOM   9033  C   LEU D 119     104.310 163.765 128.111  1.00 13.98           C  
ATOM   9034  O   LEU D 119     104.130 163.691 126.888  1.00 13.98           O  
ATOM   9035  CB  LEU D 119     106.428 165.085 128.295  1.00 13.98           C  
ATOM   9036  CG  LEU D 119     105.936 166.348 128.987  1.00 13.98           C  
ATOM   9037  CD1 LEU D 119     106.024 166.187 130.483  1.00 13.98           C  
ATOM   9038  CD2 LEU D 119     106.765 167.525 128.534  1.00 13.98           C  
ATOM   9039  N   ARG D 120     103.317 163.823 128.993  1.00 21.37           N  
ATOM   9040  CA  ARG D 120     101.922 163.704 128.593  1.00 21.37           C  
ATOM   9041  C   ARG D 120     101.140 164.836 129.235  1.00 21.37           C  
ATOM   9042  O   ARG D 120     101.033 164.901 130.464  1.00 21.37           O  
ATOM   9043  CB  ARG D 120     101.361 162.345 129.006  1.00 21.37           C  
ATOM   9044  CG  ARG D 120     100.167 161.890 128.206  1.00 21.37           C  
ATOM   9045  CD  ARG D 120      99.738 160.498 128.630  1.00 21.37           C  
ATOM   9046  NE  ARG D 120     100.807 159.521 128.457  1.00 21.37           N  
ATOM   9047  CZ  ARG D 120     100.836 158.611 127.492  1.00 21.37           C  
ATOM   9048  NH1 ARG D 120      99.848 158.544 126.615  1.00 21.37           N  
ATOM   9049  NH2 ARG D 120     101.848 157.763 127.408  1.00 21.37           N  
ATOM   9050  N   ILE D 121     100.601 165.725 128.408  1.00 19.84           N  
ATOM   9051  CA  ILE D 121      99.904 166.920 128.867  1.00 19.84           C  
ATOM   9052  C   ILE D 121      98.428 166.771 128.541  1.00 19.84           C  
ATOM   9053  O   ILE D 121      98.056 166.636 127.370  1.00 19.84           O  
ATOM   9054  CB  ILE D 121     100.473 168.190 128.223  1.00 19.84           C  
ATOM   9055  CG1 ILE D 121     101.918 168.411 128.653  1.00 19.84           C  
ATOM   9056  CG2 ILE D 121      99.622 169.384 128.578  1.00 19.84           C  
ATOM   9057  CD1 ILE D 121     102.489 169.723 128.181  1.00 19.84           C  
ATOM   9058  N   THR D 122      97.590 166.803 129.567  1.00 34.82           N  
ATOM   9059  CA  THR D 122      96.154 166.706 129.375  1.00 34.82           C  
ATOM   9060  C   THR D 122      95.553 168.088 129.147  1.00 34.82           C  
ATOM   9061  O   THR D 122      96.211 169.116 129.307  1.00 34.82           O  
ATOM   9062  CB  THR D 122      95.496 166.030 130.574  1.00 34.82           C  
ATOM   9063  OG1 THR D 122      95.769 166.790 131.757  1.00 34.82           O  
ATOM   9064  CG2 THR D 122      96.040 164.624 130.746  1.00 34.82           C  
ATOM   9065  N   GLU D 123      94.278 168.102 128.756  1.00 47.37           N  
ATOM   9066  CA  GLU D 123      93.603 169.365 128.485  1.00 47.37           C  
ATOM   9067  C   GLU D 123      93.412 170.184 129.753  1.00 47.37           C  
ATOM   9068  O   GLU D 123      93.403 171.419 129.697  1.00 47.37           O  
ATOM   9069  CB  GLU D 123      92.253 169.108 127.819  1.00 47.37           C  
ATOM   9070  CG  GLU D 123      91.523 170.373 127.405  1.00 47.37           C  
ATOM   9071  CD  GLU D 123      90.116 170.103 126.916  1.00 47.37           C  
ATOM   9072  OE1 GLU D 123      89.555 169.046 127.270  1.00 47.37           O  
ATOM   9073  OE2 GLU D 123      89.569 170.948 126.176  1.00 47.37           O  
ATOM   9074  N   ASP D 124      93.255 169.523 130.898  1.00 45.46           N  
ATOM   9075  CA  ASP D 124      93.083 170.251 132.150  1.00 45.46           C  
ATOM   9076  C   ASP D 124      94.385 170.909 132.587  1.00 45.46           C  
ATOM   9077  O   ASP D 124      94.384 172.054 133.052  1.00 45.46           O  
ATOM   9078  CB  ASP D 124      92.565 169.305 133.232  1.00 45.46           C  
ATOM   9079  CG  ASP D 124      92.118 170.034 134.481  1.00 45.46           C  
ATOM   9080  OD1 ASP D 124      92.039 171.280 134.453  1.00 45.46           O  
ATOM   9081  OD2 ASP D 124      91.846 169.359 135.496  1.00 45.46           O  
ATOM   9082  N   GLY D 125      95.503 170.208 132.432  1.00 36.71           N  
ATOM   9083  CA  GLY D 125      96.785 170.713 132.876  1.00 36.71           C  
ATOM   9084  C   GLY D 125      97.478 169.752 133.816  1.00 36.71           C  
ATOM   9085  O   GLY D 125      98.360 170.146 134.582  1.00 36.71           O  
ATOM   9086  N   THR D 126      97.081 168.483 133.767  1.00 32.67           N  
ATOM   9087  CA  THR D 126      97.619 167.455 134.656  1.00 32.67           C  
ATOM   9088  C   THR D 126      98.801 166.795 133.962  1.00 32.67           C  
ATOM   9089  O   THR D 126      98.650 165.836 133.208  1.00 32.67           O  
ATOM   9090  CB  THR D 126      96.541 166.439 135.010  1.00 32.67           C  
ATOM   9091  OG1 THR D 126      95.430 167.111 135.614  1.00 32.67           O  
ATOM   9092  CG2 THR D 126      97.079 165.405 135.977  1.00 32.67           C  
ATOM   9093  N   LEU D 127      99.998 167.309 134.226  1.00 25.49           N  
ATOM   9094  CA  LEU D 127     101.188 166.783 133.578  1.00 25.49           C  
ATOM   9095  C   LEU D 127     101.538 165.412 134.130  1.00 25.49           C  
ATOM   9096  O   LEU D 127     101.489 165.187 135.345  1.00 25.49           O  
ATOM   9097  CB  LEU D 127     102.366 167.725 133.784  1.00 25.49           C  
ATOM   9098  CG  LEU D 127     102.575 168.875 132.808  1.00 25.49           C  
ATOM   9099  CD1 LEU D 127     101.326 169.712 132.685  1.00 25.49           C  
ATOM   9100  CD2 LEU D 127     103.727 169.724 133.291  1.00 25.49           C  
ATOM   9101  N   LEU D 128     101.898 164.497 133.231  1.00 39.51           N  
ATOM   9102  CA  LEU D 128     102.451 163.197 133.586  1.00 39.51           C  
ATOM   9103  C   LEU D 128     103.850 163.096 133.003  1.00 39.51           C  
ATOM   9104  O   LEU D 128     104.063 163.440 131.834  1.00 39.51           O  
ATOM   9105  CB  LEU D 128     101.583 162.058 133.058  1.00 39.51           C  
ATOM   9106  CG  LEU D 128     102.023 160.674 133.524  1.00 39.51           C  
ATOM   9107  CD1 LEU D 128     101.590 160.450 134.952  1.00 39.51           C  
ATOM   9108  CD2 LEU D 128     101.469 159.595 132.624  1.00 39.51           C  
ATOM   9109  N   TYR D 129     104.794 162.617 133.809  1.00 39.51           N  
ATOM   9110  CA  TYR D 129     106.209 162.647 133.455  1.00 39.51           C  
ATOM   9111  C   TYR D 129     106.882 161.444 134.090  1.00 39.51           C  
ATOM   9112  O   TYR D 129     106.885 161.315 135.317  1.00 39.51           O  
ATOM   9113  CB  TYR D 129     106.836 163.952 133.936  1.00 39.51           C  
ATOM   9114  CG  TYR D 129     108.334 164.066 133.825  1.00 39.51           C  
ATOM   9115  CD1 TYR D 129     108.927 164.619 132.704  1.00 39.51           C  
ATOM   9116  CD2 TYR D 129     109.154 163.677 134.868  1.00 39.51           C  
ATOM   9117  CE1 TYR D 129     110.292 164.749 132.613  1.00 39.51           C  
ATOM   9118  CE2 TYR D 129     110.519 163.803 134.786  1.00 39.51           C  
ATOM   9119  CZ  TYR D 129     111.083 164.340 133.656  1.00 39.51           C  
ATOM   9120  OH  TYR D 129     112.447 164.467 133.567  1.00 39.51           O  
ATOM   9121  N   THR D 130     107.424 160.551 133.269  1.00 27.39           N  
ATOM   9122  CA  THR D 130     108.017 159.323 133.773  1.00 27.39           C  
ATOM   9123  C   THR D 130     109.408 159.127 133.196  1.00 27.39           C  
ATOM   9124  O   THR D 130     109.683 159.477 132.048  1.00 27.39           O  
ATOM   9125  CB  THR D 130     107.174 158.087 133.438  1.00 27.39           C  
ATOM   9126  OG1 THR D 130     107.645 157.505 132.219  1.00 27.39           O  
ATOM   9127  CG2 THR D 130     105.710 158.449 133.285  1.00 27.39           C  
ATOM   9128  N   MET D 131     110.275 158.538 134.008  1.00 27.66           N  
ATOM   9129  CA  MET D 131     111.633 158.205 133.618  1.00 27.66           C  
ATOM   9130  C   MET D 131     111.866 156.727 133.872  1.00 27.66           C  
ATOM   9131  O   MET D 131     111.082 156.064 134.552  1.00 27.66           O  
ATOM   9132  CB  MET D 131     112.665 159.016 134.398  1.00 27.66           C  
ATOM   9133  CG  MET D 131     112.182 160.366 134.854  1.00 27.66           C  
ATOM   9134  SD  MET D 131     113.406 161.158 135.900  1.00 27.66           S  
ATOM   9135  CE  MET D 131     114.833 161.078 134.825  1.00 27.66           C  
ATOM   9136  N   ARG D 132     112.963 156.214 133.333  1.00 39.51           N  
ATOM   9137  CA  ARG D 132     113.409 154.864 133.633  1.00 39.51           C  
ATOM   9138  C   ARG D 132     114.746 154.961 134.341  1.00 39.51           C  
ATOM   9139  O   ARG D 132     115.629 155.699 133.899  1.00 39.51           O  
ATOM   9140  CB  ARG D 132     113.528 154.018 132.372  1.00 39.51           C  
ATOM   9141  CG  ARG D 132     113.675 152.544 132.655  1.00 39.51           C  
ATOM   9142  CD  ARG D 132     113.462 151.723 131.406  1.00 39.51           C  
ATOM   9143  NE  ARG D 132     114.626 151.745 130.534  1.00 39.51           N  
ATOM   9144  CZ  ARG D 132     115.596 150.842 130.576  1.00 39.51           C  
ATOM   9145  NH1 ARG D 132     115.536 149.851 131.452  1.00 39.51           N  
ATOM   9146  NH2 ARG D 132     116.624 150.930 129.747  1.00 39.51           N  
ATOM   9147  N   LEU D 133     114.896 154.228 135.439  1.00 21.00           N  
ATOM   9148  CA  LEU D 133     116.063 154.407 136.286  1.00 21.00           C  
ATOM   9149  C   LEU D 133     116.636 153.067 136.707  1.00 21.00           C  
ATOM   9150  O   LEU D 133     115.916 152.077 136.846  1.00 21.00           O  
ATOM   9151  CB  LEU D 133     115.726 155.221 137.534  1.00 21.00           C  
ATOM   9152  CG  LEU D 133     115.481 156.704 137.317  1.00 21.00           C  
ATOM   9153  CD1 LEU D 133     115.226 157.377 138.639  1.00 21.00           C  
ATOM   9154  CD2 LEU D 133     116.679 157.310 136.647  1.00 21.00           C  
ATOM   9155  N   THR D 134     117.946 153.055 136.907  1.00 15.54           N  
ATOM   9156  CA  THR D 134     118.652 151.959 137.555  1.00 15.54           C  
ATOM   9157  C   THR D 134     119.228 152.516 138.846  1.00 15.54           C  
ATOM   9158  O   THR D 134     120.222 153.247 138.820  1.00 15.54           O  
ATOM   9159  CB  THR D 134     119.751 151.399 136.659  1.00 15.54           C  
ATOM   9160  OG1 THR D 134     119.171 150.891 135.453  1.00 15.54           O  
ATOM   9161  CG2 THR D 134     120.490 150.283 137.368  1.00 15.54           C  
ATOM   9162  N   VAL D 135     118.605 152.181 139.969  1.00 12.84           N  
ATOM   9163  CA  VAL D 135     118.930 152.777 141.258  1.00 12.84           C  
ATOM   9164  C   VAL D 135     119.735 151.776 142.067  1.00 12.84           C  
ATOM   9165  O   VAL D 135     119.315 150.628 142.243  1.00 12.84           O  
ATOM   9166  CB  VAL D 135     117.664 153.193 142.018  1.00 12.84           C  
ATOM   9167  CG1 VAL D 135     118.039 153.958 143.261  1.00 12.84           C  
ATOM   9168  CG2 VAL D 135     116.778 154.020 141.123  1.00 12.84           C  
ATOM   9169  N   ARG D 136     120.882 152.210 142.562  1.00 16.90           N  
ATOM   9170  CA  ARG D 136     121.778 151.371 143.344  1.00 16.90           C  
ATOM   9171  C   ARG D 136     121.804 151.929 144.758  1.00 16.90           C  
ATOM   9172  O   ARG D 136     122.468 152.936 145.019  1.00 16.90           O  
ATOM   9173  CB  ARG D 136     123.166 151.355 142.717  1.00 16.90           C  
ATOM   9174  CG  ARG D 136     124.150 150.412 143.355  1.00 16.90           C  
ATOM   9175  CD  ARG D 136     125.387 150.265 142.484  1.00 16.90           C  
ATOM   9176  NE  ARG D 136     125.072 149.690 141.179  1.00 16.90           N  
ATOM   9177  CZ  ARG D 136     124.963 150.393 140.056  1.00 16.90           C  
ATOM   9178  NH1 ARG D 136     124.671 149.785 138.916  1.00 16.90           N  
ATOM   9179  NH2 ARG D 136     125.147 151.704 140.072  1.00 16.90           N  
ATOM   9180  N   ALA D 137     121.084 151.283 145.670  1.00 21.52           N  
ATOM   9181  CA  ALA D 137     120.863 151.846 146.991  1.00 21.52           C  
ATOM   9182  C   ALA D 137     121.460 150.952 148.065  1.00 21.52           C  
ATOM   9183  O   ALA D 137     121.547 149.732 147.906  1.00 21.52           O  
ATOM   9184  CB  ALA D 137     119.374 152.050 147.262  1.00 21.52           C  
ATOM   9185  N   GLU D 138     121.855 151.572 149.172  1.00 26.35           N  
ATOM   9186  CA  GLU D 138     122.476 150.867 150.283  1.00 26.35           C  
ATOM   9187  C   GLU D 138     121.417 150.501 151.311  1.00 26.35           C  
ATOM   9188  O   GLU D 138     120.488 151.275 151.554  1.00 26.35           O  
ATOM   9189  CB  GLU D 138     123.570 151.718 150.931  1.00 26.35           C  
ATOM   9190  CG  GLU D 138     123.067 152.908 151.727  1.00 26.35           C  
ATOM   9191  CD  GLU D 138     124.187 153.666 152.411  1.00 26.35           C  
ATOM   9192  OE1 GLU D 138     125.337 153.185 152.369  1.00 26.35           O  
ATOM   9193  OE2 GLU D 138     123.920 154.743 152.986  1.00 26.35           O  
ATOM   9194  N   CYS D 139     121.549 149.312 151.895  1.00 38.83           N  
ATOM   9195  CA  CYS D 139     120.724 148.907 153.027  1.00 38.83           C  
ATOM   9196  C   CYS D 139     121.620 148.292 154.089  1.00 38.83           C  
ATOM   9197  O   CYS D 139     122.286 147.272 153.819  1.00 38.83           O  
ATOM   9198  CB  CYS D 139     119.624 147.919 152.631  1.00 38.83           C  
ATOM   9199  SG  CYS D 139     119.967 146.785 151.281  1.00 38.83           S  
ATOM   9200  N   PRO D 140     121.669 148.853 155.292  1.00 46.57           N  
ATOM   9201  CA  PRO D 140     122.403 148.199 156.374  1.00 46.57           C  
ATOM   9202  C   PRO D 140     121.739 146.886 156.745  1.00 46.57           C  
ATOM   9203  O   PRO D 140     120.518 146.739 156.674  1.00 46.57           O  
ATOM   9204  CB  PRO D 140     122.318 149.212 157.518  1.00 46.57           C  
ATOM   9205  CG  PRO D 140     121.067 149.963 157.244  1.00 46.57           C  
ATOM   9206  CD  PRO D 140     120.964 150.059 155.751  1.00 46.57           C  
ATOM   9207  N   MET D 141     122.562 145.920 157.138  1.00 53.63           N  
ATOM   9208  CA  MET D 141     122.084 144.582 157.438  1.00 53.63           C  
ATOM   9209  C   MET D 141     122.600 144.135 158.796  1.00 53.63           C  
ATOM   9210  O   MET D 141     123.660 144.570 159.253  1.00 53.63           O  
ATOM   9211  CB  MET D 141     122.522 143.577 156.368  1.00 53.63           C  
ATOM   9212  CG  MET D 141     122.046 143.907 154.967  1.00 53.63           C  
ATOM   9213  SD  MET D 141     122.629 142.709 153.754  1.00 53.63           S  
ATOM   9214  CE  MET D 141     121.925 143.377 152.252  1.00 53.63           C  
ATOM   9215  N   HIS D 142     121.833 143.259 159.435  1.00 68.36           N  
ATOM   9216  CA  HIS D 142     122.227 142.609 160.677  1.00 68.36           C  
ATOM   9217  C   HIS D 142     122.539 141.157 160.352  1.00 68.36           C  
ATOM   9218  O   HIS D 142     121.633 140.321 160.287  1.00 68.36           O  
ATOM   9219  CB  HIS D 142     121.127 142.712 161.729  1.00 68.36           C  
ATOM   9220  CG  HIS D 142     120.896 144.103 162.224  1.00 68.36           C  
ATOM   9221  ND1 HIS D 142     121.437 144.571 163.402  1.00 68.36           N  
ATOM   9222  CD2 HIS D 142     120.187 145.130 161.701  1.00 68.36           C  
ATOM   9223  CE1 HIS D 142     121.067 145.825 163.585  1.00 68.36           C  
ATOM   9224  NE2 HIS D 142     120.309 146.189 162.566  1.00 68.36           N  
ATOM   9225  N   LEU D 143     123.821 140.857 160.153  1.00 62.27           N  
ATOM   9226  CA  LEU D 143     124.253 139.529 159.749  1.00 62.27           C  
ATOM   9227  C   LEU D 143     124.521 138.617 160.937  1.00 62.27           C  
ATOM   9228  O   LEU D 143     125.307 137.673 160.820  1.00 62.27           O  
ATOM   9229  CB  LEU D 143     125.492 139.627 158.863  1.00 62.27           C  
ATOM   9230  CG  LEU D 143     125.215 140.216 157.482  1.00 62.27           C  
ATOM   9231  CD1 LEU D 143     126.469 140.234 156.635  1.00 62.27           C  
ATOM   9232  CD2 LEU D 143     124.122 139.425 156.797  1.00 62.27           C  
ATOM   9233  N   GLU D 144     123.887 138.883 162.080  1.00 65.07           N  
ATOM   9234  CA  GLU D 144     124.041 138.002 163.231  1.00 65.07           C  
ATOM   9235  C   GLU D 144     123.387 136.651 162.975  1.00 65.07           C  
ATOM   9236  O   GLU D 144     123.973 135.602 163.257  1.00 65.07           O  
ATOM   9237  CB  GLU D 144     123.452 138.662 164.476  1.00 65.07           C  
ATOM   9238  CG  GLU D 144     124.150 139.948 164.871  1.00 65.07           C  
ATOM   9239  CD  GLU D 144     123.415 140.697 165.960  1.00 65.07           C  
ATOM   9240  OE1 GLU D 144     122.251 140.344 166.243  1.00 65.07           O  
ATOM   9241  OE2 GLU D 144     124.001 141.639 166.533  1.00 65.07           O  
ATOM   9242  N   ASP D 145     122.174 136.657 162.432  1.00 58.61           N  
ATOM   9243  CA  ASP D 145     121.455 135.421 162.157  1.00 58.61           C  
ATOM   9244  C   ASP D 145     121.900 134.743 160.870  1.00 58.61           C  
ATOM   9245  O   ASP D 145     121.241 133.796 160.432  1.00 58.61           O  
ATOM   9246  CB  ASP D 145     119.951 135.688 162.102  1.00 58.61           C  
ATOM   9247  CG  ASP D 145     119.375 136.029 163.458  1.00 58.61           C  
ATOM   9248  OD1 ASP D 145     120.167 136.265 164.393  1.00 58.61           O  
ATOM   9249  OD2 ASP D 145     118.134 136.052 163.592  1.00 58.61           O  
ATOM   9250  N   PHE D 146     122.981 135.207 160.257  1.00 50.66           N  
ATOM   9251  CA  PHE D 146     123.468 134.596 159.030  1.00 50.66           C  
ATOM   9252  C   PHE D 146     123.772 133.120 159.269  1.00 50.66           C  
ATOM   9253  O   PHE D 146     124.327 132.764 160.314  1.00 50.66           O  
ATOM   9254  CB  PHE D 146     124.723 135.324 158.551  1.00 50.66           C  
ATOM   9255  CG  PHE D 146     125.311 134.771 157.290  1.00 50.66           C  
ATOM   9256  CD1 PHE D 146     124.829 135.167 156.058  1.00 50.66           C  
ATOM   9257  CD2 PHE D 146     126.364 133.879 157.335  1.00 50.66           C  
ATOM   9258  CE1 PHE D 146     125.375 134.671 154.897  1.00 50.66           C  
ATOM   9259  CE2 PHE D 146     126.912 133.381 156.177  1.00 50.66           C  
ATOM   9260  CZ  PHE D 146     126.417 133.776 154.957  1.00 50.66           C  
ATOM   9261  N   PRO D 147     123.425 132.229 158.330  1.00 46.87           N  
ATOM   9262  CA  PRO D 147     122.741 132.488 157.065  1.00 46.87           C  
ATOM   9263  C   PRO D 147     121.228 132.340 157.142  1.00 46.87           C  
ATOM   9264  O   PRO D 147     120.574 132.265 156.107  1.00 46.87           O  
ATOM   9265  CB  PRO D 147     123.324 131.420 156.150  1.00 46.87           C  
ATOM   9266  CG  PRO D 147     123.510 130.269 157.057  1.00 46.87           C  
ATOM   9267  CD  PRO D 147     123.889 130.835 158.404  1.00 46.87           C  
ATOM   9268  N   MET D 148     120.678 132.282 158.348  1.00 52.57           N  
ATOM   9269  CA  MET D 148     119.236 132.221 158.530  1.00 52.57           C  
ATOM   9270  C   MET D 148     118.604 133.603 158.603  1.00 52.57           C  
ATOM   9271  O   MET D 148     117.521 133.746 159.175  1.00 52.57           O  
ATOM   9272  CB  MET D 148     118.901 131.428 159.793  1.00 52.57           C  
ATOM   9273  CG  MET D 148     119.632 130.101 159.905  1.00 52.57           C  
ATOM   9274  SD  MET D 148     119.282 128.998 158.528  1.00 52.57           S  
ATOM   9275  CE  MET D 148     117.495 128.935 158.594  1.00 52.57           C  
ATOM   9276  N   ASP D 149     119.259 134.616 158.046  1.00 46.05           N  
ATOM   9277  CA  ASP D 149     118.821 135.991 158.226  1.00 46.05           C  
ATOM   9278  C   ASP D 149     117.662 136.336 157.302  1.00 46.05           C  
ATOM   9279  O   ASP D 149     117.471 135.729 156.247  1.00 46.05           O  
ATOM   9280  CB  ASP D 149     119.978 136.954 157.973  1.00 46.05           C  
ATOM   9281  CG  ASP D 149     120.497 136.880 156.552  1.00 46.05           C  
ATOM   9282  OD1 ASP D 149     120.310 135.831 155.902  1.00 46.05           O  
ATOM   9283  OD2 ASP D 149     121.100 137.869 156.089  1.00 46.05           O  
ATOM   9284  N   ALA D 150     116.882 137.328 157.722  1.00 38.59           N  
ATOM   9285  CA  ALA D 150     115.832 137.916 156.903  1.00 38.59           C  
ATOM   9286  C   ALA D 150     115.813 139.407 157.187  1.00 38.59           C  
ATOM   9287  O   ALA D 150     115.481 139.820 158.301  1.00 38.59           O  
ATOM   9288  CB  ALA D 150     114.469 137.289 157.203  1.00 38.59           C  
ATOM   9289  N   HIS D 151     116.165 140.211 156.187  1.00 33.07           N  
ATOM   9290  CA  HIS D 151     116.309 141.645 156.374  1.00 33.07           C  
ATOM   9291  C   HIS D 151     115.586 142.383 155.261  1.00 33.07           C  
ATOM   9292  O   HIS D 151     115.332 141.829 154.190  1.00 33.07           O  
ATOM   9293  CB  HIS D 151     117.782 142.058 156.410  1.00 33.07           C  
ATOM   9294  CG  HIS D 151     118.623 141.382 155.375  1.00 33.07           C  
ATOM   9295  ND1 HIS D 151     118.728 141.845 154.083  1.00 33.07           N  
ATOM   9296  CD2 HIS D 151     119.401 140.277 155.443  1.00 33.07           C  
ATOM   9297  CE1 HIS D 151     119.536 141.055 153.399  1.00 33.07           C  
ATOM   9298  NE2 HIS D 151     119.958 140.096 154.202  1.00 33.07           N  
ATOM   9299  N   ALA D 152     115.259 143.644 155.529  1.00 22.18           N  
ATOM   9300  CA  ALA D 152     114.469 144.470 154.629  1.00 22.18           C  
ATOM   9301  C   ALA D 152     115.318 145.620 154.113  1.00 22.18           C  
ATOM   9302  O   ALA D 152     115.879 146.382 154.904  1.00 22.18           O  
ATOM   9303  CB  ALA D 152     113.226 145.012 155.333  1.00 22.18           C  
ATOM   9304  N   CYS D 153     115.395 145.752 152.790  1.00 22.31           N  
ATOM   9305  CA  CYS D 153     116.186 146.843 152.236  1.00 22.31           C  
ATOM   9306  C   CYS D 153     115.286 148.017 151.894  1.00 22.31           C  
ATOM   9307  O   CYS D 153     114.252 147.830 151.236  1.00 22.31           O  
ATOM   9308  CB  CYS D 153     116.951 146.383 150.997  1.00 22.31           C  
ATOM   9309  SG  CYS D 153     118.448 145.436 151.406  1.00 22.31           S  
ATOM   9310  N   PRO D 154     115.614 149.218 152.362  1.00 18.65           N  
ATOM   9311  CA  PRO D 154     114.738 150.371 152.137  1.00 18.65           C  
ATOM   9312  C   PRO D 154     115.126 151.215 150.937  1.00 18.65           C  
ATOM   9313  O   PRO D 154     116.174 151.010 150.323  1.00 18.65           O  
ATOM   9314  CB  PRO D 154     114.893 151.163 153.433  1.00 18.65           C  
ATOM   9315  CG  PRO D 154     116.311 150.925 153.801  1.00 18.65           C  
ATOM   9316  CD  PRO D 154     116.641 149.516 153.371  1.00 18.65           C  
ATOM   9317  N   LEU D 155     114.260 152.166 150.603  1.00 16.54           N  
ATOM   9318  CA  LEU D 155     114.518 153.157 149.566  1.00 16.54           C  
ATOM   9319  C   LEU D 155     113.681 154.382 149.892  1.00 16.54           C  
ATOM   9320  O   LEU D 155     112.450 154.300 149.890  1.00 16.54           O  
ATOM   9321  CB  LEU D 155     114.163 152.615 148.186  1.00 16.54           C  
ATOM   9322  CG  LEU D 155     114.212 153.614 147.035  1.00 16.54           C  
ATOM   9323  CD1 LEU D 155     115.645 153.969 146.712  1.00 16.54           C  
ATOM   9324  CD2 LEU D 155     113.507 153.052 145.818  1.00 16.54           C  
ATOM   9325  N   LYS D 156     114.334 155.501 150.189  1.00 17.85           N  
ATOM   9326  CA  LYS D 156     113.653 156.701 150.657  1.00 17.85           C  
ATOM   9327  C   LYS D 156     113.936 157.839 149.693  1.00 17.85           C  
ATOM   9328  O   LYS D 156     115.095 158.217 149.502  1.00 17.85           O  
ATOM   9329  CB  LYS D 156     114.109 157.074 152.068  1.00 17.85           C  
ATOM   9330  CG  LYS D 156     113.997 155.937 153.060  1.00 17.85           C  
ATOM   9331  CD  LYS D 156     114.183 156.395 154.498  1.00 17.85           C  
ATOM   9332  CE  LYS D 156     115.643 156.458 154.897  1.00 17.85           C  
ATOM   9333  NZ  LYS D 156     116.332 157.645 154.331  1.00 17.85           N  
ATOM   9334  N   PHE D 157     112.886 158.394 149.100  1.00 39.51           N  
ATOM   9335  CA  PHE D 157     113.046 159.511 148.181  1.00 39.51           C  
ATOM   9336  C   PHE D 157     112.174 160.675 148.615  1.00 39.51           C  
ATOM   9337  O   PHE D 157     111.044 160.484 149.068  1.00 39.51           O  
ATOM   9338  CB  PHE D 157     112.714 159.118 146.742  1.00 39.51           C  
ATOM   9339  CG  PHE D 157     111.296 158.700 146.531  1.00 39.51           C  
ATOM   9340  CD1 PHE D 157     110.923 157.382 146.675  1.00 39.51           C  
ATOM   9341  CD2 PHE D 157     110.343 159.619 146.154  1.00 39.51           C  
ATOM   9342  CE1 PHE D 157     109.622 156.996 146.468  1.00 39.51           C  
ATOM   9343  CE2 PHE D 157     109.043 159.239 145.945  1.00 39.51           C  
ATOM   9344  CZ  PHE D 157     108.682 157.926 146.102  1.00 39.51           C  
ATOM   9345  N   GLY D 158     112.709 161.883 148.473  1.00 18.69           N  
ATOM   9346  CA  GLY D 158     111.991 163.082 148.847  1.00 18.69           C  
ATOM   9347  C   GLY D 158     112.459 164.239 147.996  1.00 18.69           C  
ATOM   9348  O   GLY D 158     113.391 164.115 147.201  1.00 18.69           O  
ATOM   9349  N   SER D 159     111.750 165.359 148.109  1.00 18.07           N  
ATOM   9350  CA  SER D 159     112.075 166.531 147.263  1.00 18.07           C  
ATOM   9351  C   SER D 159     113.345 167.222 147.746  1.00 18.07           C  
ATOM   9352  O   SER D 159     113.724 167.042 148.905  1.00 18.07           O  
ATOM   9353  CB  SER D 159     110.937 167.495 147.197  1.00 18.07           C  
ATOM   9354  OG  SER D 159     111.331 168.655 146.483  1.00 18.07           O  
ATOM   9355  N   TYR D 160     113.970 167.986 146.857  1.00 20.25           N  
ATOM   9356  CA  TYR D 160     115.200 168.726 147.217  1.00 20.25           C  
ATOM   9357  C   TYR D 160     114.929 170.216 147.031  1.00 20.25           C  
ATOM   9358  O   TYR D 160     114.022 170.592 146.278  1.00 20.25           O  
ATOM   9359  CB  TYR D 160     116.357 168.310 146.311  1.00 20.25           C  
ATOM   9360  CG  TYR D 160     117.730 168.552 146.877  1.00 20.25           C  
ATOM   9361  CD1 TYR D 160     118.415 169.728 146.640  1.00 20.25           C  
ATOM   9362  CD2 TYR D 160     118.358 167.584 147.633  1.00 20.25           C  
ATOM   9363  CE1 TYR D 160     119.683 169.939 147.153  1.00 20.25           C  
ATOM   9364  CE2 TYR D 160     119.624 167.774 148.151  1.00 20.25           C  
ATOM   9365  CZ  TYR D 160     120.288 168.958 147.912  1.00 20.25           C  
ATOM   9366  OH  TYR D 160     121.531 169.133 148.434  1.00 20.25           O  
ATOM   9367  N   ALA D 161     115.663 171.033 147.770  1.00 39.51           N  
ATOM   9368  CA  ALA D 161     115.564 172.486 147.661  1.00 39.51           C  
ATOM   9369  C   ALA D 161     114.140 173.001 147.798  1.00 39.51           C  
ATOM   9370  O   ALA D 161     113.863 174.144 147.427  1.00 39.51           O  
ATOM   9371  CB  ALA D 161     116.170 172.989 146.348  1.00 39.51           C  
ATOM   9372  N   TYR D 162     113.226 172.194 148.328  1.00 20.65           N  
ATOM   9373  CA  TYR D 162     111.842 172.606 148.521  1.00 20.65           C  
ATOM   9374  C   TYR D 162     111.357 172.066 149.854  1.00 20.65           C  
ATOM   9375  O   TYR D 162     111.353 170.851 150.063  1.00 20.65           O  
ATOM   9376  CB  TYR D 162     110.950 172.088 147.393  1.00 20.65           C  
ATOM   9377  CG  TYR D 162     111.081 172.821 146.079  1.00 20.65           C  
ATOM   9378  CD1 TYR D 162     111.143 174.203 146.031  1.00 20.65           C  
ATOM   9379  CD2 TYR D 162     111.130 172.125 144.886  1.00 20.65           C  
ATOM   9380  CE1 TYR D 162     111.249 174.867 144.829  1.00 20.65           C  
ATOM   9381  CE2 TYR D 162     111.237 172.777 143.687  1.00 20.65           C  
ATOM   9382  CZ  TYR D 162     111.297 174.147 143.661  1.00 20.65           C  
ATOM   9383  OH  TYR D 162     111.405 174.799 142.457  1.00 20.65           O  
ATOM   9384  N   THR D 163     110.935 172.956 150.745  1.00 19.95           N  
ATOM   9385  CA  THR D 163     110.458 172.514 152.043  1.00 19.95           C  
ATOM   9386  C   THR D 163     109.096 171.842 151.911  1.00 19.95           C  
ATOM   9387  O   THR D 163     108.509 171.762 150.831  1.00 19.95           O  
ATOM   9388  CB  THR D 163     110.352 173.684 153.014  1.00 19.95           C  
ATOM   9389  OG1 THR D 163     109.067 174.299 152.871  1.00 19.95           O  
ATOM   9390  CG2 THR D 163     111.425 174.710 152.722  1.00 19.95           C  
ATOM   9391  N   ARG D 164     108.592 171.351 153.044  1.00 17.78           N  
ATOM   9392  CA  ARG D 164     107.254 170.771 153.065  1.00 17.78           C  
ATOM   9393  C   ARG D 164     106.189 171.824 152.802  1.00 17.78           C  
ATOM   9394  O   ARG D 164     105.081 171.493 152.371  1.00 17.78           O  
ATOM   9395  CB  ARG D 164     107.016 170.077 154.406  1.00 17.78           C  
ATOM   9396  CG  ARG D 164     105.685 169.357 154.530  1.00 17.78           C  
ATOM   9397  CD  ARG D 164     104.655 170.220 155.238  1.00 17.78           C  
ATOM   9398  NE  ARG D 164     105.079 170.566 156.589  1.00 17.78           N  
ATOM   9399  CZ  ARG D 164     104.672 169.932 157.681  1.00 17.78           C  
ATOM   9400  NH1 ARG D 164     105.112 170.312 158.870  1.00 17.78           N  
ATOM   9401  NH2 ARG D 164     103.822 168.920 157.583  1.00 17.78           N  
ATOM   9402  N   ALA D 165     106.507 173.094 153.043  1.00 17.51           N  
ATOM   9403  CA  ALA D 165     105.533 174.154 152.814  1.00 17.51           C  
ATOM   9404  C   ALA D 165     105.230 174.328 151.332  1.00 17.51           C  
ATOM   9405  O   ALA D 165     104.219 174.937 150.969  1.00 17.51           O  
ATOM   9406  CB  ALA D 165     106.029 175.467 153.415  1.00 17.51           C  
ATOM   9407  N   GLU D 166     106.104 173.834 150.458  1.00 23.98           N  
ATOM   9408  CA  GLU D 166     105.991 174.140 149.038  1.00 23.98           C  
ATOM   9409  C   GLU D 166     105.724 172.934 148.147  1.00 23.98           C  
ATOM   9410  O   GLU D 166     105.123 173.100 147.082  1.00 23.98           O  
ATOM   9411  CB  GLU D 166     107.252 174.860 148.565  1.00 23.98           C  
ATOM   9412  CG  GLU D 166     107.438 176.208 149.244  1.00 23.98           C  
ATOM   9413  CD  GLU D 166     108.738 176.880 148.870  1.00 23.98           C  
ATOM   9414  OE1 GLU D 166     109.587 176.217 148.241  1.00 23.98           O  
ATOM   9415  OE2 GLU D 166     108.914 178.070 149.206  1.00 23.98           O  
ATOM   9416  N   VAL D 167     106.156 171.734 148.524  1.00 16.28           N  
ATOM   9417  CA  VAL D 167     105.929 170.537 147.720  1.00 16.28           C  
ATOM   9418  C   VAL D 167     105.619 169.371 148.645  1.00 16.28           C  
ATOM   9419  O   VAL D 167     106.371 169.104 149.586  1.00 16.28           O  
ATOM   9420  CB  VAL D 167     107.137 170.211 146.824  1.00 16.28           C  
ATOM   9421  CG1 VAL D 167     107.055 168.791 146.342  1.00 16.28           C  
ATOM   9422  CG2 VAL D 167     107.181 171.148 145.641  1.00 16.28           C  
ATOM   9423  N   VAL D 168     104.519 168.673 148.372  1.00 16.83           N  
ATOM   9424  CA  VAL D 168     104.068 167.547 149.179  1.00 16.83           C  
ATOM   9425  C   VAL D 168     103.849 166.352 148.264  1.00 16.83           C  
ATOM   9426  O   VAL D 168     103.145 166.461 147.255  1.00 16.83           O  
ATOM   9427  CB  VAL D 168     102.774 167.881 149.942  1.00 16.83           C  
ATOM   9428  CG1 VAL D 168     102.432 166.770 150.910  1.00 16.83           C  
ATOM   9429  CG2 VAL D 168     102.912 169.200 150.670  1.00 16.83           C  
ATOM   9430  N   TYR D 169     104.438 165.212 148.619  1.00 17.23           N  
ATOM   9431  CA  TYR D 169     104.344 164.002 147.812  1.00 17.23           C  
ATOM   9432  C   TYR D 169     103.207 163.111 148.293  1.00 17.23           C  
ATOM   9433  O   TYR D 169     102.988 162.957 149.496  1.00 17.23           O  
ATOM   9434  CB  TYR D 169     105.655 163.218 147.864  1.00 17.23           C  
ATOM   9435  CG  TYR D 169     106.763 163.784 147.014  1.00 17.23           C  
ATOM   9436  CD1 TYR D 169     106.498 164.348 145.782  1.00 17.23           C  
ATOM   9437  CD2 TYR D 169     108.074 163.748 147.444  1.00 17.23           C  
ATOM   9438  CE1 TYR D 169     107.506 164.857 145.005  1.00 17.23           C  
ATOM   9439  CE2 TYR D 169     109.087 164.257 146.674  1.00 17.23           C  
ATOM   9440  CZ  TYR D 169     108.797 164.809 145.457  1.00 17.23           C  
ATOM   9441  OH  TYR D 169     109.807 165.318 144.684  1.00 17.23           O  
ATOM   9442  N   GLU D 170     102.492 162.517 147.342  1.00 36.86           N  
ATOM   9443  CA  GLU D 170     101.429 161.567 147.639  1.00 36.86           C  
ATOM   9444  C   GLU D 170     101.470 160.436 146.625  1.00 36.86           C  
ATOM   9445  O   GLU D 170     102.127 160.530 145.587  1.00 36.86           O  
ATOM   9446  CB  GLU D 170     100.050 162.230 147.626  1.00 36.86           C  
ATOM   9447  CG  GLU D 170      99.775 163.090 148.833  1.00 36.86           C  
ATOM   9448  CD  GLU D 170      99.819 162.299 150.122  1.00 36.86           C  
ATOM   9449  OE1 GLU D 170      99.507 161.090 150.090  1.00 36.86           O  
ATOM   9450  OE2 GLU D 170     100.169 162.884 151.169  1.00 36.86           O  
ATOM   9451  N   TRP D 171     100.769 159.352 146.940  1.00 39.51           N  
ATOM   9452  CA  TRP D 171     100.727 158.201 146.052  1.00 39.51           C  
ATOM   9453  C   TRP D 171      99.504 158.259 145.148  1.00 39.51           C  
ATOM   9454  O   TRP D 171      98.437 158.726 145.551  1.00 39.51           O  
ATOM   9455  CB  TRP D 171     100.722 156.910 146.857  1.00 39.51           C  
ATOM   9456  CG  TRP D 171     101.848 156.817 147.814  1.00 39.51           C  
ATOM   9457  CD1 TRP D 171     101.869 157.270 149.092  1.00 39.51           C  
ATOM   9458  CD2 TRP D 171     103.125 156.226 147.576  1.00 39.51           C  
ATOM   9459  NE1 TRP D 171     103.081 157.000 149.670  1.00 39.51           N  
ATOM   9460  CE2 TRP D 171     103.870 156.357 148.756  1.00 39.51           C  
ATOM   9461  CE3 TRP D 171     103.711 155.599 146.479  1.00 39.51           C  
ATOM   9462  CZ2 TRP D 171     105.168 155.888 148.869  1.00 39.51           C  
ATOM   9463  CZ3 TRP D 171     104.999 155.133 146.594  1.00 39.51           C  
ATOM   9464  CH2 TRP D 171     105.714 155.279 147.778  1.00 39.51           C  
ATOM   9465  N   THR D 172      99.664 157.772 143.918  1.00 26.23           N  
ATOM   9466  CA  THR D 172      98.610 157.931 142.922  1.00 26.23           C  
ATOM   9467  C   THR D 172      97.394 157.079 143.253  1.00 26.23           C  
ATOM   9468  O   THR D 172      96.255 157.525 143.085  1.00 26.23           O  
ATOM   9469  CB  THR D 172      99.141 157.584 141.535  1.00 26.23           C  
ATOM   9470  OG1 THR D 172     100.416 158.208 141.341  1.00 26.23           O  
ATOM   9471  CG2 THR D 172      98.186 158.087 140.474  1.00 26.23           C  
ATOM   9472  N   ARG D 173      97.611 155.860 143.723  1.00 23.95           N  
ATOM   9473  CA  ARG D 173      96.539 154.929 144.045  1.00 23.95           C  
ATOM   9474  C   ARG D 173      96.571 154.646 145.541  1.00 23.95           C  
ATOM   9475  O   ARG D 173      97.292 155.300 146.295  1.00 23.95           O  
ATOM   9476  CB  ARG D 173      96.681 153.644 143.232  1.00 23.95           C  
ATOM   9477  CG  ARG D 173      96.973 153.871 141.769  1.00 23.95           C  
ATOM   9478  CD  ARG D 173      97.142 152.558 141.039  1.00 23.95           C  
ATOM   9479  NE  ARG D 173      97.521 152.769 139.650  1.00 23.95           N  
ATOM   9480  CZ  ARG D 173      98.777 152.848 139.229  1.00 23.95           C  
ATOM   9481  NH1 ARG D 173      99.773 152.731 140.094  1.00 23.95           N  
ATOM   9482  NH2 ARG D 173      99.039 153.043 137.946  1.00 23.95           N  
ATOM   9483  N   GLU D 174      95.772 153.682 145.973  1.00 22.34           N  
ATOM   9484  CA  GLU D 174      95.884 153.213 147.344  1.00 22.34           C  
ATOM   9485  C   GLU D 174      97.315 152.755 147.589  1.00 22.34           C  
ATOM   9486  O   GLU D 174      97.867 152.009 146.770  1.00 22.34           O  
ATOM   9487  CB  GLU D 174      94.909 152.072 147.618  1.00 22.34           C  
ATOM   9488  CG  GLU D 174      93.452 152.470 147.538  1.00 22.34           C  
ATOM   9489  CD  GLU D 174      92.824 152.104 146.212  1.00 22.34           C  
ATOM   9490  OE1 GLU D 174      93.472 151.381 145.428  1.00 22.34           O  
ATOM   9491  OE2 GLU D 174      91.683 152.538 145.955  1.00 22.34           O  
ATOM   9492  N   PRO D 175      97.950 153.183 148.679  1.00 15.93           N  
ATOM   9493  CA  PRO D 175      99.389 152.929 148.835  1.00 15.93           C  
ATOM   9494  C   PRO D 175      99.778 151.470 148.704  1.00 15.93           C  
ATOM   9495  O   PRO D 175     100.828 151.170 148.124  1.00 15.93           O  
ATOM   9496  CB  PRO D 175      99.673 153.475 150.235  1.00 15.93           C  
ATOM   9497  CG  PRO D 175      98.668 154.545 150.410  1.00 15.93           C  
ATOM   9498  CD  PRO D 175      97.427 154.054 149.740  1.00 15.93           C  
ATOM   9499  N   ALA D 176      98.956 150.549 149.208  1.00 14.02           N  
ATOM   9500  CA  ALA D 176      99.297 149.133 149.127  1.00 14.02           C  
ATOM   9501  C   ALA D 176      99.533 148.691 147.691  1.00 14.02           C  
ATOM   9502  O   ALA D 176     100.369 147.816 147.441  1.00 14.02           O  
ATOM   9503  CB  ALA D 176      98.193 148.290 149.761  1.00 14.02           C  
ATOM   9504  N   ARG D 177      98.815 149.279 146.739  1.00 22.98           N  
ATOM   9505  CA  ARG D 177      98.960 148.946 145.333  1.00 22.98           C  
ATOM   9506  C   ARG D 177      99.759 149.986 144.556  1.00 22.98           C  
ATOM   9507  O   ARG D 177      99.619 150.064 143.333  1.00 22.98           O  
ATOM   9508  CB  ARG D 177      97.583 148.769 144.692  1.00 22.98           C  
ATOM   9509  CG  ARG D 177      96.760 147.656 145.302  1.00 22.98           C  
ATOM   9510  CD  ARG D 177      95.325 147.684 144.802  1.00 22.98           C  
ATOM   9511  NE  ARG D 177      95.243 147.705 143.345  1.00 22.98           N  
ATOM   9512  CZ  ARG D 177      94.814 148.744 142.636  1.00 22.98           C  
ATOM   9513  NH1 ARG D 177      94.418 149.849 143.251  1.00 22.98           N  
ATOM   9514  NH2 ARG D 177      94.773 148.676 141.314  1.00 22.98           N  
ATOM   9515  N   SER D 178     100.581 150.793 145.230  1.00 19.78           N  
ATOM   9516  CA  SER D 178     101.371 151.785 144.507  1.00 19.78           C  
ATOM   9517  C   SER D 178     102.642 151.175 143.931  1.00 19.78           C  
ATOM   9518  O   SER D 178     102.827 151.138 142.712  1.00 19.78           O  
ATOM   9519  CB  SER D 178     101.706 152.960 145.419  1.00 19.78           C  
ATOM   9520  OG  SER D 178     100.545 153.719 145.690  1.00 19.78           O  
ATOM   9521  N   VAL D 179     103.529 150.683 144.790  1.00 15.48           N  
ATOM   9522  CA  VAL D 179     104.755 150.038 144.334  1.00 15.48           C  
ATOM   9523  C   VAL D 179     104.377 148.684 143.746  1.00 15.48           C  
ATOM   9524  O   VAL D 179     104.022 147.759 144.478  1.00 15.48           O  
ATOM   9525  CB  VAL D 179     105.768 149.884 145.471  1.00 15.48           C  
ATOM   9526  CG1 VAL D 179     106.961 149.087 145.002  1.00 15.48           C  
ATOM   9527  CG2 VAL D 179     106.207 151.240 145.954  1.00 15.48           C  
ATOM   9528  N   VAL D 180     104.452 148.562 142.425  1.00 18.86           N  
ATOM   9529  CA  VAL D 180     104.014 147.354 141.734  1.00 18.86           C  
ATOM   9530  C   VAL D 180     105.233 146.659 141.153  1.00 18.86           C  
ATOM   9531  O   VAL D 180     106.034 147.288 140.456  1.00 18.86           O  
ATOM   9532  CB  VAL D 180     102.995 147.668 140.627  1.00 18.86           C  
ATOM   9533  CG1 VAL D 180     102.573 146.396 139.933  1.00 18.86           C  
ATOM   9534  CG2 VAL D 180     101.794 148.373 141.209  1.00 18.86           C  
ATOM   9535  N   VAL D 181     105.364 145.365 141.420  1.00 20.42           N  
ATOM   9536  CA  VAL D 181     106.518 144.586 140.993  1.00 20.42           C  
ATOM   9537  C   VAL D 181     106.070 143.559 139.964  1.00 20.42           C  
ATOM   9538  O   VAL D 181     105.023 142.922 140.123  1.00 20.42           O  
ATOM   9539  CB  VAL D 181     107.209 143.910 142.192  1.00 20.42           C  
ATOM   9540  CG1 VAL D 181     106.194 143.177 143.044  1.00 20.42           C  
ATOM   9541  CG2 VAL D 181     108.296 142.968 141.721  1.00 20.42           C  
ATOM   9542  N   ALA D 182     106.856 143.412 138.900  1.00 33.26           N  
ATOM   9543  CA  ALA D 182     106.534 142.452 137.856  1.00 33.26           C  
ATOM   9544  C   ALA D 182     106.748 141.029 138.351  1.00 33.26           C  
ATOM   9545  O   ALA D 182     107.534 140.778 139.268  1.00 33.26           O  
ATOM   9546  CB  ALA D 182     107.384 142.706 136.614  1.00 33.26           C  
ATOM   9547  N   GLU D 183     106.037 140.088 137.728  1.00 58.40           N  
ATOM   9548  CA  GLU D 183     106.066 138.704 138.193  1.00 58.40           C  
ATOM   9549  C   GLU D 183     107.403 138.040 137.887  1.00 58.40           C  
ATOM   9550  O   GLU D 183     108.099 137.575 138.797  1.00 58.40           O  
ATOM   9551  CB  GLU D 183     104.917 137.921 137.563  1.00 58.40           C  
ATOM   9552  CG  GLU D 183     103.545 138.438 137.951  1.00 58.40           C  
ATOM   9553  CD  GLU D 183     102.426 137.720 137.232  1.00 58.40           C  
ATOM   9554  OE1 GLU D 183     102.718 136.955 136.289  1.00 58.40           O  
ATOM   9555  OE2 GLU D 183     101.252 137.918 137.610  1.00 58.40           O  
ATOM   9556  N   ASP D 184     107.778 137.984 136.614  1.00 58.02           N  
ATOM   9557  CA  ASP D 184     109.033 137.371 136.204  1.00 58.02           C  
ATOM   9558  C   ASP D 184     110.211 138.329 136.290  1.00 58.02           C  
ATOM   9559  O   ASP D 184     111.318 137.966 135.883  1.00 58.02           O  
ATOM   9560  CB  ASP D 184     108.923 136.844 134.773  1.00 58.02           C  
ATOM   9561  CG  ASP D 184     108.852 137.958 133.752  1.00 58.02           C  
ATOM   9562  OD1 ASP D 184     108.164 138.965 134.019  1.00 58.02           O  
ATOM   9563  OD2 ASP D 184     109.490 137.832 132.686  1.00 58.02           O  
ATOM   9564  N   GLY D 185     109.999 139.542 136.798  1.00 41.33           N  
ATOM   9565  CA  GLY D 185     111.077 140.514 136.829  1.00 41.33           C  
ATOM   9566  C   GLY D 185     112.158 140.170 137.833  1.00 41.33           C  
ATOM   9567  O   GLY D 185     113.334 140.470 137.616  1.00 41.33           O  
ATOM   9568  N   SER D 186     111.779 139.540 138.940  1.00 37.49           N  
ATOM   9569  CA  SER D 186     112.732 139.232 139.996  1.00 37.49           C  
ATOM   9570  C   SER D 186     113.858 138.357 139.467  1.00 37.49           C  
ATOM   9571  O   SER D 186     113.631 137.208 139.080  1.00 37.49           O  
ATOM   9572  CB  SER D 186     112.023 138.535 141.153  1.00 37.49           C  
ATOM   9573  OG  SER D 186     112.954 138.090 142.122  1.00 37.49           O  
ATOM   9574  N   ARG D 187     115.070 138.904 139.444  1.00 28.97           N  
ATOM   9575  CA  ARG D 187     116.271 138.139 139.123  1.00 28.97           C  
ATOM   9576  C   ARG D 187     117.195 138.215 140.333  1.00 28.97           C  
ATOM   9577  O   ARG D 187     118.094 139.053 140.413  1.00 28.97           O  
ATOM   9578  CB  ARG D 187     116.961 138.647 137.820  1.00 28.97           C  
ATOM   9579  CG  ARG D 187     117.251 140.136 137.747  1.00 28.97           C  
ATOM   9580  CD  ARG D 187     118.171 140.443 136.577  1.00 28.97           C  
ATOM   9581  NE  ARG D 187     118.579 141.844 136.548  1.00 28.97           N  
ATOM   9582  CZ  ARG D 187     118.050 142.765 135.750  1.00 28.97           C  
ATOM   9583  NH1 ARG D 187     118.490 144.014 135.799  1.00 28.97           N  
ATOM   9584  NH2 ARG D 187     117.088 142.439 134.898  1.00 28.97           N  
ATOM   9585  N   LEU D 188     116.965 137.319 141.284  1.00 29.56           N  
ATOM   9586  CA  LEU D 188     117.782 137.197 142.482  1.00 29.56           C  
ATOM   9587  C   LEU D 188     118.426 135.821 142.478  1.00 29.56           C  
ATOM   9588  O   LEU D 188     117.725 134.805 142.533  1.00 29.56           O  
ATOM   9589  CB  LEU D 188     116.944 137.397 143.743  1.00 29.56           C  
ATOM   9590  CG  LEU D 188     116.645 138.841 144.135  1.00 29.56           C  
ATOM   9591  CD1 LEU D 188     115.667 138.893 145.287  1.00 29.56           C  
ATOM   9592  CD2 LEU D 188     117.931 139.529 144.511  1.00 29.56           C  
ATOM   9593  N   ASN D 189     119.755 135.787 142.392  1.00 38.54           N  
ATOM   9594  CA  ASN D 189     120.449 134.505 142.414  1.00 38.54           C  
ATOM   9595  C   ASN D 189     120.243 133.793 143.741  1.00 38.54           C  
ATOM   9596  O   ASN D 189     119.908 132.604 143.769  1.00 38.54           O  
ATOM   9597  CB  ASN D 189     121.940 134.705 142.147  1.00 38.54           C  
ATOM   9598  CG  ASN D 189     122.237 135.009 140.694  1.00 38.54           C  
ATOM   9599  OD1 ASN D 189     121.509 134.586 139.796  1.00 38.54           O  
ATOM   9600  ND2 ASN D 189     123.318 135.741 140.455  1.00 38.54           N  
ATOM   9601  N   GLN D 190     120.410 134.509 144.848  1.00 37.19           N  
ATOM   9602  CA  GLN D 190     120.504 133.898 146.166  1.00 37.19           C  
ATOM   9603  C   GLN D 190     119.345 134.234 147.088  1.00 37.19           C  
ATOM   9604  O   GLN D 190     118.753 133.329 147.675  1.00 37.19           O  
ATOM   9605  CB  GLN D 190     121.815 134.321 146.829  1.00 37.19           C  
ATOM   9606  CG  GLN D 190     122.169 133.534 148.059  1.00 37.19           C  
ATOM   9607  CD  GLN D 190     123.584 133.802 148.511  1.00 37.19           C  
ATOM   9608  OE1 GLN D 190     124.349 134.475 147.822  1.00 37.19           O  
ATOM   9609  NE2 GLN D 190     123.942 133.279 149.674  1.00 37.19           N  
ATOM   9610  N   TYR D 191     119.000 135.508 147.230  1.00 29.83           N  
ATOM   9611  CA  TYR D 191     117.917 135.908 148.112  1.00 29.83           C  
ATOM   9612  C   TYR D 191     116.566 135.518 147.520  1.00 29.83           C  
ATOM   9613  O   TYR D 191     116.472 134.892 146.463  1.00 29.83           O  
ATOM   9614  CB  TYR D 191     117.974 137.407 148.373  1.00 29.83           C  
ATOM   9615  CG  TYR D 191     119.081 137.817 149.302  1.00 29.83           C  
ATOM   9616  CD1 TYR D 191     119.527 136.961 150.289  1.00 29.83           C  
ATOM   9617  CD2 TYR D 191     119.680 139.058 149.192  1.00 29.83           C  
ATOM   9618  CE1 TYR D 191     120.536 137.331 151.144  1.00 29.83           C  
ATOM   9619  CE2 TYR D 191     120.690 139.435 150.042  1.00 29.83           C  
ATOM   9620  CZ  TYR D 191     121.114 138.568 151.016  1.00 29.83           C  
ATOM   9621  OH  TYR D 191     122.125 138.938 151.870  1.00 29.83           O  
ATOM   9622  N   ASP D 192     115.503 135.883 148.228  1.00 28.37           N  
ATOM   9623  CA  ASP D 192     114.144 135.653 147.766  1.00 28.37           C  
ATOM   9624  C   ASP D 192     113.270 136.813 148.211  1.00 28.37           C  
ATOM   9625  O   ASP D 192     113.417 137.316 149.327  1.00 28.37           O  
ATOM   9626  CB  ASP D 192     113.585 134.339 148.307  1.00 28.37           C  
ATOM   9627  CG  ASP D 192     112.234 134.002 147.725  1.00 28.37           C  
ATOM   9628  OD1 ASP D 192     111.778 134.732 146.821  1.00 28.37           O  
ATOM   9629  OD2 ASP D 192     111.627 133.005 148.169  1.00 28.37           O  
ATOM   9630  N   LEU D 193     112.359 137.228 147.338  1.00 23.11           N  
ATOM   9631  CA  LEU D 193     111.498 138.370 147.606  1.00 23.11           C  
ATOM   9632  C   LEU D 193     110.211 137.907 148.272  1.00 23.11           C  
ATOM   9633  O   LEU D 193     109.575 136.954 147.812  1.00 23.11           O  
ATOM   9634  CB  LEU D 193     111.185 139.122 146.315  1.00 23.11           C  
ATOM   9635  CG  LEU D 193     110.385 140.408 146.497  1.00 23.11           C  
ATOM   9636  CD1 LEU D 193     111.142 141.348 147.398  1.00 23.11           C  
ATOM   9637  CD2 LEU D 193     110.117 141.066 145.161  1.00 23.11           C  
ATOM   9638  N   LEU D 194     109.833 138.582 149.357  1.00 23.47           N  
ATOM   9639  CA  LEU D 194     108.631 138.244 150.110  1.00 23.47           C  
ATOM   9640  C   LEU D 194     107.508 139.248 149.876  1.00 23.47           C  
ATOM   9641  O   LEU D 194     106.397 138.864 149.502  1.00 23.47           O  
ATOM   9642  CB  LEU D 194     108.954 138.152 151.607  1.00 23.47           C  
ATOM   9643  CG  LEU D 194     109.276 136.766 152.159  1.00 23.47           C  
ATOM   9644  CD1 LEU D 194     108.094 135.834 151.983  1.00 23.47           C  
ATOM   9645  CD2 LEU D 194     110.503 136.192 151.487  1.00 23.47           C  
ATOM   9646  N   GLY D 195     107.775 140.532 150.095  1.00 21.62           N  
ATOM   9647  CA  GLY D 195     106.732 141.532 149.966  1.00 21.62           C  
ATOM   9648  C   GLY D 195     107.296 142.934 149.950  1.00 21.62           C  
ATOM   9649  O   GLY D 195     108.504 143.153 150.076  1.00 21.62           O  
ATOM   9650  N   GLN D 196     106.389 143.892 149.787  1.00 18.71           N  
ATOM   9651  CA  GLN D 196     106.741 145.297 149.678  1.00 18.71           C  
ATOM   9652  C   GLN D 196     105.836 146.117 150.580  1.00 18.71           C  
ATOM   9653  O   GLN D 196     104.659 145.793 150.749  1.00 18.71           O  
ATOM   9654  CB  GLN D 196     106.614 145.774 148.241  1.00 18.71           C  
ATOM   9655  CG  GLN D 196     107.372 144.913 147.267  1.00 18.71           C  
ATOM   9656  CD  GLN D 196     107.188 145.358 145.844  1.00 18.71           C  
ATOM   9657  OE1 GLN D 196     106.148 145.907 145.485  1.00 18.71           O  
ATOM   9658  NE2 GLN D 196     108.201 145.132 145.019  1.00 18.71           N  
ATOM   9659  N   THR D 197     106.389 147.178 151.158  1.00 16.44           N  
ATOM   9660  CA  THR D 197     105.638 148.028 152.068  1.00 16.44           C  
ATOM   9661  C   THR D 197     106.001 149.481 151.808  1.00 16.44           C  
ATOM   9662  O   THR D 197     107.115 149.786 151.381  1.00 16.44           O  
ATOM   9663  CB  THR D 197     105.921 147.661 153.522  1.00 16.44           C  
ATOM   9664  OG1 THR D 197     105.975 146.236 153.646  1.00 16.44           O  
ATOM   9665  CG2 THR D 197     104.823 148.180 154.417  1.00 16.44           C  
ATOM   9666  N   VAL D 198     105.052 150.378 152.063  1.00 13.98           N  
ATOM   9667  CA  VAL D 198     105.239 151.797 151.801  1.00 13.98           C  
ATOM   9668  C   VAL D 198     104.903 152.590 153.052  1.00 13.98           C  
ATOM   9669  O   VAL D 198     104.202 152.108 153.946  1.00 13.98           O  
ATOM   9670  CB  VAL D 198     104.380 152.269 150.619  1.00 13.98           C  
ATOM   9671  CG1 VAL D 198     104.840 151.602 149.351  1.00 13.98           C  
ATOM   9672  CG2 VAL D 198     102.936 151.945 150.880  1.00 13.98           C  
ATOM   9673  N   ASP D 199     105.417 153.816 153.115  1.00 18.64           N  
ATOM   9674  CA  ASP D 199     105.188 154.686 154.258  1.00 18.64           C  
ATOM   9675  C   ASP D 199     105.504 156.123 153.872  1.00 18.64           C  
ATOM   9676  O   ASP D 199     106.368 156.370 153.029  1.00 18.64           O  
ATOM   9677  CB  ASP D 199     106.045 154.256 155.450  1.00 18.64           C  
ATOM   9678  CG  ASP D 199     105.797 155.100 156.675  1.00 18.64           C  
ATOM   9679  OD1 ASP D 199     104.802 155.850 156.680  1.00 18.64           O  
ATOM   9680  OD2 ASP D 199     106.593 155.014 157.635  1.00 18.64           O  
ATOM   9681  N   SER D 200     104.788 157.064 154.475  1.00 17.07           N  
ATOM   9682  CA  SER D 200     105.063 158.484 154.313  1.00 17.07           C  
ATOM   9683  C   SER D 200     105.653 159.026 155.604  1.00 17.07           C  
ATOM   9684  O   SER D 200     105.329 158.542 156.691  1.00 17.07           O  
ATOM   9685  CB  SER D 200     103.792 159.255 153.958  1.00 17.07           C  
ATOM   9686  OG  SER D 200     103.205 158.750 152.774  1.00 17.07           O  
ATOM   9687  N   GLY D 201     106.520 160.024 155.493  1.00 17.95           N  
ATOM   9688  CA  GLY D 201     107.144 160.569 156.681  1.00 17.95           C  
ATOM   9689  C   GLY D 201     107.626 161.982 156.455  1.00 17.95           C  
ATOM   9690  O   GLY D 201     107.630 162.494 155.332  1.00 17.95           O  
ATOM   9691  N   ILE D 202     108.028 162.613 157.552  1.00 16.81           N  
ATOM   9692  CA  ILE D 202     108.547 163.974 157.543  1.00 16.81           C  
ATOM   9693  C   ILE D 202     109.907 163.973 158.222  1.00 16.81           C  
ATOM   9694  O   ILE D 202     110.045 163.482 159.348  1.00 16.81           O  
ATOM   9695  CB  ILE D 202     107.577 164.940 158.239  1.00 16.81           C  
ATOM   9696  CG1 ILE D 202     106.305 165.092 157.407  1.00 16.81           C  
ATOM   9697  CG2 ILE D 202     108.230 166.279 158.441  1.00 16.81           C  
ATOM   9698  CD1 ILE D 202     105.259 165.983 158.038  1.00 16.81           C  
ATOM   9699  N   VAL D 203     110.911 164.520 157.543  1.00 20.66           N  
ATOM   9700  CA  VAL D 203     112.273 164.580 158.057  1.00 20.66           C  
ATOM   9701  C   VAL D 203     112.606 166.031 158.351  1.00 20.66           C  
ATOM   9702  O   VAL D 203     112.469 166.896 157.478  1.00 20.66           O  
ATOM   9703  CB  VAL D 203     113.281 163.977 157.067  1.00 20.66           C  
ATOM   9704  CG1 VAL D 203     114.673 164.498 157.358  1.00 20.66           C  
ATOM   9705  CG2 VAL D 203     113.252 162.461 157.134  1.00 20.66           C  
ATOM   9706  N   GLN D 204     113.040 166.297 159.577  1.00 30.65           N  
ATOM   9707  CA  GLN D 204     113.378 167.644 160.006  1.00 30.65           C  
ATOM   9708  C   GLN D 204     114.888 167.825 160.000  1.00 30.65           C  
ATOM   9709  O   GLN D 204     115.628 166.966 160.485  1.00 30.65           O  
ATOM   9710  CB  GLN D 204     112.817 167.903 161.401  1.00 30.65           C  
ATOM   9711  CG  GLN D 204     112.361 169.318 161.625  1.00 30.65           C  
ATOM   9712  CD  GLN D 204     111.368 169.423 162.757  1.00 30.65           C  
ATOM   9713  OE1 GLN D 204     111.159 168.468 163.504  1.00 30.65           O  
ATOM   9714  NE2 GLN D 204     110.742 170.585 162.888  1.00 30.65           N  
ATOM   9715  N   SER D 205     115.346 168.931 159.415  1.00 26.88           N  
ATOM   9716  CA  SER D 205     116.808 169.167 159.333  1.00 26.88           C  
ATOM   9717  C   SER D 205     117.138 170.631 159.624  1.00 26.88           C  
ATOM   9718  O   SER D 205     116.216 171.395 159.958  1.00 26.88           O  
ATOM   9719  CB  SER D 205     117.335 168.755 157.996  1.00 26.88           C  
ATOM   9720  OG  SER D 205     118.739 168.936 157.954  1.00 26.88           O  
ATOM   9721  N   SER D 206     118.411 170.996 159.453  1.00 28.84           N  
ATOM   9722  CA  SER D 206     118.895 172.375 159.717  1.00 28.84           C  
ATOM   9723  C   SER D 206     118.177 173.357 158.790  1.00 28.84           C  
ATOM   9724  O   SER D 206     117.795 174.441 159.264  1.00 28.84           O  
ATOM   9725  CB  SER D 206     120.380 172.442 159.523  1.00 28.84           C  
ATOM   9726  OG  SER D 206     120.743 171.824 158.301  1.00 28.84           O  
ATOM   9727  N   THR D 207     117.974 172.972 157.529  1.00 25.75           N  
ATOM   9728  CA  THR D 207     117.297 173.866 156.554  1.00 25.75           C  
ATOM   9729  C   THR D 207     115.794 173.945 156.840  1.00 25.75           C  
ATOM   9730  O   THR D 207     115.282 175.072 156.936  1.00 25.75           O  
ATOM   9731  CB  THR D 207     117.555 173.414 155.115  1.00 25.75           C  
ATOM   9732  OG1 THR D 207     118.970 173.312 154.970  1.00 25.75           O  
ATOM   9733  CG2 THR D 207     117.006 174.387 154.097  1.00 25.75           C  
ATOM   9734  N   GLY D 208     115.120 172.803 156.998  1.00 26.84           N  
ATOM   9735  CA  GLY D 208     113.689 172.826 157.215  1.00 26.84           C  
ATOM   9736  C   GLY D 208     113.118 171.423 157.244  1.00 26.84           C  
ATOM   9737  O   GLY D 208     113.827 170.448 157.495  1.00 26.84           O  
ATOM   9738  N   GLU D 209     111.814 171.347 157.004  1.00 25.07           N  
ATOM   9739  CA  GLU D 209     111.101 170.079 156.969  1.00 25.07           C  
ATOM   9740  C   GLU D 209     110.951 169.611 155.529  1.00 25.07           C  
ATOM   9741  O   GLU D 209     110.654 170.414 154.641  1.00 25.07           O  
ATOM   9742  CB  GLU D 209     109.726 170.209 157.621  1.00 25.07           C  
ATOM   9743  CG  GLU D 209     109.774 170.460 159.112  1.00 25.07           C  
ATOM   9744  CD  GLU D 209     108.419 170.300 159.770  1.00 25.07           C  
ATOM   9745  OE1 GLU D 209     107.411 170.177 159.043  1.00 25.07           O  
ATOM   9746  OE2 GLU D 209     108.362 170.292 161.017  1.00 25.07           O  
ATOM   9747  N   TYR D 210     111.166 168.315 155.292  1.00 20.87           N  
ATOM   9748  CA  TYR D 210     111.053 167.766 153.916  1.00 20.87           C  
ATOM   9749  C   TYR D 210     110.254 166.464 153.936  1.00 20.87           C  
ATOM   9750  O   TYR D 210     110.610 165.562 154.703  1.00 20.87           O  
ATOM   9751  CB  TYR D 210     112.436 167.458 153.346  1.00 20.87           C  
ATOM   9752  CG  TYR D 210     113.302 168.662 153.099  1.00 20.87           C  
ATOM   9753  CD1 TYR D 210     114.135 169.155 154.085  1.00 20.87           C  
ATOM   9754  CD2 TYR D 210     113.293 169.308 151.877  1.00 20.87           C  
ATOM   9755  CE1 TYR D 210     114.935 170.261 153.863  1.00 20.87           C  
ATOM   9756  CE2 TYR D 210     114.082 170.419 151.640  1.00 20.87           C  
ATOM   9757  CZ  TYR D 210     114.912 170.892 152.636  1.00 20.87           C  
ATOM   9758  OH  TYR D 210     115.697 171.982 152.411  1.00 20.87           O  
ATOM   9759  N   VAL D 211     109.226 166.372 153.093  1.00 15.51           N  
ATOM   9760  CA  VAL D 211     108.407 165.171 152.997  1.00 15.51           C  
ATOM   9761  C   VAL D 211     109.247 164.070 152.369  1.00 15.51           C  
ATOM   9762  O   VAL D 211     110.095 164.336 151.512  1.00 15.51           O  
ATOM   9763  CB  VAL D 211     107.133 165.455 152.186  1.00 15.51           C  
ATOM   9764  CG1 VAL D 211     107.491 165.867 150.777  1.00 15.51           C  
ATOM   9765  CG2 VAL D 211     106.228 164.248 152.178  1.00 15.51           C  
ATOM   9766  N   VAL D 212     109.050 162.832 152.816  1.00 14.68           N  
ATOM   9767  CA  VAL D 212     109.876 161.710 152.385  1.00 14.68           C  
ATOM   9768  C   VAL D 212     109.003 160.474 152.242  1.00 14.68           C  
ATOM   9769  O   VAL D 212     108.302 160.094 153.184  1.00 14.68           O  
ATOM   9770  CB  VAL D 212     111.017 161.442 153.381  1.00 14.68           C  
ATOM   9771  CG1 VAL D 212     111.572 160.055 153.183  1.00 14.68           C  
ATOM   9772  CG2 VAL D 212     112.105 162.472 153.225  1.00 14.68           C  
ATOM   9773  N   MET D 213     109.057 159.833 151.080  1.00 22.43           N  
ATOM   9774  CA  MET D 213     108.384 158.562 150.861  1.00 22.43           C  
ATOM   9775  C   MET D 213     109.386 157.439 151.077  1.00 22.43           C  
ATOM   9776  O   MET D 213     110.492 157.476 150.529  1.00 22.43           O  
ATOM   9777  CB  MET D 213     107.813 158.484 149.448  1.00 22.43           C  
ATOM   9778  CG  MET D 213     107.007 159.691 149.013  1.00 22.43           C  
ATOM   9779  SD  MET D 213     105.329 159.701 149.658  1.00 22.43           S  
ATOM   9780  CE  MET D 213     105.534 160.679 151.139  1.00 22.43           C  
ATOM   9781  N   THR D 214     109.003 156.446 151.874  1.00 17.51           N  
ATOM   9782  CA  THR D 214     109.850 155.307 152.184  1.00 17.51           C  
ATOM   9783  C   THR D 214     109.201 154.053 151.631  1.00 17.51           C  
ATOM   9784  O   THR D 214     107.988 153.871 151.765  1.00 17.51           O  
ATOM   9785  CB  THR D 214     110.050 155.165 153.694  1.00 17.51           C  
ATOM   9786  OG1 THR D 214     110.595 156.377 154.224  1.00 17.51           O  
ATOM   9787  CG2 THR D 214     110.987 154.015 154.006  1.00 17.51           C  
ATOM   9788  N   THR D 215     110.002 153.195 151.008  1.00 17.88           N  
ATOM   9789  CA  THR D 215     109.526 151.916 150.506  1.00 17.88           C  
ATOM   9790  C   THR D 215     110.487 150.829 150.952  1.00 17.88           C  
ATOM   9791  O   THR D 215     111.684 150.907 150.666  1.00 17.88           O  
ATOM   9792  CB  THR D 215     109.415 151.928 148.983  1.00 17.88           C  
ATOM   9793  OG1 THR D 215     108.485 152.938 148.581  1.00 17.88           O  
ATOM   9794  CG2 THR D 215     108.943 150.587 148.479  1.00 17.88           C  
ATOM   9795  N   HIS D 216     109.970 149.825 151.647  1.00 18.50           N  
ATOM   9796  CA  HIS D 216     110.759 148.695 152.114  1.00 18.50           C  
ATOM   9797  C   HIS D 216     110.474 147.485 151.239  1.00 18.50           C  
ATOM   9798  O   HIS D 216     109.309 147.172 150.971  1.00 18.50           O  
ATOM   9799  CB  HIS D 216     110.435 148.362 153.571  1.00 18.50           C  
ATOM   9800  CG  HIS D 216     110.814 149.434 154.542  1.00 18.50           C  
ATOM   9801  ND1 HIS D 216     109.884 150.245 155.154  1.00 18.50           N  
ATOM   9802  CD2 HIS D 216     112.020 149.817 155.023  1.00 18.50           C  
ATOM   9803  CE1 HIS D 216     110.500 151.087 155.964  1.00 18.50           C  
ATOM   9804  NE2 HIS D 216     111.797 150.849 155.902  1.00 18.50           N  
ATOM   9805  N   PHE D 217     111.532 146.807 150.797  1.00 17.27           N  
ATOM   9806  CA  PHE D 217     111.422 145.522 150.118  1.00 17.27           C  
ATOM   9807  C   PHE D 217     111.942 144.452 151.065  1.00 17.27           C  
ATOM   9808  O   PHE D 217     113.104 144.509 151.479  1.00 17.27           O  
ATOM   9809  CB  PHE D 217     112.226 145.506 148.818  1.00 17.27           C  
ATOM   9810  CG  PHE D 217     111.818 146.556 147.830  1.00 17.27           C  
ATOM   9811  CD1 PHE D 217     110.724 146.370 147.013  1.00 17.27           C  
ATOM   9812  CD2 PHE D 217     112.545 147.717 147.702  1.00 17.27           C  
ATOM   9813  CE1 PHE D 217     110.356 147.333 146.101  1.00 17.27           C  
ATOM   9814  CE2 PHE D 217     112.183 148.680 146.790  1.00 17.27           C  
ATOM   9815  CZ  PHE D 217     111.088 148.488 145.990  1.00 17.27           C  
ATOM   9816  N   HIS D 218     111.094 143.484 151.411  1.00 20.62           N  
ATOM   9817  CA  HIS D 218     111.478 142.433 152.344  1.00 20.62           C  
ATOM   9818  C   HIS D 218     112.182 141.307 151.597  1.00 20.62           C  
ATOM   9819  O   HIS D 218     111.714 140.867 150.545  1.00 20.62           O  
ATOM   9820  CB  HIS D 218     110.256 141.891 153.082  1.00 20.62           C  
ATOM   9821  CG  HIS D 218     109.613 142.883 153.999  1.00 20.62           C  
ATOM   9822  ND1 HIS D 218     110.282 143.461 155.054  1.00 20.62           N  
ATOM   9823  CD2 HIS D 218     108.358 143.387 154.027  1.00 20.62           C  
ATOM   9824  CE1 HIS D 218     109.468 144.287 155.688  1.00 20.62           C  
ATOM   9825  NE2 HIS D 218     108.295 144.259 155.085  1.00 20.62           N  
ATOM   9826  N   LEU D 219     113.302 140.842 152.143  1.00 24.02           N  
ATOM   9827  CA  LEU D 219     114.092 139.793 151.518  1.00 24.02           C  
ATOM   9828  C   LEU D 219     114.362 138.677 152.515  1.00 24.02           C  
ATOM   9829  O   LEU D 219     114.454 138.908 153.722  1.00 24.02           O  
ATOM   9830  CB  LEU D 219     115.423 140.326 150.988  1.00 24.02           C  
ATOM   9831  CG  LEU D 219     115.342 141.451 149.962  1.00 24.02           C  
ATOM   9832  CD1 LEU D 219     116.728 141.928 149.583  1.00 24.02           C  
ATOM   9833  CD2 LEU D 219     114.585 140.989 148.741  1.00 24.02           C  
ATOM   9834  N   LYS D 220     114.490 137.460 151.992  1.00 27.57           N  
ATOM   9835  CA  LYS D 220     114.865 136.293 152.774  1.00 27.57           C  
ATOM   9836  C   LYS D 220     115.883 135.488 151.979  1.00 27.57           C  
ATOM   9837  O   LYS D 220     115.895 135.527 150.746  1.00 27.57           O  
ATOM   9838  CB  LYS D 220     113.650 135.428 153.112  1.00 27.57           C  
ATOM   9839  CG  LYS D 220     113.926 134.333 154.120  1.00 27.57           C  
ATOM   9840  CD  LYS D 220     112.663 133.562 154.449  1.00 27.57           C  
ATOM   9841  CE  LYS D 220     112.925 132.494 155.494  1.00 27.57           C  
ATOM   9842  NZ  LYS D 220     111.685 131.743 155.828  1.00 27.57           N  
ATOM   9843  N   ARG D 221     116.739 134.762 152.689  1.00 29.55           N  
ATOM   9844  CA  ARG D 221     117.861 134.068 152.073  1.00 29.55           C  
ATOM   9845  C   ARG D 221     117.561 132.584 151.932  1.00 29.55           C  
ATOM   9846  O   ARG D 221     117.039 131.960 152.860  1.00 29.55           O  
ATOM   9847  CB  ARG D 221     119.136 134.263 152.892  1.00 29.55           C  
ATOM   9848  CG  ARG D 221     120.365 133.669 152.241  1.00 29.55           C  
ATOM   9849  CD  ARG D 221     121.561 133.759 153.157  1.00 29.55           C  
ATOM   9850  NE  ARG D 221     121.903 135.139 153.476  1.00 29.55           N  
ATOM   9851  CZ  ARG D 221     122.860 135.826 152.866  1.00 29.55           C  
ATOM   9852  NH1 ARG D 221     123.569 135.261 151.902  1.00 29.55           N  
ATOM   9853  NH2 ARG D 221     123.106 137.079 153.217  1.00 29.55           N  
ATOM   9854  N   LYS D 222     117.890 132.026 150.772  1.00 35.26           N  
ATOM   9855  CA  LYS D 222     117.796 130.587 150.574  1.00 35.26           C  
ATOM   9856  C   LYS D 222     118.926 129.882 151.312  1.00 35.26           C  
ATOM   9857  O   LYS D 222     120.065 130.355 151.332  1.00 35.26           O  
ATOM   9858  CB  LYS D 222     117.861 130.249 149.087  1.00 35.26           C  
ATOM   9859  CG  LYS D 222     116.757 130.850 148.245  1.00 35.26           C  
ATOM   9860  CD  LYS D 222     115.426 130.185 148.515  1.00 35.26           C  
ATOM   9861  CE  LYS D 222     114.392 130.616 147.493  1.00 35.26           C  
ATOM   9862  NZ  LYS D 222     113.084 129.946 147.712  1.00 35.26           N  
ATOM   9863  N   ILE D 223     118.609 128.734 151.917  1.00 39.55           N  
ATOM   9864  CA  ILE D 223     119.590 127.995 152.709  1.00 39.55           C  
ATOM   9865  C   ILE D 223     120.195 126.819 151.958  1.00 39.55           C  
ATOM   9866  O   ILE D 223     121.221 126.274 152.401  1.00 39.55           O  
ATOM   9867  CB  ILE D 223     118.942 127.502 154.017  1.00 39.55           C  
ATOM   9868  CG1 ILE D 223     120.002 127.287 155.091  1.00 39.55           C  
ATOM   9869  CG2 ILE D 223     118.170 126.222 153.776  1.00 39.55           C  
ATOM   9870  CD1 ILE D 223     120.854 128.503 155.330  1.00 39.55           C  
ATOM   9871  N   GLY D 224     119.607 126.424 150.827  1.00 48.53           N  
ATOM   9872  CA  GLY D 224     120.022 125.197 150.166  1.00 48.53           C  
ATOM   9873  C   GLY D 224     121.493 125.180 149.802  1.00 48.53           C  
ATOM   9874  O   GLY D 224     122.148 124.138 149.880  1.00 48.53           O  
ATOM   9875  N   TYR D 225     122.033 126.329 149.396  1.00 55.90           N  
ATOM   9876  CA  TYR D 225     123.443 126.384 149.029  1.00 55.90           C  
ATOM   9877  C   TYR D 225     124.332 126.062 150.221  1.00 55.90           C  
ATOM   9878  O   TYR D 225     125.191 125.176 150.150  1.00 55.90           O  
ATOM   9879  CB  TYR D 225     123.784 127.760 148.463  1.00 55.90           C  
ATOM   9880  CG  TYR D 225     125.261 127.971 148.245  1.00 55.90           C  
ATOM   9881  CD1 TYR D 225     125.950 127.236 147.295  1.00 55.90           C  
ATOM   9882  CD2 TYR D 225     125.965 128.907 148.987  1.00 55.90           C  
ATOM   9883  CE1 TYR D 225     127.300 127.424 147.090  1.00 55.90           C  
ATOM   9884  CE2 TYR D 225     127.314 129.105 148.788  1.00 55.90           C  
ATOM   9885  CZ  TYR D 225     127.977 128.360 147.838  1.00 55.90           C  
ATOM   9886  OH  TYR D 225     129.323 128.550 147.637  1.00 55.90           O  
ATOM   9887  N   PHE D 226     124.127 126.761 151.337  1.00 50.69           N  
ATOM   9888  CA  PHE D 226     124.971 126.545 152.503  1.00 50.69           C  
ATOM   9889  C   PHE D 226     124.699 125.210 153.179  1.00 50.69           C  
ATOM   9890  O   PHE D 226     125.503 124.783 154.013  1.00 50.69           O  
ATOM   9891  CB  PHE D 226     124.792 127.683 153.501  1.00 50.69           C  
ATOM   9892  CG  PHE D 226     125.155 129.022 152.948  1.00 50.69           C  
ATOM   9893  CD1 PHE D 226     126.469 129.448 152.943  1.00 50.69           C  
ATOM   9894  CD2 PHE D 226     124.185 129.853 152.426  1.00 50.69           C  
ATOM   9895  CE1 PHE D 226     126.807 130.679 152.431  1.00 50.69           C  
ATOM   9896  CE2 PHE D 226     124.517 131.085 151.914  1.00 50.69           C  
ATOM   9897  CZ  PHE D 226     125.831 131.499 151.916  1.00 50.69           C  
ATOM   9898  N   VAL D 227     123.585 124.550 152.857  1.00 52.91           N  
ATOM   9899  CA  VAL D 227     123.358 123.206 153.383  1.00 52.91           C  
ATOM   9900  C   VAL D 227     124.456 122.263 152.908  1.00 52.91           C  
ATOM   9901  O   VAL D 227     125.135 121.614 153.711  1.00 52.91           O  
ATOM   9902  CB  VAL D 227     121.967 122.689 152.983  1.00 52.91           C  
ATOM   9903  CG1 VAL D 227     121.870 121.204 153.259  1.00 52.91           C  
ATOM   9904  CG2 VAL D 227     120.896 123.432 153.749  1.00 52.91           C  
ATOM   9905  N   ILE D 228     124.649 122.177 151.589  1.00 53.99           N  
ATOM   9906  CA  ILE D 228     125.697 121.318 151.040  1.00 53.99           C  
ATOM   9907  C   ILE D 228     127.055 121.994 150.984  1.00 53.99           C  
ATOM   9908  O   ILE D 228     128.052 121.328 150.687  1.00 53.99           O  
ATOM   9909  CB  ILE D 228     125.370 120.843 149.615  1.00 53.99           C  
ATOM   9910  CG1 ILE D 228     125.664 121.956 148.613  1.00 53.99           C  
ATOM   9911  CG2 ILE D 228     123.922 120.416 149.517  1.00 53.99           C  
ATOM   9912  CD1 ILE D 228     125.533 121.528 147.178  1.00 53.99           C  
ATOM   9913  N   GLN D 229     127.126 123.297 151.247  1.00 58.30           N  
ATOM   9914  CA  GLN D 229     128.393 124.002 151.100  1.00 58.30           C  
ATOM   9915  C   GLN D 229     129.331 123.717 152.266  1.00 58.30           C  
ATOM   9916  O   GLN D 229     130.460 123.256 152.072  1.00 58.30           O  
ATOM   9917  CB  GLN D 229     128.146 125.503 150.970  1.00 58.30           C  
ATOM   9918  CG  GLN D 229     129.411 126.292 150.734  1.00 58.30           C  
ATOM   9919  CD  GLN D 229     130.135 125.832 149.494  1.00 58.30           C  
ATOM   9920  OE1 GLN D 229     129.510 125.506 148.486  1.00 58.30           O  
ATOM   9921  NE2 GLN D 229     131.458 125.788 149.561  1.00 58.30           N  
ATOM   9922  N   THR D 230     128.883 123.992 153.490  1.00 55.44           N  
ATOM   9923  CA  THR D 230     129.783 123.941 154.634  1.00 55.44           C  
ATOM   9924  C   THR D 230     129.264 123.037 155.745  1.00 55.44           C  
ATOM   9925  O   THR D 230     130.051 122.365 156.419  1.00 55.44           O  
ATOM   9926  CB  THR D 230     130.019 125.352 155.172  1.00 55.44           C  
ATOM   9927  OG1 THR D 230     130.503 126.188 154.114  1.00 55.44           O  
ATOM   9928  CG2 THR D 230     131.040 125.331 156.285  1.00 55.44           C  
ATOM   9929  N   TYR D 231     127.946 123.004 155.943  1.00 55.98           N  
ATOM   9930  CA  TYR D 231     127.386 122.205 157.029  1.00 55.98           C  
ATOM   9931  C   TYR D 231     127.629 120.717 156.809  1.00 55.98           C  
ATOM   9932  O   TYR D 231     128.100 120.015 157.714  1.00 55.98           O  
ATOM   9933  CB  TYR D 231     125.895 122.500 157.173  1.00 55.98           C  
ATOM   9934  CG  TYR D 231     125.624 123.826 157.834  1.00 55.98           C  
ATOM   9935  CD1 TYR D 231     126.552 124.387 158.697  1.00 55.98           C  
ATOM   9936  CD2 TYR D 231     124.449 124.521 157.595  1.00 55.98           C  
ATOM   9937  CE1 TYR D 231     126.317 125.598 159.308  1.00 55.98           C  
ATOM   9938  CE2 TYR D 231     124.206 125.736 158.203  1.00 55.98           C  
ATOM   9939  CZ  TYR D 231     125.144 126.268 159.058  1.00 55.98           C  
ATOM   9940  OH  TYR D 231     124.912 127.476 159.667  1.00 55.98           O  
ATOM   9941  N   LEU D 232     127.314 120.216 155.617  1.00 55.96           N  
ATOM   9942  CA  LEU D 232     127.540 118.800 155.336  1.00 55.96           C  
ATOM   9943  C   LEU D 232     129.008 118.407 155.414  1.00 55.96           C  
ATOM   9944  O   LEU D 232     129.303 117.332 155.963  1.00 55.96           O  
ATOM   9945  CB  LEU D 232     126.934 118.434 153.979  1.00 55.96           C  
ATOM   9946  CG  LEU D 232     125.425 118.209 153.989  1.00 55.96           C  
ATOM   9947  CD1 LEU D 232     124.994 117.556 152.694  1.00 55.96           C  
ATOM   9948  CD2 LEU D 232     125.025 117.360 155.180  1.00 55.96           C  
ATOM   9949  N   PRO D 233     129.964 119.179 154.883  1.00 55.55           N  
ATOM   9950  CA  PRO D 233     131.370 118.808 155.098  1.00 55.55           C  
ATOM   9951  C   PRO D 233     131.750 118.695 156.562  1.00 55.55           C  
ATOM   9952  O   PRO D 233     132.419 117.727 156.939  1.00 55.55           O  
ATOM   9953  CB  PRO D 233     132.134 119.934 154.392  1.00 55.55           C  
ATOM   9954  CG  PRO D 233     131.231 120.337 153.301  1.00 55.55           C  
ATOM   9955  CD  PRO D 233     129.844 120.249 153.876  1.00 55.55           C  
ATOM   9956  N   CYS D 234     131.332 119.638 157.410  1.00 59.46           N  
ATOM   9957  CA  CYS D 234     131.723 119.558 158.814  1.00 59.46           C  
ATOM   9958  C   CYS D 234     131.045 118.387 159.510  1.00 59.46           C  
ATOM   9959  O   CYS D 234     131.658 117.728 160.357  1.00 59.46           O  
ATOM   9960  CB  CYS D 234     131.412 120.863 159.544  1.00 59.46           C  
ATOM   9961  SG  CYS D 234     132.816 121.504 160.504  1.00 59.46           S  
ATOM   9962  N   ILE D 235     129.788 118.101 159.168  1.00 56.48           N  
ATOM   9963  CA  ILE D 235     129.120 116.958 159.782  1.00 56.48           C  
ATOM   9964  C   ILE D 235     129.797 115.657 159.370  1.00 56.48           C  
ATOM   9965  O   ILE D 235     130.061 114.782 160.210  1.00 56.48           O  
ATOM   9966  CB  ILE D 235     127.624 116.960 159.429  1.00 56.48           C  
ATOM   9967  CG1 ILE D 235     126.903 118.052 160.214  1.00 56.48           C  
ATOM   9968  CG2 ILE D 235     127.007 115.608 159.721  1.00 56.48           C  
ATOM   9969  CD1 ILE D 235     125.416 118.076 159.985  1.00 56.48           C  
ATOM   9970  N   MET D 236     130.094 115.508 158.077  1.00 62.27           N  
ATOM   9971  CA  MET D 236     130.795 114.317 157.614  1.00 62.27           C  
ATOM   9972  C   MET D 236     132.159 114.193 158.276  1.00 62.27           C  
ATOM   9973  O   MET D 236     132.583 113.090 158.634  1.00 62.27           O  
ATOM   9974  CB  MET D 236     130.939 114.347 156.093  1.00 62.27           C  
ATOM   9975  CG  MET D 236     129.631 114.228 155.322  1.00 62.27           C  
ATOM   9976  SD  MET D 236     128.898 112.581 155.360  1.00 62.27           S  
ATOM   9977  CE  MET D 236     127.693 112.760 156.673  1.00 62.27           C  
ATOM   9978  N   THR D 237     132.853 115.317 158.467  1.00 57.44           N  
ATOM   9979  CA  THR D 237     134.175 115.268 159.080  1.00 57.44           C  
ATOM   9980  C   THR D 237     134.089 114.873 160.547  1.00 57.44           C  
ATOM   9981  O   THR D 237     134.917 114.096 161.034  1.00 57.44           O  
ATOM   9982  CB  THR D 237     134.873 116.615 158.923  1.00 57.44           C  
ATOM   9983  OG1 THR D 237     134.934 116.954 157.535  1.00 57.44           O  
ATOM   9984  CG2 THR D 237     136.280 116.546 159.469  1.00 57.44           C  
ATOM   9985  N   VAL D 238     133.095 115.392 161.268  1.00 58.33           N  
ATOM   9986  CA  VAL D 238     132.907 114.988 162.659  1.00 58.33           C  
ATOM   9987  C   VAL D 238     132.641 113.493 162.740  1.00 58.33           C  
ATOM   9988  O   VAL D 238     133.248 112.776 163.547  1.00 58.33           O  
ATOM   9989  CB  VAL D 238     131.770 115.792 163.310  1.00 58.33           C  
ATOM   9990  CG1 VAL D 238     131.383 115.162 164.632  1.00 58.33           C  
ATOM   9991  CG2 VAL D 238     132.200 117.220 163.524  1.00 58.33           C  
ATOM   9992  N   ILE D 239     131.729 112.998 161.899  1.00 61.90           N  
ATOM   9993  CA  ILE D 239     131.392 111.578 161.935  1.00 61.90           C  
ATOM   9994  C   ILE D 239     132.614 110.731 161.603  1.00 61.90           C  
ATOM   9995  O   ILE D 239     132.891 109.725 162.268  1.00 61.90           O  
ATOM   9996  CB  ILE D 239     130.217 111.286 160.986  1.00 61.90           C  
ATOM   9997  CG1 ILE D 239     128.936 111.919 161.532  1.00 61.90           C  
ATOM   9998  CG2 ILE D 239     130.041 109.792 160.797  1.00 61.90           C  
ATOM   9999  CD1 ILE D 239     127.721 111.676 160.672  1.00 61.90           C  
ATOM  10000  N   LEU D 240     133.375 111.135 160.584  1.00 64.12           N  
ATOM  10001  CA  LEU D 240     134.574 110.395 160.208  1.00 64.12           C  
ATOM  10002  C   LEU D 240     135.578 110.361 161.353  1.00 64.12           C  
ATOM  10003  O   LEU D 240     136.043 109.289 161.754  1.00 64.12           O  
ATOM  10004  CB  LEU D 240     135.195 111.019 158.960  1.00 64.12           C  
ATOM  10005  CG  LEU D 240     136.267 110.187 158.261  1.00 64.12           C  
ATOM  10006  CD1 LEU D 240     135.703 108.839 157.857  1.00 64.12           C  
ATOM  10007  CD2 LEU D 240     136.822 110.919 157.050  1.00 64.12           C  
ATOM  10008  N   SER D 241     135.916 111.531 161.900  1.00 62.47           N  
ATOM  10009  CA  SER D 241     136.888 111.595 162.985  1.00 62.47           C  
ATOM  10010  C   SER D 241     136.435 110.797 164.197  1.00 62.47           C  
ATOM  10011  O   SER D 241     137.272 110.259 164.931  1.00 62.47           O  
ATOM  10012  CB  SER D 241     137.139 113.048 163.378  1.00 62.47           C  
ATOM  10013  OG  SER D 241     135.954 113.649 163.868  1.00 62.47           O  
ATOM  10014  N   GLN D 242     135.124 110.703 164.430  1.00 68.03           N  
ATOM  10015  CA  GLN D 242     134.654 109.876 165.536  1.00 68.03           C  
ATOM  10016  C   GLN D 242     134.754 108.392 165.210  1.00 68.03           C  
ATOM  10017  O   GLN D 242     134.971 107.576 166.113  1.00 68.03           O  
ATOM  10018  CB  GLN D 242     133.217 110.239 165.901  1.00 68.03           C  
ATOM  10019  CG  GLN D 242     133.089 111.468 166.778  1.00 68.03           C  
ATOM  10020  CD  GLN D 242     131.708 111.600 167.379  1.00 68.03           C  
ATOM  10021  OE1 GLN D 242     130.838 110.763 167.149  1.00 68.03           O  
ATOM  10022  NE2 GLN D 242     131.497 112.655 168.153  1.00 68.03           N  
ATOM  10023  N   VAL D 243     134.594 108.027 163.935  1.00 76.67           N  
ATOM  10024  CA  VAL D 243     134.666 106.619 163.547  1.00 76.67           C  
ATOM  10025  C   VAL D 243     136.011 106.019 163.939  1.00 76.67           C  
ATOM  10026  O   VAL D 243     136.097 104.844 164.317  1.00 76.67           O  
ATOM  10027  CB  VAL D 243     134.388 106.468 162.039  1.00 76.67           C  
ATOM  10028  CG1 VAL D 243     134.910 105.140 161.516  1.00 76.67           C  
ATOM  10029  CG2 VAL D 243     132.900 106.578 161.769  1.00 76.67           C  
ATOM  10030  N   SER D 244     137.075 106.824 163.889  1.00 77.92           N  
ATOM  10031  CA  SER D 244     138.416 106.320 164.167  1.00 77.92           C  
ATOM  10032  C   SER D 244     138.544 105.697 165.552  1.00 77.92           C  
ATOM  10033  O   SER D 244     139.475 104.919 165.781  1.00 77.92           O  
ATOM  10034  CB  SER D 244     139.437 107.447 164.018  1.00 77.92           C  
ATOM  10035  OG  SER D 244     140.723 107.021 164.431  1.00 77.92           O  
ATOM  10036  N   PHE D 245     137.635 106.009 166.475  1.00 82.59           N  
ATOM  10037  CA  PHE D 245     137.721 105.465 167.823  1.00 82.59           C  
ATOM  10038  C   PHE D 245     137.412 103.978 167.894  1.00 82.59           C  
ATOM  10039  O   PHE D 245     137.710 103.349 168.915  1.00 82.59           O  
ATOM  10040  CB  PHE D 245     136.770 106.218 168.755  1.00 82.59           C  
ATOM  10041  CG  PHE D 245     137.314 107.525 169.237  1.00 82.59           C  
ATOM  10042  CD1 PHE D 245     138.658 107.816 169.107  1.00 82.59           C  
ATOM  10043  CD2 PHE D 245     136.484 108.460 169.831  1.00 82.59           C  
ATOM  10044  CE1 PHE D 245     139.167 109.017 169.553  1.00 82.59           C  
ATOM  10045  CE2 PHE D 245     136.986 109.664 170.280  1.00 82.59           C  
ATOM  10046  CZ  PHE D 245     138.329 109.943 170.141  1.00 82.59           C  
ATOM  10047  N   TRP D 246     136.832 103.398 166.844  1.00 89.33           N  
ATOM  10048  CA  TRP D 246     136.455 101.991 166.901  1.00 89.33           C  
ATOM  10049  C   TRP D 246     137.617 101.085 166.518  1.00 89.33           C  
ATOM  10050  O   TRP D 246     137.688  99.936 166.970  1.00 89.33           O  
ATOM  10051  CB  TRP D 246     135.241 101.742 166.011  1.00 89.33           C  
ATOM  10052  CG  TRP D 246     134.005 102.369 166.564  1.00 89.33           C  
ATOM  10053  CD1 TRP D 246     133.427 103.537 166.166  1.00 89.33           C  
ATOM  10054  CD2 TRP D 246     133.209 101.873 167.643  1.00 89.33           C  
ATOM  10055  NE1 TRP D 246     132.309 103.793 166.923  1.00 89.33           N  
ATOM  10056  CE2 TRP D 246     132.154 102.786 167.838  1.00 89.33           C  
ATOM  10057  CE3 TRP D 246     133.280 100.740 168.458  1.00 89.33           C  
ATOM  10058  CZ2 TRP D 246     131.181 102.602 168.815  1.00 89.33           C  
ATOM  10059  CZ3 TRP D 246     132.314 100.559 169.427  1.00 89.33           C  
ATOM  10060  CH2 TRP D 246     131.278 101.484 169.597  1.00 89.33           C  
ATOM  10061  N   LEU D 247     138.533 101.578 165.690  1.00 85.42           N  
ATOM  10062  CA  LEU D 247     139.669 100.775 165.264  1.00 85.42           C  
ATOM  10063  C   LEU D 247     140.559 100.416 166.452  1.00 85.42           C  
ATOM  10064  O   LEU D 247     140.523 101.051 167.509  1.00 85.42           O  
ATOM  10065  CB  LEU D 247     140.481 101.516 164.204  1.00 85.42           C  
ATOM  10066  CG  LEU D 247     139.750 101.810 162.895  1.00 85.42           C  
ATOM  10067  CD1 LEU D 247     140.711 102.377 161.864  1.00 85.42           C  
ATOM  10068  CD2 LEU D 247     139.073 100.558 162.370  1.00 85.42           C  
ATOM  10069  N   ASN D 248     141.364  99.372 166.263  1.00 83.22           N  
ATOM  10070  CA  ASN D 248     142.262  98.913 167.315  1.00 83.22           C  
ATOM  10071  C   ASN D 248     143.352  99.944 167.584  1.00 83.22           C  
ATOM  10072  O   ASN D 248     143.858 100.594 166.665  1.00 83.22           O  
ATOM  10073  CB  ASN D 248     142.884  97.573 166.925  1.00 83.22           C  
ATOM  10074  CG  ASN D 248     143.826  97.036 167.981  1.00 83.22           C  
ATOM  10075  OD1 ASN D 248     143.791  97.458 169.137  1.00 83.22           O  
ATOM  10076  ND2 ASN D 248     144.671  96.090 167.591  1.00 83.22           N  
ATOM  10077  N   ARG D 249     143.716 100.088 168.861  1.00 85.03           N  
ATOM  10078  CA  ARG D 249     144.731 101.064 169.244  1.00 85.03           C  
ATOM  10079  C   ARG D 249     146.139 100.613 168.876  1.00 85.03           C  
ATOM  10080  O   ARG D 249     147.076 101.411 168.974  1.00 85.03           O  
ATOM  10081  CB  ARG D 249     144.655 101.360 170.744  1.00 85.03           C  
ATOM  10082  CG  ARG D 249     145.216 100.271 171.649  1.00 85.03           C  
ATOM  10083  CD  ARG D 249     144.231  99.130 171.843  1.00 85.03           C  
ATOM  10084  NE  ARG D 249     142.938  99.605 172.326  1.00 85.03           N  
ATOM  10085  CZ  ARG D 249     141.885  98.822 172.533  1.00 85.03           C  
ATOM  10086  NH1 ARG D 249     140.748  99.341 172.974  1.00 85.03           N  
ATOM  10087  NH2 ARG D 249     141.968  97.519 172.299  1.00 85.03           N  
ATOM  10088  N   GLU D 250     146.310  99.355 168.467  1.00 83.10           N  
ATOM  10089  CA  GLU D 250     147.627  98.898 168.039  1.00 83.10           C  
ATOM  10090  C   GLU D 250     148.028  99.532 166.713  1.00 83.10           C  
ATOM  10091  O   GLU D 250     149.185  99.928 166.534  1.00 83.10           O  
ATOM  10092  CB  GLU D 250     147.649  97.374 167.934  1.00 83.10           C  
ATOM  10093  CG  GLU D 250     147.460  96.659 169.262  1.00 83.10           C  
ATOM  10094  CD  GLU D 250     147.540  95.153 169.128  1.00 83.10           C  
ATOM  10095  OE1 GLU D 250     147.628  94.663 167.983  1.00 83.10           O  
ATOM  10096  OE2 GLU D 250     147.518  94.459 170.166  1.00 83.10           O  
ATOM  10097  N   SER D 251     147.089  99.637 165.773  1.00 77.41           N  
ATOM  10098  CA  SER D 251     147.365 100.222 164.462  1.00 77.41           C  
ATOM  10099  C   SER D 251     147.450 101.737 164.620  1.00 77.41           C  
ATOM  10100  O   SER D 251     146.495 102.481 164.390  1.00 77.41           O  
ATOM  10101  CB  SER D 251     146.298  99.815 163.455  1.00 77.41           C  
ATOM  10102  OG  SER D 251     146.288  98.410 163.267  1.00 77.41           O  
ATOM  10103  N   VAL D 252     148.631 102.194 165.023  1.00 74.68           N  
ATOM  10104  CA  VAL D 252     148.866 103.603 165.333  1.00 74.68           C  
ATOM  10105  C   VAL D 252     148.920 104.463 164.071  1.00 74.68           C  
ATOM  10106  O   VAL D 252     148.201 105.473 164.005  1.00 74.68           O  
ATOM  10107  CB  VAL D 252     150.145 103.773 166.167  1.00 74.68           C  
ATOM  10108  CG1 VAL D 252     150.439 105.244 166.392  1.00 74.68           C  
ATOM  10109  CG2 VAL D 252     150.008 103.046 167.493  1.00 74.68           C  
ATOM  10110  N   PRO D 253     149.739 104.132 163.059  1.00 74.29           N  
ATOM  10111  CA  PRO D 253     149.900 105.075 161.936  1.00 74.29           C  
ATOM  10112  C   PRO D 253     148.604 105.392 161.213  1.00 74.29           C  
ATOM  10113  O   PRO D 253     148.405 106.535 160.781  1.00 74.29           O  
ATOM  10114  CB  PRO D 253     150.901 104.357 161.019  1.00 74.29           C  
ATOM  10115  CG  PRO D 253     151.619 103.416 161.906  1.00 74.29           C  
ATOM  10116  CD  PRO D 253     150.589 102.941 162.874  1.00 74.29           C  
ATOM  10117  N   ALA D 254     147.715 104.408 161.068  1.00 73.56           N  
ATOM  10118  CA  ALA D 254     146.434 104.662 160.419  1.00 73.56           C  
ATOM  10119  C   ALA D 254     145.631 105.704 161.186  1.00 73.56           C  
ATOM  10120  O   ALA D 254     145.099 106.652 160.599  1.00 73.56           O  
ATOM  10121  CB  ALA D 254     145.646 103.359 160.287  1.00 73.56           C  
ATOM  10122  N   ARG D 255     145.545 105.551 162.509  1.00 75.05           N  
ATOM  10123  CA  ARG D 255     144.788 106.505 163.311  1.00 75.05           C  
ATOM  10124  C   ARG D 255     145.450 107.877 163.328  1.00 75.05           C  
ATOM  10125  O   ARG D 255     144.755 108.899 163.377  1.00 75.05           O  
ATOM  10126  CB  ARG D 255     144.615 105.970 164.731  1.00 75.05           C  
ATOM  10127  CG  ARG D 255     143.870 104.646 164.800  1.00 75.05           C  
ATOM  10128  CD  ARG D 255     143.893 104.061 166.204  1.00 75.05           C  
ATOM  10129  NE  ARG D 255     143.128 104.861 167.156  1.00 75.05           N  
ATOM  10130  CZ  ARG D 255     141.883 104.587 167.533  1.00 75.05           C  
ATOM  10131  NH1 ARG D 255     141.255 103.531 167.036  1.00 75.05           N  
ATOM  10132  NH2 ARG D 255     141.266 105.371 168.405  1.00 75.05           N  
ATOM  10133  N   THR D 256     146.782 107.930 163.271  1.00 69.85           N  
ATOM  10134  CA  THR D 256     147.452 109.227 163.229  1.00 69.85           C  
ATOM  10135  C   THR D 256     147.166 109.948 161.917  1.00 69.85           C  
ATOM  10136  O   THR D 256     146.869 111.149 161.909  1.00 69.85           O  
ATOM  10137  CB  THR D 256     148.956 109.062 163.427  1.00 69.85           C  
ATOM  10138  OG1 THR D 256     149.486 108.228 162.392  1.00 69.85           O  
ATOM  10139  CG2 THR D 256     149.245 108.444 164.783  1.00 69.85           C  
ATOM  10140  N   VAL D 257     147.269 109.231 160.794  1.00 66.34           N  
ATOM  10141  CA  VAL D 257     146.908 109.812 159.502  1.00 66.34           C  
ATOM  10142  C   VAL D 257     145.456 110.270 159.518  1.00 66.34           C  
ATOM  10143  O   VAL D 257     145.113 111.335 158.988  1.00 66.34           O  
ATOM  10144  CB  VAL D 257     147.172 108.801 158.370  1.00 66.34           C  
ATOM  10145  CG1 VAL D 257     146.540 109.270 157.077  1.00 66.34           C  
ATOM  10146  CG2 VAL D 257     148.664 108.594 158.185  1.00 66.34           C  
ATOM  10147  N   PHE D 258     144.584 109.469 160.133  1.00 66.58           N  
ATOM  10148  CA  PHE D 258     143.181 109.837 160.281  1.00 66.58           C  
ATOM  10149  C   PHE D 258     143.036 111.184 160.980  1.00 66.58           C  
ATOM  10150  O   PHE D 258     142.398 112.112 160.457  1.00 66.58           O  
ATOM  10151  CB  PHE D 258     142.468 108.743 161.077  1.00 66.58           C  
ATOM  10152  CG  PHE D 258     141.087 108.439 160.598  1.00 66.58           C  
ATOM  10153  CD1 PHE D 258     140.064 109.346 160.785  1.00 66.58           C  
ATOM  10154  CD2 PHE D 258     140.808 107.238 159.969  1.00 66.58           C  
ATOM  10155  CE1 PHE D 258     138.789 109.065 160.349  1.00 66.58           C  
ATOM  10156  CE2 PHE D 258     139.534 106.951 159.531  1.00 66.58           C  
ATOM  10157  CZ  PHE D 258     138.523 107.865 159.721  1.00 66.58           C  
ATOM  10158  N   GLY D 259     143.620 111.299 162.174  1.00 55.10           N  
ATOM  10159  CA  GLY D 259     143.503 112.522 162.945  1.00 55.10           C  
ATOM  10160  C   GLY D 259     144.125 113.724 162.268  1.00 55.10           C  
ATOM  10161  O   GLY D 259     143.644 114.848 162.433  1.00 55.10           O  
ATOM  10162  N   VAL D 260     145.193 113.513 161.497  1.00 58.07           N  
ATOM  10163  CA  VAL D 260     145.817 114.630 160.794  1.00 58.07           C  
ATOM  10164  C   VAL D 260     144.939 115.100 159.640  1.00 58.07           C  
ATOM  10165  O   VAL D 260     144.723 116.308 159.453  1.00 58.07           O  
ATOM  10166  CB  VAL D 260     147.224 114.236 160.314  1.00 58.07           C  
ATOM  10167  CG1 VAL D 260     147.761 115.266 159.339  1.00 58.07           C  
ATOM  10168  CG2 VAL D 260     148.156 114.093 161.500  1.00 58.07           C  
ATOM  10169  N   THR D 261     144.421 114.157 158.847  1.00 61.20           N  
ATOM  10170  CA  THR D 261     143.603 114.521 157.697  1.00 61.20           C  
ATOM  10171  C   THR D 261     142.328 115.231 158.128  1.00 61.20           C  
ATOM  10172  O   THR D 261     141.893 116.190 157.477  1.00 61.20           O  
ATOM  10173  CB  THR D 261     143.272 113.274 156.877  1.00 61.20           C  
ATOM  10174  OG1 THR D 261     144.480 112.730 156.335  1.00 61.20           O  
ATOM  10175  CG2 THR D 261     142.324 113.613 155.739  1.00 61.20           C  
ATOM  10176  N   THR D 262     141.712 114.774 159.222  1.00 56.90           N  
ATOM  10177  CA  THR D 262     140.507 115.443 159.701  1.00 56.90           C  
ATOM  10178  C   THR D 262     140.775 116.910 160.017  1.00 56.90           C  
ATOM  10179  O   THR D 262     140.024 117.794 159.585  1.00 56.90           O  
ATOM  10180  CB  THR D 262     139.958 114.725 160.931  1.00 56.90           C  
ATOM  10181  OG1 THR D 262     141.005 114.566 161.895  1.00 56.90           O  
ATOM  10182  CG2 THR D 262     139.407 113.361 160.547  1.00 56.90           C  
ATOM  10183  N   VAL D 263     141.852 117.192 160.752  1.00 53.65           N  
ATOM  10184  CA  VAL D 263     142.139 118.567 161.143  1.00 53.65           C  
ATOM  10185  C   VAL D 263     142.496 119.411 159.927  1.00 53.65           C  
ATOM  10186  O   VAL D 263     142.118 120.586 159.839  1.00 53.65           O  
ATOM  10187  CB  VAL D 263     143.253 118.602 162.203  1.00 53.65           C  
ATOM  10188  CG1 VAL D 263     143.538 120.031 162.618  1.00 53.65           C  
ATOM  10189  CG2 VAL D 263     142.846 117.778 163.405  1.00 53.65           C  
ATOM  10190  N   LEU D 264     143.225 118.836 158.967  1.00 54.42           N  
ATOM  10191  CA  LEU D 264     143.571 119.603 157.772  1.00 54.42           C  
ATOM  10192  C   LEU D 264     142.328 119.959 156.963  1.00 54.42           C  
ATOM  10193  O   LEU D 264     142.178 121.102 156.500  1.00 54.42           O  
ATOM  10194  CB  LEU D 264     144.570 118.823 156.920  1.00 54.42           C  
ATOM  10195  CG  LEU D 264     146.053 119.111 157.170  1.00 54.42           C  
ATOM  10196  CD1 LEU D 264     146.405 118.986 158.643  1.00 54.42           C  
ATOM  10197  CD2 LEU D 264     146.922 118.182 156.335  1.00 54.42           C  
ATOM  10198  N   THR D 265     141.425 118.991 156.776  1.00 54.14           N  
ATOM  10199  CA  THR D 265     140.175 119.278 156.082  1.00 54.14           C  
ATOM  10200  C   THR D 265     139.373 120.336 156.826  1.00 54.14           C  
ATOM  10201  O   THR D 265     138.777 121.227 156.207  1.00 54.14           O  
ATOM  10202  CB  THR D 265     139.353 117.999 155.924  1.00 54.14           C  
ATOM  10203  OG1 THR D 265     140.167 116.980 155.334  1.00 54.14           O  
ATOM  10204  CG2 THR D 265     138.151 118.250 155.032  1.00 54.14           C  
ATOM  10205  N   MET D 266     139.356 120.259 158.158  1.00 52.75           N  
ATOM  10206  CA  MET D 266     138.663 121.270 158.946  1.00 52.75           C  
ATOM  10207  C   MET D 266     139.260 122.651 158.720  1.00 52.75           C  
ATOM  10208  O   MET D 266     138.531 123.647 158.640  1.00 52.75           O  
ATOM  10209  CB  MET D 266     138.725 120.908 160.425  1.00 52.75           C  
ATOM  10210  CG  MET D 266     137.892 121.807 161.298  1.00 52.75           C  
ATOM  10211  SD  MET D 266     136.155 121.440 161.088  1.00 52.75           S  
ATOM  10212  CE  MET D 266     136.204 119.660 161.252  1.00 52.75           C  
ATOM  10213  N   THR D 267     140.586 122.733 158.619  1.00 56.29           N  
ATOM  10214  CA  THR D 267     141.232 124.026 158.416  1.00 56.29           C  
ATOM  10215  C   THR D 267     140.869 124.608 157.056  1.00 56.29           C  
ATOM  10216  O   THR D 267     140.568 125.803 156.937  1.00 56.29           O  
ATOM  10217  CB  THR D 267     142.746 123.884 158.554  1.00 56.29           C  
ATOM  10218  OG1 THR D 267     143.059 123.323 159.834  1.00 56.29           O  
ATOM  10219  CG2 THR D 267     143.416 125.240 158.431  1.00 56.29           C  
ATOM  10220  N   THR D 268     140.899 123.775 156.014  1.00 52.92           N  
ATOM  10221  CA  THR D 268     140.481 124.250 154.695  1.00 52.92           C  
ATOM  10222  C   THR D 268     139.029 124.718 154.711  1.00 52.92           C  
ATOM  10223  O   THR D 268     138.687 125.753 154.118  1.00 52.92           O  
ATOM  10224  CB  THR D 268     140.675 123.152 153.650  1.00 52.92           C  
ATOM  10225  OG1 THR D 268     140.034 121.951 154.094  1.00 52.92           O  
ATOM  10226  CG2 THR D 268     142.152 122.884 153.430  1.00 52.92           C  
ATOM  10227  N   LEU D 269     138.161 123.968 155.394  1.00 54.21           N  
ATOM  10228  CA  LEU D 269     136.757 124.348 155.483  1.00 54.21           C  
ATOM  10229  C   LEU D 269     136.594 125.686 156.191  1.00 54.21           C  
ATOM  10230  O   LEU D 269     135.784 126.524 155.777  1.00 54.21           O  
ATOM  10231  CB  LEU D 269     135.974 123.257 156.209  1.00 54.21           C  
ATOM  10232  CG  LEU D 269     134.461 123.264 156.024  1.00 54.21           C  
ATOM  10233  CD1 LEU D 269     134.126 123.059 154.560  1.00 54.21           C  
ATOM  10234  CD2 LEU D 269     133.816 122.187 156.881  1.00 54.21           C  
ATOM  10235  N   SER D 270     137.356 125.904 157.264  1.00 60.19           N  
ATOM  10236  CA  SER D 270     137.292 127.178 157.970  1.00 60.19           C  
ATOM  10237  C   SER D 270     137.791 128.324 157.104  1.00 60.19           C  
ATOM  10238  O   SER D 270     137.238 129.429 157.162  1.00 60.19           O  
ATOM  10239  CB  SER D 270     138.102 127.107 159.260  1.00 60.19           C  
ATOM  10240  OG  SER D 270     138.159 128.375 159.885  1.00 60.19           O  
ATOM  10241  N   ILE D 271     138.828 128.084 156.300  1.00 60.73           N  
ATOM  10242  CA  ILE D 271     139.300 129.115 155.380  1.00 60.73           C  
ATOM  10243  C   ILE D 271     138.198 129.497 154.400  1.00 60.73           C  
ATOM  10244  O   ILE D 271     137.937 130.686 154.162  1.00 60.73           O  
ATOM  10245  CB  ILE D 271     140.569 128.639 154.649  1.00 60.73           C  
ATOM  10246  CG1 ILE D 271     141.737 128.525 155.628  1.00 60.73           C  
ATOM  10247  CG2 ILE D 271     140.916 129.583 153.511  1.00 60.73           C  
ATOM  10248  CD1 ILE D 271     143.030 128.089 154.983  1.00 60.73           C  
ATOM  10249  N   SER D 272     137.521 128.499 153.828  1.00 63.52           N  
ATOM  10250  CA  SER D 272     136.433 128.800 152.900  1.00 63.52           C  
ATOM  10251  C   SER D 272     135.306 129.561 153.593  1.00 63.52           C  
ATOM  10252  O   SER D 272     134.772 130.537 153.046  1.00 63.52           O  
ATOM  10253  CB  SER D 272     135.901 127.514 152.273  1.00 63.52           C  
ATOM  10254  OG  SER D 272     134.846 127.793 151.369  1.00 63.52           O  
ATOM  10255  N   ALA D 273     134.939 129.137 154.802  1.00 65.20           N  
ATOM  10256  CA  ALA D 273     133.857 129.798 155.522  1.00 65.20           C  
ATOM  10257  C   ALA D 273     134.197 131.250 155.824  1.00 65.20           C  
ATOM  10258  O   ALA D 273     133.323 132.124 155.773  1.00 65.20           O  
ATOM  10259  CB  ALA D 273     133.554 129.045 156.811  1.00 65.20           C  
ATOM  10260  N   ARG D 274     135.458 131.528 156.159  1.00 80.05           N  
ATOM  10261  CA  ARG D 274     135.868 132.915 156.345  1.00 80.05           C  
ATOM  10262  C   ARG D 274     135.831 133.679 155.029  1.00 80.05           C  
ATOM  10263  O   ARG D 274     135.509 134.873 155.015  1.00 80.05           O  
ATOM  10264  CB  ARG D 274     137.261 132.974 156.967  1.00 80.05           C  
ATOM  10265  CG  ARG D 274     137.317 132.432 158.385  1.00 80.05           C  
ATOM  10266  CD  ARG D 274     138.745 132.324 158.886  1.00 80.05           C  
ATOM  10267  NE  ARG D 274     138.806 131.727 160.217  1.00 80.05           N  
ATOM  10268  CZ  ARG D 274     139.933 131.416 160.846  1.00 80.05           C  
ATOM  10269  NH1 ARG D 274     141.104 131.643 160.267  1.00 80.05           N  
ATOM  10270  NH2 ARG D 274     139.890 130.875 162.056  1.00 80.05           N  
ATOM  10271  N   ASN D 275     136.153 133.011 153.919  1.00 78.80           N  
ATOM  10272  CA  ASN D 275     136.000 133.635 152.609  1.00 78.80           C  
ATOM  10273  C   ASN D 275     134.549 133.992 152.318  1.00 78.80           C  
ATOM  10274  O   ASN D 275     134.279 134.932 151.562  1.00 78.80           O  
ATOM  10275  CB  ASN D 275     136.534 132.709 151.517  1.00 78.80           C  
ATOM  10276  CG  ASN D 275     135.910 132.985 150.159  1.00 78.80           C  
ATOM  10277  OD1 ASN D 275     134.927 132.348 149.773  1.00 78.80           O  
ATOM  10278  ND2 ASN D 275     136.472 133.944 149.434  1.00 78.80           N  
ATOM  10279  N   SER D 276     133.606 133.264 152.920  1.00 80.29           N  
ATOM  10280  CA  SER D 276     132.203 133.383 152.526  1.00 80.29           C  
ATOM  10281  C   SER D 276     131.665 134.803 152.689  1.00 80.29           C  
ATOM  10282  O   SER D 276     131.013 135.330 151.781  1.00 80.29           O  
ATOM  10283  CB  SER D 276     131.353 132.403 153.332  1.00 80.29           C  
ATOM  10284  OG  SER D 276     131.450 132.675 154.718  1.00 80.29           O  
ATOM  10285  N   LEU D 277     131.922 135.441 153.827  1.00 71.02           N  
ATOM  10286  CA  LEU D 277     131.207 136.661 154.173  1.00 71.02           C  
ATOM  10287  C   LEU D 277     132.164 137.827 154.369  1.00 71.02           C  
ATOM  10288  O   LEU D 277     133.303 137.632 154.805  1.00 71.02           O  
ATOM  10289  CB  LEU D 277     130.391 136.455 155.457  1.00 71.02           C  
ATOM  10290  CG  LEU D 277     129.329 137.487 155.827  1.00 71.02           C  
ATOM  10291  CD1 LEU D 277     128.124 137.345 154.919  1.00 71.02           C  
ATOM  10292  CD2 LEU D 277     128.932 137.343 157.277  1.00 71.02           C  
ATOM  10293  N   PRO D 278     131.731 139.049 154.055  1.00 66.82           N  
ATOM  10294  CA  PRO D 278     132.567 140.223 154.330  1.00 66.82           C  
ATOM  10295  C   PRO D 278     132.829 140.402 155.817  1.00 66.82           C  
ATOM  10296  O   PRO D 278     132.096 139.908 156.676  1.00 66.82           O  
ATOM  10297  CB  PRO D 278     131.741 141.390 153.773  1.00 66.82           C  
ATOM  10298  CG  PRO D 278     130.354 140.853 153.637  1.00 66.82           C  
ATOM  10299  CD  PRO D 278     130.538 139.414 153.278  1.00 66.82           C  
ATOM  10300  N   LYS D 279     133.899 141.140 156.107  1.00 63.67           N  
ATOM  10301  CA  LYS D 279     134.355 141.300 157.481  1.00 63.67           C  
ATOM  10302  C   LYS D 279     133.330 142.057 158.313  1.00 63.67           C  
ATOM  10303  O   LYS D 279     132.785 143.074 157.878  1.00 63.67           O  
ATOM  10304  CB  LYS D 279     135.698 142.029 157.506  1.00 63.67           C  
ATOM  10305  CG  LYS D 279     136.823 141.249 156.847  1.00 63.67           C  
ATOM  10306  CD  LYS D 279     138.177 141.880 157.122  1.00 63.67           C  
ATOM  10307  CE  LYS D 279     139.308 141.011 156.593  1.00 63.67           C  
ATOM  10308  NZ  LYS D 279     140.645 141.577 156.923  1.00 63.67           N  
ATOM  10309  N   VAL D 280     133.068 141.546 159.515  1.00 55.86           N  
ATOM  10310  CA  VAL D 280     132.138 142.155 160.455  1.00 55.86           C  
ATOM  10311  C   VAL D 280     132.665 141.951 161.867  1.00 55.86           C  
ATOM  10312  O   VAL D 280     133.446 141.034 162.133  1.00 55.86           O  
ATOM  10313  CB  VAL D 280     130.716 141.570 160.329  1.00 55.86           C  
ATOM  10314  CG1 VAL D 280     129.981 142.199 159.163  1.00 55.86           C  
ATOM  10315  CG2 VAL D 280     130.785 140.064 160.166  1.00 55.86           C  
ATOM  10316  N   ALA D 281     132.232 142.825 162.777  1.00 57.02           N  
ATOM  10317  CA  ALA D 281     132.567 142.648 164.185  1.00 57.02           C  
ATOM  10318  C   ALA D 281     131.716 141.562 164.828  1.00 57.02           C  
ATOM  10319  O   ALA D 281     132.136 140.948 165.815  1.00 57.02           O  
ATOM  10320  CB  ALA D 281     132.401 143.967 164.935  1.00 57.02           C  
ATOM  10321  N   TYR D 282     130.524 141.318 164.290  1.00 64.78           N  
ATOM  10322  CA  TYR D 282     129.629 140.311 164.835  1.00 64.78           C  
ATOM  10323  C   TYR D 282     130.254 138.922 164.760  1.00 64.78           C  
ATOM  10324  O   TYR D 282     131.284 138.702 164.119  1.00 64.78           O  
ATOM  10325  CB  TYR D 282     128.305 140.307 164.076  1.00 64.78           C  
ATOM  10326  CG  TYR D 282     127.480 141.555 164.255  1.00 64.78           C  
ATOM  10327  CD1 TYR D 282     127.609 142.339 165.391  1.00 64.78           C  
ATOM  10328  CD2 TYR D 282     126.569 141.946 163.289  1.00 64.78           C  
ATOM  10329  CE1 TYR D 282     126.851 143.480 165.559  1.00 64.78           C  
ATOM  10330  CE2 TYR D 282     125.808 143.084 163.447  1.00 64.78           C  
ATOM  10331  CZ  TYR D 282     125.952 143.849 164.583  1.00 64.78           C  
ATOM  10332  OH  TYR D 282     125.194 144.986 164.742  1.00 64.78           O  
ATOM  10333  N   ALA D 283     129.612 137.978 165.439  1.00 54.90           N  
ATOM  10334  CA  ALA D 283     129.934 136.561 165.321  1.00 54.90           C  
ATOM  10335  C   ALA D 283     128.779 135.872 164.604  1.00 54.90           C  
ATOM  10336  O   ALA D 283     127.671 135.783 165.141  1.00 54.90           O  
ATOM  10337  CB  ALA D 283     130.184 135.938 166.691  1.00 54.90           C  
ATOM  10338  N   THR D 284     129.037 135.387 163.395  1.00 55.32           N  
ATOM  10339  CA  THR D 284     127.995 134.744 162.609  1.00 55.32           C  
ATOM  10340  C   THR D 284     127.694 133.346 163.138  1.00 55.32           C  
ATOM  10341  O   THR D 284     128.550 132.683 163.728  1.00 55.32           O  
ATOM  10342  CB  THR D 284     128.410 134.663 161.145  1.00 55.32           C  
ATOM  10343  OG1 THR D 284     129.557 133.814 161.024  1.00 55.32           O  
ATOM  10344  CG2 THR D 284     128.761 136.040 160.627  1.00 55.32           C  
ATOM  10345  N   ALA D 285     126.458 132.897 162.912  1.00 51.81           N  
ATOM  10346  CA  ALA D 285     126.048 131.587 163.406  1.00 51.81           C  
ATOM  10347  C   ALA D 285     126.832 130.468 162.735  1.00 51.81           C  
ATOM  10348  O   ALA D 285     127.178 129.468 163.379  1.00 51.81           O  
ATOM  10349  CB  ALA D 285     124.549 131.392 163.196  1.00 51.81           C  
ATOM  10350  N   MET D 286     127.116 130.610 161.440  1.00 53.24           N  
ATOM  10351  CA  MET D 286     127.922 129.605 160.758  1.00 53.24           C  
ATOM  10352  C   MET D 286     129.306 129.506 161.382  1.00 53.24           C  
ATOM  10353  O   MET D 286     129.859 128.408 161.522  1.00 53.24           O  
ATOM  10354  CB  MET D 286     128.020 129.934 159.270  1.00 53.24           C  
ATOM  10355  CG  MET D 286     128.525 128.792 158.420  1.00 53.24           C  
ATOM  10356  SD  MET D 286     128.690 129.243 156.688  1.00 53.24           S  
ATOM  10357  CE  MET D 286     129.937 130.519 156.797  1.00 53.24           C  
ATOM  10358  N   ASP D 287     129.874 130.645 161.782  1.00 50.76           N  
ATOM  10359  CA  ASP D 287     131.163 130.620 162.462  1.00 50.76           C  
ATOM  10360  C   ASP D 287     131.058 129.885 163.791  1.00 50.76           C  
ATOM  10361  O   ASP D 287     131.964 129.135 164.166  1.00 50.76           O  
ATOM  10362  CB  ASP D 287     131.673 132.043 162.671  1.00 50.76           C  
ATOM  10363  CG  ASP D 287     133.163 132.097 162.958  1.00 50.76           C  
ATOM  10364  OD1 ASP D 287     133.703 131.139 163.547  1.00 50.76           O  
ATOM  10365  OD2 ASP D 287     133.801 133.106 162.592  1.00 50.76           O  
ATOM  10366  N   TRP D 288     129.954 130.083 164.512  1.00 47.36           N  
ATOM  10367  CA  TRP D 288     129.747 129.371 165.769  1.00 47.36           C  
ATOM  10368  C   TRP D 288     129.707 127.865 165.547  1.00 47.36           C  
ATOM  10369  O   TRP D 288     130.387 127.098 166.248  1.00 47.36           O  
ATOM  10370  CB  TRP D 288     128.451 129.854 166.416  1.00 47.36           C  
ATOM  10371  CG  TRP D 288     128.588 130.340 167.823  1.00 47.36           C  
ATOM  10372  CD1 TRP D 288     127.818 129.979 168.886  1.00 47.36           C  
ATOM  10373  CD2 TRP D 288     129.551 131.276 168.324  1.00 47.36           C  
ATOM  10374  NE1 TRP D 288     128.237 130.631 170.018  1.00 47.36           N  
ATOM  10375  CE2 TRP D 288     129.301 131.433 169.700  1.00 47.36           C  
ATOM  10376  CE3 TRP D 288     130.600 131.995 167.745  1.00 47.36           C  
ATOM  10377  CZ2 TRP D 288     130.060 132.276 170.505  1.00 47.36           C  
ATOM  10378  CZ3 TRP D 288     131.353 132.831 168.546  1.00 47.36           C  
ATOM  10379  CH2 TRP D 288     131.079 132.965 169.911  1.00 47.36           C  
ATOM  10380  N   PHE D 289     128.920 127.427 164.564  1.00 47.48           N  
ATOM  10381  CA  PHE D 289     128.821 126.005 164.261  1.00 47.48           C  
ATOM  10382  C   PHE D 289     130.174 125.425 163.873  1.00 47.48           C  
ATOM  10383  O   PHE D 289     130.544 124.335 164.328  1.00 47.48           O  
ATOM  10384  CB  PHE D 289     127.802 125.789 163.142  1.00 47.48           C  
ATOM  10385  CG  PHE D 289     127.712 124.371 162.660  1.00 47.48           C  
ATOM  10386  CD1 PHE D 289     128.537 123.914 161.649  1.00 47.48           C  
ATOM  10387  CD2 PHE D 289     126.785 123.503 163.202  1.00 47.48           C  
ATOM  10388  CE1 PHE D 289     128.452 122.616 161.204  1.00 47.48           C  
ATOM  10389  CE2 PHE D 289     126.693 122.202 162.756  1.00 47.48           C  
ATOM  10390  CZ  PHE D 289     127.527 121.760 161.756  1.00 47.48           C  
ATOM  10391  N   ILE D 290     130.927 126.137 163.035  1.00 47.41           N  
ATOM  10392  CA  ILE D 290     132.212 125.618 162.583  1.00 47.41           C  
ATOM  10393  C   ILE D 290     133.218 125.586 163.722  1.00 47.41           C  
ATOM  10394  O   ILE D 290     134.040 124.667 163.809  1.00 47.41           O  
ATOM  10395  CB  ILE D 290     132.707 126.451 161.392  1.00 47.41           C  
ATOM  10396  CG1 ILE D 290     131.809 126.185 160.191  1.00 47.41           C  
ATOM  10397  CG2 ILE D 290     134.145 126.128 161.060  1.00 47.41           C  
ATOM  10398  CD1 ILE D 290     131.784 127.299 159.207  1.00 47.41           C  
ATOM  10399  N   ALA D 291     133.166 126.568 164.623  1.00 46.08           N  
ATOM  10400  CA  ALA D 291     134.048 126.547 165.780  1.00 46.08           C  
ATOM  10401  C   ALA D 291     133.766 125.337 166.655  1.00 46.08           C  
ATOM  10402  O   ALA D 291     134.696 124.666 167.115  1.00 46.08           O  
ATOM  10403  CB  ALA D 291     133.896 127.837 166.581  1.00 46.08           C  
ATOM  10404  N   VAL D 292     132.488 125.026 166.879  1.00 46.86           N  
ATOM  10405  CA  VAL D 292     132.169 123.863 167.704  1.00 46.86           C  
ATOM  10406  C   VAL D 292     132.592 122.570 167.008  1.00 46.86           C  
ATOM  10407  O   VAL D 292     133.121 121.650 167.646  1.00 46.86           O  
ATOM  10408  CB  VAL D 292     130.675 123.854 168.063  1.00 46.86           C  
ATOM  10409  CG1 VAL D 292     130.317 122.557 168.758  1.00 46.86           C  
ATOM  10410  CG2 VAL D 292     130.354 125.034 168.958  1.00 46.86           C  
ATOM  10411  N   CYS D 293     132.366 122.478 165.697  1.00 54.18           N  
ATOM  10412  CA  CYS D 293     132.767 121.294 164.937  1.00 54.18           C  
ATOM  10413  C   CYS D 293     134.278 121.071 165.023  1.00 54.18           C  
ATOM  10414  O   CYS D 293     134.751 119.953 165.296  1.00 54.18           O  
ATOM  10415  CB  CYS D 293     132.290 121.468 163.490  1.00 54.18           C  
ATOM  10416  SG  CYS D 293     132.940 120.385 162.206  1.00 54.18           S  
ATOM  10417  N   TYR D 294     135.050 122.139 164.810  1.00 53.47           N  
ATOM  10418  CA  TYR D 294     136.502 122.065 164.921  1.00 53.47           C  
ATOM  10419  C   TYR D 294     136.931 121.686 166.331  1.00 53.47           C  
ATOM  10420  O   TYR D 294     137.853 120.881 166.512  1.00 53.47           O  
ATOM  10421  CB  TYR D 294     137.111 123.405 164.511  1.00 53.47           C  
ATOM  10422  CG  TYR D 294     138.584 123.558 164.801  1.00 53.47           C  
ATOM  10423  CD1 TYR D 294     139.536 123.056 163.931  1.00 53.47           C  
ATOM  10424  CD2 TYR D 294     139.021 124.227 165.932  1.00 53.47           C  
ATOM  10425  CE1 TYR D 294     140.878 123.200 164.182  1.00 53.47           C  
ATOM  10426  CE2 TYR D 294     140.363 124.377 166.194  1.00 53.47           C  
ATOM  10427  CZ  TYR D 294     141.289 123.861 165.314  1.00 53.47           C  
ATOM  10428  OH  TYR D 294     142.633 124.004 165.566  1.00 53.47           O  
ATOM  10429  N   ALA D 295     136.280 122.258 167.344  1.00 52.00           N  
ATOM  10430  CA  ALA D 295     136.631 121.921 168.717  1.00 52.00           C  
ATOM  10431  C   ALA D 295     136.388 120.446 168.995  1.00 52.00           C  
ATOM  10432  O   ALA D 295     137.181 119.800 169.688  1.00 52.00           O  
ATOM  10433  CB  ALA D 295     135.841 122.791 169.692  1.00 52.00           C  
ATOM  10434  N   PHE D 296     135.308 119.888 168.445  1.00 54.59           N  
ATOM  10435  CA  PHE D 296     135.022 118.475 168.671  1.00 54.59           C  
ATOM  10436  C   PHE D 296     136.079 117.588 168.029  1.00 54.59           C  
ATOM  10437  O   PHE D 296     136.588 116.653 168.661  1.00 54.59           O  
ATOM  10438  CB  PHE D 296     133.632 118.116 168.150  1.00 54.59           C  
ATOM  10439  CG  PHE D 296     132.551 118.276 169.173  1.00 54.59           C  
ATOM  10440  CD1 PHE D 296     132.765 119.041 170.305  1.00 54.59           C  
ATOM  10441  CD2 PHE D 296     131.331 117.645 169.017  1.00 54.59           C  
ATOM  10442  CE1 PHE D 296     131.776 119.190 171.253  1.00 54.59           C  
ATOM  10443  CE2 PHE D 296     130.340 117.788 169.964  1.00 54.59           C  
ATOM  10444  CZ  PHE D 296     130.562 118.561 171.083  1.00 54.59           C  
ATOM  10445  N   VAL D 297     136.425 117.859 166.767  1.00 54.16           N  
ATOM  10446  CA  VAL D 297     137.422 117.005 166.119  1.00 54.16           C  
ATOM  10447  C   VAL D 297     138.776 117.144 166.811  1.00 54.16           C  
ATOM  10448  O   VAL D 297     139.520 116.163 166.962  1.00 54.16           O  
ATOM  10449  CB  VAL D 297     137.507 117.296 164.608  1.00 54.16           C  
ATOM  10450  CG1 VAL D 297     136.156 117.064 163.950  1.00 54.16           C  
ATOM  10451  CG2 VAL D 297     138.002 118.699 164.341  1.00 54.16           C  
ATOM  10452  N   PHE D 298     139.098 118.349 167.290  1.00 61.02           N  
ATOM  10453  CA  PHE D 298     140.373 118.545 167.970  1.00 61.02           C  
ATOM  10454  C   PHE D 298     140.396 117.838 169.319  1.00 61.02           C  
ATOM  10455  O   PHE D 298     141.422 117.269 169.710  1.00 61.02           O  
ATOM  10456  CB  PHE D 298     140.652 120.036 168.137  1.00 61.02           C  
ATOM  10457  CG  PHE D 298     142.058 120.344 168.545  1.00 61.02           C  
ATOM  10458  CD1 PHE D 298     143.112 120.050 167.701  1.00 61.02           C  
ATOM  10459  CD2 PHE D 298     142.327 120.935 169.765  1.00 61.02           C  
ATOM  10460  CE1 PHE D 298     144.410 120.334 168.068  1.00 61.02           C  
ATOM  10461  CE2 PHE D 298     143.624 121.223 170.138  1.00 61.02           C  
ATOM  10462  CZ  PHE D 298     144.667 120.922 169.288  1.00 61.02           C  
ATOM  10463  N   SER D 299     139.277 117.859 170.044  1.00 59.84           N  
ATOM  10464  CA  SER D 299     139.212 117.135 171.308  1.00 59.84           C  
ATOM  10465  C   SER D 299     139.330 115.635 171.081  1.00 59.84           C  
ATOM  10466  O   SER D 299     139.962 114.927 171.874  1.00 59.84           O  
ATOM  10467  CB  SER D 299     137.914 117.469 172.038  1.00 59.84           C  
ATOM  10468  OG  SER D 299     136.790 117.099 171.262  1.00 59.84           O  
ATOM  10469  N   ALA D 300     138.737 115.131 169.997  1.00 59.54           N  
ATOM  10470  CA  ALA D 300     138.892 113.716 169.676  1.00 59.54           C  
ATOM  10471  C   ALA D 300     140.350 113.373 169.400  1.00 59.54           C  
ATOM  10472  O   ALA D 300     140.858 112.343 169.867  1.00 59.54           O  
ATOM  10473  CB  ALA D 300     138.019 113.349 168.478  1.00 59.54           C  
ATOM  10474  N   LEU D 301     141.041 114.227 168.642  1.00 60.36           N  
ATOM  10475  CA  LEU D 301     142.456 113.982 168.379  1.00 60.36           C  
ATOM  10476  C   LEU D 301     143.271 114.012 169.667  1.00 60.36           C  
ATOM  10477  O   LEU D 301     144.182 113.196 169.855  1.00 60.36           O  
ATOM  10478  CB  LEU D 301     142.995 115.006 167.384  1.00 60.36           C  
ATOM  10479  CG  LEU D 301     144.452 114.782 166.985  1.00 60.36           C  
ATOM  10480  CD1 LEU D 301     144.611 113.420 166.335  1.00 60.36           C  
ATOM  10481  CD2 LEU D 301     144.931 115.884 166.057  1.00 60.36           C  
ATOM  10482  N   ILE D 302     142.958 114.949 170.565  1.00 63.49           N  
ATOM  10483  CA  ILE D 302     143.664 115.023 171.842  1.00 63.49           C  
ATOM  10484  C   ILE D 302     143.430 113.757 172.653  1.00 63.49           C  
ATOM  10485  O   ILE D 302     144.344 113.240 173.307  1.00 63.49           O  
ATOM  10486  CB  ILE D 302     143.235 116.280 172.618  1.00 63.49           C  
ATOM  10487  CG1 ILE D 302     143.813 117.532 171.965  1.00 63.49           C  
ATOM  10488  CG2 ILE D 302     143.669 116.190 174.070  1.00 63.49           C  
ATOM  10489  CD1 ILE D 302     143.482 118.805 172.706  1.00 63.49           C  
ATOM  10490  N   GLU D 303     142.200 113.243 172.631  1.00 71.34           N  
ATOM  10491  CA  GLU D 303     141.903 112.011 173.353  1.00 71.34           C  
ATOM  10492  C   GLU D 303     142.708 110.848 172.791  1.00 71.34           C  
ATOM  10493  O   GLU D 303     143.258 110.036 173.543  1.00 71.34           O  
ATOM  10494  CB  GLU D 303     140.404 111.717 173.295  1.00 71.34           C  
ATOM  10495  CG  GLU D 303     139.940 110.605 174.225  1.00 71.34           C  
ATOM  10496  CD  GLU D 303     140.040 109.229 173.596  1.00 71.34           C  
ATOM  10497  OE1 GLU D 303     140.348 109.143 172.391  1.00 71.34           O  
ATOM  10498  OE2 GLU D 303     139.808 108.232 174.308  1.00 71.34           O  
ATOM  10499  N   PHE D 304     142.780 110.743 171.463  1.00 69.45           N  
ATOM  10500  CA  PHE D 304     143.590 109.682 170.868  1.00 69.45           C  
ATOM  10501  C   PHE D 304     145.054 109.819 171.267  1.00 69.45           C  
ATOM  10502  O   PHE D 304     145.724 108.821 171.563  1.00 69.45           O  
ATOM  10503  CB  PHE D 304     143.455 109.685 169.349  1.00 69.45           C  
ATOM  10504  CG  PHE D 304     144.506 108.869 168.655  1.00 69.45           C  
ATOM  10505  CD1 PHE D 304     144.463 107.488 168.692  1.00 69.45           C  
ATOM  10506  CD2 PHE D 304     145.544 109.483 167.976  1.00 69.45           C  
ATOM  10507  CE1 PHE D 304     145.433 106.735 168.063  1.00 69.45           C  
ATOM  10508  CE2 PHE D 304     146.515 108.734 167.342  1.00 69.45           C  
ATOM  10509  CZ  PHE D 304     146.459 107.359 167.386  1.00 69.45           C  
ATOM  10510  N   ALA D 305     145.569 111.049 171.277  1.00 68.12           N  
ATOM  10511  CA  ALA D 305     146.964 111.257 171.648  1.00 68.12           C  
ATOM  10512  C   ALA D 305     147.219 110.841 173.090  1.00 68.12           C  
ATOM  10513  O   ALA D 305     148.215 110.168 173.385  1.00 68.12           O  
ATOM  10514  CB  ALA D 305     147.350 112.719 171.436  1.00 68.12           C  
ATOM  10515  N   THR D 306     146.329 111.230 174.004  1.00 72.96           N  
ATOM  10516  CA  THR D 306     146.536 110.871 175.401  1.00 72.96           C  
ATOM  10517  C   THR D 306     146.366 109.374 175.617  1.00 72.96           C  
ATOM  10518  O   THR D 306     147.037 108.797 176.476  1.00 72.96           O  
ATOM  10519  CB  THR D 306     145.601 111.673 176.314  1.00 72.96           C  
ATOM  10520  OG1 THR D 306     146.094 111.632 177.658  1.00 72.96           O  
ATOM  10521  CG2 THR D 306     144.190 111.116 176.296  1.00 72.96           C  
ATOM  10522  N   VAL D 307     145.517 108.717 174.822  1.00 75.14           N  
ATOM  10523  CA  VAL D 307     145.405 107.264 174.910  1.00 75.14           C  
ATOM  10524  C   VAL D 307     146.697 106.603 174.454  1.00 75.14           C  
ATOM  10525  O   VAL D 307     147.176 105.646 175.074  1.00 75.14           O  
ATOM  10526  CB  VAL D 307     144.198 106.770 174.093  1.00 75.14           C  
ATOM  10527  CG1 VAL D 307     144.290 105.271 173.863  1.00 75.14           C  
ATOM  10528  CG2 VAL D 307     142.908 107.118 174.805  1.00 75.14           C  
ATOM  10529  N   ASN D 308     147.278 107.095 173.359  1.00 78.48           N  
ATOM  10530  CA  ASN D 308     148.514 106.500 172.863  1.00 78.48           C  
ATOM  10531  C   ASN D 308     149.671 106.750 173.821  1.00 78.48           C  
ATOM  10532  O   ASN D 308     150.606 105.946 173.899  1.00 78.48           O  
ATOM  10533  CB  ASN D 308     148.843 107.032 171.472  1.00 78.48           C  
ATOM  10534  CG  ASN D 308     149.832 106.152 170.733  1.00 78.48           C  
ATOM  10535  OD1 ASN D 308     149.465 105.436 169.801  1.00 78.48           O  
ATOM  10536  ND2 ASN D 308     151.093 106.204 171.145  1.00 78.48           N  
ATOM  10537  N   TYR D 309     149.643 107.874 174.540  1.00 90.04           N  
ATOM  10538  CA  TYR D 309     150.669 108.109 175.554  1.00 90.04           C  
ATOM  10539  C   TYR D 309     150.427 107.276 176.806  1.00 90.04           C  
ATOM  10540  O   TYR D 309     151.381 106.905 177.499  1.00 90.04           O  
ATOM  10541  CB  TYR D 309     150.730 109.593 175.917  1.00 90.04           C  
ATOM  10542  CG  TYR D 309     151.759 109.922 176.978  1.00 90.04           C  
ATOM  10543  CD1 TYR D 309     153.093 110.110 176.642  1.00 90.04           C  
ATOM  10544  CD2 TYR D 309     151.396 110.048 178.313  1.00 90.04           C  
ATOM  10545  CE1 TYR D 309     154.038 110.413 177.604  1.00 90.04           C  
ATOM  10546  CE2 TYR D 309     152.334 110.350 179.283  1.00 90.04           C  
ATOM  10547  CZ  TYR D 309     153.653 110.532 178.923  1.00 90.04           C  
ATOM  10548  OH  TYR D 309     154.593 110.833 179.882  1.00 90.04           O  
ATOM  10549  N   PHE D 310     149.164 106.981 177.114  1.00 87.99           N  
ATOM  10550  CA  PHE D 310     148.808 106.294 178.346  1.00 87.99           C  
ATOM  10551  C   PHE D 310     148.843 104.778 178.212  1.00 87.99           C  
ATOM  10552  O   PHE D 310     148.845 104.082 179.232  1.00 87.99           O  
ATOM  10553  CB  PHE D 310     147.416 106.750 178.782  1.00 87.99           C  
ATOM  10554  CG  PHE D 310     147.084 106.430 180.204  1.00 87.99           C  
ATOM  10555  CD1 PHE D 310     147.565 107.220 181.231  1.00 87.99           C  
ATOM  10556  CD2 PHE D 310     146.274 105.352 180.514  1.00 87.99           C  
ATOM  10557  CE1 PHE D 310     147.256 106.933 182.542  1.00 87.99           C  
ATOM  10558  CE2 PHE D 310     145.960 105.060 181.824  1.00 87.99           C  
ATOM  10559  CZ  PHE D 310     146.453 105.851 182.840  1.00 87.99           C  
ATOM  10560  N   THR D 311     148.859 104.255 176.981  1.00 83.16           N  
ATOM  10561  CA  THR D 311     148.797 102.809 176.784  1.00 83.16           C  
ATOM  10562  C   THR D 311     149.943 102.075 177.471  1.00 83.16           C  
ATOM  10563  O   THR D 311     149.802 100.896 177.814  1.00 83.16           O  
ATOM  10564  CB  THR D 311     148.790 102.481 175.291  1.00 83.16           C  
ATOM  10565  OG1 THR D 311     148.647 101.067 175.113  1.00 83.16           O  
ATOM  10566  CG2 THR D 311     150.083 102.928 174.640  1.00 83.16           C  
ATOM  10567  N   LYS D 312     151.080 102.740 177.677  1.00 84.72           N  
ATOM  10568  CA  LYS D 312     152.232 102.054 178.253  1.00 84.72           C  
ATOM  10569  C   LYS D 312     152.096 101.900 179.764  1.00 84.72           C  
ATOM  10570  O   LYS D 312     152.505 100.877 180.327  1.00 84.72           O  
ATOM  10571  CB  LYS D 312     153.517 102.802 177.900  1.00 84.72           C  
ATOM  10572  CG  LYS D 312     153.827 102.819 176.412  1.00 84.72           C  
ATOM  10573  CD  LYS D 312     155.030 103.691 176.100  1.00 84.72           C  
ATOM  10574  CE  LYS D 312     155.340 103.679 174.612  1.00 84.72           C  
ATOM  10575  NZ  LYS D 312     154.172 104.101 173.791  1.00 84.72           N  
ATOM  10576  N   SER D 313     151.532 102.902 180.440  1.00 91.14           N  
ATOM  10577  CA  SER D 313     151.438 102.850 181.895  1.00 91.14           C  
ATOM  10578  C   SER D 313     150.347 101.887 182.349  1.00 91.14           C  
ATOM  10579  O   SER D 313     150.576 101.043 183.223  1.00 91.14           O  
ATOM  10580  CB  SER D 313     151.183 104.249 182.456  1.00 91.14           C  
ATOM  10581  OG  SER D 313     149.890 104.707 182.106  1.00 91.14           O  
ATOM  10582  N   GLN D 314     149.154 101.999 181.773  1.00 89.79           N  
ATOM  10583  CA  GLN D 314     148.027 101.195 182.227  1.00 89.79           C  
ATOM  10584  C   GLN D 314     147.031 100.987 181.092  1.00 89.79           C  
ATOM  10585  O   GLN D 314     146.178 101.849 180.843  1.00 89.79           O  
ATOM  10586  CB  GLN D 314     147.359 101.863 183.429  1.00 89.79           C  
ATOM  10587  CG  GLN D 314     146.382 100.981 184.178  1.00 89.79           C  
ATOM  10588  CD  GLN D 314     145.940 101.596 185.491  1.00 89.79           C  
ATOM  10589  OE1 GLN D 314     146.464 102.626 185.915  1.00 89.79           O  
ATOM  10590  NE2 GLN D 314     144.971 100.965 186.143  1.00 89.79           N  
ATOM  10591  N   PRO D 315     147.103  99.855 180.386  1.00 87.88           N  
ATOM  10592  CA  PRO D 315     146.247  99.678 179.202  1.00 87.88           C  
ATOM  10593  C   PRO D 315     144.783  99.415 179.524  1.00 87.88           C  
ATOM  10594  O   PRO D 315     143.921  99.702 178.682  1.00 87.88           O  
ATOM  10595  CB  PRO D 315     146.892  98.483 178.487  1.00 87.88           C  
ATOM  10596  CG  PRO D 315     147.560  97.719 179.577  1.00 87.88           C  
ATOM  10597  CD  PRO D 315     148.047  98.740 180.565  1.00 87.88           C  
ATOM  10598  N   ALA D 316     144.469  98.868 180.700  1.00 85.21           N  
ATOM  10599  CA  ALA D 316     143.072  98.621 181.049  1.00 85.21           C  
ATOM  10600  C   ALA D 316     142.288  99.926 181.132  1.00 85.21           C  
ATOM  10601  O   ALA D 316     141.180 100.042 180.586  1.00 85.21           O  
ATOM  10602  CB  ALA D 316     142.990  97.854 182.369  1.00 85.21           C  
ATOM  10603  N   ARG D 317     142.852 100.925 181.818  1.00 86.70           N  
ATOM  10604  CA  ARG D 317     142.218 102.236 181.869  1.00 86.70           C  
ATOM  10605  C   ARG D 317     142.115 102.851 180.481  1.00 86.70           C  
ATOM  10606  O   ARG D 317     141.150 103.564 180.192  1.00 86.70           O  
ATOM  10607  CB  ARG D 317     142.993 103.157 182.813  1.00 86.70           C  
ATOM  10608  CG  ARG D 317     142.370 104.530 183.011  1.00 86.70           C  
ATOM  10609  CD  ARG D 317     143.162 105.370 184.008  1.00 86.70           C  
ATOM  10610  NE  ARG D 317     143.132 104.810 185.357  1.00 86.70           N  
ATOM  10611  CZ  ARG D 317     142.282 105.191 186.306  1.00 86.70           C  
ATOM  10612  NH1 ARG D 317     141.388 106.138 186.056  1.00 86.70           N  
ATOM  10613  NH2 ARG D 317     142.325 104.628 187.506  1.00 86.70           N  
ATOM  10614  N   ALA D 318     143.076 102.561 179.603  1.00 80.41           N  
ATOM  10615  CA  ALA D 318     143.009 103.066 178.236  1.00 80.41           C  
ATOM  10616  C   ALA D 318     141.840 102.455 177.474  1.00 80.41           C  
ATOM  10617  O   ALA D 318     141.136 103.157 176.741  1.00 80.41           O  
ATOM  10618  CB  ALA D 318     144.325 102.791 177.509  1.00 80.41           C  
ATOM  10619  N   ALA D 319     141.618 101.148 177.630  1.00 75.81           N  
ATOM  10620  CA  ALA D 319     140.485 100.515 176.962  1.00 75.81           C  
ATOM  10621  C   ALA D 319     139.164 101.049 177.499  1.00 75.81           C  
ATOM  10622  O   ALA D 319     138.219 101.287 176.731  1.00 75.81           O  
ATOM  10623  CB  ALA D 319     140.555  98.998 177.127  1.00 75.81           C  
ATOM  10624  N   LYS D 320     139.077 101.236 178.818  1.00 81.55           N  
ATOM  10625  CA  LYS D 320     137.879 101.832 179.402  1.00 81.55           C  
ATOM  10626  C   LYS D 320     137.641 103.234 178.848  1.00 81.55           C  
ATOM  10627  O   LYS D 320     136.510 103.602 178.512  1.00 81.55           O  
ATOM  10628  CB  LYS D 320     137.993 101.851 180.929  1.00 81.55           C  
ATOM  10629  CG  LYS D 320     137.995 100.466 181.565  1.00 81.55           C  
ATOM  10630  CD  LYS D 320     138.146 100.549 183.077  1.00 81.55           C  
ATOM  10631  CE  LYS D 320     138.254  99.166 183.714  1.00 81.55           C  
ATOM  10632  NZ  LYS D 320     138.440  99.245 185.193  1.00 81.55           N  
ATOM  10633  N   ILE D 321     138.708 104.034 178.749  1.00 79.83           N  
ATOM  10634  CA  ILE D 321     138.597 105.384 178.198  1.00 79.83           C  
ATOM  10635  C   ILE D 321     138.114 105.340 176.755  1.00 79.83           C  
ATOM  10636  O   ILE D 321     137.265 106.139 176.345  1.00 79.83           O  
ATOM  10637  CB  ILE D 321     139.944 106.122 178.324  1.00 79.83           C  
ATOM  10638  CG1 ILE D 321     140.165 106.593 179.761  1.00 79.83           C  
ATOM  10639  CG2 ILE D 321     140.002 107.300 177.380  1.00 79.83           C  
ATOM  10640  CD1 ILE D 321     141.449 107.363 179.950  1.00 79.83           C  
ATOM  10641  N   ASP D 322     138.653 104.414 175.960  1.00 80.97           N  
ATOM  10642  CA  ASP D 322     138.227 104.291 174.568  1.00 80.97           C  
ATOM  10643  C   ASP D 322     136.742 103.967 174.473  1.00 80.97           C  
ATOM  10644  O   ASP D 322     136.000 104.611 173.720  1.00 80.97           O  
ATOM  10645  CB  ASP D 322     139.052 103.223 173.855  1.00 80.97           C  
ATOM  10646  CG  ASP D 322     140.440 103.700 173.503  1.00 80.97           C  
ATOM  10647  OD1 ASP D 322     140.635 104.927 173.387  1.00 80.97           O  
ATOM  10648  OD2 ASP D 322     141.336 102.847 173.337  1.00 80.97           O  
ATOM  10649  N   ARG D 323     136.292 102.954 175.218  1.00 88.15           N  
ATOM  10650  CA  ARG D 323     134.882 102.578 175.158  1.00 88.15           C  
ATOM  10651  C   ARG D 323     133.988 103.725 175.620  1.00 88.15           C  
ATOM  10652  O   ARG D 323     132.936 103.992 175.018  1.00 88.15           O  
ATOM  10653  CB  ARG D 323     134.634 101.323 175.996  1.00 88.15           C  
ATOM  10654  CG  ARG D 323     133.211 100.787 175.897  1.00 88.15           C  
ATOM  10655  CD  ARG D 323     133.005  99.515 176.717  1.00 88.15           C  
ATOM  10656  NE  ARG D 323     133.734  98.372 176.173  1.00 88.15           N  
ATOM  10657  CZ  ARG D 323     134.824  97.848 176.725  1.00 88.15           C  
ATOM  10658  NH1 ARG D 323     135.313  98.359 177.847  1.00 88.15           N  
ATOM  10659  NH2 ARG D 323     135.423  96.809 176.159  1.00 88.15           N  
ATOM  10660  N   LEU D 324     134.409 104.438 176.668  1.00 80.46           N  
ATOM  10661  CA  LEU D 324     133.609 105.546 177.175  1.00 80.46           C  
ATOM  10662  C   LEU D 324     133.545 106.690 176.171  1.00 80.46           C  
ATOM  10663  O   LEU D 324     132.490 107.307 175.997  1.00 80.46           O  
ATOM  10664  CB  LEU D 324     134.170 106.028 178.511  1.00 80.46           C  
ATOM  10665  CG  LEU D 324     133.594 105.387 179.778  1.00 80.46           C  
ATOM  10666  CD1 LEU D 324     133.523 103.870 179.668  1.00 80.46           C  
ATOM  10667  CD2 LEU D 324     134.418 105.798 180.991  1.00 80.46           C  
ATOM  10668  N   SER D 325     134.656 106.985 175.494  1.00 79.91           N  
ATOM  10669  CA  SER D 325     134.634 108.027 174.473  1.00 79.91           C  
ATOM  10670  C   SER D 325     133.724 107.636 173.319  1.00 79.91           C  
ATOM  10671  O   SER D 325     132.953 108.466 172.819  1.00 79.91           O  
ATOM  10672  CB  SER D 325     136.048 108.302 173.966  1.00 79.91           C  
ATOM  10673  OG  SER D 325     136.862 108.837 174.992  1.00 79.91           O  
ATOM  10674  N   ARG D 326     133.800 106.374 172.888  1.00 81.55           N  
ATOM  10675  CA  ARG D 326     132.896 105.880 171.855  1.00 81.55           C  
ATOM  10676  C   ARG D 326     131.442 106.119 172.238  1.00 81.55           C  
ATOM  10677  O   ARG D 326     130.656 106.649 171.446  1.00 81.55           O  
ATOM  10678  CB  ARG D 326     133.140 104.389 171.609  1.00 81.55           C  
ATOM  10679  CG  ARG D 326     134.497 104.055 171.021  1.00 81.55           C  
ATOM  10680  CD  ARG D 326     134.732 102.556 171.035  1.00 81.55           C  
ATOM  10681  NE  ARG D 326     136.018 102.189 170.450  1.00 81.55           N  
ATOM  10682  CZ  ARG D 326     136.420 100.936 170.261  1.00 81.55           C  
ATOM  10683  NH1 ARG D 326     135.634  99.927 170.608  1.00 81.55           N  
ATOM  10684  NH2 ARG D 326     137.607 100.692 169.722  1.00 81.55           N  
ATOM  10685  N   ILE D 327     131.066 105.733 173.460  1.00 77.87           N  
ATOM  10686  CA  ILE D 327     129.664 105.844 173.847  1.00 77.87           C  
ATOM  10687  C   ILE D 327     129.278 107.260 174.264  1.00 77.87           C  
ATOM  10688  O   ILE D 327     128.090 107.535 174.458  1.00 77.87           O  
ATOM  10689  CB  ILE D 327     129.328 104.851 174.971  1.00 77.87           C  
ATOM  10690  CG1 ILE D 327     130.087 105.215 176.248  1.00 77.87           C  
ATOM  10691  CG2 ILE D 327     129.640 103.431 174.528  1.00 77.87           C  
ATOM  10692  CD1 ILE D 327     129.763 104.326 177.429  1.00 77.87           C  
ATOM  10693  N   ALA D 328     130.244 108.165 174.426  1.00 71.35           N  
ATOM  10694  CA  ALA D 328     129.948 109.509 174.909  1.00 71.35           C  
ATOM  10695  C   ALA D 328     129.941 110.578 173.821  1.00 71.35           C  
ATOM  10696  O   ALA D 328     129.105 111.483 173.866  1.00 71.35           O  
ATOM  10697  CB  ALA D 328     130.949 109.908 175.996  1.00 71.35           C  
ATOM  10698  N   PHE D 329     130.850 110.512 172.851  1.00 70.30           N  
ATOM  10699  CA  PHE D 329     130.986 111.621 171.907  1.00 70.30           C  
ATOM  10700  C   PHE D 329     129.757 111.847 171.028  1.00 70.30           C  
ATOM  10701  O   PHE D 329     129.289 113.001 170.956  1.00 70.30           O  
ATOM  10702  CB  PHE D 329     132.240 111.419 171.049  1.00 70.30           C  
ATOM  10703  CG  PHE D 329     133.383 112.316 171.423  1.00 70.30           C  
ATOM  10704  CD1 PHE D 329     133.214 113.314 172.365  1.00 70.30           C  
ATOM  10705  CD2 PHE D 329     134.624 112.169 170.829  1.00 70.30           C  
ATOM  10706  CE1 PHE D 329     134.259 114.143 172.711  1.00 70.30           C  
ATOM  10707  CE2 PHE D 329     135.673 112.997 171.173  1.00 70.30           C  
ATOM  10708  CZ  PHE D 329     135.489 113.984 172.115  1.00 70.30           C  
ATOM  10709  N   PRO D 330     129.201 110.840 170.339  1.00 71.26           N  
ATOM  10710  CA  PRO D 330     128.067 111.126 169.440  1.00 71.26           C  
ATOM  10711  C   PRO D 330     126.860 111.690 170.162  1.00 71.26           C  
ATOM  10712  O   PRO D 330     126.113 112.487 169.581  1.00 71.26           O  
ATOM  10713  CB  PRO D 330     127.768 109.760 168.808  1.00 71.26           C  
ATOM  10714  CG  PRO D 330     129.023 108.985 168.958  1.00 71.26           C  
ATOM  10715  CD  PRO D 330     129.596 109.423 170.266  1.00 71.26           C  
ATOM  10716  N   LEU D 331     126.651 111.299 171.420  1.00 70.35           N  
ATOM  10717  CA  LEU D 331     125.544 111.851 172.193  1.00 70.35           C  
ATOM  10718  C   LEU D 331     125.656 113.365 172.311  1.00 70.35           C  
ATOM  10719  O   LEU D 331     124.710 114.093 171.981  1.00 70.35           O  
ATOM  10720  CB  LEU D 331     125.508 111.211 173.579  1.00 70.35           C  
ATOM  10721  CG  LEU D 331     124.513 111.824 174.566  1.00 70.35           C  
ATOM  10722  CD1 LEU D 331     123.074 111.639 174.093  1.00 70.35           C  
ATOM  10723  CD2 LEU D 331     124.715 111.236 175.952  1.00 70.35           C  
ATOM  10724  N   LEU D 332     126.814 113.858 172.762  1.00 71.25           N  
ATOM  10725  CA  LEU D 332     126.996 115.297 172.920  1.00 71.25           C  
ATOM  10726  C   LEU D 332     126.942 116.011 171.578  1.00 71.25           C  
ATOM  10727  O   LEU D 332     126.381 117.113 171.472  1.00 71.25           O  
ATOM  10728  CB  LEU D 332     128.319 115.589 173.624  1.00 71.25           C  
ATOM  10729  CG  LEU D 332     128.278 115.576 175.151  1.00 71.25           C  
ATOM  10730  CD1 LEU D 332     129.641 115.928 175.727  1.00 71.25           C  
ATOM  10731  CD2 LEU D 332     127.209 116.532 175.659  1.00 71.25           C  
ATOM  10732  N   PHE D 333     127.510 115.398 170.536  1.00 66.03           N  
ATOM  10733  CA  PHE D 333     127.476 116.030 169.221  1.00 66.03           C  
ATOM  10734  C   PHE D 333     126.044 116.210 168.734  1.00 66.03           C  
ATOM  10735  O   PHE D 333     125.645 117.313 168.335  1.00 66.03           O  
ATOM  10736  CB  PHE D 333     128.292 115.214 168.220  1.00 66.03           C  
ATOM  10737  CG  PHE D 333     128.311 115.799 166.837  1.00 66.03           C  
ATOM  10738  CD1 PHE D 333     128.881 117.039 166.602  1.00 66.03           C  
ATOM  10739  CD2 PHE D 333     127.769 115.107 165.769  1.00 66.03           C  
ATOM  10740  CE1 PHE D 333     128.902 117.580 165.332  1.00 66.03           C  
ATOM  10741  CE2 PHE D 333     127.792 115.642 164.495  1.00 66.03           C  
ATOM  10742  CZ  PHE D 333     128.358 116.881 164.278  1.00 66.03           C  
ATOM  10743  N   GLY D 334     125.253 115.137 168.763  1.00 63.63           N  
ATOM  10744  CA  GLY D 334     123.875 115.235 168.313  1.00 63.63           C  
ATOM  10745  C   GLY D 334     123.049 116.183 169.158  1.00 63.63           C  
ATOM  10746  O   GLY D 334     122.196 116.907 168.639  1.00 63.63           O  
ATOM  10747  N   ILE D 335     123.294 116.199 170.473  1.00 68.85           N  
ATOM  10748  CA  ILE D 335     122.555 117.110 171.341  1.00 68.85           C  
ATOM  10749  C   ILE D 335     122.837 118.556 170.959  1.00 68.85           C  
ATOM  10750  O   ILE D 335     121.912 119.372 170.827  1.00 68.85           O  
ATOM  10751  CB  ILE D 335     122.891 116.839 172.818  1.00 68.85           C  
ATOM  10752  CG1 ILE D 335     122.225 115.541 173.284  1.00 68.85           C  
ATOM  10753  CG2 ILE D 335     122.454 118.012 173.680  1.00 68.85           C  
ATOM  10754  CD1 ILE D 335     122.537 115.158 174.722  1.00 68.85           C  
ATOM  10755  N   PHE D 336     124.114 118.899 170.763  1.00 64.60           N  
ATOM  10756  CA  PHE D 336     124.431 120.269 170.375  1.00 64.60           C  
ATOM  10757  C   PHE D 336     123.837 120.613 169.017  1.00 64.60           C  
ATOM  10758  O   PHE D 336     123.350 121.731 168.813  1.00 64.60           O  
ATOM  10759  CB  PHE D 336     125.938 120.499 170.349  1.00 64.60           C  
ATOM  10760  CG  PHE D 336     126.319 121.796 169.703  1.00 64.60           C  
ATOM  10761  CD1 PHE D 336     126.230 122.982 170.408  1.00 64.60           C  
ATOM  10762  CD2 PHE D 336     126.732 121.835 168.382  1.00 64.60           C  
ATOM  10763  CE1 PHE D 336     126.562 124.179 169.816  1.00 64.60           C  
ATOM  10764  CE2 PHE D 336     127.063 123.029 167.785  1.00 64.60           C  
ATOM  10765  CZ  PHE D 336     126.980 124.202 168.504  1.00 64.60           C  
ATOM  10766  N   ASN D 337     123.898 119.680 168.063  1.00 66.17           N  
ATOM  10767  CA  ASN D 337     123.337 119.958 166.745  1.00 66.17           C  
ATOM  10768  C   ASN D 337     121.844 120.234 166.835  1.00 66.17           C  
ATOM  10769  O   ASN D 337     121.337 121.176 166.211  1.00 66.17           O  
ATOM  10770  CB  ASN D 337     123.611 118.797 165.794  1.00 66.17           C  
ATOM  10771  CG  ASN D 337     125.085 118.504 165.649  1.00 66.17           C  
ATOM  10772  OD1 ASN D 337     125.490 117.348 165.531  1.00 66.17           O  
ATOM  10773  ND2 ASN D 337     125.902 119.551 165.673  1.00 66.17           N  
ATOM  10774  N   LEU D 338     121.125 119.428 167.617  1.00 62.58           N  
ATOM  10775  CA  LEU D 338     119.694 119.648 167.783  1.00 62.58           C  
ATOM  10776  C   LEU D 338     119.419 121.006 168.411  1.00 62.58           C  
ATOM  10777  O   LEU D 338     118.549 121.753 167.945  1.00 62.58           O  
ATOM  10778  CB  LEU D 338     119.088 118.532 168.631  1.00 62.58           C  
ATOM  10779  CG  LEU D 338     117.610 118.721 168.954  1.00 62.58           C  
ATOM  10780  CD1 LEU D 338     116.792 118.765 167.672  1.00 62.58           C  
ATOM  10781  CD2 LEU D 338     117.124 117.618 169.878  1.00 62.58           C  
ATOM  10782  N   VAL D 339     120.161 121.349 169.468  1.00 60.52           N  
ATOM  10783  CA  VAL D 339     119.951 122.632 170.136  1.00 60.52           C  
ATOM  10784  C   VAL D 339     120.172 123.785 169.164  1.00 60.52           C  
ATOM  10785  O   VAL D 339     119.342 124.696 169.052  1.00 60.52           O  
ATOM  10786  CB  VAL D 339     120.867 122.753 171.365  1.00 60.52           C  
ATOM  10787  CG1 VAL D 339     120.832 124.170 171.908  1.00 60.52           C  
ATOM  10788  CG2 VAL D 339     120.445 121.764 172.434  1.00 60.52           C  
ATOM  10789  N   TYR D 340     121.296 123.758 168.444  1.00 60.94           N  
ATOM  10790  CA  TYR D 340     121.632 124.843 167.525  1.00 60.94           C  
ATOM  10791  C   TYR D 340     120.587 124.988 166.427  1.00 60.94           C  
ATOM  10792  O   TYR D 340     120.115 126.100 166.138  1.00 60.94           O  
ATOM  10793  CB  TYR D 340     123.015 124.587 166.923  1.00 60.94           C  
ATOM  10794  CG  TYR D 340     123.354 125.436 165.723  1.00 60.94           C  
ATOM  10795  CD1 TYR D 340     123.919 126.691 165.876  1.00 60.94           C  
ATOM  10796  CD2 TYR D 340     123.129 124.974 164.435  1.00 60.94           C  
ATOM  10797  CE1 TYR D 340     124.238 127.466 164.783  1.00 60.94           C  
ATOM  10798  CE2 TYR D 340     123.444 125.742 163.336  1.00 60.94           C  
ATOM  10799  CZ  TYR D 340     123.999 126.988 163.515  1.00 60.94           C  
ATOM  10800  OH  TYR D 340     124.315 127.759 162.420  1.00 60.94           O  
ATOM  10801  N   TRP D 341     120.226 123.874 165.785  1.00 68.96           N  
ATOM  10802  CA  TRP D 341     119.283 123.952 164.680  1.00 68.96           C  
ATOM  10803  C   TRP D 341     117.915 124.420 165.152  1.00 68.96           C  
ATOM  10804  O   TRP D 341     117.279 125.240 164.486  1.00 68.96           O  
ATOM  10805  CB  TRP D 341     119.188 122.607 163.967  1.00 68.96           C  
ATOM  10806  CG  TRP D 341     120.326 122.381 163.027  1.00 68.96           C  
ATOM  10807  CD1 TRP D 341     121.371 121.522 163.194  1.00 68.96           C  
ATOM  10808  CD2 TRP D 341     120.548 123.043 161.779  1.00 68.96           C  
ATOM  10809  NE1 TRP D 341     122.225 121.601 162.121  1.00 68.96           N  
ATOM  10810  CE2 TRP D 341     121.740 122.529 161.239  1.00 68.96           C  
ATOM  10811  CE3 TRP D 341     119.849 124.016 161.063  1.00 68.96           C  
ATOM  10812  CZ2 TRP D 341     122.248 122.956 160.018  1.00 68.96           C  
ATOM  10813  CZ3 TRP D 341     120.355 124.437 159.853  1.00 68.96           C  
ATOM  10814  CH2 TRP D 341     121.542 123.909 159.342  1.00 68.96           C  
ATOM  10815  N   ALA D 342     117.449 123.933 166.305  1.00 68.94           N  
ATOM  10816  CA  ALA D 342     116.176 124.414 166.826  1.00 68.94           C  
ATOM  10817  C   ALA D 342     116.235 125.905 167.124  1.00 68.94           C  
ATOM  10818  O   ALA D 342     115.316 126.656 166.768  1.00 68.94           O  
ATOM  10819  CB  ALA D 342     115.789 123.631 168.079  1.00 68.94           C  
ATOM  10820  N   THR D 343     117.321 126.355 167.759  1.00 69.30           N  
ATOM  10821  CA  THR D 343     117.437 127.758 168.139  1.00 69.30           C  
ATOM  10822  C   THR D 343     117.366 128.668 166.923  1.00 69.30           C  
ATOM  10823  O   THR D 343     116.666 129.687 166.937  1.00 69.30           O  
ATOM  10824  CB  THR D 343     118.744 127.988 168.898  1.00 69.30           C  
ATOM  10825  OG1 THR D 343     118.800 127.113 170.031  1.00 69.30           O  
ATOM  10826  CG2 THR D 343     118.840 129.432 169.375  1.00 69.30           C  
ATOM  10827  N   TYR D 344     118.079 128.317 165.853  1.00 67.34           N  
ATOM  10828  CA  TYR D 344     118.125 129.238 164.721  1.00 67.34           C  
ATOM  10829  C   TYR D 344     117.007 128.996 163.717  1.00 67.34           C  
ATOM  10830  O   TYR D 344     116.776 129.842 162.847  1.00 67.34           O  
ATOM  10831  CB  TYR D 344     119.490 129.188 164.043  1.00 67.34           C  
ATOM  10832  CG  TYR D 344     120.488 130.072 164.744  1.00 67.34           C  
ATOM  10833  CD1 TYR D 344     120.261 131.433 164.863  1.00 67.34           C  
ATOM  10834  CD2 TYR D 344     121.639 129.550 165.308  1.00 67.34           C  
ATOM  10835  CE1 TYR D 344     121.158 132.251 165.514  1.00 67.34           C  
ATOM  10836  CE2 TYR D 344     122.543 130.361 165.959  1.00 67.34           C  
ATOM  10837  CZ  TYR D 344     122.298 131.711 166.058  1.00 67.34           C  
ATOM  10838  OH  TYR D 344     123.196 132.522 166.708  1.00 67.34           O  
ATOM  10839  N   LEU D 345     116.308 127.864 163.797  1.00 72.22           N  
ATOM  10840  CA  LEU D 345     115.156 127.674 162.923  1.00 72.22           C  
ATOM  10841  C   LEU D 345     113.889 128.275 163.515  1.00 72.22           C  
ATOM  10842  O   LEU D 345     113.019 128.732 162.765  1.00 72.22           O  
ATOM  10843  CB  LEU D 345     114.961 126.188 162.631  1.00 72.22           C  
ATOM  10844  CG  LEU D 345     115.921 125.622 161.585  1.00 72.22           C  
ATOM  10845  CD1 LEU D 345     115.775 124.114 161.467  1.00 72.22           C  
ATOM  10846  CD2 LEU D 345     115.675 126.286 160.248  1.00 72.22           C  
ATOM  10847  N   ASN D 346     113.758 128.280 164.847  1.00 82.82           N  
ATOM  10848  CA  ASN D 346     112.555 128.839 165.458  1.00 82.82           C  
ATOM  10849  C   ASN D 346     112.413 130.328 165.172  1.00 82.82           C  
ATOM  10850  O   ASN D 346     111.292 130.848 165.135  1.00 82.82           O  
ATOM  10851  CB  ASN D 346     112.561 128.585 166.966  1.00 82.82           C  
ATOM  10852  CG  ASN D 346     112.269 127.139 167.313  1.00 82.82           C  
ATOM  10853  OD1 ASN D 346     111.551 126.450 166.590  1.00 82.82           O  
ATOM  10854  ND2 ASN D 346     112.825 126.671 168.424  1.00 82.82           N  
ATOM  10855  N   ARG D 347     113.525 131.024 164.964  1.00 77.47           N  
ATOM  10856  CA  ARG D 347     113.499 132.456 164.693  1.00 77.47           C  
ATOM  10857  C   ARG D 347     112.838 132.756 163.354  1.00 77.47           C  
ATOM  10858  O   ARG D 347     111.937 133.590 163.271  1.00 77.47           O  
ATOM  10859  CB  ARG D 347     114.916 133.027 164.717  1.00 77.47           C  
ATOM  10860  CG  ARG D 347     115.608 132.893 166.058  1.00 77.47           C  
ATOM  10861  CD  ARG D 347     117.048 133.358 165.982  1.00 77.47           C  
ATOM  10862  NE  ARG D 347     117.151 134.762 165.599  1.00 77.47           N  
ATOM  10863  CZ  ARG D 347     117.202 135.768 166.465  1.00 77.47           C  
ATOM  10864  NH1 ARG D 347     117.298 137.015 166.027  1.00 77.47           N  
ATOM  10865  NH2 ARG D 347     117.158 135.527 167.767  1.00 77.47           N  
TER   10866      ARG D 347                                                      
ATOM  10867  N   GLY E  25     103.814 186.345 139.501  1.00 71.12           N  
ATOM  10868  CA  GLY E  25     103.928 187.395 138.506  1.00 71.12           C  
ATOM  10869  C   GLY E  25     105.020 188.400 138.817  1.00 71.12           C  
ATOM  10870  O   GLY E  25     105.574 189.026 137.915  1.00 71.12           O  
ATOM  10871  N   ASP E  26     105.321 188.564 140.105  1.00 64.16           N  
ATOM  10872  CA  ASP E  26     106.364 189.500 140.509  1.00 64.16           C  
ATOM  10873  C   ASP E  26     107.745 188.866 140.409  1.00 64.16           C  
ATOM  10874  O   ASP E  26     108.705 189.516 139.977  1.00 64.16           O  
ATOM  10875  CB  ASP E  26     106.108 189.986 141.934  1.00 64.16           C  
ATOM  10876  CG  ASP E  26     104.677 190.425 142.150  1.00 64.16           C  
ATOM  10877  OD1 ASP E  26     104.025 190.830 141.165  1.00 64.16           O  
ATOM  10878  OD2 ASP E  26     104.204 190.365 143.304  1.00 64.16           O  
ATOM  10879  N   VAL E  27     107.859 187.597 140.806  1.00 48.13           N  
ATOM  10880  CA  VAL E  27     109.161 186.948 140.908  1.00 48.13           C  
ATOM  10881  C   VAL E  27     109.862 186.906 139.559  1.00 48.13           C  
ATOM  10882  O   VAL E  27     111.094 187.002 139.488  1.00 48.13           O  
ATOM  10883  CB  VAL E  27     108.992 185.542 141.508  1.00 48.13           C  
ATOM  10884  CG1 VAL E  27     110.337 184.874 141.692  1.00 48.13           C  
ATOM  10885  CG2 VAL E  27     108.256 185.632 142.828  1.00 48.13           C  
ATOM  10886  N   THR E  28     109.103 186.782 138.469  1.00 45.14           N  
ATOM  10887  CA  THR E  28     109.718 186.780 137.147  1.00 45.14           C  
ATOM  10888  C   THR E  28     110.403 188.110 136.866  1.00 45.14           C  
ATOM  10889  O   THR E  28     111.544 188.149 136.390  1.00 45.14           O  
ATOM  10890  CB  THR E  28     108.669 186.478 136.079  1.00 45.14           C  
ATOM  10891  OG1 THR E  28     108.068 185.207 136.348  1.00 45.14           O  
ATOM  10892  CG2 THR E  28     109.311 186.439 134.705  1.00 45.14           C  
ATOM  10893  N   VAL E  29     109.722 189.216 137.168  1.00 44.12           N  
ATOM  10894  CA  VAL E  29     110.319 190.529 136.959  1.00 44.12           C  
ATOM  10895  C   VAL E  29     111.512 190.726 137.884  1.00 44.12           C  
ATOM  10896  O   VAL E  29     112.529 191.309 137.489  1.00 44.12           O  
ATOM  10897  CB  VAL E  29     109.263 191.631 137.148  1.00 44.12           C  
ATOM  10898  CG1 VAL E  29     109.885 192.997 136.939  1.00 44.12           C  
ATOM  10899  CG2 VAL E  29     108.110 191.420 136.188  1.00 44.12           C  
ATOM  10900  N   ILE E  30     111.416 190.238 139.123  1.00 38.84           N  
ATOM  10901  CA  ILE E  30     112.536 190.371 140.053  1.00 38.84           C  
ATOM  10902  C   ILE E  30     113.768 189.653 139.513  1.00 38.84           C  
ATOM  10903  O   ILE E  30     114.878 190.204 139.510  1.00 38.84           O  
ATOM  10904  CB  ILE E  30     112.144 189.847 141.445  1.00 38.84           C  
ATOM  10905  CG1 ILE E  30     111.226 190.841 142.150  1.00 38.84           C  
ATOM  10906  CG2 ILE E  30     113.374 189.595 142.286  1.00 38.84           C  
ATOM  10907  CD1 ILE E  30     110.870 190.433 143.558  1.00 38.84           C  
ATOM  10908  N   LEU E  31     113.592 188.423 139.030  1.00 35.41           N  
ATOM  10909  CA  LEU E  31     114.726 187.686 138.485  1.00 35.41           C  
ATOM  10910  C   LEU E  31     115.274 188.357 137.233  1.00 35.41           C  
ATOM  10911  O   LEU E  31     116.494 188.471 137.068  1.00 35.41           O  
ATOM  10912  CB  LEU E  31     114.325 186.243 138.192  1.00 35.41           C  
ATOM  10913  CG  LEU E  31     114.075 185.383 139.428  1.00 35.41           C  
ATOM  10914  CD1 LEU E  31     113.544 184.027 139.030  1.00 35.41           C  
ATOM  10915  CD2 LEU E  31     115.347 185.240 140.236  1.00 35.41           C  
ATOM  10916  N   ASN E  32     114.392 188.809 136.339  1.00 39.72           N  
ATOM  10917  CA  ASN E  32     114.863 189.454 135.120  1.00 39.72           C  
ATOM  10918  C   ASN E  32     115.630 190.732 135.423  1.00 39.72           C  
ATOM  10919  O   ASN E  32     116.558 191.084 134.689  1.00 39.72           O  
ATOM  10920  CB  ASN E  32     113.690 189.738 134.186  1.00 39.72           C  
ATOM  10921  CG  ASN E  32     113.136 188.481 133.558  1.00 39.72           C  
ATOM  10922  OD1 ASN E  32     113.844 187.486 133.410  1.00 39.72           O  
ATOM  10923  ND2 ASN E  32     111.864 188.515 133.180  1.00 39.72           N  
ATOM  10924  N   ASN E  33     115.268 191.439 136.495  1.00 39.64           N  
ATOM  10925  CA  ASN E  33     116.046 192.609 136.887  1.00 39.64           C  
ATOM  10926  C   ASN E  33     117.387 192.206 137.484  1.00 39.64           C  
ATOM  10927  O   ASN E  33     118.408 192.851 137.219  1.00 39.64           O  
ATOM  10928  CB  ASN E  33     115.261 193.467 137.875  1.00 39.64           C  
ATOM  10929  CG  ASN E  33     114.141 194.231 137.216  1.00 39.64           C  
ATOM  10930  OD1 ASN E  33     114.105 194.370 135.994  1.00 39.64           O  
ATOM  10931  ND2 ASN E  33     113.218 194.744 138.022  1.00 39.64           N  
ATOM  10932  N   LEU E  34     117.406 191.144 138.292  1.00 35.87           N  
ATOM  10933  CA  LEU E  34     118.663 190.701 138.891  1.00 35.87           C  
ATOM  10934  C   LEU E  34     119.666 190.285 137.823  1.00 35.87           C  
ATOM  10935  O   LEU E  34     120.853 190.617 137.904  1.00 35.87           O  
ATOM  10936  CB  LEU E  34     118.414 189.547 139.858  1.00 35.87           C  
ATOM  10937  CG  LEU E  34     117.605 189.857 141.113  1.00 35.87           C  
ATOM  10938  CD1 LEU E  34     117.682 188.696 142.085  1.00 35.87           C  
ATOM  10939  CD2 LEU E  34     118.093 191.139 141.755  1.00 35.87           C  
ATOM  10940  N   LEU E  35     119.206 189.551 136.811  1.00 33.13           N  
ATOM  10941  CA  LEU E  35     120.137 188.991 135.836  1.00 33.13           C  
ATOM  10942  C   LEU E  35     120.596 190.038 134.830  1.00 33.13           C  
ATOM  10943  O   LEU E  35     121.746 190.007 134.379  1.00 33.13           O  
ATOM  10944  CB  LEU E  35     119.505 187.800 135.124  1.00 33.13           C  
ATOM  10945  CG  LEU E  35     119.710 186.463 135.830  1.00 33.13           C  
ATOM  10946  CD1 LEU E  35     121.188 186.212 136.009  1.00 33.13           C  
ATOM  10947  CD2 LEU E  35     118.997 186.442 137.166  1.00 33.13           C  
ATOM  10948  N   GLU E  36     119.714 190.961 134.455  1.00 43.16           N  
ATOM  10949  CA  GLU E  36     120.075 191.987 133.487  1.00 43.16           C  
ATOM  10950  C   GLU E  36     121.204 192.852 134.028  1.00 43.16           C  
ATOM  10951  O   GLU E  36     1