CNRS Nantes University UFIP UFIP
home |  start a new run |  job status |  references&downloads |  examples |  help  

Elnemo is running on a new server.
Should you encounter any unexpected behaviour,
please let us know.


***    ***

elNémo ID: 19111415445455030

Job options:

ID        	=	 19111415445455030
JOBID     	=	 
USERID    	=	 unknown
PRIVAT    	=	 0

NMODES    	=	 5
DQMIN     	=	 -100
DQMAX     	=	 100
DQSTEP    	=	 20
DOGRAPHS  	=	 on

DOPROJMODS	=	 0
DORMSD    	=	 0

NRBL      	=	 0
CUTOFF    	=	 0
CAONLY    	=	 0


Input data for this run:


data_5O4U
# 
_entry.id   5O4U 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.315 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5O4U         
WWPDB D_1200005122 
EMDB  EMD-3746     
# 
_pdbx_database_related.db_name        EMDB 
_pdbx_database_related.details        'The archaellum of Pyrococcus furiosus' 
_pdbx_database_related.db_id          EMD-3746 
_pdbx_database_related.content_type   'associated EM volume' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5O4U 
_pdbx_database_status.recvd_initial_deposition_date   2017-05-31 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Daum, B.'  1 0000-0002-3767-264X 
'Vonck, J.' 2 0000-0001-5659-8863 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Elife 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2050-084X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            6 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     'Structure andin situorganisation of thePyrococcus furiosusarchaellum machinery.' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.7554/eLife.27470 
_citation.pdbx_database_id_PubMed   28653905 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Daum, B.'       1 ? 
primary 'Vonck, J.'      2 ? 
primary 'Bellack, A.'    3 ? 
primary 'Chaudhury, P.'  4 ? 
primary 'Reichelt, R.'   5 ? 
primary 'Albers, S.V.'   6 ? 
primary 'Rachel, R.'     7 ? 
primary 'Kuhlbrandt, W.' 8 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5O4U 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     1.000 
_cell.length_a_esd                 ? 
_cell.length_b                     1.000 
_cell.length_b_esd                 ? 
_cell.length_c                     1.000 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        1 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5O4U 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 nat 
_entity.pdbx_description           Flagellin 
_entity.formula_weight             22283.350 
_entity.pdbx_number_of_molecules   16 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MAKKGAVGIGTLIVFIAMVLVAAVAAAVLIQTSGYLQQKSQATGRETTQEVASGIKVLSVVGKTDSNKTYVEKLAIYISP
NAGSEGIDLNNTRVVLSNGTVQAVLKYEKTAYHKGAVGDVFNASTAWNLSNTNFGIIVLQDADNSVDQNYPTLNKGDIVV
ITVKVGEGNGVFGKGIPPRTKITGKVIPEFGAPGVIEFTTPSTYTSEVIELQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MAKKGAVGIGTLIVFIAMVLVAAVAAAVLIQTSGYLQQKSQATGRETTQEVASGIKVLSVVGKTDSNKTYVEKLAIYISP
NAGSEGIDLNNTRVVLSNGTVQAVLKYEKTAYHKGAVGDVFNASTAWNLSNTNFGIIVLQDADNSVDQNYPTLNKGDIVV
ITVKVGEGNGVFGKGIPPRTKITGKVIPEFGAPGVIEFTTPSTYTSEVIELQ
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   LYS n 
1 4   LYS n 
1 5   GLY n 
1 6   ALA n 
1 7   VAL n 
1 8   GLY n 
1 9   ILE n 
1 10  GLY n 
1 11  THR n 
1 12  LEU n 
1 13  ILE n 
1 14  VAL n 
1 15  PHE n 
1 16  ILE n 
1 17  ALA n 
1 18  MET n 
1 19  VAL n 
1 20  LEU n 
1 21  VAL n 
1 22  ALA n 
1 23  ALA n 
1 24  VAL n 
1 25  ALA n 
1 26  ALA n 
1 27  ALA n 
1 28  VAL n 
1 29  LEU n 
1 30  ILE n 
1 31  GLN n 
1 32  THR n 
1 33  SER n 
1 34  GLY n 
1 35  TYR n 
1 36  LEU n 
1 37  GLN n 
1 38  GLN n 
1 39  LYS n 
1 40  SER n 
1 41  GLN n 
1 42  ALA n 
1 43  THR n 
1 44  GLY n 
1 45  ARG n 
1 46  GLU n 
1 47  THR n 
1 48  THR n 
1 49  GLN n 
1 50  GLU n 
1 51  VAL n 
1 52  ALA n 
1 53  SER n 
1 54  GLY n 
1 55  ILE n 
1 56  LYS n 
1 57  VAL n 
1 58  LEU n 
1 59  SER n 
1 60  VAL n 
1 61  VAL n 
1 62  GLY n 
1 63  LYS n 
1 64  THR n 
1 65  ASP n 
1 66  SER n 
1 67  ASN n 
1 68  LYS n 
1 69  THR n 
1 70  TYR n 
1 71  VAL n 
1 72  GLU n 
1 73  LYS n 
1 74  LEU n 
1 75  ALA n 
1 76  ILE n 
1 77  TYR n 
1 78  ILE n 
1 79  SER n 
1 80  PRO n 
1 81  ASN n 
1 82  ALA n 
1 83  GLY n 
1 84  SER n 
1 85  GLU n 
1 86  GLY n 
1 87  ILE n 
1 88  ASP n 
1 89  LEU n 
1 90  ASN n 
1 91  ASN n 
1 92  THR n 
1 93  ARG n 
1 94  VAL n 
1 95  VAL n 
1 96  LEU n 
1 97  SER n 
1 98  ASN n 
1 99  GLY n 
1 100 THR n 
1 101 VAL n 
1 102 GLN n 
1 103 ALA n 
1 104 VAL n 
1 105 LEU n 
1 106 LYS n 
1 107 TYR n 
1 108 GLU n 
1 109 LYS n 
1 110 THR n 
1 111 ALA n 
1 112 TYR n 
1 113 HIS n 
1 114 LYS n 
1 115 GLY n 
1 116 ALA n 
1 117 VAL n 
1 118 GLY n 
1 119 ASP n 
1 120 VAL n 
1 121 PHE n 
1 122 ASN n 
1 123 ALA n 
1 124 SER n 
1 125 THR n 
1 126 ALA n 
1 127 TRP n 
1 128 ASN n 
1 129 LEU n 
1 130 SER n 
1 131 ASN n 
1 132 THR n 
1 133 ASN n 
1 134 PHE n 
1 135 GLY n 
1 136 ILE n 
1 137 ILE n 
1 138 VAL n 
1 139 LEU n 
1 140 GLN n 
1 141 ASP n 
1 142 ALA n 
1 143 ASP n 
1 144 ASN n 
1 145 SER n 
1 146 VAL n 
1 147 ASP n 
1 148 GLN n 
1 149 ASN n 
1 150 TYR n 
1 151 PRO n 
1 152 THR n 
1 153 LEU n 
1 154 ASN n 
1 155 LYS n 
1 156 GLY n 
1 157 ASP n 
1 158 ILE n 
1 159 VAL n 
1 160 VAL n 
1 161 ILE n 
1 162 THR n 
1 163 VAL n 
1 164 LYS n 
1 165 VAL n 
1 166 GLY n 
1 167 GLU n 
1 168 GLY n 
1 169 ASN n 
1 170 GLY n 
1 171 VAL n 
1 172 PHE n 
1 173 GLY n 
1 174 LYS n 
1 175 GLY n 
1 176 ILE n 
1 177 PRO n 
1 178 PRO n 
1 179 ARG n 
1 180 THR n 
1 181 LYS n 
1 182 ILE n 
1 183 THR n 
1 184 GLY n 
1 185 LYS n 
1 186 VAL n 
1 187 ILE n 
1 188 PRO n 
1 189 GLU n 
1 190 PHE n 
1 191 GLY n 
1 192 ALA n 
1 193 PRO n 
1 194 GLY n 
1 195 VAL n 
1 196 ILE n 
1 197 GLU n 
1 198 PHE n 
1 199 THR n 
1 200 THR n 
1 201 PRO n 
1 202 SER n 
1 203 THR n 
1 204 TYR n 
1 205 THR n 
1 206 SER n 
1 207 GLU n 
1 208 VAL n 
1 209 ILE n 
1 210 GLU n 
1 211 LEU n 
1 212 GLN n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           1 
_entity_src_nat.pdbx_end_seq_num           212 
_entity_src_nat.common_name                ? 
_entity_src_nat.pdbx_organism_scientific   'Pyrococcus furiosus DSM 3638' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      186497 
_entity_src_nat.genus                      ? 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  43587 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    A0A0B4ZYM1_PYRFU 
_struct_ref.pdbx_db_accession          A0A0B4ZYM1 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MAKKGAVGIGTLIVFIAMVLVAAVAAAVLIQTSGYLQQKSQATGRETTQEVASGIKVLSVVGKTDSNKTYVEKLAIYISP
NAGSEGIDLNNTRVVLSNGTVQAVLKYEKTAYHKGAVGDVFNASTAWNLSNTNFGIIVLQDADNSVDQNYPTLNKGDIVV
ITVKVGEGNGVFGKGIPPRTKITGKVIPEFGAPGVIEFTTPSTYTSEVIELQ
;
_struct_ref.pdbx_align_begin           1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 5O4U A 1 ? 212 ? A0A0B4ZYM1 1 ? 212 ? 1 212 
2  1 5O4U B 1 ? 212 ? A0A0B4ZYM1 1 ? 212 ? 1 212 
3  1 5O4U C 1 ? 212 ? A0A0B4ZYM1 1 ? 212 ? 1 212 
4  1 5O4U D 1 ? 212 ? A0A0B4ZYM1 1 ? 212 ? 1 212 
5  1 5O4U E 1 ? 212 ? A0A0B4ZYM1 1 ? 212 ? 1 212 
6  1 5O4U F 1 ? 212 ? A0A0B4ZYM1 1 ? 212 ? 1 212 
7  1 5O4U G 1 ? 212 ? A0A0B4ZYM1 1 ? 212 ? 1 212 
8  1 5O4U H 1 ? 212 ? A0A0B4ZYM1 1 ? 212 ? 1 212 
9  1 5O4U I 1 ? 212 ? A0A0B4ZYM1 1 ? 212 ? 1 212 
10 1 5O4U J 1 ? 212 ? A0A0B4ZYM1 1 ? 212 ? 1 212 
11 1 5O4U K 1 ? 212 ? A0A0B4ZYM1 1 ? 212 ? 1 212 
12 1 5O4U L 1 ? 212 ? A0A0B4ZYM1 1 ? 212 ? 1 212 
13 1 5O4U M 1 ? 212 ? A0A0B4ZYM1 1 ? 212 ? 1 212 
14 1 5O4U N 1 ? 212 ? A0A0B4ZYM1 1 ? 212 ? 1 212 
15 1 5O4U O 1 ? 212 ? A0A0B4ZYM1 1 ? 212 ? 1 212 
16 1 5O4U P 1 ? 212 ? A0A0B4ZYM1 1 ? 212 ? 1 212 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5O4U 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5O4U 
_refine.pdbx_refine_id                           'ELECTRON MICROSCOPY' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            . 
_refine.ls_d_res_low                             ? 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'ELECTRON MICROSCOPY' ? 0.007 ? 24896 ? f_bond_d           ? ? 
'ELECTRON MICROSCOPY' ? 1.168 ? 33904 ? f_angle_d          ? ? 
'ELECTRON MICROSCOPY' ? 8.170 ? 20192 ? f_dihedral_angle_d ? ? 
'ELECTRON MICROSCOPY' ? 0.078 ? 4192  ? f_chiral_restr     ? ? 
'ELECTRON MICROSCOPY' ? 0.007 ? 4320  ? f_plane_restr      ? ? 
# 
_struct.entry_id                     5O4U 
_struct.title                        'The flagellin of Pyrococcus furiosus' 
_struct.pdbx_descriptor              Flagellin 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5O4U 
_struct_keywords.text            'archaellar flagellum glycoprotein helical filament, Cell adhesion' 
_struct_keywords.pdbx_keywords   'CELL ADHESION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 1 ? 
F N N 1 ? 
G N N 1 ? 
H N N 1 ? 
I N N 1 ? 
J N N 1 ? 
K N N 1 ? 
L N N 1 ? 
M N N 1 ? 
N N N 1 ? 
O N N 1 ? 
P N N 1 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ALA A 6   ? SER A 53  ? ALA A 6   SER A 53  1 ? 48 
HELX_P HELX_P2  AA2 SER A 124 ? ASN A 128 ? SER A 124 ASN A 128 5 ? 5  
HELX_P HELX_P3  AA3 ILE B 9   ? VAL B 28  ? ILE B 9   VAL B 28  1 ? 20 
HELX_P HELX_P4  AA4 VAL B 28  ? SER B 53  ? VAL B 28  SER B 53  1 ? 26 
HELX_P HELX_P5  AA5 ASN B 90  ? THR B 92  ? ASN B 90  THR B 92  5 ? 3  
HELX_P HELX_P6  AA6 VAL C 7   ? SER C 53  ? VAL C 7   SER C 53  1 ? 47 
HELX_P HELX_P7  AA7 ASP C 88  ? THR C 92  ? ASP C 88  THR C 92  5 ? 5  
HELX_P HELX_P8  AA8 VAL D 7   ? SER D 53  ? VAL D 7   SER D 53  1 ? 47 
HELX_P HELX_P9  AA9 SER D 124 ? ASN D 128 ? SER D 124 ASN D 128 5 ? 5  
HELX_P HELX_P10 AB1 VAL E 7   ? SER E 53  ? VAL E 7   SER E 53  1 ? 47 
HELX_P HELX_P11 AB2 SER E 124 ? ASN E 128 ? SER E 124 ASN E 128 5 ? 5  
HELX_P HELX_P12 AB3 ILE F 9   ? ALA F 25  ? ILE F 9   ALA F 25  1 ? 17 
HELX_P HELX_P13 AB4 VAL F 28  ? GLN F 38  ? VAL F 28  GLN F 38  1 ? 11 
HELX_P HELX_P14 AB5 LYS F 39  ? SER F 53  ? LYS F 39  SER F 53  1 ? 15 
HELX_P HELX_P15 AB6 SER F 124 ? ASN F 128 ? SER F 124 ASN F 128 5 ? 5  
HELX_P HELX_P16 AB7 VAL G 7   ? ALA G 25  ? VAL G 7   ALA G 25  1 ? 19 
HELX_P HELX_P17 AB8 ILE G 30  ? ALA G 52  ? ILE G 30  ALA G 52  1 ? 23 
HELX_P HELX_P18 AB9 SER G 124 ? ASN G 128 ? SER G 124 ASN G 128 5 ? 5  
HELX_P HELX_P19 AC1 ILE H 9   ? ALA H 25  ? ILE H 9   ALA H 25  1 ? 17 
HELX_P HELX_P20 AC2 VAL H 28  ? SER H 53  ? VAL H 28  SER H 53  1 ? 26 
HELX_P HELX_P21 AC3 SER H 124 ? ASN H 128 ? SER H 124 ASN H 128 5 ? 5  
HELX_P HELX_P22 AC4 VAL I 7   ? ARG I 45  ? VAL I 7   ARG I 45  1 ? 39 
HELX_P HELX_P23 AC5 ARG I 45  ? SER I 53  ? ARG I 45  SER I 53  1 ? 9  
HELX_P HELX_P24 AC6 SER I 124 ? ASN I 128 ? SER I 124 ASN I 128 5 ? 5  
HELX_P HELX_P25 AC7 VAL J 7   ? ALA J 27  ? VAL J 7   ALA J 27  1 ? 21 
HELX_P HELX_P26 AC8 ILE J 30  ? SER J 53  ? ILE J 30  SER J 53  1 ? 24 
HELX_P HELX_P27 AC9 SER J 124 ? ASN J 128 ? SER J 124 ASN J 128 5 ? 5  
HELX_P HELX_P28 AD1 ILE K 9   ? SER K 53  ? ILE K 9   SER K 53  1 ? 45 
HELX_P HELX_P29 AD2 VAL L 7   ? GLN L 41  ? VAL L 7   GLN L 41  1 ? 35 
HELX_P HELX_P30 AD3 GLN L 41  ? SER L 53  ? GLN L 41  SER L 53  1 ? 13 
HELX_P HELX_P31 AD4 VAL M 7   ? VAL M 28  ? VAL M 7   VAL M 28  1 ? 22 
HELX_P HELX_P32 AD5 ILE M 30  ? SER M 53  ? ILE M 30  SER M 53  1 ? 24 
HELX_P HELX_P33 AD6 SER M 124 ? ASN M 128 ? SER M 124 ASN M 128 5 ? 5  
HELX_P HELX_P34 AD7 VAL N 7   ? ILE N 30  ? VAL N 7   ILE N 30  1 ? 24 
HELX_P HELX_P35 AD8 ILE N 30  ? SER N 53  ? ILE N 30  SER N 53  1 ? 24 
HELX_P HELX_P36 AD9 VAL O 7   ? VAL O 28  ? VAL O 7   VAL O 28  1 ? 22 
HELX_P HELX_P37 AE1 VAL O 28  ? GLU O 50  ? VAL O 28  GLU O 50  1 ? 23 
HELX_P HELX_P38 AE2 VAL P 7   ? SER P 53  ? VAL P 7   SER P 53  1 ? 47 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3 ? 
AA2 ? 3 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 5 ? 
AA6 ? 4 ? 
AA7 ? 3 ? 
AA8 ? 3 ? 
AA9 ? 5 ? 
AB1 ? 3 ? 
AB2 ? 2 ? 
AB3 ? 4 ? 
AB4 ? 2 ? 
AB5 ? 3 ? 
AB6 ? 2 ? 
AB7 ? 5 ? 
AB8 ? 3 ? 
AB9 ? 3 ? 
AC1 ? 3 ? 
AC2 ? 3 ? 
AC3 ? 3 ? 
AC4 ? 2 ? 
AC5 ? 8 ? 
AC6 ? 3 ? 
AC7 ? 5 ? 
AC8 ? 3 ? 
AC9 ? 3 ? 
AD1 ? 4 ? 
AD2 ? 3 ? 
AD3 ? 3 ? 
AD4 ? 3 ? 
AD5 ? 3 ? 
AD6 ? 5 ? 
AD7 ? 3 ? 
AD8 ? 3 ? 
AD9 ? 3 ? 
AE1 ? 2 ? 
AE2 ? 5 ? 
AE3 ? 2 ? 
AE4 ? 3 ? 
AE5 ? 4 ? 
AE6 ? 3 ? 
AE7 ? 3 ? 
AE8 ? 3 ? 
AE9 ? 3 ? 
AF1 ? 3 ? 
AF2 ? 2 ? 
AF3 ? 4 ? 
AF4 ? 3 ? 
AF5 ? 2 ? 
AF6 ? 2 ? 
AF7 ? 3 ? 
AF8 ? 3 ? 
AF9 ? 3 ? 
AG1 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA3 1 2 ? parallel      
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA5 4 5 ? parallel      
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AA9 2 3 ? anti-parallel 
AA9 3 4 ? anti-parallel 
AA9 4 5 ? parallel      
AB1 1 2 ? anti-parallel 
AB1 2 3 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB3 3 4 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? anti-parallel 
AB6 1 2 ? parallel      
AB7 1 2 ? anti-parallel 
AB7 2 3 ? anti-parallel 
AB7 3 4 ? anti-parallel 
AB7 4 5 ? parallel      
AB8 1 2 ? anti-parallel 
AB8 2 3 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AB9 2 3 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC1 2 3 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC2 2 3 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC3 2 3 ? anti-parallel 
AC4 1 2 ? parallel      
AC5 1 2 ? anti-parallel 
AC5 2 3 ? anti-parallel 
AC5 3 4 ? anti-parallel 
AC5 4 5 ? parallel      
AC5 5 6 ? anti-parallel 
AC5 6 7 ? anti-parallel 
AC5 7 8 ? anti-parallel 
AC6 1 2 ? anti-parallel 
AC6 2 3 ? anti-parallel 
AC7 1 2 ? anti-parallel 
AC7 2 3 ? anti-parallel 
AC7 3 4 ? anti-parallel 
AC7 4 5 ? parallel      
AC8 1 2 ? anti-parallel 
AC8 2 3 ? anti-parallel 
AC9 1 2 ? anti-parallel 
AC9 2 3 ? anti-parallel 
AD1 1 2 ? anti-parallel 
AD1 2 3 ? anti-parallel 
AD1 3 4 ? anti-parallel 
AD2 1 2 ? anti-parallel 
AD2 2 3 ? anti-parallel 
AD3 1 2 ? anti-parallel 
AD3 2 3 ? anti-parallel 
AD4 1 2 ? anti-parallel 
AD4 2 3 ? anti-parallel 
AD5 1 2 ? anti-parallel 
AD5 2 3 ? anti-parallel 
AD6 1 2 ? parallel      
AD6 2 3 ? anti-parallel 
AD6 3 4 ? anti-parallel 
AD6 4 5 ? anti-parallel 
AD7 1 2 ? anti-parallel 
AD7 2 3 ? anti-parallel 
AD8 1 2 ? anti-parallel 
AD8 2 3 ? anti-parallel 
AD9 1 2 ? anti-parallel 
AD9 2 3 ? anti-parallel 
AE1 1 2 ? parallel      
AE2 1 2 ? anti-parallel 
AE2 2 3 ? anti-parallel 
AE2 3 4 ? anti-parallel 
AE2 4 5 ? parallel      
AE3 1 2 ? anti-parallel 
AE4 1 2 ? anti-parallel 
AE4 2 3 ? anti-parallel 
AE5 1 2 ? anti-parallel 
AE5 2 3 ? anti-parallel 
AE5 3 4 ? anti-parallel 
AE6 1 2 ? anti-parallel 
AE6 2 3 ? anti-parallel 
AE7 1 2 ? anti-parallel 
AE7 2 3 ? anti-parallel 
AE8 1 2 ? anti-parallel 
AE8 2 3 ? anti-parallel 
AE9 1 2 ? anti-parallel 
AE9 2 3 ? anti-parallel 
AF1 1 2 ? anti-parallel 
AF1 2 3 ? anti-parallel 
AF2 1 2 ? parallel      
AF3 1 2 ? anti-parallel 
AF3 2 3 ? anti-parallel 
AF3 3 4 ? anti-parallel 
AF4 1 2 ? anti-parallel 
AF4 2 3 ? anti-parallel 
AF5 1 2 ? parallel      
AF6 1 2 ? anti-parallel 
AF7 1 2 ? anti-parallel 
AF7 2 3 ? anti-parallel 
AF8 1 2 ? anti-parallel 
AF8 2 3 ? anti-parallel 
AF9 1 2 ? anti-parallel 
AF9 2 3 ? anti-parallel 
AG1 1 2 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ILE A 55  ? VAL A 57  ? ILE A 55  VAL A 57  
AA1 2 LYS A 73  ? PRO A 80  ? LYS A 73  PRO A 80  
AA1 3 VAL A 159 ? LYS A 164 ? VAL A 159 LYS A 164 
AA2 1 ARG A 93  ? LEU A 96  ? ARG A 93  LEU A 96  
AA2 2 THR A 183 ? ILE A 187 ? THR A 183 ILE A 187 
AA2 3 GLY A 194 ? GLU A 197 ? GLY A 194 GLU A 197 
AA3 1 LYS A 106 ? TYR A 107 ? LYS A 106 TYR A 107 
AA3 2 ASN A 133 ? PHE A 134 ? ASN A 133 PHE A 134 
AA4 1 VAL A 146 ? ASP A 147 ? VAL A 146 ASP A 147 
AA4 2 TYR A 150 ? PRO A 151 ? TYR A 150 PRO A 151 
AA5 1 ILE B 55  ? VAL B 61  ? ILE B 55  VAL B 61  
AA5 2 LYS B 73  ? PRO B 80  ? LYS B 73  PRO B 80  
AA5 3 ILE B 158 ? LYS B 164 ? ILE B 158 LYS B 164 
AA5 4 ASN B 133 ? GLY B 135 ? ASN B 133 GLY B 135 
AA5 5 LYS B 106 ? TYR B 107 ? LYS B 106 TYR B 107 
AA6 1 ILE B 55  ? VAL B 61  ? ILE B 55  VAL B 61  
AA6 2 LYS B 73  ? PRO B 80  ? LYS B 73  PRO B 80  
AA6 3 ILE B 158 ? LYS B 164 ? ILE B 158 LYS B 164 
AA6 4 VAL B 138 ? LEU B 139 ? VAL B 138 LEU B 139 
AA7 1 ILE B 87  ? ASP B 88  ? ILE B 87  ASP B 88  
AA7 2 TYR B 150 ? LEU B 153 ? TYR B 150 LEU B 153 
AA7 3 VAL B 146 ? ASP B 147 ? VAL B 146 ASP B 147 
AA8 1 VAL B 94  ? LEU B 96  ? VAL B 94  LEU B 96  
AA8 2 THR B 183 ? VAL B 186 ? THR B 183 VAL B 186 
AA8 3 GLY B 194 ? GLU B 197 ? GLY B 194 GLU B 197 
AA9 1 ILE C 55  ? VAL C 57  ? ILE C 55  VAL C 57  
AA9 2 LYS C 73  ? PRO C 80  ? LYS C 73  PRO C 80  
AA9 3 ILE C 158 ? LYS C 164 ? ILE C 158 LYS C 164 
AA9 4 ASN C 133 ? LEU C 139 ? ASN C 133 LEU C 139 
AA9 5 LYS C 106 ? TYR C 107 ? LYS C 106 TYR C 107 
AB1 1 ARG C 93  ? LEU C 96  ? ARG C 93  LEU C 96  
AB1 2 LYS C 181 ? ILE C 187 ? LYS C 181 ILE C 187 
AB1 3 GLY C 194 ? THR C 199 ? GLY C 194 THR C 199 
AB2 1 VAL C 146 ? ASP C 147 ? VAL C 146 ASP C 147 
AB2 2 TYR C 150 ? PRO C 151 ? TYR C 150 PRO C 151 
AB3 1 ILE D 55  ? VAL D 61  ? ILE D 55  VAL D 61  
AB3 2 LYS D 73  ? PRO D 80  ? LYS D 73  PRO D 80  
AB3 3 ILE D 158 ? LYS D 164 ? ILE D 158 LYS D 164 
AB3 4 VAL D 138 ? LEU D 139 ? VAL D 138 LEU D 139 
AB4 1 ILE D 87  ? ASP D 88  ? ILE D 87  ASP D 88  
AB4 2 THR D 152 ? LEU D 153 ? THR D 152 LEU D 153 
AB5 1 THR D 92  ? LEU D 96  ? THR D 92  LEU D 96  
AB5 2 THR D 183 ? PRO D 188 ? THR D 183 PRO D 188 
AB5 3 GLY D 194 ? GLU D 197 ? GLY D 194 GLU D 197 
AB6 1 LYS D 106 ? TYR D 107 ? LYS D 106 TYR D 107 
AB6 2 ASN D 133 ? PHE D 134 ? ASN D 133 PHE D 134 
AB7 1 ILE E 55  ? VAL E 61  ? ILE E 55  VAL E 61  
AB7 2 LYS E 73  ? PRO E 80  ? LYS E 73  PRO E 80  
AB7 3 VAL E 159 ? LYS E 164 ? VAL E 159 LYS E 164 
AB7 4 ASN E 133 ? VAL E 138 ? ASN E 133 VAL E 138 
AB7 5 LYS E 106 ? TYR E 107 ? LYS E 106 TYR E 107 
AB8 1 ILE E 87  ? ASP E 88  ? ILE E 87  ASP E 88  
AB8 2 TYR E 150 ? LEU E 153 ? TYR E 150 LEU E 153 
AB8 3 VAL E 146 ? ASP E 147 ? VAL E 146 ASP E 147 
AB9 1 ARG E 93  ? LEU E 96  ? ARG E 93  LEU E 96  
AB9 2 THR E 183 ? ILE E 187 ? THR E 183 ILE E 187 
AB9 3 GLY E 194 ? GLU E 197 ? GLY E 194 GLU E 197 
AC1 1 ILE F 55  ? VAL F 61  ? ILE F 55  VAL F 61  
AC1 2 LYS F 73  ? PRO F 80  ? LYS F 73  PRO F 80  
AC1 3 VAL F 159 ? LYS F 164 ? VAL F 159 LYS F 164 
AC2 1 ILE F 87  ? ASP F 88  ? ILE F 87  ASP F 88  
AC2 2 TYR F 150 ? LEU F 153 ? TYR F 150 LEU F 153 
AC2 3 VAL F 146 ? ASP F 147 ? VAL F 146 ASP F 147 
AC3 1 ARG F 93  ? SER F 97  ? ARG F 93  SER F 97  
AC3 2 THR F 183 ? ILE F 187 ? THR F 183 ILE F 187 
AC3 3 GLY F 194 ? GLU F 197 ? GLY F 194 GLU F 197 
AC4 1 LYS F 106 ? TYR F 107 ? LYS F 106 TYR F 107 
AC4 2 ASN F 133 ? PHE F 134 ? ASN F 133 PHE F 134 
AC5 1 ILE G 55  ? VAL G 61  ? ILE G 55  VAL G 61  
AC5 2 LYS G 73  ? PRO G 80  ? LYS G 73  PRO G 80  
AC5 3 VAL G 159 ? LYS G 164 ? VAL G 159 LYS G 164 
AC5 4 ASN G 133 ? VAL G 138 ? ASN G 133 VAL G 138 
AC5 5 ALA G 103 ? TYR G 107 ? ALA G 103 TYR G 107 
AC5 6 ARG G 93  ? LEU G 96  ? ARG G 93  LEU G 96  
AC5 7 THR G 183 ? ILE G 187 ? THR G 183 ILE G 187 
AC5 8 GLY G 194 ? GLU G 197 ? GLY G 194 GLU G 197 
AC6 1 ILE G 87  ? ASP G 88  ? ILE G 87  ASP G 88  
AC6 2 TYR G 150 ? LEU G 153 ? TYR G 150 LEU G 153 
AC6 3 VAL G 146 ? ASP G 147 ? VAL G 146 ASP G 147 
AC7 1 ILE H 55  ? VAL H 57  ? ILE H 55  VAL H 57  
AC7 2 ILE H 76  ? PRO H 80  ? ILE H 76  PRO H 80  
AC7 3 VAL H 159 ? THR H 162 ? VAL H 159 THR H 162 
AC7 4 ASN H 133 ? VAL H 138 ? ASN H 133 VAL H 138 
AC7 5 LYS H 106 ? TYR H 107 ? LYS H 106 TYR H 107 
AC8 1 ILE H 87  ? ASP H 88  ? ILE H 87  ASP H 88  
AC8 2 TYR H 150 ? LEU H 153 ? TYR H 150 LEU H 153 
AC8 3 VAL H 146 ? ASP H 147 ? VAL H 146 ASP H 147 
AC9 1 ARG H 93  ? LEU H 96  ? ARG H 93  LEU H 96  
AC9 2 THR H 183 ? ILE H 187 ? THR H 183 ILE H 187 
AC9 3 GLY H 194 ? GLU H 197 ? GLY H 194 GLU H 197 
AD1 1 ILE I 55  ? VAL I 57  ? ILE I 55  VAL I 57  
AD1 2 LYS I 73  ? PRO I 80  ? LYS I 73  PRO I 80  
AD1 3 VAL I 159 ? LYS I 164 ? VAL I 159 LYS I 164 
AD1 4 GLY I 135 ? VAL I 138 ? GLY I 135 VAL I 138 
AD2 1 ILE I 87  ? ASP I 88  ? ILE I 87  ASP I 88  
AD2 2 TYR I 150 ? LEU I 153 ? TYR I 150 LEU I 153 
AD2 3 VAL I 146 ? ASP I 147 ? VAL I 146 ASP I 147 
AD3 1 ARG I 93  ? LEU I 96  ? ARG I 93  LEU I 96  
AD3 2 THR I 183 ? ILE I 187 ? THR I 183 ILE I 187 
AD3 3 GLY I 194 ? GLU I 197 ? GLY I 194 GLU I 197 
AD4 1 ILE J 55  ? VAL J 61  ? ILE J 55  VAL J 61  
AD4 2 LYS J 73  ? PRO J 80  ? LYS J 73  PRO J 80  
AD4 3 VAL J 159 ? LYS J 164 ? VAL J 159 LYS J 164 
AD5 1 ILE J 87  ? ASP J 88  ? ILE J 87  ASP J 88  
AD5 2 TYR J 150 ? LEU J 153 ? TYR J 150 LEU J 153 
AD5 3 VAL J 146 ? ASP J 147 ? VAL J 146 ASP J 147 
AD6 1 ASN J 133 ? PHE J 134 ? ASN J 133 PHE J 134 
AD6 2 ALA J 103 ? TYR J 107 ? ALA J 103 TYR J 107 
AD6 3 ARG J 93  ? LEU J 96  ? ARG J 93  LEU J 96  
AD6 4 LYS J 181 ? ILE J 187 ? LYS J 181 ILE J 187 
AD6 5 GLY J 194 ? THR J 199 ? GLY J 194 THR J 199 
AD7 1 ILE K 55  ? VAL K 61  ? ILE K 55  VAL K 61  
AD7 2 LYS K 73  ? PRO K 80  ? LYS K 73  PRO K 80  
AD7 3 VAL K 159 ? LYS K 164 ? VAL K 159 LYS K 164 
AD8 1 ILE K 87  ? ASP K 88  ? ILE K 87  ASP K 88  
AD8 2 TYR K 150 ? LEU K 153 ? TYR K 150 LEU K 153 
AD8 3 VAL K 146 ? ASP K 147 ? VAL K 146 ASP K 147 
AD9 1 ARG K 93  ? LEU K 96  ? ARG K 93  LEU K 96  
AD9 2 THR K 183 ? ILE K 187 ? THR K 183 ILE K 187 
AD9 3 GLY K 194 ? GLU K 197 ? GLY K 194 GLU K 197 
AE1 1 LYS K 106 ? TYR K 107 ? LYS K 106 TYR K 107 
AE1 2 ASN K 133 ? PHE K 134 ? ASN K 133 PHE K 134 
AE2 1 ILE L 55  ? VAL L 57  ? ILE L 55  VAL L 57  
AE2 2 LYS L 73  ? PRO L 80  ? LYS L 73  PRO L 80  
AE2 3 VAL L 159 ? LYS L 164 ? VAL L 159 LYS L 164 
AE2 4 ASN L 133 ? VAL L 138 ? ASN L 133 VAL L 138 
AE2 5 LYS L 106 ? TYR L 107 ? LYS L 106 TYR L 107 
AE3 1 ILE L 87  ? ASP L 88  ? ILE L 87  ASP L 88  
AE3 2 THR L 152 ? LEU L 153 ? THR L 152 LEU L 153 
AE4 1 ARG L 93  ? LEU L 96  ? ARG L 93  LEU L 96  
AE4 2 THR L 183 ? ILE L 187 ? THR L 183 ILE L 187 
AE4 3 GLY L 194 ? GLU L 197 ? GLY L 194 GLU L 197 
AE5 1 ILE M 55  ? VAL M 57  ? ILE M 55  VAL M 57  
AE5 2 LYS M 73  ? PRO M 80  ? LYS M 73  PRO M 80  
AE5 3 VAL M 159 ? LYS M 164 ? VAL M 159 LYS M 164 
AE5 4 GLY M 135 ? VAL M 138 ? GLY M 135 VAL M 138 
AE6 1 ILE M 87  ? ASP M 88  ? ILE M 87  ASP M 88  
AE6 2 TYR M 150 ? LEU M 153 ? TYR M 150 LEU M 153 
AE6 3 VAL M 146 ? ASP M 147 ? VAL M 146 ASP M 147 
AE7 1 ARG M 93  ? LEU M 96  ? ARG M 93  LEU M 96  
AE7 2 THR M 183 ? ILE M 187 ? THR M 183 ILE M 187 
AE7 3 GLY M 194 ? GLU M 197 ? GLY M 194 GLU M 197 
AE8 1 ILE N 55  ? VAL N 57  ? ILE N 55  VAL N 57  
AE8 2 LYS N 73  ? PRO N 80  ? LYS N 73  PRO N 80  
AE8 3 VAL N 159 ? LYS N 164 ? VAL N 159 LYS N 164 
AE9 1 ILE N 87  ? ASP N 88  ? ILE N 87  ASP N 88  
AE9 2 TYR N 150 ? LEU N 153 ? TYR N 150 LEU N 153 
AE9 3 VAL N 146 ? ASP N 147 ? VAL N 146 ASP N 147 
AF1 1 ARG N 93  ? LEU N 96  ? ARG N 93  LEU N 96  
AF1 2 THR N 183 ? ILE N 187 ? THR N 183 ILE N 187 
AF1 3 GLY N 194 ? GLU N 197 ? GLY N 194 GLU N 197 
AF2 1 LYS N 106 ? TYR N 107 ? LYS N 106 TYR N 107 
AF2 2 ASN N 133 ? PHE N 134 ? ASN N 133 PHE N 134 
AF3 1 ILE O 55  ? VAL O 61  ? ILE O 55  VAL O 61  
AF3 2 LYS O 73  ? PRO O 80  ? LYS O 73  PRO O 80  
AF3 3 ILE O 158 ? LYS O 164 ? ILE O 158 LYS O 164 
AF3 4 VAL O 138 ? LEU O 139 ? VAL O 138 LEU O 139 
AF4 1 ARG O 93  ? LEU O 96  ? ARG O 93  LEU O 96  
AF4 2 THR O 183 ? ILE O 187 ? THR O 183 ILE O 187 
AF4 3 GLY O 194 ? GLU O 197 ? GLY O 194 GLU O 197 
AF5 1 LYS O 106 ? TYR O 107 ? LYS O 106 TYR O 107 
AF5 2 ASN O 133 ? PHE O 134 ? ASN O 133 PHE O 134 
AF6 1 VAL O 146 ? ASP O 147 ? VAL O 146 ASP O 147 
AF6 2 TYR O 150 ? PRO O 151 ? TYR O 150 PRO O 151 
AF7 1 ILE P 55  ? LYS P 56  ? ILE P 55  LYS P 56  
AF7 2 LYS P 73  ? PRO P 80  ? LYS P 73  PRO P 80  
AF7 3 VAL P 159 ? LYS P 164 ? VAL P 159 LYS P 164 
AF8 1 ILE P 87  ? ASP P 88  ? ILE P 87  ASP P 88  
AF8 2 TYR P 150 ? LEU P 153 ? TYR P 150 LEU P 153 
AF8 3 VAL P 146 ? ASP P 147 ? VAL P 146 ASP P 147 
AF9 1 ARG P 93  ? LEU P 96  ? ARG P 93  LEU P 96  
AF9 2 THR P 183 ? ILE P 187 ? THR P 183 ILE P 187 
AF9 3 GLY P 194 ? GLU P 197 ? GLY P 194 GLU P 197 
AG1 1 LYS P 106 ? TYR P 107 ? LYS P 106 TYR P 107 
AG1 2 ASN P 133 ? PHE P 134 ? ASN P 133 PHE P 134 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N LYS A 56  ? N LYS A 56  O SER A 79  ? O SER A 79  
AA1 2 3 N ILE A 78  ? N ILE A 78  O VAL A 159 ? O VAL A 159 
AA2 1 2 N VAL A 95  ? N VAL A 95  O LYS A 185 ? O LYS A 185 
AA2 2 3 N VAL A 186 ? N VAL A 186 O GLY A 194 ? O GLY A 194 
AA3 1 2 N LYS A 106 ? N LYS A 106 O PHE A 134 ? O PHE A 134 
AA4 1 2 N ASP A 147 ? N ASP A 147 O TYR A 150 ? O TYR A 150 
AA5 1 2 N VAL B 61  ? N VAL B 61  O ALA B 75  ? O ALA B 75  
AA5 2 3 N ILE B 78  ? N ILE B 78  O VAL B 159 ? O VAL B 159 
AA5 3 4 O THR B 162 ? O THR B 162 N GLY B 135 ? N GLY B 135 
AA5 4 5 O PHE B 134 ? O PHE B 134 N LYS B 106 ? N LYS B 106 
AA6 1 2 N VAL B 61  ? N VAL B 61  O ALA B 75  ? O ALA B 75  
AA6 2 3 N ILE B 78  ? N ILE B 78  O VAL B 159 ? O VAL B 159 
AA6 3 4 O ILE B 158 ? O ILE B 158 N LEU B 139 ? N LEU B 139 
AA7 1 2 N ILE B 87  ? N ILE B 87  O LEU B 153 ? O LEU B 153 
AA7 2 3 O TYR B 150 ? O TYR B 150 N ASP B 147 ? N ASP B 147 
AA8 1 2 N VAL B 95  ? N VAL B 95  O LYS B 185 ? O LYS B 185 
AA8 2 3 N GLY B 184 ? N GLY B 184 O ILE B 196 ? O ILE B 196 
AA9 1 2 N LYS C 56  ? N LYS C 56  O SER C 79  ? O SER C 79  
AA9 2 3 N ILE C 76  ? N ILE C 76  O ILE C 161 ? O ILE C 161 
AA9 3 4 O THR C 162 ? O THR C 162 N GLY C 135 ? N GLY C 135 
AA9 4 5 O PHE C 134 ? O PHE C 134 N LYS C 106 ? N LYS C 106 
AB1 1 2 N VAL C 95  ? N VAL C 95  O LYS C 185 ? O LYS C 185 
AB1 2 3 N VAL C 186 ? N VAL C 186 O GLY C 194 ? O GLY C 194 
AB2 1 2 N ASP C 147 ? N ASP C 147 O TYR C 150 ? O TYR C 150 
AB3 1 2 N LYS D 56  ? N LYS D 56  O SER D 79  ? O SER D 79  
AB3 2 3 N ILE D 78  ? N ILE D 78  O VAL D 159 ? O VAL D 159 
AB3 3 4 O ILE D 158 ? O ILE D 158 N LEU D 139 ? N LEU D 139 
AB4 1 2 N ILE D 87  ? N ILE D 87  O LEU D 153 ? O LEU D 153 
AB5 1 2 N VAL D 95  ? N VAL D 95  O LYS D 185 ? O LYS D 185 
AB5 2 3 N VAL D 186 ? N VAL D 186 O GLY D 194 ? O GLY D 194 
AB6 1 2 N LYS D 106 ? N LYS D 106 O PHE D 134 ? O PHE D 134 
AB7 1 2 N LYS E 56  ? N LYS E 56  O SER E 79  ? O SER E 79  
AB7 2 3 N ILE E 78  ? N ILE E 78  O VAL E 159 ? O VAL E 159 
AB7 3 4 O THR E 162 ? O THR E 162 N GLY E 135 ? N GLY E 135 
AB7 4 5 O PHE E 134 ? O PHE E 134 N LYS E 106 ? N LYS E 106 
AB8 1 2 N ILE E 87  ? N ILE E 87  O LEU E 153 ? O LEU E 153 
AB8 2 3 O TYR E 150 ? O TYR E 150 N ASP E 147 ? N ASP E 147 
AB9 1 2 N VAL E 95  ? N VAL E 95  O LYS E 185 ? O LYS E 185 
AB9 2 3 N VAL E 186 ? N VAL E 186 O GLY E 194 ? O GLY E 194 
AC1 1 2 N VAL F 61  ? N VAL F 61  O ALA F 75  ? O ALA F 75  
AC1 2 3 N ILE F 76  ? N ILE F 76  O ILE F 161 ? O ILE F 161 
AC2 1 2 N ILE F 87  ? N ILE F 87  O LEU F 153 ? O LEU F 153 
AC2 2 3 O TYR F 150 ? O TYR F 150 N ASP F 147 ? N ASP F 147 
AC3 1 2 N SER F 97  ? N SER F 97  O THR F 183 ? O THR F 183 
AC3 2 3 N GLY F 184 ? N GLY F 184 O ILE F 196 ? O ILE F 196 
AC4 1 2 N LYS F 106 ? N LYS F 106 O PHE F 134 ? O PHE F 134 
AC5 1 2 N VAL G 61  ? N VAL G 61  O ALA G 75  ? O ALA G 75  
AC5 2 3 N ILE G 78  ? N ILE G 78  O VAL G 159 ? O VAL G 159 
AC5 3 4 O THR G 162 ? O THR G 162 N GLY G 135 ? N GLY G 135 
AC5 4 5 O PHE G 134 ? O PHE G 134 N LYS G 106 ? N LYS G 106 
AC5 5 6 O LEU G 105 ? O LEU G 105 N VAL G 94  ? N VAL G 94  
AC5 6 7 N VAL G 95  ? N VAL G 95  O LYS G 185 ? O LYS G 185 
AC5 7 8 N GLY G 184 ? N GLY G 184 O ILE G 196 ? O ILE G 196 
AC6 1 2 N ILE G 87  ? N ILE G 87  O LEU G 153 ? O LEU G 153 
AC6 2 3 O TYR G 150 ? O TYR G 150 N ASP G 147 ? N ASP G 147 
AC7 1 2 N LYS H 56  ? N LYS H 56  O SER H 79  ? O SER H 79  
AC7 2 3 N ILE H 78  ? N ILE H 78  O VAL H 159 ? O VAL H 159 
AC7 3 4 O THR H 162 ? O THR H 162 N GLY H 135 ? N GLY H 135 
AC7 4 5 O PHE H 134 ? O PHE H 134 N LYS H 106 ? N LYS H 106 
AC8 1 2 N ILE H 87  ? N ILE H 87  O LEU H 153 ? O LEU H 153 
AC8 2 3 O TYR H 150 ? O TYR H 150 N ASP H 147 ? N ASP H 147 
AC9 1 2 N VAL H 95  ? N VAL H 95  O LYS H 185 ? O LYS H 185 
AC9 2 3 N VAL H 186 ? N VAL H 186 O GLY H 194 ? O GLY H 194 
AD1 1 2 N LYS I 56  ? N LYS I 56  O SER I 79  ? O SER I 79  
AD1 2 3 N ILE I 78  ? N ILE I 78  O VAL I 159 ? O VAL I 159 
AD1 3 4 O THR I 162 ? O THR I 162 N GLY I 135 ? N GLY I 135 
AD2 1 2 N ILE I 87  ? N ILE I 87  O LEU I 153 ? O LEU I 153 
AD2 2 3 O TYR I 150 ? O TYR I 150 N ASP I 147 ? N ASP I 147 
AD3 1 2 N VAL I 95  ? N VAL I 95  O LYS I 185 ? O LYS I 185 
AD3 2 3 N GLY I 184 ? N GLY I 184 O ILE I 196 ? O ILE I 196 
AD4 1 2 N LYS J 56  ? N LYS J 56  O SER J 79  ? O SER J 79  
AD4 2 3 N ILE J 76  ? N ILE J 76  O ILE J 161 ? O ILE J 161 
AD5 1 2 N ILE J 87  ? N ILE J 87  O LEU J 153 ? O LEU J 153 
AD5 2 3 O TYR J 150 ? O TYR J 150 N ASP J 147 ? N ASP J 147 
AD6 1 2 O PHE J 134 ? O PHE J 134 N LYS J 106 ? N LYS J 106 
AD6 2 3 O ALA J 103 ? O ALA J 103 N LEU J 96  ? N LEU J 96  
AD6 3 4 N VAL J 95  ? N VAL J 95  O LYS J 185 ? O LYS J 185 
AD6 4 5 N VAL J 186 ? N VAL J 186 O GLY J 194 ? O GLY J 194 
AD7 1 2 N LYS K 56  ? N LYS K 56  O SER K 79  ? O SER K 79  
AD7 2 3 N ILE K 76  ? N ILE K 76  O ILE K 161 ? O ILE K 161 
AD8 1 2 N ILE K 87  ? N ILE K 87  O LEU K 153 ? O LEU K 153 
AD8 2 3 O TYR K 150 ? O TYR K 150 N ASP K 147 ? N ASP K 147 
AD9 1 2 N VAL K 95  ? N VAL K 95  O LYS K 185 ? O LYS K 185 
AD9 2 3 N VAL K 186 ? N VAL K 186 O GLY K 194 ? O GLY K 194 
AE1 1 2 N LYS K 106 ? N LYS K 106 O PHE K 134 ? O PHE K 134 
AE2 1 2 N LYS L 56  ? N LYS L 56  O SER L 79  ? O SER L 79  
AE2 2 3 N ILE L 78  ? N ILE L 78  O VAL L 159 ? O VAL L 159 
AE2 3 4 O THR L 162 ? O THR L 162 N GLY L 135 ? N GLY L 135 
AE2 4 5 O PHE L 134 ? O PHE L 134 N LYS L 106 ? N LYS L 106 
AE3 1 2 N ILE L 87  ? N ILE L 87  O LEU L 153 ? O LEU L 153 
AE4 1 2 N VAL L 95  ? N VAL L 95  O LYS L 185 ? O LYS L 185 
AE4 2 3 N VAL L 186 ? N VAL L 186 O GLY L 194 ? O GLY L 194 
AE5 1 2 N LYS M 56  ? N LYS M 56  O SER M 79  ? O SER M 79  
AE5 2 3 N ILE M 78  ? N ILE M 78  O VAL M 159 ? O VAL M 159 
AE5 3 4 O THR M 162 ? O THR M 162 N GLY M 135 ? N GLY M 135 
AE6 1 2 N ILE M 87  ? N ILE M 87  O LEU M 153 ? O LEU M 153 
AE6 2 3 O TYR M 150 ? O TYR M 150 N ASP M 147 ? N ASP M 147 
AE7 1 2 N VAL M 95  ? N VAL M 95  O LYS M 185 ? O LYS M 185 
AE7 2 3 N GLY M 184 ? N GLY M 184 O ILE M 196 ? O ILE M 196 
AE8 1 2 N LYS N 56  ? N LYS N 56  O SER N 79  ? O SER N 79  
AE8 2 3 N ILE N 76  ? N ILE N 76  O ILE N 161 ? O ILE N 161 
AE9 1 2 N ILE N 87  ? N ILE N 87  O LEU N 153 ? O LEU N 153 
AE9 2 3 O TYR N 150 ? O TYR N 150 N ASP N 147 ? N ASP N 147 
AF1 1 2 N VAL N 95  ? N VAL N 95  O LYS N 185 ? O LYS N 185 
AF1 2 3 N GLY N 184 ? N GLY N 184 O ILE N 196 ? O ILE N 196 
AF2 1 2 N LYS N 106 ? N LYS N 106 O PHE N 134 ? O PHE N 134 
AF3 1 2 N VAL O 61  ? N VAL O 61  O ALA O 75  ? O ALA O 75  
AF3 2 3 N ILE O 78  ? N ILE O 78  O VAL O 159 ? O VAL O 159 
AF3 3 4 O ILE O 158 ? O ILE O 158 N LEU O 139 ? N LEU O 139 
AF4 1 2 N VAL O 95  ? N VAL O 95  O LYS O 185 ? O LYS O 185 
AF4 2 3 N VAL O 186 ? N VAL O 186 O GLY O 194 ? O GLY O 194 
AF5 1 2 N LYS O 106 ? N LYS O 106 O PHE O 134 ? O PHE O 134 
AF6 1 2 N ASP O 147 ? N ASP O 147 O TYR O 150 ? O TYR O 150 
AF7 1 2 N LYS P 56  ? N LYS P 56  O SER P 79  ? O SER P 79  
AF7 2 3 N ILE P 76  ? N ILE P 76  O ILE P 161 ? O ILE P 161 
AF8 1 2 N ILE P 87  ? N ILE P 87  O LEU P 153 ? O LEU P 153 
AF8 2 3 O TYR P 150 ? O TYR P 150 N ASP P 147 ? N ASP P 147 
AF9 1 2 N VAL P 95  ? N VAL P 95  O LYS P 185 ? O LYS P 185 
AF9 2 3 N VAL P 186 ? N VAL P 186 O GLY P 194 ? O GLY P 194 
AG1 1 2 N LYS P 106 ? N LYS P 106 O PHE P 134 ? O PHE P 134 
# 
_atom_sites.entry_id                    5O4U 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N   . ALA A 1 6   ? 107.023 108.324 186.334 1.00 30.00  ? 6   ALA A N   1 
ATOM 2     C CA  . ALA A 1 6   ? 108.457 108.410 186.090 1.00 30.00  ? 6   ALA A CA  1 
ATOM 3     C C   . ALA A 1 6   ? 108.743 108.560 184.601 1.00 30.00  ? 6   ALA A C   1 
ATOM 4     O O   . ALA A 1 6   ? 107.831 108.505 183.778 1.00 30.00  ? 6   ALA A O   1 
ATOM 5     C CB  . ALA A 1 6   ? 109.159 107.192 186.647 1.00 30.00  ? 6   ALA A CB  1 
ATOM 6     N N   . VAL A 1 7   ? 110.022 108.717 184.260 1.00 176.07 ? 7   VAL A N   1 
ATOM 7     C CA  . VAL A 1 7   ? 110.435 109.059 182.903 1.00 158.44 ? 7   VAL A CA  1 
ATOM 8     C C   . VAL A 1 7   ? 110.507 107.766 182.096 1.00 137.52 ? 7   VAL A C   1 
ATOM 9     O O   . VAL A 1 7   ? 110.483 107.776 180.859 1.00 139.74 ? 7   VAL A O   1 
ATOM 10    C CB  . VAL A 1 7   ? 111.771 109.833 182.940 1.00 30.00  ? 7   VAL A CB  1 
ATOM 11    C CG1 . VAL A 1 7   ? 112.223 110.322 181.568 1.00 30.00  ? 7   VAL A CG1 1 
ATOM 12    C CG2 . VAL A 1 7   ? 111.641 111.010 183.867 1.00 30.00  ? 7   VAL A CG2 1 
ATOM 13    N N   . GLY A 1 8   ? 110.494 106.631 182.791 1.00 131.64 ? 8   GLY A N   1 
ATOM 14    C CA  . GLY A 1 8   ? 110.346 105.364 182.104 1.00 139.85 ? 8   GLY A CA  1 
ATOM 15    C C   . GLY A 1 8   ? 108.986 105.129 181.475 1.00 132.89 ? 8   GLY A C   1 
ATOM 16    O O   . GLY A 1 8   ? 108.851 104.240 180.632 1.00 133.27 ? 8   GLY A O   1 
ATOM 17    N N   . ILE A 1 9   ? 107.981 105.912 181.857 1.00 131.26 ? 9   ILE A N   1 
ATOM 18    C CA  . ILE A 1 9   ? 106.645 105.750 181.299 1.00 135.93 ? 9   ILE A CA  1 
ATOM 19    C C   . ILE A 1 9   ? 106.453 106.683 180.109 1.00 126.64 ? 9   ILE A C   1 
ATOM 20    O O   . ILE A 1 9   ? 105.815 106.320 179.108 1.00 121.41 ? 9   ILE A O   1 
ATOM 21    C CB  . ILE A 1 9   ? 105.590 105.981 182.404 1.00 30.00  ? 9   ILE A CB  1 
ATOM 22    C CG1 . ILE A 1 9   ? 105.690 104.919 183.511 1.00 30.00  ? 9   ILE A CG1 1 
ATOM 23    C CG2 . ILE A 1 9   ? 104.175 105.967 181.853 1.00 30.00  ? 9   ILE A CG2 1 
ATOM 24    C CD1 . ILE A 1 9   ? 106.514 105.301 184.736 1.00 30.00  ? 9   ILE A CD1 1 
ATOM 25    N N   . GLY A 1 10  ? 107.052 107.877 180.181 1.00 116.23 ? 10  GLY A N   1 
ATOM 26    C CA  . GLY A 1 10  ? 106.846 108.891 179.161 1.00 108.48 ? 10  GLY A CA  1 
ATOM 27    C C   . GLY A 1 10  ? 107.414 108.530 177.804 1.00 119.42 ? 10  GLY A C   1 
ATOM 28    O O   . GLY A 1 10  ? 106.801 108.827 176.778 1.00 124.33 ? 10  GLY A O   1 
ATOM 29    N N   . THR A 1 11  ? 108.571 107.866 177.773 1.00 133.79 ? 11  THR A N   1 
ATOM 30    C CA  . THR A 1 11  ? 109.112 107.418 176.495 1.00 134.97 ? 11  THR A CA  1 
ATOM 31    C C   . THR A 1 11  ? 108.345 106.223 175.948 1.00 126.74 ? 11  THR A C   1 
ATOM 32    O O   . THR A 1 11  ? 108.402 105.951 174.745 1.00 132.88 ? 11  THR A O   1 
ATOM 33    C CB  . THR A 1 11  ? 110.590 107.072 176.634 1.00 30.00  ? 11  THR A CB  1 
ATOM 34    O OG1 . THR A 1 11  ? 110.740 106.015 177.587 1.00 30.00  ? 11  THR A OG1 1 
ATOM 35    C CG2 . THR A 1 11  ? 111.366 108.283 177.103 1.00 30.00  ? 11  THR A CG2 1 
ATOM 36    N N   . LEU A 1 12  ? 107.631 105.495 176.809 1.00 118.09 ? 12  LEU A N   1 
ATOM 37    C CA  . LEU A 1 12  ? 106.748 104.441 176.324 1.00 128.80 ? 12  LEU A CA  1 
ATOM 38    C C   . LEU A 1 12  ? 105.499 105.028 175.680 1.00 127.81 ? 12  LEU A C   1 
ATOM 39    O O   . LEU A 1 12  ? 105.050 104.555 174.631 1.00 112.49 ? 12  LEU A O   1 
ATOM 40    C CB  . LEU A 1 12  ? 106.370 103.497 177.463 1.00 30.00  ? 12  LEU A CB  1 
ATOM 41    C CG  . LEU A 1 12  ? 107.494 102.654 178.053 1.00 30.00  ? 12  LEU A CG  1 
ATOM 42    C CD1 . LEU A 1 12  ? 106.972 101.838 179.220 1.00 30.00  ? 12  LEU A CD1 1 
ATOM 43    C CD2 . LEU A 1 12  ? 108.086 101.756 176.988 1.00 30.00  ? 12  LEU A CD2 1 
ATOM 44    N N   . ILE A 1 13  ? 104.918 106.058 176.300 1.00 134.37 ? 13  ILE A N   1 
ATOM 45    C CA  . ILE A 1 13  ? 103.706 106.653 175.745 1.00 120.65 ? 13  ILE A CA  1 
ATOM 46    C C   . ILE A 1 13  ? 104.029 107.455 174.486 1.00 125.25 ? 13  ILE A C   1 
ATOM 47    O O   . ILE A 1 13  ? 103.281 107.415 173.500 1.00 127.06 ? 13  ILE A O   1 
ATOM 48    C CB  . ILE A 1 13  ? 102.998 107.497 176.820 1.00 30.00  ? 13  ILE A CB  1 
ATOM 49    C CG1 . ILE A 1 13  ? 102.588 106.600 177.987 1.00 30.00  ? 13  ILE A CG1 1 
ATOM 50    C CG2 . ILE A 1 13  ? 101.766 108.187 176.262 1.00 30.00  ? 13  ILE A CG2 1 
ATOM 51    C CD1 . ILE A 1 13  ? 102.008 107.346 179.155 1.00 30.00  ? 13  ILE A CD1 1 
ATOM 52    N N   . VAL A 1 14  ? 105.165 108.161 174.482 1.00 120.61 ? 14  VAL A N   1 
ATOM 53    C CA  . VAL A 1 14  ? 105.642 108.825 173.268 1.00 119.27 ? 14  VAL A CA  1 
ATOM 54    C C   . VAL A 1 14  ? 106.036 107.794 172.213 1.00 125.86 ? 14  VAL A C   1 
ATOM 55    O O   . VAL A 1 14  ? 105.839 108.017 171.010 1.00 127.57 ? 14  VAL A O   1 
ATOM 56    C CB  . VAL A 1 14  ? 106.793 109.791 173.624 1.00 30.00  ? 14  VAL A CB  1 
ATOM 57    C CG1 . VAL A 1 14  ? 107.513 110.319 172.391 1.00 30.00  ? 14  VAL A CG1 1 
ATOM 58    C CG2 . VAL A 1 14  ? 106.244 110.975 174.398 1.00 30.00  ? 14  VAL A CG2 1 
ATOM 59    N N   . PHE A 1 15  ? 106.539 106.634 172.646 1.00 120.93 ? 15  PHE A N   1 
ATOM 60    C CA  . PHE A 1 15  ? 106.828 105.538 171.724 1.00 130.25 ? 15  PHE A CA  1 
ATOM 61    C C   . PHE A 1 15  ? 105.570 105.027 171.030 1.00 137.12 ? 15  PHE A C   1 
ATOM 62    O O   . PHE A 1 15  ? 105.563 104.855 169.807 1.00 136.10 ? 15  PHE A O   1 
ATOM 63    C CB  . PHE A 1 15  ? 107.532 104.409 172.473 1.00 30.00  ? 15  PHE A CB  1 
ATOM 64    C CG  . PHE A 1 15  ? 107.634 103.135 171.696 1.00 30.00  ? 15  PHE A CG  1 
ATOM 65    C CD1 . PHE A 1 15  ? 108.464 103.036 170.591 1.00 30.00  ? 15  PHE A CD1 1 
ATOM 66    C CD2 . PHE A 1 15  ? 106.921 102.015 172.101 1.00 30.00  ? 15  PHE A CD2 1 
ATOM 67    C CE1 . PHE A 1 15  ? 108.554 101.849 169.887 1.00 30.00  ? 15  PHE A CE1 1 
ATOM 68    C CE2 . PHE A 1 15  ? 107.013 100.826 171.404 1.00 30.00  ? 15  PHE A CE2 1 
ATOM 69    C CZ  . PHE A 1 15  ? 107.831 100.742 170.294 1.00 30.00  ? 15  PHE A CZ  1 
ATOM 70    N N   . ILE A 1 16  ? 104.490 104.810 171.789 1.00 132.37 ? 16  ILE A N   1 
ATOM 71    C CA  . ILE A 1 16  ? 103.212 104.404 171.202 1.00 131.31 ? 16  ILE A CA  1 
ATOM 72    C C   . ILE A 1 16  ? 102.658 105.504 170.302 1.00 126.36 ? 16  ILE A C   1 
ATOM 73    O O   . ILE A 1 16  ? 102.112 105.224 169.223 1.00 114.96 ? 16  ILE A O   1 
ATOM 74    C CB  . ILE A 1 16  ? 102.224 104.022 172.324 1.00 30.00  ? 16  ILE A CB  1 
ATOM 75    C CG1 . ILE A 1 16  ? 102.744 102.819 173.104 1.00 30.00  ? 16  ILE A CG1 1 
ATOM 76    C CG2 . ILE A 1 16  ? 100.851 103.691 171.775 1.00 30.00  ? 16  ILE A CG2 1 
ATOM 77    C CD1 . ILE A 1 16  ? 101.952 102.523 174.349 1.00 30.00  ? 16  ILE A CD1 1 
ATOM 78    N N   . ALA A 1 17  ? 102.849 106.766 170.700 1.00 123.07 ? 17  ALA A N   1 
ATOM 79    C CA  . ALA A 1 17  ? 102.353 107.899 169.926 1.00 113.60 ? 17  ALA A CA  1 
ATOM 80    C C   . ALA A 1 17  ? 103.037 107.998 168.571 1.00 122.78 ? 17  ALA A C   1 
ATOM 81    O O   . ALA A 1 17  ? 102.372 108.124 167.539 1.00 135.51 ? 17  ALA A O   1 
ATOM 82    C CB  . ALA A 1 17  ? 102.553 109.189 170.714 1.00 30.00  ? 17  ALA A CB  1 
ATOM 83    N N   . MET A 1 18  ? 104.363 107.921 168.548 1.00 110.98 ? 18  MET A N   1 
ATOM 84    C CA  . MET A 1 18  ? 105.073 108.052 167.287 1.00 128.27 ? 18  MET A CA  1 
ATOM 85    C C   . MET A 1 18  ? 104.991 106.775 166.456 1.00 133.84 ? 18  MET A C   1 
ATOM 86    O O   . MET A 1 18  ? 105.140 106.837 165.231 1.00 141.63 ? 18  MET A O   1 
ATOM 87    C CB  . MET A 1 18  ? 106.523 108.461 167.563 1.00 30.00  ? 18  MET A CB  1 
ATOM 88    C CG  . MET A 1 18  ? 107.320 108.884 166.344 1.00 30.00  ? 18  MET A CG  1 
ATOM 89    S SD  . MET A 1 18  ? 108.952 109.497 166.750 1.00 30.00  ? 18  MET A SD  1 
ATOM 90    C CE  . MET A 1 18  ? 109.584 109.750 165.099 1.00 30.00  ? 18  MET A CE  1 
ATOM 91    N N   . VAL A 1 19  ? 104.738 105.624 167.086 1.00 128.57 ? 19  VAL A N   1 
ATOM 92    C CA  . VAL A 1 19  ? 104.400 104.432 166.310 1.00 124.82 ? 19  VAL A CA  1 
ATOM 93    C C   . VAL A 1 19  ? 103.075 104.625 165.579 1.00 121.88 ? 19  VAL A C   1 
ATOM 94    O O   . VAL A 1 19  ? 102.964 104.309 164.389 1.00 114.40 ? 19  VAL A O   1 
ATOM 95    C CB  . VAL A 1 19  ? 104.401 103.180 167.211 1.00 30.00  ? 19  VAL A CB  1 
ATOM 96    C CG1 . VAL A 1 19  ? 103.652 102.028 166.567 1.00 30.00  ? 19  VAL A CG1 1 
ATOM 97    C CG2 . VAL A 1 19  ? 105.826 102.719 167.431 1.00 30.00  ? 19  VAL A CG2 1 
ATOM 98    N N   . LEU A 1 20  ? 102.068 105.196 166.252 1.00 123.94 ? 20  LEU A N   1 
ATOM 99    C CA  . LEU A 1 20  ? 100.776 105.399 165.593 1.00 120.76 ? 20  LEU A CA  1 
ATOM 100   C C   . LEU A 1 20  ? 100.818 106.520 164.558 1.00 118.82 ? 20  LEU A C   1 
ATOM 101   O O   . LEU A 1 20  ? 100.151 106.424 163.520 1.00 128.24 ? 20  LEU A O   1 
ATOM 102   C CB  . LEU A 1 20  ? 99.697  105.676 166.632 1.00 30.00  ? 20  LEU A CB  1 
ATOM 103   C CG  . LEU A 1 20  ? 99.381  104.459 167.489 1.00 30.00  ? 20  LEU A CG  1 
ATOM 104   C CD1 . LEU A 1 20  ? 98.421  104.829 168.595 1.00 30.00  ? 20  LEU A CD1 1 
ATOM 105   C CD2 . LEU A 1 20  ? 98.799  103.368 166.617 1.00 30.00  ? 20  LEU A CD2 1 
ATOM 106   N N   . VAL A 1 21  ? 101.586 107.582 164.815 1.00 118.89 ? 21  VAL A N   1 
ATOM 107   C CA  . VAL A 1 21  ? 101.758 108.636 163.820 1.00 124.09 ? 21  VAL A CA  1 
ATOM 108   C C   . VAL A 1 21  ? 102.596 108.127 162.650 1.00 132.71 ? 21  VAL A C   1 
ATOM 109   O O   . VAL A 1 21  ? 102.402 108.545 161.501 1.00 133.89 ? 21  VAL A O   1 
ATOM 110   C CB  . VAL A 1 21  ? 102.344 109.890 164.502 1.00 30.00  ? 21  VAL A CB  1 
ATOM 111   C CG1 . VAL A 1 21  ? 102.716 110.984 163.510 1.00 30.00  ? 21  VAL A CG1 1 
ATOM 112   C CG2 . VAL A 1 21  ? 101.320 110.445 165.463 1.00 30.00  ? 21  VAL A CG2 1 
ATOM 113   N N   . ALA A 1 22  ? 103.486 107.171 162.904 1.00 119.64 ? 22  ALA A N   1 
ATOM 114   C CA  . ALA A 1 22  ? 104.177 106.501 161.811 1.00 121.63 ? 22  ALA A CA  1 
ATOM 115   C C   . ALA A 1 22  ? 103.221 105.624 161.013 1.00 121.50 ? 22  ALA A C   1 
ATOM 116   O O   . ALA A 1 22  ? 103.308 105.561 159.781 1.00 124.27 ? 22  ALA A O   1 
ATOM 117   C CB  . ALA A 1 22  ? 105.332 105.672 162.360 1.00 30.00  ? 22  ALA A CB  1 
ATOM 118   N N   . ALA A 1 23  ? 102.289 104.960 161.695 1.00 123.64 ? 23  ALA A N   1 
ATOM 119   C CA  . ALA A 1 23  ? 101.344 104.075 161.031 1.00 136.43 ? 23  ALA A CA  1 
ATOM 120   C C   . ALA A 1 23  ? 100.268 104.832 160.272 1.00 124.63 ? 23  ALA A C   1 
ATOM 121   O O   . ALA A 1 23  ? 99.649  104.255 159.373 1.00 135.97 ? 23  ALA A O   1 
ATOM 122   C CB  . ALA A 1 23  ? 100.689 103.135 162.044 1.00 30.00  ? 23  ALA A CB  1 
ATOM 123   N N   . VAL A 1 24  ? 100.021 106.098 160.611 1.00 119.23 ? 24  VAL A N   1 
ATOM 124   C CA  . VAL A 1 24  ? 99.148  106.921 159.783 1.00 115.14 ? 24  VAL A CA  1 
ATOM 125   C C   . VAL A 1 24  ? 99.941  107.711 158.750 1.00 115.95 ? 24  VAL A C   1 
ATOM 126   O O   . VAL A 1 24  ? 99.364  108.136 157.738 1.00 121.87 ? 24  VAL A O   1 
ATOM 127   C CB  . VAL A 1 24  ? 98.268  107.863 160.631 1.00 30.00  ? 24  VAL A CB  1 
ATOM 128   C CG1 . VAL A 1 24  ? 97.450  107.064 161.639 1.00 30.00  ? 24  VAL A CG1 1 
ATOM 129   C CG2 . VAL A 1 24  ? 99.090  108.928 161.305 1.00 30.00  ? 24  VAL A CG2 1 
ATOM 130   N N   . ALA A 1 25  ? 101.248 107.891 158.954 1.00 113.08 ? 25  ALA A N   1 
ATOM 131   C CA  . ALA A 1 25  ? 102.121 108.325 157.873 1.00 132.88 ? 25  ALA A CA  1 
ATOM 132   C C   . ALA A 1 25  ? 102.277 107.239 156.823 1.00 125.56 ? 25  ALA A C   1 
ATOM 133   O O   . ALA A 1 25  ? 102.630 107.540 155.680 1.00 130.11 ? 25  ALA A O   1 
ATOM 134   C CB  . ALA A 1 25  ? 103.488 108.721 158.422 1.00 30.00  ? 25  ALA A CB  1 
ATOM 135   N N   . ALA A 1 26  ? 102.034 105.984 157.201 1.00 112.05 ? 26  ALA A N   1 
ATOM 136   C CA  . ALA A 1 26  ? 101.845 104.894 156.260 1.00 121.96 ? 26  ALA A CA  1 
ATOM 137   C C   . ALA A 1 26  ? 100.419 104.801 155.745 1.00 122.57 ? 26  ALA A C   1 
ATOM 138   O O   . ALA A 1 26  ? 100.223 104.559 154.551 1.00 124.18 ? 26  ALA A O   1 
ATOM 139   C CB  . ALA A 1 26  ? 102.216 103.560 156.916 1.00 30.00  ? 26  ALA A CB  1 
ATOM 140   N N   . ALA A 1 27  ? 99.425  105.012 156.606 1.00 120.74 ? 27  ALA A N   1 
ATOM 141   C CA  . ALA A 1 27  ? 98.030  104.877 156.212 1.00 112.14 ? 27  ALA A CA  1 
ATOM 142   C C   . ALA A 1 27  ? 97.533  106.033 155.356 1.00 126.27 ? 27  ALA A C   1 
ATOM 143   O O   . ALA A 1 27  ? 96.418  105.954 154.832 1.00 129.46 ? 27  ALA A O   1 
ATOM 144   C CB  . ALA A 1 27  ? 97.144  104.739 157.449 1.00 30.00  ? 27  ALA A CB  1 
ATOM 145   N N   . VAL A 1 28  ? 98.308  107.103 155.213 1.00 128.89 ? 28  VAL A N   1 
ATOM 146   C CA  . VAL A 1 28  ? 98.027  108.134 154.226 1.00 113.05 ? 28  VAL A CA  1 
ATOM 147   C C   . VAL A 1 28  ? 98.824  107.917 152.949 1.00 121.90 ? 28  VAL A C   1 
ATOM 148   O O   . VAL A 1 28  ? 98.270  107.961 151.852 1.00 122.20 ? 28  VAL A O   1 
ATOM 149   C CB  . VAL A 1 28  ? 98.303  109.529 154.821 1.00 30.00  ? 28  VAL A CB  1 
ATOM 150   C CG1 . VAL A 1 28  ? 98.227  110.592 153.750 1.00 30.00  ? 28  VAL A CG1 1 
ATOM 151   C CG2 . VAL A 1 28  ? 97.294  109.833 155.885 1.00 30.00  ? 28  VAL A CG2 1 
ATOM 152   N N   . LEU A 1 29  ? 100.119 107.643 153.082 1.00 114.96 ? 29  LEU A N   1 
ATOM 153   C CA  . LEU A 1 29  ? 101.007 107.631 151.928 1.00 129.81 ? 29  LEU A CA  1 
ATOM 154   C C   . LEU A 1 29  ? 100.800 106.370 151.093 1.00 140.90 ? 29  LEU A C   1 
ATOM 155   O O   . LEU A 1 29  ? 100.705 106.444 149.857 1.00 135.21 ? 29  LEU A O   1 
ATOM 156   C CB  . LEU A 1 29  ? 102.451 107.762 152.421 1.00 30.00  ? 29  LEU A CB  1 
ATOM 157   C CG  . LEU A 1 29  ? 103.601 108.309 151.572 1.00 30.00  ? 29  LEU A CG  1 
ATOM 158   C CD1 . LEU A 1 29  ? 104.652 108.868 152.508 1.00 30.00  ? 29  LEU A CD1 1 
ATOM 159   C CD2 . LEU A 1 29  ? 104.224 107.282 150.679 1.00 30.00  ? 29  LEU A CD2 1 
ATOM 160   N N   . ILE A 1 30  ? 100.697 105.216 151.763 1.00 133.11 ? 30  ILE A N   1 
ATOM 161   C CA  . ILE A 1 30  ? 100.375 103.954 151.097 1.00 124.38 ? 30  ILE A CA  1 
ATOM 162   C C   . ILE A 1 30  ? 99.000  104.025 150.443 1.00 127.80 ? 30  ILE A C   1 
ATOM 163   O O   . ILE A 1 30  ? 98.813  103.569 149.310 1.00 124.15 ? 30  ILE A O   1 
ATOM 164   C CB  . ILE A 1 30  ? 100.466 102.788 152.103 1.00 30.00  ? 30  ILE A CB  1 
ATOM 165   C CG1 . ILE A 1 30  ? 101.901 102.599 152.588 1.00 30.00  ? 30  ILE A CG1 1 
ATOM 166   C CG2 . ILE A 1 30  ? 99.960  101.482 151.507 1.00 30.00  ? 30  ILE A CG2 1 
ATOM 167   C CD1 . ILE A 1 30  ? 102.017 101.601 153.715 1.00 30.00  ? 30  ILE A CD1 1 
ATOM 168   N N   . GLN A 1 31  ? 98.028  104.631 151.129 1.00 132.79 ? 31  GLN A N   1 
ATOM 169   C CA  . GLN A 1 31  ? 96.659  104.650 150.625 1.00 126.31 ? 31  GLN A CA  1 
ATOM 170   C C   . GLN A 1 31  ? 96.492  105.598 149.442 1.00 126.39 ? 31  GLN A C   1 
ATOM 171   O O   . GLN A 1 31  ? 95.884  105.221 148.436 1.00 134.06 ? 31  GLN A O   1 
ATOM 172   C CB  . GLN A 1 31  ? 95.693  105.026 151.746 1.00 30.00  ? 31  GLN A CB  1 
ATOM 173   C CG  . GLN A 1 31  ? 94.236  105.001 151.337 1.00 30.00  ? 31  GLN A CG  1 
ATOM 174   C CD  . GLN A 1 31  ? 93.309  105.351 152.478 1.00 30.00  ? 31  GLN A CD  1 
ATOM 175   O OE1 . GLN A 1 31  ? 93.753  105.629 153.589 1.00 30.00  ? 31  GLN A OE1 1 
ATOM 176   N NE2 . GLN A 1 31  ? 92.011  105.349 152.208 1.00 30.00  ? 31  GLN A NE2 1 
ATOM 177   N N   . THR A 1 32  ? 97.019  106.825 149.538 1.00 112.61 ? 32  THR A N   1 
ATOM 178   C CA  . THR A 1 32  ? 96.945  107.769 148.425 1.00 127.34 ? 32  THR A CA  1 
ATOM 179   C C   . THR A 1 32  ? 97.788  107.326 147.241 1.00 131.45 ? 32  THR A C   1 
ATOM 180   O O   . THR A 1 32  ? 97.443  107.627 146.089 1.00 120.85 ? 32  THR A O   1 
ATOM 181   C CB  . THR A 1 32  ? 97.375  109.166 148.870 1.00 30.00  ? 32  THR A CB  1 
ATOM 182   O OG1 . THR A 1 32  ? 98.672  109.102 149.475 1.00 30.00  ? 32  THR A OG1 1 
ATOM 183   C CG2 . THR A 1 32  ? 96.367  109.751 149.844 1.00 30.00  ? 32  THR A CG2 1 
ATOM 184   N N   . SER A 1 33  ? 98.879  106.598 147.497 1.00 130.67 ? 33  SER A N   1 
ATOM 185   C CA  . SER A 1 33  ? 99.481  105.814 146.426 1.00 132.42 ? 33  SER A CA  1 
ATOM 186   C C   . SER A 1 33  ? 98.497  104.776 145.900 1.00 131.30 ? 33  SER A C   1 
ATOM 187   O O   . SER A 1 33  ? 98.476  104.500 144.694 1.00 133.84 ? 33  SER A O   1 
ATOM 188   C CB  . SER A 1 33  ? 100.760 105.150 146.922 1.00 30.00  ? 33  SER A CB  1 
ATOM 189   O OG  . SER A 1 33  ? 101.709 106.134 147.292 1.00 30.00  ? 33  SER A OG  1 
ATOM 190   N N   . GLY A 1 34  ? 97.649  104.239 146.786 1.00 129.56 ? 34  GLY A N   1 
ATOM 191   C CA  . GLY A 1 34  ? 96.543  103.394 146.364 1.00 121.87 ? 34  GLY A CA  1 
ATOM 192   C C   . GLY A 1 34  ? 95.575  104.099 145.435 1.00 127.99 ? 34  GLY A C   1 
ATOM 193   O O   . GLY A 1 34  ? 94.981  103.473 144.554 1.00 136.74 ? 34  GLY A O   1 
ATOM 194   N N   . TYR A 1 35  ? 95.409  105.410 145.610 1.00 111.57 ? 35  TYR A N   1 
ATOM 195   C CA  . TYR A 1 35  ? 94.679  106.179 144.613 1.00 115.71 ? 35  TYR A CA  1 
ATOM 196   C C   . TYR A 1 35  ? 95.494  106.326 143.337 1.00 122.18 ? 35  TYR A C   1 
ATOM 197   O O   . TYR A 1 35  ? 94.929  106.384 142.239 1.00 127.53 ? 35  TYR A O   1 
ATOM 198   C CB  . TYR A 1 35  ? 94.290  107.547 145.170 1.00 30.00  ? 35  TYR A CB  1 
ATOM 199   C CG  . TYR A 1 35  ? 93.550  108.391 144.167 1.00 30.00  ? 35  TYR A CG  1 
ATOM 200   C CD1 . TYR A 1 35  ? 92.234  108.113 143.841 1.00 30.00  ? 35  TYR A CD1 1 
ATOM 201   C CD2 . TYR A 1 35  ? 94.171  109.458 143.535 1.00 30.00  ? 35  TYR A CD2 1 
ATOM 202   C CE1 . TYR A 1 35  ? 91.554  108.875 142.915 1.00 30.00  ? 35  TYR A CE1 1 
ATOM 203   C CE2 . TYR A 1 35  ? 93.502  110.222 142.610 1.00 30.00  ? 35  TYR A CE2 1 
ATOM 204   C CZ  . TYR A 1 35  ? 92.195  109.931 142.306 1.00 30.00  ? 35  TYR A CZ  1 
ATOM 205   O OH  . TYR A 1 35  ? 91.524  110.699 141.384 1.00 30.00  ? 35  TYR A OH  1 
ATOM 206   N N   . LEU A 1 36  ? 96.821  106.374 143.453 1.00 116.21 ? 36  LEU A N   1 
ATOM 207   C CA  . LEU A 1 36  ? 97.642  106.600 142.269 1.00 130.01 ? 36  LEU A CA  1 
ATOM 208   C C   . LEU A 1 36  ? 97.751  105.390 141.351 1.00 123.78 ? 36  LEU A C   1 
ATOM 209   O O   . LEU A 1 36  ? 97.906  105.582 140.136 1.00 118.51 ? 36  LEU A O   1 
ATOM 210   C CB  . LEU A 1 36  ? 99.043  107.042 142.674 1.00 30.00  ? 36  LEU A CB  1 
ATOM 211   C CG  . LEU A 1 36  ? 99.115  108.414 143.323 1.00 30.00  ? 36  LEU A CG  1 
ATOM 212   C CD1 . LEU A 1 36  ? 100.524 108.668 143.808 1.00 30.00  ? 36  LEU A CD1 1 
ATOM 213   C CD2 . LEU A 1 36  ? 98.694  109.457 142.323 1.00 30.00  ? 36  LEU A CD2 1 
ATOM 214   N N   . GLN A 1 37  ? 97.689  104.161 141.887 1.00 123.38 ? 37  GLN A N   1 
ATOM 215   C CA  . GLN A 1 37  ? 97.857  102.993 141.022 1.00 117.62 ? 37  GLN A CA  1 
ATOM 216   C C   . GLN A 1 37  ? 96.697  102.818 140.051 1.00 110.58 ? 37  GLN A C   1 
ATOM 217   O O   . GLN A 1 37  ? 96.924  102.464 138.886 1.00 111.88 ? 37  GLN A O   1 
ATOM 218   C CB  . GLN A 1 37  ? 98.040  101.693 141.819 1.00 30.00  ? 37  GLN A CB  1 
ATOM 219   C CG  . GLN A 1 37  ? 99.414  101.485 142.433 1.00 30.00  ? 37  GLN A CG  1 
ATOM 220   C CD  . GLN A 1 37  ? 99.499  101.767 143.895 1.00 30.00  ? 37  GLN A CD  1 
ATOM 221   O OE1 . GLN A 1 37  ? 98.535  101.586 144.624 1.00 30.00  ? 37  GLN A OE1 1 
ATOM 222   N NE2 . GLN A 1 37  ? 100.642 102.263 144.334 1.00 30.00  ? 37  GLN A NE2 1 
ATOM 223   N N   . GLN A 1 38  ? 95.462  103.070 140.494 1.00 110.77 ? 38  GLN A N   1 
ATOM 224   C CA  . GLN A 1 38  ? 94.307  102.855 139.625 1.00 125.53 ? 38  GLN A CA  1 
ATOM 225   C C   . GLN A 1 38  ? 94.282  103.864 138.481 1.00 131.29 ? 38  GLN A C   1 
ATOM 226   O O   . GLN A 1 38  ? 93.973  103.517 137.333 1.00 143.08 ? 38  GLN A O   1 
ATOM 227   C CB  . GLN A 1 38  ? 93.004  102.898 140.442 1.00 30.00  ? 38  GLN A CB  1 
ATOM 228   C CG  . GLN A 1 38  ? 92.703  104.201 141.186 1.00 30.00  ? 38  GLN A CG  1 
ATOM 229   C CD  . GLN A 1 38  ? 91.368  104.179 141.903 1.00 30.00  ? 38  GLN A CD  1 
ATOM 230   O OE1 . GLN A 1 38  ? 90.620  103.208 141.816 1.00 30.00  ? 38  GLN A OE1 1 
ATOM 231   N NE2 . GLN A 1 38  ? 91.056  105.260 142.609 1.00 30.00  ? 38  GLN A NE2 1 
ATOM 232   N N   . LYS A 1 39  ? 94.675  105.106 138.761 1.00 115.39 ? 39  LYS A N   1 
ATOM 233   C CA  . LYS A 1 39  ? 94.562  106.154 137.762 1.00 122.69 ? 39  LYS A CA  1 
ATOM 234   C C   . LYS A 1 39  ? 95.771  106.149 136.840 1.00 122.92 ? 39  LYS A C   1 
ATOM 235   O O   . LYS A 1 39  ? 95.640  106.438 135.647 1.00 119.94 ? 39  LYS A O   1 
ATOM 236   C CB  . LYS A 1 39  ? 94.400  107.498 138.464 1.00 30.00  ? 39  LYS A CB  1 
ATOM 237   C CG  . LYS A 1 39  ? 93.979  108.647 137.589 1.00 30.00  ? 39  LYS A CG  1 
ATOM 238   C CD  . LYS A 1 39  ? 92.568  108.430 137.097 1.00 30.00  ? 39  LYS A CD  1 
ATOM 239   C CE  . LYS A 1 39  ? 91.990  109.709 136.544 1.00 30.00  ? 39  LYS A CE  1 
ATOM 240   N NZ  . LYS A 1 39  ? 92.757  110.222 135.395 1.00 30.00  ? 39  LYS A NZ  1 
ATOM 241   N N   . SER A 1 40  ? 96.945  105.799 137.367 1.00 115.71 ? 40  SER A N   1 
ATOM 242   C CA  . SER A 1 40  ? 98.124  105.668 136.519 1.00 125.17 ? 40  SER A CA  1 
ATOM 243   C C   . SER A 1 40  ? 98.004  104.462 135.597 1.00 124.47 ? 40  SER A C   1 
ATOM 244   O O   . SER A 1 40  ? 98.198  104.577 134.377 1.00 117.25 ? 40  SER A O   1 
ATOM 245   C CB  . SER A 1 40  ? 99.371  105.562 137.390 1.00 30.00  ? 40  SER A CB  1 
ATOM 246   O OG  . SER A 1 40  ? 99.310  104.403 138.197 1.00 30.00  ? 40  SER A OG  1 
ATOM 247   N N   . GLN A 1 41  ? 97.663  103.299 136.167 1.00 124.77 ? 41  GLN A N   1 
ATOM 248   C CA  . GLN A 1 41  ? 97.516  102.081 135.374 1.00 118.76 ? 41  GLN A CA  1 
ATOM 249   C C   . GLN A 1 41  ? 96.331  102.157 134.424 1.00 112.40 ? 41  GLN A C   1 
ATOM 250   O O   . GLN A 1 41  ? 96.352  101.522 133.364 1.00 107.21 ? 41  GLN A O   1 
ATOM 251   C CB  . GLN A 1 41  ? 97.371  100.865 136.289 1.00 30.00  ? 41  GLN A CB  1 
ATOM 252   C CG  . GLN A 1 41  ? 98.642  100.446 137.003 1.00 30.00  ? 41  GLN A CG  1 
ATOM 253   C CD  . GLN A 1 41  ? 98.394  99.319  137.979 1.00 30.00  ? 41  GLN A CD  1 
ATOM 254   O OE1 . GLN A 1 41  ? 97.252  98.932  138.216 1.00 30.00  ? 41  GLN A OE1 1 
ATOM 255   N NE2 . GLN A 1 41  ? 99.463  98.773  138.539 1.00 30.00  ? 41  GLN A NE2 1 
ATOM 256   N N   . ALA A 1 42  ? 95.297  102.921 134.779 1.00 117.08 ? 42  ALA A N   1 
ATOM 257   C CA  . ALA A 1 42  ? 94.190  103.124 133.853 1.00 121.87 ? 42  ALA A CA  1 
ATOM 258   C C   . ALA A 1 42  ? 94.598  104.045 132.708 1.00 124.60 ? 42  ALA A C   1 
ATOM 259   O O   . ALA A 1 42  ? 94.533  103.662 131.533 1.00 129.32 ? 42  ALA A O   1 
ATOM 260   C CB  . ALA A 1 42  ? 92.978  103.683 134.597 1.00 30.00  ? 42  ALA A CB  1 
ATOM 261   N N   . THR A 1 43  ? 95.057  105.257 133.035 1.00 122.18 ? 43  THR A N   1 
ATOM 262   C CA  . THR A 1 43  ? 95.336  106.260 132.014 1.00 129.90 ? 43  THR A CA  1 
ATOM 263   C C   . THR A 1 43  ? 96.517  105.921 131.118 1.00 121.89 ? 43  THR A C   1 
ATOM 264   O O   . THR A 1 43  ? 96.589  106.470 130.016 1.00 106.94 ? 43  THR A O   1 
ATOM 265   C CB  . THR A 1 43  ? 95.578  107.625 132.647 1.00 30.00  ? 43  THR A CB  1 
ATOM 266   O OG1 . THR A 1 43  ? 96.596  107.516 133.649 1.00 30.00  ? 43  THR A OG1 1 
ATOM 267   C CG2 . THR A 1 43  ? 94.301  108.166 133.242 1.00 30.00  ? 43  THR A CG2 1 
ATOM 268   N N   . GLY A 1 44  ? 97.430  105.050 131.546 1.00 116.35 ? 44  GLY A N   1 
ATOM 269   C CA  . GLY A 1 44  ? 98.491  104.624 130.651 1.00 102.42 ? 44  GLY A CA  1 
ATOM 270   C C   . GLY A 1 44  ? 97.966  103.878 129.440 1.00 107.16 ? 44  GLY A C   1 
ATOM 271   O O   . GLY A 1 44  ? 98.176  104.292 128.289 1.00 105.71 ? 44  GLY A O   1 
ATOM 272   N N   . ARG A 1 45  ? 97.241  102.793 129.715 1.00 121.34 ? 45  ARG A N   1 
ATOM 273   C CA  . ARG A 1 45  ? 96.645  101.994 128.653 1.00 118.64 ? 45  ARG A CA  1 
ATOM 274   C C   . ARG A 1 45  ? 95.608  102.792 127.878 1.00 114.49 ? 45  ARG A C   1 
ATOM 275   O O   . ARG A 1 45  ? 95.569  102.733 126.645 1.00 119.78 ? 45  ARG A O   1 
ATOM 276   C CB  . ARG A 1 45  ? 95.996  100.746 129.242 1.00 30.00  ? 45  ARG A CB  1 
ATOM 277   C CG  . ARG A 1 45  ? 96.924  99.795  129.973 1.00 30.00  ? 45  ARG A CG  1 
ATOM 278   C CD  . ARG A 1 45  ? 96.142  98.591  130.471 1.00 30.00  ? 45  ARG A CD  1 
ATOM 279   N NE  . ARG A 1 45  ? 95.172  98.967  131.497 1.00 30.00  ? 45  ARG A NE  1 
ATOM 280   C CZ  . ARG A 1 45  ? 93.856  99.005  131.304 1.00 30.00  ? 45  ARG A CZ  1 
ATOM 281   N NH1 . ARG A 1 45  ? 93.353  98.707  130.114 1.00 30.00  ? 45  ARG A NH1 1 
ATOM 282   N NH2 . ARG A 1 45  ? 93.048  99.361  132.291 1.00 30.00  ? 45  ARG A NH2 1 
ATOM 283   N N   . GLU A 1 46  ? 94.769  103.553 128.590 1.00 110.36 ? 46  GLU A N   1 
ATOM 284   C CA  . GLU A 1 46  ? 93.711  104.326 127.946 1.00 120.39 ? 46  GLU A CA  1 
ATOM 285   C C   . GLU A 1 46  ? 94.267  105.406 127.029 1.00 123.08 ? 46  GLU A C   1 
ATOM 286   O O   . GLU A 1 46  ? 93.660  105.712 125.997 1.00 126.45 ? 46  GLU A O   1 
ATOM 287   C CB  . GLU A 1 46  ? 92.807  104.931 129.015 1.00 30.00  ? 46  GLU A CB  1 
ATOM 288   C CG  . GLU A 1 46  ? 91.918  103.912 129.688 1.00 30.00  ? 46  GLU A CG  1 
ATOM 289   C CD  . GLU A 1 46  ? 91.288  104.443 130.950 1.00 30.00  ? 46  GLU A CD  1 
ATOM 290   O OE1 . GLU A 1 46  ? 91.693  105.533 131.397 1.00 30.00  ? 46  GLU A OE1 1 
ATOM 291   O OE2 . GLU A 1 46  ? 90.395  103.770 131.502 1.00 30.00  ? 46  GLU A OE2 1 
ATOM 292   N N   . THR A 1 47  ? 95.432  105.957 127.353 1.00 109.60 ? 47  THR A N   1 
ATOM 293   C CA  . THR A 1 47  ? 96.035  106.932 126.459 1.00 114.97 ? 47  THR A CA  1 
ATOM 294   C C   . THR A 1 47  ? 96.847  106.312 125.337 1.00 122.24 ? 47  THR A C   1 
ATOM 295   O O   . THR A 1 47  ? 97.016  106.958 124.298 1.00 126.78 ? 47  THR A O   1 
ATOM 296   C CB  . THR A 1 47  ? 96.918  107.880 127.240 1.00 30.00  ? 47  THR A CB  1 
ATOM 297   O OG1 . THR A 1 47  ? 97.733  107.108 128.129 1.00 30.00  ? 47  THR A OG1 1 
ATOM 298   C CG2 . THR A 1 47  ? 96.083  108.920 127.986 1.00 30.00  ? 47  THR A CG2 1 
ATOM 299   N N   . THR A 1 48  ? 97.375  105.100 125.512 1.00 106.63 ? 48  THR A N   1 
ATOM 300   C CA  . THR A 1 48  ? 97.930  104.427 124.340 1.00 106.27 ? 48  THR A CA  1 
ATOM 301   C C   . THR A 1 48  ? 96.827  104.004 123.377 1.00 112.60 ? 48  THR A C   1 
ATOM 302   O O   . THR A 1 48  ? 97.041  103.959 122.159 1.00 117.23 ? 48  THR A O   1 
ATOM 303   C CB  . THR A 1 48  ? 98.754  103.218 124.756 1.00 30.00  ? 48  THR A CB  1 
ATOM 304   O OG1 . THR A 1 48  ? 97.934  102.354 125.544 1.00 30.00  ? 48  THR A OG1 1 
ATOM 305   C CG2 . THR A 1 48  ? 99.969  103.643 125.553 1.00 30.00  ? 48  THR A CG2 1 
ATOM 306   N N   . GLN A 1 49  ? 95.644  103.694 123.909 1.00 120.76 ? 49  GLN A N   1 
ATOM 307   C CA  . GLN A 1 49  ? 94.486  103.456 123.060 1.00 129.15 ? 49  GLN A CA  1 
ATOM 308   C C   . GLN A 1 49  ? 93.997  104.744 122.417 1.00 124.57 ? 49  GLN A C   1 
ATOM 309   O O   . GLN A 1 49  ? 93.491  104.714 121.291 1.00 134.69 ? 49  GLN A O   1 
ATOM 310   C CB  . GLN A 1 49  ? 93.370  102.813 123.878 1.00 30.00  ? 49  GLN A CB  1 
ATOM 311   C CG  . GLN A 1 49  ? 93.692  101.417 124.371 1.00 30.00  ? 49  GLN A CG  1 
ATOM 312   C CD  . GLN A 1 49  ? 92.624  100.866 125.291 1.00 30.00  ? 49  GLN A CD  1 
ATOM 313   O OE1 . GLN A 1 49  ? 91.644  101.541 125.600 1.00 30.00  ? 49  GLN A OE1 1 
ATOM 314   N NE2 . GLN A 1 49  ? 92.814  99.634  125.742 1.00 30.00  ? 49  GLN A NE2 1 
ATOM 315   N N   . GLU A 1 50  ? 94.148  105.876 123.115 1.00 118.17 ? 50  GLU A N   1 
ATOM 316   C CA  . GLU A 1 50  ? 93.755  107.185 122.597 1.00 122.89 ? 50  GLU A CA  1 
ATOM 317   C C   . GLU A 1 50  ? 94.544  107.579 121.355 1.00 108.02 ? 50  GLU A C   1 
ATOM 318   O O   . GLU A 1 50  ? 94.010  108.276 120.486 1.00 108.64 ? 50  GLU A O   1 
ATOM 319   C CB  . GLU A 1 50  ? 93.947  108.242 123.694 1.00 30.00  ? 50  GLU A CB  1 
ATOM 320   C CG  . GLU A 1 50  ? 93.470  109.661 123.382 1.00 30.00  ? 50  GLU A CG  1 
ATOM 321   C CD  . GLU A 1 50  ? 91.956  109.796 123.356 1.00 30.00  ? 50  GLU A CD  1 
ATOM 322   O OE1 . GLU A 1 50  ? 91.271  108.989 124.019 1.00 30.00  ? 50  GLU A OE1 1 
ATOM 323   O OE2 . GLU A 1 50  ? 91.451  110.722 122.686 1.00 30.00  ? 50  GLU A OE2 1 
ATOM 324   N N   . VAL A 1 51  ? 95.790  107.132 121.243 1.00 112.66 ? 51  VAL A N   1 
ATOM 325   C CA  . VAL A 1 51  ? 96.612  107.433 120.081 1.00 114.59 ? 51  VAL A CA  1 
ATOM 326   C C   . VAL A 1 51  ? 96.671  106.282 119.089 1.00 112.54 ? 51  VAL A C   1 
ATOM 327   O O   . VAL A 1 51  ? 96.934  106.527 117.903 1.00 128.80 ? 51  VAL A O   1 
ATOM 328   C CB  . VAL A 1 51  ? 98.040  107.846 120.497 1.00 30.00  ? 51  VAL A CB  1 
ATOM 329   C CG1 . VAL A 1 51  ? 97.999  109.079 121.371 1.00 30.00  ? 51  VAL A CG1 1 
ATOM 330   C CG2 . VAL A 1 51  ? 98.751  106.715 121.223 1.00 30.00  ? 51  VAL A CG2 1 
ATOM 331   N N   . ALA A 1 52  ? 96.422  105.046 119.520 1.00 30.00  ? 52  ALA A N   1 
ATOM 332   C CA  . ALA A 1 52  ? 96.760  103.900 118.687 1.00 30.00  ? 52  ALA A CA  1 
ATOM 333   C C   . ALA A 1 52  ? 95.671  103.609 117.664 1.00 30.00  ? 52  ALA A C   1 
ATOM 334   O O   . ALA A 1 52  ? 95.948  103.510 116.464 1.00 30.00  ? 52  ALA A O   1 
ATOM 335   C CB  . ALA A 1 52  ? 97.015  102.682 119.569 1.00 30.00  ? 52  ALA A CB  1 
ATOM 336   N N   . SER A 1 53  ? 94.432  103.460 118.121 1.00 113.33 ? 53  SER A N   1 
ATOM 337   C CA  . SER A 1 53  ? 93.349  103.041 117.245 1.00 119.89 ? 53  SER A CA  1 
ATOM 338   C C   . SER A 1 53  ? 92.946  104.164 116.301 1.00 124.17 ? 53  SER A C   1 
ATOM 339   O O   . SER A 1 53  ? 93.104  105.348 116.603 1.00 123.77 ? 53  SER A O   1 
ATOM 340   C CB  . SER A 1 53  ? 92.145  102.596 118.065 1.00 135.93 ? 53  SER A CB  1 
ATOM 341   O OG  . SER A 1 53  ? 91.611  103.682 118.795 1.00 150.89 ? 53  SER A OG  1 
ATOM 342   N N   . GLY A 1 54  ? 92.433  103.782 115.137 1.00 126.56 ? 54  GLY A N   1 
ATOM 343   C CA  . GLY A 1 54  ? 92.074  104.781 114.156 1.00 107.25 ? 54  GLY A CA  1 
ATOM 344   C C   . GLY A 1 54  ? 91.380  104.286 112.905 1.00 106.60 ? 54  GLY A C   1 
ATOM 345   O O   . GLY A 1 54  ? 91.596  103.156 112.460 1.00 103.76 ? 54  GLY A O   1 
ATOM 346   N N   . ILE A 1 55  ? 90.563  105.163 112.326 1.00 100.38 ? 55  ILE A N   1 
ATOM 347   C CA  . ILE A 1 55  ? 89.726  104.882 111.166 1.00 80.06  ? 55  ILE A CA  1 
ATOM 348   C C   . ILE A 1 55  ? 90.325  105.595 109.961 1.00 98.77  ? 55  ILE A C   1 
ATOM 349   O O   . ILE A 1 55  ? 90.784  106.733 110.084 1.00 111.05 ? 55  ILE A O   1 
ATOM 350   C CB  . ILE A 1 55  ? 88.278  105.329 111.441 1.00 30.00  ? 55  ILE A CB  1 
ATOM 351   C CG1 . ILE A 1 55  ? 87.624  104.378 112.443 1.00 30.00  ? 55  ILE A CG1 1 
ATOM 352   C CG2 . ILE A 1 55  ? 87.453  105.491 110.186 1.00 30.00  ? 55  ILE A CG2 1 
ATOM 353   C CD1 . ILE A 1 55  ? 86.233  104.767 112.841 1.00 30.00  ? 55  ILE A CD1 1 
ATOM 354   N N   . LYS A 1 56  ? 90.370  104.917 108.813 1.00 98.92  ? 56  LYS A N   1 
ATOM 355   C CA  . LYS A 1 56  ? 90.783  105.542 107.563 1.00 91.81  ? 56  LYS A CA  1 
ATOM 356   C C   . LYS A 1 56  ? 89.744  105.291 106.477 1.00 85.75  ? 56  LYS A C   1 
ATOM 357   O O   . LYS A 1 56  ? 89.113  104.230 106.436 1.00 101.89 ? 56  LYS A O   1 
ATOM 358   C CB  . LYS A 1 56  ? 92.171  105.051 107.125 1.00 30.00  ? 56  LYS A CB  1 
ATOM 359   C CG  . LYS A 1 56  ? 92.288  103.581 106.776 1.00 30.00  ? 56  LYS A CG  1 
ATOM 360   C CD  . LYS A 1 56  ? 93.730  103.247 106.452 1.00 30.00  ? 56  LYS A CD  1 
ATOM 361   C CE  . LYS A 1 56  ? 93.915  101.773 106.169 1.00 30.00  ? 56  LYS A CE  1 
ATOM 362   N NZ  . LYS A 1 56  ? 93.225  101.374 104.923 1.00 30.00  ? 56  LYS A NZ  1 
ATOM 363   N N   . VAL A 1 57  ? 89.560  106.287 105.612 1.00 72.52  ? 57  VAL A N   1 
ATOM 364   C CA  . VAL A 1 57  ? 88.503  106.303 104.606 1.00 81.55  ? 57  VAL A CA  1 
ATOM 365   C C   . VAL A 1 57  ? 89.127  106.082 103.240 1.00 102.46 ? 57  VAL A C   1 
ATOM 366   O O   . VAL A 1 57  ? 90.050  106.803 102.851 1.00 103.19 ? 57  VAL A O   1 
ATOM 367   C CB  . VAL A 1 57  ? 87.723  107.623 104.639 1.00 30.00  ? 57  VAL A CB  1 
ATOM 368   C CG1 . VAL A 1 57  ? 86.797  107.718 103.463 1.00 30.00  ? 57  VAL A CG1 1 
ATOM 369   C CG2 . VAL A 1 57  ? 86.931  107.716 105.914 1.00 30.00  ? 57  VAL A CG2 1 
ATOM 370   N N   . LEU A 1 58  ? 88.617  105.098 102.506 1.00 92.19  ? 58  LEU A N   1 
ATOM 371   C CA  . LEU A 1 58  ? 89.129  104.767 101.186 1.00 86.93  ? 58  LEU A CA  1 
ATOM 372   C C   . LEU A 1 58  ? 87.975  104.562 100.214 1.00 105.85 ? 58  LEU A C   1 
ATOM 373   O O   . LEU A 1 58  ? 87.026  103.841 100.526 1.00 120.09 ? 58  LEU A O   1 
ATOM 374   C CB  . LEU A 1 58  ? 90.033  103.526 101.273 1.00 30.00  ? 58  LEU A CB  1 
ATOM 375   C CG  . LEU A 1 58  ? 89.549  102.196 101.874 1.00 30.00  ? 58  LEU A CG  1 
ATOM 376   C CD1 . LEU A 1 58  ? 88.970  101.235 100.849 1.00 30.00  ? 58  LEU A CD1 1 
ATOM 377   C CD2 . LEU A 1 58  ? 90.657  101.525 102.651 1.00 30.00  ? 58  LEU A CD2 1 
ATOM 378   N N   . SER A 1 59  ? 88.043  105.245 99.066  1.00 102.02 ? 59  SER A N   1 
ATOM 379   C CA  . SER A 1 59  ? 87.270  104.939 97.855  1.00 101.26 ? 59  SER A CA  1 
ATOM 380   C C   . SER A 1 59  ? 85.755  105.015 98.086  1.00 100.91 ? 59  SER A C   1 
ATOM 381   O O   . SER A 1 59  ? 85.041  104.015 98.089  1.00 93.78  ? 59  SER A O   1 
ATOM 382   C CB  . SER A 1 59  ? 87.674  103.571 97.296  1.00 30.00  ? 59  SER A CB  1 
ATOM 383   O OG  . SER A 1 59  ? 89.031  103.581 96.890  1.00 30.00  ? 59  SER A OG  1 
ATOM 384   N N   . VAL A 1 60  ? 85.294  106.231 98.309  1.00 114.53 ? 60  VAL A N   1 
ATOM 385   C CA  . VAL A 1 60  ? 83.868  106.501 98.432  1.00 106.73 ? 60  VAL A CA  1 
ATOM 386   C C   . VAL A 1 60  ? 83.246  106.513 97.035  1.00 97.61  ? 60  VAL A C   1 
ATOM 387   O O   . VAL A 1 60  ? 83.932  106.771 96.042  1.00 91.29  ? 60  VAL A O   1 
ATOM 388   C CB  . VAL A 1 60  ? 83.677  107.831 99.179  1.00 30.00  ? 60  VAL A CB  1 
ATOM 389   C CG1 . VAL A 1 60  ? 82.245  108.039 99.595  1.00 30.00  ? 60  VAL A CG1 1 
ATOM 390   C CG2 . VAL A 1 60  ? 84.590  107.870 100.371 1.00 30.00  ? 60  VAL A CG2 1 
ATOM 391   N N   . VAL A 1 61  ? 81.952  106.189 96.934  1.00 91.21  ? 61  VAL A N   1 
ATOM 392   C CA  . VAL A 1 61  ? 81.269  106.020 95.657  1.00 75.96  ? 61  VAL A CA  1 
ATOM 393   C C   . VAL A 1 61  ? 79.989  106.851 95.633  1.00 85.19  ? 61  VAL A C   1 
ATOM 394   O O   . VAL A 1 61  ? 79.427  107.199 96.674  1.00 107.80 ? 61  VAL A O   1 
ATOM 395   C CB  . VAL A 1 61  ? 80.958  104.542 95.390  1.00 30.00  ? 61  VAL A CB  1 
ATOM 396   C CG1 . VAL A 1 61  ? 82.230  103.779 95.191  1.00 30.00  ? 61  VAL A CG1 1 
ATOM 397   C CG2 . VAL A 1 61  ? 80.248  103.966 96.569  1.00 30.00  ? 61  VAL A CG2 1 
ATOM 398   N N   . GLY A 1 62  ? 79.530  107.179 94.419  1.00 70.41  ? 62  GLY A N   1 
ATOM 399   C CA  . GLY A 1 62  ? 78.472  108.168 94.274  1.00 74.08  ? 62  GLY A CA  1 
ATOM 400   C C   . GLY A 1 62  ? 77.008  107.780 94.124  1.00 71.97  ? 62  GLY A C   1 
ATOM 401   O O   . GLY A 1 62  ? 76.218  108.128 95.004  1.00 101.24 ? 62  GLY A O   1 
ATOM 402   N N   . LYS A 1 63  ? 76.642  107.037 93.065  1.00 30.00  ? 63  LYS A N   1 
ATOM 403   C CA  . LYS A 1 63  ? 75.255  106.736 92.672  1.00 30.00  ? 63  LYS A CA  1 
ATOM 404   C C   . LYS A 1 63  ? 74.399  107.980 92.428  1.00 30.00  ? 63  LYS A C   1 
ATOM 405   O O   . LYS A 1 63  ? 73.659  108.415 93.316  1.00 30.00  ? 63  LYS A O   1 
ATOM 406   C CB  . LYS A 1 63  ? 74.541  105.814 93.671  1.00 30.00  ? 63  LYS A CB  1 
ATOM 407   C CG  . LYS A 1 63  ? 73.165  105.305 93.227  1.00 30.00  ? 63  LYS A CG  1 
ATOM 408   C CD  . LYS A 1 63  ? 73.253  104.411 92.023  1.00 30.00  ? 63  LYS A CD  1 
ATOM 409   C CE  . LYS A 1 63  ? 71.867  104.055 91.544  1.00 30.00  ? 63  LYS A CE  1 
ATOM 410   N NZ  . LYS A 1 63  ? 71.118  103.304 92.577  1.00 30.00  ? 63  LYS A NZ  1 
ATOM 411   N N   . THR A 1 64  ? 74.563  108.638 91.285  1.00 74.75  ? 64  THR A N   1 
ATOM 412   C CA  . THR A 1 64  ? 73.549  109.618 90.926  1.00 85.42  ? 64  THR A CA  1 
ATOM 413   C C   . THR A 1 64  ? 72.267  108.925 90.465  1.00 94.58  ? 64  THR A C   1 
ATOM 414   O O   . THR A 1 64  ? 72.203  107.703 90.309  1.00 107.53 ? 64  THR A O   1 
ATOM 415   C CB  . THR A 1 64  ? 74.040  110.557 89.832  1.00 30.00  ? 64  THR A CB  1 
ATOM 416   O OG1 . THR A 1 64  ? 73.097  111.622 89.669  1.00 30.00  ? 64  THR A OG1 1 
ATOM 417   C CG2 . THR A 1 64  ? 74.131  109.836 88.534  1.00 30.00  ? 64  THR A CG2 1 
ATOM 418   N N   . ASP A 1 65  ? 71.237  109.736 90.223  1.00 92.95  ? 65  ASP A N   1 
ATOM 419   C CA  . ASP A 1 65  ? 69.924  109.250 89.814  1.00 78.92  ? 65  ASP A CA  1 
ATOM 420   C C   . ASP A 1 65  ? 69.954  108.947 88.312  1.00 87.53  ? 65  ASP A C   1 
ATOM 421   O O   . ASP A 1 65  ? 70.972  109.133 87.641  1.00 108.21 ? 65  ASP A O   1 
ATOM 422   C CB  . ASP A 1 65  ? 68.863  110.281 90.201  1.00 30.00  ? 65  ASP A CB  1 
ATOM 423   C CG  . ASP A 1 65  ? 67.465  109.697 90.265  1.00 30.00  ? 65  ASP A CG  1 
ATOM 424   O OD1 . ASP A 1 65  ? 67.311  108.496 89.964  1.00 30.00  ? 65  ASP A OD1 1 
ATOM 425   O OD2 . ASP A 1 65  ? 66.523  110.440 90.612  1.00 30.00  ? 65  ASP A OD2 1 
ATOM 426   N N   . SER A 1 66  ? 68.833  108.483 87.750  1.00 82.88  ? 66  SER A N   1 
ATOM 427   C CA  . SER A 1 66  ? 68.741  108.241 86.315  1.00 100.10 ? 66  SER A CA  1 
ATOM 428   C C   . SER A 1 66  ? 68.737  109.524 85.496  1.00 99.91  ? 66  SER A C   1 
ATOM 429   O O   . SER A 1 66  ? 68.898  109.462 84.274  1.00 105.10 ? 66  SER A O   1 
ATOM 430   C CB  . SER A 1 66  ? 67.486  107.431 85.997  1.00 30.00  ? 66  SER A CB  1 
ATOM 431   O OG  . SER A 1 66  ? 67.549  106.153 86.602  1.00 30.00  ? 66  SER A OG  1 
ATOM 432   N N   . ASN A 1 67  ? 68.537  110.668 86.134  1.00 97.83  ? 67  ASN A N   1 
ATOM 433   C CA  . ASN A 1 67  ? 68.850  111.973 85.568  1.00 107.23 ? 67  ASN A CA  1 
ATOM 434   C C   . ASN A 1 67  ? 70.049  112.446 86.383  1.00 118.78 ? 67  ASN A C   1 
ATOM 435   O O   . ASN A 1 67  ? 69.964  112.545 87.611  1.00 119.03 ? 67  ASN A O   1 
ATOM 436   C CB  . ASN A 1 67  ? 67.657  112.917 85.658  1.00 30.00  ? 67  ASN A CB  1 
ATOM 437   C CG  . ASN A 1 67  ? 67.814  114.139 84.786  1.00 30.00  ? 67  ASN A CG  1 
ATOM 438   O OD1 . ASN A 1 67  ? 68.830  114.315 84.117  1.00 30.00  ? 67  ASN A OD1 1 
ATOM 439   N ND2 . ASN A 1 67  ? 66.790  114.979 84.764  1.00 30.00  ? 67  ASN A ND2 1 
ATOM 440   N N   . LYS A 1 68  ? 71.164  112.724 85.701  1.00 119.07 ? 68  LYS A N   1 
ATOM 441   C CA  . LYS A 1 68  ? 72.500  112.778 86.295  1.00 123.65 ? 68  LYS A CA  1 
ATOM 442   C C   . LYS A 1 68  ? 72.709  113.860 87.352  1.00 120.01 ? 68  LYS A C   1 
ATOM 443   O O   . LYS A 1 68  ? 73.723  113.851 88.051  1.00 120.34 ? 68  LYS A O   1 
ATOM 444   C CB  . LYS A 1 68  ? 73.538  112.969 85.192  1.00 30.00  ? 68  LYS A CB  1 
ATOM 445   C CG  . LYS A 1 68  ? 73.480  111.930 84.082  1.00 30.00  ? 68  LYS A CG  1 
ATOM 446   C CD  . LYS A 1 68  ? 73.766  110.530 84.580  1.00 30.00  ? 68  LYS A CD  1 
ATOM 447   C CE  . LYS A 1 68  ? 73.922  109.576 83.414  1.00 30.00  ? 68  LYS A CE  1 
ATOM 448   N NZ  . LYS A 1 68  ? 72.658  109.422 82.658  1.00 30.00  ? 68  LYS A NZ  1 
ATOM 449   N N   . THR A 1 69  ? 71.780  114.801 87.463  1.00 104.67 ? 69  THR A N   1 
ATOM 450   C CA  . THR A 1 69  ? 71.852  115.837 88.480  1.00 117.77 ? 69  THR A CA  1 
ATOM 451   C C   . THR A 1 69  ? 71.589  115.228 89.861  1.00 114.76 ? 69  THR A C   1 
ATOM 452   O O   . THR A 1 69  ? 70.842  114.254 89.993  1.00 113.10 ? 69  THR A O   1 
ATOM 453   C CB  . THR A 1 69  ? 70.827  116.933 88.155  1.00 30.00  ? 69  THR A CB  1 
ATOM 454   O OG1 . THR A 1 69  ? 70.979  117.329 86.787  1.00 30.00  ? 69  THR A OG1 1 
ATOM 455   C CG2 . THR A 1 69  ? 71.018  118.181 89.012  1.00 30.00  ? 69  THR A CG2 1 
ATOM 456   N N   . TYR A 1 70  ? 72.235  115.804 90.885  1.00 95.58  ? 70  TYR A N   1 
ATOM 457   C CA  . TYR A 1 70  ? 71.917  115.590 92.301  1.00 91.75  ? 70  TYR A CA  1 
ATOM 458   C C   . TYR A 1 70  ? 72.127  114.134 92.730  1.00 97.36  ? 70  TYR A C   1 
ATOM 459   O O   . TYR A 1 70  ? 71.176  113.379 92.939  1.00 106.50 ? 70  TYR A O   1 
ATOM 460   C CB  . TYR A 1 70  ? 70.485  116.041 92.616  1.00 30.00  ? 70  TYR A CB  1 
ATOM 461   C CG  . TYR A 1 70  ? 70.260  117.536 92.602  1.00 30.00  ? 70  TYR A CG  1 
ATOM 462   C CD1 . TYR A 1 70  ? 71.327  118.426 92.647  1.00 30.00  ? 70  TYR A CD1 1 
ATOM 463   C CD2 . TYR A 1 70  ? 68.971  118.058 92.560  1.00 30.00  ? 70  TYR A CD2 1 
ATOM 464   C CE1 . TYR A 1 70  ? 71.117  119.796 92.642  1.00 30.00  ? 70  TYR A CE1 1 
ATOM 465   C CE2 . TYR A 1 70  ? 68.751  119.422 92.553  1.00 30.00  ? 70  TYR A CE2 1 
ATOM 466   C CZ  . TYR A 1 70  ? 69.828  120.286 92.594  1.00 30.00  ? 70  TYR A CZ  1 
ATOM 467   O OH  . TYR A 1 70  ? 69.614  121.645 92.587  1.00 30.00  ? 70  TYR A OH  1 
ATOM 468   N N   . VAL A 1 71  ? 73.406  113.746 92.781  1.00 94.49  ? 71  VAL A N   1 
ATOM 469   C CA  . VAL A 1 71  ? 73.838  112.454 93.319  1.00 80.78  ? 71  VAL A CA  1 
ATOM 470   C C   . VAL A 1 71  ? 73.305  112.220 94.729  1.00 87.45  ? 71  VAL A C   1 
ATOM 471   O O   . VAL A 1 71  ? 73.517  113.033 95.635  1.00 96.24  ? 71  VAL A O   1 
ATOM 472   C CB  . VAL A 1 71  ? 75.374  112.327 93.249  1.00 30.00  ? 71  VAL A CB  1 
ATOM 473   C CG1 . VAL A 1 71  ? 76.062  113.548 93.769  1.00 30.00  ? 71  VAL A CG1 1 
ATOM 474   C CG2 . VAL A 1 71  ? 75.831  111.171 94.061  1.00 30.00  ? 71  VAL A CG2 1 
ATOM 475   N N   . GLU A 1 72  ? 72.573  111.119 94.920  1.00 85.64  ? 72  GLU A N   1 
ATOM 476   C CA  . GLU A 1 72  ? 71.717  110.992 96.093  1.00 94.43  ? 72  GLU A CA  1 
ATOM 477   C C   . GLU A 1 72  ? 72.131  109.907 97.079  1.00 97.09  ? 72  GLU A C   1 
ATOM 478   O O   . GLU A 1 72  ? 71.986  110.108 98.284  1.00 121.72 ? 72  GLU A O   1 
ATOM 479   C CB  . GLU A 1 72  ? 70.244  110.785 95.675  1.00 30.00  ? 72  GLU A CB  1 
ATOM 480   C CG  . GLU A 1 72  ? 69.845  109.460 95.058  1.00 30.00  ? 72  GLU A CG  1 
ATOM 481   C CD  . GLU A 1 72  ? 69.963  109.438 93.561  1.00 30.00  ? 72  GLU A CD  1 
ATOM 482   O OE1 . GLU A 1 72  ? 70.618  110.334 92.994  1.00 30.00  ? 72  GLU A OE1 1 
ATOM 483   O OE2 . GLU A 1 72  ? 69.384  108.516 92.956  1.00 30.00  ? 72  GLU A OE2 1 
ATOM 484   N N   . LYS A 1 73  ? 72.626  108.759 96.637  1.00 88.72  ? 73  LYS A N   1 
ATOM 485   C CA  . LYS A 1 73  ? 72.812  107.623 97.538  1.00 76.19  ? 73  LYS A CA  1 
ATOM 486   C C   . LYS A 1 73  ? 74.289  107.274 97.651  1.00 76.39  ? 73  LYS A C   1 
ATOM 487   O O   . LYS A 1 73  ? 74.811  106.484 96.865  1.00 99.03  ? 73  LYS A O   1 
ATOM 488   C CB  . LYS A 1 73  ? 71.995  106.426 97.073  1.00 30.00  ? 73  LYS A CB  1 
ATOM 489   C CG  . LYS A 1 73  ? 70.509  106.553 97.339  1.00 30.00  ? 73  LYS A CG  1 
ATOM 490   C CD  . LYS A 1 73  ? 69.790  105.216 97.189  1.00 30.00  ? 73  LYS A CD  1 
ATOM 491   C CE  . LYS A 1 73  ? 69.687  104.769 95.743  1.00 30.00  ? 73  LYS A CE  1 
ATOM 492   N NZ  . LYS A 1 73  ? 68.894  103.514 95.608  1.00 30.00  ? 73  LYS A NZ  1 
ATOM 493   N N   . LEU A 1 74  ? 74.941  107.811 98.672  1.00 86.10  ? 74  LEU A N   1 
ATOM 494   C CA  . LEU A 1 74  ? 76.378  107.676 98.836  1.00 69.89  ? 74  LEU A CA  1 
ATOM 495   C C   . LEU A 1 74  ? 76.710  106.484 99.726  1.00 74.51  ? 74  LEU A C   1 
ATOM 496   O O   . LEU A 1 74  ? 75.904  106.062 100.560 1.00 105.24 ? 74  LEU A O   1 
ATOM 497   C CB  . LEU A 1 74  ? 76.951  108.972 99.417  1.00 30.00  ? 74  LEU A CB  1 
ATOM 498   C CG  . LEU A 1 74  ? 78.435  109.273 99.592  1.00 30.00  ? 74  LEU A CG  1 
ATOM 499   C CD1 . LEU A 1 74  ? 78.637  110.751 99.411  1.00 30.00  ? 74  LEU A CD1 1 
ATOM 500   C CD2 . LEU A 1 74  ? 78.873  108.889 100.980 1.00 30.00  ? 74  LEU A CD2 1 
ATOM 501   N N   . ALA A 1 75  ? 77.908  105.934 99.526  1.00 74.85  ? 75  ALA A N   1 
ATOM 502   C CA  . ALA A 1 75  ? 78.433  104.851 100.348 1.00 71.52  ? 75  ALA A CA  1 
ATOM 503   C C   . ALA A 1 75  ? 79.915  105.084 100.576 1.00 78.01  ? 75  ALA A C   1 
ATOM 504   O O   . ALA A 1 75  ? 80.696  105.083 99.624  1.00 114.52 ? 75  ALA A O   1 
ATOM 505   C CB  . ALA A 1 75  ? 78.218  103.486 99.691  1.00 30.00  ? 75  ALA A CB  1 
ATOM 506   N N   . ILE A 1 76  ? 80.299  105.269 101.832 1.00 65.73  ? 76  ILE A N   1 
ATOM 507   C CA  . ILE A 1 76  ? 81.681  105.519 102.216 1.00 91.48  ? 76  ILE A CA  1 
ATOM 508   C C   . ILE A 1 76  ? 82.255  104.260 102.850 1.00 89.44  ? 76  ILE A C   1 
ATOM 509   O O   . ILE A 1 76  ? 81.718  103.755 103.843 1.00 103.39 ? 76  ILE A O   1 
ATOM 510   C CB  . ILE A 1 76  ? 81.783  106.737 103.146 1.00 30.00  ? 76  ILE A CB  1 
ATOM 511   C CG1 . ILE A 1 76  ? 83.150  106.815 103.816 1.00 30.00  ? 76  ILE A CG1 1 
ATOM 512   C CG2 . ILE A 1 76  ? 80.622  106.831 104.095 1.00 30.00  ? 76  ILE A CG2 1 
ATOM 513   C CD1 . ILE A 1 76  ? 83.298  108.029 104.699 1.00 30.00  ? 76  ILE A CD1 1 
ATOM 514   N N   . TYR A 1 77  ? 83.337  103.743 102.266 1.00 92.49  ? 77  TYR A N   1 
ATOM 515   C CA  . TYR A 1 77  ? 83.972  102.522 102.745 1.00 95.04  ? 77  TYR A CA  1 
ATOM 516   C C   . TYR A 1 77  ? 84.914  102.878 103.882 1.00 90.68  ? 77  TYR A C   1 
ATOM 517   O O   . TYR A 1 77  ? 85.666  103.847 103.789 1.00 88.28  ? 77  TYR A O   1 
ATOM 518   C CB  . TYR A 1 77  ? 84.789  101.826 101.654 1.00 30.00  ? 77  TYR A CB  1 
ATOM 519   C CG  . TYR A 1 77  ? 84.085  101.369 100.396 1.00 30.00  ? 77  TYR A CG  1 
ATOM 520   C CD1 . TYR A 1 77  ? 82.708  101.317 100.305 1.00 30.00  ? 77  TYR A CD1 1 
ATOM 521   C CD2 . TYR A 1 77  ? 84.825  100.971 99.293  1.00 30.00  ? 77  TYR A CD2 1 
ATOM 522   C CE1 . TYR A 1 77  ? 82.082  100.892 99.149  1.00 30.00  ? 77  TYR A CE1 1 
ATOM 523   C CE2 . TYR A 1 77  ? 84.213  100.545 98.133  1.00 30.00  ? 77  TYR A CE2 1 
ATOM 524   C CZ  . TYR A 1 77  ? 82.841  100.509 98.066  1.00 30.00  ? 77  TYR A CZ  1 
ATOM 525   O OH  . TYR A 1 77  ? 82.229  100.087 96.909  1.00 30.00  ? 77  TYR A OH  1 
ATOM 526   N N   . ILE A 1 78  ? 84.896  102.084 104.946 1.00 100.82 ? 78  ILE A N   1 
ATOM 527   C CA  . ILE A 1 78  ? 85.771  102.314 106.089 1.00 80.56  ? 78  ILE A CA  1 
ATOM 528   C C   . ILE A 1 78  ? 86.381  101.000 106.554 1.00 87.00  ? 78  ILE A C   1 
ATOM 529   O O   . ILE A 1 78  ? 85.670  100.009 106.749 1.00 104.52 ? 78  ILE A O   1 
ATOM 530   C CB  . ILE A 1 78  ? 85.035  103.030 107.240 1.00 30.00  ? 78  ILE A CB  1 
ATOM 531   C CG1 . ILE A 1 78  ? 84.999  104.527 106.961 1.00 30.00  ? 78  ILE A CG1 1 
ATOM 532   C CG2 . ILE A 1 78  ? 85.628  102.721 108.607 1.00 30.00  ? 78  ILE A CG2 1 
ATOM 533   C CD1 . ILE A 1 78  ? 84.311  105.311 107.995 1.00 30.00  ? 78  ILE A CD1 1 
ATOM 534   N N   . SER A 1 79  ? 87.702  100.994 106.697 1.00 77.59  ? 79  SER A N   1 
ATOM 535   C CA  . SER A 1 79  ? 88.471  99.990  107.408 1.00 81.74  ? 79  SER A CA  1 
ATOM 536   C C   . SER A 1 79  ? 89.325  100.703 108.443 1.00 98.36  ? 79  SER A C   1 
ATOM 537   O O   . SER A 1 79  ? 89.785  101.821 108.195 1.00 117.87 ? 79  SER A O   1 
ATOM 538   C CB  . SER A 1 79  ? 89.367  99.189  106.451 1.00 30.00  ? 79  SER A CB  1 
ATOM 539   O OG  . SER A 1 79  ? 90.142  98.224  107.138 1.00 30.00  ? 79  SER A OG  1 
ATOM 540   N N   . PRO A 1 80  ? 89.535  100.109 109.609 1.00 92.20  ? 80  PRO A N   1 
ATOM 541   C CA  . PRO A 1 80  ? 90.359  100.755 110.626 1.00 88.75  ? 80  PRO A CA  1 
ATOM 542   C C   . PRO A 1 80  ? 91.832  100.550 110.306 1.00 95.71  ? 80  PRO A C   1 
ATOM 543   O O   . PRO A 1 80  ? 92.200  99.840  109.373 1.00 117.12 ? 80  PRO A O   1 
ATOM 544   C CB  . PRO A 1 80  ? 89.958  100.039 111.911 1.00 30.00  ? 80  PRO A CB  1 
ATOM 545   C CG  . PRO A 1 80  ? 89.608  98.703  111.462 1.00 30.00  ? 80  PRO A CG  1 
ATOM 546   C CD  . PRO A 1 80  ? 88.969  98.850  110.113 1.00 30.00  ? 80  PRO A CD  1 
ATOM 547   N N   . ASN A 1 81  ? 92.681  101.160 111.124 1.00 89.04  ? 81  ASN A N   1 
ATOM 548   C CA  . ASN A 1 81  ? 94.115  101.149 110.872 1.00 119.16 ? 81  ASN A CA  1 
ATOM 549   C C   . ASN A 1 81  ? 94.714  99.803  111.282 1.00 129.92 ? 81  ASN A C   1 
ATOM 550   O O   . ASN A 1 81  ? 94.008  98.812  111.491 1.00 123.56 ? 81  ASN A O   1 
ATOM 551   C CB  . ASN A 1 81  ? 94.788  102.318 111.582 1.00 30.00  ? 81  ASN A CB  1 
ATOM 552   C CG  . ASN A 1 81  ? 94.494  103.645 110.922 1.00 30.00  ? 81  ASN A CG  1 
ATOM 553   O OD1 . ASN A 1 81  ? 94.415  103.736 109.700 1.00 30.00  ? 81  ASN A OD1 1 
ATOM 554   N ND2 . ASN A 1 81  ? 94.367  104.689 111.722 1.00 30.00  ? 81  ASN A ND2 1 
ATOM 555   N N   . ALA A 1 82  ? 96.045  99.749  111.359 1.00 129.27 ? 82  ALA A N   1 
ATOM 556   C CA  . ALA A 1 82  ? 96.726  98.511  111.717 1.00 116.73 ? 82  ALA A CA  1 
ATOM 557   C C   . ALA A 1 82  ? 96.433  98.124  113.160 1.00 106.52 ? 82  ALA A C   1 
ATOM 558   O O   . ALA A 1 82  ? 95.844  97.071  113.428 1.00 96.85  ? 82  ALA A O   1 
ATOM 559   C CB  . ALA A 1 82  ? 98.232  98.659  111.491 1.00 30.00  ? 82  ALA A CB  1 
ATOM 560   N N   . GLY A 1 83  ? 96.801  98.981  114.101 1.00 114.15 ? 83  GLY A N   1 
ATOM 561   C CA  . GLY A 1 83  ? 96.605  98.657  115.494 1.00 114.95 ? 83  GLY A CA  1 
ATOM 562   C C   . GLY A 1 83  ? 95.405  99.338  116.097 1.00 115.25 ? 83  GLY A C   1 
ATOM 563   O O   . GLY A 1 83  ? 95.407  100.554 116.300 1.00 115.65 ? 83  GLY A O   1 
ATOM 564   N N   . SER A 1 84  ? 94.371  98.560  116.394 1.00 112.07 ? 84  SER A N   1 
ATOM 565   C CA  . SER A 1 84  ? 93.165  99.114  116.978 1.00 124.31 ? 84  SER A CA  1 
ATOM 566   C C   . SER A 1 84  ? 92.525  98.113  117.918 1.00 115.58 ? 84  SER A C   1 
ATOM 567   O O   . SER A 1 84  ? 92.426  96.927  117.599 1.00 106.26 ? 84  SER A O   1 
ATOM 568   C CB  . SER A 1 84  ? 92.148  99.503  115.916 1.00 30.00  ? 84  SER A CB  1 
ATOM 569   O OG  . SER A 1 84  ? 90.944  99.850  116.561 1.00 30.00  ? 84  SER A OG  1 
ATOM 570   N N   . GLU A 1 85  ? 92.095  98.602  119.075 1.00 118.56 ? 85  GLU A N   1 
ATOM 571   C CA  . GLU A 1 85  ? 91.322  97.791  120.006 1.00 105.86 ? 85  GLU A CA  1 
ATOM 572   C C   . GLU A 1 85  ? 89.837  98.146  119.910 1.00 107.85 ? 85  GLU A C   1 
ATOM 573   O O   . GLU A 1 85  ? 89.225  98.659  120.846 1.00 104.84 ? 85  GLU A O   1 
ATOM 574   C CB  . GLU A 1 85  ? 91.865  97.960  121.419 1.00 30.00  ? 85  GLU A CB  1 
ATOM 575   C CG  . GLU A 1 85  ? 93.294  97.467  121.558 1.00 30.00  ? 85  GLU A CG  1 
ATOM 576   C CD  . GLU A 1 85  ? 93.834  97.616  122.962 1.00 30.00  ? 85  GLU A CD  1 
ATOM 577   O OE1 . GLU A 1 85  ? 93.115  98.174  123.813 1.00 30.00  ? 85  GLU A OE1 1 
ATOM 578   O OE2 . GLU A 1 85  ? 94.977  97.181  123.217 1.00 30.00  ? 85  GLU A OE2 1 
ATOM 579   N N   . GLY A 1 86  ? 89.256  97.848  118.748 1.00 113.31 ? 86  GLY A N   1 
ATOM 580   C CA  . GLY A 1 86  ? 87.810  97.818  118.634 1.00 111.17 ? 86  GLY A CA  1 
ATOM 581   C C   . GLY A 1 86  ? 87.026  99.116  118.663 1.00 101.55 ? 86  GLY A C   1 
ATOM 582   O O   . GLY A 1 86  ? 86.442  99.431  119.703 1.00 106.00 ? 86  GLY A O   1 
ATOM 583   N N   . ILE A 1 87  ? 87.042  99.907  117.587 1.00 75.80  ? 87  ILE A N   1 
ATOM 584   C CA  . ILE A 1 87  ? 86.117  101.037 117.489 1.00 73.31  ? 87  ILE A CA  1 
ATOM 585   C C   . ILE A 1 87  ? 84.689  100.507 117.439 1.00 100.35 ? 87  ILE A C   1 
ATOM 586   O O   . ILE A 1 87  ? 84.355  99.662  116.601 1.00 117.40 ? 87  ILE A O   1 
ATOM 587   C CB  . ILE A 1 87  ? 86.394  101.900 116.251 1.00 30.00  ? 87  ILE A CB  1 
ATOM 588   C CG1 . ILE A 1 87  ? 87.815  102.436 116.212 1.00 30.00  ? 87  ILE A CG1 1 
ATOM 589   C CG2 . ILE A 1 87  ? 85.432  103.059 116.190 1.00 30.00  ? 87  ILE A CG2 1 
ATOM 590   C CD1 . ILE A 1 87  ? 88.679  101.696 115.245 1.00 30.00  ? 87  ILE A CD1 1 
ATOM 591   N N   . ASP A 1 88  ? 83.838  101.005 118.328 1.00 103.88 ? 88  ASP A N   1 
ATOM 592   C CA  . ASP A 1 88  ? 82.428  100.655 118.312 1.00 95.71  ? 88  ASP A CA  1 
ATOM 593   C C   . ASP A 1 88  ? 81.672  101.701 117.503 1.00 94.42  ? 88  ASP A C   1 
ATOM 594   O O   . ASP A 1 88  ? 82.053  102.872 117.467 1.00 101.39 ? 88  ASP A O   1 
ATOM 595   C CB  . ASP A 1 88  ? 81.885  100.574 119.742 1.00 30.00  ? 88  ASP A CB  1 
ATOM 596   C CG  . ASP A 1 88  ? 80.543  99.862  119.834 1.00 30.00  ? 88  ASP A CG  1 
ATOM 597   O OD1 . ASP A 1 88  ? 79.985  99.467  118.792 1.00 30.00  ? 88  ASP A OD1 1 
ATOM 598   O OD2 . ASP A 1 88  ? 80.044  99.687  120.966 1.00 30.00  ? 88  ASP A OD2 1 
ATOM 599   N N   . LEU A 1 89  ? 80.596  101.271 116.842 1.00 99.19  ? 89  LEU A N   1 
ATOM 600   C CA  . LEU A 1 89  ? 79.849  102.153 115.952 1.00 104.74 ? 89  LEU A CA  1 
ATOM 601   C C   . LEU A 1 89  ? 78.509  102.606 116.514 1.00 110.40 ? 89  LEU A C   1 
ATOM 602   O O   . LEU A 1 89  ? 77.808  103.377 115.853 1.00 132.98 ? 89  LEU A O   1 
ATOM 603   C CB  . LEU A 1 89  ? 79.619  101.489 114.600 1.00 30.00  ? 89  LEU A CB  1 
ATOM 604   C CG  . LEU A 1 89  ? 80.833  101.213 113.733 1.00 30.00  ? 89  LEU A CG  1 
ATOM 605   C CD1 . LEU A 1 89  ? 80.346  100.499 112.523 1.00 30.00  ? 89  LEU A CD1 1 
ATOM 606   C CD2 . LEU A 1 89  ? 81.531  102.495 113.345 1.00 30.00  ? 89  LEU A CD2 1 
ATOM 607   N N   . ASN A 1 90  ? 78.128  102.156 117.706 1.00 101.49 ? 90  ASN A N   1 
ATOM 608   C CA  . ASN A 1 90  ? 77.031  102.830 118.382 1.00 104.71 ? 90  ASN A CA  1 
ATOM 609   C C   . ASN A 1 90  ? 77.518  104.147 118.971 1.00 105.99 ? 90  ASN A C   1 
ATOM 610   O O   . ASN A 1 90  ? 76.709  105.027 119.280 1.00 109.37 ? 90  ASN A O   1 
ATOM 611   C CB  . ASN A 1 90  ? 76.433  101.922 119.456 1.00 30.00  ? 90  ASN A CB  1 
ATOM 612   C CG  . ASN A 1 90  ? 74.960  102.210 119.725 1.00 30.00  ? 90  ASN A CG  1 
ATOM 613   O OD1 . ASN A 1 90  ? 74.258  101.388 120.313 1.00 30.00  ? 90  ASN A OD1 1 
ATOM 614   N ND2 . ASN A 1 90  ? 74.480  103.362 119.276 1.00 30.00  ? 90  ASN A ND2 1 
ATOM 615   N N   . ASN A 1 91  ? 78.834  104.292 119.138 1.00 96.80  ? 91  ASN A N   1 
ATOM 616   C CA  . ASN A 1 91  ? 79.467  105.576 119.424 1.00 97.18  ? 91  ASN A CA  1 
ATOM 617   C C   . ASN A 1 91  ? 80.402  105.911 118.265 1.00 103.39 ? 91  ASN A C   1 
ATOM 618   O O   . ASN A 1 91  ? 81.604  105.656 118.302 1.00 107.67 ? 91  ASN A O   1 
ATOM 619   C CB  . ASN A 1 91  ? 80.215  105.525 120.747 1.00 30.00  ? 91  ASN A CB  1 
ATOM 620   C CG  . ASN A 1 91  ? 79.303  105.290 121.916 1.00 30.00  ? 91  ASN A CG  1 
ATOM 621   O OD1 . ASN A 1 91  ? 79.407  104.277 122.604 1.00 30.00  ? 91  ASN A OD1 1 
ATOM 622   N ND2 . ASN A 1 91  ? 78.394  106.224 122.148 1.00 30.00  ? 91  ASN A ND2 1 
ATOM 623   N N   . THR A 1 92  ? 79.827  106.499 117.219 1.00 101.15 ? 92  THR A N   1 
ATOM 624   C CA  . THR A 1 92  ? 80.582  106.953 116.057 1.00 84.54  ? 92  THR A CA  1 
ATOM 625   C C   . THR A 1 92  ? 79.758  108.016 115.352 1.00 86.65  ? 92  THR A C   1 
ATOM 626   O O   . THR A 1 92  ? 78.575  107.800 115.082 1.00 106.48 ? 92  THR A O   1 
ATOM 627   C CB  . THR A 1 92  ? 80.896  105.802 115.096 1.00 30.00  ? 92  THR A CB  1 
ATOM 628   O OG1 . THR A 1 92  ? 81.754  104.859 115.741 1.00 30.00  ? 92  THR A OG1 1 
ATOM 629   C CG2 . THR A 1 92  ? 81.589  106.310 113.852 1.00 30.00  ? 92  THR A CG2 1 
ATOM 630   N N   . ARG A 1 93  ? 80.367  109.162 115.074 1.00 78.31  ? 93  ARG A N   1 
ATOM 631   C CA  . ARG A 1 93  ? 79.685  110.250 114.396 1.00 89.86  ? 93  ARG A CA  1 
ATOM 632   C C   . ARG A 1 93  ? 80.434  110.612 113.122 1.00 89.07  ? 93  ARG A C   1 
ATOM 633   O O   . ARG A 1 93  ? 81.580  111.064 113.171 1.00 106.87 ? 93  ARG A O   1 
ATOM 634   C CB  . ARG A 1 93  ? 79.564  111.460 115.314 1.00 30.00  ? 93  ARG A CB  1 
ATOM 635   C CG  . ARG A 1 93  ? 78.797  111.150 116.585 1.00 30.00  ? 93  ARG A CG  1 
ATOM 636   C CD  . ARG A 1 93  ? 77.371  110.762 116.265 1.00 30.00  ? 93  ARG A CD  1 
ATOM 637   N NE  . ARG A 1 93  ? 76.569  110.504 117.457 1.00 30.00  ? 93  ARG A NE  1 
ATOM 638   C CZ  . ARG A 1 93  ? 76.445  109.310 118.023 1.00 30.00  ? 93  ARG A CZ  1 
ATOM 639   N NH1 . ARG A 1 93  ? 77.077  108.269 117.509 1.00 30.00  ? 93  ARG A NH1 1 
ATOM 640   N NH2 . ARG A 1 93  ? 75.687  109.151 119.097 1.00 30.00  ? 93  ARG A NH2 1 
ATOM 641   N N   . VAL A 1 94  ? 79.776  110.416 111.981 1.00 84.22  ? 94  VAL A N   1 
ATOM 642   C CA  . VAL A 1 94  ? 80.372  110.695 110.679 1.00 73.51  ? 94  VAL A CA  1 
ATOM 643   C C   . VAL A 1 94  ? 80.045  112.133 110.317 1.00 86.10  ? 94  VAL A C   1 
ATOM 644   O O   . VAL A 1 94  ? 78.971  112.422 109.782 1.00 102.58 ? 94  VAL A O   1 
ATOM 645   C CB  . VAL A 1 94  ? 79.851  109.720 109.611 1.00 30.00  ? 94  VAL A CB  1 
ATOM 646   C CG1 . VAL A 1 94  ? 80.477  110.010 108.258 1.00 30.00  ? 94  VAL A CG1 1 
ATOM 647   C CG2 . VAL A 1 94  ? 80.117  108.292 110.034 1.00 30.00  ? 94  VAL A CG2 1 
ATOM 648   N N   . VAL A 1 95  ? 80.953  113.052 110.624 1.00 80.17  ? 95  VAL A N   1 
ATOM 649   C CA  . VAL A 1 95  ? 80.665  114.476 110.525 1.00 77.28  ? 95  VAL A CA  1 
ATOM 650   C C   . VAL A 1 95  ? 81.133  114.944 109.154 1.00 86.14  ? 95  VAL A C   1 
ATOM 651   O O   . VAL A 1 95  ? 82.304  115.262 108.961 1.00 98.38  ? 95  VAL A O   1 
ATOM 652   C CB  . VAL A 1 95  ? 81.337  115.268 111.644 1.00 30.00  ? 95  VAL A CB  1 
ATOM 653   C CG1 . VAL A 1 95  ? 80.936  116.725 111.571 1.00 30.00  ? 95  VAL A CG1 1 
ATOM 654   C CG2 . VAL A 1 95  ? 81.000  114.668 112.984 1.00 30.00  ? 95  VAL A CG2 1 
ATOM 655   N N   . LEU A 1 96  ? 80.217  114.992 108.198 1.00 91.86  ? 96  LEU A N   1 
ATOM 656   C CA  . LEU A 1 96  ? 80.499  115.572 106.895 1.00 76.62  ? 96  LEU A CA  1 
ATOM 657   C C   . LEU A 1 96  ? 79.792  116.913 106.796 1.00 90.23  ? 96  LEU A C   1 
ATOM 658   O O   . LEU A 1 96  ? 78.613  117.027 107.144 1.00 122.98 ? 96  LEU A O   1 
ATOM 659   C CB  . LEU A 1 96  ? 80.091  114.625 105.760 1.00 30.00  ? 96  LEU A CB  1 
ATOM 660   C CG  . LEU A 1 96  ? 78.671  114.104 105.522 1.00 30.00  ? 96  LEU A CG  1 
ATOM 661   C CD1 . LEU A 1 96  ? 77.865  115.009 104.618 1.00 30.00  ? 96  LEU A CD1 1 
ATOM 662   C CD2 . LEU A 1 96  ? 78.723  112.702 104.944 1.00 30.00  ? 96  LEU A CD2 1 
ATOM 663   N N   . SER A 1 97  ? 80.518  117.924 106.326 1.00 77.79  ? 97  SER A N   1 
ATOM 664   C CA  . SER A 1 97  ? 79.991  119.274 106.156 1.00 80.19  ? 97  SER A CA  1 
ATOM 665   C C   . SER A 1 97  ? 79.189  119.362 104.872 1.00 99.22  ? 97  SER A C   1 
ATOM 666   O O   . SER A 1 97  ? 78.698  118.349 104.381 1.00 107.37 ? 97  SER A O   1 
ATOM 667   C CB  . SER A 1 97  ? 81.115  120.305 106.129 1.00 30.00  ? 97  SER A CB  1 
ATOM 668   O OG  . SER A 1 97  ? 81.913  120.150 104.971 1.00 30.00  ? 97  SER A OG  1 
ATOM 669   N N   . ASN A 1 98  ? 78.953  120.573 104.385 1.00 30.00  ? 98  ASN A N   1 
ATOM 670   C CA  . ASN A 1 98  ? 78.576  120.763 102.993 1.00 30.00  ? 98  ASN A CA  1 
ATOM 671   C C   . ASN A 1 98  ? 79.381  121.959 102.518 1.00 30.00  ? 98  ASN A C   1 
ATOM 672   O O   . ASN A 1 98  ? 80.325  122.379 103.193 1.00 30.00  ? 98  ASN A O   1 
ATOM 673   C CB  . ASN A 1 98  ? 77.068  120.999 102.843 1.00 30.00  ? 98  ASN A CB  1 
ATOM 674   C CG  . ASN A 1 98  ? 76.544  120.682 101.444 1.00 30.00  ? 98  ASN A CG  1 
ATOM 675   O OD1 . ASN A 1 98  ? 77.308  120.327 100.552 1.00 30.00  ? 98  ASN A OD1 1 
ATOM 676   N ND2 . ASN A 1 98  ? 75.233  120.783 101.264 1.00 30.00  ? 98  ASN A ND2 1 
ATOM 677   N N   . GLY A 1 99  ? 79.038  122.510 101.359 1.00 30.00  ? 99  GLY A N   1 
ATOM 678   C CA  . GLY A 1 99  ? 79.403  123.883 101.111 1.00 30.00  ? 99  GLY A CA  1 
ATOM 679   C C   . GLY A 1 99  ? 78.655  124.859 101.992 1.00 30.00  ? 99  GLY A C   1 
ATOM 680   O O   . GLY A 1 99  ? 79.130  125.978 102.196 1.00 30.00  ? 99  GLY A O   1 
ATOM 681   N N   . THR A 1 100 ? 77.495  124.463 102.523 1.00 85.87  ? 100 THR A N   1 
ATOM 682   C CA  . THR A 1 100 ? 76.695  125.362 103.344 1.00 102.79 ? 100 THR A CA  1 
ATOM 683   C C   . THR A 1 100 ? 76.424  124.838 104.749 1.00 104.11 ? 100 THR A C   1 
ATOM 684   O O   . THR A 1 100 ? 76.686  125.550 105.724 1.00 96.07  ? 100 THR A O   1 
ATOM 685   C CB  . THR A 1 100 ? 75.372  125.655 102.627 1.00 30.00  ? 100 THR A CB  1 
ATOM 686   O OG1 . THR A 1 100 ? 75.649  126.161 101.318 1.00 30.00  ? 100 THR A OG1 1 
ATOM 687   C CG2 . THR A 1 100 ? 74.586  126.702 103.386 1.00 30.00  ? 100 THR A CG2 1 
ATOM 688   N N   . VAL A 1 101 ? 75.928  123.609 104.894 1.00 97.64  ? 101 VAL A N   1 
ATOM 689   C CA  . VAL A 1 101 ? 75.307  123.148 106.135 1.00 100.35 ? 101 VAL A CA  1 
ATOM 690   C C   . VAL A 1 101 ? 76.071  121.946 106.671 1.00 117.38 ? 101 VAL A C   1 
ATOM 691   O O   . VAL A 1 101 ? 76.266  120.961 105.953 1.00 123.46 ? 101 VAL A O   1 
ATOM 692   C CB  . VAL A 1 101 ? 73.826  122.780 105.916 1.00 30.00  ? 101 VAL A CB  1 
ATOM 693   C CG1 . VAL A 1 101 ? 73.199  122.277 107.197 1.00 30.00  ? 101 VAL A CG1 1 
ATOM 694   C CG2 . VAL A 1 101 ? 73.043  123.964 105.384 1.00 30.00  ? 101 VAL A CG2 1 
ATOM 695   N N   . GLN A 1 102 ? 76.473  122.014 107.941 1.00 107.35 ? 102 GLN A N   1 
ATOM 696   C CA  . GLN A 1 102 ? 77.085  120.883 108.630 1.00 99.10  ? 102 GLN A CA  1 
ATOM 697   C C   . GLN A 1 102 ? 76.127  119.703 108.733 1.00 93.31  ? 102 GLN A C   1 
ATOM 698   O O   . GLN A 1 102 ? 74.910  119.829 108.588 1.00 114.39 ? 102 GLN A O   1 
ATOM 699   C CB  . GLN A 1 102 ? 77.521  121.269 110.042 1.00 30.00  ? 102 GLN A CB  1 
ATOM 700   C CG  . GLN A 1 102 ? 78.760  122.103 110.117 1.00 30.00  ? 102 GLN A CG  1 
ATOM 701   C CD  . GLN A 1 102 ? 79.996  121.302 109.807 1.00 30.00  ? 102 GLN A CD  1 
ATOM 702   O OE1 . GLN A 1 102 ? 80.142  120.168 110.250 1.00 30.00  ? 102 GLN A OE1 1 
ATOM 703   N NE2 . GLN A 1 102 ? 80.886  121.879 109.033 1.00 30.00  ? 102 GLN A NE2 1 
ATOM 704   N N   . ALA A 1 103 ? 76.698  118.540 109.017 1.00 90.25  ? 103 ALA A N   1 
ATOM 705   C CA  . ALA A 1 103 ? 75.892  117.375 109.326 1.00 88.34  ? 103 ALA A CA  1 
ATOM 706   C C   . ALA A 1 103 ? 76.688  116.451 110.224 1.00 104.79 ? 103 ALA A C   1 
ATOM 707   O O   . ALA A 1 103 ? 77.892  116.276 110.032 1.00 117.96 ? 103 ALA A O   1 
ATOM 708   C CB  . ALA A 1 103 ? 75.462  116.633 108.062 1.00 30.00  ? 103 ALA A CB  1 
ATOM 709   N N   . VAL A 1 104 ? 76.013  115.884 111.213 1.00 94.80  ? 104 VAL A N   1 
ATOM 710   C CA  . VAL A 1 104 ? 76.548  114.784 111.996 1.00 109.96 ? 104 VAL A CA  1 
ATOM 711   C C   . VAL A 1 104 ? 75.585  113.621 111.835 1.00 89.25  ? 104 VAL A C   1 
ATOM 712   O O   . VAL A 1 104 ? 74.398  113.812 111.556 1.00 75.68  ? 104 VAL A O   1 
ATOM 713   C CB  . VAL A 1 104 ? 76.749  115.160 113.477 1.00 30.00  ? 104 VAL A CB  1 
ATOM 714   C CG1 . VAL A 1 104 ? 77.734  116.299 113.594 1.00 30.00  ? 104 VAL A CG1 1 
ATOM 715   C CG2 . VAL A 1 104 ? 75.445  115.554 114.100 1.00 30.00  ? 104 VAL A CG2 1 
ATOM 716   N N   . LEU A 1 105 ? 76.105  112.407 111.954 1.00 88.49  ? 105 LEU A N   1 
ATOM 717   C CA  . LEU A 1 105 ? 75.346  111.216 111.593 1.00 98.24  ? 105 LEU A CA  1 
ATOM 718   C C   . LEU A 1 105 ? 75.370  110.226 112.750 1.00 91.87  ? 105 LEU A C   1 
ATOM 719   O O   . LEU A 1 105 ? 76.417  109.654 113.065 1.00 103.67 ? 105 LEU A O   1 
ATOM 720   C CB  . LEU A 1 105 ? 75.894  110.584 110.314 1.00 30.00  ? 105 LEU A CB  1 
ATOM 721   C CG  . LEU A 1 105 ? 75.443  111.119 108.943 1.00 30.00  ? 105 LEU A CG  1 
ATOM 722   C CD1 . LEU A 1 105 ? 73.937  111.057 108.826 1.00 30.00  ? 105 LEU A CD1 1 
ATOM 723   C CD2 . LEU A 1 105 ? 75.937  112.501 108.565 1.00 30.00  ? 105 LEU A CD2 1 
ATOM 724   N N   . LYS A 1 106 ? 74.215  110.034 113.379 1.00 80.59  ? 106 LYS A N   1 
ATOM 725   C CA  . LYS A 1 106 ? 74.027  109.084 114.465 1.00 95.20  ? 106 LYS A CA  1 
ATOM 726   C C   . LYS A 1 106 ? 73.775  107.704 113.877 1.00 109.74 ? 106 LYS A C   1 
ATOM 727   O O   . LYS A 1 106 ? 73.282  107.580 112.755 1.00 125.41 ? 106 LYS A O   1 
ATOM 728   C CB  . LYS A 1 106 ? 72.849  109.529 115.343 1.00 30.00  ? 106 LYS A CB  1 
ATOM 729   C CG  . LYS A 1 106 ? 72.577  108.723 116.608 1.00 30.00  ? 106 LYS A CG  1 
ATOM 730   C CD  . LYS A 1 106 ? 71.492  109.379 117.444 1.00 30.00  ? 106 LYS A CD  1 
ATOM 731   C CE  . LYS A 1 106 ? 70.134  109.269 116.779 1.00 30.00  ? 106 LYS A CE  1 
ATOM 732   N NZ  . LYS A 1 106 ? 69.654  107.862 116.751 1.00 30.00  ? 106 LYS A NZ  1 
ATOM 733   N N   . TYR A 1 107 ? 74.147  106.667 114.624 1.00 113.92 ? 107 TYR A N   1 
ATOM 734   C CA  . TYR A 1 107 ? 73.937  105.302 114.159 1.00 120.86 ? 107 TYR A CA  1 
ATOM 735   C C   . TYR A 1 107 ? 72.452  104.960 114.102 1.00 104.10 ? 107 TYR A C   1 
ATOM 736   O O   . TYR A 1 107 ? 71.654  105.422 114.921 1.00 105.66 ? 107 TYR A O   1 
ATOM 737   C CB  . TYR A 1 107 ? 74.670  104.307 115.058 1.00 30.00  ? 107 TYR A CB  1 
ATOM 738   C CG  . TYR A 1 107 ? 74.544  102.882 114.578 1.00 30.00  ? 107 TYR A CG  1 
ATOM 739   C CD1 . TYR A 1 107 ? 75.275  102.439 113.494 1.00 30.00  ? 107 TYR A CD1 1 
ATOM 740   C CD2 . TYR A 1 107 ? 73.673  101.989 115.190 1.00 30.00  ? 107 TYR A CD2 1 
ATOM 741   C CE1 . TYR A 1 107 ? 75.162  101.148 113.048 1.00 30.00  ? 107 TYR A CE1 1 
ATOM 742   C CE2 . TYR A 1 107 ? 73.554  100.690 114.742 1.00 30.00  ? 107 TYR A CE2 1 
ATOM 743   C CZ  . TYR A 1 107 ? 74.299  100.279 113.668 1.00 30.00  ? 107 TYR A CZ  1 
ATOM 744   O OH  . TYR A 1 107 ? 74.187  98.986  113.225 1.00 30.00  ? 107 TYR A OH  1 
ATOM 745   N N   . GLU A 1 108 ? 72.089  104.149 113.116 1.00 101.18 ? 108 GLU A N   1 
ATOM 746   C CA  . GLU A 1 108 ? 70.731  103.680 112.925 1.00 107.42 ? 108 GLU A CA  1 
ATOM 747   C C   . GLU A 1 108 ? 70.740  102.162 112.880 1.00 97.36  ? 108 GLU A C   1 
ATOM 748   O O   . GLU A 1 108 ? 71.655  101.557 112.315 1.00 99.71  ? 108 GLU A O   1 
ATOM 749   C CB  . GLU A 1 108 ? 70.144  104.258 111.637 1.00 30.00  ? 108 GLU A CB  1 
ATOM 750   C CG  . GLU A 1 108 ? 68.698  103.893 111.337 1.00 30.00  ? 108 GLU A CG  1 
ATOM 751   C CD  . GLU A 1 108 ? 67.707  104.474 112.329 1.00 30.00  ? 108 GLU A CD  1 
ATOM 752   O OE1 . GLU A 1 108 ? 68.011  105.510 112.954 1.00 30.00  ? 108 GLU A OE1 1 
ATOM 753   O OE2 . GLU A 1 108 ? 66.610  103.894 112.480 1.00 30.00  ? 108 GLU A OE2 1 
ATOM 754   N N   . LYS A 1 109 ? 69.731  101.549 113.495 1.00 87.60  ? 109 LYS A N   1 
ATOM 755   C CA  . LYS A 1 109 ? 69.548  100.110 113.431 1.00 83.82  ? 109 LYS A CA  1 
ATOM 756   C C   . LYS A 1 109 ? 68.916  99.725  112.097 1.00 93.03  ? 109 LYS A C   1 
ATOM 757   O O   . LYS A 1 109 ? 68.669  100.569 111.230 1.00 117.66 ? 109 LYS A O   1 
ATOM 758   C CB  . LYS A 1 109 ? 68.676  99.634  114.588 1.00 30.00  ? 109 LYS A CB  1 
ATOM 759   C CG  . LYS A 1 109 ? 69.276  99.871  115.954 1.00 30.00  ? 109 LYS A CG  1 
ATOM 760   C CD  . LYS A 1 109 ? 68.317  99.443  117.049 1.00 30.00  ? 109 LYS A CD  1 
ATOM 761   C CE  . LYS A 1 109 ? 68.862  99.779  118.429 1.00 30.00  ? 109 LYS A CE  1 
ATOM 762   N NZ  . LYS A 1 109 ? 67.915  99.415  119.520 1.00 30.00  ? 109 LYS A NZ  1 
ATOM 763   N N   . THR A 1 110 ? 68.633  98.429  111.962 1.00 94.95  ? 110 THR A N   1 
ATOM 764   C CA  . THR A 1 110 ? 67.954  97.816  110.812 1.00 121.68 ? 110 THR A CA  1 
ATOM 765   C C   . THR A 1 110 ? 68.634  98.158  109.488 1.00 133.18 ? 110 THR A C   1 
ATOM 766   O O   . THR A 1 110 ? 68.002  98.635  108.544 1.00 143.94 ? 110 THR A O   1 
ATOM 767   C CB  . THR A 1 110 ? 66.466  98.188  110.762 1.00 30.00  ? 110 THR A CB  1 
ATOM 768   O OG1 . THR A 1 110 ? 66.317  99.588  110.497 1.00 30.00  ? 110 THR A OG1 1 
ATOM 769   C CG2 . THR A 1 110 ? 65.794  97.860  112.081 1.00 30.00  ? 110 THR A CG2 1 
ATOM 770   N N   . ALA A 1 111 ? 69.946  97.926  109.427 1.00 106.50 ? 111 ALA A N   1 
ATOM 771   C CA  . ALA A 1 111 ? 70.664  98.078  108.161 1.00 107.45 ? 111 ALA A CA  1 
ATOM 772   C C   . ALA A 1 111 ? 71.863  97.127  108.156 1.00 124.52 ? 111 ALA A C   1 
ATOM 773   O O   . ALA A 1 111 ? 72.935  97.477  108.643 1.00 140.43 ? 111 ALA A O   1 
ATOM 774   C CB  . ALA A 1 111 ? 71.099  99.521  107.955 1.00 30.00  ? 111 ALA A CB  1 
ATOM 775   N N   . TYR A 1 112 ? 71.673  95.918  107.621 1.00 30.00  ? 112 TYR A N   1 
ATOM 776   C CA  . TYR A 1 112 ? 72.829  95.084  107.297 1.00 30.00  ? 112 TYR A CA  1 
ATOM 777   C C   . TYR A 1 112 ? 72.904  94.659  105.836 1.00 30.00  ? 112 TYR A C   1 
ATOM 778   O O   . TYR A 1 112 ? 73.821  95.109  105.145 1.00 30.00  ? 112 TYR A O   1 
ATOM 779   C CB  . TYR A 1 112 ? 72.881  93.880  108.239 1.00 30.00  ? 112 TYR A CB  1 
ATOM 780   C CG  . TYR A 1 112 ? 73.539  94.262  109.533 1.00 30.00  ? 112 TYR A CG  1 
ATOM 781   C CD1 . TYR A 1 112 ? 74.914  94.172  109.666 1.00 30.00  ? 112 TYR A CD1 1 
ATOM 782   C CD2 . TYR A 1 112 ? 72.811  94.792  110.585 1.00 30.00  ? 112 TYR A CD2 1 
ATOM 783   C CE1 . TYR A 1 112 ? 75.544  94.540  110.823 1.00 30.00  ? 112 TYR A CE1 1 
ATOM 784   C CE2 . TYR A 1 112 ? 73.439  95.169  111.754 1.00 30.00  ? 112 TYR A CE2 1 
ATOM 785   C CZ  . TYR A 1 112 ? 74.802  95.040  111.861 1.00 30.00  ? 112 TYR A CZ  1 
ATOM 786   O OH  . TYR A 1 112 ? 75.433  95.419  113.014 1.00 30.00  ? 112 TYR A OH  1 
ATOM 787   N N   . HIS A 1 113 ? 71.943  93.874  105.337 1.00 30.00  ? 113 HIS A N   1 
ATOM 788   C CA  . HIS A 1 113 ? 71.894  93.363  103.955 1.00 30.00  ? 113 HIS A CA  1 
ATOM 789   C C   . HIS A 1 113 ? 73.234  92.749  103.521 1.00 30.00  ? 113 HIS A C   1 
ATOM 790   O O   . HIS A 1 113 ? 73.904  93.216  102.601 1.00 30.00  ? 113 HIS A O   1 
ATOM 791   C CB  . HIS A 1 113 ? 71.438  94.475  103.005 1.00 30.00  ? 113 HIS A CB  1 
ATOM 792   C CG  . HIS A 1 113 ? 71.186  94.026  101.601 1.00 30.00  ? 113 HIS A CG  1 
ATOM 793   N ND1 . HIS A 1 113 ? 70.132  93.207  101.259 1.00 30.00  ? 113 HIS A ND1 1 
ATOM 794   C CD2 . HIS A 1 113 ? 71.829  94.315  100.446 1.00 30.00  ? 113 HIS A CD2 1 
ATOM 795   C CE1 . HIS A 1 113 ? 70.149  92.994  99.956  1.00 30.00  ? 113 HIS A CE1 1 
ATOM 796   N NE2 . HIS A 1 113 ? 71.169  93.656  99.439  1.00 30.00  ? 113 HIS A NE2 1 
ATOM 797   N N   . LYS A 1 114 ? 73.645  91.710  104.239 1.00 30.00  ? 114 LYS A N   1 
ATOM 798   C CA  . LYS A 1 114 ? 75.026  91.254  104.184 1.00 30.00  ? 114 LYS A CA  1 
ATOM 799   C C   . LYS A 1 114 ? 75.238  89.959  103.410 1.00 30.00  ? 114 LYS A C   1 
ATOM 800   O O   . LYS A 1 114 ? 76.350  89.421  103.438 1.00 30.00  ? 114 LYS A O   1 
ATOM 801   C CB  . LYS A 1 114 ? 75.569  91.096  105.605 1.00 30.00  ? 114 LYS A CB  1 
ATOM 802   C CG  . LYS A 1 114 ? 74.837  90.071  106.439 1.00 30.00  ? 114 LYS A CG  1 
ATOM 803   C CD  . LYS A 1 114 ? 75.400  90.012  107.847 1.00 30.00  ? 114 LYS A CD  1 
ATOM 804   C CE  . LYS A 1 114 ? 74.680  88.967  108.678 1.00 30.00  ? 114 LYS A CE  1 
ATOM 805   N NZ  . LYS A 1 114 ? 75.214  88.889  110.062 1.00 30.00  ? 114 LYS A NZ  1 
ATOM 806   N N   . GLY A 1 115 ? 74.224  89.447  102.715 1.00 30.00  ? 115 GLY A N   1 
ATOM 807   C CA  . GLY A 1 115 ? 74.374  88.194  101.994 1.00 30.00  ? 115 GLY A CA  1 
ATOM 808   C C   . GLY A 1 115 ? 74.207  88.317  100.493 1.00 30.00  ? 115 GLY A C   1 
ATOM 809   O O   . GLY A 1 115 ? 74.792  87.546  99.728  1.00 30.00  ? 115 GLY A O   1 
ATOM 810   N N   . ALA A 1 116 ? 73.403  89.287  100.064 1.00 30.00  ? 116 ALA A N   1 
ATOM 811   C CA  . ALA A 1 116 ? 73.205  89.617  98.654  1.00 30.00  ? 116 ALA A CA  1 
ATOM 812   C C   . ALA A 1 116 ? 73.976  90.871  98.279  1.00 30.00  ? 116 ALA A C   1 
ATOM 813   O O   . ALA A 1 116 ? 73.497  91.720  97.523  1.00 30.00  ? 116 ALA A O   1 
ATOM 814   C CB  . ALA A 1 116 ? 71.722  89.782  98.342  1.00 30.00  ? 116 ALA A CB  1 
ATOM 815   N N   . VAL A 1 117 ? 75.198  90.984  98.800  1.00 30.00  ? 117 VAL A N   1 
ATOM 816   C CA  . VAL A 1 117 ? 75.990  92.209  98.827  1.00 30.00  ? 117 VAL A CA  1 
ATOM 817   C C   . VAL A 1 117 ? 76.533  92.548  97.439  1.00 30.00  ? 117 VAL A C   1 
ATOM 818   O O   . VAL A 1 117 ? 77.047  93.649  97.213  1.00 30.00  ? 117 VAL A O   1 
ATOM 819   C CB  . VAL A 1 117 ? 77.118  92.049  99.867  1.00 30.00  ? 117 VAL A CB  1 
ATOM 820   C CG1 . VAL A 1 117 ? 78.172  91.066  99.375  1.00 30.00  ? 117 VAL A CG1 1 
ATOM 821   C CG2 . VAL A 1 117 ? 77.707  93.391  100.327 1.00 30.00  ? 117 VAL A CG2 1 
ATOM 822   N N   . GLY A 1 118 ? 76.368  91.629  96.482  1.00 30.00  ? 118 GLY A N   1 
ATOM 823   C CA  . GLY A 1 118 ? 76.898  91.786  95.135  1.00 30.00  ? 118 GLY A CA  1 
ATOM 824   C C   . GLY A 1 118 ? 76.328  92.944  94.343  1.00 30.00  ? 118 GLY A C   1 
ATOM 825   O O   . GLY A 1 118 ? 76.892  93.304  93.308  1.00 30.00  ? 118 GLY A O   1 
ATOM 826   N N   . ASP A 1 119 ? 75.224  93.521  94.786  1.00 30.00  ? 119 ASP A N   1 
ATOM 827   C CA  . ASP A 1 119 ? 74.778  94.821  94.308  1.00 30.00  ? 119 ASP A CA  1 
ATOM 828   C C   . ASP A 1 119 ? 74.751  95.738  95.524  1.00 30.00  ? 119 ASP A C   1 
ATOM 829   O O   . ASP A 1 119 ? 73.937  95.542  96.432  1.00 30.00  ? 119 ASP A O   1 
ATOM 830   C CB  . ASP A 1 119 ? 73.414  94.730  93.629  1.00 30.00  ? 119 ASP A CB  1 
ATOM 831   C CG  . ASP A 1 119 ? 73.459  93.941  92.329  1.00 30.00  ? 119 ASP A CG  1 
ATOM 832   O OD1 . ASP A 1 119 ? 74.534  93.891  91.700  1.00 30.00  ? 119 ASP A OD1 1 
ATOM 833   O OD2 . ASP A 1 119 ? 72.417  93.386  91.924  1.00 30.00  ? 119 ASP A OD2 1 
ATOM 834   N N   . VAL A 1 120 ? 75.662  96.716  95.552  1.00 30.00  ? 120 VAL A N   1 
ATOM 835   C CA  . VAL A 1 120 ? 75.822  97.559  96.735  1.00 30.00  ? 120 VAL A CA  1 
ATOM 836   C C   . VAL A 1 120 ? 74.632  98.496  96.888  1.00 30.00  ? 120 VAL A C   1 
ATOM 837   O O   . VAL A 1 120 ? 74.136  98.724  97.997  1.00 30.00  ? 120 VAL A O   1 
ATOM 838   C CB  . VAL A 1 120 ? 77.149  98.337  96.656  1.00 30.00  ? 120 VAL A CB  1 
ATOM 839   C CG1 . VAL A 1 120 ? 77.343  99.205  97.878  1.00 30.00  ? 120 VAL A CG1 1 
ATOM 840   C CG2 . VAL A 1 120 ? 78.307  97.388  96.512  1.00 30.00  ? 120 VAL A CG2 1 
ATOM 841   N N   . PHE A 1 121 ? 74.125  99.014  95.774  1.00 30.00  ? 121 PHE A N   1 
ATOM 842   C CA  . PHE A 1 121 ? 73.085  100.031 95.786  1.00 30.00  ? 121 PHE A CA  1 
ATOM 843   C C   . PHE A 1 121 ? 71.706  99.456  95.509  1.00 30.00  ? 121 PHE A C   1 
ATOM 844   O O   . PHE A 1 121 ? 70.841  100.151 94.969  1.00 30.00  ? 121 PHE A O   1 
ATOM 845   C CB  . PHE A 1 121 ? 73.442  101.119 94.782  1.00 30.00  ? 121 PHE A CB  1 
ATOM 846   C CG  . PHE A 1 121 ? 74.611  101.943 95.202  1.00 30.00  ? 121 PHE A CG  1 
ATOM 847   C CD1 . PHE A 1 121 ? 74.882  102.130 96.540  1.00 30.00  ? 121 PHE A CD1 1 
ATOM 848   C CD2 . PHE A 1 121 ? 75.490  102.449 94.269  1.00 30.00  ? 121 PHE A CD2 1 
ATOM 849   C CE1 . PHE A 1 121 ? 75.959  102.866 96.934  1.00 30.00  ? 121 PHE A CE1 1 
ATOM 850   C CE2 . PHE A 1 121 ? 76.586  103.175 94.665  1.00 30.00  ? 121 PHE A CE2 1 
ATOM 851   C CZ  . PHE A 1 121 ? 76.808  103.392 95.995  1.00 30.00  ? 121 PHE A CZ  1 
ATOM 852   N N   . ASN A 1 122 ? 71.485  98.198  95.868  1.00 30.00  ? 122 ASN A N   1 
ATOM 853   C CA  . ASN A 1 122 ? 70.151  97.630  95.773  1.00 30.00  ? 122 ASN A CA  1 
ATOM 854   C C   . ASN A 1 122 ? 69.276  98.231  96.866  1.00 30.00  ? 122 ASN A C   1 
ATOM 855   O O   . ASN A 1 122 ? 69.722  98.426  98.000  1.00 30.00  ? 122 ASN A O   1 
ATOM 856   C CB  . ASN A 1 122 ? 70.208  96.106  95.900  1.00 30.00  ? 122 ASN A CB  1 
ATOM 857   C CG  . ASN A 1 122 ? 68.929  95.425  95.438  1.00 30.00  ? 122 ASN A CG  1 
ATOM 858   O OD1 . ASN A 1 122 ? 67.997  96.075  94.961  1.00 30.00  ? 122 ASN A OD1 1 
ATOM 859   N ND2 . ASN A 1 122 ? 68.881  94.107  95.579  1.00 30.00  ? 122 ASN A ND2 1 
ATOM 860   N N   . ALA A 1 123 ? 68.024  98.529  96.521  1.00 30.00  ? 123 ALA A N   1 
ATOM 861   C CA  . ALA A 1 123 ? 67.109  99.191  97.444  1.00 30.00  ? 123 ALA A CA  1 
ATOM 862   C C   . ALA A 1 123 ? 66.605  98.231  98.512  1.00 30.00  ? 123 ALA A C   1 
ATOM 863   O O   . ALA A 1 123 ? 65.419  97.887  98.536  1.00 30.00  ? 123 ALA A O   1 
ATOM 864   C CB  . ALA A 1 123 ? 65.929  99.793  96.680  1.00 30.00  ? 123 ALA A CB  1 
ATOM 865   N N   . SER A 1 124 ? 67.491  97.810  99.408  1.00 30.00  ? 124 SER A N   1 
ATOM 866   C CA  . SER A 1 124 ? 67.194  96.787  100.396 1.00 30.00  ? 124 SER A CA  1 
ATOM 867   C C   . SER A 1 124 ? 66.477  97.396  101.598 1.00 30.00  ? 124 SER A C   1 
ATOM 868   O O   . SER A 1 124 ? 66.010  98.537  101.566 1.00 30.00  ? 124 SER A O   1 
ATOM 869   C CB  . SER A 1 124 ? 68.479  96.089  100.822 1.00 30.00  ? 124 SER A CB  1 
ATOM 870   O OG  . SER A 1 124 ? 68.226  95.126  101.829 1.00 30.00  ? 124 SER A OG  1 
ATOM 871   N N   . THR A 1 125 ? 66.378  96.621  102.680 1.00 30.00  ? 125 THR A N   1 
ATOM 872   C CA  . THR A 1 125 ? 65.940  97.178  103.952 1.00 30.00  ? 125 THR A CA  1 
ATOM 873   C C   . THR A 1 125 ? 67.036  97.997  104.615 1.00 30.00  ? 125 THR A C   1 
ATOM 874   O O   . THR A 1 125 ? 66.748  98.766  105.537 1.00 30.00  ? 125 THR A O   1 
ATOM 875   C CB  . THR A 1 125 ? 65.491  96.066  104.897 1.00 30.00  ? 125 THR A CB  1 
ATOM 876   O OG1 . THR A 1 125 ? 66.592  95.184  105.151 1.00 30.00  ? 125 THR A OG1 1 
ATOM 877   C CG2 . THR A 1 125 ? 64.340  95.284  104.284 1.00 30.00  ? 125 THR A CG2 1 
ATOM 878   N N   . ALA A 1 126 ? 68.277  97.861  104.150 1.00 30.00  ? 126 ALA A N   1 
ATOM 879   C CA  . ALA A 1 126 ? 69.425  98.581  104.680 1.00 30.00  ? 126 ALA A CA  1 
ATOM 880   C C   . ALA A 1 126 ? 69.586  99.975  104.090 1.00 30.00  ? 126 ALA A C   1 
ATOM 881   O O   . ALA A 1 126 ? 70.694  100.520 104.108 1.00 30.00  ? 126 ALA A O   1 
ATOM 882   C CB  . ALA A 1 126 ? 70.692  97.769  104.445 1.00 30.00  ? 126 ALA A CB  1 
ATOM 883   N N   . TRP A 1 127 ? 68.515  100.543 103.544 1.00 30.00  ? 127 TRP A N   1 
ATOM 884   C CA  . TRP A 1 127 ? 68.487  101.913 103.057 1.00 30.00  ? 127 TRP A CA  1 
ATOM 885   C C   . TRP A 1 127 ? 67.257  102.654 103.549 1.00 30.00  ? 127 TRP A C   1 
ATOM 886   O O   . TRP A 1 127 ? 67.013  103.787 103.122 1.00 30.00  ? 127 TRP A O   1 
ATOM 887   C CB  . TRP A 1 127 ? 68.539  101.921 101.533 1.00 30.00  ? 127 TRP A CB  1 
ATOM 888   C CG  . TRP A 1 127 ? 69.867  101.544 101.019 1.00 30.00  ? 127 TRP A CG  1 
ATOM 889   C CD1 . TRP A 1 127 ? 70.356  100.287 100.858 1.00 30.00  ? 127 TRP A CD1 1 
ATOM 890   C CD2 . TRP A 1 127 ? 70.861  102.430 100.514 1.00 30.00  ? 127 TRP A CD2 1 
ATOM 891   N NE1 . TRP A 1 127 ? 71.621  100.336 100.329 1.00 30.00  ? 127 TRP A NE1 1 
ATOM 892   C CE2 . TRP A 1 127 ? 71.951  101.644 100.101 1.00 30.00  ? 127 TRP A CE2 1 
ATOM 893   C CE3 . TRP A 1 127 ? 70.941  103.814 100.381 1.00 30.00  ? 127 TRP A CE3 1 
ATOM 894   C CZ2 . TRP A 1 127 ? 73.105  102.195 99.567  1.00 30.00  ? 127 TRP A CZ2 1 
ATOM 895   C CZ3 . TRP A 1 127 ? 72.087  104.358 99.859  1.00 30.00  ? 127 TRP A CZ3 1 
ATOM 896   C CH2 . TRP A 1 127 ? 73.153  103.553 99.450  1.00 30.00  ? 127 TRP A CH2 1 
ATOM 897   N N   . ASN A 1 128 ? 66.472  102.038 104.427 1.00 30.00  ? 128 ASN A N   1 
ATOM 898   C CA  . ASN A 1 128 ? 65.339  102.696 105.070 1.00 30.00  ? 128 ASN A CA  1 
ATOM 899   C C   . ASN A 1 128 ? 65.905  103.540 106.201 1.00 30.00  ? 128 ASN A C   1 
ATOM 900   O O   . ASN A 1 128 ? 65.937  103.123 107.358 1.00 30.00  ? 128 ASN A O   1 
ATOM 901   C CB  . ASN A 1 128 ? 64.339  101.670 105.585 1.00 30.00  ? 128 ASN A CB  1 
ATOM 902   C CG  . ASN A 1 128 ? 63.033  102.298 106.037 1.00 30.00  ? 128 ASN A CG  1 
ATOM 903   O OD1 . ASN A 1 128 ? 62.815  103.498 105.879 1.00 30.00  ? 128 ASN A OD1 1 
ATOM 904   N ND2 . ASN A 1 128 ? 62.163  101.486 106.625 1.00 30.00  ? 128 ASN A ND2 1 
ATOM 905   N N   . LEU A 1 129 ? 66.364  104.744 105.869 1.00 30.00  ? 129 LEU A N   1 
ATOM 906   C CA  . LEU A 1 129 ? 67.038  105.572 106.854 1.00 30.00  ? 129 LEU A CA  1 
ATOM 907   C C   . LEU A 1 129 ? 66.696  107.033 106.602 1.00 30.00  ? 129 LEU A C   1 
ATOM 908   O O   . LEU A 1 129 ? 66.040  107.380 105.618 1.00 30.00  ? 129 LEU A O   1 
ATOM 909   C CB  . LEU A 1 129 ? 68.546  105.299 106.837 1.00 30.00  ? 129 LEU A CB  1 
ATOM 910   C CG  . LEU A 1 129 ? 69.411  105.581 105.610 1.00 30.00  ? 129 LEU A CG  1 
ATOM 911   C CD1 . LEU A 1 129 ? 70.051  106.947 105.711 1.00 30.00  ? 129 LEU A CD1 1 
ATOM 912   C CD2 . LEU A 1 129 ? 70.464  104.506 105.440 1.00 30.00  ? 129 LEU A CD2 1 
ATOM 913   N N   . SER A 1 130 ? 67.160  107.890 107.509 1.00 30.00  ? 130 SER A N   1 
ATOM 914   C CA  . SER A 1 130 ? 66.690  109.269 107.580 1.00 30.00  ? 130 SER A CA  1 
ATOM 915   C C   . SER A 1 130 ? 67.838  110.268 107.538 1.00 30.00  ? 130 SER A C   1 
ATOM 916   O O   . SER A 1 130 ? 68.955  109.916 107.146 1.00 30.00  ? 130 SER A O   1 
ATOM 917   C CB  . SER A 1 130 ? 65.852  109.484 108.842 1.00 30.00  ? 130 SER A CB  1 
ATOM 918   O OG  . SER A 1 130 ? 66.641  109.353 110.009 1.00 30.00  ? 130 SER A OG  1 
ATOM 919   N N   . ASN A 1 131 ? 67.537  111.522 107.903 1.00 30.00  ? 131 ASN A N   1 
ATOM 920   C CA  . ASN A 1 131 ? 68.480  112.635 107.796 1.00 30.00  ? 131 ASN A CA  1 
ATOM 921   C C   . ASN A 1 131 ? 69.738  112.398 108.626 1.00 30.00  ? 131 ASN A C   1 
ATOM 922   O O   . ASN A 1 131 ? 70.855  112.379 108.099 1.00 30.00  ? 131 ASN A O   1 
ATOM 923   C CB  . ASN A 1 131 ? 67.808  113.930 108.254 1.00 30.00  ? 131 ASN A CB  1 
ATOM 924   C CG  . ASN A 1 131 ? 66.578  114.265 107.454 1.00 30.00  ? 131 ASN A CG  1 
ATOM 925   O OD1 . ASN A 1 131 ? 66.513  114.015 106.254 1.00 30.00  ? 131 ASN A OD1 1 
ATOM 926   N ND2 . ASN A 1 131 ? 65.589  114.850 108.117 1.00 30.00  ? 131 ASN A ND2 1 
ATOM 927   N N   . THR A 1 132 ? 69.569  112.207 109.931 1.00 30.00  ? 132 THR A N   1 
ATOM 928   C CA  . THR A 1 132 ? 70.682  112.159 110.875 1.00 30.00  ? 132 THR A CA  1 
ATOM 929   C C   . THR A 1 132 ? 71.186  110.740 111.076 1.00 30.00  ? 132 THR A C   1 
ATOM 930   O O   . THR A 1 132 ? 71.742  110.414 112.127 1.00 30.00  ? 132 THR A O   1 
ATOM 931   C CB  . THR A 1 132 ? 70.254  112.749 112.211 1.00 30.00  ? 132 THR A CB  1 
ATOM 932   O OG1 . THR A 1 132 ? 69.375  111.831 112.865 1.00 30.00  ? 132 THR A OG1 1 
ATOM 933   C CG2 . THR A 1 132 ? 69.477  114.016 111.980 1.00 30.00  ? 132 THR A CG2 1 
ATOM 934   N N   . ASN A 1 133 ? 71.007  109.868 110.092 1.00 30.00  ? 133 ASN A N   1 
ATOM 935   C CA  . ASN A 1 133 ? 71.279  108.455 110.270 1.00 30.00  ? 133 ASN A CA  1 
ATOM 936   C C   . ASN A 1 133 ? 72.097  107.918 109.107 1.00 30.00  ? 133 ASN A C   1 
ATOM 937   O O   . ASN A 1 133 ? 72.059  108.453 107.998 1.00 30.00  ? 133 ASN A O   1 
ATOM 938   C CB  . ASN A 1 133 ? 69.975  107.678 110.407 1.00 30.00  ? 133 ASN A CB  1 
ATOM 939   C CG  . ASN A 1 133 ? 69.214  108.049 111.654 1.00 30.00  ? 133 ASN A CG  1 
ATOM 940   O OD1 . ASN A 1 133 ? 68.120  108.604 111.591 1.00 30.00  ? 133 ASN A OD1 1 
ATOM 941   N ND2 . ASN A 1 133 ? 69.791  107.737 112.806 1.00 30.00  ? 133 ASN A ND2 1 
ATOM 942   N N   . PHE A 1 134 ? 72.833  106.841 109.369 1.00 30.00  ? 134 PHE A N   1 
ATOM 943   C CA  . PHE A 1 134 ? 73.620  106.193 108.334 1.00 30.00  ? 134 PHE A CA  1 
ATOM 944   C C   . PHE A 1 134 ? 73.413  104.687 108.378 1.00 30.00  ? 134 PHE A C   1 
ATOM 945   O O   . PHE A 1 134 ? 73.193  104.107 109.443 1.00 30.00  ? 134 PHE A O   1 
ATOM 946   C CB  . PHE A 1 134 ? 75.121  106.527 108.444 1.00 30.00  ? 134 PHE A CB  1 
ATOM 947   C CG  . PHE A 1 134 ? 75.768  106.111 109.742 1.00 30.00  ? 134 PHE A CG  1 
ATOM 948   C CD1 . PHE A 1 134 ? 75.823  106.989 110.806 1.00 30.00  ? 134 PHE A CD1 1 
ATOM 949   C CD2 . PHE A 1 134 ? 76.367  104.866 109.882 1.00 30.00  ? 134 PHE A CD2 1 
ATOM 950   C CE1 . PHE A 1 134 ? 76.438  106.627 111.987 1.00 30.00  ? 134 PHE A CE1 1 
ATOM 951   C CE2 . PHE A 1 134 ? 76.966  104.498 111.068 1.00 30.00  ? 134 PHE A CE2 1 
ATOM 952   C CZ  . PHE A 1 134 ? 77.001  105.379 112.119 1.00 30.00  ? 134 PHE A CZ  1 
ATOM 953   N N   . GLY A 1 135 ? 73.504  104.057 107.205 1.00 30.00  ? 135 GLY A N   1 
ATOM 954   C CA  . GLY A 1 135 ? 73.435  102.618 107.090 1.00 30.00  ? 135 GLY A CA  1 
ATOM 955   C C   . GLY A 1 135 ? 74.817  101.992 107.101 1.00 30.00  ? 135 GLY A C   1 
ATOM 956   O O   . GLY A 1 135 ? 75.808  102.635 106.783 1.00 30.00  ? 135 GLY A O   1 
ATOM 957   N N   . ILE A 1 136 ? 74.877  100.729 107.512 1.00 30.00  ? 136 ILE A N   1 
ATOM 958   C CA  . ILE A 1 136 ? 76.149  100.097 107.844 1.00 30.00  ? 136 ILE A CA  1 
ATOM 959   C C   . ILE A 1 136 ? 76.318  98.746  107.127 1.00 30.00  ? 136 ILE A C   1 
ATOM 960   O O   . ILE A 1 136 ? 76.640  97.725  107.750 1.00 30.00  ? 136 ILE A O   1 
ATOM 961   C CB  . ILE A 1 136 ? 76.306  100.065 109.385 1.00 30.00  ? 136 ILE A CB  1 
ATOM 962   C CG1 . ILE A 1 136 ? 77.752  99.776  109.807 1.00 30.00  ? 136 ILE A CG1 1 
ATOM 963   C CG2 . ILE A 1 136 ? 75.214  99.251  110.088 1.00 30.00  ? 136 ILE A CG2 1 
ATOM 964   C CD1 . ILE A 1 136 ? 78.690  100.799 109.286 1.00 30.00  ? 136 ILE A CD1 1 
ATOM 965   N N   . ILE A 1 137 ? 75.992  98.705  105.825 1.00 30.00  ? 137 ILE A N   1 
ATOM 966   C CA  . ILE A 1 137 ? 76.060  97.456  105.060 1.00 30.00  ? 137 ILE A CA  1 
ATOM 967   C C   . ILE A 1 137 ? 77.480  96.899  105.091 1.00 30.00  ? 137 ILE A C   1 
ATOM 968   O O   . ILE A 1 137 ? 78.462  97.624  104.899 1.00 30.00  ? 137 ILE A O   1 
ATOM 969   C CB  . ILE A 1 137 ? 75.508  97.665  103.635 1.00 30.00  ? 137 ILE A CB  1 
ATOM 970   C CG1 . ILE A 1 137 ? 76.382  98.505  102.703 1.00 30.00  ? 137 ILE A CG1 1 
ATOM 971   C CG2 . ILE A 1 137 ? 74.219  98.412  103.705 1.00 30.00  ? 137 ILE A CG2 1 
ATOM 972   C CD1 . ILE A 1 137 ? 77.213  97.675  101.742 1.00 30.00  ? 137 ILE A CD1 1 
ATOM 973   N N   . VAL A 1 138 ? 77.600  95.630  105.464 1.00 30.00  ? 138 VAL A N   1 
ATOM 974   C CA  . VAL A 1 138 ? 78.851  95.097  105.985 1.00 30.00  ? 138 VAL A CA  1 
ATOM 975   C C   . VAL A 1 138 ? 79.390  94.031  105.039 1.00 30.00  ? 138 VAL A C   1 
ATOM 976   O O   . VAL A 1 138 ? 78.628  93.266  104.438 1.00 30.00  ? 138 VAL A O   1 
ATOM 977   C CB  . VAL A 1 138 ? 78.665  94.567  107.428 1.00 30.00  ? 138 VAL A CB  1 
ATOM 978   C CG1 . VAL A 1 138 ? 77.671  93.436  107.491 1.00 30.00  ? 138 VAL A CG1 1 
ATOM 979   C CG2 . VAL A 1 138 ? 79.983  94.152  108.055 1.00 30.00  ? 138 VAL A CG2 1 
ATOM 980   N N   . LEU A 1 139 ? 80.703  94.043  104.849 1.00 30.00  ? 139 LEU A N   1 
ATOM 981   C CA  . LEU A 1 139 ? 81.410  93.026  104.097 1.00 30.00  ? 139 LEU A CA  1 
ATOM 982   C C   . LEU A 1 139 ? 82.772  92.822  104.742 1.00 30.00  ? 139 LEU A C   1 
ATOM 983   O O   . LEU A 1 139 ? 83.290  93.716  105.414 1.00 30.00  ? 139 LEU A O   1 
ATOM 984   C CB  . LEU A 1 139 ? 81.513  93.412  102.612 1.00 30.00  ? 139 LEU A CB  1 
ATOM 985   C CG  . LEU A 1 139 ? 82.132  94.737  102.158 1.00 30.00  ? 139 LEU A CG  1 
ATOM 986   C CD1 . LEU A 1 139 ? 83.625  94.650  101.910 1.00 30.00  ? 139 LEU A CD1 1 
ATOM 987   C CD2 . LEU A 1 139 ? 81.423  95.233  100.918 1.00 30.00  ? 139 LEU A CD2 1 
ATOM 988   N N   . GLN A 1 140 ? 83.325  91.625  104.541 1.00 30.00  ? 140 GLN A N   1 
ATOM 989   C CA  . GLN A 1 140 ? 84.594  91.174  105.122 1.00 30.00  ? 140 GLN A CA  1 
ATOM 990   C C   . GLN A 1 140 ? 84.571  91.289  106.651 1.00 30.00  ? 140 GLN A C   1 
ATOM 991   O O   . GLN A 1 140 ? 85.229  92.125  107.264 1.00 30.00  ? 140 GLN A O   1 
ATOM 992   C CB  . GLN A 1 140 ? 85.787  91.919  104.508 1.00 30.00  ? 140 GLN A CB  1 
ATOM 993   C CG  . GLN A 1 140 ? 87.154  91.342  104.875 1.00 30.00  ? 140 GLN A CG  1 
ATOM 994   C CD  . GLN A 1 140 ? 88.294  92.088  104.239 1.00 30.00  ? 140 GLN A CD  1 
ATOM 995   O OE1 . GLN A 1 140 ? 88.087  93.043  103.501 1.00 30.00  ? 140 GLN A OE1 1 
ATOM 996   N NE2 . GLN A 1 140 ? 89.511  91.661  104.528 1.00 30.00  ? 140 GLN A NE2 1 
ATOM 997   N N   . ASP A 1 141 ? 83.723  90.464  107.253 1.00 30.00  ? 141 ASP A N   1 
ATOM 998   C CA  . ASP A 1 141 ? 83.771  90.225  108.687 1.00 30.00  ? 141 ASP A CA  1 
ATOM 999   C C   . ASP A 1 141 ? 84.360  88.842  108.933 1.00 30.00  ? 141 ASP A C   1 
ATOM 1000  O O   . ASP A 1 141 ? 83.829  87.835  108.459 1.00 30.00  ? 141 ASP A O   1 
ATOM 1001  C CB  . ASP A 1 141 ? 82.391  90.403  109.348 1.00 30.00  ? 141 ASP A CB  1 
ATOM 1002  C CG  . ASP A 1 141 ? 81.274  89.646  108.642 1.00 30.00  ? 141 ASP A CG  1 
ATOM 1003  O OD1 . ASP A 1 141 ? 81.491  89.117  107.533 1.00 30.00  ? 141 ASP A OD1 1 
ATOM 1004  O OD2 . ASP A 1 141 ? 80.161  89.590  109.208 1.00 30.00  ? 141 ASP A OD2 1 
ATOM 1005  N N   . ALA A 1 142 ? 85.480  88.804  109.651 1.00 30.00  ? 142 ALA A N   1 
ATOM 1006  C CA  . ALA A 1 142 ? 86.221  87.559  109.803 1.00 30.00  ? 142 ALA A CA  1 
ATOM 1007  C C   . ALA A 1 142 ? 85.550  86.630  110.805 1.00 30.00  ? 142 ALA A C   1 
ATOM 1008  O O   . ALA A 1 142 ? 85.103  85.535  110.452 1.00 30.00  ? 142 ALA A O   1 
ATOM 1009  C CB  . ALA A 1 142 ? 87.659  87.861  110.229 1.00 30.00  ? 142 ALA A CB  1 
ATOM 1010  N N   . ASP A 1 143 ? 85.460  87.058  112.059 1.00 30.00  ? 143 ASP A N   1 
ATOM 1011  C CA  . ASP A 1 143 ? 84.893  86.254  113.135 1.00 30.00  ? 143 ASP A CA  1 
ATOM 1012  C C   . ASP A 1 143 ? 83.450  86.649  113.417 1.00 30.00  ? 143 ASP A C   1 
ATOM 1013  O O   . ASP A 1 143 ? 82.954  86.468  114.533 1.00 30.00  ? 143 ASP A O   1 
ATOM 1014  C CB  . ASP A 1 143 ? 85.735  86.379  114.400 1.00 30.00  ? 143 ASP A CB  1 
ATOM 1015  C CG  . ASP A 1 143 ? 87.100  85.752  114.250 1.00 30.00  ? 143 ASP A CG  1 
ATOM 1016  O OD1 . ASP A 1 143 ? 87.227  84.785  113.472 1.00 30.00  ? 143 ASP A OD1 1 
ATOM 1017  O OD2 . ASP A 1 143 ? 88.049  86.230  114.905 1.00 30.00  ? 143 ASP A OD2 1 
ATOM 1018  N N   . ASN A 1 144 ? 82.778  87.176  112.385 1.00 30.00  ? 144 ASN A N   1 
ATOM 1019  C CA  . ASN A 1 144 ? 81.418  87.719  112.456 1.00 30.00  ? 144 ASN A CA  1 
ATOM 1020  C C   . ASN A 1 144 ? 81.313  88.775  113.555 1.00 30.00  ? 144 ASN A C   1 
ATOM 1021  O O   . ASN A 1 144 ? 80.401  88.763  114.382 1.00 30.00  ? 144 ASN A O   1 
ATOM 1022  C CB  . ASN A 1 144 ? 80.384  86.605  112.641 1.00 30.00  ? 144 ASN A CB  1 
ATOM 1023  C CG  . ASN A 1 144 ? 80.339  85.654  111.459 1.00 30.00  ? 144 ASN A CG  1 
ATOM 1024  O OD1 . ASN A 1 144 ? 80.445  86.072  110.308 1.00 30.00  ? 144 ASN A OD1 1 
ATOM 1025  N ND2 . ASN A 1 144 ? 80.181  84.368  111.740 1.00 30.00  ? 144 ASN A ND2 1 
ATOM 1026  N N   . SER A 1 145 ? 82.279  89.691  113.560 1.00 30.00  ? 145 SER A N   1 
ATOM 1027  C CA  . SER A 1 145 ? 82.460  90.621  114.663 1.00 30.00  ? 145 SER A CA  1 
ATOM 1028  C C   . SER A 1 145 ? 81.581  91.858  114.567 1.00 30.00  ? 145 SER A C   1 
ATOM 1029  O O   . SER A 1 145 ? 81.611  92.682  115.487 1.00 30.00  ? 145 SER A O   1 
ATOM 1030  C CB  . SER A 1 145 ? 83.928  91.041  114.753 1.00 30.00  ? 145 SER A CB  1 
ATOM 1031  O OG  . SER A 1 145 ? 84.342  91.733  113.589 1.00 30.00  ? 145 SER A OG  1 
ATOM 1032  N N   . VAL A 1 146 ? 80.806  92.017  113.495 1.00 30.00  ? 146 VAL A N   1 
ATOM 1033  C CA  . VAL A 1 146 ? 79.872  93.133  113.408 1.00 30.00  ? 146 VAL A CA  1 
ATOM 1034  C C   . VAL A 1 146 ? 78.457  92.565  113.400 1.00 30.00  ? 146 VAL A C   1 
ATOM 1035  O O   . VAL A 1 146 ? 77.900  92.255  112.341 1.00 30.00  ? 146 VAL A O   1 
ATOM 1036  C CB  . VAL A 1 146 ? 80.143  93.999  112.162 1.00 30.00  ? 146 VAL A CB  1 
ATOM 1037  C CG1 . VAL A 1 146 ? 79.211  95.206  112.115 1.00 30.00  ? 146 VAL A CG1 1 
ATOM 1038  C CG2 . VAL A 1 146 ? 81.589  94.446  112.128 1.00 30.00  ? 146 VAL A CG2 1 
ATOM 1039  N N   . ASP A 1 147 ? 77.874  92.409  114.581 1.00 30.00  ? 147 ASP A N   1 
ATOM 1040  C CA  . ASP A 1 147 ? 76.516  91.915  114.728 1.00 30.00  ? 147 ASP A CA  1 
ATOM 1041  C C   . ASP A 1 147 ? 75.564  93.081  114.925 1.00 30.00  ? 147 ASP A C   1 
ATOM 1042  O O   . ASP A 1 147 ? 75.978  94.235  115.043 1.00 30.00  ? 147 ASP A O   1 
ATOM 1043  C CB  . ASP A 1 147 ? 76.408  90.941  115.904 1.00 30.00  ? 147 ASP A CB  1 
ATOM 1044  C CG  . ASP A 1 147 ? 77.022  89.594  115.604 1.00 30.00  ? 147 ASP A CG  1 
ATOM 1045  O OD1 . ASP A 1 147 ? 76.986  89.175  114.429 1.00 30.00  ? 147 ASP A OD1 1 
ATOM 1046  O OD2 . ASP A 1 147 ? 77.539  88.953  116.543 1.00 30.00  ? 147 ASP A OD2 1 
ATOM 1047  N N   . GLN A 1 148 ? 74.270  92.768  114.910 1.00 30.00  ? 148 GLN A N   1 
ATOM 1048  C CA  . GLN A 1 148 ? 73.249  93.752  115.241 1.00 30.00  ? 148 GLN A CA  1 
ATOM 1049  C C   . GLN A 1 148 ? 73.427  94.199  116.686 1.00 30.00  ? 148 GLN A C   1 
ATOM 1050  O O   . GLN A 1 148 ? 73.831  93.405  117.541 1.00 30.00  ? 148 GLN A O   1 
ATOM 1051  C CB  . GLN A 1 148 ? 71.855  93.156  115.042 1.00 30.00  ? 148 GLN A CB  1 
ATOM 1052  C CG  . GLN A 1 148 ? 70.722  94.144  115.207 1.00 30.00  ? 148 GLN A CG  1 
ATOM 1053  C CD  . GLN A 1 148 ? 70.598  95.078  114.036 1.00 30.00  ? 148 GLN A CD  1 
ATOM 1054  O OE1 . GLN A 1 148 ? 70.580  94.644  112.889 1.00 30.00  ? 148 GLN A OE1 1 
ATOM 1055  N NE2 . GLN A 1 148 ? 70.532  96.369  114.314 1.00 30.00  ? 148 GLN A NE2 1 
ATOM 1056  N N   . ASN A 1 149 ? 73.222  95.503  116.921 1.00 30.00  ? 149 ASN A N   1 
ATOM 1057  C CA  . ASN A 1 149 ? 73.279  96.201  118.210 1.00 30.00  ? 149 ASN A CA  1 
ATOM 1058  C C   . ASN A 1 149 ? 74.687  96.292  118.795 1.00 30.00  ? 149 ASN A C   1 
ATOM 1059  O O   . ASN A 1 149 ? 74.875  96.919  119.841 1.00 30.00  ? 149 ASN A O   1 
ATOM 1060  C CB  . ASN A 1 149 ? 72.338  95.562  119.242 1.00 30.00  ? 149 ASN A CB  1 
ATOM 1061  C CG  . ASN A 1 149 ? 70.895  95.551  118.789 1.00 30.00  ? 149 ASN A CG  1 
ATOM 1062  O OD1 . ASN A 1 149 ? 70.313  94.492  118.563 1.00 30.00  ? 149 ASN A OD1 1 
ATOM 1063  N ND2 . ASN A 1 149 ? 70.308  96.730  118.659 1.00 30.00  ? 149 ASN A ND2 1 
ATOM 1064  N N   . TYR A 1 150 ? 75.682  95.686  118.149 1.00 30.00  ? 150 TYR A N   1 
ATOM 1065  C CA  . TYR A 1 150 ? 77.085  95.825  118.546 1.00 30.00  ? 150 TYR A CA  1 
ATOM 1066  C C   . TYR A 1 150 ? 77.985  95.868  117.317 1.00 30.00  ? 150 TYR A C   1 
ATOM 1067  O O   . TYR A 1 150 ? 78.724  94.916  117.041 1.00 30.00  ? 150 TYR A O   1 
ATOM 1068  C CB  . TYR A 1 150 ? 77.502  94.674  119.464 1.00 30.00  ? 150 TYR A CB  1 
ATOM 1069  C CG  . TYR A 1 150 ? 76.829  94.669  120.808 1.00 30.00  ? 150 TYR A CG  1 
ATOM 1070  C CD1 . TYR A 1 150 ? 77.309  95.454  121.846 1.00 30.00  ? 150 TYR A CD1 1 
ATOM 1071  C CD2 . TYR A 1 150 ? 75.711  93.885  121.038 1.00 30.00  ? 150 TYR A CD2 1 
ATOM 1072  C CE1 . TYR A 1 150 ? 76.697  95.455  123.079 1.00 30.00  ? 150 TYR A CE1 1 
ATOM 1073  C CE2 . TYR A 1 150 ? 75.089  93.880  122.264 1.00 30.00  ? 150 TYR A CE2 1 
ATOM 1074  C CZ  . TYR A 1 150 ? 75.586  94.666  123.282 1.00 30.00  ? 150 TYR A CZ  1 
ATOM 1075  O OH  . TYR A 1 150 ? 74.967  94.663  124.511 1.00 30.00  ? 150 TYR A OH  1 
ATOM 1076  N N   . PRO A 1 151 ? 77.964  96.972  116.545 1.00 118.75 ? 151 PRO A N   1 
ATOM 1077  C CA  . PRO A 1 151 ? 78.878  97.038  115.402 1.00 118.46 ? 151 PRO A CA  1 
ATOM 1078  C C   . PRO A 1 151 ? 80.273  97.419  115.851 1.00 119.90 ? 151 PRO A C   1 
ATOM 1079  O O   . PRO A 1 151 ? 80.542  98.595  116.111 1.00 131.05 ? 151 PRO A O   1 
ATOM 1080  C CB  . PRO A 1 151 ? 78.266  98.132  114.520 1.00 30.00  ? 151 PRO A CB  1 
ATOM 1081  C CG  . PRO A 1 151 ? 76.901  98.360  115.055 1.00 30.00  ? 151 PRO A CG  1 
ATOM 1082  C CD  . PRO A 1 151 ? 77.035  98.112  116.517 1.00 30.00  ? 151 PRO A CD  1 
ATOM 1083  N N   . THR A 1 152 ? 81.177  96.448  115.912 1.00 103.12 ? 152 THR A N   1 
ATOM 1084  C CA  . THR A 1 152 ? 82.525  96.653  116.427 1.00 94.10  ? 152 THR A CA  1 
ATOM 1085  C C   . THR A 1 152 ? 83.522  96.262  115.350 1.00 104.71 ? 152 THR A C   1 
ATOM 1086  O O   . THR A 1 152 ? 83.453  95.153  114.813 1.00 113.36 ? 152 THR A O   1 
ATOM 1087  C CB  . THR A 1 152 ? 82.757  95.834  117.699 1.00 30.00  ? 152 THR A CB  1 
ATOM 1088  O OG1 . THR A 1 152 ? 82.545  94.444  117.419 1.00 30.00  ? 152 THR A OG1 1 
ATOM 1089  C CG2 . THR A 1 152 ? 81.814  96.278  118.813 1.00 30.00  ? 152 THR A CG2 1 
ATOM 1090  N N   . LEU A 1 153 ? 84.438  97.166  115.031 1.00 105.17 ? 153 LEU A N   1 
ATOM 1091  C CA  . LEU A 1 153 ? 85.438  96.885  114.014 1.00 86.31  ? 153 LEU A CA  1 
ATOM 1092  C C   . LEU A 1 153 ? 86.668  96.236  114.630 1.00 100.45 ? 153 LEU A C   1 
ATOM 1093  O O   . LEU A 1 153 ? 86.983  96.432  115.805 1.00 121.22 ? 153 LEU A O   1 
ATOM 1094  C CB  . LEU A 1 153 ? 85.842  98.160  113.269 1.00 85.43  ? 153 LEU A CB  1 
ATOM 1095  C CG  . LEU A 1 153 ? 85.052  98.602  112.034 1.00 104.80 ? 153 LEU A CG  1 
ATOM 1096  C CD1 . LEU A 1 153 ? 83.652  98.967  112.371 1.00 109.08 ? 153 LEU A CD1 1 
ATOM 1097  C CD2 . LEU A 1 153 ? 85.710  99.800  111.410 1.00 104.18 ? 153 LEU A CD2 1 
ATOM 1098  N N   . ASN A 1 154 ? 87.352  95.436  113.820 1.00 92.73  ? 154 ASN A N   1 
ATOM 1099  C CA  . ASN A 1 154 ? 88.615  94.820  114.198 1.00 102.94 ? 154 ASN A CA  1 
ATOM 1100  C C   . ASN A 1 154 ? 89.570  94.879  113.016 1.00 103.88 ? 154 ASN A C   1 
ATOM 1101  O O   . ASN A 1 154 ? 89.252  95.506  112.003 1.00 114.48 ? 154 ASN A O   1 
ATOM 1102  C CB  . ASN A 1 154 ? 88.383  93.387  114.688 1.00 108.28 ? 154 ASN A CB  1 
ATOM 1103  C CG  . ASN A 1 154 ? 87.524  92.562  113.735 1.00 136.92 ? 154 ASN A CG  1 
ATOM 1104  O OD1 . ASN A 1 154 ? 87.133  93.019  112.664 1.00 143.53 ? 154 ASN A OD1 1 
ATOM 1105  N ND2 . ASN A 1 154 ? 87.228  91.333  114.133 1.00 139.78 ? 154 ASN A ND2 1 
ATOM 1106  N N   . LYS A 1 155 ? 90.736  94.253  113.126 1.00 95.21  ? 155 LYS A N   1 
ATOM 1107  C CA  . LYS A 1 155 ? 91.658  94.225  112.000 1.00 95.36  ? 155 LYS A CA  1 
ATOM 1108  C C   . LYS A 1 155 ? 91.113  93.341  110.883 1.00 115.83 ? 155 LYS A C   1 
ATOM 1109  O O   . LYS A 1 155 ? 90.443  92.334  111.124 1.00 123.08 ? 155 LYS A O   1 
ATOM 1110  C CB  . LYS A 1 155 ? 93.040  93.739  112.445 1.00 30.00  ? 155 LYS A CB  1 
ATOM 1111  C CG  . LYS A 1 155 ? 93.088  92.315  112.986 1.00 30.00  ? 155 LYS A CG  1 
ATOM 1112  C CD  . LYS A 1 155 ? 94.488  91.941  113.422 1.00 30.00  ? 155 LYS A CD  1 
ATOM 1113  C CE  . LYS A 1 155 ? 94.870  92.691  114.683 1.00 30.00  ? 155 LYS A CE  1 
ATOM 1114  N NZ  . LYS A 1 155 ? 96.196  92.270  115.201 1.00 30.00  ? 155 LYS A NZ  1 
ATOM 1115  N N   . GLY A 1 156 ? 91.387  93.746  109.649 1.00 120.22 ? 156 GLY A N   1 
ATOM 1116  C CA  . GLY A 1 156 ? 90.866  93.033  108.498 1.00 108.72 ? 156 GLY A CA  1 
ATOM 1117  C C   . GLY A 1 156 ? 89.363  93.116  108.365 1.00 114.31 ? 156 GLY A C   1 
ATOM 1118  O O   . GLY A 1 156 ? 88.691  92.080  108.329 1.00 129.66 ? 156 GLY A O   1 
ATOM 1119  N N   . ASP A 1 157 ? 88.816  94.324  108.301 1.00 108.95 ? 157 ASP A N   1 
ATOM 1120  C CA  . ASP A 1 157 ? 87.372  94.520  108.307 1.00 110.20 ? 157 ASP A CA  1 
ATOM 1121  C C   . ASP A 1 157 ? 87.083  95.805  107.545 1.00 98.60  ? 157 ASP A C   1 
ATOM 1122  O O   . ASP A 1 157 ? 87.477  96.886  107.986 1.00 104.60 ? 157 ASP A O   1 
ATOM 1123  C CB  . ASP A 1 157 ? 86.852  94.585  109.743 1.00 30.00  ? 157 ASP A CB  1 
ATOM 1124  C CG  . ASP A 1 157 ? 85.343  94.483  109.839 1.00 30.00  ? 157 ASP A CG  1 
ATOM 1125  O OD1 . ASP A 1 157 ? 84.654  94.460  108.802 1.00 30.00  ? 157 ASP A OD1 1 
ATOM 1126  O OD2 . ASP A 1 157 ? 84.840  94.408  110.978 1.00 30.00  ? 157 ASP A OD2 1 
ATOM 1127  N N   . ILE A 1 158 ? 86.413  95.696  106.404 1.00 93.46  ? 158 ILE A N   1 
ATOM 1128  C CA  . ILE A 1 158 ? 86.070  96.855  105.590 1.00 94.83  ? 158 ILE A CA  1 
ATOM 1129  C C   . ILE A 1 158 ? 84.554  96.970  105.576 1.00 87.24  ? 158 ILE A C   1 
ATOM 1130  O O   . ILE A 1 158 ? 83.883  96.409  104.705 1.00 105.72 ? 158 ILE A O   1 
ATOM 1131  C CB  . ILE A 1 158 ? 86.627  96.733  104.168 1.00 30.00  ? 158 ILE A CB  1 
ATOM 1132  C CG1 . ILE A 1 158 ? 88.129  96.519  104.211 1.00 30.00  ? 158 ILE A CG1 1 
ATOM 1133  C CG2 . ILE A 1 158 ? 86.375  98.005  103.380 1.00 30.00  ? 158 ILE A CG2 1 
ATOM 1134  C CD1 . ILE A 1 158 ? 88.699  96.187  102.881 1.00 30.00  ? 158 ILE A CD1 1 
ATOM 1135  N N   . VAL A 1 159 ? 84.005  97.707  106.525 1.00 72.04  ? 159 VAL A N   1 
ATOM 1136  C CA  . VAL A 1 159 ? 82.573  97.918  106.574 1.00 85.77  ? 159 VAL A CA  1 
ATOM 1137  C C   . VAL A 1 159 ? 82.271  99.112  105.679 1.00 98.46  ? 159 VAL A C   1 
ATOM 1138  O O   . VAL A 1 159 ? 83.131  99.955  105.413 1.00 103.95 ? 159 VAL A O   1 
ATOM 1139  C CB  . VAL A 1 159 ? 82.077  98.120  108.024 1.00 96.17  ? 159 VAL A CB  1 
ATOM 1140  C CG1 . VAL A 1 159 ? 82.466  99.487  108.567 1.00 92.70  ? 159 VAL A CG1 1 
ATOM 1141  C CG2 . VAL A 1 159 ? 80.590  97.836  108.158 1.00 104.55 ? 159 VAL A CG2 1 
ATOM 1142  N N   . VAL A 1 160 ? 81.056  99.153  105.156 1.00 95.14  ? 160 VAL A N   1 
ATOM 1143  C CA  . VAL A 1 160 ? 80.646  100.191 104.223 1.00 101.45 ? 160 VAL A CA  1 
ATOM 1144  C C   . VAL A 1 160 ? 79.577  101.022 104.901 1.00 102.27 ? 160 VAL A C   1 
ATOM 1145  O O   . VAL A 1 160 ? 78.469  100.533 105.149 1.00 103.82 ? 160 VAL A O   1 
ATOM 1146  C CB  . VAL A 1 160 ? 80.119  99.604  102.913 1.00 30.00  ? 160 VAL A CB  1 
ATOM 1147  C CG1 . VAL A 1 160 ? 79.623  100.708 102.007 1.00 30.00  ? 160 VAL A CG1 1 
ATOM 1148  C CG2 . VAL A 1 160 ? 81.176  98.761  102.251 1.00 30.00  ? 160 VAL A CG2 1 
ATOM 1149  N N   . ILE A 1 161 ? 79.891  102.275 105.200 1.00 90.95  ? 161 ILE A N   1 
ATOM 1150  C CA  . ILE A 1 161 ? 78.883  103.173 105.744 1.00 81.94  ? 161 ILE A CA  1 
ATOM 1151  C C   . ILE A 1 161 ? 78.014  103.676 104.603 1.00 79.66  ? 161 ILE A C   1 
ATOM 1152  O O   . ILE A 1 161 ? 78.498  104.340 103.682 1.00 99.72  ? 161 ILE A O   1 
ATOM 1153  C CB  . ILE A 1 161 ? 79.508  104.333 106.527 1.00 30.00  ? 161 ILE A CB  1 
ATOM 1154  C CG1 . ILE A 1 161 ? 80.159  103.813 107.799 1.00 30.00  ? 161 ILE A CG1 1 
ATOM 1155  C CG2 . ILE A 1 161 ? 78.458  105.379 106.860 1.00 30.00  ? 161 ILE A CG2 1 
ATOM 1156  C CD1 . ILE A 1 161 ? 80.763  104.874 108.644 1.00 30.00  ? 161 ILE A CD1 1 
ATOM 1157  N N   . THR A 1 162 ? 76.738  103.324 104.649 1.00 81.25  ? 162 THR A N   1 
ATOM 1158  C CA  . THR A 1 162 ? 75.731  103.824 103.732 1.00 79.19  ? 162 THR A CA  1 
ATOM 1159  C C   . THR A 1 162 ? 75.155  105.117 104.285 1.00 81.11  ? 162 THR A C   1 
ATOM 1160  O O   . THR A 1 162 ? 74.728  105.159 105.439 1.00 116.53 ? 162 THR A O   1 
ATOM 1161  C CB  . THR A 1 162 ? 74.636  102.771 103.561 1.00 105.99 ? 162 THR A CB  1 
ATOM 1162  O OG1 . THR A 1 162 ? 75.111  101.696 102.743 1.00 101.14 ? 162 THR A OG1 1 
ATOM 1163  C CG2 . THR A 1 162 ? 73.379  103.351 102.995 1.00 102.00 ? 162 THR A CG2 1 
ATOM 1164  N N   . VAL A 1 163 ? 75.165  106.174 103.477 1.00 74.05  ? 163 VAL A N   1 
ATOM 1165  C CA  . VAL A 1 163 ? 74.586  107.458 103.857 1.00 59.01  ? 163 VAL A CA  1 
ATOM 1166  C C   . VAL A 1 163 ? 73.674  107.918 102.734 1.00 74.94  ? 163 VAL A C   1 
ATOM 1167  O O   . VAL A 1 163 ? 74.137  108.126 101.608 1.00 100.06 ? 163 VAL A O   1 
ATOM 1168  C CB  . VAL A 1 163 ? 75.652  108.531 104.134 1.00 30.00  ? 163 VAL A CB  1 
ATOM 1169  C CG1 . VAL A 1 163 ? 74.986  109.865 104.374 1.00 30.00  ? 163 VAL A CG1 1 
ATOM 1170  C CG2 . VAL A 1 163 ? 76.492  108.172 105.332 1.00 30.00  ? 163 VAL A CG2 1 
ATOM 1171  N N   . LYS A 1 164 ? 72.391  108.092 103.034 1.00 74.88  ? 164 LYS A N   1 
ATOM 1172  C CA  . LYS A 1 164 ? 71.486  108.677 102.059 1.00 83.69  ? 164 LYS A CA  1 
ATOM 1173  C C   . LYS A 1 164 ? 71.599  110.192 102.107 1.00 106.81 ? 164 LYS A C   1 
ATOM 1174  O O   . LYS A 1 164 ? 71.570  110.797 103.180 1.00 129.13 ? 164 LYS A O   1 
ATOM 1175  C CB  . LYS A 1 164 ? 70.043  108.255 102.314 1.00 30.00  ? 164 LYS A CB  1 
ATOM 1176  C CG  . LYS A 1 164 ? 69.079  108.729 101.250 1.00 30.00  ? 164 LYS A CG  1 
ATOM 1177  C CD  . LYS A 1 164 ? 67.679  108.263 101.528 1.00 30.00  ? 164 LYS A CD  1 
ATOM 1178  C CE  . LYS A 1 164 ? 66.744  108.735 100.447 1.00 30.00  ? 164 LYS A CE  1 
ATOM 1179  N NZ  . LYS A 1 164 ? 65.348  108.307 100.713 1.00 30.00  ? 164 LYS A NZ  1 
ATOM 1180  N N   . VAL A 1 165 ? 71.729  110.805 100.934 1.00 100.36 ? 165 VAL A N   1 
ATOM 1181  C CA  . VAL A 1 165 ? 71.988  112.233 100.818 1.00 103.79 ? 165 VAL A CA  1 
ATOM 1182  C C   . VAL A 1 165 ? 70.836  112.959 100.135 1.00 97.79  ? 165 VAL A C   1 
ATOM 1183  O O   . VAL A 1 165 ? 70.182  113.815 100.739 1.00 106.74 ? 165 VAL A O   1 
ATOM 1184  C CB  . VAL A 1 165 ? 73.314  112.498 100.075 1.00 30.00  ? 165 VAL A CB  1 
ATOM 1185  C CG1 . VAL A 1 165 ? 73.547  113.966 99.935  1.00 30.00  ? 165 VAL A CG1 1 
ATOM 1186  C CG2 . VAL A 1 165 ? 74.464  111.847 100.794 1.00 30.00  ? 165 VAL A CG2 1 
ATOM 1187  N N   . GLY A 1 166 ? 70.565  112.625 98.876  1.00 79.70  ? 166 GLY A N   1 
ATOM 1188  C CA  . GLY A 1 166 ? 69.819  113.513 98.004  1.00 92.16  ? 166 GLY A CA  1 
ATOM 1189  C C   . GLY A 1 166 ? 68.308  113.596 97.994  1.00 91.30  ? 166 GLY A C   1 
ATOM 1190  O O   . GLY A 1 166 ? 67.758  114.630 98.377  1.00 97.71  ? 166 GLY A O   1 
ATOM 1191  N N   . GLU A 1 167 ? 67.622  112.535 97.570  1.00 104.44 ? 167 GLU A N   1 
ATOM 1192  C CA  . GLU A 1 167 ? 66.271  112.691 97.039  1.00 121.81 ? 167 GLU A CA  1 
ATOM 1193  C C   . GLU A 1 167 ? 65.246  112.900 98.152  1.00 118.30 ? 167 GLU A C   1 
ATOM 1194  O O   . GLU A 1 167 ? 65.206  112.150 99.132  1.00 118.15 ? 167 GLU A O   1 
ATOM 1195  C CB  . GLU A 1 167 ? 65.903  111.500 96.141  1.00 30.00  ? 167 GLU A CB  1 
ATOM 1196  C CG  . GLU A 1 167 ? 65.852  110.106 96.764  1.00 30.00  ? 167 GLU A CG  1 
ATOM 1197  C CD  . GLU A 1 167 ? 64.473  109.763 97.301  1.00 30.00  ? 167 GLU A CD  1 
ATOM 1198  O OE1 . GLU A 1 167 ? 63.498  110.429 96.898  1.00 30.00  ? 167 GLU A OE1 1 
ATOM 1199  O OE2 . GLU A 1 167 ? 64.360  108.832 98.123  1.00 30.00  ? 167 GLU A OE2 1 
ATOM 1200  N N   . GLY A 1 168 ? 64.439  113.951 98.007  1.00 30.00  ? 168 GLY A N   1 
ATOM 1201  C CA  . GLY A 1 168 ? 63.453  114.316 99.004  1.00 30.00  ? 168 GLY A CA  1 
ATOM 1202  C C   . GLY A 1 168 ? 64.087  114.766 100.300 1.00 30.00  ? 168 GLY A C   1 
ATOM 1203  O O   . GLY A 1 168 ? 64.723  115.820 100.355 1.00 30.00  ? 168 GLY A O   1 
ATOM 1204  N N   . ASN A 1 169 ? 63.927  113.969 101.348 1.00 30.00  ? 169 ASN A N   1 
ATOM 1205  C CA  . ASN A 1 169 ? 64.645  114.213 102.586 1.00 30.00  ? 169 ASN A CA  1 
ATOM 1206  C C   . ASN A 1 169 ? 66.032  113.587 102.530 1.00 30.00  ? 169 ASN A C   1 
ATOM 1207  O O   . ASN A 1 169 ? 66.313  112.722 101.700 1.00 30.00  ? 169 ASN A O   1 
ATOM 1208  C CB  . ASN A 1 169 ? 63.857  113.681 103.790 1.00 30.00  ? 169 ASN A CB  1 
ATOM 1209  C CG  . ASN A 1 169 ? 63.490  112.200 103.676 1.00 30.00  ? 169 ASN A CG  1 
ATOM 1210  O OD1 . ASN A 1 169 ? 63.833  111.516 102.712 1.00 30.00  ? 169 ASN A OD1 1 
ATOM 1211  N ND2 . ASN A 1 169 ? 62.791  111.699 104.687 1.00 30.00  ? 169 ASN A ND2 1 
ATOM 1212  N N   . GLY A 1 170 ? 66.903  114.031 103.422 1.00 30.00  ? 170 GLY A N   1 
ATOM 1213  C CA  . GLY A 1 170 ? 68.229  113.457 103.472 1.00 30.00  ? 170 GLY A CA  1 
ATOM 1214  C C   . GLY A 1 170 ? 69.159  114.345 104.259 1.00 30.00  ? 170 GLY A C   1 
ATOM 1215  O O   . GLY A 1 170 ? 68.727  115.259 104.964 1.00 30.00  ? 170 GLY A O   1 
ATOM 1216  N N   . VAL A 1 171 ? 70.453  114.043 104.134 1.00 30.00  ? 171 VAL A N   1 
ATOM 1217  C CA  . VAL A 1 171 ? 71.486  114.862 104.762 1.00 30.00  ? 171 VAL A CA  1 
ATOM 1218  C C   . VAL A 1 171 ? 71.470  116.268 104.184 1.00 30.00  ? 171 VAL A C   1 
ATOM 1219  O O   . VAL A 1 171 ? 71.589  117.261 104.913 1.00 30.00  ? 171 VAL A O   1 
ATOM 1220  C CB  . VAL A 1 171 ? 72.856  114.181 104.599 1.00 30.00  ? 171 VAL A CB  1 
ATOM 1221  C CG1 . VAL A 1 171 ? 73.969  115.080 105.047 1.00 30.00  ? 171 VAL A CG1 1 
ATOM 1222  C CG2 . VAL A 1 171 ? 72.890  112.901 105.409 1.00 30.00  ? 171 VAL A CG2 1 
ATOM 1223  N N   . PHE A 1 172 ? 71.262  116.379 102.879 1.00 30.00  ? 172 PHE A N   1 
ATOM 1224  C CA  . PHE A 1 172 ? 71.240  117.661 102.201 1.00 30.00  ? 172 PHE A CA  1 
ATOM 1225  C C   . PHE A 1 172 ? 69.882  117.888 101.559 1.00 30.00  ? 172 PHE A C   1 
ATOM 1226  O O   . PHE A 1 172 ? 69.156  116.940 101.248 1.00 30.00  ? 172 PHE A O   1 
ATOM 1227  C CB  . PHE A 1 172 ? 72.321  117.729 101.129 1.00 30.00  ? 172 PHE A CB  1 
ATOM 1228  C CG  . PHE A 1 172 ? 73.709  117.691 101.673 1.00 30.00  ? 172 PHE A CG  1 
ATOM 1229  C CD1 . PHE A 1 172 ? 73.980  118.111 102.958 1.00 30.00  ? 172 PHE A CD1 1 
ATOM 1230  C CD2 . PHE A 1 172 ? 74.739  117.184 100.911 1.00 30.00  ? 172 PHE A CD2 1 
ATOM 1231  C CE1 . PHE A 1 172 ? 75.242  118.044 103.454 1.00 30.00  ? 172 PHE A CE1 1 
ATOM 1232  C CE2 . PHE A 1 172 ? 76.006  117.117 101.413 1.00 30.00  ? 172 PHE A CE2 1 
ATOM 1233  C CZ  . PHE A 1 172 ? 76.251  117.544 102.676 1.00 30.00  ? 172 PHE A CZ  1 
ATOM 1234  N N   . GLY A 1 173 ? 69.542  119.160 101.374 1.00 90.87  ? 173 GLY A N   1 
ATOM 1235  C CA  . GLY A 1 173 ? 68.414  119.510 100.538 1.00 106.12 ? 173 GLY A CA  1 
ATOM 1236  C C   . GLY A 1 173 ? 68.749  119.200 99.096  1.00 110.53 ? 173 GLY A C   1 
ATOM 1237  O O   . GLY A 1 173 ? 69.625  119.855 98.505  1.00 115.60 ? 173 GLY A O   1 
ATOM 1238  N N   . LYS A 1 174 ? 68.122  118.158 98.539  1.00 97.87  ? 174 LYS A N   1 
ATOM 1239  C CA  . LYS A 1 174 ? 68.271  117.642 97.175  1.00 80.02  ? 174 LYS A CA  1 
ATOM 1240  C C   . LYS A 1 174 ? 69.658  117.064 96.882  1.00 94.77  ? 174 LYS A C   1 
ATOM 1241  O O   . LYS A 1 174 ? 69.905  116.620 95.759  1.00 96.54  ? 174 LYS A O   1 
ATOM 1242  C CB  . LYS A 1 174 ? 67.910  118.698 96.115  1.00 30.00  ? 174 LYS A CB  1 
ATOM 1243  C CG  . LYS A 1 174 ? 66.493  119.237 96.232  1.00 30.00  ? 174 LYS A CG  1 
ATOM 1244  C CD  . LYS A 1 174 ? 65.460  118.155 95.987  1.00 30.00  ? 174 LYS A CD  1 
ATOM 1245  C CE  . LYS A 1 174 ? 65.475  117.700 94.535  1.00 30.00  ? 174 LYS A CE  1 
ATOM 1246  N NZ  . LYS A 1 174 ? 65.062  118.791 93.607  1.00 30.00  ? 174 LYS A NZ  1 
ATOM 1247  N N   . GLY A 1 175 ? 70.567  117.032 97.859  1.00 111.68 ? 175 GLY A N   1 
ATOM 1248  C CA  . GLY A 1 175 ? 71.879  116.444 97.667  1.00 81.48  ? 175 GLY A CA  1 
ATOM 1249  C C   . GLY A 1 175 ? 72.853  117.325 96.909  1.00 95.21  ? 175 GLY A C   1 
ATOM 1250  O O   . GLY A 1 175 ? 72.510  118.363 96.349  1.00 97.91  ? 175 GLY A O   1 
ATOM 1251  N N   . ILE A 1 176 ? 74.104  116.876 96.906  1.00 83.15  ? 176 ILE A N   1 
ATOM 1252  C CA  . ILE A 1 176 ? 75.183  117.619 96.263  1.00 78.96  ? 176 ILE A CA  1 
ATOM 1253  C C   . ILE A 1 176 ? 75.044  117.601 94.746  1.00 94.93  ? 176 ILE A C   1 
ATOM 1254  O O   . ILE A 1 176 ? 74.777  116.551 94.150  1.00 88.90  ? 176 ILE A O   1 
ATOM 1255  C CB  . ILE A 1 176 ? 76.562  117.100 96.700  1.00 30.00  ? 176 ILE A CB  1 
ATOM 1256  C CG1 . ILE A 1 176 ? 76.595  115.577 96.729  1.00 30.00  ? 176 ILE A CG1 1 
ATOM 1257  C CG2 . ILE A 1 176 ? 76.975  117.689 98.020  1.00 30.00  ? 176 ILE A CG2 1 
ATOM 1258  C CD1 . ILE A 1 176 ? 77.967  115.015 96.982  1.00 30.00  ? 176 ILE A CD1 1 
ATOM 1259  N N   . PRO A 1 177 ? 75.159  118.754 94.100  1.00 104.13 ? 177 PRO A N   1 
ATOM 1260  C CA  . PRO A 1 177 ? 75.262  118.799 92.646  1.00 102.32 ? 177 PRO A CA  1 
ATOM 1261  C C   . PRO A 1 177 ? 76.700  118.575 92.218  1.00 111.82 ? 177 PRO A C   1 
ATOM 1262  O O   . PRO A 1 177 ? 77.586  118.473 93.078  1.00 109.13 ? 177 PRO A O   1 
ATOM 1263  C CB  . PRO A 1 177 ? 74.786  120.225 92.320  1.00 30.00  ? 177 PRO A CB  1 
ATOM 1264  C CG  . PRO A 1 177 ? 75.117  121.000 93.520  1.00 30.00  ? 177 PRO A CG  1 
ATOM 1265  C CD  . PRO A 1 177 ? 74.915  120.084 94.678  1.00 30.00  ? 177 PRO A CD  1 
ATOM 1266  N N   . PRO A 1 178 ? 76.981  118.458 90.916  1.00 116.59 ? 178 PRO A N   1 
ATOM 1267  C CA  . PRO A 1 178 ? 78.374  118.502 90.461  1.00 103.53 ? 178 PRO A CA  1 
ATOM 1268  C C   . PRO A 1 178 ? 79.031  119.842 90.741  1.00 98.48  ? 178 PRO A C   1 
ATOM 1269  O O   . PRO A 1 178 ? 78.373  120.862 90.962  1.00 99.69  ? 178 PRO A O   1 
ATOM 1270  C CB  . PRO A 1 178 ? 78.275  118.252 88.954  1.00 30.00  ? 178 PRO A CB  1 
ATOM 1271  C CG  . PRO A 1 178 ? 76.865  118.507 88.604  1.00 30.00  ? 178 PRO A CG  1 
ATOM 1272  C CD  . PRO A 1 178 ? 76.089  118.079 89.807  1.00 30.00  ? 178 PRO A CD  1 
ATOM 1273  N N   . ARG A 1 179 ? 80.368  119.798 90.721  1.00 103.48 ? 179 ARG A N   1 
ATOM 1274  C CA  . ARG A 1 179 ? 81.256  120.950 90.882  1.00 103.58 ? 179 ARG A CA  1 
ATOM 1275  C C   . ARG A 1 179 ? 81.006  121.641 92.227  1.00 107.40 ? 179 ARG A C   1 
ATOM 1276  O O   . ARG A 1 179 ? 80.520  122.770 92.310  1.00 119.87 ? 179 ARG A O   1 
ATOM 1277  C CB  . ARG A 1 179 ? 81.117  121.906 89.688  1.00 30.00  ? 179 ARG A CB  1 
ATOM 1278  C CG  . ARG A 1 179 ? 82.146  123.023 89.574  1.00 30.00  ? 179 ARG A CG  1 
ATOM 1279  C CD  . ARG A 1 179 ? 81.901  123.843 88.321  1.00 30.00  ? 179 ARG A CD  1 
ATOM 1280  N NE  . ARG A 1 179 ? 80.576  124.455 88.324  1.00 30.00  ? 179 ARG A NE  1 
ATOM 1281  C CZ  . ARG A 1 179 ? 79.606  124.135 87.473  1.00 30.00  ? 179 ARG A CZ  1 
ATOM 1282  N NH1 . ARG A 1 179 ? 79.820  123.217 86.543  1.00 30.00  ? 179 ARG A NH1 1 
ATOM 1283  N NH2 . ARG A 1 179 ? 78.426  124.735 87.549  1.00 30.00  ? 179 ARG A NH2 1 
ATOM 1284  N N   . THR A 1 180 ? 81.296  120.904 93.294  1.00 92.25  ? 180 THR A N   1 
ATOM 1285  C CA  . THR A 1 180 ? 81.238  121.458 94.637  1.00 103.08 ? 180 THR A CA  1 
ATOM 1286  C C   . THR A 1 180 ? 82.264  120.748 95.502  1.00 94.35  ? 180 THR A C   1 
ATOM 1287  O O   . THR A 1 180 ? 82.671  119.618 95.213  1.00 104.26 ? 180 THR A O   1 
ATOM 1288  C CB  . THR A 1 180 ? 79.841  121.341 95.269  1.00 30.00  ? 180 THR A CB  1 
ATOM 1289  O OG1 . THR A 1 180 ? 79.833  121.999 96.542  1.00 30.00  ? 180 THR A OG1 1 
ATOM 1290  C CG2 . THR A 1 180 ? 79.440  119.891 95.460  1.00 30.00  ? 180 THR A CG2 1 
ATOM 1291  N N   . LYS A 1 181 ? 82.709  121.441 96.542  1.00 87.17  ? 181 LYS A N   1 
ATOM 1292  C CA  . LYS A 1 181 ? 83.575  120.855 97.551  1.00 109.98 ? 181 LYS A CA  1 
ATOM 1293  C C   . LYS A 1 181 ? 82.723  120.380 98.716  1.00 103.75 ? 181 LYS A C   1 
ATOM 1294  O O   . LYS A 1 181 ? 82.020  121.174 99.347  1.00 108.59 ? 181 LYS A O   1 
ATOM 1295  C CB  . LYS A 1 181 ? 84.630  121.848 98.031  1.00 30.00  ? 181 LYS A CB  1 
ATOM 1296  C CG  . LYS A 1 181 ? 85.588  121.249 99.031  1.00 30.00  ? 181 LYS A CG  1 
ATOM 1297  C CD  . LYS A 1 181 ? 86.645  122.240 99.450  1.00 30.00  ? 181 LYS A CD  1 
ATOM 1298  C CE  . LYS A 1 181 ? 87.609  122.497 98.311  1.00 30.00  ? 181 LYS A CE  1 
ATOM 1299  N NZ  . LYS A 1 181 ? 88.381  121.269 97.973  1.00 30.00  ? 181 LYS A NZ  1 
ATOM 1300  N N   . ILE A 1 182 ? 82.784  119.084 98.983  1.00 87.71  ? 182 ILE A N   1 
ATOM 1301  C CA  . ILE A 1 182 ? 82.055  118.432 100.061 1.00 85.86  ? 182 ILE A CA  1 
ATOM 1302  C C   . ILE A 1 182 ? 83.054  117.612 100.860 1.00 85.66  ? 182 ILE A C   1 
ATOM 1303  O O   . ILE A 1 182 ? 83.678  116.683 100.342 1.00 101.40 ? 182 ILE A O   1 
ATOM 1304  C CB  . ILE A 1 182 ? 80.879  117.608 99.498  1.00 30.00  ? 182 ILE A CB  1 
ATOM 1305  C CG1 . ILE A 1 182 ? 80.351  116.585 100.494 1.00 30.00  ? 182 ILE A CG1 1 
ATOM 1306  C CG2 . ILE A 1 182 ? 81.175  117.059 98.147  1.00 30.00  ? 182 ILE A CG2 1 
ATOM 1307  C CD1 . ILE A 1 182 ? 79.660  117.172 101.600 1.00 30.00  ? 182 ILE A CD1 1 
ATOM 1308  N N   . THR A 1 183 ? 83.243  117.991 102.118 1.00 68.96  ? 183 THR A N   1 
ATOM 1309  C CA  . THR A 1 183 ? 84.407  117.610 102.899 1.00 83.69  ? 183 THR A CA  1 
ATOM 1310  C C   . THR A 1 183 ? 84.014  117.429 104.355 1.00 82.58  ? 183 THR A C   1 
ATOM 1311  O O   . THR A 1 183 ? 83.363  118.292 104.942 1.00 95.81  ? 183 THR A O   1 
ATOM 1312  C CB  . THR A 1 183 ? 85.487  118.693 102.800 1.00 30.00  ? 183 THR A CB  1 
ATOM 1313  O OG1 . THR A 1 183 ? 85.834  118.897 101.428 1.00 30.00  ? 183 THR A OG1 1 
ATOM 1314  C CG2 . THR A 1 183 ? 86.733  118.318 103.583 1.00 30.00  ? 183 THR A CG2 1 
ATOM 1315  N N   . GLY A 1 184 ? 84.427  116.324 104.944 1.00 79.97  ? 184 GLY A N   1 
ATOM 1316  C CA  . GLY A 1 184 ? 84.124  116.097 106.334 1.00 78.59  ? 184 GLY A CA  1 
ATOM 1317  C C   . GLY A 1 184 ? 85.137  115.210 106.995 1.00 88.15  ? 184 GLY A C   1 
ATOM 1318  O O   . GLY A 1 184 ? 86.290  115.131 106.572 1.00 103.22 ? 184 GLY A O   1 
ATOM 1319  N N   . LYS A 1 185 ? 84.687  114.510 108.030 1.00 86.13  ? 185 LYS A N   1 
ATOM 1320  C CA  . LYS A 1 185 ? 85.565  113.629 108.778 1.00 94.37  ? 185 LYS A CA  1 
ATOM 1321  C C   . LYS A 1 185 ? 84.725  112.574 109.476 1.00 83.41  ? 185 LYS A C   1 
ATOM 1322  O O   . LYS A 1 185 ? 83.524  112.758 109.685 1.00 95.27  ? 185 LYS A O   1 
ATOM 1323  C CB  . LYS A 1 185 ? 86.395  114.418 109.790 1.00 30.00  ? 185 LYS A CB  1 
ATOM 1324  C CG  . LYS A 1 185 ? 85.564  115.093 110.848 1.00 30.00  ? 185 LYS A CG  1 
ATOM 1325  C CD  . LYS A 1 185 ? 86.420  115.978 111.714 1.00 30.00  ? 185 LYS A CD  1 
ATOM 1326  C CE  . LYS A 1 185 ? 87.343  115.158 112.574 1.00 30.00  ? 185 LYS A CE  1 
ATOM 1327  N NZ  . LYS A 1 185 ? 88.152  115.999 113.487 1.00 30.00  ? 185 LYS A NZ  1 
ATOM 1328  N N   . VAL A 1 186 ? 85.363  111.462 109.818 1.00 72.23  ? 186 VAL A N   1 
ATOM 1329  C CA  . VAL A 1 186 ? 84.716  110.368 110.531 1.00 76.48  ? 186 VAL A CA  1 
ATOM 1330  C C   . VAL A 1 186 ? 85.467  110.184 111.838 1.00 91.96  ? 186 VAL A C   1 
ATOM 1331  O O   . VAL A 1 186 ? 86.609  109.714 111.835 1.00 98.46  ? 186 VAL A O   1 
ATOM 1332  C CB  . VAL A 1 186 ? 84.727  109.067 109.722 1.00 30.00  ? 186 VAL A CB  1 
ATOM 1333  C CG1 . VAL A 1 186 ? 84.023  107.980 110.504 1.00 30.00  ? 186 VAL A CG1 1 
ATOM 1334  C CG2 . VAL A 1 186 ? 84.106  109.267 108.361 1.00 30.00  ? 186 VAL A CG2 1 
ATOM 1335  N N   . ILE A 1 187 ? 84.846  110.531 112.954 1.00 77.25  ? 187 ILE A N   1 
ATOM 1336  C CA  . ILE A 1 187 ? 85.514  110.505 114.252 1.00 61.12  ? 187 ILE A CA  1 
ATOM 1337  C C   . ILE A 1 187 ? 85.038  109.287 115.036 1.00 80.93  ? 187 ILE A C   1 
ATOM 1338  O O   . ILE A 1 187 ? 83.849  108.950 114.975 1.00 97.89  ? 187 ILE A O   1 
ATOM 1339  C CB  . ILE A 1 187 ? 85.305  111.817 115.038 1.00 30.00  ? 187 ILE A CB  1 
ATOM 1340  C CG1 . ILE A 1 187 ? 86.173  111.829 116.300 1.00 30.00  ? 187 ILE A CG1 1 
ATOM 1341  C CG2 . ILE A 1 187 ? 83.836  112.115 115.341 1.00 30.00  ? 187 ILE A CG2 1 
ATOM 1342  C CD1 . ILE A 1 187 ? 86.363  113.204 116.904 1.00 30.00  ? 187 ILE A CD1 1 
ATOM 1343  N N   . PRO A 1 188 ? 85.933  108.550 115.669 1.00 79.27  ? 188 PRO A N   1 
ATOM 1344  C CA  . PRO A 1 188 ? 85.527  107.468 116.570 1.00 92.71  ? 188 PRO A CA  1 
ATOM 1345  C C   . PRO A 1 188 ? 85.208  107.987 117.956 1.00 106.31 ? 188 PRO A C   1 
ATOM 1346  O O   . PRO A 1 188 ? 85.099  109.198 118.165 1.00 120.75 ? 188 PRO A O   1 
ATOM 1347  C CB  . PRO A 1 188 ? 86.760  106.559 116.610 1.00 30.00  ? 188 PRO A CB  1 
ATOM 1348  C CG  . PRO A 1 188 ? 87.580  106.958 115.444 1.00 30.00  ? 188 PRO A CG  1 
ATOM 1349  C CD  . PRO A 1 188 ? 87.339  108.420 115.275 1.00 30.00  ? 188 PRO A CD  1 
ATOM 1350  N N   . GLU A 1 189 ? 85.026  107.065 118.902 1.00 104.74 ? 189 GLU A N   1 
ATOM 1351  C CA  . GLU A 1 189 ? 84.974  107.437 120.310 1.00 101.76 ? 189 GLU A CA  1 
ATOM 1352  C C   . GLU A 1 189 ? 86.281  108.076 120.756 1.00 111.14 ? 189 GLU A C   1 
ATOM 1353  O O   . GLU A 1 189 ? 86.324  109.255 121.121 1.00 104.62 ? 189 GLU A O   1 
ATOM 1354  C CB  . GLU A 1 189 ? 84.670  106.207 121.159 1.00 30.00  ? 189 GLU A CB  1 
ATOM 1355  C CG  . GLU A 1 189 ? 84.634  106.493 122.640 1.00 30.00  ? 189 GLU A CG  1 
ATOM 1356  C CD  . GLU A 1 189 ? 84.321  105.264 123.453 1.00 30.00  ? 189 GLU A CD  1 
ATOM 1357  O OE1 . GLU A 1 189 ? 84.143  104.186 122.851 1.00 30.00  ? 189 GLU A OE1 1 
ATOM 1358  O OE2 . GLU A 1 189 ? 84.253  105.373 124.695 1.00 30.00  ? 189 GLU A OE2 1 
ATOM 1359  N N   . PHE A 1 190 ? 87.363  107.308 120.718 1.00 129.13 ? 190 PHE A N   1 
ATOM 1360  C CA  . PHE A 1 190 ? 88.667  107.786 121.142 1.00 141.21 ? 190 PHE A CA  1 
ATOM 1361  C C   . PHE A 1 190 ? 89.725  107.640 120.062 1.00 124.26 ? 190 PHE A C   1 
ATOM 1362  O O   . PHE A 1 190 ? 90.828  108.173 120.223 1.00 113.63 ? 190 PHE A O   1 
ATOM 1363  C CB  . PHE A 1 190 ? 89.118  107.058 122.426 1.00 30.00  ? 190 PHE A CB  1 
ATOM 1364  C CG  . PHE A 1 190 ? 89.206  105.553 122.294 1.00 30.00  ? 190 PHE A CG  1 
ATOM 1365  C CD1 . PHE A 1 190 ? 88.103  104.754 122.561 1.00 30.00  ? 190 PHE A CD1 1 
ATOM 1366  C CD2 . PHE A 1 190 ? 90.396  104.937 121.938 1.00 30.00  ? 190 PHE A CD2 1 
ATOM 1367  C CE1 . PHE A 1 190 ? 88.179  103.375 122.446 1.00 30.00  ? 190 PHE A CE1 1 
ATOM 1368  C CE2 . PHE A 1 190 ? 90.476  103.562 121.821 1.00 30.00  ? 190 PHE A CE2 1 
ATOM 1369  C CZ  . PHE A 1 190 ? 89.367  102.781 122.078 1.00 30.00  ? 190 PHE A CZ  1 
ATOM 1370  N N   . GLY A 1 191 ? 89.416  106.959 118.964 1.00 111.32 ? 191 GLY A N   1 
ATOM 1371  C CA  . GLY A 1 191 ? 90.393  106.650 117.945 1.00 115.22 ? 191 GLY A CA  1 
ATOM 1372  C C   . GLY A 1 191 ? 90.776  107.848 117.102 1.00 110.01 ? 191 GLY A C   1 
ATOM 1373  O O   . GLY A 1 191 ? 90.445  108.999 117.391 1.00 109.59 ? 191 GLY A O   1 
ATOM 1374  N N   . ALA A 1 192 ? 91.490  107.562 116.049 1.00 108.77 ? 192 ALA A N   1 
ATOM 1375  C CA  . ALA A 1 192 ? 91.942  108.652 115.199 1.00 106.70 ? 192 ALA A CA  1 
ATOM 1376  C C   . ALA A 1 192 ? 90.853  109.018 114.204 1.00 76.53  ? 192 ALA A C   1 
ATOM 1377  O O   . ALA A 1 192 ? 90.248  108.126 113.603 1.00 78.88  ? 192 ALA A O   1 
ATOM 1378  C CB  . ALA A 1 192 ? 93.208  108.269 114.456 1.00 30.00  ? 192 ALA A CB  1 
ATOM 1379  N N   . PRO A 1 193 ? 90.579  110.305 114.006 1.00 77.98  ? 193 PRO A N   1 
ATOM 1380  C CA  . PRO A 1 193 ? 89.516  110.700 113.078 1.00 87.61  ? 193 PRO A CA  1 
ATOM 1381  C C   . PRO A 1 193 ? 89.945  110.545 111.625 1.00 84.24  ? 193 PRO A C   1 
ATOM 1382  O O   . PRO A 1 193 ? 90.932  111.138 111.185 1.00 100.83 ? 193 PRO A O   1 
ATOM 1383  C CB  . PRO A 1 193 ? 89.268  112.168 113.436 1.00 30.00  ? 193 PRO A CB  1 
ATOM 1384  C CG  . PRO A 1 193 ? 90.535  112.627 114.041 1.00 30.00  ? 193 PRO A CG  1 
ATOM 1385  C CD  . PRO A 1 193 ? 91.106  111.450 114.762 1.00 30.00  ? 193 PRO A CD  1 
ATOM 1386  N N   . GLY A 1 194 ? 89.192  109.742 110.877 1.00 86.21  ? 194 GLY A N   1 
ATOM 1387  C CA  . GLY A 1 194 ? 89.439  109.573 109.456 1.00 97.13  ? 194 GLY A CA  1 
ATOM 1388  C C   . GLY A 1 194 ? 88.730  110.644 108.647 1.00 91.83  ? 194 GLY A C   1 
ATOM 1389  O O   . GLY A 1 194 ? 87.551  110.918 108.853 1.00 103.47 ? 194 GLY A O   1 
ATOM 1390  N N   . VAL A 1 195 ? 89.463  111.234 107.714 1.00 73.79  ? 195 VAL A N   1 
ATOM 1391  C CA  . VAL A 1 195 ? 89.006  112.443 107.054 1.00 78.62  ? 195 VAL A CA  1 
ATOM 1392  C C   . VAL A 1 195 ? 88.550  112.092 105.642 1.00 87.46  ? 195 VAL A C   1 
ATOM 1393  O O   . VAL A 1 195 ? 88.850  111.019 105.116 1.00 109.43 ? 195 VAL A O   1 
ATOM 1394  C CB  . VAL A 1 195 ? 90.124  113.507 107.051 1.00 30.00  ? 195 VAL A CB  1 
ATOM 1395  C CG1 . VAL A 1 195 ? 91.110  113.256 105.925 1.00 30.00  ? 195 VAL A CG1 1 
ATOM 1396  C CG2 . VAL A 1 195 ? 89.572  114.928 107.079 1.00 30.00  ? 195 VAL A CG2 1 
ATOM 1397  N N   . ILE A 1 196 ? 87.796  112.999 105.026 1.00 80.94  ? 196 ILE A N   1 
ATOM 1398  C CA  . ILE A 1 196 ? 87.230  112.775 103.701 1.00 81.29  ? 196 ILE A CA  1 
ATOM 1399  C C   . ILE A 1 196 ? 87.005  114.106 102.989 1.00 89.24  ? 196 ILE A C   1 
ATOM 1400  O O   . ILE A 1 196 ? 86.434  115.041 103.558 1.00 98.54  ? 196 ILE A O   1 
ATOM 1401  C CB  . ILE A 1 196 ? 85.936  111.943 103.809 1.00 30.00  ? 196 ILE A CB  1 
ATOM 1402  C CG1 . ILE A 1 196 ? 85.260  111.785 102.457 1.00 30.00  ? 196 ILE A CG1 1 
ATOM 1403  C CG2 . ILE A 1 196 ? 84.984  112.473 104.865 1.00 30.00  ? 196 ILE A CG2 1 
ATOM 1404  C CD1 . ILE A 1 196 ? 84.115  110.862 102.523 1.00 30.00  ? 196 ILE A CD1 1 
ATOM 1405  N N   . GLU A 1 197 ? 87.474  114.214 101.745 1.00 100.52 ? 197 GLU A N   1 
ATOM 1406  C CA  . GLU A 1 197 ? 87.354  115.448 100.972 1.00 92.70  ? 197 GLU A CA  1 
ATOM 1407  C C   . GLU A 1 197 ? 87.053  115.095 99.524  1.00 91.79  ? 197 GLU A C   1 
ATOM 1408  O O   . GLU A 1 197 ? 87.955  114.697 98.782  1.00 115.82 ? 197 GLU A O   1 
ATOM 1409  C CB  . GLU A 1 197 ? 88.629  116.283 101.059 1.00 30.00  ? 197 GLU A CB  1 
ATOM 1410  C CG  . GLU A 1 197 ? 88.569  117.575 100.274 1.00 30.00  ? 197 GLU A CG  1 
ATOM 1411  C CD  . GLU A 1 197 ? 89.841  118.382 100.370 1.00 30.00  ? 197 GLU A CD  1 
ATOM 1412  O OE1 . GLU A 1 197 ? 90.792  117.913 101.027 1.00 30.00  ? 197 GLU A OE1 1 
ATOM 1413  O OE2 . GLU A 1 197 ? 89.893  119.484 99.783  1.00 30.00  ? 197 GLU A OE2 1 
ATOM 1414  N N   . PHE A 1 198 ? 85.806  115.265 99.108  1.00 80.89  ? 198 PHE A N   1 
ATOM 1415  C CA  . PHE A 1 198 ? 85.422  114.968 97.740  1.00 87.10  ? 198 PHE A CA  1 
ATOM 1416  C C   . PHE A 1 198 ? 85.852  116.092 96.818  1.00 99.66  ? 198 PHE A C   1 
ATOM 1417  O O   . PHE A 1 198 ? 86.185  117.191 97.267  1.00 107.35 ? 198 PHE A O   1 
ATOM 1418  C CB  . PHE A 1 198 ? 83.920  114.801 97.579  1.00 30.00  ? 198 PHE A CB  1 
ATOM 1419  C CG  . PHE A 1 198 ? 83.334  113.683 98.351  1.00 30.00  ? 198 PHE A CG  1 
ATOM 1420  C CD1 . PHE A 1 198 ? 83.550  112.388 97.965  1.00 30.00  ? 198 PHE A CD1 1 
ATOM 1421  C CD2 . PHE A 1 198 ? 82.482  113.931 99.408  1.00 30.00  ? 198 PHE A CD2 1 
ATOM 1422  C CE1 . PHE A 1 198 ? 82.986  111.362 98.643  1.00 30.00  ? 198 PHE A CE1 1 
ATOM 1423  C CE2 . PHE A 1 198 ? 81.907  112.905 100.098 1.00 30.00  ? 198 PHE A CE2 1 
ATOM 1424  C CZ  . PHE A 1 198 ? 82.154  111.619 99.707  1.00 30.00  ? 198 PHE A CZ  1 
ATOM 1425  N N   . THR A 1 199 ? 85.830  115.808 95.522  1.00 95.30  ? 199 THR A N   1 
ATOM 1426  C CA  . THR A 1 199 ? 85.918  116.868 94.533  1.00 87.27  ? 199 THR A CA  1 
ATOM 1427  C C   . THR A 1 199 ? 84.616  117.015 93.761  1.00 91.37  ? 199 THR A C   1 
ATOM 1428  O O   . THR A 1 199 ? 84.307  118.121 93.303  1.00 118.25 ? 199 THR A O   1 
ATOM 1429  C CB  . THR A 1 199 ? 87.073  116.603 93.573  1.00 30.00  ? 199 THR A CB  1 
ATOM 1430  O OG1 . THR A 1 199 ? 86.825  115.393 92.849  1.00 30.00  ? 199 THR A OG1 1 
ATOM 1431  C CG2 . THR A 1 199 ? 88.360  116.453 94.350  1.00 30.00  ? 199 THR A CG2 1 
ATOM 1432  N N   . THR A 1 200 ? 83.834  115.918 93.649  1.00 66.50  ? 200 THR A N   1 
ATOM 1433  C CA  . THR A 1 200 ? 82.571  115.794 92.921  1.00 93.24  ? 200 THR A CA  1 
ATOM 1434  C C   . THR A 1 200 ? 82.765  116.247 91.481  1.00 108.13 ? 200 THR A C   1 
ATOM 1435  O O   . THR A 1 200 ? 82.517  117.420 91.170  1.00 112.01 ? 200 THR A O   1 
ATOM 1436  C CB  . THR A 1 200 ? 81.454  116.583 93.599  1.00 30.00  ? 200 THR A CB  1 
ATOM 1437  O OG1 . THR A 1 200 ? 81.414  116.228 94.980  1.00 30.00  ? 200 THR A OG1 1 
ATOM 1438  C CG2 . THR A 1 200 ? 80.112  116.208 92.998  1.00 30.00  ? 200 THR A CG2 1 
ATOM 1439  N N   . PRO A 1 201 ? 83.314  115.379 90.625  1.00 98.08  ? 201 PRO A N   1 
ATOM 1440  C CA  . PRO A 1 201 ? 83.767  115.798 89.290  1.00 101.37 ? 201 PRO A CA  1 
ATOM 1441  C C   . PRO A 1 201 ? 82.656  116.384 88.436  1.00 96.67  ? 201 PRO A C   1 
ATOM 1442  O O   . PRO A 1 201 ? 81.533  115.883 88.417  1.00 97.22  ? 201 PRO A O   1 
ATOM 1443  C CB  . PRO A 1 201 ? 84.300  114.498 88.684  1.00 30.00  ? 201 PRO A CB  1 
ATOM 1444  C CG  . PRO A 1 201 ? 83.557  113.433 89.388  1.00 30.00  ? 201 PRO A CG  1 
ATOM 1445  C CD  . PRO A 1 201 ? 83.364  113.921 90.787  1.00 30.00  ? 201 PRO A CD  1 
ATOM 1446  N N   . SER A 1 202 ? 82.988  117.469 87.743  1.00 84.53  ? 202 SER A N   1 
ATOM 1447  C CA  . SER A 1 202 ? 81.980  118.333 87.151  1.00 96.04  ? 202 SER A CA  1 
ATOM 1448  C C   . SER A 1 202 ? 81.331  117.685 85.939  1.00 107.48 ? 202 SER A C   1 
ATOM 1449  O O   . SER A 1 202 ? 82.017  117.155 85.061  1.00 120.32 ? 202 SER A O   1 
ATOM 1450  C CB  . SER A 1 202 ? 82.602  119.664 86.745  1.00 30.00  ? 202 SER A CB  1 
ATOM 1451  O OG  . SER A 1 202 ? 83.531  119.482 85.694  1.00 30.00  ? 202 SER A OG  1 
ATOM 1452  N N   . THR A 1 203 ? 79.995  117.732 85.922  1.00 102.41 ? 203 THR A N   1 
ATOM 1453  C CA  . THR A 1 203 ? 79.137  117.409 84.780  1.00 89.41  ? 203 THR A CA  1 
ATOM 1454  C C   . THR A 1 203 ? 79.336  115.950 84.348  1.00 95.49  ? 203 THR A C   1 
ATOM 1455  O O   . THR A 1 203 ? 79.849  115.640 83.274  1.00 116.57 ? 203 THR A O   1 
ATOM 1456  C CB  . THR A 1 203 ? 79.399  118.404 83.642  1.00 30.00  ? 203 THR A CB  1 
ATOM 1457  O OG1 . THR A 1 203 ? 79.469  119.723 84.194  1.00 30.00  ? 203 THR A OG1 1 
ATOM 1458  C CG2 . THR A 1 203 ? 78.253  118.418 82.677  1.00 30.00  ? 203 THR A CG2 1 
ATOM 1459  N N   . TYR A 1 204 ? 78.935  115.059 85.249  1.00 87.34  ? 204 TYR A N   1 
ATOM 1460  C CA  . TYR A 1 204 ? 79.347  113.662 85.241  1.00 85.33  ? 204 TYR A CA  1 
ATOM 1461  C C   . TYR A 1 204 ? 78.285  112.735 84.667  1.00 90.64  ? 204 TYR A C   1 
ATOM 1462  O O   . TYR A 1 204 ? 77.200  113.151 84.260  1.00 110.75 ? 204 TYR A O   1 
ATOM 1463  C CB  . TYR A 1 204 ? 79.707  113.211 86.660  1.00 30.00  ? 204 TYR A CB  1 
ATOM 1464  C CG  . TYR A 1 204 ? 78.632  113.469 87.703  1.00 30.00  ? 204 TYR A CG  1 
ATOM 1465  C CD1 . TYR A 1 204 ? 77.602  112.569 87.922  1.00 30.00  ? 204 TYR A CD1 1 
ATOM 1466  C CD2 . TYR A 1 204 ? 78.661  114.617 88.479  1.00 30.00  ? 204 TYR A CD2 1 
ATOM 1467  C CE1 . TYR A 1 204 ? 76.641  112.813 88.870  1.00 30.00  ? 204 TYR A CE1 1 
ATOM 1468  C CE2 . TYR A 1 204 ? 77.710  114.853 89.438  1.00 30.00  ? 204 TYR A CE2 1 
ATOM 1469  C CZ  . TYR A 1 204 ? 76.704  113.959 89.623  1.00 30.00  ? 204 TYR A CZ  1 
ATOM 1470  O OH  . TYR A 1 204 ? 75.758  114.229 90.573  1.00 30.00  ? 204 TYR A OH  1 
ATOM 1471  N N   . THR A 1 205 ? 78.636  111.451 84.655  1.00 82.57  ? 205 THR A N   1 
ATOM 1472  C CA  . THR A 1 205 ? 77.751  110.325 84.391  1.00 83.12  ? 205 THR A CA  1 
ATOM 1473  C C   . THR A 1 205 ? 77.658  109.467 85.652  1.00 89.17  ? 205 THR A C   1 
ATOM 1474  O O   . THR A 1 205 ? 78.278  109.771 86.672  1.00 113.02 ? 205 THR A O   1 
ATOM 1475  C CB  . THR A 1 205 ? 78.255  109.510 83.202  1.00 30.00  ? 205 THR A CB  1 
ATOM 1476  O OG1 . THR A 1 205 ? 79.548  108.974 83.509  1.00 30.00  ? 205 THR A OG1 1 
ATOM 1477  C CG2 . THR A 1 205 ? 78.355  110.393 81.967  1.00 30.00  ? 205 THR A CG2 1 
ATOM 1478  N N   . SER A 1 206 ? 76.907  108.368 85.568  1.00 77.54  ? 206 SER A N   1 
ATOM 1479  C CA  . SER A 1 206 ? 76.453  107.683 86.774  1.00 75.49  ? 206 SER A CA  1 
ATOM 1480  C C   . SER A 1 206 ? 77.572  106.895 87.453  1.00 85.95  ? 206 SER A C   1 
ATOM 1481  O O   . SER A 1 206 ? 78.554  106.494 86.822  1.00 96.77  ? 206 SER A O   1 
ATOM 1482  C CB  . SER A 1 206 ? 75.277  106.765 86.455  1.00 30.00  ? 206 SER A CB  1 
ATOM 1483  O OG  . SER A 1 206 ? 74.166  107.509 85.996  1.00 30.00  ? 206 SER A OG  1 
ATOM 1484  N N   . GLU A 1 207 ? 77.402  106.695 88.770  1.00 92.70  ? 207 GLU A N   1 
ATOM 1485  C CA  . GLU A 1 207 ? 78.366  106.050 89.673  1.00 84.94  ? 207 GLU A CA  1 
ATOM 1486  C C   . GLU A 1 207 ? 79.699  106.811 89.664  1.00 75.08  ? 207 GLU A C   1 
ATOM 1487  O O   . GLU A 1 207 ? 80.656  106.470 88.974  1.00 99.39  ? 207 GLU A O   1 
ATOM 1488  C CB  . GLU A 1 207 ? 78.523  104.558 89.361  1.00 30.00  ? 207 GLU A CB  1 
ATOM 1489  C CG  . GLU A 1 207 ? 78.982  103.745 90.550  1.00 30.00  ? 207 GLU A CG  1 
ATOM 1490  C CD  . GLU A 1 207 ? 80.472  103.751 90.743  1.00 30.00  ? 207 GLU A CD  1 
ATOM 1491  O OE1 . GLU A 1 207 ? 81.206  103.846 89.742  1.00 30.00  ? 207 GLU A OE1 1 
ATOM 1492  O OE2 . GLU A 1 207 ? 80.914  103.662 91.903  1.00 30.00  ? 207 GLU A OE2 1 
ATOM 1493  N N   . VAL A 1 208 ? 79.692  107.918 90.404  1.00 54.53  ? 208 VAL A N   1 
ATOM 1494  C CA  . VAL A 1 208 ? 80.523  109.099 90.176  1.00 74.84  ? 208 VAL A CA  1 
ATOM 1495  C C   . VAL A 1 208 ? 81.935  108.948 90.762  1.00 90.59  ? 208 VAL A C   1 
ATOM 1496  O O   . VAL A 1 208 ? 82.728  109.893 90.716  1.00 111.15 ? 208 VAL A O   1 
ATOM 1497  C CB  . VAL A 1 208 ? 79.770  110.313 90.772  1.00 30.00  ? 208 VAL A CB  1 
ATOM 1498  C CG1 . VAL A 1 208 ? 80.227  111.671 90.223  1.00 30.00  ? 208 VAL A CG1 1 
ATOM 1499  C CG2 . VAL A 1 208 ? 78.278  110.142 90.598  1.00 30.00  ? 208 VAL A CG2 1 
ATOM 1500  N N   . ILE A 1 209 ? 82.311  107.722 91.161  1.00 82.05  ? 209 ILE A N   1 
ATOM 1501  C CA  . ILE A 1 209 ? 83.290  107.372 92.205  1.00 100.57 ? 209 ILE A CA  1 
ATOM 1502  C C   . ILE A 1 209 ? 84.539  108.250 92.301  1.00 110.18 ? 209 ILE A C   1 
ATOM 1503  O O   . ILE A 1 209 ? 85.227  108.499 91.306  1.00 121.76 ? 209 ILE A O   1 
ATOM 1504  C CB  . ILE A 1 209 ? 83.707  105.894 92.022  1.00 30.00  ? 209 ILE A CB  1 
ATOM 1505  C CG1 . ILE A 1 209 ? 84.803  105.497 93.015  1.00 30.00  ? 209 ILE A CG1 1 
ATOM 1506  C CG2 . ILE A 1 209 ? 84.080  105.577 90.570  1.00 30.00  ? 209 ILE A CG2 1 
ATOM 1507  C CD1 . ILE A 1 209 ? 85.179  104.040 92.965  1.00 30.00  ? 209 ILE A CD1 1 
ATOM 1508  N N   . GLU A 1 210 ? 84.805  108.764 93.503  1.00 30.00  ? 210 GLU A N   1 
ATOM 1509  C CA  . GLU A 1 210 ? 85.916  109.671 93.745  1.00 30.00  ? 210 GLU A CA  1 
ATOM 1510  C C   . GLU A 1 210 ? 86.483  109.395 95.131  1.00 30.00  ? 210 GLU A C   1 
ATOM 1511  O O   . GLU A 1 210 ? 85.758  109.006 96.048  1.00 30.00  ? 210 GLU A O   1 
ATOM 1512  C CB  . GLU A 1 210 ? 85.475  111.132 93.602  1.00 30.00  ? 210 GLU A CB  1 
ATOM 1513  C CG  . GLU A 1 210 ? 84.535  111.627 94.677  1.00 30.00  ? 210 GLU A CG  1 
ATOM 1514  C CD  . GLU A 1 210 ? 83.074  111.292 94.433  1.00 30.00  ? 210 GLU A CD  1 
ATOM 1515  O OE1 . GLU A 1 210 ? 82.771  110.466 93.553  1.00 30.00  ? 210 GLU A OE1 1 
ATOM 1516  O OE2 . GLU A 1 210 ? 82.212  111.852 95.136  1.00 30.00  ? 210 GLU A OE2 1 
ATOM 1517  N N   . LEU A 1 211 ? 87.786  109.594 95.276  1.00 30.00  ? 211 LEU A N   1 
ATOM 1518  C CA  . LEU A 1 211 ? 88.532  108.990 96.370  1.00 30.00  ? 211 LEU A CA  1 
ATOM 1519  C C   . LEU A 1 211 ? 88.647  109.915 97.575  1.00 30.00  ? 211 LEU A C   1 
ATOM 1520  O O   . LEU A 1 211 ? 88.697  111.140 97.444  1.00 30.00  ? 211 LEU A O   1 
ATOM 1521  C CB  . LEU A 1 211 ? 89.929  108.583 95.895  1.00 30.00  ? 211 LEU A CB  1 
ATOM 1522  C CG  . LEU A 1 211 ? 89.988  107.490 94.824  1.00 30.00  ? 211 LEU A CG  1 
ATOM 1523  C CD1 . LEU A 1 211 ? 91.417  107.290 94.341  1.00 30.00  ? 211 LEU A CD1 1 
ATOM 1524  C CD2 . LEU A 1 211 ? 89.408  106.187 95.352  1.00 30.00  ? 211 LEU A CD2 1 
ATOM 1525  N N   . GLN A 1 212 ? 88.692  109.285 98.751  1.00 30.00  ? 212 GLN A N   1 
ATOM 1526  C CA  . GLN A 1 212 ? 88.934  109.881 100.071 1.00 30.00  ? 212 GLN A CA  1 
ATOM 1527  C C   . GLN A 1 212 ? 88.026  111.062 100.400 1.00 30.00  ? 212 GLN A C   1 
ATOM 1528  O O   . GLN A 1 212 ? 88.357  112.212 100.129 1.00 30.00  ? 212 GLN A O   1 
ATOM 1529  C CB  . GLN A 1 212 ? 90.403  110.299 100.206 1.00 30.00  ? 212 GLN A CB  1 
ATOM 1530  C CG  . GLN A 1 212 ? 90.797  110.681 101.630 1.00 30.00  ? 212 GLN A CG  1 
ATOM 1531  C CD  . GLN A 1 212 ? 92.269  111.000 101.782 1.00 30.00  ? 212 GLN A CD  1 
ATOM 1532  O OE1 . GLN A 1 212 ? 93.024  110.984 100.814 1.00 30.00  ? 212 GLN A OE1 1 
ATOM 1533  N NE2 . GLN A 1 212 ? 92.683  111.289 103.009 1.00 30.00  ? 212 GLN A NE2 1 
ATOM 1534  N N   . ALA B 1 6   ? 115.190 107.393 208.952 1.00 30.00  ? 6   ALA B N   1 
ATOM 1535  C CA  . ALA B 1 6   ? 115.026 108.706 208.339 1.00 30.00  ? 6   ALA B CA  1 
ATOM 1536  C C   . ALA B 1 6   ? 114.207 108.623 207.053 1.00 30.00  ? 6   ALA B C   1 
ATOM 1537  O O   . ALA B 1 6   ? 113.481 107.655 206.826 1.00 30.00  ? 6   ALA B O   1 
ATOM 1538  C CB  . ALA B 1 6   ? 116.385 109.334 208.062 1.00 30.00  ? 6   ALA B CB  1 
ATOM 1539  N N   . VAL B 1 7   ? 114.335 109.649 206.214 1.00 176.07 ? 7   VAL B N   1 
ATOM 1540  C CA  . VAL B 1 7   ? 113.570 109.754 204.978 1.00 158.44 ? 7   VAL B CA  1 
ATOM 1541  C C   . VAL B 1 7   ? 114.530 109.428 203.836 1.00 137.52 ? 7   VAL B C   1 
ATOM 1542  O O   . VAL B 1 7   ? 114.118 109.138 202.706 1.00 139.74 ? 7   VAL B O   1 
ATOM 1543  C CB  . VAL B 1 7   ? 112.941 111.161 204.861 1.00 30.00  ? 7   VAL B CB  1 
ATOM 1544  C CG1 . VAL B 1 7   ? 111.977 111.283 203.684 1.00 30.00  ? 7   VAL B CG1 1 
ATOM 1545  C CG2 . VAL B 1 7   ? 112.233 111.529 206.155 1.00 30.00  ? 7   VAL B CG2 1 
ATOM 1546  N N   . GLY B 1 8   ? 115.825 109.396 204.149 1.00 131.64 ? 8   GLY B N   1 
ATOM 1547  C CA  . GLY B 1 8   ? 116.841 109.099 203.155 1.00 139.85 ? 8   GLY B CA  1 
ATOM 1548  C C   . GLY B 1 8   ? 116.903 107.658 202.696 1.00 132.89 ? 8   GLY B C   1 
ATOM 1549  O O   . GLY B 1 8   ? 117.601 107.362 201.722 1.00 133.27 ? 8   GLY B O   1 
ATOM 1550  N N   . ILE B 1 9   ? 116.201 106.753 203.374 1.00 131.26 ? 9   ILE B N   1 
ATOM 1551  C CA  . ILE B 1 9   ? 116.132 105.373 202.913 1.00 135.93 ? 9   ILE B CA  1 
ATOM 1552  C C   . ILE B 1 9   ? 115.286 105.283 201.648 1.00 126.64 ? 9   ILE B C   1 
ATOM 1553  O O   . ILE B 1 9   ? 115.645 104.579 200.697 1.00 121.41 ? 9   ILE B O   1 
ATOM 1554  C CB  . ILE B 1 9   ? 115.593 104.455 204.034 1.00 30.00  ? 9   ILE B CB  1 
ATOM 1555  C CG1 . ILE B 1 9   ? 116.540 104.412 205.244 1.00 30.00  ? 9   ILE B CG1 1 
ATOM 1556  C CG2 . ILE B 1 9   ? 115.360 103.034 203.534 1.00 30.00  ? 9   ILE B CG2 1 
ATOM 1557  C CD1 . ILE B 1 9   ? 116.195 105.369 206.381 1.00 30.00  ? 9   ILE B CD1 1 
ATOM 1558  N N   . GLY B 1 10  ? 114.181 106.035 201.602 1.00 116.23 ? 10  GLY B N   1 
ATOM 1559  C CA  . GLY B 1 10  ? 113.242 105.922 200.498 1.00 108.48 ? 10  GLY B CA  1 
ATOM 1560  C C   . GLY B 1 10  ? 113.772 106.451 199.182 1.00 119.42 ? 10  GLY B C   1 
ATOM 1561  O O   . GLY B 1 10  ? 113.394 105.953 198.118 1.00 124.33 ? 10  GLY B O   1 
ATOM 1562  N N   . THR B 1 11  ? 114.665 107.444 199.230 1.00 133.79 ? 11  THR B N   1 
ATOM 1563  C CA  . THR B 1 11  ? 115.297 107.931 198.007 1.00 134.97 ? 11  THR B CA  1 
ATOM 1564  C C   . THR B 1 11  ? 116.329 106.945 197.479 1.00 126.74 ? 11  THR B C   1 
ATOM 1565  O O   . THR B 1 11  ? 116.737 107.038 196.317 1.00 132.88 ? 11  THR B O   1 
ATOM 1566  C CB  . THR B 1 11  ? 115.954 109.285 198.251 1.00 30.00  ? 11  THR B CB  1 
ATOM 1567  O OG1 . THR B 1 11  ? 116.995 109.137 199.222 1.00 30.00  ? 11  THR B OG1 1 
ATOM 1568  C CG2 . THR B 1 11  ? 114.935 110.277 198.772 1.00 30.00  ? 11  THR B CG2 1 
ATOM 1569  N N   . LEU B 1 12  ? 116.772 106.011 198.323 1.00 118.09 ? 12  LEU B N   1 
ATOM 1570  C CA  . LEU B 1 12  ? 117.638 104.931 197.865 1.00 128.80 ? 12  LEU B CA  1 
ATOM 1571  C C   . LEU B 1 12  ? 116.815 103.786 197.285 1.00 127.81 ? 12  LEU B C   1 
ATOM 1572  O O   . LEU B 1 12  ? 117.282 103.048 196.411 1.00 112.49 ? 12  LEU B O   1 
ATOM 1573  C CB  . LEU B 1 12  ? 118.502 104.445 199.027 1.00 30.00  ? 12  LEU B CB  1 
ATOM 1574  C CG  . LEU B 1 12  ? 119.444 105.494 199.615 1.00 30.00  ? 12  LEU B CG  1 
ATOM 1575  C CD1 . LEU B 1 12  ? 120.115 104.973 200.871 1.00 30.00  ? 12  LEU B CD1 1 
ATOM 1576  C CD2 . LEU B 1 12  ? 120.481 105.906 198.586 1.00 30.00  ? 12  LEU B CD2 1 
ATOM 1577  N N   . ILE B 1 13  ? 115.582 103.624 197.766 1.00 134.37 ? 13  ILE B N   1 
ATOM 1578  C CA  . ILE B 1 13  ? 114.726 102.554 197.270 1.00 120.65 ? 13  ILE B CA  1 
ATOM 1579  C C   . ILE B 1 13  ? 114.175 102.908 195.895 1.00 125.25 ? 13  ILE B C   1 
ATOM 1580  O O   . ILE B 1 13  ? 114.110 102.055 195.000 1.00 127.06 ? 13  ILE B O   1 
ATOM 1581  C CB  . ILE B 1 13  ? 113.616 102.261 198.294 1.00 30.00  ? 13  ILE B CB  1 
ATOM 1582  C CG1 . ILE B 1 13  ? 114.241 101.766 199.597 1.00 30.00  ? 13  ILE B CG1 1 
ATOM 1583  C CG2 . ILE B 1 13  ? 112.643 101.216 197.782 1.00 30.00  ? 13  ILE B CG2 1 
ATOM 1584  C CD1 . ILE B 1 13  ? 113.260 101.615 200.727 1.00 30.00  ? 13  ILE B CD1 1 
ATOM 1585  N N   . VAL B 1 14  ? 113.789 104.173 195.696 1.00 120.61 ? 14  VAL B N   1 
ATOM 1586  C CA  . VAL B 1 14  ? 113.405 104.643 194.365 1.00 119.27 ? 14  VAL B CA  1 
ATOM 1587  C C   . VAL B 1 14  ? 114.607 104.602 193.426 1.00 125.86 ? 14  VAL B C   1 
ATOM 1588  O O   . VAL B 1 14  ? 114.462 104.315 192.229 1.00 127.57 ? 14  VAL B O   1 
ATOM 1589  C CB  . VAL B 1 14  ? 112.783 106.051 194.470 1.00 30.00  ? 14  VAL B CB  1 
ATOM 1590  C CG1 . VAL B 1 14  ? 112.418 106.622 193.103 1.00 30.00  ? 14  VAL B CG1 1 
ATOM 1591  C CG2 . VAL B 1 14  ? 111.550 106.011 195.357 1.00 30.00  ? 14  VAL B CG2 1 
ATOM 1592  N N   . PHE B 1 15  ? 115.812 104.826 193.965 1.00 120.93 ? 15  PHE B N   1 
ATOM 1593  C CA  . PHE B 1 15  ? 117.040 104.625 193.199 1.00 130.25 ? 15  PHE B CA  1 
ATOM 1594  C C   . PHE B 1 15  ? 117.202 103.169 192.774 1.00 137.12 ? 15  PHE B C   1 
ATOM 1595  O O   . PHE B 1 15  ? 117.767 102.887 191.714 1.00 136.10 ? 15  PHE B O   1 
ATOM 1596  C CB  . PHE B 1 15  ? 118.245 105.090 194.018 1.00 30.00  ? 15  PHE B CB  1 
ATOM 1597  C CG  . PHE B 1 15  ? 119.564 104.878 193.333 1.00 30.00  ? 15  PHE B CG  1 
ATOM 1598  C CD1 . PHE B 1 15  ? 119.951 105.688 192.278 1.00 30.00  ? 15  PHE B CD1 1 
ATOM 1599  C CD2 . PHE B 1 15  ? 120.426 103.878 193.758 1.00 30.00  ? 15  PHE B CD2 1 
ATOM 1600  C CE1 . PHE B 1 15  ? 121.171 105.495 191.646 1.00 30.00  ? 15  PHE B CE1 1 
ATOM 1601  C CE2 . PHE B 1 15  ? 121.645 103.679 193.132 1.00 30.00  ? 15  PHE B CE2 1 
ATOM 1602  C CZ  . PHE B 1 15  ? 122.018 104.489 192.076 1.00 30.00  ? 15  PHE B CZ  1 
ATOM 1603  N N   . ILE B 1 16  ? 116.708 102.228 193.579 1.00 132.37 ? 16  ILE B N   1 
ATOM 1604  C CA  . ILE B 1 16  ? 116.641 100.850 193.105 1.00 131.31 ? 16  ILE B CA  1 
ATOM 1605  C C   . ILE B 1 16  ? 115.482 100.687 192.133 1.00 126.36 ? 16  ILE B C   1 
ATOM 1606  O O   . ILE B 1 16  ? 115.607 100.007 191.107 1.00 114.96 ? 16  ILE B O   1 
ATOM 1607  C CB  . ILE B 1 16  ? 116.531 99.879  194.297 1.00 30.00  ? 16  ILE B CB  1 
ATOM 1608  C CG1 . ILE B 1 16  ? 117.751 100.018 195.202 1.00 30.00  ? 16  ILE B CG1 1 
ATOM 1609  C CG2 . ILE B 1 16  ? 116.425 98.441  193.826 1.00 30.00  ? 16  ILE B CG2 1 
ATOM 1610  C CD1 . ILE B 1 16  ? 117.630 99.263  196.505 1.00 30.00  ? 16  ILE B CD1 1 
ATOM 1611  N N   . ALA B 1 17  ? 114.357 101.349 192.406 1.00 123.07 ? 17  ALA B N   1 
ATOM 1612  C CA  . ALA B 1 17  ? 113.133 101.082 191.659 1.00 113.60 ? 17  ALA B CA  1 
ATOM 1613  C C   . ALA B 1 17  ? 113.153 101.744 190.286 1.00 122.78 ? 17  ALA B C   1 
ATOM 1614  O O   . ALA B 1 17  ? 112.907 101.086 189.269 1.00 135.51 ? 17  ALA B O   1 
ATOM 1615  C CB  . ALA B 1 17  ? 111.923 101.550 192.463 1.00 30.00  ? 17  ALA B CB  1 
ATOM 1616  N N   . MET B 1 18  ? 113.435 103.047 190.238 1.00 110.98 ? 18  MET B N   1 
ATOM 1617  C CA  . MET B 1 18  ? 113.296 103.798 188.993 1.00 128.27 ? 18  MET B CA  1 
ATOM 1618  C C   . MET B 1 18  ? 114.400 103.464 187.991 1.00 133.84 ? 18  MET B C   1 
ATOM 1619  O O   . MET B 1 18  ? 114.195 103.622 186.783 1.00 141.63 ? 18  MET B O   1 
ATOM 1620  C CB  . MET B 1 18  ? 113.253 105.301 189.311 1.00 30.00  ? 18  MET B CB  1 
ATOM 1621  C CG  . MET B 1 18  ? 112.911 106.225 188.145 1.00 30.00  ? 18  MET B CG  1 
ATOM 1622  S SD  . MET B 1 18  ? 112.721 107.943 188.643 1.00 30.00  ? 18  MET B SD  1 
ATOM 1623  C CE  . MET B 1 18  ? 112.512 108.724 187.047 1.00 30.00  ? 18  MET B CE  1 
ATOM 1624  N N   . VAL B 1 19  ? 115.548 102.974 188.460 1.00 128.57 ? 19  VAL B N   1 
ATOM 1625  C CA  . VAL B 1 19  ? 116.553 102.434 187.550 1.00 124.82 ? 19  VAL B CA  1 
ATOM 1626  C C   . VAL B 1 19  ? 116.042 101.160 186.883 1.00 121.88 ? 19  VAL B C   1 
ATOM 1627  O O   . VAL B 1 19  ? 116.265 100.937 185.686 1.00 114.40 ? 19  VAL B O   1 
ATOM 1628  C CB  . VAL B 1 19  ? 117.877 102.221 188.309 1.00 30.00  ? 19  VAL B CB  1 
ATOM 1629  C CG1 . VAL B 1 19  ? 118.876 101.419 187.495 1.00 30.00  ? 19  VAL B CG1 1 
ATOM 1630  C CG2 . VAL B 1 19  ? 118.484 103.568 188.635 1.00 30.00  ? 19  VAL B CG2 1 
ATOM 1631  N N   . LEU B 1 20  ? 115.311 100.325 187.629 1.00 123.94 ? 20  LEU B N   1 
ATOM 1632  C CA  . LEU B 1 20  ? 114.648 99.179  187.012 1.00 120.76 ? 20  LEU B CA  1 
ATOM 1633  C C   . LEU B 1 20  ? 113.507 99.619  186.104 1.00 118.82 ? 20  LEU B C   1 
ATOM 1634  O O   . LEU B 1 20  ? 113.188 98.924  185.133 1.00 128.24 ? 20  LEU B O   1 
ATOM 1635  C CB  . LEU B 1 20  ? 114.140 98.216  188.081 1.00 30.00  ? 20  LEU B CB  1 
ATOM 1636  C CG  . LEU B 1 20  ? 115.227 97.506  188.885 1.00 30.00  ? 20  LEU B CG  1 
ATOM 1637  C CD1 . LEU B 1 20  ? 114.614 96.669  189.992 1.00 30.00  ? 20  LEU B CD1 1 
ATOM 1638  C CD2 . LEU B 1 20  ? 116.082 96.648  187.972 1.00 30.00  ? 20  LEU B CD2 1 
ATOM 1639  N N   . VAL B 1 21  ? 112.886 100.762 186.403 1.00 118.89 ? 21  VAL B N   1 
ATOM 1640  C CA  . VAL B 1 21  ? 111.979 101.384 185.445 1.00 124.09 ? 21  VAL B CA  1 
ATOM 1641  C C   . VAL B 1 21  ? 112.772 101.963 184.278 1.00 132.71 ? 21  VAL B C   1 
ATOM 1642  O O   . VAL B 1 21  ? 112.333 101.900 183.122 1.00 133.89 ? 21  VAL B O   1 
ATOM 1643  C CB  . VAL B 1 21  ? 111.118 102.449 186.153 1.00 30.00  ? 21  VAL B CB  1 
ATOM 1644  C CG1 . VAL B 1 21  ? 110.182 103.150 185.177 1.00 30.00  ? 21  VAL B CG1 1 
ATOM 1645  C CG2 . VAL B 1 21  ? 110.328 101.813 187.282 1.00 30.00  ? 21  VAL B CG2 1 
ATOM 1646  N N   . ALA B 1 22  ? 113.964 102.503 184.548 1.00 119.64 ? 22  ALA B N   1 
ATOM 1647  C CA  . ALA B 1 22  ? 114.841 102.931 183.462 1.00 121.63 ? 22  ALA B CA  1 
ATOM 1648  C C   . ALA B 1 22  ? 115.383 101.734 182.694 1.00 121.50 ? 22  ALA B C   1 
ATOM 1649  O O   . ALA B 1 22  ? 115.686 101.841 181.500 1.00 124.27 ? 22  ALA B O   1 
ATOM 1650  C CB  . ALA B 1 22  ? 115.987 103.779 184.007 1.00 30.00  ? 22  ALA B CB  1 
ATOM 1651  N N   . ALA B 1 23  ? 115.514 100.588 183.362 1.00 123.64 ? 23  ALA B N   1 
ATOM 1652  C CA  . ALA B 1 23  ? 115.874 99.360  182.673 1.00 136.43 ? 23  ALA B CA  1 
ATOM 1653  C C   . ALA B 1 23  ? 114.788 98.894  181.718 1.00 124.63 ? 23  ALA B C   1 
ATOM 1654  O O   . ALA B 1 23  ? 115.094 98.599  180.561 1.00 135.97 ? 23  ALA B O   1 
ATOM 1655  C CB  . ALA B 1 23  ? 116.185 98.250  183.678 1.00 30.00  ? 23  ALA B CB  1 
ATOM 1656  N N   . VAL B 1 24  ? 113.528 98.851  182.155 1.00 119.23 ? 24  VAL B N   1 
ATOM 1657  C CA  . VAL B 1 24  ? 112.443 98.471  181.258 1.00 115.14 ? 24  VAL B CA  1 
ATOM 1658  C C   . VAL B 1 24  ? 112.099 99.590  180.283 1.00 115.95 ? 24  VAL B C   1 
ATOM 1659  O O   . VAL B 1 24  ? 111.373 99.344  179.309 1.00 121.87 ? 24  VAL B O   1 
ATOM 1660  C CB  . VAL B 1 24  ? 111.182 98.033  182.033 1.00 30.00  ? 24  VAL B CB  1 
ATOM 1661  C CG1 . VAL B 1 24  ? 111.516 96.903  183.001 1.00 30.00  ? 24  VAL B CG1 1 
ATOM 1662  C CG2 . VAL B 1 24  ? 110.537 99.201  182.740 1.00 30.00  ? 24  VAL B CG2 1 
ATOM 1663  N N   . ALA B 1 25  ? 112.597 100.805 180.511 1.00 113.08 ? 25  ALA B N   1 
ATOM 1664  C CA  . ALA B 1 25  ? 112.595 101.814 179.466 1.00 132.88 ? 25  ALA B CA  1 
ATOM 1665  C C   . ALA B 1 25  ? 113.624 101.512 178.390 1.00 125.56 ? 25  ALA B C   1 
ATOM 1666  O O   . ALA B 1 25  ? 113.542 102.075 177.296 1.00 130.11 ? 25  ALA B O   1 
ATOM 1667  C CB  . ALA B 1 25  ? 112.864 103.194 180.061 1.00 30.00  ? 25  ALA B CB  1 
ATOM 1668  N N   . ALA B 1 26  ? 114.603 100.659 178.688 1.00 112.05 ? 26  ALA B N   1 
ATOM 1669  C CA  . ALA B 1 26  ? 115.561 100.198 177.697 1.00 121.96 ? 26  ALA B CA  1 
ATOM 1670  C C   . ALA B 1 26  ? 115.353 98.745  177.306 1.00 122.57 ? 26  ALA B C   1 
ATOM 1671  O O   . ALA B 1 26  ? 115.585 98.399  176.145 1.00 124.18 ? 26  ALA B O   1 
ATOM 1672  C CB  . ALA B 1 26  ? 116.992 100.368 178.217 1.00 30.00  ? 26  ALA B CB  1 
ATOM 1673  N N   . ALA B 1 27  ? 114.904 97.895  178.233 1.00 120.74 ? 27  ALA B N   1 
ATOM 1674  C CA  . ALA B 1 27  ? 114.692 96.484  177.933 1.00 112.14 ? 27  ALA B CA  1 
ATOM 1675  C C   . ALA B 1 27  ? 113.522 96.243  176.995 1.00 126.27 ? 27  ALA B C   1 
ATOM 1676  O O   . ALA B 1 27  ? 113.404 95.138  176.462 1.00 129.46 ? 27  ALA B O   1 
ATOM 1677  C CB  . ALA B 1 27  ? 114.473 95.682  179.217 1.00 30.00  ? 27  ALA B CB  1 
ATOM 1678  N N   . VAL B 1 28  ? 112.657 97.232  176.794 1.00 128.89 ? 28  VAL B N   1 
ATOM 1679  C CA  . VAL B 1 28  ? 111.585 97.146  175.815 1.00 113.05 ? 28  VAL B CA  1 
ATOM 1680  C C   . VAL B 1 28  ? 111.881 97.993  174.585 1.00 121.90 ? 28  VAL B C   1 
ATOM 1681  O O   . VAL B 1 28  ? 111.766 97.512  173.457 1.00 122.20 ? 28  VAL B O   1 
ATOM 1682  C CB  . VAL B 1 28  ? 110.246 97.555  176.463 1.00 30.00  ? 28  VAL B CB  1 
ATOM 1683  C CG1 . VAL B 1 28  ? 109.144 97.603  175.432 1.00 30.00  ? 28  VAL B CG1 1 
ATOM 1684  C CG2 . VAL B 1 28  ? 109.885 96.586  177.569 1.00 30.00  ? 28  VAL B CG2 1 
ATOM 1685  N N   . LEU B 1 29  ? 112.302 99.242  174.793 1.00 114.96 ? 29  LEU B N   1 
ATOM 1686  C CA  . LEU B 1 29  ? 112.422 100.193 173.693 1.00 129.81 ? 29  LEU B CA  1 
ATOM 1687  C C   . LEU B 1 29  ? 113.601 99.859  172.785 1.00 140.90 ? 29  LEU B C   1 
ATOM 1688  O O   . LEU B 1 29  ? 113.577 100.185 171.594 1.00 135.21 ? 29  LEU B O   1 
ATOM 1689  C CB  . LEU B 1 29  ? 112.523 101.615 174.255 1.00 30.00  ? 29  LEU B CB  1 
ATOM 1690  C CG  . LEU B 1 29  ? 112.367 102.867 173.387 1.00 30.00  ? 29  LEU B CG  1 
ATOM 1691  C CD1 . LEU B 1 29  ? 111.739 103.957 174.221 1.00 30.00  ? 29  LEU B CD1 1 
ATOM 1692  C CD2 . LEU B 1 29  ? 113.685 103.363 172.880 1.00 30.00  ? 29  LEU B CD2 1 
ATOM 1693  N N   . ILE B 1 30  ? 114.633 99.200  173.313 1.00 133.11 ? 30  ILE B N   1 
ATOM 1694  C CA  . ILE B 1 30  ? 115.630 98.615  172.423 1.00 124.38 ? 30  ILE B CA  1 
ATOM 1695  C C   . ILE B 1 30  ? 115.071 97.353  171.786 1.00 127.80 ? 30  ILE B C   1 
ATOM 1696  O O   . ILE B 1 30  ? 115.227 97.126  170.581 1.00 124.15 ? 30  ILE B O   1 
ATOM 1697  C CB  . ILE B 1 30  ? 116.946 98.332  173.173 1.00 30.00  ? 30  ILE B CB  1 
ATOM 1698  C CG1 . ILE B 1 30  ? 117.529 99.614  173.755 1.00 30.00  ? 30  ILE B CG1 1 
ATOM 1699  C CG2 . ILE B 1 30  ? 117.976 97.700  172.249 1.00 30.00  ? 30  ILE B CG2 1 
ATOM 1700  C CD1 . ILE B 1 30  ? 118.710 99.373  174.673 1.00 30.00  ? 30  ILE B CD1 1 
ATOM 1701  N N   . GLN B 1 31  ? 114.386 96.526  172.579 1.00 132.79 ? 31  GLN B N   1 
ATOM 1702  C CA  . GLN B 1 31  ? 113.926 95.228  172.097 1.00 126.31 ? 31  GLN B CA  1 
ATOM 1703  C C   . GLN B 1 31  ? 112.771 95.368  171.109 1.00 126.39 ? 31  GLN B C   1 
ATOM 1704  O O   . GLN B 1 31  ? 112.643 94.558  170.184 1.00 134.06 ? 31  GLN B O   1 
ATOM 1705  C CB  . GLN B 1 31  ? 113.535 94.348  173.286 1.00 30.00  ? 31  GLN B CB  1 
ATOM 1706  C CG  . GLN B 1 31  ? 113.157 92.921  172.935 1.00 30.00  ? 31  GLN B CG  1 
ATOM 1707  C CD  . GLN B 1 31  ? 112.818 92.088  174.152 1.00 30.00  ? 31  GLN B CD  1 
ATOM 1708  O OE1 . GLN B 1 31  ? 112.870 92.569  175.280 1.00 30.00  ? 31  GLN B OE1 1 
ATOM 1709  N NE2 . GLN B 1 31  ? 112.454 90.832  173.927 1.00 30.00  ? 31  GLN B NE2 1 
ATOM 1710  N N   . THR B 1 32  ? 111.934 96.396  171.262 1.00 112.61 ? 32  THR B N   1 
ATOM 1711  C CA  . THR B 1 32  ? 110.944 96.658  170.224 1.00 127.34 ? 32  THR B CA  1 
ATOM 1712  C C   . THR B 1 32  ? 111.578 97.276  168.990 1.00 131.45 ? 32  THR B C   1 
ATOM 1713  O O   . THR B 1 32  ? 111.106 97.041  167.873 1.00 120.85 ? 32  THR B O   1 
ATOM 1714  C CB  . THR B 1 32  ? 109.826 97.554  170.749 1.00 30.00  ? 32  THR B CB  1 
ATOM 1715  O OG1 . THR B 1 32  ? 110.390 98.737  171.328 1.00 30.00  ? 32  THR B OG1 1 
ATOM 1716  C CG2 . THR B 1 32  ? 108.990 96.813  171.771 1.00 30.00  ? 32  THR B CG2 1 
ATOM 1717  N N   . SER B 1 33  ? 112.687 97.977  169.169 1.00 130.67 ? 33  SER B N   1 
ATOM 1718  C CA  . SER B 1 33  ? 113.407 98.541  168.039 1.00 132.42 ? 33  SER B CA  1 
ATOM 1719  C C   . SER B 1 33  ? 113.918 97.399  167.165 1.00 131.30 ? 33  SER B C   1 
ATOM 1720  O O   . SER B 1 33  ? 113.898 97.477  165.935 1.00 133.84 ? 33  SER B O   1 
ATOM 1721  C CB  . SER B 1 33  ? 114.582 99.374  168.526 1.00 30.00  ? 33  SER B CB  1 
ATOM 1722  O OG  . SER B 1 33  ? 114.216 100.149 169.650 1.00 30.00  ? 33  SER B OG  1 
ATOM 1723  N N   . GLY B 1 34  ? 114.344 96.324  167.825 1.00 129.56 ? 34  GLY B N   1 
ATOM 1724  C CA  . GLY B 1 34  ? 114.913 95.159  167.167 1.00 121.87 ? 34  GLY B CA  1 
ATOM 1725  C C   . GLY B 1 34  ? 113.983 94.478  166.187 1.00 127.99 ? 34  GLY B C   1 
ATOM 1726  O O   . GLY B 1 34  ? 114.413 94.025  165.119 1.00 136.74 ? 34  GLY B O   1 
ATOM 1727  N N   . TYR B 1 35  ? 112.702 94.400  166.532 1.00 111.57 ? 35  TYR B N   1 
ATOM 1728  C CA  . TYR B 1 35  ? 111.728 93.795  165.633 1.00 115.71 ? 35  TYR B CA  1 
ATOM 1729  C C   . TYR B 1 35  ? 111.664 94.618  164.347 1.00 122.18 ? 35  TYR B C   1 
ATOM 1730  O O   . TYR B 1 35  ? 111.690 94.073  163.238 1.00 127.53 ? 35  TYR B O   1 
ATOM 1731  C CB  . TYR B 1 35  ? 110.354 93.746  166.297 1.00 30.00  ? 35  TYR B CB  1 
ATOM 1732  C CG  . TYR B 1 35  ? 109.254 93.259  165.387 1.00 30.00  ? 35  TYR B CG  1 
ATOM 1733  C CD1 . TYR B 1 35  ? 108.781 94.054  164.356 1.00 30.00  ? 35  TYR B CD1 1 
ATOM 1734  C CD2 . TYR B 1 35  ? 108.691 92.004  165.557 1.00 30.00  ? 35  TYR B CD2 1 
ATOM 1735  C CE1 . TYR B 1 35  ? 107.775 93.615  163.518 1.00 30.00  ? 35  TYR B CE1 1 
ATOM 1736  C CE2 . TYR B 1 35  ? 107.684 91.556  164.724 1.00 30.00  ? 35  TYR B CE2 1 
ATOM 1737  C CZ  . TYR B 1 35  ? 107.231 92.366  163.706 1.00 30.00  ? 35  TYR B CZ  1 
ATOM 1738  O OH  . TYR B 1 35  ? 106.229 91.926  162.873 1.00 30.00  ? 35  TYR B OH  1 
ATOM 1739  N N   . LEU B 1 36  ? 111.652 95.942  164.491 1.00 116.21 ? 36  LEU B N   1 
ATOM 1740  C CA  . LEU B 1 36  ? 111.628 96.827  163.341 1.00 130.01 ? 36  LEU B CA  1 
ATOM 1741  C C   . LEU B 1 36  ? 112.890 96.627  162.515 1.00 123.78 ? 36  LEU B C   1 
ATOM 1742  O O   . LEU B 1 36  ? 112.818 96.551  161.292 1.00 118.51 ? 36  LEU B O   1 
ATOM 1743  C CB  . LEU B 1 36  ? 111.496 98.279  163.784 1.00 30.00  ? 36  LEU B CB  1 
ATOM 1744  C CG  . LEU B 1 36  ? 110.394 98.465  164.825 1.00 30.00  ? 36  LEU B CG  1 
ATOM 1745  C CD1 . LEU B 1 36  ? 109.771 99.846  164.713 1.00 30.00  ? 36  LEU B CD1 1 
ATOM 1746  C CD2 . LEU B 1 36  ? 109.330 97.398  164.636 1.00 30.00  ? 36  LEU B CD2 1 
ATOM 1747  N N   . GLN B 1 37  ? 114.038 96.482  163.174 1.00 123.38 ? 37  GLN B N   1 
ATOM 1748  C CA  . GLN B 1 37  ? 115.270 96.275  162.432 1.00 117.62 ? 37  GLN B CA  1 
ATOM 1749  C C   . GLN B 1 37  ? 115.178 95.009  161.600 1.00 110.58 ? 37  GLN B C   1 
ATOM 1750  O O   . GLN B 1 37  ? 115.436 95.048  160.388 1.00 111.88 ? 37  GLN B O   1 
ATOM 1751  C CB  . GLN B 1 37  ? 116.458 96.110  163.386 1.00 30.00  ? 37  GLN B CB  1 
ATOM 1752  C CG  . GLN B 1 37  ? 117.364 97.323  163.513 1.00 30.00  ? 37  GLN B CG  1 
ATOM 1753  C CD  . GLN B 1 37  ? 117.319 97.947  164.891 1.00 30.00  ? 37  GLN B CD  1 
ATOM 1754  O OE1 . GLN B 1 37  ? 116.930 97.302  165.862 1.00 30.00  ? 37  GLN B OE1 1 
ATOM 1755  N NE2 . GLN B 1 37  ? 117.733 99.206  164.986 1.00 30.00  ? 37  GLN B NE2 1 
ATOM 1756  N N   . GLN B 1 38  ? 114.707 93.917  162.196 1.00 110.77 ? 38  GLN B N   1 
ATOM 1757  C CA  . GLN B 1 38  ? 114.645 92.687  161.415 1.00 125.53 ? 38  GLN B CA  1 
ATOM 1758  C C   . GLN B 1 38  ? 113.684 92.820  160.235 1.00 131.29 ? 38  GLN B C   1 
ATOM 1759  O O   . GLN B 1 38  ? 114.017 92.442  159.091 1.00 143.08 ? 38  GLN B O   1 
ATOM 1760  C CB  . GLN B 1 38  ? 114.398 91.438  162.287 1.00 30.00  ? 38  GLN B CB  1 
ATOM 1761  C CG  . GLN B 1 38  ? 112.978 91.171  162.758 1.00 30.00  ? 38  GLN B CG  1 
ATOM 1762  C CD  . GLN B 1 38  ? 112.915 90.130  163.866 1.00 30.00  ? 38  GLN B CD  1 
ATOM 1763  O OE1 . GLN B 1 38  ? 113.935 89.758  164.446 1.00 30.00  ? 38  GLN B OE1 1 
ATOM 1764  N NE2 . GLN B 1 38  ? 111.711 89.659  164.168 1.00 30.00  ? 38  GLN B NE2 1 
ATOM 1765  N N   . LYS B 1 39  ? 112.531 93.437  160.479 1.00 115.39 ? 39  LYS B N   1 
ATOM 1766  C CA  . LYS B 1 39  ? 111.571 93.564  159.394 1.00 122.69 ? 39  LYS B CA  1 
ATOM 1767  C C   . LYS B 1 39  ? 112.126 94.416  158.259 1.00 122.92 ? 39  LYS B C   1 
ATOM 1768  O O   . LYS B 1 39  ? 111.993 94.074  157.083 1.00 119.94 ? 39  LYS B O   1 
ATOM 1769  C CB  . LYS B 1 39  ? 110.233 94.110  159.881 1.00 30.00  ? 39  LYS B CB  1 
ATOM 1770  C CG  . LYS B 1 39  ? 109.172 94.046  158.803 1.00 30.00  ? 39  LYS B CG  1 
ATOM 1771  C CD  . LYS B 1 39  ? 109.277 92.727  158.059 1.00 30.00  ? 39  LYS B CD  1 
ATOM 1772  C CE  . LYS B 1 39  ? 108.976 92.908  156.583 1.00 30.00  ? 39  LYS B CE  1 
ATOM 1773  N NZ  . LYS B 1 39  ? 109.987 93.782  155.926 1.00 30.00  ? 39  LYS B NZ  1 
ATOM 1774  N N   . SER B 1 40  ? 112.798 95.503  158.614 1.00 115.71 ? 40  SER B N   1 
ATOM 1775  C CA  . SER B 1 40  ? 113.356 96.388  157.609 1.00 125.17 ? 40  SER B CA  1 
ATOM 1776  C C   . SER B 1 40  ? 114.408 95.671  156.796 1.00 124.47 ? 40  SER B C   1 
ATOM 1777  O O   . SER B 1 40  ? 114.459 95.809  155.577 1.00 117.25 ? 40  SER B O   1 
ATOM 1778  C CB  . SER B 1 40  ? 113.940 97.642  158.251 1.00 30.00  ? 40  SER B CB  1 
ATOM 1779  O OG  . SER B 1 40  ? 114.580 97.341  159.472 1.00 30.00  ? 40  SER B OG  1 
ATOM 1780  N N   . GLN B 1 41  ? 115.234 94.882  157.469 1.00 124.77 ? 41  GLN B N   1 
ATOM 1781  C CA  . GLN B 1 41  ? 116.274 94.162  156.767 1.00 118.76 ? 41  GLN B CA  1 
ATOM 1782  C C   . GLN B 1 41  ? 115.663 93.205  155.752 1.00 112.40 ? 41  GLN B C   1 
ATOM 1783  O O   . GLN B 1 41  ? 116.135 93.132  154.617 1.00 107.21 ? 41  GLN B O   1 
ATOM 1784  C CB  . GLN B 1 41  ? 117.166 93.416  157.762 1.00 30.00  ? 41  GLN B CB  1 
ATOM 1785  C CG  . GLN B 1 41  ? 118.026 94.341  158.612 1.00 30.00  ? 41  GLN B CG  1 
ATOM 1786  C CD  . GLN B 1 41  ? 118.925 93.598  159.581 1.00 30.00  ? 41  GLN B CD  1 
ATOM 1787  O OE1 . GLN B 1 41  ? 118.858 92.376  159.697 1.00 30.00  ? 41  GLN B OE1 1 
ATOM 1788  N NE2 . GLN B 1 41  ? 119.776 94.339  160.281 1.00 30.00  ? 41  GLN B NE2 1 
ATOM 1789  N N   . ALA B 1 42  ? 114.614 92.478  156.138 1.00 117.08 ? 42  ALA B N   1 
ATOM 1790  C CA  . ALA B 1 42  ? 113.966 91.564  155.177 1.00 121.87 ? 42  ALA B CA  1 
ATOM 1791  C C   . ALA B 1 42  ? 113.272 92.299  154.015 1.00 124.60 ? 42  ALA B C   1 
ATOM 1792  O O   . ALA B 1 42  ? 113.270 91.856  152.865 1.00 129.32 ? 42  ALA B O   1 
ATOM 1793  C CB  . ALA B 1 42  ? 112.988 90.635  155.881 1.00 30.00  ? 42  ALA B CB  1 
ATOM 1794  N N   . THR B 1 43  ? 112.666 93.420  154.384 1.00 122.18 ? 43  THR B N   1 
ATOM 1795  C CA  . THR B 1 43  ? 111.871 94.326  153.563 1.00 129.90 ? 43  THR B CA  1 
ATOM 1796  C C   . THR B 1 43  ? 112.667 95.509  153.035 1.00 121.89 ? 43  THR B C   1 
ATOM 1797  O O   . THR B 1 43  ? 112.169 96.221  152.158 1.00 106.94 ? 43  THR B O   1 
ATOM 1798  C CB  . THR B 1 43  ? 110.671 94.830  154.353 1.00 30.00  ? 43  THR B CB  1 
ATOM 1799  O OG1 . THR B 1 43  ? 111.129 95.482  155.542 1.00 30.00  ? 43  THR B OG1 1 
ATOM 1800  C CG2 . THR B 1 43  ? 109.766 93.676  154.724 1.00 30.00  ? 43  THR B CG2 1 
ATOM 1801  N N   . GLY B 1 44  ? 113.866 95.752  153.551 1.00 116.35 ? 44  GLY B N   1 
ATOM 1802  C CA  . GLY B 1 44  ? 114.764 96.684  152.906 1.00 102.42 ? 44  GLY B CA  1 
ATOM 1803  C C   . GLY B 1 44  ? 115.375 96.079  151.660 1.00 107.16 ? 44  GLY B C   1 
ATOM 1804  O O   . GLY B 1 44  ? 115.410 96.713  150.601 1.00 105.71 ? 44  GLY B O   1 
ATOM 1805  N N   . ARG B 1 45  ? 115.850 94.838  151.772 1.00 121.34 ? 45  ARG B N   1 
ATOM 1806  C CA  . ARG B 1 45  ? 116.570 94.226  150.663 1.00 118.64 ? 45  ARG B CA  1 
ATOM 1807  C C   . ARG B 1 45  ? 115.621 93.699  149.596 1.00 114.49 ? 45  ARG B C   1 
ATOM 1808  O O   . ARG B 1 45  ? 115.795 93.995  148.408 1.00 119.78 ? 45  ARG B O   1 
ATOM 1809  C CB  . ARG B 1 45  ? 117.453 93.093  151.170 1.00 30.00  ? 45  ARG B CB  1 
ATOM 1810  C CG  . ARG B 1 45  ? 118.580 93.507  152.081 1.00 30.00  ? 45  ARG B CG  1 
ATOM 1811  C CD  . ARG B 1 45  ? 119.432 92.303  152.426 1.00 30.00  ? 45  ARG B CD  1 
ATOM 1812  N NE  . ARG B 1 45  ? 118.696 91.323  153.219 1.00 30.00  ? 45  ARG B NE  1 
ATOM 1813  C CZ  . ARG B 1 45  ? 118.309 90.133  152.769 1.00 30.00  ? 45  ARG B CZ  1 
ATOM 1814  N NH1 . ARG B 1 45  ? 118.580 89.775  151.522 1.00 30.00  ? 45  ARG B NH1 1 
ATOM 1815  N NH2 . ARG B 1 45  ? 117.642 89.307  153.561 1.00 30.00  ? 45  ARG B NH2 1 
ATOM 1816  N N   . GLU B 1 46  ? 114.624 92.899  150.005 1.00 110.36 ? 46  GLU B N   1 
ATOM 1817  C CA  . GLU B 1 46  ? 113.795 92.136  149.072 1.00 120.39 ? 46  GLU B CA  1 
ATOM 1818  C C   . GLU B 1 46  ? 112.980 93.033  148.155 1.00 123.08 ? 46  GLU B C   1 
ATOM 1819  O O   . GLU B 1 46  ? 112.758 92.688  146.990 1.00 126.45 ? 46  GLU B O   1 
ATOM 1820  C CB  . GLU B 1 46  ? 112.853 91.214  149.840 1.00 30.00  ? 46  GLU B CB  1 
ATOM 1821  C CG  . GLU B 1 46  ? 113.534 90.100  150.591 1.00 30.00  ? 46  GLU B CG  1 
ATOM 1822  C CD  . GLU B 1 46  ? 112.559 89.316  151.437 1.00 30.00  ? 46  GLU B CD  1 
ATOM 1823  O OE1 . GLU B 1 46  ? 111.390 89.739  151.531 1.00 30.00  ? 46  GLU B OE1 1 
ATOM 1824  O OE2 . GLU B 1 46  ? 112.953 88.279  152.010 1.00 30.00  ? 46  GLU B OE2 1 
ATOM 1825  N N   . THR B 1 47  ? 112.556 94.191  148.652 1.00 109.60 ? 47  THR B N   1 
ATOM 1826  C CA  . THR B 1 47  ? 111.814 95.156  147.857 1.00 114.97 ? 47  THR B CA  1 
ATOM 1827  C C   . THR B 1 47  ? 112.650 95.808  146.771 1.00 122.24 ? 47  THR B C   1 
ATOM 1828  O O   . THR B 1 47  ? 112.086 96.414  145.855 1.00 126.78 ? 47  THR B O   1 
ATOM 1829  C CB  . THR B 1 47  ? 111.248 96.219  148.778 1.00 30.00  ? 47  THR B CB  1 
ATOM 1830  O OG1 . THR B 1 47  ? 112.309 96.693  149.611 1.00 30.00  ? 47  THR B OG1 1 
ATOM 1831  C CG2 . THR B 1 47  ? 110.137 95.636  149.633 1.00 30.00  ? 47  THR B CG2 1 
ATOM 1832  N N   . THR B 1 48  ? 113.973 95.721  146.858 1.00 106.63 ? 48  THR B N   1 
ATOM 1833  C CA  . THR B 1 48  ? 114.806 96.100  145.727 1.00 106.27 ? 48  THR B CA  1 
ATOM 1834  C C   . THR B 1 48  ? 114.934 94.943  144.748 1.00 112.60 ? 48  THR B C   1 
ATOM 1835  O O   . THR B 1 48  ? 114.950 95.150  143.531 1.00 117.23 ? 48  THR B O   1 
ATOM 1836  C CB  . THR B 1 48  ? 116.179 96.533  146.217 1.00 30.00  ? 48  THR B CB  1 
ATOM 1837  O OG1 . THR B 1 48  ? 116.863 95.398  146.757 1.00 30.00  ? 48  THR B OG1 1 
ATOM 1838  C CG2 . THR B 1 48  ? 116.008 97.547  147.320 1.00 30.00  ? 48  THR B CG2 1 
ATOM 1839  N N   . GLN B 1 49  ? 115.026 93.721  145.278 1.00 120.76 ? 49  GLN B N   1 
ATOM 1840  C CA  . GLN B 1 49  ? 114.998 92.518  144.456 1.00 129.15 ? 49  GLN B CA  1 
ATOM 1841  C C   . GLN B 1 49  ? 113.648 92.336  143.778 1.00 124.57 ? 49  GLN B C   1 
ATOM 1842  O O   . GLN B 1 49  ? 113.577 91.774  142.680 1.00 134.69 ? 49  GLN B O   1 
ATOM 1843  C CB  . GLN B 1 49  ? 115.306 91.306  145.327 1.00 30.00  ? 49  GLN B CB  1 
ATOM 1844  C CG  . GLN B 1 49  ? 116.684 91.311  145.940 1.00 30.00  ? 49  GLN B CG  1 
ATOM 1845  C CD  . GLN B 1 49  ? 116.870 90.174  146.916 1.00 30.00  ? 49  GLN B CD  1 
ATOM 1846  O OE1 . GLN B 1 49  ? 115.926 89.449  147.227 1.00 30.00  ? 49  GLN B OE1 1 
ATOM 1847  N NE2 . GLN B 1 49  ? 118.095 90.000  147.397 1.00 30.00  ? 49  GLN B NE2 1 
ATOM 1848  N N   . GLU B 1 50  ? 112.574 92.787  144.433 1.00 118.17 ? 50  GLU B N   1 
ATOM 1849  C CA  . GLU B 1 50  ? 111.218 92.715  143.900 1.00 122.89 ? 50  GLU B CA  1 
ATOM 1850  C C   . GLU B 1 50  ? 111.051 93.522  142.618 1.00 108.02 ? 50  GLU B C   1 
ATOM 1851  O O   . GLU B 1 50  ? 110.220 93.168  141.775 1.00 108.64 ? 50  GLU B O   1 
ATOM 1852  C CB  . GLU B 1 50  ? 110.241 93.220  144.968 1.00 30.00  ? 50  GLU B CB  1 
ATOM 1853  C CG  . GLU B 1 50  ? 108.763 93.109  144.646 1.00 30.00  ? 50  GLU B CG  1 
ATOM 1854  C CD  . GLU B 1 50  ? 108.278 91.683  144.653 1.00 30.00  ? 50  GLU B CD  1 
ATOM 1855  O OE1 . GLU B 1 50  ? 108.877 90.861  145.377 1.00 30.00  ? 50  GLU B OE1 1 
ATOM 1856  O OE2 . GLU B 1 50  ? 107.297 91.384  143.937 1.00 30.00  ? 50  GLU B OE2 1 
ATOM 1857  N N   . VAL B 1 51  ? 111.831 94.582  142.440 1.00 112.66 ? 51  VAL B N   1 
ATOM 1858  C CA  . VAL B 1 51  ? 111.645 95.482  141.314 1.00 114.59 ? 51  VAL B CA  1 
ATOM 1859  C C   . VAL B 1 51  ? 112.783 95.419  140.307 1.00 112.54 ? 51  VAL B C   1 
ATOM 1860  O O   . VAL B 1 51  ? 112.558 95.740  139.130 1.00 128.80 ? 51  VAL B O   1 
ATOM 1861  C CB  . VAL B 1 51  ? 111.438 96.929  141.801 1.00 30.00  ? 51  VAL B CB  1 
ATOM 1862  C CG1 . VAL B 1 51  ? 110.208 96.991  142.683 1.00 30.00  ? 51  VAL B CG1 1 
ATOM 1863  C CG2 . VAL B 1 51  ? 112.650 97.425  142.564 1.00 30.00  ? 51  VAL B CG2 1 
ATOM 1864  N N   . ALA B 1 52  ? 113.981 94.995  140.711 1.00 30.00  ? 52  ALA B N   1 
ATOM 1865  C CA  . ALA B 1 52  ? 115.114 95.014  139.795 1.00 30.00  ? 52  ALA B CA  1 
ATOM 1866  C C   . ALA B 1 52  ? 115.114 93.788  138.899 1.00 30.00  ? 52  ALA B C   1 
ATOM 1867  O O   . ALA B 1 52  ? 115.387 93.885  137.698 1.00 30.00  ? 52  ALA B O   1 
ATOM 1868  C CB  . ALA B 1 52  ? 116.421 95.104  140.577 1.00 30.00  ? 52  ALA B CB  1 
ATOM 1869  N N   . SER B 1 53  ? 114.829 92.625  139.470 1.00 113.33 ? 53  SER B N   1 
ATOM 1870  C CA  . SER B 1 53  ? 114.761 91.406  138.684 1.00 119.89 ? 53  SER B CA  1 
ATOM 1871  C C   . SER B 1 53  ? 113.524 91.417  137.797 1.00 124.17 ? 53  SER B C   1 
ATOM 1872  O O   . SER B 1 53  ? 112.470 91.940  138.164 1.00 123.77 ? 53  SER B O   1 
ATOM 1873  C CB  . SER B 1 53  ? 114.753 90.184  139.601 1.00 135.93 ? 53  SER B CB  1 
ATOM 1874  O OG  . SER B 1 53  ? 113.613 90.171  140.438 1.00 150.89 ? 53  SER B OG  1 
ATOM 1875  N N   . GLY B 1 54  ? 113.669 90.851  136.609 1.00 126.56 ? 54  GLY B N   1 
ATOM 1876  C CA  . GLY B 1 54  ? 112.578 90.845  135.663 1.00 107.25 ? 54  GLY B CA  1 
ATOM 1877  C C   . GLY B 1 54  ? 112.907 90.030  134.437 1.00 106.60 ? 54  GLY B C   1 
ATOM 1878  O O   . GLY B 1 54  ? 114.060 89.986  134.004 1.00 103.76 ? 54  GLY B O   1 
ATOM 1879  N N   . ILE B 1 55  ? 111.894 89.396  133.861 1.00 100.38 ? 55  ILE B N   1 
ATOM 1880  C CA  . ILE B 1 55  ? 112.056 88.414  132.800 1.00 80.06  ? 55  ILE B CA  1 
ATOM 1881  C C   . ILE B 1 55  ? 111.404 88.949  131.538 1.00 98.77  ? 55  ILE B C   1 
ATOM 1882  O O   . ILE B 1 55  ? 110.196 89.194  131.521 1.00 111.05 ? 55  ILE B O   1 
ATOM 1883  C CB  . ILE B 1 55  ? 111.444 87.070  133.219 1.00 30.00  ? 55  ILE B CB  1 
ATOM 1884  C CG1 . ILE B 1 55  ? 112.285 86.436  134.322 1.00 30.00  ? 55  ILE B CG1 1 
ATOM 1885  C CG2 . ILE B 1 55  ? 111.298 86.166  132.051 1.00 30.00  ? 55  ILE B CG2 1 
ATOM 1886  C CD1 . ILE B 1 55  ? 111.688 85.183  134.896 1.00 30.00  ? 55  ILE B CD1 1 
ATOM 1887  N N   . LYS B 1 56  ? 112.195 89.137  130.485 1.00 98.92  ? 56  LYS B N   1 
ATOM 1888  C CA  . LYS B 1 56  ? 111.704 89.756  129.262 1.00 91.81  ? 56  LYS B CA  1 
ATOM 1889  C C   . LYS B 1 56  ? 111.579 88.731  128.142 1.00 85.75  ? 56  LYS B C   1 
ATOM 1890  O O   . LYS B 1 56  ? 112.406 87.823  128.013 1.00 101.89 ? 56  LYS B O   1 
ATOM 1891  C CB  . LYS B 1 56  ? 112.595 90.935  128.838 1.00 30.00  ? 56  LYS B CB  1 
ATOM 1892  C CG  . LYS B 1 56  ? 114.029 90.616  128.463 1.00 30.00  ? 56  LYS B CG  1 
ATOM 1893  C CD  . LYS B 1 56  ? 114.767 91.914  128.172 1.00 30.00  ? 56  LYS B CD  1 
ATOM 1894  C CE  . LYS B 1 56  ? 116.224 91.692  127.838 1.00 30.00  ? 56  LYS B CE  1 
ATOM 1895  N NZ  . LYS B 1 56  ? 116.386 90.999  126.543 1.00 30.00  ? 56  LYS B NZ  1 
ATOM 1896  N N   . VAL B 1 57  ? 110.525 88.891  127.345 1.00 72.52  ? 57  VAL B N   1 
ATOM 1897  C CA  . VAL B 1 57  ? 110.125 87.950  126.305 1.00 81.55  ? 57  VAL B CA  1 
ATOM 1898  C C   . VAL B 1 57  ? 110.619 88.477  124.968 1.00 102.46 ? 57  VAL B C   1 
ATOM 1899  O O   . VAL B 1 57  ? 110.414 89.652  124.644 1.00 103.19 ? 57  VAL B O   1 
ATOM 1900  C CB  . VAL B 1 57  ? 108.600 87.765  126.293 1.00 30.00  ? 57  VAL B CB  1 
ATOM 1901  C CG1 . VAL B 1 57  ? 108.156 86.944  125.108 1.00 30.00  ? 57  VAL B CG1 1 
ATOM 1902  C CG2 . VAL B 1 57  ? 108.147 87.120  127.580 1.00 30.00  ? 57  VAL B CG2 1 
ATOM 1903  N N   . LEU B 1 58  ? 111.259 87.614  124.186 1.00 92.19  ? 58  LEU B N   1 
ATOM 1904  C CA  . LEU B 1 58  ? 111.726 87.982  122.860 1.00 86.93  ? 58  LEU B CA  1 
ATOM 1905  C C   . LEU B 1 58  ? 111.670 86.780  121.931 1.00 105.85 ? 58  LEU B C   1 
ATOM 1906  O O   . LEU B 1 58  ? 112.034 85.671  122.331 1.00 120.09 ? 58  LEU B O   1 
ATOM 1907  C CB  . LEU B 1 58  ? 113.142 88.566  122.949 1.00 30.00  ? 58  LEU B CB  1 
ATOM 1908  C CG  . LEU B 1 58  ? 114.283 87.773  123.601 1.00 30.00  ? 58  LEU B CG  1 
ATOM 1909  C CD1 . LEU B 1 58  ? 115.073 86.915  122.624 1.00 30.00  ? 58  LEU B CD1 1 
ATOM 1910  C CD2 . LEU B 1 58  ? 115.212 88.704  124.343 1.00 30.00  ? 58  LEU B CD2 1 
ATOM 1911  N N   . SER B 1 59  ? 111.183 87.008  120.707 1.00 102.02 ? 59  SER B N   1 
ATOM 1912  C CA  . SER B 1 59  ? 111.338 86.116  119.553 1.00 101.26 ? 59  SER B CA  1 
ATOM 1913  C C   . SER B 1 59  ? 110.725 84.734  119.801 1.00 100.91 ? 59  SER B C   1 
ATOM 1914  O O   . SER B 1 59  ? 111.410 83.724  119.941 1.00 93.78  ? 59  SER B O   1 
ATOM 1915  C CB  . SER B 1 59  ? 112.811 86.015  119.154 1.00 30.00  ? 59  SER B CB  1 
ATOM 1916  O OG  . SER B 1 59  ? 113.277 87.287  118.752 1.00 30.00  ? 59  SER B OG  1 
ATOM 1917  N N   . VAL B 1 60  ? 109.412 84.730  119.884 1.00 114.53 ? 60  VAL B N   1 
ATOM 1918  C CA  . VAL B 1 60  ? 108.666 83.490  120.032 1.00 106.73 ? 60  VAL B CA  1 
ATOM 1919  C C   . VAL B 1 60  ? 108.476 82.854  118.658 1.00 97.61  ? 60  VAL B C   1 
ATOM 1920  O O   . VAL B 1 60  ? 108.288 83.552  117.659 1.00 91.29  ? 60  VAL B O   1 
ATOM 1921  C CB  . VAL B 1 60  ? 107.326 83.782  120.718 1.00 30.00  ? 60  VAL B CB  1 
ATOM 1922  C CG1 . VAL B 1 60  ? 106.625 82.502  121.079 1.00 30.00  ? 60  VAL B CG1 1 
ATOM 1923  C CG2 . VAL B 1 60  ? 107.544 84.660  121.932 1.00 30.00  ? 60  VAL B CG2 1 
ATOM 1924  N N   . VAL B 1 61  ? 108.535 81.525  118.593 1.00 91.21  ? 61  VAL B N   1 
ATOM 1925  C CA  . VAL B 1 61  ? 108.497 80.798  117.333 1.00 75.96  ? 61  VAL B CA  1 
ATOM 1926  C C   . VAL B 1 61  ? 107.287 79.865  117.311 1.00 85.19  ? 61  VAL B C   1 
ATOM 1927  O O   . VAL B 1 61  ? 106.780 79.441  118.351 1.00 107.80 ? 61  VAL B O   1 
ATOM 1928  C CB  . VAL B 1 61  ? 109.805 80.026  117.111 1.00 30.00  ? 61  VAL B CB  1 
ATOM 1929  C CG1 . VAL B 1 61  ? 110.954 80.994  117.036 1.00 30.00  ? 61  VAL B CG1 1 
ATOM 1930  C CG2 . VAL B 1 61  ? 110.053 79.105  118.260 1.00 30.00  ? 61  VAL B CG2 1 
ATOM 1931  N N   . GLY B 1 62  ? 106.806 79.570  116.100 1.00 70.41  ? 62  GLY B N   1 
ATOM 1932  C CA  . GLY B 1 62  ? 105.508 78.929  115.941 1.00 74.08  ? 62  GLY B CA  1 
ATOM 1933  C C   . GLY B 1 62  ? 105.369 77.424  115.769 1.00 71.97  ? 62  GLY B C   1 
ATOM 1934  O O   . GLY B 1 62  ? 104.688 76.795  116.581 1.00 101.24 ? 62  GLY B O   1 
ATOM 1935  N N   . LYS B 1 63  ? 105.996 76.842  114.735 1.00 30.00  ? 63  LYS B N   1 
ATOM 1936  C CA  . LYS B 1 63  ? 105.875 75.429  114.348 1.00 30.00  ? 63  LYS B CA  1 
ATOM 1937  C C   . LYS B 1 63  ? 104.432 75.003  114.085 1.00 30.00  ? 63  LYS B C   1 
ATOM 1938  O O   . LYS B 1 63  ? 103.784 74.410  114.952 1.00 30.00  ? 63  LYS B O   1 
ATOM 1939  C CB  . LYS B 1 63  ? 106.530 74.484  115.366 1.00 30.00  ? 63  LYS B CB  1 
ATOM 1940  C CG  . LYS B 1 63  ? 106.610 73.017  114.905 1.00 30.00  ? 63  LYS B CG  1 
ATOM 1941  C CD  . LYS B 1 63  ? 107.428 72.874  113.647 1.00 30.00  ? 63  LYS B CD  1 
ATOM 1942  C CE  . LYS B 1 63  ? 107.419 71.446  113.164 1.00 30.00  ? 63  LYS B CE  1 
ATOM 1943  N NZ  . LYS B 1 63  ? 108.079 70.541  114.133 1.00 30.00  ? 63  LYS B NZ  1 
ATOM 1944  N N   . THR B 1 64  ? 103.869 75.402  112.953 1.00 74.75  ? 64  THR B N   1 
ATOM 1945  C CA  . THR B 1 64  ? 102.564 74.865  112.612 1.00 85.42  ? 64  THR B CA  1 
ATOM 1946  C C   . THR B 1 64  ? 102.661 73.426  112.125 1.00 94.58  ? 64  THR B C   1 
ATOM 1947  O O   . THR B 1 64  ? 103.741 72.854  111.966 1.00 107.53 ? 64  THR B O   1 
ATOM 1948  C CB  . THR B 1 64  ? 101.885 75.688  111.532 1.00 30.00  ? 64  THR B CB  1 
ATOM 1949  O OG1 . THR B 1 64  ? 100.577 75.158  111.297 1.00 30.00  ? 64  THR B OG1 1 
ATOM 1950  C CG2 . THR B 1 64  ? 102.660 75.601  110.268 1.00 30.00  ? 64  THR B CG2 1 
ATOM 1951  N N   . ASP B 1 65  ? 101.490 72.852  111.871 1.00 92.95  ? 65  ASP B N   1 
ATOM 1952  C CA  . ASP B 1 65  ? 101.363 71.522  111.298 1.00 78.92  ? 65  ASP B CA  1 
ATOM 1953  C C   . ASP B 1 65  ? 101.754 71.590  109.822 1.00 87.53  ? 65  ASP B C   1 
ATOM 1954  O O   . ASP B 1 65  ? 101.690 72.646  109.189 1.00 108.21 ? 65  ASP B O   1 
ATOM 1955  C CB  . ASP B 1 65  ? 99.936  71.016  111.505 1.00 30.00  ? 65  ASP B CB  1 
ATOM 1956  C CG  . ASP B 1 65  ? 99.769  69.546  111.175 1.00 30.00  ? 65  ASP B CG  1 
ATOM 1957  O OD1 . ASP B 1 65  ? 100.770 68.872  110.851 1.00 30.00  ? 65  ASP B OD1 1 
ATOM 1958  O OD2 . ASP B 1 65  ? 98.619  69.065  111.232 1.00 30.00  ? 65  ASP B OD2 1 
ATOM 1959  N N   . SER B 1 66  ? 102.153 70.455  109.245 1.00 82.88  ? 66  SER B N   1 
ATOM 1960  C CA  . SER B 1 66  ? 102.471 70.406  107.824 1.00 100.10 ? 66  SER B CA  1 
ATOM 1961  C C   . SER B 1 66  ? 101.236 70.508  106.942 1.00 99.91  ? 66  SER B C   1 
ATOM 1962  O O   . SER B 1 66  ? 101.367 70.756  105.740 1.00 105.10 ? 66  SER B O   1 
ATOM 1963  C CB  . SER B 1 66  ? 103.229 69.122  107.504 1.00 30.00  ? 66  SER B CB  1 
ATOM 1964  O OG  . SER B 1 66  ? 104.464 69.090  108.197 1.00 30.00  ? 66  SER B OG  1 
ATOM 1965  N N   . ASN B 1 67  ? 100.053 70.304  107.506 1.00 97.83  ? 67  ASN B N   1 
ATOM 1966  C CA  . ASN B 1 67  ? 98.788  70.711  106.909 1.00 107.23 ? 67  ASN B CA  1 
ATOM 1967  C C   . ASN B 1 67  ? 98.434  72.001  107.643 1.00 118.78 ? 67  ASN B C   1 
ATOM 1968  O O   . ASN B 1 67  ? 98.008  71.952  108.802 1.00 119.03 ? 67  ASN B O   1 
ATOM 1969  C CB  . ASN B 1 67  ? 97.727  69.630  107.079 1.00 30.00  ? 67  ASN B CB  1 
ATOM 1970  C CG  . ASN B 1 67  ? 96.512  69.862  106.215 1.00 30.00  ? 67  ASN B CG  1 
ATOM 1971  O OD1 . ASN B 1 67  ? 96.441  70.838  105.470 1.00 30.00  ? 67  ASN B OD1 1 
ATOM 1972  N ND2 . ASN B 1 67  ? 95.550  68.950  106.295 1.00 30.00  ? 67  ASN B ND2 1 
ATOM 1973  N N   . LYS B 1 68  ? 98.579  73.142  106.953 1.00 119.07 ? 68  LYS B N   1 
ATOM 1974  C CA  . LYS B 1 68  ? 98.835  74.478  107.508 1.00 123.65 ? 68  LYS B CA  1 
ATOM 1975  C C   . LYS B 1 68  ? 97.935  74.960  108.645 1.00 120.01 ? 68  LYS B C   1 
ATOM 1976  O O   . LYS B 1 68  ? 98.275  75.929  109.326 1.00 120.34 ? 68  LYS B O   1 
ATOM 1977  C CB  . LYS B 1 68  ? 98.756  75.515  106.390 1.00 30.00  ? 68  LYS B CB  1 
ATOM 1978  C CG  . LYS B 1 68  ? 99.721  75.303  105.240 1.00 30.00  ? 68  LYS B CG  1 
ATOM 1979  C CD  . LYS B 1 68  ? 101.163 75.446  105.672 1.00 30.00  ? 68  LYS B CD  1 
ATOM 1980  C CE  . LYS B 1 68  ? 102.076 75.498  104.459 1.00 30.00  ? 68  LYS B CE  1 
ATOM 1981  N NZ  . LYS B 1 68  ? 102.083 74.226  103.692 1.00 30.00  ? 68  LYS B NZ  1 
ATOM 1982  N N   . THR B 1 69  ? 96.782  74.330  108.829 1.00 104.67 ? 69  THR B N   1 
ATOM 1983  C CA  . THR B 1 69  ? 95.868  74.643  109.915 1.00 117.77 ? 69  THR B CA  1 
ATOM 1984  C C   . THR B 1 69  ? 96.518  74.347  111.275 1.00 114.76 ? 69  THR B C   1 
ATOM 1985  O O   . THR B 1 69  ? 97.351  73.444  111.401 1.00 113.10 ? 69  THR B O   1 
ATOM 1986  C CB  . THR B 1 69  ? 94.591  73.813  109.733 1.00 30.00  ? 69  THR B CB  1 
ATOM 1987  O OG1 . THR B 1 69  ? 94.169  73.899  108.368 1.00 30.00  ? 69  THR B OG1 1 
ATOM 1988  C CG2 . THR B 1 69  ? 93.445  74.333  110.585 1.00 30.00  ? 69  THR B CG2 1 
ATOM 1989  N N   . TYR B 1 70  ? 96.138  75.141  112.289 1.00 95.58  ? 70  TYR B N   1 
ATOM 1990  C CA  . TYR B 1 70  ? 96.273  74.801  113.713 1.00 91.75  ? 70  TYR B CA  1 
ATOM 1991  C C   . TYR B 1 70  ? 97.731  74.651  114.161 1.00 97.36  ? 70  TYR B C   1 
ATOM 1992  O O   . TYR B 1 70  ? 98.223  73.543  114.383 1.00 106.50 ? 70  TYR B O   1 
ATOM 1993  C CB  . TYR B 1 70  ? 95.494  73.522  114.038 1.00 30.00  ? 70  TYR B CB  1 
ATOM 1994  C CG  . TYR B 1 70  ? 93.993  73.663  114.034 1.00 30.00  ? 70  TYR B CG  1 
ATOM 1995  C CD1 . TYR B 1 70  ? 93.387  74.910  114.141 1.00 30.00  ? 70  TYR B CD1 1 
ATOM 1996  C CD2 . TYR B 1 70  ? 93.178  72.545  113.915 1.00 30.00  ? 70  TYR B CD2 1 
ATOM 1997  C CE1 . TYR B 1 70  ? 92.008  75.036  114.136 1.00 30.00  ? 70  TYR B CE1 1 
ATOM 1998  C CE2 . TYR B 1 70  ? 91.805  72.658  113.908 1.00 30.00  ? 70  TYR B CE2 1 
ATOM 1999  C CZ  . TYR B 1 70  ? 91.225  73.906  114.019 1.00 30.00  ? 70  TYR B CZ  1 
ATOM 2000  O OH  . TYR B 1 70  ? 89.855  74.025  114.011 1.00 30.00  ? 70  TYR B OH  1 
ATOM 2001  N N   . VAL B 1 71  ? 98.423  75.794  114.253 1.00 94.49  ? 71  VAL B N   1 
ATOM 2002  C CA  . VAL B 1 71  ? 99.786  75.846  114.794 1.00 80.78  ? 71  VAL B CA  1 
ATOM 2003  C C   . VAL B 1 71  ? 99.863  75.341  116.236 1.00 87.45  ? 71  VAL B C   1 
ATOM 2004  O O   . VAL B 1 71  ? 99.205  75.869  117.138 1.00 96.24  ? 71  VAL B O   1 
ATOM 2005  C CB  . VAL B 1 71  ? 100.385 77.262  114.644 1.00 30.00  ? 71  VAL B CB  1 
ATOM 2006  C CG1 . VAL B 1 71  ? 99.441  78.334  115.119 1.00 30.00  ? 71  VAL B CG1 1 
ATOM 2007  C CG2 . VAL B 1 71  ? 101.675 77.363  115.419 1.00 30.00  ? 71  VAL B CG2 1 
ATOM 2008  N N   . GLU B 1 72  ? 100.667 74.299  116.461 1.00 85.64  ? 72  GLU B N   1 
ATOM 2009  C CA  . GLU B 1 72  ? 100.483 73.448  117.629 1.00 94.43  ? 72  GLU B CA  1 
ATOM 2010  C C   . GLU B 1 72  ? 101.580 73.529  118.684 1.00 97.09  ? 72  GLU B C   1 
ATOM 2011  O O   . GLU B 1 72  ? 101.278 73.385  119.870 1.00 121.72 ? 72  GLU B O   1 
ATOM 2012  C CB  . GLU B 1 72  ? 100.290 71.982  117.192 1.00 30.00  ? 72  GLU B CB  1 
ATOM 2013  C CG  . GLU B 1 72  ? 101.481 71.273  116.575 1.00 30.00  ? 72  GLU B CG  1 
ATOM 2014  C CD  . GLU B 1 72  ? 101.560 71.433  115.077 1.00 30.00  ? 72  GLU B CD  1 
ATOM 2015  O OE1 . GLU B 1 72  ? 100.882 72.328  114.532 1.00 30.00  ? 72  GLU B OE1 1 
ATOM 2016  O OE2 . GLU B 1 72  ? 102.295 70.646  114.441 1.00 30.00  ? 72  GLU B OE2 1 
ATOM 2017  N N   . LYS B 1 73  ? 102.843 73.740  118.322 1.00 88.72  ? 73  LYS B N   1 
ATOM 2018  C CA  . LYS B 1 73  ? 103.941 73.602  119.281 1.00 76.19  ? 73  LYS B CA  1 
ATOM 2019  C C   . LYS B 1 73  ? 104.720 74.905  119.386 1.00 76.39  ? 73  LYS B C   1 
ATOM 2020  O O   . LYS B 1 73  ? 105.693 75.114  118.660 1.00 99.03  ? 73  LYS B O   1 
ATOM 2021  C CB  . LYS B 1 73  ? 104.860 72.454  118.888 1.00 30.00  ? 73  LYS B CB  1 
ATOM 2022  C CG  . LYS B 1 73  ? 104.239 71.088  119.070 1.00 30.00  ? 73  LYS B CG  1 
ATOM 2023  C CD  . LYS B 1 73  ? 105.240 69.957  118.870 1.00 30.00  ? 73  LYS B CD  1 
ATOM 2024  C CE  . LYS B 1 73  ? 105.609 69.758  117.416 1.00 30.00  ? 73  LYS B CE  1 
ATOM 2025  N NZ  . LYS B 1 73  ? 106.495 68.573  117.257 1.00 30.00  ? 73  LYS B NZ  1 
ATOM 2026  N N   . LEU B 1 74  ? 104.319 75.756  120.321 1.00 86.10  ? 74  LEU B N   1 
ATOM 2027  C CA  . LEU B 1 74  ? 104.958 77.046  120.526 1.00 69.89  ? 74  LEU B CA  1 
ATOM 2028  C C   . LEU B 1 74  ? 106.219 76.882  121.364 1.00 74.51  ? 74  LEU B C   1 
ATOM 2029  O O   . LEU B 1 74  ? 106.355 75.938  122.145 1.00 105.24 ? 74  LEU B O   1 
ATOM 2030  C CB  . LEU B 1 74  ? 103.979 78.017  121.197 1.00 30.00  ? 74  LEU B CB  1 
ATOM 2031  C CG  . LEU B 1 74  ? 104.272 79.502  121.426 1.00 30.00  ? 74  LEU B CG  1 
ATOM 2032  C CD1 . LEU B 1 74  ? 102.984 80.280  121.329 1.00 30.00  ? 74  LEU B CD1 1 
ATOM 2033  C CD2 . LEU B 1 74  ? 104.867 79.723  122.797 1.00 30.00  ? 74  LEU B CD2 1 
ATOM 2034  N N   . ALA B 1 75  ? 107.157 77.806  121.173 1.00 74.85  ? 75  ALA B N   1 
ATOM 2035  C CA  . ALA B 1 75  ? 108.343 77.910  122.010 1.00 71.52  ? 75  ALA B CA  1 
ATOM 2036  C C   . ALA B 1 75  ? 108.673 79.381  122.170 1.00 78.01  ? 75  ALA B C   1 
ATOM 2037  O O   . ALA B 1 75  ? 108.855 80.086  121.177 1.00 114.52 ? 75  ALA B O   1 
ATOM 2038  C CB  . ALA B 1 75  ? 109.531 77.157  121.406 1.00 30.00  ? 75  ALA B CB  1 
ATOM 2039  N N   . ILE B 1 76  ? 108.754 79.837  123.413 1.00 65.73  ? 76  ILE B N   1 
ATOM 2040  C CA  . ILE B 1 76  ? 108.960 81.242  123.744 1.00 91.48  ? 76  ILE B CA  1 
ATOM 2041  C C   . ILE B 1 76  ? 110.356 81.416  124.336 1.00 89.44  ? 76  ILE B C   1 
ATOM 2042  O O   . ILE B 1 76  ? 110.649 80.901  125.422 1.00 103.39 ? 76  ILE B O   1 
ATOM 2043  C CB  . ILE B 1 76  ? 107.856 81.742  124.689 1.00 30.00  ? 76  ILE B CB  1 
ATOM 2044  C CG1 . ILE B 1 76  ? 108.211 83.080  125.332 1.00 30.00  ? 76  ILE B CG1 1 
ATOM 2045  C CG2 . ILE B 1 76  ? 107.408 80.680  125.666 1.00 30.00  ? 76  ILE B CG2 1 
ATOM 2046  C CD1 . ILE B 1 76  ? 107.124 83.588  126.241 1.00 30.00  ? 76  ILE B CD1 1 
ATOM 2047  N N   . TYR B 1 77  ? 111.229 82.119  123.611 1.00 92.49  ? 77  TYR B N   1 
ATOM 2048  C CA  . TYR B 1 77  ? 112.592 82.357  124.072 1.00 95.04  ? 77  TYR B CA  1 
ATOM 2049  C C   . TYR B 1 77  ? 112.543 83.426  125.153 1.00 90.68  ? 77  TYR B C   1 
ATOM 2050  O O   . TYR B 1 77  ? 111.830 84.419  125.014 1.00 88.28  ? 77  TYR B O   1 
ATOM 2051  C CB  . TYR B 1 77  ? 113.522 82.841  122.953 1.00 30.00  ? 77  TYR B CB  1 
ATOM 2052  C CG  . TYR B 1 77  ? 113.709 81.975  121.716 1.00 30.00  ? 77  TYR B CG  1 
ATOM 2053  C CD1 . TYR B 1 77  ? 113.276 80.660  121.660 1.00 30.00  ? 77  TYR B CD1 1 
ATOM 2054  C CD2 . TYR B 1 77  ? 114.345 82.497  120.593 1.00 30.00  ? 77  TYR B CD2 1 
ATOM 2055  C CE1 . TYR B 1 77  ? 113.452 79.895  120.518 1.00 30.00  ? 77  TYR B CE1 1 
ATOM 2056  C CE2 . TYR B 1 77  ? 114.527 81.741  119.452 1.00 30.00  ? 77  TYR B CE2 1 
ATOM 2057  C CZ  . TYR B 1 77  ? 114.079 80.444  119.420 1.00 30.00  ? 77  TYR B CZ  1 
ATOM 2058  O OH  . TYR B 1 77  ? 114.260 79.694  118.284 1.00 30.00  ? 77  TYR B OH  1 
ATOM 2059  N N   . ILE B 1 78  ? 113.321 83.240  126.214 1.00 100.82 ? 78  ILE B N   1 
ATOM 2060  C CA  . ILE B 1 78  ? 113.240 84.085  127.400 1.00 80.56  ? 78  ILE B CA  1 
ATOM 2061  C C   . ILE B 1 78  ? 114.608 84.224  128.056 1.00 87.00  ? 78  ILE B C   1 
ATOM 2062  O O   . ILE B 1 78  ? 115.355 83.247  128.175 1.00 104.52 ? 78  ILE B O   1 
ATOM 2063  C CB  . ILE B 1 78  ? 112.172 83.556  128.384 1.00 30.00  ? 78  ILE B CB  1 
ATOM 2064  C CG1 . ILE B 1 78  ? 110.826 84.224  128.100 1.00 30.00  ? 78  ILE B CG1 1 
ATOM 2065  C CG2 . ILE B 1 78  ? 112.585 83.606  129.838 1.00 30.00  ? 78  ILE B CG2 1 
ATOM 2066  C CD1 . ILE B 1 78  ? 109.716 83.759  128.964 1.00 30.00  ? 78  ILE B CD1 1 
ATOM 2067  N N   . SER B 1 79  ? 114.941 85.448  128.453 1.00 77.59  ? 79  SER B N   1 
ATOM 2068  C CA  . SER B 1 79  ? 116.131 85.789  129.208 1.00 81.74  ? 79  SER B CA  1 
ATOM 2069  C C   . SER B 1 79  ? 115.780 86.873  130.213 1.00 98.36  ? 79  SER B C   1 
ATOM 2070  O O   . SER B 1 79  ? 114.999 87.776  129.902 1.00 117.87 ? 79  SER B O   1 
ATOM 2071  C CB  . SER B 1 79  ? 117.250 86.285  128.282 1.00 30.00  ? 79  SER B CB  1 
ATOM 2072  O OG  . SER B 1 79  ? 118.397 86.670  129.019 1.00 30.00  ? 79  SER B OG  1 
ATOM 2073  N N   . PRO B 1 80  ? 116.326 86.810  131.419 1.00 92.20  ? 80  PRO B N   1 
ATOM 2074  C CA  . PRO B 1 80  ? 116.011 87.816  132.433 1.00 88.75  ? 80  PRO B CA  1 
ATOM 2075  C C   . PRO B 1 80  ? 116.760 89.114  132.159 1.00 95.71  ? 80  PRO B C   1 
ATOM 2076  O O   . PRO B 1 80  ? 117.613 89.197  131.279 1.00 117.12 ? 80  PRO B O   1 
ATOM 2077  C CB  . PRO B 1 80  ? 116.474 87.159  133.732 1.00 30.00  ? 80  PRO B CB  1 
ATOM 2078  C CG  . PRO B 1 80  ? 117.555 86.268  133.316 1.00 30.00  ? 80  PRO B CG  1 
ATOM 2079  C CD  . PRO B 1 80  ? 117.185 85.749  131.961 1.00 30.00  ? 80  PRO B CD  1 
ATOM 2080  N N   . ASN B 1 81  ? 116.438 90.131  132.952 1.00 89.04  ? 81  ASN B N   1 
ATOM 2081  C CA  . ASN B 1 81  ? 116.988 91.466  132.758 1.00 119.16 ? 81  ASN B CA  1 
ATOM 2082  C C   . ASN B 1 81  ? 118.409 91.535  133.316 1.00 129.92 ? 81  ASN B C   1 
ATOM 2083  O O   . ASN B 1 81  ? 119.037 90.519  133.625 1.00 123.56 ? 81  ASN B O   1 
ATOM 2084  C CB  . ASN B 1 81  ? 116.081 92.521  133.390 1.00 30.00  ? 81  ASN B CB  1 
ATOM 2085  C CG  . ASN B 1 81  ? 114.803 92.735  132.611 1.00 30.00  ? 81  ASN B CG  1 
ATOM 2086  O OD1 . ASN B 1 81  ? 114.805 92.733  131.384 1.00 30.00  ? 81  ASN B OD1 1 
ATOM 2087  N ND2 . ASN B 1 81  ? 113.707 92.946  133.320 1.00 30.00  ? 81  ASN B ND2 1 
ATOM 2088  N N   . ALA B 1 82  ? 118.931 92.758  133.437 1.00 129.27 ? 82  ALA B N   1 
ATOM 2089  C CA  . ALA B 1 82  ? 120.338 92.950  133.771 1.00 116.73 ? 82  ALA B CA  1 
ATOM 2090  C C   . ALA B 1 82  ? 120.623 92.568  135.217 1.00 106.52 ? 82  ALA B C   1 
ATOM 2091  O O   . ALA B 1 82  ? 121.395 91.641  135.486 1.00 96.85  ? 82  ALA B O   1 
ATOM 2092  C CB  . ALA B 1 82  ? 120.737 94.401  133.505 1.00 30.00  ? 82  ALA B CB  1 
ATOM 2093  N N   . GLY B 1 83  ? 119.998 93.254  136.161 1.00 114.15 ? 83  GLY B N   1 
ATOM 2094  C CA  . GLY B 1 83  ? 120.229 92.931  137.551 1.00 114.95 ? 83  GLY B CA  1 
ATOM 2095  C C   . GLY B 1 83  ? 119.154 92.021  138.095 1.00 115.25 ? 83  GLY B C   1 
ATOM 2096  O O   . GLY B 1 83  ? 118.002 92.441  138.241 1.00 115.65 ? 83  GLY B O   1 
ATOM 2097  N N   . SER B 1 84  ? 119.510 90.776  138.401 1.00 112.07 ? 84  SER B N   1 
ATOM 2098  C CA  . SER B 1 84  ? 118.532 89.801  138.856 1.00 124.31 ? 84  SER B CA  1 
ATOM 2099  C C   . SER B 1 84  ? 119.216 88.696  139.639 1.00 115.58 ? 84  SER B C   1 
ATOM 2100  O O   . SER B 1 84  ? 120.230 88.152  139.199 1.00 106.26 ? 84  SER B O   1 
ATOM 2101  C CB  . SER B 1 84  ? 117.774 89.186  137.687 1.00 30.00  ? 84  SER B CB  1 
ATOM 2102  O OG  . SER B 1 84  ? 116.933 88.174  138.181 1.00 30.00  ? 84  SER B OG  1 
ATOM 2103  N N   . GLU B 1 85  ? 118.652 88.366  140.797 1.00 118.56 ? 85  GLU B N   1 
ATOM 2104  C CA  . GLU B 1 85  ? 119.246 87.362  141.677 1.00 105.86 ? 85  GLU B CA  1 
ATOM 2105  C C   . GLU B 1 85  ? 118.508 86.025  141.567 1.00 107.85 ? 85  GLU B C   1 
ATOM 2106  O O   . GLU B 1 85  ? 117.935 85.519  142.532 1.00 104.84 ? 85  GLU B O   1 
ATOM 2107  C CB  . GLU B 1 85  ? 119.266 87.876  143.113 1.00 30.00  ? 85  GLU B CB  1 
ATOM 2108  C CG  . GLU B 1 85  ? 120.127 89.113  143.303 1.00 30.00  ? 85  GLU B CG  1 
ATOM 2109  C CD  . GLU B 1 85  ? 120.145 89.597  144.737 1.00 30.00  ? 85  GLU B CD  1 
ATOM 2110  O OE1 . GLU B 1 85  ? 119.417 89.018  145.566 1.00 30.00  ? 85  GLU B OE1 1 
ATOM 2111  O OE2 . GLU B 1 85  ? 120.884 90.557  145.036 1.00 30.00  ? 85  GLU B OE2 1 
ATOM 2112  N N   . GLY B 1 86  ? 118.549 85.436  140.370 1.00 113.31 ? 86  GLY B N   1 
ATOM 2113  C CA  . GLY B 1 86  ? 118.153 84.045  140.222 1.00 111.17 ? 86  GLY B CA  1 
ATOM 2114  C C   . GLY B 1 86  ? 116.685 83.677  140.358 1.00 101.55 ? 86  GLY B C   1 
ATOM 2115  O O   . GLY B 1 86  ? 116.298 83.144  141.402 1.00 106.00 ? 86  GLY B O   1 
ATOM 2116  N N   . ILE B 1 87  ? 115.847 83.987  139.366 1.00 75.80  ? 87  ILE B N   1 
ATOM 2117  C CA  . ILE B 1 87  ? 114.449 83.558  139.406 1.00 73.31  ? 87  ILE B CA  1 
ATOM 2118  C C   . ILE B 1 87  ? 114.388 82.042  139.269 1.00 100.35 ? 87  ILE B C   1 
ATOM 2119  O O   . ILE B 1 87  ? 114.893 81.474  138.295 1.00 117.40 ? 87  ILE B O   1 
ATOM 2120  C CB  . ILE B 1 87  ? 113.616 84.203  138.293 1.00 30.00  ? 87  ILE B CB  1 
ATOM 2121  C CG1 . ILE B 1 87  ? 113.728 85.716  138.272 1.00 30.00  ? 87  ILE B CG1 1 
ATOM 2122  C CG2 . ILE B 1 87  ? 112.171 83.816  138.441 1.00 30.00  ? 87  ILE B CG2 1 
ATOM 2123  C CD1 . ILE B 1 87  ? 114.623 86.191  137.177 1.00 30.00  ? 87  ILE B CD1 1 
ATOM 2124  N N   . ASP B 1 88  ? 113.747 81.382  140.225 1.00 103.88 ? 88  ASP B N   1 
ATOM 2125  C CA  . ASP B 1 88  ? 113.560 79.944  140.139 1.00 95.71  ? 88  ASP B CA  1 
ATOM 2126  C C   . ASP B 1 88  ? 112.330 79.656  139.292 1.00 94.42  ? 88  ASP B C   1 
ATOM 2127  O O   . ASP B 1 88  ? 111.235 80.151  139.568 1.00 101.39 ? 88  ASP B O   1 
ATOM 2128  C CB  . ASP B 1 88  ? 113.402 79.335  141.534 1.00 30.00  ? 88  ASP B CB  1 
ATOM 2129  C CG  . ASP B 1 88  ? 113.560 77.823  141.545 1.00 30.00  ? 88  ASP B CG  1 
ATOM 2130  O OD1 . ASP B 1 88  ? 113.786 77.224  140.474 1.00 30.00  ? 88  ASP B OD1 1 
ATOM 2131  O OD2 . ASP B 1 88  ? 113.458 77.230  142.640 1.00 30.00  ? 88  ASP B OD2 1 
ATOM 2132  N N   . LEU B 1 89  ? 112.511 78.837  138.260 1.00 99.19  ? 89  LEU B N   1 
ATOM 2133  C CA  . LEU B 1 89  ? 111.448 78.609  137.293 1.00 104.74 ? 89  LEU B CA  1 
ATOM 2134  C C   . LEU B 1 89  ? 110.491 77.495  137.696 1.00 110.40 ? 89  LEU B C   1 
ATOM 2135  O O   . LEU B 1 89  ? 109.488 77.283  137.008 1.00 132.98 ? 89  LEU B O   1 
ATOM 2136  C CB  . LEU B 1 89  ? 112.034 78.314  135.917 1.00 30.00  ? 89  LEU B CB  1 
ATOM 2137  C CG  . LEU B 1 89  ? 112.847 79.456  135.324 1.00 30.00  ? 89  LEU B CG  1 
ATOM 2138  C CD1 . LEU B 1 89  ? 113.370 79.018  133.999 1.00 30.00  ? 89  LEU B CD1 1 
ATOM 2139  C CD2 . LEU B 1 89  ? 112.033 80.714  135.174 1.00 30.00  ? 89  LEU B CD2 1 
ATOM 2140  N N   . ASN B 1 90  ? 110.774 76.774  138.781 1.00 101.49 ? 90  ASN B N   1 
ATOM 2141  C CA  . ASN B 1 90  ? 109.728 75.975  139.406 1.00 104.71 ? 90  ASN B CA  1 
ATOM 2142  C C   . ASN B 1 90  ? 108.652 76.890  139.977 1.00 105.99 ? 90  ASN B C   1 
ATOM 2143  O O   . ASN B 1 90  ? 107.467 76.539  139.969 1.00 109.37 ? 90  ASN B O   1 
ATOM 2144  C CB  . ASN B 1 90  ? 110.336 75.081  140.494 1.00 30.00  ? 90  ASN B CB  1 
ATOM 2145  C CG  . ASN B 1 90  ? 109.524 73.816  140.758 1.00 30.00  ? 90  ASN B CG  1 
ATOM 2146  O OD1 . ASN B 1 90  ? 110.008 72.883  141.399 1.00 30.00  ? 90  ASN B OD1 1 
ATOM 2147  N ND2 . ASN B 1 90  ? 108.306 73.767  140.246 1.00 30.00  ? 90  ASN B ND2 1 
ATOM 2148  N N   . ASN B 1 91  ? 109.047 78.063  140.475 1.00 96.80  ? 91  ASN B N   1 
ATOM 2149  C CA  . ASN B 1 91  ? 108.111 79.119  140.846 1.00 97.18  ? 91  ASN B CA  1 
ATOM 2150  C C   . ASN B 1 91  ? 108.076 80.164  139.734 1.00 103.39 ? 91  ASN B C   1 
ATOM 2151  O O   . ASN B 1 91  ? 108.497 81.305  139.905 1.00 107.67 ? 91  ASN B O   1 
ATOM 2152  C CB  . ASN B 1 91  ? 108.509 79.746  142.174 1.00 30.00  ? 91  ASN B CB  1 
ATOM 2153  C CG  . ASN B 1 91  ? 108.478 78.765  143.309 1.00 30.00  ? 91  ASN B CG  1 
ATOM 2154  O OD1 . ASN B 1 91  ? 109.502 78.483  143.926 1.00 30.00  ? 91  ASN B OD1 1 
ATOM 2155  N ND2 . ASN B 1 91  ? 107.302 78.231  143.593 1.00 30.00  ? 91  ASN B ND2 1 
ATOM 2156  N N   . THR B 1 92  ? 107.564 79.763  138.572 1.00 101.15 ? 92  THR B N   1 
ATOM 2157  C CA  . THR B 1 92  ? 107.328 80.710  137.488 1.00 84.54  ? 92  THR B CA  1 
ATOM 2158  C C   . THR B 1 92  ? 106.165 80.208  136.653 1.00 86.65  ? 92  THR B C   1 
ATOM 2159  O O   . THR B 1 92  ? 106.322 79.273  135.864 1.00 106.48 ? 92  THR B O   1 
ATOM 2160  C CB  . THR B 1 92  ? 108.562 80.895  136.609 1.00 30.00  ? 92  THR B CB  1 
ATOM 2161  O OG1 . THR B 1 92  ? 109.631 81.421  137.398 1.00 30.00  ? 92  THR B OG1 1 
ATOM 2162  C CG2 . THR B 1 92  ? 108.274 81.867  135.489 1.00 30.00  ? 92  THR B CG2 1 
ATOM 2163  N N   . ARG B 1 93  ? 105.005 80.821  136.833 1.00 78.31  ? 93  ARG B N   1 
ATOM 2164  C CA  . ARG B 1 93  ? 103.788 80.404  136.162 1.00 89.86  ? 93  ARG B CA  1 
ATOM 2165  C C   . ARG B 1 93  ? 103.581 81.255  134.919 1.00 89.07  ? 93  ARG B C   1 
ATOM 2166  O O   . ARG B 1 93  ? 103.341 82.460  135.015 1.00 106.87 ? 93  ARG B O   1 
ATOM 2167  C CB  . ARG B 1 93  ? 102.600 80.515  137.107 1.00 30.00  ? 93  ARG B CB  1 
ATOM 2168  C CG  . ARG B 1 93  ? 102.720 79.602  138.314 1.00 30.00  ? 93  ARG B CG  1 
ATOM 2169  C CD  . ARG B 1 93  ? 102.631 78.143  137.897 1.00 30.00  ? 93  ARG B CD  1 
ATOM 2170  N NE  . ARG B 1 93  ? 102.618 77.231  139.038 1.00 30.00  ? 93  ARG B NE  1 
ATOM 2171  C CZ  . ARG B 1 93  ? 103.695 76.639  139.539 1.00 30.00  ? 93  ARG B CZ  1 
ATOM 2172  N NH1 . ARG B 1 93  ? 104.880 76.845  138.995 1.00 30.00  ? 93  ARG B NH1 1 
ATOM 2173  N NH2 . ARG B 1 93  ? 103.585 75.826  140.578 1.00 30.00  ? 93  ARG B NH2 1 
ATOM 2174  N N   . VAL B 1 94  ? 103.681 80.624  133.750 1.00 84.22  ? 94  VAL B N   1 
ATOM 2175  C CA  . VAL B 1 94  ? 103.581 81.333  132.478 1.00 73.51  ? 94  VAL B CA  1 
ATOM 2176  C C   . VAL B 1 94  ? 102.124 81.391  132.052 1.00 86.10  ? 94  VAL B C   1 
ATOM 2177  O O   . VAL B 1 94  ? 101.571 80.404  131.560 1.00 102.58 ? 94  VAL B O   1 
ATOM 2178  C CB  . VAL B 1 94  ? 104.441 80.659  131.398 1.00 30.00  ? 94  VAL B CB  1 
ATOM 2179  C CG1 . VAL B 1 94  ? 104.304 81.385  130.077 1.00 30.00  ? 94  VAL B CG1 1 
ATOM 2180  C CG2 . VAL B 1 94  ? 105.882 80.631  131.834 1.00 30.00  ? 94  VAL B CG2 1 
ATOM 2181  N N   . VAL B 1 95  ? 101.491 82.544  132.242 1.00 80.17  ? 95  VAL B N   1 
ATOM 2182  C CA  . VAL B 1 95  ? 100.067 82.707  131.978 1.00 77.28  ? 95  VAL B CA  1 
ATOM 2183  C C   . VAL B 1 95  ? 99.925  83.152  130.528 1.00 86.14  ? 95  VAL B C   1 
ATOM 2184  O O   . VAL B 1 95  ? 100.567 84.104  130.097 1.00 98.38  ? 95  VAL B O   1 
ATOM 2185  C CB  . VAL B 1 95  ? 99.430  83.711  132.938 1.00 30.00  ? 95  VAL B CB  1 
ATOM 2186  C CG1 . VAL B 1 95  ? 97.974  83.924  132.598 1.00 30.00  ? 95  VAL B CG1 1 
ATOM 2187  C CG2 . VAL B 1 95  ? 99.577  83.241  134.364 1.00 30.00  ? 95  VAL B CG2 1 
ATOM 2188  N N   . LEU B 1 96  ? 99.095  82.450  129.767 1.00 91.86  ? 96  LEU B N   1 
ATOM 2189  C CA  . LEU B 1 96  ? 98.696  82.886  128.438 1.00 76.62  ? 96  LEU B CA  1 
ATOM 2190  C C   . LEU B 1 96  ? 97.206  82.635  128.257 1.00 90.23  ? 96  LEU B C   1 
ATOM 2191  O O   . LEU B 1 96  ? 96.704  81.564  128.611 1.00 122.98 ? 96  LEU B O   1 
ATOM 2192  C CB  . LEU B 1 96  ? 99.528  82.195  127.352 1.00 30.00  ? 96  LEU B CB  1 
ATOM 2193  C CG  . LEU B 1 96  ? 99.636  80.678  127.163 1.00 30.00  ? 96  LEU B CG  1 
ATOM 2194  C CD1 . LEU B 1 96  ? 98.537  80.099  126.291 1.00 30.00  ? 96  LEU B CD1 1 
ATOM 2195  C CD2 . LEU B 1 96  ? 100.993 80.342  126.571 1.00 30.00  ? 96  LEU B CD2 1 
ATOM 2196  N N   . SER B 1 97  ? 96.502  83.634  127.732 1.00 77.79  ? 97  SER B N   1 
ATOM 2197  C CA  . SER B 1 97  ? 95.059  83.554  127.557 1.00 80.19  ? 97  SER B CA  1 
ATOM 2198  C C   . SER B 1 97  ? 94.733  83.030  126.173 1.00 99.22  ? 97  SER B C   1 
ATOM 2199  O O   . SER B 1 97  ? 95.611  82.521  125.485 1.00 107.37 ? 97  SER B O   1 
ATOM 2200  C CB  . SER B 1 97  ? 94.416  84.921  127.753 1.00 30.00  ? 97  SER B CB  1 
ATOM 2201  O OG  . SER B 1 97  ? 94.797  85.806  126.718 1.00 30.00  ? 97  SER B OG  1 
ATOM 2202  N N   . ASN B 1 98  ? 93.474  83.137  125.768 1.00 30.00  ? 98  ASN B N   1 
ATOM 2203  C CA  . ASN B 1 98  ? 93.049  82.854  124.405 1.00 30.00  ? 98  ASN B CA  1 
ATOM 2204  C C   . ASN B 1 98  ? 92.070  83.967  124.066 1.00 30.00  ? 98  ASN B C   1 
ATOM 2205  O O   . ASN B 1 98  ? 92.020  84.977  124.773 1.00 30.00  ? 98  ASN B O   1 
ATOM 2206  C CB  . ASN B 1 98  ? 92.415  81.459  124.306 1.00 30.00  ? 98  ASN B CB  1 
ATOM 2207  C CG  . ASN B 1 98  ? 92.335  80.935  122.877 1.00 30.00  ? 98  ASN B CG  1 
ATOM 2208  O OD1 . ASN B 1 98  ? 92.735  81.616  121.938 1.00 30.00  ? 98  ASN B OD1 1 
ATOM 2209  N ND2 . ASN B 1 98  ? 91.806  79.728  122.710 1.00 30.00  ? 98  ASN B ND2 1 
ATOM 2210  N N   . GLY B 1 99  ? 91.304  83.825  122.990 1.00 30.00  ? 99  GLY B N   1 
ATOM 2211  C CA  . GLY B 1 99  ? 90.076  84.584  122.905 1.00 30.00  ? 99  GLY B CA  1 
ATOM 2212  C C   . GLY B 1 99  ? 88.987  84.061  123.823 1.00 30.00  ? 99  GLY B C   1 
ATOM 2213  O O   . GLY B 1 99  ? 88.000  84.766  124.065 1.00 30.00  ? 99  GLY B O   1 
ATOM 2214  N N   . THR B 1 100 ? 89.133  82.834  124.325 1.00 85.87  ? 100 THR B N   1 
ATOM 2215  C CA  . THR B 1 100 ? 88.150  82.246  125.221 1.00 102.79 ? 100 THR B CA  1 
ATOM 2216  C C   . THR B 1 100 ? 88.730  81.801  126.556 1.00 104.11 ? 100 THR B C   1 
ATOM 2217  O O   . THR B 1 100 ? 88.175  82.141  127.606 1.00 96.07  ? 100 THR B O   1 
ATOM 2218  C CB  . THR B 1 100 ? 87.473  81.064  124.517 1.00 30.00  ? 100 THR B CB  1 
ATOM 2219  O OG1 . THR B 1 100 ? 86.915  81.514  123.278 1.00 30.00  ? 100 THR B OG1 1 
ATOM 2220  C CG2 . THR B 1 100 ? 86.355  80.508  125.372 1.00 30.00  ? 100 THR B CG2 1 
ATOM 2221  N N   . VAL B 1 101 ? 89.842  81.067  126.557 1.00 97.64  ? 101 VAL B N   1 
ATOM 2222  C CA  . VAL B 1 101 ? 90.247  80.247  127.697 1.00 100.35 ? 101 VAL B CA  1 
ATOM 2223  C C   . VAL B 1 101 ? 91.599  80.709  128.224 1.00 117.38 ? 101 VAL B C   1 
ATOM 2224  O O   . VAL B 1 101 ? 92.600  80.657  127.504 1.00 123.46 ? 101 VAL B O   1 
ATOM 2225  C CB  . VAL B 1 101 ? 90.313  78.758  127.312 1.00 30.00  ? 101 VAL B CB  1 
ATOM 2226  C CG1 . VAL B 1 101 ? 90.736  77.923  128.492 1.00 30.00  ? 101 VAL B CG1 1 
ATOM 2227  C CG2 . VAL B 1 101 ? 88.977  78.271  126.778 1.00 30.00  ? 101 VAL B CG2 1 
ATOM 2228  N N   . GLN B 1 102 ? 91.633  81.120  129.491 1.00 107.35 ? 102 GLN B N   1 
ATOM 2229  C CA  . GLN B 1 102 ? 92.882  81.428  130.177 1.00 99.10  ? 102 GLN B CA  1 
ATOM 2230  C C   . GLN B 1 102 ? 93.671  80.149  130.449 1.00 93.31  ? 102 GLN B C   1 
ATOM 2231  O O   . GLN B 1 102 ? 93.156  79.037  130.338 1.00 114.39 ? 102 GLN B O   1 
ATOM 2232  C CB  . GLN B 1 102 ? 92.613  82.124  131.511 1.00 30.00  ? 102 GLN B CB  1 
ATOM 2233  C CG  . GLN B 1 102 ? 91.951  83.489  131.450 1.00 30.00  ? 102 GLN B CG  1 
ATOM 2234  C CD  . GLN B 1 102 ? 92.867  84.577  130.945 1.00 30.00  ? 102 GLN B CD  1 
ATOM 2235  O OE1 . GLN B 1 102 ? 94.066  84.574  131.215 1.00 30.00  ? 102 GLN B OE1 1 
ATOM 2236  N NE2 . GLN B 1 102 ? 92.296  85.539  130.235 1.00 30.00  ? 102 GLN B NE2 1 
ATOM 2237  N N   . ALA B 1 103 ? 94.925  80.315  130.863 1.00 90.25  ? 103 ALA B N   1 
ATOM 2238  C CA  . ALA B 1 103 ? 95.726  79.174  131.286 1.00 88.34  ? 103 ALA B CA  1 
ATOM 2239  C C   . ALA B 1 103 ? 96.847  79.638  132.200 1.00 104.79 ? 103 ALA B C   1 
ATOM 2240  O O   . ALA B 1 103 ? 97.365  80.743  132.041 1.00 117.96 ? 103 ALA B O   1 
ATOM 2241  C CB  . ALA B 1 103 ? 96.326  78.426  130.093 1.00 30.00  ? 103 ALA B CB  1 
ATOM 2242  N N   . VAL B 1 104 ? 97.214  78.786  133.152 1.00 94.80  ? 104 VAL B N   1 
ATOM 2243  C CA  . VAL B 1 104 ? 98.476  78.905  133.867 1.00 109.96 ? 104 VAL B CA  1 
ATOM 2244  C C   . VAL B 1 104 ? 99.294  77.667  133.544 1.00 89.25  ? 104 VAL B C   1 
ATOM 2245  O O   . VAL B 1 104 ? 98.751  76.616  133.193 1.00 75.68  ? 104 VAL B O   1 
ATOM 2246  C CB  . VAL B 1 104 ? 98.300  79.070  135.392 1.00 30.00  ? 104 VAL B CB  1 
ATOM 2247  C CG1 . VAL B 1 104 ? 97.569  80.358  135.703 1.00 30.00  ? 104 VAL B CG1 1 
ATOM 2248  C CG2 . VAL B 1 104 ? 97.555  77.889  135.975 1.00 30.00  ? 104 VAL B CG2 1 
ATOM 2249  N N   . LEU B 1 105 ? 100.610 77.803  133.627 1.00 88.49  ? 105 LEU B N   1 
ATOM 2250  C CA  . LEU B 1 105 ? 101.522 76.748  133.205 1.00 98.24  ? 105 LEU B CA  1 
ATOM 2251  C C   . LEU B 1 105 ? 102.491 76.452  134.342 1.00 91.87  ? 105 LEU B C   1 
ATOM 2252  O O   . LEU B 1 105 ? 103.302 77.306  134.713 1.00 103.67 ? 105 LEU B O   1 
ATOM 2253  C CB  . LEU B 1 105 ? 102.264 77.146  131.927 1.00 30.00  ? 105 LEU B CB  1 
ATOM 2254  C CG  . LEU B 1 105 ? 101.649 76.913  130.532 1.00 30.00  ? 105 LEU B CG  1 
ATOM 2255  C CD1 . LEU B 1 105 ? 101.428 75.448  130.279 1.00 30.00  ? 105 LEU B CD1 1 
ATOM 2256  C CD2 . LEU B 1 105 ? 100.366 77.671  130.241 1.00 30.00  ? 105 LEU B CD2 1 
ATOM 2257  N N   . LYS B 1 106 ? 102.391 75.249  134.896 1.00 80.59  ? 106 LYS B N   1 
ATOM 2258  C CA  . LYS B 1 106 ? 103.254 74.776  135.968 1.00 95.20  ? 106 LYS B CA  1 
ATOM 2259  C C   . LYS B 1 106 ? 104.373 73.926  135.385 1.00 109.74 ? 106 LYS B C   1 
ATOM 2260  O O   . LYS B 1 106 ? 104.158 73.151  134.454 1.00 125.41 ? 106 LYS B O   1 
ATOM 2261  C CB  . LYS B 1 106 ? 102.440 73.959  136.974 1.00 30.00  ? 106 LYS B CB  1 
ATOM 2262  C CG  . LYS B 1 106 ? 103.208 73.411  138.164 1.00 30.00  ? 106 LYS B CG  1 
ATOM 2263  C CD  . LYS B 1 106 ? 102.269 72.718  139.136 1.00 30.00  ? 106 LYS B CD  1 
ATOM 2264  C CE  . LYS B 1 106 ? 101.751 71.412  138.565 1.00 30.00  ? 106 LYS B CE  1 
ATOM 2265  N NZ  . LYS B 1 106 ? 102.838 70.404  138.451 1.00 30.00  ? 106 LYS B NZ  1 
ATOM 2266  N N   . TYR B 1 107 ? 105.571 74.081  135.943 1.00 113.92 ? 107 TYR B N   1 
ATOM 2267  C CA  . TYR B 1 107 ? 106.749 73.405  135.415 1.00 120.86 ? 107 TYR B CA  1 
ATOM 2268  C C   . TYR B 1 107 ? 106.670 71.894  135.574 1.00 104.10 ? 107 TYR B C   1 
ATOM 2269  O O   . TYR B 1 107 ? 106.291 71.380  136.629 1.00 105.66 ? 107 TYR B O   1 
ATOM 2270  C CB  . TYR B 1 107 ? 108.004 73.925  136.102 1.00 30.00  ? 107 TYR B CB  1 
ATOM 2271  C CG  . TYR B 1 107 ? 109.238 73.168  135.706 1.00 30.00  ? 107 TYR B CG  1 
ATOM 2272  C CD1 . TYR B 1 107 ? 109.748 73.274  134.431 1.00 30.00  ? 107 TYR B CD1 1 
ATOM 2273  C CD2 . TYR B 1 107 ? 109.903 72.360  136.615 1.00 30.00  ? 107 TYR B CD2 1 
ATOM 2274  C CE1 . TYR B 1 107 ? 110.869 72.597  134.069 1.00 30.00  ? 107 TYR B CE1 1 
ATOM 2275  C CE2 . TYR B 1 107 ? 111.036 71.672  136.252 1.00 30.00  ? 107 TYR B CE2 1 
ATOM 2276  C CZ  . TYR B 1 107 ? 111.513 71.797  134.976 1.00 30.00  ? 107 TYR B CZ  1 
ATOM 2277  O OH  . TYR B 1 107 ? 112.644 71.118  134.600 1.00 30.00  ? 107 TYR B OH  1 
ATOM 2278  N N   . GLU B 1 108 ? 107.033 71.186  134.511 1.00 101.18 ? 108 GLU B N   1 
ATOM 2279  C CA  . GLU B 1 108 ? 107.131 69.738  134.525 1.00 107.42 ? 108 GLU B CA  1 
ATOM 2280  C C   . GLU B 1 108 ? 108.593 69.340  134.471 1.00 97.36  ? 108 GLU B C   1 
ATOM 2281  O O   . GLU B 1 108 ? 109.358 69.872  133.664 1.00 99.71  ? 108 GLU B O   1 
ATOM 2282  C CB  . GLU B 1 108 ? 106.389 69.111  133.348 1.00 30.00  ? 108 GLU B CB  1 
ATOM 2283  C CG  . GLU B 1 108 ? 106.407 67.588  133.318 1.00 30.00  ? 108 GLU B CG  1 
ATOM 2284  C CD  . GLU B 1 108 ? 105.641 66.950  134.469 1.00 30.00  ? 108 GLU B CD  1 
ATOM 2285  O OE1 . GLU B 1 108 ? 104.688 67.570  134.986 1.00 30.00  ? 108 GLU B OE1 1 
ATOM 2286  O OE2 . GLU B 1 108 ? 105.993 65.818  134.858 1.00 30.00  ? 108 GLU B OE2 1 
ATOM 2287  N N   . LYS B 1 109 ? 108.971 68.395  135.324 1.00 87.60  ? 109 LYS B N   1 
ATOM 2288  C CA  . LYS B 1 109 ? 110.322 67.867  135.333 1.00 83.82  ? 109 LYS B CA  1 
ATOM 2289  C C   . LYS B 1 109 ? 110.552 67.005  134.092 1.00 93.03  ? 109 LYS B C   1 
ATOM 2290  O O   . LYS B 1 109 ? 109.614 66.634  133.379 1.00 117.66 ? 109 LYS B O   1 
ATOM 2291  C CB  . LYS B 1 109 ? 110.557 67.093  136.625 1.00 30.00  ? 109 LYS B CB  1 
ATOM 2292  C CG  . LYS B 1 109 ? 110.438 67.977  137.852 1.00 30.00  ? 109 LYS B CG  1 
ATOM 2293  C CD  . LYS B 1 109 ? 110.623 67.206  139.141 1.00 30.00  ? 109 LYS B CD  1 
ATOM 2294  C CE  . LYS B 1 109 ? 110.455 68.119  140.346 1.00 30.00  ? 109 LYS B CE  1 
ATOM 2295  N NZ  . LYS B 1 109 ? 110.618 67.388  141.637 1.00 30.00  ? 109 LYS B NZ  1 
ATOM 2296  N N   . THR B 1 110 ? 111.826 66.690  133.847 1.00 94.95  ? 110 THR B N   1 
ATOM 2297  C CA  . THR B 1 110 ? 112.312 65.940  132.679 1.00 121.68 ? 110 THR B CA  1 
ATOM 2298  C C   . THR B 1 110 ? 111.893 66.590  131.361 1.00 133.18 ? 110 THR B C   1 
ATOM 2299  O O   . THR B 1 110 ? 111.115 66.032  130.585 1.00 143.94 ? 110 THR B O   1 
ATOM 2300  C CB  . THR B 1 110 ? 111.883 64.465  132.713 1.00 30.00  ? 110 THR B CB  1 
ATOM 2301  O OG1 . THR B 1 110 ? 110.461 64.361  132.562 1.00 30.00  ? 110 THR B OG1 1 
ATOM 2302  C CG2 . THR B 1 110 ? 112.296 63.822  134.026 1.00 30.00  ? 110 THR B CG2 1 
ATOM 2303  N N   . ALA B 1 111 ? 112.412 67.798  131.115 1.00 106.50 ? 111 ALA B N   1 
ATOM 2304  C CA  . ALA B 1 111 ? 112.384 68.377  129.770 1.00 107.45 ? 111 ALA B CA  1 
ATOM 2305  C C   . ALA B 1 111 ? 113.599 69.297  129.619 1.00 124.52 ? 111 ALA B C   1 
ATOM 2306  O O   . ALA B 1 111 ? 113.500 70.498  129.860 1.00 140.43 ? 111 ALA B O   1 
ATOM 2307  C CB  . ALA B 1 111 ? 111.086 69.131  129.524 1.00 30.00  ? 111 ALA B CB  1 
ATOM 2308  N N   . TYR B 1 112 ? 114.729 68.735  129.175 1.00 30.00  ? 112 TYR B N   1 
ATOM 2309  C CA  . TYR B 1 112 ? 115.965 69.513  129.081 1.00 30.00  ? 112 TYR B CA  1 
ATOM 2310  C C   . TYR B 1 112 ? 116.513 69.639  127.666 1.00 30.00  ? 112 TYR B C   1 
ATOM 2311  O O   . TYR B 1 112 ? 116.689 70.769  127.207 1.00 30.00  ? 112 TYR B O   1 
ATOM 2312  C CB  . TYR B 1 112 ? 117.008 68.926  130.040 1.00 30.00  ? 112 TYR B CB  1 
ATOM 2313  C CG  . TYR B 1 112 ? 116.724 69.317  131.472 1.00 30.00  ? 112 TYR B CG  1 
ATOM 2314  C CD1 . TYR B 1 112 ? 116.024 70.480  131.747 1.00 30.00  ? 112 TYR B CD1 1 
ATOM 2315  C CD2 . TYR B 1 112 ? 117.102 68.510  132.540 1.00 30.00  ? 112 TYR B CD2 1 
ATOM 2316  C CE1 . TYR B 1 112 ? 115.737 70.851  133.021 1.00 30.00  ? 112 TYR B CE1 1 
ATOM 2317  C CE2 . TYR B 1 112 ? 116.808 68.882  133.844 1.00 30.00  ? 112 TYR B CE2 1 
ATOM 2318  C CZ  . TYR B 1 112 ? 116.123 70.060  134.065 1.00 30.00  ? 112 TYR B CZ  1 
ATOM 2319  O OH  . TYR B 1 112 ? 115.793 70.490  135.320 1.00 30.00  ? 112 TYR B OH  1 
ATOM 2320  N N   . HIS B 1 113 ? 116.820 68.531  126.980 1.00 30.00  ? 113 HIS B N   1 
ATOM 2321  C CA  . HIS B 1 113 ? 117.190 68.486  125.551 1.00 30.00  ? 113 HIS B CA  1 
ATOM 2322  C C   . HIS B 1 113 ? 118.416 69.365  125.248 1.00 30.00  ? 113 HIS B C   1 
ATOM 2323  O O   . HIS B 1 113 ? 118.602 69.896  124.153 1.00 30.00  ? 113 HIS B O   1 
ATOM 2324  C CB  . HIS B 1 113 ? 115.967 68.864  124.703 1.00 30.00  ? 113 HIS B CB  1 
ATOM 2325  C CG  . HIS B 1 113 ? 116.094 68.583  123.237 1.00 30.00  ? 113 HIS B CG  1 
ATOM 2326  N ND1 . HIS B 1 113 ? 116.121 67.306  122.721 1.00 30.00  ? 113 HIS B ND1 1 
ATOM 2327  C CD2 . HIS B 1 113 ? 116.144 69.419  122.174 1.00 30.00  ? 113 HIS B CD2 1 
ATOM 2328  C CE1 . HIS B 1 113 ? 116.214 67.369  121.405 1.00 30.00  ? 113 HIS B CE1 1 
ATOM 2329  N NE2 . HIS B 1 113 ? 116.224 68.640  121.047 1.00 30.00  ? 113 HIS B NE2 1 
ATOM 2330  N N   . LYS B 1 114 ? 119.275 69.497  126.254 1.00 30.00  ? 114 LYS B N   1 
ATOM 2331  C CA  . LYS B 1 114 ? 120.244 70.581  126.309 1.00 30.00  ? 114 LYS B CA  1 
ATOM 2332  C C   . LYS B 1 114 ? 121.472 70.381  125.430 1.00 30.00  ? 114 LYS B C   1 
ATOM 2333  O O   . LYS B 1 114 ? 122.302 71.293  125.347 1.00 30.00  ? 114 LYS B O   1 
ATOM 2334  C CB  . LYS B 1 114 ? 120.670 70.800  127.762 1.00 30.00  ? 114 LYS B CB  1 
ATOM 2335  C CG  . LYS B 1 114 ? 121.319 69.596  128.404 1.00 30.00  ? 114 LYS B CG  1 
ATOM 2336  C CD  . LYS B 1 114 ? 121.637 69.869  129.864 1.00 30.00  ? 114 LYS B CD  1 
ATOM 2337  C CE  . LYS B 1 114 ? 122.301 68.669  130.517 1.00 30.00  ? 114 LYS B CE  1 
ATOM 2338  N NZ  . LYS B 1 114 ? 122.603 68.916  131.952 1.00 30.00  ? 114 LYS B NZ  1 
ATOM 2339  N N   . GLY B 1 115 ? 121.612 69.238  124.764 1.00 30.00  ? 115 GLY B N   1 
ATOM 2340  C CA  . GLY B 1 115 ? 122.807 68.987  123.977 1.00 30.00  ? 115 GLY B CA  1 
ATOM 2341  C C   . GLY B 1 115 ? 122.598 68.825  122.483 1.00 30.00  ? 115 GLY B C   1 
ATOM 2342  O O   . GLY B 1 115 ? 123.468 69.190  121.688 1.00 30.00  ? 115 GLY B O   1 
ATOM 2343  N N   . ALA B 1 116 ? 121.447 68.285  122.088 1.00 30.00  ? 116 ALA B N   1 
ATOM 2344  C CA  . ALA B 1 116 ? 121.109 68.046  120.685 1.00 30.00  ? 116 ALA B CA  1 
ATOM 2345  C C   . ALA B 1 116 ? 120.203 69.142  120.144 1.00 30.00  ? 116 ALA B C   1 
ATOM 2346  O O   . ALA B 1 116 ? 119.288 68.887  119.356 1.00 30.00  ? 116 ALA B O   1 
ATOM 2347  C CB  . ALA B 1 116 ? 120.462 66.676  120.517 1.00 30.00  ? 116 ALA B CB  1 
ATOM 2348  N N   . VAL B 1 117 ? 120.468 70.383  120.548 1.00 30.00  ? 117 VAL B N   1 
ATOM 2349  C CA  . VAL B 1 117 ? 119.538 71.507  120.481 1.00 30.00  ? 117 VAL B CA  1 
ATOM 2350  C C   . VAL B 1 117 ? 119.343 72.026  119.053 1.00 30.00  ? 117 VAL B C   1 
ATOM 2351  O O   . VAL B 1 117 ? 118.508 72.904  118.811 1.00 30.00  ? 117 VAL B O   1 
ATOM 2352  C CB  . VAL B 1 117 ? 120.053 72.607  121.436 1.00 30.00  ? 117 VAL B CB  1 
ATOM 2353  C CG1 . VAL B 1 117 ? 121.284 73.297  120.860 1.00 30.00  ? 117 VAL B CG1 1 
ATOM 2354  C CG2 . VAL B 1 117 ? 118.956 73.577  121.895 1.00 30.00  ? 117 VAL B CG2 1 
ATOM 2355  N N   . GLY B 1 118 ? 120.077 71.463  118.088 1.00 30.00  ? 118 GLY B N   1 
ATOM 2356  C CA  . GLY B 1 118 ? 120.051 71.935  116.710 1.00 30.00  ? 118 GLY B CA  1 
ATOM 2357  C C   . GLY B 1 118 ? 118.719 71.795  116.005 1.00 30.00  ? 118 GLY B C   1 
ATOM 2358  O O   . GLY B 1 118 ? 118.430 72.579  115.096 1.00 30.00  ? 118 GLY B O   1 
ATOM 2359  N N   . ASP B 1 119 ? 117.909 70.818  116.389 1.00 30.00  ? 119 ASP B N   1 
ATOM 2360  C CA  . ASP B 1 119 ? 116.510 70.754  115.985 1.00 30.00  ? 119 ASP B CA  1 
ATOM 2361  C C   . ASP B 1 119 ? 115.679 70.973  117.239 1.00 30.00  ? 119 ASP B C   1 
ATOM 2362  O O   . ASP B 1 119 ? 115.559 70.071  118.075 1.00 30.00  ? 119 ASP B O   1 
ATOM 2363  C CB  . ASP B 1 119 ? 116.161 69.427  115.313 1.00 30.00  ? 119 ASP B CB  1 
ATOM 2364  C CG  . ASP B 1 119 ? 116.752 69.301  113.922 1.00 30.00  ? 119 ASP B CG  1 
ATOM 2365  O OD1 . ASP B 1 119 ? 116.967 70.343  113.271 1.00 30.00  ? 119 ASP B OD1 1 
ATOM 2366  O OD2 . ASP B 1 119 ? 116.987 68.160  113.472 1.00 30.00  ? 119 ASP B OD2 1 
ATOM 2367  N N   . VAL B 1 120 ? 115.110 72.175  117.363 1.00 30.00  ? 120 VAL B N   1 
ATOM 2368  C CA  . VAL B 1 120 ? 114.369 72.544  118.565 1.00 30.00  ? 120 VAL B CA  1 
ATOM 2369  C C   . VAL B 1 120 ? 113.049 71.780  118.624 1.00 30.00  ? 120 VAL B C   1 
ATOM 2370  O O   . VAL B 1 120 ? 112.501 71.523  119.704 1.00 30.00  ? 120 VAL B O   1 
ATOM 2371  C CB  . VAL B 1 120 ? 114.164 74.074  118.585 1.00 30.00  ? 120 VAL B CB  1 
ATOM 2372  C CG1 . VAL B 1 120 ? 113.541 74.553  119.883 1.00 30.00  ? 120 VAL B CG1 1 
ATOM 2373  C CG2 . VAL B 1 120 ? 115.470 74.788  118.339 1.00 30.00  ? 120 VAL B CG2 1 
ATOM 2374  N N   . PHE B 1 121 ? 112.557 71.338  117.469 1.00 30.00  ? 121 PHE B N   1 
ATOM 2375  C CA  . PHE B 1 121 ? 111.201 70.833  117.327 1.00 30.00  ? 121 PHE B CA  1 
ATOM 2376  C C   . PHE B 1 121 ? 111.152 69.362  116.934 1.00 30.00  ? 121 PHE B C   1 
ATOM 2377  O O   . PHE B 1 121 ? 110.185 68.924  116.305 1.00 30.00  ? 121 PHE B O   1 
ATOM 2378  C CB  . PHE B 1 121 ? 110.459 71.683  116.302 1.00 30.00  ? 121 PHE B CB  1 
ATOM 2379  C CG  . PHE B 1 121 ? 110.171 73.073  116.769 1.00 30.00  ? 121 PHE B CG  1 
ATOM 2380  C CD1 . PHE B 1 121 ? 110.062 73.354  118.114 1.00 30.00  ? 121 PHE B CD1 1 
ATOM 2381  C CD2 . PHE B 1 121 ? 110.063 74.106  115.866 1.00 30.00  ? 121 PHE B CD2 1 
ATOM 2382  C CE1 . PHE B 1 121 ? 109.805 74.625  118.544 1.00 30.00  ? 121 PHE B CE1 1 
ATOM 2383  C CE2 . PHE B 1 121 ? 109.815 75.383  116.296 1.00 30.00  ? 121 PHE B CE2 1 
ATOM 2384  C CZ  . PHE B 1 121 ? 109.680 75.636  117.633 1.00 30.00  ? 121 PHE B CZ  1 
ATOM 2385  N N   . ASN B 1 122 ? 112.171 68.586  117.283 1.00 30.00  ? 122 ASN B N   1 
ATOM 2386  C CA  . ASN B 1 122 ? 112.090 67.151  117.057 1.00 30.00  ? 122 ASN B CA  1 
ATOM 2387  C C   . ASN B 1 122 ? 111.228 66.530  118.151 1.00 30.00  ? 122 ASN B C   1 
ATOM 2388  O O   . ASN B 1 122 ? 110.997 67.142  119.197 1.00 30.00  ? 122 ASN B O   1 
ATOM 2389  C CB  . ASN B 1 122 ? 113.492 66.530  117.040 1.00 30.00  ? 122 ASN B CB  1 
ATOM 2390  C CG  . ASN B 1 122 ? 113.516 65.126  116.441 1.00 30.00  ? 122 ASN B CG  1 
ATOM 2391  O OD1 . ASN B 1 122 ? 112.492 64.607  116.001 1.00 30.00  ? 122 ASN B OD1 1 
ATOM 2392  N ND2 . ASN B 1 122 ? 114.690 64.511  116.427 1.00 30.00  ? 122 ASN B ND2 1 
ATOM 2393  N N   . ALA B 1 123 ? 110.750 65.307  117.912 1.00 30.00  ? 123 ALA B N   1 
ATOM 2394  C CA  . ALA B 1 123 ? 109.943 64.596  118.898 1.00 30.00  ? 123 ALA B CA  1 
ATOM 2395  C C   . ALA B 1 123 ? 110.820 64.118  120.046 1.00 30.00  ? 123 ALA B C   1 
ATOM 2396  O O   . ALA B 1 123 ? 111.109 62.923  120.161 1.00 30.00  ? 123 ALA B O   1 
ATOM 2397  C CB  . ALA B 1 123 ? 109.220 63.414  118.250 1.00 30.00  ? 123 ALA B CB  1 
ATOM 2398  N N   . SER B 1 124 ? 111.234 65.046  120.904 1.00 30.00  ? 124 SER B N   1 
ATOM 2399  C CA  . SER B 1 124 ? 112.324 64.827  121.840 1.00 30.00  ? 124 SER B CA  1 
ATOM 2400  C C   . SER B 1 124 ? 111.831 64.141  123.109 1.00 30.00  ? 124 SER B C   1 
ATOM 2401  O O   . SER B 1 124 ? 110.689 63.684  123.204 1.00 30.00  ? 124 SER B O   1 
ATOM 2402  C CB  . SER B 1 124 ? 112.998 66.155  122.174 1.00 30.00  ? 124 SER B CB  1 
ATOM 2403  O OG  . SER B 1 124 ? 114.010 65.980  123.152 1.00 30.00  ? 124 SER B OG  1 
ATOM 2404  N N   . THR B 1 125 ? 112.720 64.053  124.098 1.00 30.00  ? 125 THR B N   1 
ATOM 2405  C CA  . THR B 1 125 ? 112.307 63.726  125.453 1.00 30.00  ? 125 THR B CA  1 
ATOM 2406  C C   . THR B 1 125 ? 111.774 64.947  126.182 1.00 30.00  ? 125 THR B C   1 
ATOM 2407  O O   . THR B 1 125 ? 111.139 64.801  127.232 1.00 30.00  ? 125 THR B O   1 
ATOM 2408  C CB  . THR B 1 125 ? 113.478 63.131  126.228 1.00 30.00  ? 125 THR B CB  1 
ATOM 2409  O OG1 . THR B 1 125 ? 114.541 64.090  126.289 1.00 30.00  ? 125 THR B OG1 1 
ATOM 2410  C CG2 . THR B 1 125 ? 113.976 61.873  125.542 1.00 30.00  ? 125 THR B CG2 1 
ATOM 2411  N N   . ALA B 1 126 ? 112.011 66.142  125.643 1.00 30.00  ? 126 ALA B N   1 
ATOM 2412  C CA  . ALA B 1 126 ? 111.567 67.387  126.248 1.00 30.00  ? 126 ALA B CA  1 
ATOM 2413  C C   . ALA B 1 126 ? 110.251 67.888  125.687 1.00 30.00  ? 126 ALA B C   1 
ATOM 2414  O O   . ALA B 1 126 ? 110.057 69.102  125.585 1.00 30.00  ? 126 ALA B O   1 
ATOM 2415  C CB  . ALA B 1 126 ? 112.628 68.459  126.070 1.00 30.00  ? 126 ALA B CB  1 
ATOM 2416  N N   . TRP B 1 127 ? 109.366 66.982  125.289 1.00 30.00  ? 127 TRP B N   1 
ATOM 2417  C CA  . TRP B 1 127 ? 108.025 67.325  124.845 1.00 30.00  ? 127 TRP B CA  1 
ATOM 2418  C C   . TRP B 1 127 ? 106.998 66.349  125.392 1.00 30.00  ? 127 TRP B C   1 
ATOM 2419  O O   . TRP B 1 127 ? 105.798 66.537  125.170 1.00 30.00  ? 127 TRP B O   1 
ATOM 2420  C CB  . TRP B 1 127 ? 107.966 67.341  123.319 1.00 30.00  ? 127 TRP B CB  1 
ATOM 2421  C CG  . TRP B 1 127 ? 108.802 68.398  122.684 1.00 30.00  ? 127 TRP B CG  1 
ATOM 2422  C CD1 . TRP B 1 127 ? 110.132 68.324  122.410 1.00 30.00  ? 127 TRP B CD1 1 
ATOM 2423  C CD2 . TRP B 1 127 ? 108.353 69.643  122.143 1.00 30.00  ? 127 TRP B CD2 1 
ATOM 2424  N NE1 . TRP B 1 127 ? 110.553 69.469  121.786 1.00 30.00  ? 127 TRP B NE1 1 
ATOM 2425  C CE2 . TRP B 1 127 ? 109.476 70.292  121.603 1.00 30.00  ? 127 TRP B CE2 1 
ATOM 2426  C CE3 . TRP B 1 127 ? 107.115 70.277  122.079 1.00 30.00  ? 127 TRP B CE3 1 
ATOM 2427  C CZ2 . TRP B 1 127 ? 109.400 71.541  121.010 1.00 30.00  ? 127 TRP B CZ2 1 
ATOM 2428  C CZ3 . TRP B 1 127 ? 107.045 71.520  121.498 1.00 30.00  ? 127 TRP B CZ3 1 
ATOM 2429  C CH2 . TRP B 1 127 ? 108.173 72.129  120.947 1.00 30.00  ? 127 TRP B CH2 1 
ATOM 2430  N N   . ASN B 1 128 ? 107.437 65.308  126.096 1.00 30.00  ? 128 ASN B N   1 
ATOM 2431  C CA  . ASN B 1 128 ? 106.529 64.335  126.697 1.00 30.00  ? 128 ASN B CA  1 
ATOM 2432  C C   . ASN B 1 128 ? 105.914 65.010  127.912 1.00 30.00  ? 128 ASN B C   1 
ATOM 2433  O O   . ASN B 1 128 ? 106.379 64.859  129.042 1.00 30.00  ? 128 ASN B O   1 
ATOM 2434  C CB  . ASN B 1 128 ? 107.268 63.055  127.072 1.00 30.00  ? 128 ASN B CB  1 
ATOM 2435  C CG  . ASN B 1 128 ? 106.326 61.914  127.451 1.00 30.00  ? 128 ASN B CG  1 
ATOM 2436  O OD1 . ASN B 1 128 ? 105.104 62.047  127.383 1.00 30.00  ? 128 ASN B OD1 1 
ATOM 2437  N ND2 . ASN B 1 128 ? 106.899 60.787  127.859 1.00 30.00  ? 128 ASN B ND2 1 
ATOM 2438  N N   . LEU B 1 129 ? 104.851 65.770  127.673 1.00 30.00  ? 129 LEU B N   1 
ATOM 2439  C CA  . LEU B 1 129 ? 104.280 66.613  128.708 1.00 30.00  ? 129 LEU B CA  1 
ATOM 2440  C C   . LEU B 1 129 ? 102.782 66.738  128.470 1.00 30.00  ? 129 LEU B C   1 
ATOM 2441  O O   . LEU B 1 129 ? 102.221 66.117  127.564 1.00 30.00  ? 129 LEU B O   1 
ATOM 2442  C CB  . LEU B 1 129 ? 105.009 67.963  128.753 1.00 30.00  ? 129 LEU B CB  1 
ATOM 2443  C CG  . LEU B 1 129 ? 105.108 68.862  127.518 1.00 30.00  ? 129 LEU B CG  1 
ATOM 2444  C CD1 . LEU B 1 129 ? 103.967 69.847  127.445 1.00 30.00  ? 129 LEU B CD1 1 
ATOM 2445  C CD2 . LEU B 1 129 ? 106.439 69.585  127.490 1.00 30.00  ? 129 LEU B CD2 1 
ATOM 2446  N N   . SER B 1 130 ? 102.136 67.556  129.299 1.00 30.00  ? 130 SER B N   1 
ATOM 2447  C CA  . SER B 1 130 ? 100.680 67.600  129.352 1.00 30.00  ? 130 SER B CA  1 
ATOM 2448  C C   . SER B 1 130 ? 100.162 69.018  129.155 1.00 30.00  ? 130 SER B C   1 
ATOM 2449  O O   . SER B 1 130 ? 100.886 69.875  128.640 1.00 30.00  ? 130 SER B O   1 
ATOM 2450  C CB  . SER B 1 130 ? 100.165 67.009  130.668 1.00 30.00  ? 130 SER B CB  1 
ATOM 2451  O OG  . SER B 1 130 ? 100.550 67.789  131.780 1.00 30.00  ? 130 SER B OG  1 
ATOM 2452  N N   . ASN B 1 131 ? 98.890  69.239  129.504 1.00 30.00  ? 131 ASN B N   1 
ATOM 2453  C CA  . ASN B 1 131 ? 98.199  70.493  129.208 1.00 30.00  ? 131 ASN B CA  1 
ATOM 2454  C C   . ASN B 1 131 ? 98.852  71.678  129.908 1.00 30.00  ? 131 ASN B C   1 
ATOM 2455  O O   . ASN B 1 131 ? 99.216  72.672  129.272 1.00 30.00  ? 131 ASN B O   1 
ATOM 2456  C CB  . ASN B 1 131 ? 96.735  70.385  129.631 1.00 30.00  ? 131 ASN B CB  1 
ATOM 2457  C CG  . ASN B 1 131 ? 96.005  69.272  128.922 1.00 30.00  ? 131 ASN B CG  1 
ATOM 2458  O OD1 . ASN B 1 131 ? 96.239  69.010  127.746 1.00 30.00  ? 131 ASN B OD1 1 
ATOM 2459  N ND2 . ASN B 1 131 ? 95.108  68.607  129.637 1.00 30.00  ? 131 ASN B ND2 1 
ATOM 2460  N N   . THR B 1 132 ? 99.028  71.580  131.221 1.00 30.00  ? 132 THR B N   1 
ATOM 2461  C CA  . THR B 1 132 ? 99.471  72.700  132.046 1.00 30.00  ? 132 THR B CA  1 
ATOM 2462  C C   . THR B 1 132 ? 100.966 72.650  132.326 1.00 30.00  ? 132 THR B C   1 
ATOM 2463  O O   . THR B 1 132 ? 101.409 72.967  133.431 1.00 30.00  ? 132 THR B O   1 
ATOM 2464  C CB  . THR B 1 132 ? 98.680  72.730  133.346 1.00 30.00  ? 132 THR B CB  1 
ATOM 2465  O OG1 . THR B 1 132 ? 98.939  71.534  134.086 1.00 30.00  ? 132 THR B OG1 1 
ATOM 2466  C CG2 . THR B 1 132 ? 97.202  72.800  133.047 1.00 30.00  ? 132 THR B CG2 1 
ATOM 2467  N N   . ASN B 1 133 ? 101.771 72.250  131.344 1.00 30.00  ? 133 ASN B N   1 
ATOM 2468  C CA  . ASN B 1 133 ? 103.207 72.124  131.528 1.00 30.00  ? 133 ASN B CA  1 
ATOM 2469  C C   . ASN B 1 133 ? 103.973 72.836  130.422 1.00 30.00  ? 133 ASN B C   1 
ATOM 2470  O O   . ASN B 1 133 ? 103.473 73.025  129.313 1.00 30.00  ? 133 ASN B O   1 
ATOM 2471  C CB  . ASN B 1 133 ? 103.618 70.661  131.583 1.00 30.00  ? 133 ASN B CB  1 
ATOM 2472  C CG  . ASN B 1 133 ? 103.023 69.949  132.763 1.00 30.00  ? 133 ASN B CG  1 
ATOM 2473  O OD1 . ASN B 1 133 ? 102.281 68.984  132.614 1.00 30.00  ? 133 ASN B OD1 1 
ATOM 2474  N ND2 . ASN B 1 133 ? 103.321 70.443  133.955 1.00 30.00  ? 133 ASN B ND2 1 
ATOM 2475  N N   . PHE B 1 134 ? 105.210 73.218  130.736 1.00 30.00  ? 134 PHE B N   1 
ATOM 2476  C CA  . PHE B 1 134 ? 106.079 73.869  129.771 1.00 30.00  ? 134 PHE B CA  1 
ATOM 2477  C C   . PHE B 1 134 ? 107.486 73.291  129.855 1.00 30.00  ? 134 PHE B C   1 
ATOM 2478  O O   . PHE B 1 134 ? 108.037 73.113  130.942 1.00 30.00  ? 134 PHE B O   1 
ATOM 2479  C CB  . PHE B 1 134 ? 106.098 75.399  129.962 1.00 30.00  ? 134 PHE B CB  1 
ATOM 2480  C CG  . PHE B 1 134 ? 106.619 75.865  131.298 1.00 30.00  ? 134 PHE B CG  1 
ATOM 2481  C CD1 . PHE B 1 134 ? 105.770 75.999  132.378 1.00 30.00  ? 134 PHE B CD1 1 
ATOM 2482  C CD2 . PHE B 1 134 ? 107.944 76.236  131.453 1.00 30.00  ? 134 PHE B CD2 1 
ATOM 2483  C CE1 . PHE B 1 134 ? 106.242 76.454  133.593 1.00 30.00  ? 134 PHE B CE1 1 
ATOM 2484  C CE2 . PHE B 1 134 ? 108.418 76.683  132.665 1.00 30.00  ? 134 PHE B CE2 1 
ATOM 2485  C CZ  . PHE B 1 134 ? 107.567 76.790  133.734 1.00 30.00  ? 134 PHE B CZ  1 
ATOM 2486  N N   . GLY B 1 135 ? 108.060 72.983  128.688 1.00 30.00  ? 135 GLY B N   1 
ATOM 2487  C CA  . GLY B 1 135 ? 109.428 72.525  128.600 1.00 30.00  ? 135 GLY B CA  1 
ATOM 2488  C C   . GLY B 1 135 ? 110.390 73.691  128.720 1.00 30.00  ? 135 GLY B C   1 
ATOM 2489  O O   . GLY B 1 135 ? 110.024 74.832  128.478 1.00 30.00  ? 135 GLY B O   1 
ATOM 2490  N N   . ILE B 1 136 ? 111.630 73.397  129.112 1.00 30.00  ? 136 ILE B N   1 
ATOM 2491  C CA  . ILE B 1 136 ? 112.521 74.451  129.583 1.00 30.00  ? 136 ILE B CA  1 
ATOM 2492  C C   . ILE B 1 136 ? 113.891 74.387  128.887 1.00 30.00  ? 136 ILE B C   1 
ATOM 2493  O O   . ILE B 1 136 ? 114.921 74.741  129.477 1.00 30.00  ? 136 ILE B O   1 
ATOM 2494  C CB  . ILE B 1 136 ? 112.572 74.386  131.132 1.00 30.00  ? 136 ILE B CB  1 
ATOM 2495  C CG1 . ILE B 1 136 ? 112.990 75.719  131.751 1.00 30.00  ? 136 ILE B CG1 1 
ATOM 2496  C CG2 . ILE B 1 136 ? 113.350 73.176  131.670 1.00 30.00  ? 136 ILE B CG2 1 
ATOM 2497  C CD1 . ILE B 1 136 ? 112.012 76.792  131.443 1.00 30.00  ? 136 ILE B CD1 1 
ATOM 2498  N N   . ILE B 1 137 ? 113.904 73.973  127.606 1.00 30.00  ? 137 ILE B N   1 
ATOM 2499  C CA  . ILE B 1 137 ? 115.149 73.611  126.915 1.00 30.00  ? 137 ILE B CA  1 
ATOM 2500  C C   . ILE B 1 137 ? 116.094 74.801  126.830 1.00 30.00  ? 137 ILE B C   1 
ATOM 2501  O O   . ILE B 1 137 ? 115.686 75.932  126.545 1.00 30.00  ? 137 ILE B O   1 
ATOM 2502  C CB  . ILE B 1 137 ? 114.843 72.991  125.537 1.00 30.00  ? 137 ILE B CB  1 
ATOM 2503  C CG1 . ILE B 1 137 ? 114.212 73.948  124.526 1.00 30.00  ? 137 ILE B CG1 1 
ATOM 2504  C CG2 . ILE B 1 137 ? 113.892 71.870  125.701 1.00 30.00  ? 137 ILE B CG2 1 
ATOM 2505  C CD1 . ILE B 1 137 ? 115.193 74.523  123.518 1.00 30.00  ? 137 ILE B CD1 1 
ATOM 2506  N N   . VAL B 1 138 ? 117.353 74.563  127.176 1.00 30.00  ? 138 VAL B N   1 
ATOM 2507  C CA  . VAL B 1 138 ? 118.244 75.618  127.632 1.00 30.00  ? 138 VAL B CA  1 
ATOM 2508  C C   . VAL B 1 138 ? 119.381 75.779  126.636 1.00 30.00  ? 138 VAL B C   1 
ATOM 2509  O O   . VAL B 1 138 ? 119.797 74.819  125.979 1.00 30.00  ? 138 VAL B O   1 
ATOM 2510  C CB  . VAL B 1 138 ? 118.751 75.324  129.065 1.00 30.00  ? 138 VAL B CB  1 
ATOM 2511  C CG1 . VAL B 1 138 ? 119.666 74.111  129.115 1.00 30.00  ? 138 VAL B CG1 1 
ATOM 2512  C CG2 . VAL B 1 138 ? 119.398 76.545  129.703 1.00 30.00  ? 138 VAL B CG2 1 
ATOM 2513  N N   . LEU B 1 139 ? 119.824 77.018  126.472 1.00 30.00  ? 139 LEU B N   1 
ATOM 2514  C CA  . LEU B 1 139 ? 120.956 77.365  125.638 1.00 30.00  ? 139 LEU B CA  1 
ATOM 2515  C C   . LEU B 1 139 ? 121.646 78.570  126.258 1.00 30.00  ? 139 LEU B C   1 
ATOM 2516  O O   . LEU B 1 139 ? 120.996 79.419  126.872 1.00 30.00  ? 139 LEU B O   1 
ATOM 2517  C CB  . LEU B 1 139 ? 120.501 77.609  124.187 1.00 30.00  ? 139 LEU B CB  1 
ATOM 2518  C CG  . LEU B 1 139 ? 119.340 78.556  123.854 1.00 30.00  ? 139 LEU B CG  1 
ATOM 2519  C CD1 . LEU B 1 139 ? 119.772 79.995  123.669 1.00 30.00  ? 139 LEU B CD1 1 
ATOM 2520  C CD2 . LEU B 1 139 ? 118.589 78.065  122.625 1.00 30.00  ? 139 LEU B CD2 1 
ATOM 2521  N N   . GLN B 1 140 ? 122.975 78.603  126.121 1.00 30.00  ? 140 GLN B N   1 
ATOM 2522  C CA  . GLN B 1 140 ? 123.858 79.613  126.716 1.00 30.00  ? 140 GLN B CA  1 
ATOM 2523  C C   . GLN B 1 140 ? 123.697 79.654  128.242 1.00 30.00  ? 140 GLN B C   1 
ATOM 2524  O O   . GLN B 1 140 ? 123.147 80.586  128.824 1.00 30.00  ? 140 GLN B O   1 
ATOM 2525  C CB  . GLN B 1 140 ? 123.639 80.999  126.088 1.00 30.00  ? 140 GLN B CB  1 
ATOM 2526  C CG  . GLN B 1 140 ? 124.654 82.065  126.496 1.00 30.00  ? 140 GLN B CG  1 
ATOM 2527  C CD  . GLN B 1 140 ? 124.278 83.430  125.999 1.00 30.00  ? 140 GLN B CD  1 
ATOM 2528  O OE1 . GLN B 1 140 ? 123.285 83.597  125.298 1.00 30.00  ? 140 GLN B OE1 1 
ATOM 2529  N NE2 . GLN B 1 140 ? 125.039 84.427  126.405 1.00 30.00  ? 140 GLN B NE2 1 
ATOM 2530  N N   . ASP B 1 141 ? 124.134 78.577  128.883 1.00 30.00  ? 141 ASP B N   1 
ATOM 2531  C CA  . ASP B 1 141 ? 124.218 78.543  130.336 1.00 30.00  ? 141 ASP B CA  1 
ATOM 2532  C C   . ASP B 1 141 ? 125.608 78.981  130.777 1.00 30.00  ? 141 ASP B C   1 
ATOM 2533  O O   . ASP B 1 141 ? 126.617 78.419  130.343 1.00 30.00  ? 141 ASP B O   1 
ATOM 2534  C CB  . ASP B 1 141 ? 123.852 77.163  130.892 1.00 30.00  ? 141 ASP B CB  1 
ATOM 2535  C CG  . ASP B 1 141 ? 124.584 76.034  130.204 1.00 30.00  ? 141 ASP B CG  1 
ATOM 2536  O OD1 . ASP B 1 141 ? 125.225 76.269  129.159 1.00 30.00  ? 141 ASP B OD1 1 
ATOM 2537  O OD2 . ASP B 1 141 ? 124.515 74.898  130.716 1.00 30.00  ? 141 ASP B OD2 1 
ATOM 2538  N N   . ALA B 1 142 ? 125.656 80.007  131.624 1.00 30.00  ? 142 ALA B N   1 
ATOM 2539  C CA  . ALA B 1 142 ? 126.936 80.570  132.034 1.00 30.00  ? 142 ALA B CA  1 
ATOM 2540  C C   . ALA B 1 142 ? 127.614 79.698  133.083 1.00 30.00  ? 142 ALA B C   1 
ATOM 2541  O O   . ALA B 1 142 ? 128.697 79.154  132.846 1.00 30.00  ? 142 ALA B O   1 
ATOM 2542  C CB  . ALA B 1 142 ? 126.736 81.992  132.562 1.00 30.00  ? 142 ALA B CB  1 
ATOM 2543  N N   . ASP B 1 143 ? 126.987 79.550  134.247 1.00 30.00  ? 143 ASP B N   1 
ATOM 2544  C CA  . ASP B 1 143 ? 127.518 78.743  135.340 1.00 30.00  ? 143 ASP B CA  1 
ATOM 2545  C C   . ASP B 1 143 ? 126.792 77.409  135.450 1.00 30.00  ? 143 ASP B C   1 
ATOM 2546  O O   . ASP B 1 143 ? 126.738 76.811  136.528 1.00 30.00  ? 143 ASP B O   1 
ATOM 2547  C CB  . ASP B 1 143 ? 127.435 79.495  136.665 1.00 30.00  ? 143 ASP B CB  1 
ATOM 2548  C CG  . ASP B 1 143 ? 128.404 80.652  136.738 1.00 30.00  ? 143 ASP B CG  1 
ATOM 2549  O OD1 . ASP B 1 143 ? 129.464 80.579  136.084 1.00 30.00  ? 143 ASP B OD1 1 
ATOM 2550  O OD2 . ASP B 1 143 ? 128.110 81.631  137.456 1.00 30.00  ? 143 ASP B OD2 1 
ATOM 2551  N N   . ASN B 1 144 ? 126.245 76.945  134.319 1.00 30.00  ? 144 ASN B N   1 
ATOM 2552  C CA  . ASN B 1 144 ? 125.437 75.725  134.215 1.00 30.00  ? 144 ASN B CA  1 
ATOM 2553  C C   . ASN B 1 144 ? 124.263 75.761  135.193 1.00 30.00  ? 144 ASN B C   1 
ATOM 2554  O O   . ASN B 1 144 ? 123.964 74.787  135.883 1.00 30.00  ? 144 ASN B O   1 
ATOM 2555  C CB  . ASN B 1 144 ? 126.294 74.472  134.412 1.00 30.00  ? 144 ASN B CB  1 
ATOM 2556  C CG  . ASN B 1 144 ? 127.338 74.309  133.329 1.00 30.00  ? 144 ASN B CG  1 
ATOM 2557  O OD1 . ASN B 1 144 ? 127.073 74.552  132.155 1.00 30.00  ? 144 ASN B OD1 1 
ATOM 2558  N ND2 . ASN B 1 144 ? 128.537 73.904  133.721 1.00 30.00  ? 144 ASN B ND2 1 
ATOM 2559  N N   . SER B 1 145 ? 123.596 76.913  135.246 1.00 30.00  ? 145 SER B N   1 
ATOM 2560  C CA  . SER B 1 145 ? 122.630 77.200  136.296 1.00 30.00  ? 145 SER B CA  1 
ATOM 2561  C C   . SER B 1 145 ? 121.232 76.674  136.009 1.00 30.00  ? 145 SER B C   1 
ATOM 2562  O O   . SER B 1 145 ? 120.292 77.080  136.699 1.00 30.00  ? 145 SER B O   1 
ATOM 2563  C CB  . SER B 1 145 ? 122.565 78.708  136.540 1.00 30.00  ? 145 SER B CB  1 
ATOM 2564  O OG  . SER B 1 145 ? 122.115 79.388  135.386 1.00 30.00  ? 145 SER B OG  1 
ATOM 2565  N N   . VAL B 1 146 ? 121.056 75.800  135.019 1.00 30.00  ? 146 VAL B N   1 
ATOM 2566  C CA  . VAL B 1 146 ? 119.769 75.135  134.820 1.00 30.00  ? 146 VAL B CA  1 
ATOM 2567  C C   . VAL B 1 146 ? 119.994 73.628  134.885 1.00 30.00  ? 146 VAL B C   1 
ATOM 2568  O O   . VAL B 1 146 ? 120.392 73.000  133.898 1.00 30.00  ? 146 VAL B O   1 
ATOM 2569  C CB  . VAL B 1 146 ? 119.099 75.550  133.494 1.00 30.00  ? 146 VAL B CB  1 
ATOM 2570  C CG1 . VAL B 1 146 ? 117.766 74.835  133.321 1.00 30.00  ? 146 VAL B CG1 1 
ATOM 2571  C CG2 . VAL B 1 146 ? 118.891 77.054  133.437 1.00 30.00  ? 146 VAL B CG2 1 
ATOM 2572  N N   . ASP B 1 147 ? 119.778 73.048  136.058 1.00 30.00  ? 147 ASP B N   1 
ATOM 2573  C CA  . ASP B 1 147 ? 119.957 71.624  136.282 1.00 30.00  ? 147 ASP B CA  1 
ATOM 2574  C C   . ASP B 1 147 ? 118.631 70.950  136.599 1.00 30.00  ? 147 ASP B C   1 
ATOM 2575  O O   . ASP B 1 147 ? 117.555 71.534  136.460 1.00 30.00  ? 147 ASP B O   1 
ATOM 2576  C CB  . ASP B 1 147 ? 120.956 71.370  137.409 1.00 30.00  ? 147 ASP B CB  1 
ATOM 2577  C CG  . ASP B 1 147 ? 122.375 71.661  136.997 1.00 30.00  ? 147 ASP B CG  1 
ATOM 2578  O OD1 . ASP B 1 147 ? 122.677 71.527  135.794 1.00 30.00  ? 147 ASP B OD1 1 
ATOM 2579  O OD2 . ASP B 1 147 ? 123.191 72.011  137.874 1.00 30.00  ? 147 ASP B OD2 1 
ATOM 2580  N N   . GLN B 1 148 ? 118.730 69.683  136.996 1.00 30.00  ? 148 GLN B N   1 
ATOM 2581  C CA  . GLN B 1 148 ? 117.573 68.951  137.489 1.00 30.00  ? 148 GLN B CA  1 
ATOM 2582  C C   . GLN B 1 148 ? 117.065 69.591  138.774 1.00 30.00  ? 148 GLN B C   1 
ATOM 2583  O O   . GLN B 1 148 ? 117.854 70.008  139.628 1.00 30.00  ? 148 GLN B O   1 
ATOM 2584  C CB  . GLN B 1 148 ? 117.933 67.482  137.715 1.00 30.00  ? 148 GLN B CB  1 
ATOM 2585  C CG  . GLN B 1 148 ? 116.765 66.597  138.113 1.00 30.00  ? 148 GLN B CG  1 
ATOM 2586  C CD  . GLN B 1 148 ? 115.707 66.498  137.034 1.00 30.00  ? 148 GLN B CD  1 
ATOM 2587  O OE1 . GLN B 1 148 ? 116.017 66.456  135.843 1.00 30.00  ? 148 GLN B OE1 1 
ATOM 2588  N NE2 . GLN B 1 148 ? 114.448 66.441  137.447 1.00 30.00  ? 148 GLN B NE2 1 
ATOM 2589  N N   . ASN B 1 149 ? 115.740 69.761  138.841 1.00 30.00  ? 149 ASN B N   1 
ATOM 2590  C CA  . ASN B 1 149 ? 114.959 70.256  139.976 1.00 30.00  ? 149 ASN B CA  1 
ATOM 2591  C C   . ASN B 1 149 ? 115.186 71.731  140.302 1.00 30.00  ? 149 ASN B C   1 
ATOM 2592  O O   . ASN B 1 149 ? 114.520 72.263  141.193 1.00 30.00  ? 149 ASN B O   1 
ATOM 2593  C CB  . ASN B 1 149 ? 115.224 69.434  141.246 1.00 30.00  ? 149 ASN B CB  1 
ATOM 2594  C CG  . ASN B 1 149 ? 114.992 67.954  141.049 1.00 30.00  ? 149 ASN B CG  1 
ATOM 2595  O OD1 . ASN B 1 149 ? 115.906 67.148  141.210 1.00 30.00  ? 149 ASN B OD1 1 
ATOM 2596  N ND2 . ASN B 1 149 ? 113.772 67.587  140.688 1.00 30.00  ? 149 ASN B ND2 1 
ATOM 2597  N N   . TYR B 1 150 ? 116.102 72.412  139.615 1.00 30.00  ? 150 TYR B N   1 
ATOM 2598  C CA  . TYR B 1 150 ? 116.434 73.806  139.926 1.00 30.00  ? 150 TYR B CA  1 
ATOM 2599  C C   . TYR B 1 150 ? 116.764 74.585  138.661 1.00 30.00  ? 150 TYR B C   1 
ATOM 2600  O O   . TYR B 1 150 ? 117.934 74.759  138.308 1.00 30.00  ? 150 TYR B O   1 
ATOM 2601  C CB  . TYR B 1 150 ? 117.603 73.877  140.913 1.00 30.00  ? 150 TYR B CB  1 
ATOM 2602  C CG  . TYR B 1 150 ? 117.287 73.343  142.286 1.00 30.00  ? 150 TYR B CG  1 
ATOM 2603  C CD1 . TYR B 1 150 ? 116.609 74.122  143.212 1.00 30.00  ? 150 TYR B CD1 1 
ATOM 2604  C CD2 . TYR B 1 150 ? 117.657 72.058  142.651 1.00 30.00  ? 150 TYR B CD2 1 
ATOM 2605  C CE1 . TYR B 1 150 ? 116.310 73.640  144.465 1.00 30.00  ? 150 TYR B CE1 1 
ATOM 2606  C CE2 . TYR B 1 150 ? 117.360 71.564  143.901 1.00 30.00  ? 150 TYR B CE2 1 
ATOM 2607  C CZ  . TYR B 1 150 ? 116.686 72.361  144.804 1.00 30.00  ? 150 TYR B CZ  1 
ATOM 2608  O OH  . TYR B 1 150 ? 116.389 71.877  146.056 1.00 30.00  ? 150 TYR B OH  1 
ATOM 2609  N N   . PRO B 1 151 ? 115.755 75.079  137.952 1.00 118.75 ? 151 PRO B N   1 
ATOM 2610  C CA  . PRO B 1 151 ? 116.042 76.056  136.900 1.00 118.46 ? 151 PRO B CA  1 
ATOM 2611  C C   . PRO B 1 151 ? 116.175 77.454  137.479 1.00 119.90 ? 151 PRO B C   1 
ATOM 2612  O O   . PRO B 1 151 ? 115.181 78.026  137.934 1.00 131.05 ? 151 PRO B O   1 
ATOM 2613  C CB  . PRO B 1 151 ? 114.824 75.950  135.975 1.00 30.00  ? 151 PRO B CB  1 
ATOM 2614  C CG  . PRO B 1 151 ? 114.159 74.672  136.343 1.00 30.00  ? 151 PRO B CG  1 
ATOM 2615  C CD  . PRO B 1 151 ? 114.395 74.539  137.807 1.00 30.00  ? 151 PRO B CD  1 
ATOM 2616  N N   . THR B 1 152 ? 117.382 78.014  137.481 1.00 103.12 ? 152 THR B N   1 
ATOM 2617  C CA  . THR B 1 152 ? 117.626 79.364  137.977 1.00 94.10  ? 152 THR B CA  1 
ATOM 2618  C C   . THR B 1 152 ? 118.239 80.189  136.858 1.00 104.71 ? 152 THR B C   1 
ATOM 2619  O O   . THR B 1 152 ? 119.189 79.745  136.208 1.00 113.36 ? 152 THR B O   1 
ATOM 2620  C CB  . THR B 1 152 ? 118.557 79.354  139.188 1.00 30.00  ? 152 THR B CB  1 
ATOM 2621  O OG1 . THR B 1 152 ? 119.822 78.803  138.804 1.00 30.00  ? 152 THR B OG1 1 
ATOM 2622  C CG2 . THR B 1 152 ? 117.968 78.522  140.316 1.00 30.00  ? 152 THR B CG2 1 
ATOM 2623  N N   . LEU B 1 153 ? 117.699 81.380  136.633 1.00 105.17 ? 153 LEU B N   1 
ATOM 2624  C CA  . LEU B 1 153 ? 118.208 82.245  135.579 1.00 86.31  ? 153 LEU B CA  1 
ATOM 2625  C C   . LEU B 1 153 ? 119.035 83.393  136.140 1.00 100.45 ? 153 LEU B C   1 
ATOM 2626  O O   . LEU B 1 153 ? 118.578 84.175  136.976 1.00 121.22 ? 153 LEU B O   1 
ATOM 2627  C CB  . LEU B 1 153 ? 117.060 82.779  134.727 1.00 85.43  ? 153 LEU B CB  1 
ATOM 2628  C CG  . LEU B 1 153 ? 116.804 82.049  133.414 1.00 104.80 ? 153 LEU B CG  1 
ATOM 2629  C CD1 . LEU B 1 153 ? 116.644 80.571  133.595 1.00 109.08 ? 153 LEU B CD1 1 
ATOM 2630  C CD2 . LEU B 1 153 ? 115.535 82.603  132.823 1.00 104.18 ? 153 LEU B CD2 1 
ATOM 2631  N N   . ASN B 1 154 ? 120.267 83.489  135.650 1.00 92.73  ? 154 ASN B N   1 
ATOM 2632  C CA  . ASN B 1 154 ? 121.208 84.527  136.041 1.00 102.94 ? 154 ASN B CA  1 
ATOM 2633  C C   . ASN B 1 154 ? 121.386 85.507  134.891 1.00 103.88 ? 154 ASN B C   1 
ATOM 2634  O O   . ASN B 1 154 ? 120.697 85.386  133.876 1.00 114.48 ? 154 ASN B O   1 
ATOM 2635  C CB  . ASN B 1 154 ? 122.524 83.881  136.480 1.00 108.28 ? 154 ASN B CB  1 
ATOM 2636  C CG  . ASN B 1 154 ? 123.024 82.830  135.499 1.00 136.92 ? 154 ASN B CG  1 
ATOM 2637  O OD1 . ASN B 1 154 ? 122.479 82.662  134.413 1.00 143.53 ? 154 ASN B OD1 1 
ATOM 2638  N ND2 . ASN B 1 154 ? 124.048 82.092  135.902 1.00 139.78 ? 154 ASN B ND2 1 
ATOM 2639  N N   . LYS B 1 155 ? 122.280 86.481  135.036 1.00 95.21  ? 155 LYS B N   1 
ATOM 2640  C CA  . LYS B 1 155 ? 122.435 87.498  134.004 1.00 95.36  ? 155 LYS B CA  1 
ATOM 2641  C C   . LYS B 1 155 ? 123.092 86.921  132.750 1.00 115.83 ? 155 LYS B C   1 
ATOM 2642  O O   . LYS B 1 155 ? 124.119 86.239  132.802 1.00 123.08 ? 155 LYS B O   1 
ATOM 2643  C CB  . LYS B 1 155 ? 123.220 88.700  134.546 1.00 30.00  ? 155 LYS B CB  1 
ATOM 2644  C CG  . LYS B 1 155 ? 124.615 88.414  135.089 1.00 30.00  ? 155 LYS B CG  1 
ATOM 2645  C CD  . LYS B 1 155 ? 125.284 89.679  135.590 1.00 30.00  ? 155 LYS B CD  1 
ATOM 2646  C CE  . LYS B 1 155 ? 124.639 90.166  136.875 1.00 30.00  ? 155 LYS B CE  1 
ATOM 2647  N NZ  . LYS B 1 155 ? 125.361 91.336  137.442 1.00 30.00  ? 155 LYS B NZ  1 
ATOM 2648  N N   . GLY B 1 156 ? 122.457 87.173  131.612 1.00 120.22 ? 156 GLY B N   1 
ATOM 2649  C CA  . GLY B 1 156 ? 122.923 86.608  130.362 1.00 108.72 ? 156 GLY B CA  1 
ATOM 2650  C C   . GLY B 1 156 ? 122.701 85.118  130.248 1.00 114.31 ? 156 GLY B C   1 
ATOM 2651  O O   . GLY B 1 156 ? 123.670 84.351  130.245 1.00 129.66 ? 156 GLY B O   1 
ATOM 2652  N N   . ASP B 1 157 ? 121.446 84.685  130.167 1.00 108.95 ? 157 ASP B N   1 
ATOM 2653  C CA  . ASP B 1 157 ? 121.107 83.271  130.043 1.00 110.20 ? 157 ASP B CA  1 
ATOM 2654  C C   . ASP B 1 157 ? 119.757 83.208  129.344 1.00 98.60  ? 157 ASP B C   1 
ATOM 2655  O O   . ASP B 1 157 ? 118.784 83.789  129.826 1.00 104.60 ? 157 ASP B O   1 
ATOM 2656  C CB  . ASP B 1 157 ? 121.079 82.603  131.420 1.00 30.00  ? 157 ASP B CB  1 
ATOM 2657  C CG  . ASP B 1 157 ? 120.998 81.083  131.357 1.00 30.00  ? 157 ASP B CG  1 
ATOM 2658  O OD1 . ASP B 1 157 ? 120.737 80.504  130.285 1.00 30.00  ? 157 ASP B OD1 1 
ATOM 2659  O OD2 . ASP B 1 157 ? 121.239 80.451  132.405 1.00 30.00  ? 157 ASP B OD2 1 
ATOM 2660  N N   . ILE B 1 158 ? 119.694 82.511  128.215 1.00 93.46  ? 158 ILE B N   1 
ATOM 2661  C CA  . ILE B 1 158 ? 118.522 82.526  127.349 1.00 94.83  ? 158 ILE B CA  1 
ATOM 2662  C C   . ILE B 1 158 ? 117.887 81.145  127.384 1.00 87.24  ? 158 ILE B C   1 
ATOM 2663  O O   . ILE B 1 158 ? 118.284 80.247  126.637 1.00 105.72 ? 158 ILE B O   1 
ATOM 2664  C CB  . ILE B 1 158 ? 118.888 82.919  125.915 1.00 30.00  ? 158 ILE B CB  1 
ATOM 2665  C CG1 . ILE B 1 158 ? 119.607 84.259  125.903 1.00 30.00  ? 158 ILE B CG1 1 
ATOM 2666  C CG2 . ILE B 1 158 ? 117.641 83.046  125.067 1.00 30.00  ? 158 ILE B CG2 1 
ATOM 2667  C CD1 . ILE B 1 158 ? 120.200 84.592  124.565 1.00 30.00  ? 158 ILE B CD1 1 
ATOM 2668  N N   . VAL B 1 159 ? 116.890 80.969  128.235 1.00 72.04  ? 159 VAL B N   1 
ATOM 2669  C CA  . VAL B 1 159 ? 116.166 79.715  128.310 1.00 85.77  ? 159 VAL B CA  1 
ATOM 2670  C C   . VAL B 1 159 ? 115.058 79.773  127.267 1.00 98.46  ? 159 VAL B C   1 
ATOM 2671  O O   . VAL B 1 159 ? 114.640 80.846  126.829 1.00 103.95 ? 159 VAL B O   1 
ATOM 2672  C CB  . VAL B 1 159 ? 115.621 79.471  129.736 1.00 96.17  ? 159 VAL B CB  1 
ATOM 2673  C CG1 . VAL B 1 159 ? 114.442 80.368  130.041 1.00 92.70  ? 159 VAL B CG1 1 
ATOM 2674  C CG2 . VAL B 1 159 ? 115.309 78.013  129.982 1.00 104.55 ? 159 VAL B CG2 1 
ATOM 2675  N N   . VAL B 1 160 ? 114.621 78.609  126.808 1.00 95.14  ? 160 VAL B N   1 
ATOM 2676  C CA  . VAL B 1 160 ? 113.494 78.524  125.893 1.00 101.45 ? 160 VAL B CA  1 
ATOM 2677  C C   . VAL B 1 160 ? 112.379 77.799  126.619 1.00 102.27 ? 160 VAL B C   1 
ATOM 2678  O O   . VAL B 1 160 ? 112.409 76.570  126.752 1.00 103.82 ? 160 VAL B O   1 
ATOM 2679  C CB  . VAL B 1 160 ? 113.854 77.809  124.590 1.00 30.00  ? 160 VAL B CB  1 
ATOM 2680  C CG1 . VAL B 1 160 ? 112.646 77.732  123.675 1.00 30.00  ? 160 VAL B CG1 1 
ATOM 2681  C CG2 . VAL B 1 160 ? 115.006 78.506  123.919 1.00 30.00  ? 160 VAL B CG2 1 
ATOM 2682  N N   . ILE B 1 161 ? 111.414 78.560  127.119 1.00 90.95  ? 161 ILE B N   1 
ATOM 2683  C CA  . ILE B 1 161 ? 110.189 77.979  127.645 1.00 81.94  ? 161 ILE B CA  1 
ATOM 2684  C C   . ILE B 1 161 ? 109.433 77.360  126.481 1.00 79.66  ? 161 ILE B C   1 
ATOM 2685  O O   . ILE B 1 161 ? 109.243 77.997  125.442 1.00 99.72  ? 161 ILE B O   1 
ATOM 2686  C CB  . ILE B 1 161 ? 109.351 79.025  128.389 1.00 30.00  ? 161 ILE B CB  1 
ATOM 2687  C CG1 . ILE B 1 161 ? 110.063 79.410  129.680 1.00 30.00  ? 161 ILE B CG1 1 
ATOM 2688  C CG2 . ILE B 1 161 ? 107.959 78.520  128.665 1.00 30.00  ? 161 ILE B CG2 1 
ATOM 2689  C CD1 . ILE B 1 161 ? 109.372 80.455  130.479 1.00 30.00  ? 161 ILE B CD1 1 
ATOM 2690  N N   . THR B 1 162 ? 109.063 76.095  126.626 1.00 81.25  ? 162 THR B N   1 
ATOM 2691  C CA  . THR B 1 162 ? 108.522 75.315  125.528 1.00 79.19  ? 162 THR B CA  1 
ATOM 2692  C C   . THR B 1 162 ? 107.110 74.861  125.860 1.00 81.11  ? 162 THR B C   1 
ATOM 2693  O O   . THR B 1 162 ? 106.922 73.914  126.627 1.00 116.53 ? 162 THR B O   1 
ATOM 2694  C CB  . THR B 1 162 ? 109.422 74.115  125.271 1.00 105.99 ? 162 THR B CB  1 
ATOM 2695  O OG1 . THR B 1 162 ? 110.745 74.574  124.986 1.00 101.14 ? 162 THR B OG1 1 
ATOM 2696  C CG2 . THR B 1 162 ? 108.927 73.337  124.118 1.00 102.00 ? 162 THR B CG2 1 
ATOM 2697  N N   . VAL B 1 163 ? 106.122 75.527  125.272 1.00 74.05  ? 163 VAL B N   1 
ATOM 2698  C CA  . VAL B 1 163 ? 104.722 75.318  125.615 1.00 59.01  ? 163 VAL B CA  1 
ATOM 2699  C C   . VAL B 1 163 ? 104.066 74.531  124.497 1.00 74.94  ? 163 VAL B C   1 
ATOM 2700  O O   . VAL B 1 163 ? 103.926 75.039  123.380 1.00 100.06 ? 163 VAL B O   1 
ATOM 2701  C CB  . VAL B 1 163 ? 103.977 76.642  125.834 1.00 30.00  ? 163 VAL B CB  1 
ATOM 2702  C CG1 . VAL B 1 163 ? 102.516 76.373  126.103 1.00 30.00  ? 163 VAL B CG1 1 
ATOM 2703  C CG2 . VAL B 1 163 ? 104.595 77.414  126.976 1.00 30.00  ? 163 VAL B CG2 1 
ATOM 2704  N N   . LYS B 1 164 ? 103.651 73.306  124.794 1.00 74.88  ? 164 LYS B N   1 
ATOM 2705  C CA  . LYS B 1 164 ? 102.865 72.542  123.841 1.00 83.69  ? 164 LYS B CA  1 
ATOM 2706  C C   . LYS B 1 164 ? 101.416 72.995  123.907 1.00 106.81 ? 164 LYS B C   1 
ATOM 2707  O O   . LYS B 1 164 ? 100.842 73.132  124.990 1.00 129.13 ? 164 LYS B O   1 
ATOM 2708  C CB  . LYS B 1 164 ? 102.968 71.046  124.121 1.00 30.00  ? 164 LYS B CB  1 
ATOM 2709  C CG  . LYS B 1 164 ? 102.274 70.187  123.093 1.00 30.00  ? 164 LYS B CG  1 
ATOM 2710  C CD  . LYS B 1 164 ? 102.475 68.727  123.397 1.00 30.00  ? 164 LYS B CD  1 
ATOM 2711  C CE  . LYS B 1 164 ? 101.760 67.861  122.388 1.00 30.00  ? 164 LYS B CE  1 
ATOM 2712  N NZ  . LYS B 1 164 ? 101.950 66.411  122.676 1.00 30.00  ? 164 LYS B NZ  1 
ATOM 2713  N N   . VAL B 1 165 ? 100.831 73.250  122.741 1.00 100.36 ? 165 VAL B N   1 
ATOM 2714  C CA  . VAL B 1 165 ? 99.523  73.882  122.686 1.00 103.79 ? 165 VAL B CA  1 
ATOM 2715  C C   . VAL B 1 165 ? 98.525  72.994  121.959 1.00 97.79  ? 165 VAL B C   1 
ATOM 2716  O O   . VAL B 1 165 ? 97.521  72.567  122.537 1.00 106.74 ? 165 VAL B O   1 
ATOM 2717  C CB  . VAL B 1 165 ? 99.613  75.256  121.998 1.00 30.00  ? 165 VAL B CB  1 
ATOM 2718  C CG1 . VAL B 1 165 ? 98.252  75.874  121.892 1.00 30.00  ? 165 VAL B CG1 1 
ATOM 2719  C CG2 . VAL B 1 165 ? 100.558 76.175  122.733 1.00 30.00  ? 165 VAL B CG2 1 
ATOM 2720  N N   . GLY B 1 166 ? 98.788  72.728  120.683 1.00 79.70  ? 166 GLY B N   1 
ATOM 2721  C CA  . GLY B 1 166 ? 97.751  72.272  119.779 1.00 92.16  ? 166 GLY B CA  1 
ATOM 2722  C C   . GLY B 1 166 ? 97.331  70.825  119.679 1.00 91.30  ? 166 GLY B C   1 
ATOM 2723  O O   . GLY B 1 166 ? 96.196  70.489  120.028 1.00 97.71  ? 166 GLY B O   1 
ATOM 2724  N N   . GLU B 1 167 ? 98.223  69.959  119.203 1.00 104.44 ? 167 GLU B N   1 
ATOM 2725  C CA  . GLU B 1 167 ? 97.792  68.683  118.648 1.00 121.81 ? 167 GLU B CA  1 
ATOM 2726  C C   . GLU B 1 167 ? 97.425  67.699  119.754 1.00 118.30 ? 167 GLU B C   1 
ATOM 2727  O O   . GLU B 1 167 ? 98.169  67.523  120.724 1.00 118.15 ? 167 GLU B O   1 
ATOM 2728  C CB  . GLU B 1 167 ? 98.864  68.120  117.707 1.00 30.00  ? 167 GLU B CB  1 
ATOM 2729  C CG  . GLU B 1 167 ? 100.259 67.882  118.277 1.00 30.00  ? 167 GLU B CG  1 
ATOM 2730  C CD  . GLU B 1 167 ? 100.445 66.477  118.808 1.00 30.00  ? 167 GLU B CD  1 
ATOM 2731  O OE1 . GLU B 1 167 ? 99.629  65.598  118.465 1.00 30.00  ? 167 GLU B OE1 1 
ATOM 2732  O OE2 . GLU B 1 167 ? 101.423 66.242  119.544 1.00 30.00  ? 167 GLU B OE2 1 
ATOM 2733  N N   . GLY B 1 168 ? 96.243  67.099  119.622 1.00 30.00  ? 168 GLY B N   1 
ATOM 2734  C CA  . GLY B 1 168 ? 95.704  66.223  120.641 1.00 30.00  ? 168 GLY B CA  1 
ATOM 2735  C C   . GLY B 1 168 ? 95.355  66.975  121.906 1.00 30.00  ? 168 GLY B C   1 
ATOM 2736  O O   . GLY B 1 168 ? 94.406  67.764  121.930 1.00 30.00  ? 168 GLY B O   1 
ATOM 2737  N N   . ASN B 1 169 ? 96.120  66.738  122.965 1.00 30.00  ? 169 ASN B N   1 
ATOM 2738  C CA  . ASN B 1 169 ? 95.970  67.497  124.194 1.00 30.00  ? 169 ASN B CA  1 
ATOM 2739  C C   . ASN B 1 169 ? 96.750  68.799  124.116 1.00 30.00  ? 169 ASN B C   1 
ATOM 2740  O O   . ASN B 1 169 ? 97.384  69.107  123.104 1.00 30.00  ? 169 ASN B O   1 
ATOM 2741  C CB  . ASN B 1 169 ? 96.422  66.669  125.401 1.00 30.00  ? 169 ASN B CB  1 
ATOM 2742  C CG  . ASN B 1 169 ? 97.852  66.139  125.278 1.00 30.00  ? 169 ASN B CG  1 
ATOM 2743  O OD1 . ASN B 1 169 ? 98.580  66.432  124.329 1.00 30.00  ? 169 ASN B OD1 1 
ATOM 2744  N ND2 . ASN B 1 169 ? 98.254  65.342  126.259 1.00 30.00  ? 169 ASN B ND2 1 
ATOM 2745  N N   . GLY B 1 170 ? 96.705  69.563  125.197 1.00 30.00  ? 170 GLY B N   1 
ATOM 2746  C CA  . GLY B 1 170 ? 97.528  70.750  125.268 1.00 30.00  ? 170 GLY B CA  1 
ATOM 2747  C C   . GLY B 1 170 ? 96.814  71.862  125.997 1.00 30.00  ? 170 GLY B C   1 
ATOM 2748  O O   . GLY B 1 170 ? 95.809  71.644  126.677 1.00 30.00  ? 170 GLY B O   1 
ATOM 2749  N N   . VAL B 1 171 ? 97.372  73.064  125.853 1.00 30.00  ? 171 VAL B N   1 
ATOM 2750  C CA  . VAL B 1 171 ? 96.769  74.247  126.453 1.00 30.00  ? 171 VAL B CA  1 
ATOM 2751  C C   . VAL B 1 171 ? 95.428  74.538  125.802 1.00 30.00  ? 171 VAL B C   1 
ATOM 2752  O O   . VAL B 1 171 ? 94.435  74.824  126.482 1.00 30.00  ? 171 VAL B O   1 
ATOM 2753  C CB  . VAL B 1 171 ? 97.728  75.445  126.332 1.00 30.00  ? 171 VAL B CB  1 
ATOM 2754  C CG1 . VAL B 1 171 ? 97.089  76.698  126.869 1.00 30.00  ? 171 VAL B CG1 1 
ATOM 2755  C CG2 . VAL B 1 171 ? 99.026  75.157  127.065 1.00 30.00  ? 171 VAL B CG2 1 
ATOM 2756  N N   . PHE B 1 172 ? 95.369  74.429  124.483 1.00 30.00  ? 172 PHE B N   1 
ATOM 2757  C CA  . PHE B 1 172 ? 94.167  74.717  123.723 1.00 30.00  ? 172 PHE B CA  1 
ATOM 2758  C C   . PHE B 1 172 ? 93.727  73.460  122.991 1.00 30.00  ? 172 PHE B C   1 
ATOM 2759  O O   . PHE B 1 172 ? 94.554  72.637  122.591 1.00 30.00  ? 172 PHE B O   1 
ATOM 2760  C CB  . PHE B 1 172 ? 94.418  75.838  122.717 1.00 30.00  ? 172 PHE B CB  1 
ATOM 2761  C CG  . PHE B 1 172 ? 94.742  77.160  123.344 1.00 30.00  ? 172 PHE B CG  1 
ATOM 2762  C CD1 . PHE B 1 172 ? 94.294  77.481  124.610 1.00 30.00  ? 172 PHE B CD1 1 
ATOM 2763  C CD2 . PHE B 1 172 ? 95.548  78.062  122.679 1.00 30.00  ? 172 PHE B CD2 1 
ATOM 2764  C CE1 . PHE B 1 172 ? 94.617  78.689  125.174 1.00 30.00  ? 172 PHE B CE1 1 
ATOM 2765  C CE2 . PHE B 1 172 ? 95.876  79.261  123.249 1.00 30.00  ? 172 PHE B CE2 1 
ATOM 2766  C CZ  . PHE B 1 172 ? 95.417  79.573  124.491 1.00 30.00  ? 172 PHE B CZ  1 
ATOM 2767  N N   . GLY B 1 173 ? 92.416  73.311  122.824 1.00 90.87  ? 173 GLY B N   1 
ATOM 2768  C CA  . GLY B 1 173 ? 91.895  72.266  121.969 1.00 106.12 ? 173 GLY B CA  1 
ATOM 2769  C C   . GLY B 1 173 ? 92.210  72.599  120.527 1.00 110.53 ? 173 GLY B C   1 
ATOM 2770  O O   . GLY B 1 173 ? 91.723  73.615  120.003 1.00 115.60 ? 173 GLY B O   1 
ATOM 2771  N N   . LYS B 1 174 ? 93.084  71.801  119.898 1.00 97.87  ? 174 LYS B N   1 
ATOM 2772  C CA  . LYS B 1 174 ? 93.617  71.929  118.538 1.00 80.02  ? 174 LYS B CA  1 
ATOM 2773  C C   . LYS B 1 174 ? 94.538  73.140  118.353 1.00 94.77  ? 174 LYS B C   1 
ATOM 2774  O O   . LYS B 1 174 ? 95.088  73.324  117.265 1.00 96.54  ? 174 LYS B O   1 
ATOM 2775  C CB  . LYS B 1 174 ? 92.508  71.952  117.467 1.00 30.00  ? 174 LYS B CB  1 
ATOM 2776  C CG  . LYS B 1 174 ? 91.576  70.747  117.482 1.00 30.00  ? 174 LYS B CG  1 
ATOM 2777  C CD  . LYS B 1 174 ? 92.290  69.455  117.130 1.00 30.00  ? 174 LYS B CD  1 
ATOM 2778  C CE  . LYS B 1 174 ? 92.724  69.438  115.670 1.00 30.00  ? 174 LYS B CE  1 
ATOM 2779  N NZ  . LYS B 1 174 ? 91.566  69.462  114.733 1.00 30.00  ? 174 LYS B NZ  1 
ATOM 2780  N N   . GLY B 1 175 ? 94.738  73.964  119.382 1.00 111.68 ? 175 GLY B N   1 
ATOM 2781  C CA  . GLY B 1 175 ? 95.625  75.110  119.289 1.00 81.48  ? 175 GLY B CA  1 
ATOM 2782  C C   . GLY B 1 175 ? 95.060  76.281  118.511 1.00 95.21  ? 175 GLY B C   1 
ATOM 2783  O O   . GLY B 1 175 ? 93.984  76.224  117.922 1.00 97.91  ? 175 GLY B O   1 
ATOM 2784  N N   . ILE B 1 176 ? 95.833  77.362  118.517 1.00 83.15  ? 176 ILE B N   1 
ATOM 2785  C CA  . ILE B 1 176 ? 95.420  78.637  117.936 1.00 78.96  ? 176 ILE B CA  1 
ATOM 2786  C C   . ILE B 1 176 ? 95.289  78.558  116.418 1.00 94.93  ? 176 ILE B C   1 
ATOM 2787  O O   . ILE B 1 176 ? 96.213  78.119  115.723 1.00 88.90  ? 176 ILE B O   1 
ATOM 2788  C CB  . ILE B 1 176 ? 96.365  79.771  118.372 1.00 30.00  ? 176 ILE B CB  1 
ATOM 2789  C CG1 . ILE B 1 176 ? 97.833  79.373  118.230 1.00 30.00  ? 176 ILE B CG1 1 
ATOM 2790  C CG2 . ILE B 1 176 ? 96.083  80.188  119.787 1.00 30.00  ? 176 ILE B CG2 1 
ATOM 2791  C CD1 . ILE B 1 176 ? 98.800  80.505  118.506 1.00 30.00  ? 176 ILE B CD1 1 
ATOM 2792  N N   . PRO B 1 177 ? 94.130  78.916  115.878 1.00 104.13 ? 177 PRO B N   1 
ATOM 2793  C CA  . PRO B 1 177 ? 93.982  79.061  114.434 1.00 102.32 ? 177 PRO B CA  1 
ATOM 2794  C C   . PRO B 1 177 ? 94.573  80.384  113.981 1.00 111.82 ? 177 PRO B C   1 
ATOM 2795  O O   . PRO B 1 177 ? 94.935  81.213  114.828 1.00 109.13 ? 177 PRO B O   1 
ATOM 2796  C CB  . PRO B 1 177 ? 92.455  79.021  114.246 1.00 30.00  ? 177 PRO B CB  1 
ATOM 2797  C CG  . PRO B 1 177 ? 91.917  79.532  115.508 1.00 30.00  ? 177 PRO B CG  1 
ATOM 2798  C CD  . PRO B 1 177 ? 92.843  79.050  116.578 1.00 30.00  ? 177 PRO B CD  1 
ATOM 2799  N N   . PRO B 1 178 ? 94.726  80.618  112.673 1.00 116.59 ? 178 PRO B N   1 
ATOM 2800  C CA  . PRO B 1 178 ? 95.170  81.938  112.214 1.00 103.53 ? 178 PRO B CA  1 
ATOM 2801  C C   . PRO B 1 178 ? 94.146  83.018  112.509 1.00 98.48  ? 178 PRO B C   1 
ATOM 2802  O O   . PRO B 1 178 ? 92.973  82.748  112.774 1.00 99.69  ? 178 PRO B O   1 
ATOM 2803  C CB  . PRO B 1 178 ? 95.348  81.759  110.705 1.00 30.00  ? 178 PRO B CB  1 
ATOM 2804  C CG  . PRO B 1 178 ? 94.549  80.576  110.360 1.00 30.00  ? 178 PRO B CG  1 
ATOM 2805  C CD  . PRO B 1 178 ? 94.659  79.673  111.542 1.00 30.00  ? 178 PRO B CD  1 
ATOM 2806  N N   . ARG B 1 179 ? 94.642  84.260  112.467 1.00 103.48 ? 179 ARG B N   1 
ATOM 2807  C CA  . ARG B 1 179 ? 93.851  85.487  112.584 1.00 103.58 ? 179 ARG B CA  1 
ATOM 2808  C C   . ARG B 1 179 ? 93.126  85.532  113.933 1.00 107.40 ? 179 ARG B C   1 
ATOM 2809  O O   . ARG B 1 179 ? 91.898  85.517  114.028 1.00 119.87 ? 179 ARG B O   1 
ATOM 2810  C CB  . ARG B 1 179 ? 92.901  85.614  111.383 1.00 30.00  ? 179 ARG B CB  1 
ATOM 2811  C CG  . ARG B 1 179 ? 92.169  86.930  111.179 1.00 30.00  ? 179 ARG B CG  1 
ATOM 2812  C CD  . ARG B 1 179 ? 91.368  86.874  109.883 1.00 30.00  ? 179 ARG B CD  1 
ATOM 2813  N NE  . ARG B 1 179 ? 90.374  85.801  109.890 1.00 30.00  ? 179 ARG B NE  1 
ATOM 2814  C CZ  . ARG B 1 179 ? 90.431  84.719  109.117 1.00 30.00  ? 179 ARG B CZ  1 
ATOM 2815  N NH1 . ARG B 1 179 ? 91.441  84.558  108.273 1.00 30.00  ? 179 ARG B NH1 1 
ATOM 2816  N NH2 . ARG B 1 179 ? 89.484  83.793  109.194 1.00 30.00  ? 179 ARG B NH2 1 
ATOM 2817  N N   . THR B 1 180 ? 93.929  85.527  114.992 1.00 92.25  ? 180 THR B N   1 
ATOM 2818  C CA  . THR B 1 180 ? 93.413  85.613  116.348 1.00 103.08 ? 180 THR B CA  1 
ATOM 2819  C C   . THR B 1 180 ? 94.419  86.347  117.208 1.00 94.35  ? 180 THR B C   1 
ATOM 2820  O O   . THR B 1 180 ? 95.556  86.585  116.796 1.00 104.26 ? 180 THR B O   1 
ATOM 2821  C CB  . THR B 1 180 ? 93.147  84.243  116.973 1.00 30.00  ? 180 THR B CB  1 
ATOM 2822  O OG1 . THR B 1 180 ? 92.521  84.423  118.249 1.00 30.00  ? 180 THR B OG1 1 
ATOM 2823  C CG2 . THR B 1 180 ? 94.449  83.496  117.181 1.00 30.00  ? 180 THR B CG2 1 
ATOM 2824  N N   . LYS B 1 181 ? 93.994  86.695  118.413 1.00 87.17  ? 181 LYS B N   1 
ATOM 2825  C CA  . LYS B 1 181 ? 94.892  87.265  119.400 1.00 109.98 ? 181 LYS B CA  1 
ATOM 2826  C C   . LYS B 1 181 ? 95.102  86.244  120.508 1.00 103.75 ? 181 LYS B C   1 
ATOM 2827  O O   . LYS B 1 181 ? 94.165  85.549  120.911 1.00 108.59 ? 181 LYS B O   1 
ATOM 2828  C CB  . LYS B 1 181 ? 94.350  88.580  119.956 1.00 30.00  ? 181 LYS B CB  1 
ATOM 2829  C CG  . LYS B 1 181 ? 95.348  89.342  120.798 1.00 30.00  ? 181 LYS B CG  1 
ATOM 2830  C CD  . LYS B 1 181 ? 94.766  90.651  121.261 1.00 30.00  ? 181 LYS B CD  1 
ATOM 2831  C CE  . LYS B 1 181 ? 94.596  91.594  120.090 1.00 30.00  ? 181 LYS B CE  1 
ATOM 2832  N NZ  . LYS B 1 181 ? 95.909  91.970  119.509 1.00 30.00  ? 181 LYS B NZ  1 
ATOM 2833  N N   . ILE B 1 182 ? 96.343  86.139  120.959 1.00 87.71  ? 182 ILE B N   1 
ATOM 2834  C CA  . ILE B 1 182 ? 96.808  85.185  121.955 1.00 85.86  ? 182 ILE B CA  1 
ATOM 2835  C C   . ILE B 1 182 ? 97.733  85.950  122.888 1.00 85.66  ? 182 ILE B C   1 
ATOM 2836  O O   . ILE B 1 182 ? 98.858  86.312  122.526 1.00 101.40 ? 182 ILE B O   1 
ATOM 2837  C CB  . ILE B 1 182 ? 97.451  83.962  121.261 1.00 30.00  ? 182 ILE B CB  1 
ATOM 2838  C CG1 . ILE B 1 182 ? 98.396  83.147  122.151 1.00 30.00  ? 182 ILE B CG1 1 
ATOM 2839  C CG2 . ILE B 1 182 ? 97.969  84.296  119.896 1.00 30.00  ? 182 ILE B CG2 1 
ATOM 2840  C CD1 . ILE B 1 182 ? 97.746  82.324  123.139 1.00 30.00  ? 182 ILE B CD1 1 
ATOM 2841  N N   . THR B 1 183 ? 97.221  86.258  124.074 1.00 68.96  ? 183 THR B N   1 
ATOM 2842  C CA  . THR B 1 183 ? 97.769  87.254  124.980 1.00 83.69  ? 183 THR B CA  1 
ATOM 2843  C C   . THR B 1 183 ? 98.137  86.568  126.289 1.00 82.58  ? 183 THR B C   1 
ATOM 2844  O O   . THR B 1 183 ? 97.498  85.592  126.684 1.00 95.81  ? 183 THR B O   1 
ATOM 2845  C CB  . THR B 1 183 ? 96.720  88.369  125.218 1.00 30.00  ? 183 THR B CB  1 
ATOM 2846  O OG1 . THR B 1 183 ? 96.265  88.862  123.954 1.00 30.00  ? 183 THR B OG1 1 
ATOM 2847  C CG2 . THR B 1 183 ? 97.280  89.547  126.005 1.00 30.00  ? 183 THR B CG2 1 
ATOM 2848  N N   . GLY B 1 184 ? 99.174  87.053  126.952 1.00 79.97  ? 184 GLY B N   1 
ATOM 2849  C CA  . GLY B 1 184 ? 99.478  86.559  128.272 1.00 78.59  ? 184 GLY B CA  1 
ATOM 2850  C C   . GLY B 1 184 ? 100.511 87.393  128.977 1.00 88.15  ? 184 GLY B C   1 
ATOM 2851  O O   . GLY B 1 184 ? 100.797 88.522  128.580 1.00 103.22 ? 184 GLY B O   1 
ATOM 2852  N N   . LYS B 1 185 ? 101.099 86.806  130.017 1.00 86.13  ? 185 LYS B N   1 
ATOM 2853  C CA  . LYS B 1 185 ? 102.199 87.429  130.736 1.00 94.37  ? 185 LYS B CA  1 
ATOM 2854  C C   . LYS B 1 185 ? 102.994 86.344  131.445 1.00 83.41  ? 185 LYS B C   1 
ATOM 2855  O O   . LYS B 1 185 ? 102.436 85.348  131.908 1.00 95.27  ? 185 LYS B O   1 
ATOM 2856  C CB  . LYS B 1 185 ? 101.703 88.487  131.731 1.00 30.00  ? 185 LYS B CB  1 
ATOM 2857  C CG  . LYS B 1 185 ? 100.806 87.969  132.835 1.00 30.00  ? 185 LYS B CG  1 
ATOM 2858  C CD  . LYS B 1 185 ? 100.310 89.101  133.705 1.00 30.00  ? 185 LYS B CD  1 
ATOM 2859  C CE  . LYS B 1 185 ? 101.438 89.669  134.526 1.00 30.00  ? 185 LYS B CE  1 
ATOM 2860  N NZ  . LYS B 1 185 ? 100.987 90.727  135.461 1.00 30.00  ? 185 LYS B NZ  1 
ATOM 2861  N N   . VAL B 1 186 ? 104.305 86.536  131.502 1.00 72.23  ? 186 VAL B N   1 
ATOM 2862  C CA  . VAL B 1 186 ? 105.213 85.588  132.133 1.00 76.48  ? 186 VAL B CA  1 
ATOM 2863  C C   . VAL B 1 186 ? 105.655 86.209  133.448 1.00 91.96  ? 186 VAL B C   1 
ATOM 2864  O O   . VAL B 1 186 ? 106.587 87.022  133.477 1.00 98.46  ? 186 VAL B O   1 
ATOM 2865  C CB  . VAL B 1 186 ? 106.414 85.263  131.234 1.00 30.00  ? 186 VAL B CB  1 
ATOM 2866  C CG1 . VAL B 1 186 ? 107.325 84.243  131.892 1.00 30.00  ? 186 VAL B CG1 1 
ATOM 2867  C CG2 . VAL B 1 186 ? 105.942 84.764  129.891 1.00 30.00  ? 186 VAL B CG2 1 
ATOM 2868  N N   . ILE B 1 187 ? 104.985 85.857  134.534 1.00 77.25  ? 187 ILE B N   1 
ATOM 2869  C CA  . ILE B 1 187 ? 105.258 86.436  135.845 1.00 61.12  ? 187 ILE B CA  1 
ATOM 2870  C C   . ILE B 1 187 ? 106.358 85.623  136.520 1.00 80.93  ? 187 ILE B C   1 
ATOM 2871  O O   . ILE B 1 187 ? 106.328 84.389  136.450 1.00 97.89  ? 187 ILE B O   1 
ATOM 2872  C CB  . ILE B 1 187 ? 103.991 86.515  136.721 1.00 30.00  ? 187 ILE B CB  1 
ATOM 2873  C CG1 . ILE B 1 187 ? 104.309 87.123  138.090 1.00 30.00  ? 187 ILE B CG1 1 
ATOM 2874  C CG2 . ILE B 1 187 ? 103.253 85.190  136.815 1.00 30.00  ? 187 ILE B CG2 1 
ATOM 2875  C CD1 . ILE B 1 187 ? 103.090 87.473  138.907 1.00 30.00  ? 187 ILE B CD1 1 
ATOM 2876  N N   . PRO B 1 188 ? 107.363 86.257  137.089 1.00 79.27  ? 188 PRO B N   1 
ATOM 2877  C CA  . PRO B 1 188 ? 108.367 85.515  137.855 1.00 92.71  ? 188 PRO B CA  1 
ATOM 2878  C C   . PRO B 1 188 ? 107.906 85.260  139.277 1.00 106.31 ? 188 PRO B C   1 
ATOM 2879  O O   . PRO B 1 188 ? 106.753 85.536  139.621 1.00 120.75 ? 188 PRO B O   1 
ATOM 2880  C CB  . PRO B 1 188 ? 109.583 86.445  137.831 1.00 30.00  ? 188 PRO B CB  1 
ATOM 2881  C CG  . PRO B 1 188 ? 109.327 87.388  136.706 1.00 30.00  ? 188 PRO B CG  1 
ATOM 2882  C CD  . PRO B 1 188 ? 107.852 87.581  136.688 1.00 30.00  ? 188 PRO B CD  1 
ATOM 2883  N N   . GLU B 1 189 ? 108.796 84.714  140.106 1.00 104.74 ? 189 GLU B N   1 
ATOM 2884  C CA  . GLU B 1 189 ? 108.509 84.570  141.528 1.00 101.76 ? 189 GLU B CA  1 
ATOM 2885  C C   . GLU B 1 189 ? 108.341 85.931  142.191 1.00 111.14 ? 189 GLU B C   1 
ATOM 2886  O O   . GLU B 1 189 ? 107.249 86.291  142.643 1.00 104.62 ? 189 GLU B O   1 
ATOM 2887  C CB  . GLU B 1 189 ? 109.626 83.776  142.201 1.00 30.00  ? 189 GLU B CB  1 
ATOM 2888  C CG  . GLU B 1 189 ? 109.422 83.549  143.679 1.00 30.00  ? 189 GLU B CG  1 
ATOM 2889  C CD  . GLU B 1 189 ? 110.520 82.708  144.285 1.00 30.00  ? 189 GLU B CD  1 
ATOM 2890  O OE1 . GLU B 1 189 ? 111.448 82.327  143.545 1.00 30.00  ? 189 GLU B OE1 1 
ATOM 2891  O OE2 . GLU B 1 189 ? 110.455 82.424  145.498 1.00 30.00  ? 189 GLU B OE2 1 
ATOM 2892  N N   . PHE B 1 190 ? 109.412 86.716  142.229 1.00 129.13 ? 190 PHE B N   1 
ATOM 2893  C CA  . PHE B 1 190 ? 109.349 88.074  142.738 1.00 141.21 ? 190 PHE B CA  1 
ATOM 2894  C C   . PHE B 1 190 ? 109.729 89.124  141.704 1.00 124.26 ? 190 PHE B C   1 
ATOM 2895  O O   . PHE B 1 190 ? 109.757 90.312  142.039 1.00 113.63 ? 190 PHE B O   1 
ATOM 2896  C CB  . PHE B 1 190 ? 110.237 88.228  143.990 1.00 30.00  ? 190 PHE B CB  1 
ATOM 2897  C CG  . PHE B 1 190 ? 111.677 87.805  143.796 1.00 30.00  ? 190 PHE B CG  1 
ATOM 2898  C CD1 . PHE B 1 190 ? 112.627 88.687  143.290 1.00 30.00  ? 190 PHE B CD1 1 
ATOM 2899  C CD2 . PHE B 1 190 ? 112.084 86.526  144.142 1.00 30.00  ? 190 PHE B CD2 1 
ATOM 2900  C CE1 . PHE B 1 190 ? 113.943 88.292  143.117 1.00 30.00  ? 190 PHE B CE1 1 
ATOM 2901  C CE2 . PHE B 1 190 ? 113.403 86.130  143.979 1.00 30.00  ? 190 PHE B CE2 1 
ATOM 2902  C CZ  . PHE B 1 190 ? 114.330 87.013  143.466 1.00 30.00  ? 190 PHE B CZ  1 
ATOM 2903  N N   . GLY B 1 191 ? 110.008 88.730  140.467 1.00 111.32 ? 191 GLY B N   1 
ATOM 2904  C CA  . GLY B 1 191 ? 110.527 89.640  139.471 1.00 115.22 ? 191 GLY B CA  1 
ATOM 2905  C C   . GLY B 1 191 ? 109.459 90.508  138.838 1.00 110.01 ? 191 GLY B C   1 
ATOM 2906  O O   . GLY B 1 191 ? 108.315 90.586  139.285 1.00 109.59 ? 191 GLY B O   1 
ATOM 2907  N N   . ALA B 1 192 ? 109.859 91.181  137.782 1.00 108.77 ? 192 ALA B N   1 
ATOM 2908  C CA  . ALA B 1 192 ? 108.925 92.003  137.027 1.00 106.70 ? 192 ALA B CA  1 
ATOM 2909  C C   . ALA B 1 192 ? 108.340 91.189  135.885 1.00 76.53  ? 192 ALA B C   1 
ATOM 2910  O O   . ALA B 1 192 ? 109.059 90.396  135.271 1.00 78.88  ? 192 ALA B O   1 
ATOM 2911  C CB  . ALA B 1 192 ? 109.615 93.241  136.476 1.00 30.00  ? 192 ALA B CB  1 
ATOM 2912  N N   . PRO B 1 193 ? 107.057 91.344  135.570 1.00 77.98  ? 193 PRO B N   1 
ATOM 2913  C CA  . PRO B 1 193 ? 106.446 90.493  134.542 1.00 87.61  ? 193 PRO B CA  1 
ATOM 2914  C C   . PRO B 1 193 ? 106.724 91.005  133.137 1.00 84.24  ? 193 PRO B C   1 
ATOM 2915  O O   . PRO B 1 193 ? 106.540 92.186  132.841 1.00 100.83 ? 193 PRO B O   1 
ATOM 2916  C CB  . PRO B 1 193 ? 104.954 90.560  134.874 1.00 30.00  ? 193 PRO B CB  1 
ATOM 2917  C CG  . PRO B 1 193 ? 104.786 91.856  135.563 1.00 30.00  ? 193 PRO B CG  1 
ATOM 2918  C CD  . PRO B 1 193 ? 106.049 92.099  136.331 1.00 30.00  ? 193 PRO B CD  1 
ATOM 2919  N N   . GLY B 1 194 ? 107.175 90.104  132.269 1.00 86.21  ? 194 GLY B N   1 
ATOM 2920  C CA  . GLY B 1 194 ? 107.329 90.419  130.861 1.00 97.13  ? 194 GLY B CA  1 
ATOM 2921  C C   . GLY B 1 194 ? 106.162 89.862  130.068 1.00 91.83  ? 194 GLY B C   1 
ATOM 2922  O O   . GLY B 1 194 ? 105.757 88.717  130.251 1.00 103.47 ? 194 GLY B O   1 
ATOM 2923  N N   . VAL B 1 195 ? 105.642 90.679  129.179 1.00 73.79  ? 195 VAL B N   1 
ATOM 2924  C CA  . VAL B 1 195 ? 104.322 90.448  128.627 1.00 78.62  ? 195 VAL B CA  1 
ATOM 2925  C C   . VAL B 1 195 ? 104.462 89.787  127.260 1.00 87.46  ? 195 VAL B C   1 
ATOM 2926  O O   . VAL B 1 195 ? 105.540 89.754  126.664 1.00 109.43 ? 195 VAL B O   1 
ATOM 2927  C CB  . VAL B 1 195 ? 103.551 91.783  128.558 1.00 30.00  ? 195 VAL B CB  1 
ATOM 2928  C CG1 . VAL B 1 195 ? 104.004 92.596  127.372 1.00 30.00  ? 195 VAL B CG1 1 
ATOM 2929  C CG2 . VAL B 1 195 ? 102.035 91.602  128.634 1.00 30.00  ? 195 VAL B CG2 1 
ATOM 2930  N N   . ILE B 1 196 ? 103.358 89.231  126.765 1.00 80.94  ? 196 ILE B N   1 
ATOM 2931  C CA  . ILE B 1 196 ? 103.334 88.530  125.488 1.00 81.29  ? 196 ILE B CA  1 
ATOM 2932  C C   . ILE B 1 196 ? 101.972 88.689  124.816 1.00 89.24  ? 196 ILE B C   1 
ATOM 2933  O O   . ILE B 1 196 ? 100.926 88.404  125.409 1.00 98.54  ? 196 ILE B O   1 
ATOM 2934  C CB  . ILE B 1 196 ? 103.729 87.050  125.683 1.00 30.00  ? 196 ILE B CB  1 
ATOM 2935  C CG1 . ILE B 1 196 ? 103.613 86.249  124.392 1.00 30.00  ? 196 ILE B CG1 1 
ATOM 2936  C CG2 . ILE B 1 196 ? 103.001 86.389  126.836 1.00 30.00  ? 196 ILE B CG2 1 
ATOM 2937  C CD1 . ILE B 1 196 ? 104.142 84.861  124.560 1.00 30.00  ? 196 ILE B CD1 1 
ATOM 2938  N N   . GLU B 1 197 ? 101.977 89.185  123.580 1.00 100.52 ? 197 GLU B N   1 
ATOM 2939  C CA  . GLU B 1 197 ? 100.757 89.380  122.800 1.00 92.70  ? 197 GLU B CA  1 
ATOM 2940  C C   . GLU B 1 197 ? 101.099 89.215  121.331 1.00 91.79  ? 197 GLU B C   1 
ATOM 2941  O O   . GLU B 1 197 ? 101.762 90.077  120.749 1.00 115.82 ? 197 GLU B O   1 
ATOM 2942  C CB  . GLU B 1 197 ? 100.144 90.755  123.041 1.00 30.00  ? 197 GLU B CB  1 
ATOM 2943  C CG  . GLU B 1 197 ? 98.913  91.022  122.192 1.00 30.00  ? 197 GLU B CG  1 
ATOM 2944  C CD  . GLU B 1 197 ? 98.342  92.414  122.388 1.00 30.00  ? 197 GLU B CD  1 
ATOM 2945  O OE1 . GLU B 1 197 ? 98.916  93.189  123.177 1.00 30.00  ? 197 GLU B OE1 1 
ATOM 2946  O OE2 . GLU B 1 197 ? 97.321  92.737  121.746 1.00 30.00  ? 197 GLU B OE2 1 
ATOM 2947  N N   . PHE B 1 198 ? 100.620 88.142  120.723 1.00 80.89  ? 198 PHE B N   1 
ATOM 2948  C CA  . PHE B 1 198 ? 100.898 87.863  119.326 1.00 87.10  ? 198 PHE B CA  1 
ATOM 2949  C C   . PHE B 1 198 ? 99.906  88.581  118.432 1.00 99.66  ? 198 PHE B C   1 
ATOM 2950  O O   . PHE B 1 198 ? 99.070  89.358  118.899 1.00 107.35 ? 198 PHE B O   1 
ATOM 2951  C CB  . PHE B 1 198 ? 100.792 86.378  119.028 1.00 30.00  ? 198 PHE B CB  1 
ATOM 2952  C CG  . PHE B 1 198 ? 101.718 85.532  119.811 1.00 30.00  ? 198 PHE B CG  1 
ATOM 2953  C CD1 . PHE B 1 198 ? 103.020 85.365  119.415 1.00 30.00  ? 198 PHE B CD1 1 
ATOM 2954  C CD2 . PHE B 1 198 ? 101.278 84.884  120.941 1.00 30.00  ? 198 PHE B CD2 1 
ATOM 2955  C CE1 . PHE B 1 198 ? 103.864 84.569  120.128 1.00 30.00  ? 198 PHE B CE1 1 
ATOM 2956  C CE2 . PHE B 1 198 ? 102.114 84.082  121.658 1.00 30.00  ? 198 PHE B CE2 1 
ATOM 2957  C CZ  . PHE B 1 198 ? 103.406 83.926  121.248 1.00 30.00  ? 198 PHE B CZ  1 
ATOM 2958  N N   . THR B 1 199 ? 100.017 88.316  117.132 1.00 95.30  ? 199 THR B N   1 
ATOM 2959  C CA  . THR B 1 199 ? 98.938  88.606  116.201 1.00 87.27  ? 199 THR B CA  1 
ATOM 2960  C C   . THR B 1 199 ? 98.570  87.377  115.381 1.00 91.37  ? 199 THR B C   1 
ATOM 2961  O O   . THR B 1 199 ? 97.470  87.334  114.821 1.00 118.25 ? 199 THR B O   1 
ATOM 2962  C CB  . THR B 1 199 ? 99.316  89.752  115.260 1.00 30.00  ? 199 THR B CB  1 
ATOM 2963  O OG1 . THR B 1 199 ? 100.476 89.391  114.502 1.00 30.00  ? 199 THR B OG1 1 
ATOM 2964  C CG2 . THR B 1 199 ? 99.591  91.036  116.032 1.00 30.00  ? 199 THR B CG2 1 
ATOM 2965  N N   . THR B 1 200 ? 99.476  86.372  115.316 1.00 66.50  ? 200 THR B N   1 
ATOM 2966  C CA  . THR B 1 200 ? 99.353  85.101  114.598 1.00 93.24  ? 200 THR B CA  1 
ATOM 2967  C C   . THR B 1 200 ? 98.996  85.351  113.137 1.00 108.13 ? 200 THR B C   1 
ATOM 2968  O O   . THR B 1 200 ? 97.807  85.338  112.794 1.00 112.01 ? 200 THR B O   1 
ATOM 2969  C CB  . THR B 1 200 ? 98.326  84.187  115.261 1.00 30.00  ? 200 THR B CB  1 
ATOM 2970  O OG1 . THR B 1 200 ? 98.627  84.089  116.652 1.00 30.00  ? 200 THR B OG1 1 
ATOM 2971  C CG2 . THR B 1 200 ? 98.419  82.784  114.677 1.00 30.00  ? 200 THR B CG2 1 
ATOM 2972  N N   . PRO B 1 201 ? 99.987  85.675  112.295 1.00 98.08  ? 201 PRO B N   1 
ATOM 2973  C CA  . PRO B 1 201 ? 99.718  86.272  110.975 1.00 101.37 ? 201 PRO B CA  1 
ATOM 2974  C C   . PRO B 1 201 ? 98.849  85.407  110.076 1.00 96.67  ? 201 PRO B C   1 
ATOM 2975  O O   . PRO B 1 201 ? 99.088  84.211  109.909 1.00 97.22  ? 201 PRO B O   1 
ATOM 2976  C CB  . PRO B 1 201 ? 101.119 86.452  110.384 1.00 30.00  ? 201 PRO B CB  1 
ATOM 2977  C CG  . PRO B 1 201 ? 101.947 85.440  111.070 1.00 30.00  ? 201 PRO B CG  1 
ATOM 2978  C CD  . PRO B 1 201 ? 101.409 85.344  112.465 1.00 30.00  ? 201 PRO B CD  1 
ATOM 2979  N N   . SER B 1 202 ? 97.828  86.043  109.508 1.00 84.53  ? 202 SER B N   1 
ATOM 2980  C CA  . SER B 1 202 ? 96.652  85.339  109.024 1.00 96.04  ? 202 SER B CA  1 
ATOM 2981  C C   . SER B 1 202 ? 96.932  84.577  107.740 1.00 107.48 ? 202 SER B C   1 
ATOM 2982  O O   . SER B 1 202 ? 97.567  85.097  106.818 1.00 120.32 ? 202 SER B O   1 
ATOM 2983  C CB  . SER B 1 202 ? 95.516  86.325  108.789 1.00 30.00  ? 202 SER B CB  1 
ATOM 2984  O OG  . SER B 1 202 ? 95.853  87.205  107.736 1.00 30.00  ? 202 SER B OG  1 
ATOM 2985  N N   . THR B 1 203 ? 96.443  83.332  107.708 1.00 102.41 ? 203 THR B N   1 
ATOM 2986  C CA  . THR B 1 203 ? 96.426  82.439  106.547 1.00 89.41  ? 203 THR B CA  1 
ATOM 2987  C C   . THR B 1 203 ? 97.854  82.212  106.036 1.00 95.49  ? 203 THR B C   1 
ATOM 2988  O O   . THR B 1 203 ? 98.262  82.666  104.968 1.00 116.57 ? 203 THR B O   1 
ATOM 2989  C CB  . THR B 1 203 ? 95.477  82.988  105.476 1.00 30.00  ? 203 THR B CB  1 
ATOM 2990  O OG1 . THR B 1 203 ? 94.254  83.385  106.109 1.00 30.00  ? 203 THR B OG1 1 
ATOM 2991  C CG2 . THR B 1 203 ? 95.112  81.907  104.489 1.00 30.00  ? 203 THR B CG2 1 
ATOM 2992  N N   . TYR B 1 204 ? 98.615  81.532  106.883 1.00 87.34  ? 204 TYR B N   1 
ATOM 2993  C CA  . TYR B 1 204 ? 100.067 81.572  106.890 1.00 85.33  ? 204 TYR B CA  1 
ATOM 2994  C C   . TYR B 1 204 ? 100.697 80.367  106.209 1.00 90.64  ? 204 TYR B C   1 
ATOM 2995  O O   . TYR B 1 204 ? 100.023 79.456  105.725 1.00 110.75 ? 204 TYR B O   1 
ATOM 2996  C CB  . TYR B 1 204 ? 100.580 81.677  108.328 1.00 30.00  ? 204 TYR B CB  1 
ATOM 2997  C CG  . TYR B 1 204 ? 99.997  80.660  109.299 1.00 30.00  ? 204 TYR B CG  1 
ATOM 2998  C CD1 . TYR B 1 204 ? 100.513 79.382  109.404 1.00 30.00  ? 204 TYR B CD1 1 
ATOM 2999  C CD2 . TYR B 1 204 ? 98.932  80.997  110.124 1.00 30.00  ? 204 TYR B CD2 1 
ATOM 3000  C CE1 . TYR B 1 204 ? 99.982  78.472  110.293 1.00 30.00  ? 204 TYR B CE1 1 
ATOM 3001  C CE2 . TYR B 1 204 ? 98.410  80.093  111.023 1.00 30.00  ? 204 TYR B CE2 1 
ATOM 3002  C CZ  . TYR B 1 204 ? 98.930  78.835  111.099 1.00 30.00  ? 204 TYR B CZ  1 
ATOM 3003  O OH  . TYR B 1 204 ? 98.391  77.940  111.990 1.00 30.00  ? 204 TYR B OH  1 
ATOM 3004  N N   . THR B 1 205 ? 102.025 80.390  106.194 1.00 82.57  ? 205 THR B N   1 
ATOM 3005  C CA  . THR B 1 205 ? 102.881 79.302  105.754 1.00 83.12  ? 205 THR B CA  1 
ATOM 3006  C C   . THR B 1 205 ? 103.607 78.721  106.966 1.00 89.17  ? 205 THR B C   1 
ATOM 3007  O O   . THR B 1 205 ? 103.409 79.162  108.099 1.00 113.02 ? 205 THR B O   1 
ATOM 3008  C CB  . THR B 1 205 ? 103.866 79.791  104.696 1.00 30.00  ? 205 THR B CB  1 
ATOM 3009  O OG1 . THR B 1 205 ? 104.694 80.816  105.259 1.00 30.00  ? 205 THR B OG1 1 
ATOM 3010  C CG2 . THR B 1 205 ? 103.112 80.349  103.505 1.00 30.00  ? 205 THR B CG2 1 
ATOM 3011  N N   . SER B 1 206 ? 104.469 77.736  106.717 1.00 77.54  ? 206 SER B N   1 
ATOM 3012  C CA  . SER B 1 206 ? 104.989 76.906  107.795 1.00 75.49  ? 206 SER B CA  1 
ATOM 3013  C C   . SER B 1 206 ? 106.035 77.645  108.628 1.00 85.95  ? 206 SER B C   1 
ATOM 3014  O O   . SER B 1 206 ? 106.772 78.499  108.128 1.00 96.77  ? 206 SER B O   1 
ATOM 3015  C CB  . SER B 1 206 ? 105.575 75.616  107.236 1.00 30.00  ? 206 SER B CB  1 
ATOM 3016  O OG  . SER B 1 206 ? 104.573 74.852  106.595 1.00 30.00  ? 206 SER B OG  1 
ATOM 3017  N N   . GLU B 1 207 ? 106.080 77.292  109.922 1.00 92.70  ? 207 GLU B N   1 
ATOM 3018  C CA  . GLU B 1 207 ? 106.984 77.852  110.939 1.00 84.94  ? 207 GLU B CA  1 
ATOM 3019  C C   . GLU B 1 207 ? 106.784 79.369  111.061 1.00 75.08  ? 207 GLU B C   1 
ATOM 3020  O O   . GLU B 1 207 ? 107.515 80.185  110.506 1.00 99.39  ? 207 GLU B O   1 
ATOM 3021  C CB  . GLU B 1 207 ? 108.445 77.471  110.683 1.00 30.00  ? 207 GLU B CB  1 
ATOM 3022  C CG  . GLU B 1 207 ? 109.251 77.394  111.964 1.00 30.00  ? 207 GLU B CG  1 
ATOM 3023  C CD  . GLU B 1 207 ? 109.729 78.725  112.464 1.00 30.00  ? 207 GLU B CD  1 
ATOM 3024  O OE1 . GLU B 1 207 ? 110.042 79.601  111.638 1.00 30.00  ? 207 GLU B OE1 1 
ATOM 3025  O OE2 . GLU B 1 207 ? 109.778 78.903  113.694 1.00 30.00  ? 207 GLU B OE2 1 
ATOM 3026  N N   . VAL B 1 208 ? 105.722 79.713  111.784 1.00 54.53  ? 208 VAL B N   1 
ATOM 3027  C CA  . VAL B 1 208 ? 104.900 80.907  111.607 1.00 74.84  ? 208 VAL B CA  1 
ATOM 3028  C C   . VAL B 1 208 ? 105.525 82.151  112.258 1.00 90.59  ? 208 VAL B C   1 
ATOM 3029  O O   . VAL B 1 208 ? 104.881 83.202  112.317 1.00 111.15 ? 208 VAL B O   1 
ATOM 3030  C CB  . VAL B 1 208 ? 103.496 80.593  112.181 1.00 30.00  ? 208 VAL B CB  1 
ATOM 3031  C CG1 . VAL B 1 208 ? 102.375 81.506  111.665 1.00 30.00  ? 208 VAL B CG1 1 
ATOM 3032  C CG2 . VAL B 1 208 ? 103.138 79.158  111.927 1.00 30.00  ? 208 VAL B CG2 1 
ATOM 3033  N N   . ILE B 1 209 ? 106.815 82.079  112.635 1.00 82.05  ? 209 ILE B N   1 
ATOM 3034  C CA  . ILE B 1 209 ? 107.497 82.895  113.657 1.00 100.57 ? 209 ILE B CA  1 
ATOM 3035  C C   . ILE B 1 209 ? 107.119 84.375  113.716 1.00 110.18 ? 209 ILE B C   1 
ATOM 3036  O O   . ILE B 1 209 ? 107.177 85.096  112.715 1.00 121.76 ? 209 ILE B O   1 
ATOM 3037  C CB  . ILE B 1 209 ? 109.028 82.777  113.474 1.00 30.00  ? 209 ILE B CB  1 
ATOM 3038  C CG1 . ILE B 1 209 ? 109.770 83.740  114.411 1.00 30.00  ? 209 ILE B CG1 1 
ATOM 3039  C CG2 . ILE B 1 209 ? 109.449 82.936  112.009 1.00 30.00  ? 209 ILE B CG2 1 
ATOM 3040  C CD1 . ILE B 1 209 ? 111.265 83.607  114.386 1.00 30.00  ? 209 ILE B CD1 1 
ATOM 3041  N N   . GLU B 1 210 ? 106.695 84.823  114.897 1.00 30.00  ? 210 GLU B N   1 
ATOM 3042  C CA  . GLU B 1 210 ? 106.197 86.176  115.069 1.00 30.00  ? 210 GLU B CA  1 
ATOM 3043  C C   . GLU B 1 210 ? 106.643 86.680  116.432 1.00 30.00  ? 210 GLU B C   1 
ATOM 3044  O O   . GLU B 1 210 ? 106.659 85.937  117.417 1.00 30.00  ? 210 GLU B O   1 
ATOM 3045  C CB  . GLU B 1 210 ? 104.669 86.228  114.896 1.00 30.00  ? 210 GLU B CB  1 
ATOM 3046  C CG  . GLU B 1 210 ? 103.841 85.603  116.000 1.00 30.00  ? 210 GLU B CG  1 
ATOM 3047  C CD  . GLU B 1 210 ? 103.727 84.092  115.926 1.00 30.00  ? 210 GLU B CD  1 
ATOM 3048  O OE1 . GLU B 1 210 ? 104.483 83.444  115.177 1.00 30.00  ? 210 GLU B OE1 1 
ATOM 3049  O OE2 . GLU B 1 210 ? 102.876 83.537  116.646 1.00 30.00  ? 210 GLU B OE2 1 
ATOM 3050  N N   . LEU B 1 211 ? 107.056 87.937  116.466 1.00 30.00  ? 211 LEU B N   1 
ATOM 3051  C CA  . LEU B 1 211 ? 107.741 88.486  117.622 1.00 30.00  ? 211 LEU B CA  1 
ATOM 3052  C C   . LEU B 1 211 ? 106.763 88.746  118.757 1.00 30.00  ? 211 LEU B C   1 
ATOM 3053  O O   . LEU B 1 211 ? 105.611 89.128  118.535 1.00 30.00  ? 211 LEU B O   1 
ATOM 3054  C CB  . LEU B 1 211 ? 108.475 89.777  117.250 1.00 30.00  ? 211 LEU B CB  1 
ATOM 3055  C CG  . LEU B 1 211 ? 109.630 89.637  116.255 1.00 30.00  ? 211 LEU B CG  1 
ATOM 3056  C CD1 . LEU B 1 211 ? 110.169 91.005  115.865 1.00 30.00  ? 211 LEU B CD1 1 
ATOM 3057  C CD2 . LEU B 1 211 ? 110.734 88.765  116.831 1.00 30.00  ? 211 LEU B CD2 1 
ATOM 3058  N N   . GLN B 1 212 ? 107.256 88.524  119.974 1.00 30.00  ? 212 GLN B N   1 
ATOM 3059  C CA  . GLN B 1 212 ? 106.576 88.763  121.249 1.00 30.00  ? 212 GLN B CA  1 
ATOM 3060  C C   . GLN B 1 212 ? 105.219 88.069  121.369 1.00 30.00  ? 212 GLN B C   1 
ATOM 3061  O O   . GLN B 1 212 ? 104.192 88.599  120.955 1.00 30.00  ? 212 GLN B O   1 
ATOM 3062  C CB  . GLN B 1 212 ? 106.424 90.265  121.495 1.00 30.00  ? 212 GLN B CB  1 
ATOM 3063  C CG  . GLN B 1 212 ? 105.914 90.598  122.881 1.00 30.00  ? 212 GLN B CG  1 
ATOM 3064  C CD  . GLN B 1 212 ? 105.885 92.082  123.149 1.00 30.00  ? 212 GLN B CD  1 
ATOM 3065  O OE1 . GLN B 1 212 ? 106.214 92.888  122.285 1.00 30.00  ? 212 GLN B OE1 1 
ATOM 3066  N NE2 . GLN B 1 212 ? 105.494 92.452  124.357 1.00 30.00  ? 212 GLN B NE2 1 
ATOM 3067  N N   . ALA C 1 6   ? 114.985 109.189 192.830 1.00 30.00  ? 6   ALA C N   1 
ATOM 3068  C CA  . ALA C 1 6   ? 115.145 110.528 192.280 1.00 30.00  ? 6   ALA C CA  1 
ATOM 3069  C C   . ALA C 1 6   ? 115.162 110.492 190.753 1.00 30.00  ? 6   ALA C C   1 
ATOM 3070  O O   . ALA C 1 6   ? 115.702 109.568 190.146 1.00 30.00  ? 6   ALA C O   1 
ATOM 3071  C CB  . ALA C 1 6   ? 116.413 111.175 192.818 1.00 30.00  ? 6   ALA C CB  1 
ATOM 3072  N N   . VAL C 1 7   ? 114.585 111.527 190.146 1.00 176.07 ? 7   VAL C N   1 
ATOM 3073  C CA  . VAL C 1 7   ? 114.372 111.612 188.704 1.00 158.44 ? 7   VAL C CA  1 
ATOM 3074  C C   . VAL C 1 7   ? 115.646 112.175 188.072 1.00 137.52 ? 7   VAL C C   1 
ATOM 3075  O O   . VAL C 1 7   ? 115.862 112.082 186.857 1.00 139.74 ? 7   VAL C O   1 
ATOM 3076  C CB  . VAL C 1 7   ? 113.100 112.449 188.433 1.00 30.00  ? 7   VAL C CB  1 
ATOM 3077  C CG1 . VAL C 1 7   ? 112.768 112.618 186.962 1.00 30.00  ? 7   VAL C CG1 1 
ATOM 3078  C CG2 . VAL C 1 7   ? 111.922 111.788 189.114 1.00 30.00  ? 7   VAL C CG2 1 
ATOM 3079  N N   . GLY C 1 8   ? 116.563 112.653 188.912 1.00 131.64 ? 8   GLY C N   1 
ATOM 3080  C CA  . GLY C 1 8   ? 117.885 113.030 188.442 1.00 139.85 ? 8   GLY C CA  1 
ATOM 3081  C C   . GLY C 1 8   ? 118.758 111.887 187.952 1.00 132.89 ? 8   GLY C C   1 
ATOM 3082  O O   . GLY C 1 8   ? 119.832 112.142 187.401 1.00 133.27 ? 8   GLY C O   1 
ATOM 3083  N N   . ILE C 1 9   ? 118.335 110.638 188.147 1.00 131.26 ? 9   ILE C N   1 
ATOM 3084  C CA  . ILE C 1 9   ? 119.053 109.505 187.575 1.00 135.93 ? 9   ILE C CA  1 
ATOM 3085  C C   . ILE C 1 9   ? 118.389 109.064 186.275 1.00 126.64 ? 9   ILE C C   1 
ATOM 3086  O O   . ILE C 1 9   ? 119.070 108.700 185.309 1.00 121.41 ? 9   ILE C O   1 
ATOM 3087  C CB  . ILE C 1 9   ? 119.130 108.346 188.594 1.00 30.00  ? 9   ILE C CB  1 
ATOM 3088  C CG1 . ILE C 1 9   ? 119.860 108.753 189.878 1.00 30.00  ? 9   ILE C CG1 1 
ATOM 3089  C CG2 . ILE C 1 9   ? 119.839 107.135 188.016 1.00 30.00  ? 9   ILE C CG2 1 
ATOM 3090  C CD1 . ILE C 1 9   ? 118.956 109.127 191.035 1.00 30.00  ? 9   ILE C CD1 1 
ATOM 3091  N N   . GLY C 1 10  ? 117.057 109.158 186.217 1.00 116.23 ? 10  GLY C N   1 
ATOM 3092  C CA  . GLY C 1 10  ? 116.287 108.440 185.214 1.00 108.48 ? 10  GLY C CA  1 
ATOM 3093  C C   . GLY C 1 10  ? 116.458 108.934 183.792 1.00 119.42 ? 10  GLY C C   1 
ATOM 3094  O O   . GLY C 1 10  ? 116.464 108.133 182.855 1.00 124.33 ? 10  GLY C O   1 
ATOM 3095  N N   . THR C 1 11  ? 116.603 110.246 183.604 1.00 133.79 ? 11  THR C N   1 
ATOM 3096  C CA  . THR C 1 11  ? 116.777 110.764 182.251 1.00 134.97 ? 11  THR C CA  1 
ATOM 3097  C C   . THR C 1 11  ? 118.171 110.478 181.713 1.00 126.74 ? 11  THR C C   1 
ATOM 3098  O O   . THR C 1 11  ? 118.382 110.518 180.496 1.00 132.88 ? 11  THR C O   1 
ATOM 3099  C CB  . THR C 1 11  ? 116.507 112.266 182.216 1.00 30.00  ? 11  THR C CB  1 
ATOM 3100  O OG1 . THR C 1 11  ? 117.421 112.936 183.091 1.00 30.00  ? 11  THR C OG1 1 
ATOM 3101  C CG2 . THR C 1 11  ? 115.083 112.562 182.650 1.00 30.00  ? 11  THR C CG2 1 
ATOM 3102  N N   . LEU C 1 12  ? 119.130 110.195 182.596 1.00 118.09 ? 12  LEU C N   1 
ATOM 3103  C CA  . LEU C 1 12  ? 120.478 109.856 182.154 1.00 128.80 ? 12  LEU C CA  1 
ATOM 3104  C C   . LEU C 1 12  ? 120.516 108.468 181.527 1.00 127.81 ? 12  LEU C C   1 
ATOM 3105  O O   . LEU C 1 12  ? 121.218 108.240 180.536 1.00 112.49 ? 12  LEU C O   1 
ATOM 3106  C CB  . LEU C 1 12  ? 121.443 109.933 183.335 1.00 30.00  ? 12  LEU C CB  1 
ATOM 3107  C CG  . LEU C 1 12  ? 121.598 111.303 183.985 1.00 30.00  ? 12  LEU C CG  1 
ATOM 3108  C CD1 . LEU C 1 12  ? 122.454 111.195 185.228 1.00 30.00  ? 12  LEU C CD1 1 
ATOM 3109  C CD2 . LEU C 1 12  ? 122.207 112.271 182.998 1.00 30.00  ? 12  LEU C CD2 1 
ATOM 3110  N N   . ILE C 1 13  ? 119.762 107.528 182.095 1.00 134.37 ? 13  ILE C N   1 
ATOM 3111  C CA  . ILE C 1 13  ? 119.813 106.148 181.630 1.00 120.65 ? 13  ILE C CA  1 
ATOM 3112  C C   . ILE C 1 13  ? 119.029 105.993 180.333 1.00 125.25 ? 13  ILE C C   1 
ATOM 3113  O O   . ILE C 1 13  ? 119.440 105.260 179.426 1.00 127.06 ? 13  ILE C O   1 
ATOM 3114  C CB  . ILE C 1 13  ? 119.299 105.217 182.741 1.00 30.00  ? 13  ILE C CB  1 
ATOM 3115  C CG1 . ILE C 1 13  ? 120.158 105.387 183.991 1.00 30.00  ? 13  ILE C CG1 1 
ATOM 3116  C CG2 . ILE C 1 13  ? 119.338 103.768 182.306 1.00 30.00  ? 13  ILE C CG2 1 
ATOM 3117  C CD1 . ILE C 1 13  ? 119.622 104.667 185.193 1.00 30.00  ? 13  ILE C CD1 1 
ATOM 3118  N N   . VAL C 1 14  ? 117.903 106.701 180.215 1.00 120.61 ? 14  VAL C N   1 
ATOM 3119  C CA  . VAL C 1 14  ? 117.137 106.710 178.971 1.00 119.27 ? 14  VAL C CA  1 
ATOM 3120  C C   . VAL C 1 14  ? 117.925 107.409 177.865 1.00 125.86 ? 14  VAL C C   1 
ATOM 3121  O O   . VAL C 1 14  ? 117.823 107.038 176.686 1.00 127.57 ? 14  VAL C O   1 
ATOM 3122  C CB  . VAL C 1 14  ? 115.761 107.359 179.229 1.00 30.00  ? 14  VAL C CB  1 
ATOM 3123  C CG1 . VAL C 1 14  ? 114.929 107.471 177.960 1.00 30.00  ? 14  VAL C CG1 1 
ATOM 3124  C CG2 . VAL C 1 14  ? 115.003 106.554 180.270 1.00 30.00  ? 14  VAL C CG2 1 
ATOM 3125  N N   . PHE C 1 15  ? 118.755 108.393 178.229 1.00 120.93 ? 15  PHE C N   1 
ATOM 3126  C CA  . PHE C 1 15  ? 119.708 108.965 177.281 1.00 130.25 ? 15  PHE C CA  1 
ATOM 3127  C C   . PHE C 1 15  ? 120.710 107.930 176.786 1.00 137.12 ? 15  PHE C C   1 
ATOM 3128  O O   . PHE C 1 15  ? 121.086 107.940 175.611 1.00 136.10 ? 15  PHE C O   1 
ATOM 3129  C CB  . PHE C 1 15  ? 120.435 110.148 177.913 1.00 30.00  ? 15  PHE C CB  1 
ATOM 3130  C CG  . PHE C 1 15  ? 121.609 110.624 177.119 1.00 30.00  ? 15  PHE C CG  1 
ATOM 3131  C CD1 . PHE C 1 15  ? 121.433 111.233 175.887 1.00 30.00  ? 15  PHE C CD1 1 
ATOM 3132  C CD2 . PHE C 1 15  ? 122.895 110.479 177.619 1.00 30.00  ? 15  PHE C CD2 1 
ATOM 3133  C CE1 . PHE C 1 15  ? 122.522 111.670 175.157 1.00 30.00  ? 15  PHE C CE1 1 
ATOM 3134  C CE2 . PHE C 1 15  ? 123.987 110.919 176.898 1.00 30.00  ? 15  PHE C CE2 1 
ATOM 3135  C CZ  . PHE C 1 15  ? 123.802 111.518 175.664 1.00 30.00  ? 15  PHE C CZ  1 
ATOM 3136  N N   . ILE C 1 16  ? 121.146 107.022 177.662 1.00 132.37 ? 16  ILE C N   1 
ATOM 3137  C CA  . ILE C 1 16  ? 121.985 105.913 177.216 1.00 131.31 ? 16  ILE C CA  1 
ATOM 3138  C C   . ILE C 1 16  ? 121.167 104.947 176.370 1.00 126.36 ? 16  ILE C C   1 
ATOM 3139  O O   . ILE C 1 16  ? 121.675 104.363 175.404 1.00 114.96 ? 16  ILE C O   1 
ATOM 3140  C CB  . ILE C 1 16  ? 122.626 105.223 178.437 1.00 30.00  ? 16  ILE C CB  1 
ATOM 3141  C CG1 . ILE C 1 16  ? 123.461 106.226 179.226 1.00 30.00  ? 16  ILE C CG1 1 
ATOM 3142  C CG2 . ILE C 1 16  ? 123.528 104.080 178.021 1.00 30.00  ? 16  ILE C CG2 1 
ATOM 3143  C CD1 . ILE C 1 16  ? 123.930 105.703 180.558 1.00 30.00  ? 16  ILE C CD1 1 
ATOM 3144  N N   . ALA C 1 17  ? 119.877 104.810 176.680 1.00 123.07 ? 17  ALA C N   1 
ATOM 3145  C CA  . ALA C 1 17  ? 119.017 103.891 175.945 1.00 113.60 ? 17  ALA C CA  1 
ATOM 3146  C C   . ALA C 1 17  ? 118.726 104.396 174.538 1.00 122.78 ? 17  ALA C C   1 
ATOM 3147  O O   . ALA C 1 17  ? 118.791 103.631 173.571 1.00 135.51 ? 17  ALA C O   1 
ATOM 3148  C CB  . ALA C 1 17  ? 117.715 103.679 176.710 1.00 30.00  ? 17  ALA C CB  1 
ATOM 3149  N N   . MET C 1 18  ? 118.399 105.680 174.405 1.00 110.98 ? 18  MET C N   1 
ATOM 3150  C CA  . MET C 1 18  ? 117.973 106.204 173.116 1.00 128.27 ? 18  MET C CA  1 
ATOM 3151  C C   . MET C 1 18  ? 119.123 106.312 172.120 1.00 133.84 ? 18  MET C C   1 
ATOM 3152  O O   . MET C 1 18  ? 118.895 106.143 170.919 1.00 141.63 ? 18  MET C O   1 
ATOM 3153  C CB  . MET C 1 18  ? 117.294 107.562 173.317 1.00 30.00  ? 18  MET C CB  1 
ATOM 3154  C CG  . MET C 1 18  ? 116.677 108.164 172.064 1.00 30.00  ? 18  MET C CG  1 
ATOM 3155  S SD  . MET C 1 18  ? 115.794 109.701 172.347 1.00 30.00  ? 18  MET C SD  1 
ATOM 3156  C CE  . MET C 1 18  ? 115.387 110.134 170.661 1.00 30.00  ? 18  MET C CE  1 
ATOM 3157  N N   . VAL C 1 19  ? 120.350 106.549 172.595 1.00 128.57 ? 19  VAL C N   1 
ATOM 3158  C CA  . VAL C 1 19  ? 121.511 106.640 171.709 1.00 124.82 ? 19  VAL C CA  1 
ATOM 3159  C C   . VAL C 1 19  ? 121.796 105.296 171.043 1.00 121.88 ? 19  VAL C C   1 
ATOM 3160  O O   . VAL C 1 19  ? 122.116 105.240 169.848 1.00 114.40 ? 19  VAL C O   1 
ATOM 3161  C CB  . VAL C 1 19  ? 122.723 107.182 172.494 1.00 30.00  ? 19  VAL C CB  1 
ATOM 3162  C CG1 . VAL C 1 19  ? 124.020 107.032 171.719 1.00 30.00  ? 19  VAL C CG1 1 
ATOM 3163  C CG2 . VAL C 1 19  ? 122.515 108.650 172.793 1.00 30.00  ? 19  VAL C CG2 1 
ATOM 3164  N N   . LEU C 1 20  ? 121.643 104.193 171.787 1.00 123.94 ? 20  LEU C N   1 
ATOM 3165  C CA  . LEU C 1 20  ? 121.704 102.867 171.177 1.00 120.76 ? 20  LEU C CA  1 
ATOM 3166  C C   . LEU C 1 20  ? 120.574 102.654 170.180 1.00 118.82 ? 20  LEU C C   1 
ATOM 3167  O O   . LEU C 1 20  ? 120.769 101.991 169.156 1.00 128.24 ? 20  LEU C O   1 
ATOM 3168  C CB  . LEU C 1 20  ? 121.654 101.785 172.250 1.00 30.00  ? 20  LEU C CB  1 
ATOM 3169  C CG  . LEU C 1 20  ? 122.857 101.745 173.180 1.00 30.00  ? 20  LEU C CG  1 
ATOM 3170  C CD1 . LEU C 1 20  ? 122.660 100.687 174.249 1.00 30.00  ? 20  LEU C CD1 1 
ATOM 3171  C CD2 . LEU C 1 20  ? 124.112 101.486 172.373 1.00 30.00  ? 20  LEU C CD2 1 
ATOM 3172  N N   . VAL C 1 21  ? 119.395 103.214 170.461 1.00 118.89 ? 21  VAL C N   1 
ATOM 3173  C CA  . VAL C 1 21  ? 118.303 103.170 169.498 1.00 124.09 ? 21  VAL C CA  1 
ATOM 3174  C C   . VAL C 1 21  ? 118.547 104.177 168.381 1.00 132.71 ? 21  VAL C C   1 
ATOM 3175  O O   . VAL C 1 21  ? 118.185 103.932 167.223 1.00 133.89 ? 21  VAL C O   1 
ATOM 3176  C CB  . VAL C 1 21  ? 116.971 103.388 170.237 1.00 30.00  ? 21  VAL C CB  1 
ATOM 3177  C CG1 . VAL C 1 21  ? 115.790 103.421 169.286 1.00 30.00  ? 21  VAL C CG1 1 
ATOM 3178  C CG2 . VAL C 1 21  ? 116.784 102.274 171.232 1.00 30.00  ? 21  VAL C CG2 1 
ATOM 3179  N N   . ALA C 1 22  ? 119.211 105.294 168.690 1.00 119.64 ? 22  ALA C N   1 
ATOM 3180  C CA  . ALA C 1 22  ? 119.685 106.189 167.639 1.00 121.63 ? 22  ALA C CA  1 
ATOM 3181  C C   . ALA C 1 22  ? 120.742 105.513 166.780 1.00 121.50 ? 22  ALA C C   1 
ATOM 3182  O O   . ALA C 1 22  ? 120.803 105.740 165.567 1.00 124.27 ? 22  ALA C O   1 
ATOM 3183  C CB  . ALA C 1 22  ? 120.242 107.473 168.246 1.00 30.00  ? 22  ALA C CB  1 
ATOM 3184  N N   . ALA C 1 23  ? 121.579 104.676 167.395 1.00 123.64 ? 23  ALA C N   1 
ATOM 3185  C CA  . ALA C 1 23  ? 122.566 103.907 166.651 1.00 136.43 ? 23  ALA C CA  1 
ATOM 3186  C C   . ALA C 1 23  ? 121.932 102.873 165.734 1.00 124.63 ? 23  ALA C C   1 
ATOM 3187  O O   . ALA C 1 23  ? 122.324 102.786 164.569 1.00 135.97 ? 23  ALA C O   1 
ATOM 3188  C CB  . ALA C 1 23  ? 123.534 103.211 167.610 1.00 30.00  ? 23  ALA C CB  1 
ATOM 3189  N N   . VAL C 1 24  ? 120.951 102.108 166.214 1.00 119.23 ? 24  VAL C N   1 
ATOM 3190  C CA  . VAL C 1 24  ? 120.312 101.108 165.369 1.00 115.14 ? 24  VAL C CA  1 
ATOM 3191  C C   . VAL C 1 24  ? 119.298 101.725 164.414 1.00 115.95 ? 24  VAL C C   1 
ATOM 3192  O O   . VAL C 1 24  ? 118.879 101.055 163.459 1.00 121.87 ? 24  VAL C O   1 
ATOM 3193  C CB  . VAL C 1 24  ? 119.646 99.996  166.204 1.00 30.00  ? 24  VAL C CB  1 
ATOM 3194  C CG1 . VAL C 1 24  ? 120.660 99.357  167.146 1.00 30.00  ? 24  VAL C CG1 1 
ATOM 3195  C CG2 . VAL C 1 24  ? 118.444 100.520 166.945 1.00 30.00  ? 24  VAL C CG2 1 
ATOM 3196  N N   . ALA C 1 25  ? 118.888 102.975 164.640 1.00 113.08 ? 25  ALA C N   1 
ATOM 3197  C CA  . ALA C 1 25  ? 118.193 103.713 163.596 1.00 132.88 ? 25  ALA C CA  1 
ATOM 3198  C C   . ALA C 1 25  ? 119.167 104.302 162.595 1.00 125.56 ? 25  ALA C C   1 
ATOM 3199  O O   . ALA C 1 25  ? 118.735 104.840 161.572 1.00 130.11 ? 25  ALA C O   1 
ATOM 3200  C CB  . ALA C 1 25  ? 117.339 104.829 164.190 1.00 30.00  ? 25  ALA C CB  1 
ATOM 3201  N N   . ALA C 1 26  ? 120.466 104.235 162.885 1.00 112.05 ? 26  ALA C N   1 
ATOM 3202  C CA  . ALA C 1 26  ? 121.505 104.630 161.950 1.00 121.96 ? 26  ALA C CA  1 
ATOM 3203  C C   . ALA C 1 26  ? 122.265 103.448 161.374 1.00 122.57 ? 26  ALA C C   1 
ATOM 3204  O O   . ALA C 1 26  ? 122.522 103.437 160.168 1.00 124.18 ? 26  ALA C O   1 
ATOM 3205  C CB  . ALA C 1 26  ? 122.500 105.578 162.629 1.00 30.00  ? 26  ALA C CB  1 
ATOM 3206  N N   . ALA C 1 27  ? 122.607 102.447 162.193 1.00 120.74 ? 27  ALA C N   1 
ATOM 3207  C CA  . ALA C 1 27  ? 123.364 101.293 161.723 1.00 112.14 ? 27  ALA C CA  1 
ATOM 3208  C C   . ALA C 1 27  ? 122.589 100.435 160.737 1.00 126.27 ? 27  ALA C C   1 
ATOM 3209  O O   . ALA C 1 27  ? 123.211 99.729  159.939 1.00 129.46 ? 27  ALA C O   1 
ATOM 3210  C CB  . ALA C 1 27  ? 123.810 100.419 162.896 1.00 30.00  ? 27  ALA C CB  1 
ATOM 3211  N N   . VAL C 1 28  ? 121.262 100.468 160.779 1.00 128.89 ? 28  VAL C N   1 
ATOM 3212  C CA  . VAL C 1 28  ? 120.435 99.860  159.749 1.00 113.05 ? 28  VAL C CA  1 
ATOM 3213  C C   . VAL C 1 28  ? 120.278 100.781 158.550 1.00 121.90 ? 28  VAL C C   1 
ATOM 3214  O O   . VAL C 1 28  ? 120.483 100.365 157.410 1.00 122.20 ? 28  VAL C O   1 
ATOM 3215  C CB  . VAL C 1 28  ? 119.061 99.483  160.338 1.00 30.00  ? 28  VAL C CB  1 
ATOM 3216  C CG1 . VAL C 1 28  ? 118.145 98.944  159.265 1.00 30.00  ? 28  VAL C CG1 1 
ATOM 3217  C CG2 . VAL C 1 28  ? 119.238 98.471  161.425 1.00 30.00  ? 28  VAL C CG2 1 
ATOM 3218  N N   . LEU C 1 29  ? 119.951 102.045 158.816 1.00 114.96 ? 29  LEU C N   1 
ATOM 3219  C CA  . LEU C 1 29  ? 119.581 102.986 157.769 1.00 129.81 ? 29  LEU C CA  1 
ATOM 3220  C C   . LEU C 1 29  ? 120.788 103.390 156.929 1.00 140.90 ? 29  LEU C C   1 
ATOM 3221  O O   . LEU C 1 29  ? 120.630 103.796 155.773 1.00 135.21 ? 29  LEU C O   1 
ATOM 3222  C CB  . LEU C 1 29  ? 118.894 104.191 158.412 1.00 30.00  ? 29  LEU C CB  1 
ATOM 3223  C CG  . LEU C 1 29  ? 118.096 105.236 157.642 1.00 30.00  ? 29  LEU C CG  1 
ATOM 3224  C CD1 . LEU C 1 29  ? 116.986 105.717 158.540 1.00 30.00  ? 29  LEU C CD1 1 
ATOM 3225  C CD2 . LEU C 1 29  ? 118.948 106.408 157.279 1.00 30.00  ? 29  LEU C CD2 1 
ATOM 3226  N N   . ILE C 1 30  ? 121.999 103.272 157.479 1.00 133.11 ? 30  ILE C N   1 
ATOM 3227  C CA  . ILE C 1 30  ? 123.190 103.352 156.638 1.00 124.38 ? 30  ILE C CA  1 
ATOM 3228  C C   . ILE C 1 30  ? 123.364 102.062 155.846 1.00 127.80 ? 30  ILE C C   1 
ATOM 3229  O O   . ILE C 1 30  ? 123.552 102.090 154.624 1.00 124.15 ? 30  ILE C O   1 
ATOM 3230  C CB  . ILE C 1 30  ? 124.441 103.671 157.482 1.00 30.00  ? 30  ILE C CB  1 
ATOM 3231  C CG1 . ILE C 1 30  ? 124.363 105.079 158.065 1.00 30.00  ? 30  ILE C CG1 1 
ATOM 3232  C CG2 . ILE C 1 30  ? 125.708 103.545 156.654 1.00 30.00  ? 30  ILE C CG2 1 
ATOM 3233  C CD1 . ILE C 1 30  ? 125.462 105.377 159.057 1.00 30.00  ? 30  ILE C CD1 1 
ATOM 3234  N N   . GLN C 1 31  ? 123.278 100.912 156.522 1.00 132.79 ? 31  GLN C N   1 
ATOM 3235  C CA  . GLN C 1 31  ? 123.636 99.642  155.897 1.00 126.31 ? 31  GLN C CA  1 
ATOM 3236  C C   . GLN C 1 31  ? 122.594 99.194  154.875 1.00 126.39 ? 31  GLN C C   1 
ATOM 3237  O O   . GLN C 1 31  ? 122.944 98.575  153.865 1.00 134.06 ? 31  GLN C O   1 
ATOM 3238  C CB  . GLN C 1 31  ? 123.840 98.572  156.973 1.00 30.00  ? 31  GLN C CB  1 
ATOM 3239  C CG  . GLN C 1 31  ? 124.352 97.228  156.469 1.00 30.00  ? 31  GLN C CG  1 
ATOM 3240  C CD  . GLN C 1 31  ? 124.563 96.224  157.584 1.00 30.00  ? 31  GLN C CD  1 
ATOM 3241  O OE1 . GLN C 1 31  ? 124.320 96.518  158.753 1.00 30.00  ? 31  GLN C OE1 1 
ATOM 3242  N NE2 . GLN C 1 31  ? 125.008 95.026  157.226 1.00 30.00  ? 31  GLN C NE2 1 
ATOM 3243  N N   . THR C 1 32  ? 121.323 99.514  155.063 1.00 112.61 ? 32  THR C N   1 
ATOM 3244  C CA  . THR C 1 32  ? 120.370 99.158  154.013 1.00 127.34 ? 32  THR C CA  1 
ATOM 3245  C C   . THR C 1 32  ? 120.747 99.943  152.751 1.00 131.45 ? 32  THR C C   1 
ATOM 3246  O O   . THR C 1 32  ? 120.747 99.417  151.622 1.00 120.85 ? 32  THR C O   1 
ATOM 3247  C CB  . THR C 1 32  ? 118.926 99.483  154.401 1.00 30.00  ? 32  THR C CB  1 
ATOM 3248  O OG1 . THR C 1 32  ? 118.900 100.693 155.164 1.00 30.00  ? 32  THR C OG1 1 
ATOM 3249  C CG2 . THR C 1 32  ? 118.348 98.362  155.232 1.00 30.00  ? 32  THR C CG2 1 
ATOM 3250  N N   . SER C 1 33  ? 121.124 101.202 152.975 1.00 130.67 ? 33  SER C N   1 
ATOM 3251  C CA  . SER C 1 33  ? 121.516 102.129 151.921 1.00 132.42 ? 33  SER C CA  1 
ATOM 3252  C C   . SER C 1 33  ? 122.735 101.623 151.176 1.00 131.30 ? 33  SER C C   1 
ATOM 3253  O O   . SER C 1 33  ? 122.824 101.771 149.965 1.00 133.84 ? 33  SER C O   1 
ATOM 3254  C CB  . SER C 1 33  ? 121.802 103.512 152.499 1.00 30.00  ? 33  SER C CB  1 
ATOM 3255  O OG  . SER C 1 33  ? 120.607 104.148 152.907 1.00 30.00  ? 33  SER C OG  1 
ATOM 3256  N N   . GLY C 1 34  ? 123.682 101.027 151.894 1.00 129.56 ? 34  GLY C N   1 
ATOM 3257  C CA  . GLY C 1 34  ? 124.863 100.487 151.251 1.00 121.87 ? 34  GLY C CA  1 
ATOM 3258  C C   . GLY C 1 34  ? 124.475 99.385  150.281 1.00 127.99 ? 34  GLY C C   1 
ATOM 3259  O O   . GLY C 1 34  ? 124.987 99.325  149.158 1.00 136.74 ? 34  GLY C O   1 
ATOM 3260  N N   . TYR C 1 35  ? 123.543 98.525  150.695 1.00 111.57 ? 35  TYR C N   1 
ATOM 3261  C CA  . TYR C 1 35  ? 123.082 97.450  149.831 1.00 115.71 ? 35  TYR C CA  1 
ATOM 3262  C C   . TYR C 1 35  ? 122.428 98.041  148.594 1.00 122.18 ? 35  TYR C C   1 
ATOM 3263  O O   . TYR C 1 35  ? 122.693 97.607  147.462 1.00 127.53 ? 35  TYR C O   1 
ATOM 3264  C CB  . TYR C 1 35  ? 122.083 96.555  150.558 1.00 30.00  ? 35  TYR C CB  1 
ATOM 3265  C CG  . TYR C 1 35  ? 121.314 95.661  149.618 1.00 30.00  ? 35  TYR C CG  1 
ATOM 3266  C CD1 . TYR C 1 35  ? 121.887 95.217  148.437 1.00 30.00  ? 35  TYR C CD1 1 
ATOM 3267  C CD2 . TYR C 1 35  ? 120.013 95.280  149.895 1.00 30.00  ? 35  TYR C CD2 1 
ATOM 3268  C CE1 . TYR C 1 35  ? 121.193 94.405  147.566 1.00 30.00  ? 35  TYR C CE1 1 
ATOM 3269  C CE2 . TYR C 1 35  ? 119.309 94.465  149.031 1.00 30.00  ? 35  TYR C CE2 1 
ATOM 3270  C CZ  . TYR C 1 35  ? 119.905 94.032  147.868 1.00 30.00  ? 35  TYR C CZ  1 
ATOM 3271  O OH  . TYR C 1 35  ? 119.214 93.224  146.999 1.00 30.00  ? 35  TYR C OH  1 
ATOM 3272  N N   . LEU C 1 36  ? 121.614 99.075  148.787 1.00 116.21 ? 36  LEU C N   1 
ATOM 3273  C CA  . LEU C 1 36  ? 120.982 99.686  147.625 1.00 130.01 ? 36  LEU C CA  1 
ATOM 3274  C C   . LEU C 1 36  ? 122.013 100.272 146.671 1.00 123.78 ? 36  LEU C C   1 
ATOM 3275  O O   . LEU C 1 36  ? 121.888 100.120 145.461 1.00 118.51 ? 36  LEU C O   1 
ATOM 3276  C CB  . LEU C 1 36  ? 119.946 100.725 148.025 1.00 30.00  ? 36  LEU C CB  1 
ATOM 3277  C CG  . LEU C 1 36  ? 118.564 100.108 147.865 1.00 30.00  ? 36  LEU C CG  1 
ATOM 3278  C CD1 . LEU C 1 36  ? 117.467 101.134 148.093 1.00 30.00  ? 36  LEU C CD1 1 
ATOM 3279  C CD2 . LEU C 1 36  ? 118.475 99.522  146.467 1.00 30.00  ? 36  LEU C CD2 1 
ATOM 3280  N N   . GLN C 1 37  ? 123.045 100.910 147.213 1.00 123.38 ? 37  GLN C N   1 
ATOM 3281  C CA  . GLN C 1 37  ? 124.083 101.502 146.387 1.00 117.62 ? 37  GLN C CA  1 
ATOM 3282  C C   . GLN C 1 37  ? 124.774 100.426 145.579 1.00 110.58 ? 37  GLN C C   1 
ATOM 3283  O O   . GLN C 1 37  ? 124.986 100.578 144.364 1.00 111.88 ? 37  GLN C O   1 
ATOM 3284  C CB  . GLN C 1 37  ? 125.132 102.192 147.263 1.00 30.00  ? 37  GLN C CB  1 
ATOM 3285  C CG  . GLN C 1 37  ? 124.659 103.466 147.937 1.00 30.00  ? 37  GLN C CG  1 
ATOM 3286  C CD  . GLN C 1 37  ? 125.746 104.132 148.755 1.00 30.00  ? 37  GLN C CD  1 
ATOM 3287  O OE1 . GLN C 1 37  ? 126.800 103.547 148.998 1.00 30.00  ? 37  GLN C OE1 1 
ATOM 3288  N NE2 . GLN C 1 37  ? 125.496 105.363 149.185 1.00 30.00  ? 37  GLN C NE2 1 
ATOM 3289  N N   . GLN C 1 38  ? 125.085 99.310  146.230 1.00 110.77 ? 38  GLN C N   1 
ATOM 3290  C CA  . GLN C 1 38  ? 125.771 98.259  145.500 1.00 125.53 ? 38  GLN C CA  1 
ATOM 3291  C C   . GLN C 1 38  ? 124.887 97.741  144.364 1.00 131.29 ? 38  GLN C C   1 
ATOM 3292  O O   . GLN C 1 38  ? 125.347 97.627  143.225 1.00 143.08 ? 38  GLN C O   1 
ATOM 3293  C CB  . GLN C 1 38  ? 126.337 97.162  146.434 1.00 30.00  ? 38  GLN C CB  1 
ATOM 3294  C CG  . GLN C 1 38  ? 125.416 96.018  146.837 1.00 30.00  ? 38  GLN C CG  1 
ATOM 3295  C CD  . GLN C 1 38  ? 125.931 95.242  148.036 1.00 30.00  ? 38  GLN C CD  1 
ATOM 3296  O OE1 . GLN C 1 38  ? 126.591 95.799  148.914 1.00 30.00  ? 38  GLN C OE1 1 
ATOM 3297  N NE2 . GLN C 1 38  ? 125.623 93.950  148.083 1.00 30.00  ? 38  GLN C NE2 1 
ATOM 3298  N N   . LYS C 1 39  ? 123.598 97.542  144.632 1.00 115.39 ? 39  LYS C N   1 
ATOM 3299  C CA  . LYS C 1 39  ? 122.722 97.043  143.578 1.00 122.69 ? 39  LYS C CA  1 
ATOM 3300  C C   . LYS C 1 39  ? 122.610 98.037  142.425 1.00 122.92 ? 39  LYS C C   1 
ATOM 3301  O O   . LYS C 1 39  ? 122.568 97.655  141.258 1.00 119.94 ? 39  LYS C O   1 
ATOM 3302  C CB  . LYS C 1 39  ? 121.343 96.680  144.117 1.00 30.00  ? 39  LYS C CB  1 
ATOM 3303  C CG  . LYS C 1 39  ? 120.491 95.929  143.111 1.00 30.00  ? 39  LYS C CG  1 
ATOM 3304  C CD  . LYS C 1 39  ? 121.275 94.785  142.497 1.00 30.00  ? 39  LYS C CD  1 
ATOM 3305  C CE  . LYS C 1 39  ? 120.453 94.051  141.454 1.00 30.00  ? 39  LYS C CE  1 
ATOM 3306  N NZ  . LYS C 1 39  ? 120.051 94.952  140.342 1.00 30.00  ? 39  LYS C NZ  1 
ATOM 3307  N N   . SER C 1 40  ? 122.539 99.315  142.765 1.00 115.71 ? 40  SER C N   1 
ATOM 3308  C CA  . SER C 1 40  ? 122.430 100.368 141.772 1.00 125.17 ? 40  SER C CA  1 
ATOM 3309  C C   . SER C 1 40  ? 123.648 100.457 140.868 1.00 124.47 ? 40  SER C C   1 
ATOM 3310  O O   . SER C 1 40  ? 123.510 100.700 139.671 1.00 117.25 ? 40  SER C O   1 
ATOM 3311  C CB  . SER C 1 40  ? 122.175 101.715 142.441 1.00 30.00  ? 40  SER C CB  1 
ATOM 3312  O OG  . SER C 1 40  ? 123.259 102.078 143.270 1.00 30.00  ? 40  SER C OG  1 
ATOM 3313  N N   . GLN C 1 41  ? 124.840 100.254 141.427 1.00 124.77 ? 41  GLN C N   1 
ATOM 3314  C CA  . GLN C 1 41  ? 126.056 100.386 140.614 1.00 118.76 ? 41  GLN C CA  1 
ATOM 3315  C C   . GLN C 1 41  ? 126.133 99.405  139.434 1.00 112.40 ? 41  GLN C C   1 
ATOM 3316  O O   . GLN C 1 41  ? 126.541 99.764  138.328 1.00 107.21 ? 41  GLN C O   1 
ATOM 3317  C CB  . GLN C 1 41  ? 127.300 100.253 141.497 1.00 30.00  ? 41  GLN C CB  1 
ATOM 3318  C CG  . GLN C 1 41  ? 127.475 101.393 142.490 1.00 30.00  ? 41  GLN C CG  1 
ATOM 3319  C CD  . GLN C 1 41  ? 128.741 101.267 143.319 1.00 30.00  ? 41  GLN C CD  1 
ATOM 3320  O OE1 . GLN C 1 41  ? 129.610 100.442 143.032 1.00 30.00  ? 41  GLN C OE1 1 
ATOM 3321  N NE2 . GLN C 1 41  ? 128.852 102.092 144.353 1.00 30.00  ? 41  GLN C NE2 1 
ATOM 3322  N N   . ALA C 1 42  ? 125.724 98.173  139.700 1.00 117.08 ? 42  ALA C N   1 
ATOM 3323  C CA  . ALA C 1 42  ? 125.685 97.049  138.768 1.00 121.87 ? 42  ALA C CA  1 
ATOM 3324  C C   . ALA C 1 42  ? 124.628 97.281  137.696 1.00 124.60 ? 42  ALA C C   1 
ATOM 3325  O O   . ALA C 1 42  ? 124.883 97.103  136.502 1.00 129.32 ? 42  ALA C O   1 
ATOM 3326  C CB  . ALA C 1 42  ? 125.421 95.744  139.520 1.00 30.00  ? 42  ALA C CB  1 
ATOM 3327  N N   . THR C 1 43  ? 123.430 97.696  138.108 1.00 122.18 ? 43  THR C N   1 
ATOM 3328  C CA  . THR C 1 43  ? 122.404 98.080  137.149 1.00 129.90 ? 43  THR C CA  1 
ATOM 3329  C C   . THR C 1 43  ? 122.657 99.437  136.517 1.00 121.89 ? 43  THR C C   1 
ATOM 3330  O O   . THR C 1 43  ? 121.975 99.781  135.549 1.00 106.94 ? 43  THR C O   1 
ATOM 3331  C CB  . THR C 1 43  ? 121.038 98.090  137.816 1.00 30.00  ? 43  THR C CB  1 
ATOM 3332  O OG1 . THR C 1 43  ? 121.075 98.966  138.948 1.00 30.00  ? 43  THR C OG1 1 
ATOM 3333  C CG2 . THR C 1 43  ? 120.661 96.696  138.254 1.00 30.00  ? 43  THR C CG2 1 
ATOM 3334  N N   . GLY C 1 44  ? 123.588 100.223 137.044 1.00 116.35 ? 44  GLY C N   1 
ATOM 3335  C CA  . GLY C 1 44  ? 123.952 101.463 136.391 1.00 102.42 ? 44  GLY C CA  1 
ATOM 3336  C C   . GLY C 1 44  ? 124.737 101.206 135.125 1.00 107.16 ? 44  GLY C C   1 
ATOM 3337  O O   . GLY C 1 44  ? 124.454 101.785 134.073 1.00 105.71 ? 44  GLY C O   1 
ATOM 3338  N N   . ARG C 1 45  ? 125.727 100.319 135.218 1.00 121.34 ? 45  ARG C N   1 
ATOM 3339  C CA  . ARG C 1 45  ? 126.602 100.077 134.078 1.00 118.64 ? 45  ARG C CA  1 
ATOM 3340  C C   . ARG C 1 45  ? 125.972 99.110  133.086 1.00 114.49 ? 45  ARG C C   1 
ATOM 3341  O O   . ARG C 1 45  ? 126.015 99.344  131.873 1.00 119.78 ? 45  ARG C O   1 
ATOM 3342  C CB  . ARG C 1 45  ? 127.947 99.542  134.559 1.00 30.00  ? 45  ARG C CB  1 
ATOM 3343  C CG  . ARG C 1 45  ? 128.738 100.516 135.408 1.00 30.00  ? 45  ARG C CG  1 
ATOM 3344  C CD  . ARG C 1 45  ? 130.080 99.925  135.778 1.00 30.00  ? 45  ARG C CD  1 
ATOM 3345  N NE  . ARG C 1 45  ? 129.938 98.772  136.661 1.00 30.00  ? 45  ARG C NE  1 
ATOM 3346  C CZ  . ARG C 1 45  ? 130.193 97.518  136.300 1.00 30.00  ? 45  ARG C CZ  1 
ATOM 3347  N NH1 . ARG C 1 45  ? 130.597 97.253  135.066 1.00 30.00  ? 45  ARG C NH1 1 
ATOM 3348  N NH2 . ARG C 1 45  ? 130.036 96.530  137.170 1.00 30.00  ? 45  ARG C NH2 1 
ATOM 3349  N N   . GLU C 1 46  ? 125.381 98.019  133.582 1.00 110.36 ? 46  GLU C N   1 
ATOM 3350  C CA  . GLU C 1 46  ? 124.963 96.928  132.708 1.00 120.39 ? 46  GLU C CA  1 
ATOM 3351  C C   . GLU C 1 46  ? 123.761 97.296  131.854 1.00 123.08 ? 46  GLU C C   1 
ATOM 3352  O O   . GLU C 1 46  ? 123.644 96.820  130.721 1.00 126.45 ? 46  GLU C O   1 
ATOM 3353  C CB  . GLU C 1 46  ? 124.658 95.686  133.539 1.00 30.00  ? 46  GLU C CB  1 
ATOM 3354  C CG  . GLU C 1 46  ? 125.887 95.068  134.166 1.00 30.00  ? 46  GLU C CG  1 
ATOM 3355  C CD  . GLU C 1 46  ? 125.552 93.919  135.083 1.00 30.00  ? 46  GLU C CD  1 
ATOM 3356  O OE1 . GLU C 1 46  ? 124.353 93.700  135.339 1.00 30.00  ? 46  GLU C OE1 1 
ATOM 3357  O OE2 . GLU C 1 46  ? 126.485 93.235  135.550 1.00 30.00  ? 46  GLU C OE2 1 
ATOM 3358  N N   . THR C 1 47  ? 122.873 98.144  132.361 1.00 109.60 ? 47  THR C N   1 
ATOM 3359  C CA  . THR C 1 47  ? 121.700 98.525  131.590 1.00 114.97 ? 47  THR C CA  1 
ATOM 3360  C C   . THR C 1 47  ? 122.021 99.476  130.453 1.00 122.24 ? 47  THR C C   1 
ATOM 3361  O O   . THR C 1 47  ? 121.219 99.598  129.523 1.00 126.78 ? 47  THR C O   1 
ATOM 3362  C CB  . THR C 1 47  ? 120.665 99.159  132.499 1.00 30.00  ? 47  THR C CB  1 
ATOM 3363  O OG1 . THR C 1 47  ? 121.284 100.226 133.226 1.00 30.00  ? 47  THR C OG1 1 
ATOM 3364  C CG2 . THR C 1 47  ? 120.091 98.124  133.454 1.00 30.00  ? 47  THR C CG2 1 
ATOM 3365  N N   . THR C 1 48  ? 123.156 100.163 130.505 1.00 106.63 ? 48  THR C N   1 
ATOM 3366  C CA  . THR C 1 48  ? 123.639 100.807 129.295 1.00 106.27 ? 48  THR C CA  1 
ATOM 3367  C C   . THR C 1 48  ? 124.265 99.780  128.367 1.00 112.60 ? 48  THR C C   1 
ATOM 3368  O O   . THR C 1 48  ? 124.113 99.865  127.145 1.00 117.23 ? 48  THR C O   1 
ATOM 3369  C CB  . THR C 1 48  ? 124.660 101.880 129.636 1.00 30.00  ? 48  THR C CB  1 
ATOM 3370  O OG1 . THR C 1 48  ? 125.806 101.250 130.214 1.00 30.00  ? 48  THR C OG1 1 
ATOM 3371  C CG2 . THR C 1 48  ? 124.085 102.840 130.641 1.00 30.00  ? 48  THR C CG2 1 
ATOM 3372  N N   . GLN C 1 49  ? 124.959 98.794  128.940 1.00 120.76 ? 49  GLN C N   1 
ATOM 3373  C CA  . GLN C 1 49  ? 125.601 97.763  128.136 1.00 129.15 ? 49  GLN C CA  1 
ATOM 3374  C C   . GLN C 1 49  ? 124.578 96.811  127.541 1.00 124.57 ? 49  GLN C C   1 
ATOM 3375  O O   . GLN C 1 49  ? 124.816 96.239  126.473 1.00 134.69 ? 49  GLN C O   1 
ATOM 3376  C CB  . GLN C 1 49  ? 126.608 97.001  128.991 1.00 30.00  ? 49  GLN C CB  1 
ATOM 3377  C CG  . GLN C 1 49  ? 127.737 97.871  129.508 1.00 30.00  ? 49  GLN C CG  1 
ATOM 3378  C CD  . GLN C 1 49  ? 128.681 97.124  130.426 1.00 30.00  ? 49  GLN C CD  1 
ATOM 3379  O OE1 . GLN C 1 49  ? 128.494 95.940  130.703 1.00 30.00  ? 49  GLN C OE1 1 
ATOM 3380  N NE2 . GLN C 1 49  ? 129.698 97.821  130.915 1.00 30.00  ? 49  GLN C NE2 1 
ATOM 3381  N N   . GLU C 1 50  ? 123.432 96.651  128.208 1.00 118.17 ? 50  GLU C N   1 
ATOM 3382  C CA  . GLU C 1 50  ? 122.335 95.851  127.676 1.00 122.89 ? 50  GLU C CA  1 
ATOM 3383  C C   . GLU C 1 50  ? 121.743 96.464  126.415 1.00 108.02 ? 50  GLU C C   1 
ATOM 3384  O O   . GLU C 1 50  ? 121.221 95.733  125.566 1.00 108.64 ? 50  GLU C O   1 
ATOM 3385  C CB  . GLU C 1 50  ? 121.249 95.693  128.751 1.00 30.00  ? 50  GLU C CB  1 
ATOM 3386  C CG  . GLU C 1 50  ? 120.092 94.752  128.414 1.00 30.00  ? 50  GLU C CG  1 
ATOM 3387  C CD  . GLU C 1 50  ? 120.512 93.293  128.344 1.00 30.00  ? 50  GLU C CD  1 
ATOM 3388  O OE1 . GLU C 1 50  ? 121.480 92.909  129.034 1.00 30.00  ? 50  GLU C OE1 1 
ATOM 3389  O OE2 . GLU C 1 50  ? 119.877 92.527  127.591 1.00 30.00  ? 50  GLU C OE2 1 
ATOM 3390  N N   . VAL C 1 51  ? 121.846 97.778  126.248 1.00 112.66 ? 51  VAL C N   1 
ATOM 3391  C CA  . VAL C 1 51  ? 121.218 98.445  125.121 1.00 114.59 ? 51  VAL C CA  1 
ATOM 3392  C C   . VAL C 1 51  ? 122.215 98.989  124.103 1.00 112.54 ? 51  VAL C C   1 
ATOM 3393  O O   . VAL C 1 51  ? 121.871 99.062  122.914 1.00 128.80 ? 51  VAL C O   1 
ATOM 3394  C CB  . VAL C 1 51  ? 120.266 99.565  125.596 1.00 30.00  ? 51  VAL C CB  1 
ATOM 3395  C CG1 . VAL C 1 51  ? 119.189 98.977  126.486 1.00 30.00  ? 51  VAL C CG1 1 
ATOM 3396  C CG2 . VAL C 1 51  ? 121.008 100.668 126.338 1.00 30.00  ? 51  VAL C CG2 1 
ATOM 3397  N N   . ALA C 1 52  ? 123.437 99.343  124.506 1.00 30.00  ? 52  ALA C N   1 
ATOM 3398  C CA  . ALA C 1 52  ? 124.338 100.008 123.570 1.00 30.00  ? 52  ALA C CA  1 
ATOM 3399  C C   . ALA C 1 52  ? 125.068 99.003  122.694 1.00 30.00  ? 52  ALA C C   1 
ATOM 3400  O O   . ALA C 1 52  ? 125.193 99.201  121.481 1.00 30.00  ? 52  ALA C O   1 
ATOM 3401  C CB  . ALA C 1 52  ? 125.338 100.886 124.319 1.00 30.00  ? 52  ALA C CB  1 
ATOM 3402  N N   . SER C 1 53  ? 125.574 97.931  123.292 1.00 113.33 ? 53  SER C N   1 
ATOM 3403  C CA  . SER C 1 53  ? 126.294 96.925  122.530 1.00 119.89 ? 53  SER C CA  1 
ATOM 3404  C C   . SER C 1 53  ? 125.335 96.137  121.647 1.00 124.17 ? 53  SER C C   1 
ATOM 3405  O O   . SER C 1 53  ? 124.150 95.990  121.954 1.00 123.77 ? 53  SER C O   1 
ATOM 3406  C CB  . SER C 1 53  ? 127.044 95.985  123.468 1.00 135.93 ? 53  SER C CB  1 
ATOM 3407  O OG  . SER C 1 53  ? 126.147 95.255  124.282 1.00 150.89 ? 53  SER C OG  1 
ATOM 3408  N N   . GLY C 1 54  ? 125.851 95.651  120.525 1.00 126.56 ? 54  GLY C N   1 
ATOM 3409  C CA  . GLY C 1 54  ? 124.998 94.947  119.595 1.00 107.25 ? 54  GLY C CA  1 
ATOM 3410  C C   . GLY C 1 54  ? 125.651 94.535  118.294 1.00 106.60 ? 54  GLY C C   1 
ATOM 3411  O O   . GLY C 1 54  ? 126.667 95.097  117.876 1.00 103.76 ? 54  GLY C O   1 
ATOM 3412  N N   . ILE C 1 55  ? 125.032 93.560  117.639 1.00 100.38 ? 55  ILE C N   1 
ATOM 3413  C CA  . ILE C 1 55  ? 125.545 92.909  116.442 1.00 80.06  ? 55  ILE C CA  1 
ATOM 3414  C C   . ILE C 1 55  ? 124.750 93.412  115.245 1.00 98.77  ? 55  ILE C C   1 
ATOM 3415  O O   . ILE C 1 55  ? 123.535 93.602  115.347 1.00 111.05 ? 55  ILE C O   1 
ATOM 3416  C CB  . ILE C 1 55  ? 125.452 91.380  116.606 1.00 30.00  ? 55  ILE C CB  1 
ATOM 3417  C CG1 . ILE C 1 55  ? 126.525 90.895  117.578 1.00 30.00  ? 55  ILE C CG1 1 
ATOM 3418  C CG2 . ILE C 1 55  ? 125.461 90.627  115.297 1.00 30.00  ? 55  ILE C CG2 1 
ATOM 3419  C CD1 . ILE C 1 55  ? 126.439 89.435  117.890 1.00 30.00  ? 55  ILE C CD1 1 
ATOM 3420  N N   . LYS C 1 56  ? 125.433 93.676  114.128 1.00 98.92  ? 56  LYS C N   1 
ATOM 3421  C CA  . LYS C 1 56  ? 124.756 93.949  112.869 1.00 91.81  ? 56  LYS C CA  1 
ATOM 3422  C C   . LYS C 1 56  ? 125.285 93.035  111.769 1.00 85.75  ? 56  LYS C C   1 
ATOM 3423  O O   . LYS C 1 56  ? 126.483 92.743  111.703 1.00 101.89 ? 56  LYS C O   1 
ATOM 3424  C CB  . LYS C 1 56  ? 124.873 95.430  112.471 1.00 30.00  ? 56  LYS C CB  1 
ATOM 3425  C CG  . LYS C 1 56  ? 126.247 95.956  112.140 1.00 30.00  ? 56  LYS C CG  1 
ATOM 3426  C CD  . LYS C 1 56  ? 126.128 97.429  111.801 1.00 30.00  ? 56  LYS C CD  1 
ATOM 3427  C CE  . LYS C 1 56  ? 127.464 98.040  111.463 1.00 30.00  ? 56  LYS C CE  1 
ATOM 3428  N NZ  . LYS C 1 56  ? 127.998 97.475  110.202 1.00 30.00  ? 56  LYS C NZ  1 
ATOM 3429  N N   . VAL C 1 57  ? 124.366 92.571  110.924 1.00 72.52  ? 57  VAL C N   1 
ATOM 3430  C CA  . VAL C 1 57  ? 124.620 91.559  109.904 1.00 81.55  ? 57  VAL C CA  1 
ATOM 3431  C C   . VAL C 1 57  ? 124.761 92.255  108.561 1.00 102.46 ? 57  VAL C C   1 
ATOM 3432  O O   . VAL C 1 57  ? 123.905 93.064  108.184 1.00 103.19 ? 57  VAL C O   1 
ATOM 3433  C CB  . VAL C 1 57  ? 123.489 90.522  109.870 1.00 30.00  ? 57  VAL C CB  1 
ATOM 3434  C CG1 . VAL C 1 57  ? 123.602 89.631  108.664 1.00 30.00  ? 57  VAL C CG1 1 
ATOM 3435  C CG2 . VAL C 1 57  ? 123.524 89.689  111.122 1.00 30.00  ? 57  VAL C CG2 1 
ATOM 3436  N N   . LEU C 1 58  ? 125.829 91.942  107.833 1.00 92.19  ? 58  LEU C N   1 
ATOM 3437  C CA  . LEU C 1 58  ? 126.079 92.552  106.536 1.00 86.93  ? 58  LEU C CA  1 
ATOM 3438  C C   . LEU C 1 58  ? 126.611 91.516  105.558 1.00 105.85 ? 58  LEU C C   1 
ATOM 3439  O O   . LEU C 1 58  ? 127.571 90.809  105.868 1.00 120.09 ? 58  LEU C O   1 
ATOM 3440  C CB  . LEU C 1 58  ? 127.040 93.742  106.695 1.00 30.00  ? 58  LEU C CB  1 
ATOM 3441  C CG  . LEU C 1 58  ? 128.428 93.633  107.346 1.00 30.00  ? 58  LEU C CG  1 
ATOM 3442  C CD1 . LEU C 1 58  ? 129.539 93.363  106.348 1.00 30.00  ? 58  LEU C CD1 1 
ATOM 3443  C CD2 . LEU C 1 58  ? 128.740 94.875  108.150 1.00 30.00  ? 58  LEU C CD2 1 
ATOM 3444  N N   . SER C 1 59  ? 125.943 91.399  104.405 1.00 102.02 ? 59  SER C N   1 
ATOM 3445  C CA  . SER C 1 59  ? 126.457 90.757  103.188 1.00 101.26 ? 59  SER C CA  1 
ATOM 3446  C C   . SER C 1 59  ? 126.820 89.283  103.406 1.00 100.91 ? 59  SER C C   1 
ATOM 3447  O O   . SER C 1 59  ? 127.982 88.884  103.389 1.00 93.78  ? 59  SER C O   1 
ATOM 3448  C CB  . SER C 1 59  ? 127.649 91.542  102.632 1.00 30.00  ? 59  SER C CB  1 
ATOM 3449  O OG  . SER C 1 59  ? 127.248 92.834  102.213 1.00 30.00  ? 59  SER C OG  1 
ATOM 3450  N N   . VAL C 1 60  ? 125.792 88.492  103.632 1.00 114.53 ? 60  VAL C N   1 
ATOM 3451  C CA  . VAL C 1 60  ? 125.953 87.056  103.815 1.00 106.73 ? 60  VAL C CA  1 
ATOM 3452  C C   . VAL C 1 60  ? 126.182 86.399  102.454 1.00 97.61  ? 60  VAL C C   1 
ATOM 3453  O O   . VAL C 1 60  ? 125.674 86.870  101.433 1.00 91.29  ? 60  VAL C O   1 
ATOM 3454  C CB  . VAL C 1 60  ? 124.710 86.506  104.529 1.00 30.00  ? 60  VAL C CB  1 
ATOM 3455  C CG1 . VAL C 1 60  ? 124.892 85.076  104.951 1.00 30.00  ? 60  VAL C CG1 1 
ATOM 3456  C CG2 . VAL C 1 60  ? 124.365 87.379  105.704 1.00 30.00  ? 60  VAL C CG2 1 
ATOM 3457  N N   . VAL C 1 61  ? 126.968 85.317  102.418 1.00 91.21  ? 61  VAL C N   1 
ATOM 3458  C CA  . VAL C 1 61  ? 127.383 84.682  101.171 1.00 75.96  ? 61  VAL C CA  1 
ATOM 3459  C C   . VAL C 1 61  ? 127.047 83.190  101.184 1.00 85.19  ? 61  VAL C C   1 
ATOM 3460  O O   . VAL C 1 61  ? 126.974 82.552  102.236 1.00 107.80 ? 61  VAL C O   1 
ATOM 3461  C CB  . VAL C 1 61  ? 128.881 84.900  100.917 1.00 30.00  ? 61  VAL C CB  1 
ATOM 3462  C CG1 . VAL C 1 61  ? 129.143 86.353  100.659 1.00 30.00  ? 61  VAL C CG1 1 
ATOM 3463  C CG2 . VAL C 1 61  ? 129.661 84.491  102.131 1.00 30.00  ? 61  VAL C CG2 1 
ATOM 3464  N N   . GLY C 1 62  ? 126.833 82.633  99.983  1.00 70.41  ? 62  GLY C N   1 
ATOM 3465  C CA  . GLY C 1 62  ? 126.214 81.320  99.854  1.00 74.08  ? 62  GLY C CA  1 
ATOM 3466  C C   . GLY C 1 62  ? 127.003 80.029  99.680  1.00 71.97  ? 62  GLY C C   1 
ATOM 3467  O O   . GLY C 1 62  ? 126.895 79.159  100.545 1.00 101.24 ? 62  GLY C O   1 
ATOM 3468  N N   . LYS C 1 63  ? 127.810 79.904  98.612  1.00 30.00  ? 63  LYS C N   1 
ATOM 3469  C CA  . LYS C 1 63  ? 128.491 78.669  98.180  1.00 30.00  ? 63  LYS C CA  1 
ATOM 3470  C C   . LYS C 1 63  ? 127.550 77.504  97.882  1.00 30.00  ? 63  LYS C C   1 
ATOM 3471  O O   . LYS C 1 63  ? 127.321 76.649  98.743  1.00 30.00  ? 63  LYS C O   1 
ATOM 3472  C CB  . LYS C 1 63  ? 129.565 78.193  99.168  1.00 30.00  ? 63  LYS C CB  1 
ATOM 3473  C CG  . LYS C 1 63  ? 130.446 77.063  98.625  1.00 30.00  ? 63  LYS C CG  1 
ATOM 3474  C CD  . LYS C 1 63  ? 131.222 77.528  97.422  1.00 30.00  ? 63  LYS C CD  1 
ATOM 3475  C CE  . LYS C 1 63  ? 131.992 76.389  96.805  1.00 30.00  ? 63  LYS C CE  1 
ATOM 3476  N NZ  . LYS C 1 63  ? 133.019 75.863  97.733  1.00 30.00  ? 63  LYS C NZ  1 
ATOM 3477  N N   . THR C 1 64  ? 126.905 77.506  96.720  1.00 74.75  ? 64  THR C N   1 
ATOM 3478  C CA  . THR C 1 64  ? 126.199 76.300  96.310  1.00 85.42  ? 64  THR C CA  1 
ATOM 3479  C C   . THR C 1 64  ? 127.179 75.197  95.902  1.00 94.58  ? 64  THR C C   1 
ATOM 3480  O O   . THR C 1 64  ? 128.394 75.396  95.831  1.00 107.53 ? 64  THR C O   1 
ATOM 3481  C CB  . THR C 1 64  ? 125.258 76.581  95.149  1.00 30.00  ? 64  THR C CB  1 
ATOM 3482  O OG1 . THR C 1 64  ? 124.443 75.428  94.917  1.00 30.00  ? 64  THR C OG1 1 
ATOM 3483  C CG2 . THR C 1 64  ? 126.049 76.832  93.912  1.00 30.00  ? 64  THR C CG2 1 
ATOM 3484  N N   . ASP C 1 65  ? 126.623 74.018  95.608  1.00 92.95  ? 65  ASP C N   1 
ATOM 3485  C CA  . ASP C 1 65  ? 127.411 72.864  95.187  1.00 78.92  ? 65  ASP C CA  1 
ATOM 3486  C C   . ASP C 1 65  ? 127.577 72.906  93.665  1.00 87.53  ? 65  ASP C C   1 
ATOM 3487  O O   . ASP C 1 65  ? 126.987 73.746  92.981  1.00 108.21 ? 65  ASP C O   1 
ATOM 3488  C CB  . ASP C 1 65  ? 126.746 71.575  95.667  1.00 30.00  ? 65  ASP C CB  1 
ATOM 3489  C CG  . ASP C 1 65  ? 127.693 70.386  95.673  1.00 30.00  ? 65  ASP C CG  1 
ATOM 3490  O OD1 . ASP C 1 65  ? 128.857 70.550  95.250  1.00 30.00  ? 65  ASP C OD1 1 
ATOM 3491  O OD2 . ASP C 1 65  ? 127.272 69.290  96.099  1.00 30.00  ? 65  ASP C OD2 1 
ATOM 3492  N N   . SER C 1 66  ? 128.381 71.992  93.112  1.00 82.88  ? 66  SER C N   1 
ATOM 3493  C CA  . SER C 1 66  ? 128.682 71.962  91.686  1.00 100.10 ? 66  SER C CA  1 
ATOM 3494  C C   . SER C 1 66  ? 127.481 71.600  90.822  1.00 99.91  ? 66  SER C C   1 
ATOM 3495  O O   . SER C 1 66  ? 127.500 71.871  89.618  1.00 105.10 ? 66  SER C O   1 
ATOM 3496  C CB  . SER C 1 66  ? 129.817 70.977  91.420  1.00 30.00  ? 66  SER C CB  1 
ATOM 3497  O OG  . SER C 1 66  ? 130.998 71.388  92.083  1.00 30.00  ? 66  SER C OG  1 
ATOM 3498  N N   . ASN C 1 67  ? 126.453 70.994  91.397  1.00 97.83  ? 67  ASN C N   1 
ATOM 3499  C CA  . ASN C 1 67  ? 125.153 70.866  90.753  1.00 107.23 ? 67  ASN C CA  1 
ATOM 3500  C C   . ASN C 1 67  ? 124.271 71.849  91.515  1.00 118.78 ? 67  ASN C C   1 
ATOM 3501  O O   . ASN C 1 67  ? 123.998 71.646  92.701  1.00 119.03 ? 67  ASN C O   1 
ATOM 3502  C CB  . ASN C 1 67  ? 124.641 69.431  90.804  1.00 30.00  ? 67  ASN C CB  1 
ATOM 3503  C CG  . ASN C 1 67  ? 123.494 69.184  89.846  1.00 30.00  ? 67  ASN C CG  1 
ATOM 3504  O OD1 . ASN C 1 67  ? 123.025 70.097  89.169  1.00 30.00  ? 67  ASN C OD1 1 
ATOM 3505  N ND2 . ASN C 1 67  ? 123.062 67.933  89.755  1.00 30.00  ? 67  ASN C ND2 1 
ATOM 3506  N N   . LYS C 1 68  ? 123.835 72.901  90.814  1.00 119.07 ? 68  LYS C N   1 
ATOM 3507  C CA  . LYS C 1 68  ? 123.438 74.206  91.348  1.00 123.65 ? 68  LYS C CA  1 
ATOM 3508  C C   . LYS C 1 68  ? 122.470 74.237  92.526  1.00 120.01 ? 68  LYS C C   1 
ATOM 3509  O O   . LYS C 1 68  ? 122.470 75.205  93.285  1.00 120.34 ? 68  LYS C O   1 
ATOM 3510  C CB  . LYS C 1 68  ? 122.836 75.041  90.220  1.00 30.00  ? 68  LYS C CB  1 
ATOM 3511  C CG  . LYS C 1 68  ? 123.800 75.370  89.090  1.00 30.00  ? 68  LYS C CG  1 
ATOM 3512  C CD  . LYS C 1 68  ? 124.916 76.286  89.562  1.00 30.00  ? 68  LYS C CD  1 
ATOM 3513  C CE  . LYS C 1 68  ? 125.714 76.820  88.391  1.00 30.00  ? 68  LYS C CE  1 
ATOM 3514  N NZ  . LYS C 1 68  ? 126.471 75.746  87.708  1.00 30.00  ? 68  LYS C NZ  1 
ATOM 3515  N N   . THR C 1 69  ? 121.649 73.209  92.696  1.00 104.67 ? 69  THR C N   1 
ATOM 3516  C CA  . THR C 1 69  ? 120.687 73.194  93.788  1.00 117.77 ? 69  THR C CA  1 
ATOM 3517  C C   . THR C 1 69  ? 121.422 72.946  95.114  1.00 114.76 ? 69  THR C C   1 
ATOM 3518  O O   . THR C 1 69  ? 122.590 72.545  95.128  1.00 113.10 ? 69  THR C O   1 
ATOM 3519  C CB  . THR C 1 69  ? 119.635 72.111  93.509  1.00 30.00  ? 69  THR C CB  1 
ATOM 3520  O OG1 . THR C 1 69  ? 119.308 72.148  92.117  1.00 30.00  ? 69  THR C OG1 1 
ATOM 3521  C CG2 . THR C 1 69  ? 118.315 72.374  94.248  1.00 30.00  ? 69  THR C CG2 1 
ATOM 3522  N N   . TYR C 1 70  ? 120.730 73.220  96.229  1.00 95.58  ? 70  TYR C N   1 
ATOM 3523  C CA  . TYR C 1 70  ? 121.134 72.847  97.590  1.00 91.75  ? 70  TYR C CA  1 
ATOM 3524  C C   . TYR C 1 70  ? 122.444 73.523  98.009  1.00 97.36  ? 70  TYR C C   1 
ATOM 3525  O O   . TYR C 1 70  ? 123.494 72.890  98.118  1.00 106.50 ? 70  TYR C O   1 
ATOM 3526  C CB  . TYR C 1 70  ? 121.250 71.323  97.735  1.00 30.00  ? 70  TYR C CB  1 
ATOM 3527  C CG  . TYR C 1 70  ? 119.950 70.552  97.655  1.00 30.00  ? 70  TYR C CG  1 
ATOM 3528  C CD1 . TYR C 1 70  ? 118.721 71.192  97.766  1.00 30.00  ? 70  TYR C CD1 1 
ATOM 3529  C CD2 . TYR C 1 70  ? 119.958 69.172  97.481  1.00 30.00  ? 70  TYR C CD2 1 
ATOM 3530  C CE1 . TYR C 1 70  ? 117.534 70.477  97.694  1.00 30.00  ? 70  TYR C CE1 1 
ATOM 3531  C CE2 . TYR C 1 70  ? 118.781 68.451  97.409  1.00 30.00  ? 70  TYR C CE2 1 
ATOM 3532  C CZ  . TYR C 1 70  ? 117.574 69.107  97.517  1.00 30.00  ? 70  TYR C CZ  1 
ATOM 3533  O OH  . TYR C 1 70  ? 116.404 68.388  97.445  1.00 30.00  ? 70  TYR C OH  1 
ATOM 3534  N N   . VAL C 1 71  ? 122.362 74.841  98.195  1.00 94.49  ? 71  VAL C N   1 
ATOM 3535  C CA  . VAL C 1 71  ? 123.472 75.624  98.737  1.00 80.78  ? 71  VAL C CA  1 
ATOM 3536  C C   . VAL C 1 71  ? 123.834 75.172  100.152 1.00 87.45  ? 71  VAL C C   1 
ATOM 3537  O O   . VAL C 1 71  ? 122.990 75.153  101.052 1.00 96.24  ? 71  VAL C O   1 
ATOM 3538  C CB  . VAL C 1 71  ? 123.162 77.134  98.660  1.00 30.00  ? 71  VAL C CB  1 
ATOM 3539  C CG1 . VAL C 1 71  ? 121.798 77.462  99.190  1.00 30.00  ? 71  VAL C CG1 1 
ATOM 3540  C CG2 . VAL C 1 71  ? 124.153 77.898  99.452  1.00 30.00  ? 71  VAL C CG2 1 
ATOM 3541  N N   . GLU C 1 72  ? 125.093 74.771  100.352 1.00 85.64  ? 72  GLU C N   1 
ATOM 3542  C CA  . GLU C 1 72  ? 125.460 74.010  101.539 1.00 94.43  ? 72  GLU C CA  1 
ATOM 3543  C C   . GLU C 1 72  ? 126.306 74.771  102.553 1.00 97.09  ? 72  GLU C C   1 
ATOM 3544  O O   . GLU C 1 72  ? 126.003 74.719  103.747 1.00 121.72 ? 72  GLU C O   1 
ATOM 3545  C CB  . GLU C 1 72  ? 126.156 72.683  101.139 1.00 30.00  ? 72  GLU C CB  1 
ATOM 3546  C CG  . GLU C 1 72  ? 127.524 72.709  100.473 1.00 30.00  ? 72  GLU C CG  1 
ATOM 3547  C CD  . GLU C 1 72  ? 127.453 72.815  98.976  1.00 30.00  ? 72  GLU C CD  1 
ATOM 3548  O OE1 . GLU C 1 72  ? 126.380 73.179  98.456  1.00 30.00  ? 72  GLU C OE1 1 
ATOM 3549  O OE2 . GLU C 1 72  ? 128.475 72.527  98.321  1.00 30.00  ? 72  GLU C OE2 1 
ATOM 3550  N N   . LYS C 1 73  ? 127.345 75.487  102.141 1.00 88.72  ? 73  LYS C N   1 
ATOM 3551  C CA  . LYS C 1 73  ? 128.353 75.991  103.070 1.00 76.19  ? 73  LYS C CA  1 
ATOM 3552  C C   . LYS C 1 73  ? 128.232 77.504  103.178 1.00 76.39  ? 73  LYS C C   1 
ATOM 3553  O O   . LYS C 1 73  ? 128.846 78.238  102.403 1.00 99.03  ? 73  LYS C O   1 
ATOM 3554  C CB  . LYS C 1 73  ? 129.749 75.579  102.626 1.00 30.00  ? 73  LYS C CB  1 
ATOM 3555  C CG  . LYS C 1 73  ? 130.050 74.099  102.794 1.00 30.00  ? 73  LYS C CG  1 
ATOM 3556  C CD  . LYS C 1 73  ? 131.543 73.782  102.643 1.00 30.00  ? 73  LYS C CD  1 
ATOM 3557  C CE  . LYS C 1 73  ? 132.033 73.899  101.211 1.00 30.00  ? 73  LYS C CE  1 
ATOM 3558  N NZ  . LYS C 1 73  ? 133.465 73.511  101.090 1.00 30.00  ? 73  LYS C NZ  1 
ATOM 3559  N N   . LEU C 1 74  ? 127.477 77.966  104.166 1.00 86.10  ? 74  LEU C N   1 
ATOM 3560  C CA  . LEU C 1 74  ? 127.133 79.374  104.287 1.00 69.89  ? 74  LEU C CA  1 
ATOM 3561  C C   . LEU C 1 74  ? 128.097 80.084  105.232 1.00 74.51  ? 74  LEU C C   1 
ATOM 3562  O O   . LEU C 1 74  ? 128.704 79.469  106.112 1.00 105.24 ? 74  LEU C O   1 
ATOM 3563  C CB  . LEU C 1 74  ? 125.685 79.511  104.769 1.00 30.00  ? 74  LEU C CB  1 
ATOM 3564  C CG  . LEU C 1 74  ? 124.921 80.831  104.810 1.00 30.00  ? 74  LEU C CG  1 
ATOM 3565  C CD1 . LEU C 1 74  ? 123.466 80.549  104.563 1.00 30.00  ? 74  LEU C CD1 1 
ATOM 3566  C CD2 . LEU C 1 74  ? 125.062 81.500  106.158 1.00 30.00  ? 74  LEU C CD2 1 
ATOM 3567  N N   . ALA C 1 75  ? 128.245 81.392  105.022 1.00 74.85  ? 75  ALA C N   1 
ATOM 3568  C CA  . ALA C 1 75  ? 129.089 82.243  105.849 1.00 71.52  ? 75  ALA C CA  1 
ATOM 3569  C C   . ALA C 1 75  ? 128.426 83.601  105.990 1.00 78.01  ? 75  ALA C C   1 
ATOM 3570  O O   . ALA C 1 75  ? 128.048 84.208  104.988 1.00 114.52 ? 75  ALA C O   1 
ATOM 3571  C CB  . ALA C 1 75  ? 130.484 82.405  105.243 1.00 30.00  ? 75  ALA C CB  1 
ATOM 3572  N N   . ILE C 1 76  ? 128.303 84.081  107.221 1.00 65.73  ? 76  ILE C N   1 
ATOM 3573  C CA  . ILE C 1 76  ? 127.639 85.345  107.522 1.00 91.48  ? 76  ILE C CA  1 
ATOM 3574  C C   . ILE C 1 76  ? 128.651 86.308  108.133 1.00 89.44  ? 76  ILE C C   1 
ATOM 3575  O O   . ILE C 1 76  ? 129.254 86.013  109.172 1.00 103.39 ? 76  ILE C O   1 
ATOM 3576  C CB  . ILE C 1 76  ? 126.420 85.125  108.433 1.00 30.00  ? 76  ILE C CB  1 
ATOM 3577  C CG1 . ILE C 1 76  ? 125.900 86.444  108.990 1.00 30.00  ? 76  ILE C CG1 1 
ATOM 3578  C CG2 . ILE C 1 76  ? 126.659 84.066  109.487 1.00 30.00  ? 76  ILE C CG2 1 
ATOM 3579  C CD1 . ILE C 1 76  ? 124.646 86.274  109.799 1.00 30.00  ? 76  ILE C CD1 1 
ATOM 3580  N N   . TYR C 1 77  ? 128.853 87.454  107.479 1.00 92.49  ? 77  TYR C N   1 
ATOM 3581  C CA  . TYR C 1 77  ? 129.838 88.437  107.919 1.00 95.04  ? 77  TYR C CA  1 
ATOM 3582  C C   . TYR C 1 77  ? 129.215 89.316  108.991 1.00 90.68  ? 77  TYR C C   1 
ATOM 3583  O O   . TYR C 1 77  ? 128.162 89.915  108.774 1.00 88.28  ? 77  TYR C O   1 
ATOM 3584  C CB  . TYR C 1 77  ? 130.309 89.337  106.772 1.00 30.00  ? 77  TYR C CB  1 
ATOM 3585  C CG  . TYR C 1 77  ? 131.001 88.689  105.590 1.00 30.00  ? 77  TYR C CG  1 
ATOM 3586  C CD1 . TYR C 1 77  ? 131.453 87.383  105.636 1.00 30.00  ? 77  TYR C CD1 1 
ATOM 3587  C CD2 . TYR C 1 77  ? 131.211 89.411  104.423 1.00 30.00  ? 77  TYR C CD2 1 
ATOM 3588  C CE1 . TYR C 1 77  ? 132.081 86.805  104.552 1.00 30.00  ? 77  TYR C CE1 1 
ATOM 3589  C CE2 . TYR C 1 77  ? 131.838 88.843  103.333 1.00 30.00  ? 77  TYR C CE2 1 
ATOM 3590  C CZ  . TYR C 1 77  ? 132.272 87.541  103.404 1.00 30.00  ? 77  TYR C CZ  1 
ATOM 3591  O OH  . TYR C 1 77  ? 132.896 86.971  102.319 1.00 30.00  ? 77  TYR C OH  1 
ATOM 3592  N N   . ILE C 1 78  ? 129.869 89.409  110.144 1.00 100.82 ? 78  ILE C N   1 
ATOM 3593  C CA  . ILE C 1 78  ? 129.318 90.125  111.290 1.00 80.56  ? 78  ILE C CA  1 
ATOM 3594  C C   . ILE C 1 78  ? 130.391 90.982  111.943 1.00 87.00  ? 78  ILE C C   1 
ATOM 3595  O O   . ILE C 1 78  ? 131.477 90.494  112.273 1.00 104.52 ? 78  ILE C O   1 
ATOM 3596  C CB  . ILE C 1 78  ? 128.676 89.159  112.306 1.00 30.00  ? 78  ILE C CB  1 
ATOM 3597  C CG1 . ILE C 1 78  ? 127.290 88.746  111.814 1.00 30.00  ? 78  ILE C CG1 1 
ATOM 3598  C CG2 . ILE C 1 78  ? 128.626 89.737  113.704 1.00 30.00  ? 78  ILE C CG2 1 
ATOM 3599  C CD1 . ILE C 1 78  ? 126.608 87.743  112.669 1.00 30.00  ? 78  ILE C CD1 1 
ATOM 3600  N N   . SER C 1 79  ? 130.085 92.264  112.107 1.00 77.59  ? 79  SER C N   1 
ATOM 3601  C CA  . SER C 1 79  ? 130.831 93.226  112.896 1.00 81.74  ? 79  SER C CA  1 
ATOM 3602  C C   . SER C 1 79  ? 129.881 93.862  113.896 1.00 98.36  ? 79  SER C C   1 
ATOM 3603  O O   . SER C 1 79  ? 128.716 94.108  113.572 1.00 117.87 ? 79  SER C O   1 
ATOM 3604  C CB  . SER C 1 79  ? 131.454 94.312  112.006 1.00 30.00  ? 79  SER C CB  1 
ATOM 3605  O OG  . SER C 1 79  ? 132.125 95.293  112.775 1.00 30.00  ? 79  SER C OG  1 
ATOM 3606  N N   . PRO C 1 80  ? 130.335 94.126  115.113 1.00 92.20  ? 80  PRO C N   1 
ATOM 3607  C CA  . PRO C 1 80  ? 129.460 94.718  116.124 1.00 88.75  ? 80  PRO C CA  1 
ATOM 3608  C C   . PRO C 1 80  ? 129.258 96.203  115.853 1.00 95.71  ? 80  PRO C C   1 
ATOM 3609  O O   . PRO C 1 80  ? 129.885 96.794  114.977 1.00 117.12 ? 80  PRO C O   1 
ATOM 3610  C CB  . PRO C 1 80  ? 130.218 94.479  117.427 1.00 30.00  ? 80  PRO C CB  1 
ATOM 3611  C CG  . PRO C 1 80  ? 131.618 94.445  117.023 1.00 30.00  ? 80  PRO C CG  1 
ATOM 3612  C CD  . PRO C 1 80  ? 131.661 93.817  115.665 1.00 30.00  ? 80  PRO C CD  1 
ATOM 3613  N N   . ASN C 1 81  ? 128.377 96.808  116.645 1.00 89.04  ? 81  ASN C N   1 
ATOM 3614  C CA  . ASN C 1 81  ? 127.962 98.186  116.420 1.00 119.16 ? 81  ASN C CA  1 
ATOM 3615  C C   . ASN C 1 81  ? 129.065 99.152  116.854 1.00 129.92 ? 81  ASN C C   1 
ATOM 3616  O O   . ASN C 1 81  ? 130.178 98.752  117.208 1.00 123.56 ? 81  ASN C O   1 
ATOM 3617  C CB  . ASN C 1 81  ? 126.649 98.474  117.142 1.00 30.00  ? 81  ASN C CB  1 
ATOM 3618  C CG  . ASN C 1 81  ? 125.478 97.738  116.534 1.00 30.00  ? 81  ASN C CG  1 
ATOM 3619  O OD1 . ASN C 1 81  ? 125.420 97.534  115.323 1.00 30.00  ? 81  ASN C OD1 1 
ATOM 3620  N ND2 . ASN C 1 81  ? 124.512 97.381  117.364 1.00 30.00  ? 81  ASN C ND2 1 
ATOM 3621  N N   . ALA C 1 82  ? 128.758 100.451 116.823 1.00 129.27 ? 82  ALA C N   1 
ATOM 3622  C CA  . ALA C 1 82  ? 129.770 101.463 117.106 1.00 116.73 ? 82  ALA C CA  1 
ATOM 3623  C C   . ALA C 1 82  ? 130.148 101.466 118.581 1.00 106.52 ? 82  ALA C C   1 
ATOM 3624  O O   . ALA C 1 82  ? 131.296 101.185 118.942 1.00 96.85  ? 82  ALA C O   1 
ATOM 3625  C CB  . ALA C 1 82  ? 129.267 102.840 116.673 1.00 30.00  ? 82  ALA C CB  1 
ATOM 3626  N N   . GLY C 1 83  ? 129.192 101.757 119.449 1.00 114.15 ? 83  GLY C N   1 
ATOM 3627  C CA  . GLY C 1 83  ? 129.472 101.695 120.864 1.00 114.95 ? 83  GLY C CA  1 
ATOM 3628  C C   . GLY C 1 83  ? 129.114 100.341 121.420 1.00 115.25 ? 83  GLY C C   1 
ATOM 3629  O O   . GLY C 1 83  ? 127.953 100.084 121.744 1.00 115.65 ? 83  GLY C O   1 
ATOM 3630  N N   . SER C 1 84  ? 130.100 99.463  121.541 1.00 112.07 ? 84  SER C N   1 
ATOM 3631  C CA  . SER C 1 84  ? 129.812 98.100  121.945 1.00 124.31 ? 84  SER C CA  1 
ATOM 3632  C C   . SER C 1 84  ? 130.941 97.564  122.804 1.00 115.58 ? 84  SER C C   1 
ATOM 3633  O O   . SER C 1 84  ? 132.105 97.577  122.396 1.00 106.26 ? 84  SER C O   1 
ATOM 3634  C CB  . SER C 1 84  ? 129.604 97.198  120.732 1.00 30.00  ? 84  SER C CB  1 
ATOM 3635  O OG  . SER C 1 84  ? 129.387 95.872  121.153 1.00 30.00  ? 84  SER C OG  1 
ATOM 3636  N N   . GLU C 1 85  ? 130.588 97.099  123.995 1.00 118.56 ? 85  GLU C N   1 
ATOM 3637  C CA  . GLU C 1 85  ? 131.571 96.558  124.923 1.00 105.86 ? 85  GLU C CA  1 
ATOM 3638  C C   . GLU C 1 85  ? 131.527 95.031  124.907 1.00 107.85 ? 85  GLU C C   1 
ATOM 3639  O O   . GLU C 1 85  ? 130.996 94.377  125.804 1.00 104.84 ? 85  GLU C O   1 
ATOM 3640  C CB  . GLU C 1 85  ? 131.339 97.121  126.319 1.00 30.00  ? 85  GLU C CB  1 
ATOM 3641  C CG  . GLU C 1 85  ? 131.570 98.614  126.398 1.00 30.00  ? 85  GLU C CG  1 
ATOM 3642  C CD  . GLU C 1 85  ? 131.356 99.160  127.787 1.00 30.00  ? 85  GLU C CD  1 
ATOM 3643  O OE1 . GLU C 1 85  ? 130.918 98.390  128.662 1.00 30.00  ? 85  GLU C OE1 1 
ATOM 3644  O OE2 . GLU C 1 85  ? 131.629 100.358 128.009 1.00 30.00  ? 85  GLU C OE2 1 
ATOM 3645  N N   . GLY C 1 86  ? 132.111 94.468  123.853 1.00 113.31 ? 86  GLY C N   1 
ATOM 3646  C CA  . GLY C 1 86  ? 132.485 93.069  123.881 1.00 111.17 ? 86  GLY C CA  1 
ATOM 3647  C C   . GLY C 1 86  ? 131.409 92.005  123.826 1.00 101.55 ? 86  GLY C C   1 
ATOM 3648  O O   . GLY C 1 86  ? 131.113 91.395  124.856 1.00 106.00 ? 86  GLY C O   1 
ATOM 3649  N N   . ILE C 1 87  ? 130.780 91.793  122.672 1.00 75.80  ? 87  ILE C N   1 
ATOM 3650  C CA  . ILE C 1 87  ? 130.038 90.551  122.488 1.00 73.31  ? 87  ILE C CA  1 
ATOM 3651  C C   . ILE C 1 87  ? 131.033 89.400  122.508 1.00 100.35 ? 87  ILE C C   1 
ATOM 3652  O O   . ILE C 1 87  ? 131.914 89.308  121.647 1.00 117.40 ? 87  ILE C O   1 
ATOM 3653  C CB  . ILE C 1 87  ? 129.238 90.542  121.180 1.00 30.00  ? 87  ILE C CB  1 
ATOM 3654  C CG1 . ILE C 1 87  ? 128.169 91.627  121.149 1.00 30.00  ? 87  ILE C CG1 1 
ATOM 3655  C CG2 . ILE C 1 87  ? 128.589 89.193  120.983 1.00 30.00  ? 87  ILE C CG2 1 
ATOM 3656  C CD1 . ILE C 1 87  ? 128.569 92.841  120.381 1.00 30.00  ? 87  ILE C CD1 1 
ATOM 3657  N N   . ASP C 1 88  ? 130.903 88.522  123.492 1.00 103.88 ? 88  ASP C N   1 
ATOM 3658  C CA  . ASP C 1 88  ? 131.832 87.416  123.641 1.00 95.71  ? 88  ASP C CA  1 
ATOM 3659  C C   . ASP C 1 88  ? 131.226 86.170  123.008 1.00 94.42  ? 88  ASP C C   1 
ATOM 3660  O O   . ASP C 1 88  ? 130.233 85.624  123.494 1.00 101.39 ? 88  ASP C O   1 
ATOM 3661  C CB  . ASP C 1 88  ? 132.142 87.184  125.121 1.00 30.00  ? 88  ASP C CB  1 
ATOM 3662  C CG  . ASP C 1 88  ? 133.406 86.373  125.343 1.00 30.00  ? 88  ASP C CG  1 
ATOM 3663  O OD1 . ASP C 1 88  ? 134.014 85.915  124.357 1.00 30.00  ? 88  ASP C OD1 1 
ATOM 3664  O OD2 . ASP C 1 88  ? 133.806 86.210  126.515 1.00 30.00  ? 88  ASP C OD2 1 
ATOM 3665  N N   . LEU C 1 89  ? 131.835 85.723  121.911 1.00 99.19  ? 89  LEU C N   1 
ATOM 3666  C CA  . LEU C 1 89  ? 131.195 84.774  121.009 1.00 104.74 ? 89  LEU C CA  1 
ATOM 3667  C C   . LEU C 1 89  ? 131.191 83.336  121.508 1.00 110.40 ? 89  LEU C C   1 
ATOM 3668  O O   . LEU C 1 89  ? 130.600 82.478  120.848 1.00 132.98 ? 89  LEU C O   1 
ATOM 3669  C CB  . LEU C 1 89  ? 131.844 84.827  119.628 1.00 30.00  ? 89  LEU C CB  1 
ATOM 3670  C CG  . LEU C 1 89  ? 131.627 86.127  118.865 1.00 30.00  ? 89  LEU C CG  1 
ATOM 3671  C CD1 . LEU C 1 89  ? 132.324 86.033  117.547 1.00 30.00  ? 89  LEU C CD1 1 
ATOM 3672  C CD2 . LEU C 1 89  ? 130.155 86.414  118.660 1.00 30.00  ? 89  LEU C CD2 1 
ATOM 3673  N N   . ASN C 1 90  ? 131.832 83.038  122.636 1.00 101.49 ? 90  ASN C N   1 
ATOM 3674  C CA  . ASN C 1 90  ? 131.593 81.737  123.244 1.00 104.71 ? 90  ASN C CA  1 
ATOM 3675  C C   . ASN C 1 90  ? 130.193 81.691  123.832 1.00 105.99 ? 90  ASN C C   1 
ATOM 3676  O O   . ASN C 1 90  ? 129.548 80.639  123.819 1.00 109.37 ? 90  ASN C O   1 
ATOM 3677  C CB  . ASN C 1 90  ? 132.640 81.445  124.316 1.00 30.00  ? 90  ASN C CB  1 
ATOM 3678  C CG  . ASN C 1 90  ? 132.873 79.955  124.523 1.00 30.00  ? 90  ASN C CG  1 
ATOM 3679  O OD1 . ASN C 1 90  ? 133.855 79.556  125.144 1.00 30.00  ? 90  ASN C OD1 1 
ATOM 3680  N ND2 . ASN C 1 90  ? 131.995 79.127  123.974 1.00 30.00  ? 90  ASN C ND2 1 
ATOM 3681  N N   . ASN C 1 91  ? 129.714 82.819  124.351 1.00 96.80  ? 91  ASN C N   1 
ATOM 3682  C CA  . ASN C 1 91  ? 128.327 82.967  124.777 1.00 97.18  ? 91  ASN C CA  1 
ATOM 3683  C C   . ASN C 1 91  ? 127.579 83.762  123.709 1.00 103.39 ? 91  ASN C C   1 
ATOM 3684  O O   . ASN C 1 91  ? 127.247 84.932  123.885 1.00 107.67 ? 91  ASN C O   1 
ATOM 3685  C CB  . ASN C 1 91  ? 128.263 83.650  126.138 1.00 30.00  ? 91  ASN C CB  1 
ATOM 3686  C CG  . ASN C 1 91  ? 128.962 82.861  127.216 1.00 30.00  ? 91  ASN C CG  1 
ATOM 3687  O OD1 . ASN C 1 91  ? 129.940 83.322  127.801 1.00 30.00  ? 91  ASN C OD1 1 
ATOM 3688  N ND2 . ASN C 1 91  ? 128.470 81.659  127.482 1.00 30.00  ? 91  ASN C ND2 1 
ATOM 3689  N N   . THR C 1 92  ? 127.311 83.108  122.581 1.00 101.15 ? 92  THR C N   1 
ATOM 3690  C CA  . THR C 1 92  ? 126.551 83.724  121.498 1.00 84.54  ? 92  THR C CA  1 
ATOM 3691  C C   . THR C 1 92  ? 125.884 82.626  120.689 1.00 86.65  ? 92  THR C C   1 
ATOM 3692  O O   . THR C 1 92  ? 126.551 81.679  120.267 1.00 106.48 ? 92  THR C O   1 
ATOM 3693  C CB  . THR C 1 92  ? 127.446 84.576  120.590 1.00 30.00  ? 92  THR C CB  1 
ATOM 3694  O OG1 . THR C 1 92  ? 127.997 85.664  121.338 1.00 30.00  ? 92  THR C OG1 1 
ATOM 3695  C CG2 . THR C 1 92  ? 126.659 85.133  119.418 1.00 30.00  ? 92  THR C CG2 1 
ATOM 3696  N N   . ARG C 1 93  ? 124.580 82.750  120.476 1.00 78.31  ? 93  ARG C N   1 
ATOM 3697  C CA  . ARG C 1 93  ? 123.821 81.779  119.708 1.00 89.86  ? 93  ARG C CA  1 
ATOM 3698  C C   . ARG C 1 93  ? 123.335 82.425  118.420 1.00 89.07  ? 93  ARG C C   1 
ATOM 3699  O O   . ARG C 1 93  ? 122.753 83.512  118.443 1.00 106.87 ? 93  ARG C O   1 
ATOM 3700  C CB  . ARG C 1 93  ? 122.655 81.253  120.530 1.00 30.00  ? 93  ARG C CB  1 
ATOM 3701  C CG  . ARG C 1 93  ? 123.120 80.615  121.822 1.00 30.00  ? 93  ARG C CG  1 
ATOM 3702  C CD  . ARG C 1 93  ? 123.933 79.365  121.545 1.00 30.00  ? 93  ARG C CD  1 
ATOM 3703  N NE  . ARG C 1 93  ? 124.402 78.705  122.762 1.00 30.00  ? 93  ARG C NE  1 
ATOM 3704  C CZ  . ARG C 1 93  ? 125.587 78.930  123.321 1.00 30.00  ? 93  ARG C CZ  1 
ATOM 3705  N NH1 . ARG C 1 93  ? 126.425 79.795  122.774 1.00 30.00  ? 93  ARG C NH1 1 
ATOM 3706  N NH2 . ARG C 1 93  ? 125.941 78.286  124.421 1.00 30.00  ? 93  ARG C NH2 1 
ATOM 3707  N N   . VAL C 1 94  ? 123.588 81.758  117.296 1.00 84.22  ? 94  VAL C N   1 
ATOM 3708  C CA  . VAL C 1 94  ? 123.203 82.272  115.987 1.00 73.51  ? 94  VAL C CA  1 
ATOM 3709  C C   . VAL C 1 94  ? 121.960 81.526  115.538 1.00 86.10  ? 94  VAL C C   1 
ATOM 3710  O O   . VAL C 1 94  ? 122.041 80.379  115.092 1.00 102.58 ? 94  VAL C O   1 
ATOM 3711  C CB  . VAL C 1 94  ? 124.341 82.120  114.965 1.00 30.00  ? 94  VAL C CB  1 
ATOM 3712  C CG1 . VAL C 1 94  ? 123.904 82.620  113.603 1.00 30.00  ? 94  VAL C CG1 1 
ATOM 3713  C CG2 . VAL C 1 94  ? 125.568 82.869  115.439 1.00 30.00  ? 94  VAL C CG2 1 
ATOM 3714  N N   . VAL C 1 95  ? 120.802 82.162  115.667 1.00 80.17  ? 95  VAL C N   1 
ATOM 3715  C CA  . VAL C 1 95  ? 119.523 81.495  115.468 1.00 77.28  ? 95  VAL C CA  1 
ATOM 3716  C C   . VAL C 1 95  ? 119.123 81.696  114.013 1.00 86.14  ? 95  VAL C C   1 
ATOM 3717  O O   . VAL C 1 95  ? 119.061 82.820  113.525 1.00 98.38  ? 95  VAL C O   1 
ATOM 3718  C CB  . VAL C 1 95  ? 118.457 82.033  116.420 1.00 30.00  ? 95  VAL C CB  1 
ATOM 3719  C CG1 . VAL C 1 95  ? 117.144 81.315  116.206 1.00 30.00  ? 95  VAL C CG1 1 
ATOM 3720  C CG2 . VAL C 1 95  ? 118.922 81.914  117.848 1.00 30.00  ? 95  VAL C CG2 1 
ATOM 3721  N N   . LEU C 1 96  ? 118.860 80.603  113.310 1.00 91.86  ? 96  LEU C N   1 
ATOM 3722  C CA  . LEU C 1 96  ? 118.277 80.668  111.980 1.00 76.62  ? 96  LEU C CA  1 
ATOM 3723  C C   . LEU C 1 96  ? 117.207 79.593  111.855 1.00 90.23  ? 96  LEU C C   1 
ATOM 3724  O O   . LEU C 1 96  ? 117.453 78.422  112.161 1.00 122.98 ? 96  LEU C O   1 
ATOM 3725  C CB  . LEU C 1 96  ? 119.359 80.546  110.901 1.00 30.00  ? 96  LEU C CB  1 
ATOM 3726  C CG  . LEU C 1 96  ? 120.301 79.352  110.739 1.00 30.00  ? 96  LEU C CG  1 
ATOM 3727  C CD1 . LEU C 1 96  ? 119.741 78.312  109.795 1.00 30.00  ? 96  LEU C CD1 1 
ATOM 3728  C CD2 . LEU C 1 96  ? 121.668 79.811  110.270 1.00 30.00  ? 96  LEU C CD2 1 
ATOM 3729  N N   . SER C 1 97  ? 116.007 80.006  111.448 1.00 77.79  ? 97  SER C N   1 
ATOM 3730  C CA  . SER C 1 97  ? 114.886 79.096  111.252 1.00 80.19  ? 97  SER C CA  1 
ATOM 3731  C C   . SER C 1 97  ? 114.955 78.495  109.864 1.00 99.22  ? 97  SER C C   1 
ATOM 3732  O O   . SER C 1 97  ? 115.992 78.561  109.211 1.00 107.37 ? 97  SER C O   1 
ATOM 3733  C CB  . SER C 1 97  ? 113.552 79.811  111.430 1.00 30.00  ? 97  SER C CB  1 
ATOM 3734  O OG  . SER C 1 97  ? 113.355 80.772  110.412 1.00 30.00  ? 97  SER C OG  1 
ATOM 3735  N N   . ASN C 1 98  ? 113.869 77.882  109.416 1.00 30.00  ? 98  ASN C N   1 
ATOM 3736  C CA  . ASN C 1 98  ? 113.766 77.480  108.023 1.00 30.00  ? 98  ASN C CA  1 
ATOM 3737  C C   . ASN C 1 98  ? 112.360 77.849  107.587 1.00 30.00  ? 98  ASN C C   1 
ATOM 3738  O O   . ASN C 1 98  ? 111.668 78.598  108.283 1.00 30.00  ? 98  ASN C O   1 
ATOM 3739  C CB  . ASN C 1 98  ? 114.030 75.979  107.863 1.00 30.00  ? 98  ASN C CB  1 
ATOM 3740  C CG  . ASN C 1 98  ? 114.479 75.599  106.459 1.00 30.00  ? 98  ASN C CG  1 
ATOM 3741  O OD1 . ASN C 1 98  ? 114.558 76.448  105.575 1.00 30.00  ? 98  ASN C OD1 1 
ATOM 3742  N ND2 . ASN C 1 98  ? 114.790 74.324  106.256 1.00 30.00  ? 98  ASN C ND2 1 
ATOM 3743  N N   . GLY C 1 99  ? 111.925 77.347  106.437 1.00 30.00  ? 99  GLY C N   1 
ATOM 3744  C CA  . GLY C 1 99  ? 110.504 77.187  106.257 1.00 30.00  ? 99  GLY C CA  1 
ATOM 3745  C C   . GLY C 1 99  ? 109.899 76.203  107.233 1.00 30.00  ? 99  GLY C C   1 
ATOM 3746  O O   . GLY C 1 99  ? 108.728 76.348  107.591 1.00 30.00  ? 99  GLY C O   1 
ATOM 3747  N N   . THR C 1 100 ? 110.669 75.213  107.689 1.00 85.87  ? 100 THR C N   1 
ATOM 3748  C CA  . THR C 1 100 ? 110.115 74.187  108.559 1.00 102.79 ? 100 THR C CA  1 
ATOM 3749  C C   . THR C 1 100 ? 110.727 74.168  109.953 1.00 104.11 ? 100 THR C C   1 
ATOM 3750  O O   . THR C 1 100 ? 109.997 74.329  110.936 1.00 96.07  ? 100 THR C O   1 
ATOM 3751  C CB  . THR C 1 100 ? 110.271 72.814  107.895 1.00 30.00  ? 100 THR C CB  1 
ATOM 3752  O OG1 . THR C 1 100 ? 109.733 72.870  106.570 1.00 30.00  ? 100 THR C OG1 1 
ATOM 3753  C CG2 . THR C 1 100 ? 109.483 71.781  108.666 1.00 30.00  ? 100 THR C CG2 1 
ATOM 3754  N N   . VAL C 1 101 ? 112.044 74.003  110.083 1.00 97.64  ? 101 VAL C N   1 
ATOM 3755  C CA  . VAL C 1 101 ? 112.665 73.619  111.350 1.00 100.35 ? 101 VAL C CA  1 
ATOM 3756  C C   . VAL C 1 101 ? 113.603 74.725  111.820 1.00 117.38 ? 101 VAL C C   1 
ATOM 3757  O O   . VAL C 1 101 ? 114.438 75.206  111.048 1.00 123.46 ? 101 VAL C O   1 
ATOM 3758  C CB  . VAL C 1 101 ? 113.425 72.285  111.215 1.00 30.00  ? 101 VAL C CB  1 
ATOM 3759  C CG1 . VAL C 1 101 ? 114.088 71.892  112.519 1.00 30.00  ? 101 VAL C CG1 1 
ATOM 3760  C CG2 . VAL C 1 101 ? 112.493 71.178  110.759 1.00 30.00  ? 101 VAL C CG2 1 
ATOM 3761  N N   . GLN C 1 102 ? 113.473 75.110  113.093 1.00 107.35 ? 102 GLN C N   1 
ATOM 3762  C CA  . GLN C 1 102 ? 114.384 76.037  113.757 1.00 99.10  ? 102 GLN C CA  1 
ATOM 3763  C C   . GLN C 1 102 ? 115.796 75.472  113.853 1.00 93.31  ? 102 GLN C C   1 
ATOM 3764  O O   . GLN C 1 102 ? 116.048 74.289  113.619 1.00 114.39 ? 102 GLN C O   1 
ATOM 3765  C CB  . GLN C 1 102 ? 113.915 76.346  115.180 1.00 30.00  ? 102 GLN C CB  1 
ATOM 3766  C CG  . GLN C 1 102 ? 112.730 77.270  115.310 1.00 30.00  ? 102 GLN C CG  1 
ATOM 3767  C CD  . GLN C 1 102 ? 113.089 78.715  115.047 1.00 30.00  ? 102 GLN C CD  1 
ATOM 3768  O OE1 . GLN C 1 102 ? 114.154 79.186  115.442 1.00 30.00  ? 102 GLN C OE1 1 
ATOM 3769  N NE2 . GLN C 1 102 ? 112.194 79.430  114.391 1.00 30.00  ? 102 GLN C NE2 1 
ATOM 3770  N N   . ALA C 1 103 ? 116.718 76.343  114.253 1.00 90.25  ? 103 ALA C N   1 
ATOM 3771  C CA  . ALA C 1 103 ? 118.061 75.929  114.623 1.00 88.34  ? 103 ALA C CA  1 
ATOM 3772  C C   . ALA C 1 103 ? 118.667 76.995  115.518 1.00 104.79 ? 103 ALA C C   1 
ATOM 3773  O O   . ALA C 1 103 ? 118.443 78.187  115.308 1.00 117.96 ? 103 ALA C O   1 
ATOM 3774  C CB  . ALA C 1 103 ? 118.957 75.712  113.400 1.00 30.00  ? 103 ALA C CB  1 
ATOM 3775  N N   . VAL C 1 104 ? 119.415 76.555  116.522 1.00 94.80  ? 104 VAL C N   1 
ATOM 3776  C CA  . VAL C 1 104 ? 120.304 77.418  117.286 1.00 109.96 ? 104 VAL C CA  1 
ATOM 3777  C C   . VAL C 1 104 ? 121.689 76.793  117.229 1.00 89.25  ? 104 VAL C C   1 
ATOM 3778  O O   . VAL C 1 104 ? 121.832 75.577  117.073 1.00 75.68  ? 104 VAL C O   1 
ATOM 3779  C CB  . VAL C 1 104 ? 119.830 77.618  118.740 1.00 30.00  ? 104 VAL C CB  1 
ATOM 3780  C CG1 . VAL C 1 104 ? 118.515 78.350  118.767 1.00 30.00  ? 104 VAL C CG1 1 
ATOM 3781  C CG2 . VAL C 1 104 ? 119.665 76.297  119.420 1.00 30.00  ? 104 VAL C CG2 1 
ATOM 3782  N N   . LEU C 1 105 ? 122.717 77.634  117.306 1.00 88.49  ? 105 LEU C N   1 
ATOM 3783  C CA  . LEU C 1 105 ? 124.078 77.214  116.984 1.00 98.24  ? 105 LEU C CA  1 
ATOM 3784  C C   . LEU C 1 105 ? 125.014 77.562  118.135 1.00 91.87  ? 105 LEU C C   1 
ATOM 3785  O O   . LEU C 1 105 ? 125.215 78.740  118.442 1.00 103.67 ? 105 LEU C O   1 
ATOM 3786  C CB  . LEU C 1 105 ? 124.556 77.859  115.682 1.00 30.00  ? 105 LEU C CB  1 
ATOM 3787  C CG  . LEU C 1 105 ? 124.166 77.256  114.322 1.00 30.00  ? 105 LEU C CG  1 
ATOM 3788  C CD1 . LEU C 1 105 ? 124.609 75.813  114.236 1.00 30.00  ? 105 LEU C CD1 1 
ATOM 3789  C CD2 . LEU C 1 105 ? 122.700 77.384  113.940 1.00 30.00  ? 105 LEU C CD2 1 
ATOM 3790  N N   . LYS C 1 106 ? 125.582 76.536  118.764 1.00 80.59  ? 106 LYS C N   1 
ATOM 3791  C CA  . LYS C 1 106 ? 126.569 76.689  119.824 1.00 95.20  ? 106 LYS C CA  1 
ATOM 3792  C C   . LYS C 1 106 ? 127.949 76.851  119.201 1.00 109.74 ? 106 LYS C C   1 
ATOM 3793  O O   . LYS C 1 106 ? 128.200 76.373  118.094 1.00 125.41 ? 106 LYS C O   1 
ATOM 3794  C CB  . LYS C 1 106 ? 126.533 75.470  120.756 1.00 30.00  ? 106 LYS C CB  1 
ATOM 3795  C CG  . LYS C 1 106 ? 127.404 75.535  122.012 1.00 30.00  ? 106 LYS C CG  1 
ATOM 3796  C CD  . LYS C 1 106 ? 127.167 74.336  122.919 1.00 30.00  ? 106 LYS C CD  1 
ATOM 3797  C CE  . LYS C 1 106 ? 127.743 73.063  122.331 1.00 30.00  ? 106 LYS C CE  1 
ATOM 3798  N NZ  . LYS C 1 106 ? 129.229 73.100  122.308 1.00 30.00  ? 106 LYS C NZ  1 
ATOM 3799  N N   . TYR C 1 107 ? 128.830 77.559  119.904 1.00 113.92 ? 107 TYR C N   1 
ATOM 3800  C CA  . TYR C 1 107 ? 130.192 77.764  119.426 1.00 120.86 ? 107 TYR C CA  1 
ATOM 3801  C C   . TYR C 1 107 ? 130.965 76.450  119.382 1.00 104.10 ? 107 TYR C C   1 
ATOM 3802  O O   . TYR C 1 107 ? 130.717 75.536  120.171 1.00 105.66 ? 107 TYR C O   1 
ATOM 3803  C CB  . TYR C 1 107 ? 130.917 78.772  120.319 1.00 30.00  ? 107 TYR C CB  1 
ATOM 3804  C CG  . TYR C 1 107 ? 132.323 79.080  119.869 1.00 30.00  ? 107 TYR C CG  1 
ATOM 3805  C CD1 . TYR C 1 107 ? 132.548 79.893  118.777 1.00 30.00  ? 107 TYR C CD1 1 
ATOM 3806  C CD2 . TYR C 1 107 ? 133.422 78.539  120.524 1.00 30.00  ? 107 TYR C CD2 1 
ATOM 3807  C CE1 . TYR C 1 107 ? 133.821 80.173  118.359 1.00 30.00  ? 107 TYR C CE1 1 
ATOM 3808  C CE2 . TYR C 1 107 ? 134.707 78.815  120.104 1.00 30.00  ? 107 TYR C CE2 1 
ATOM 3809  C CZ  . TYR C 1 107 ? 134.897 79.633  119.018 1.00 30.00  ? 107 TYR C CZ  1 
ATOM 3810  O OH  . TYR C 1 107 ? 136.167 79.921  118.587 1.00 30.00  ? 107 TYR C OH  1 
ATOM 3811  N N   . GLU C 1 108 ? 131.894 76.355  118.436 1.00 101.18 ? 108 GLU C N   1 
ATOM 3812  C CA  . GLU C 1 108 ? 132.777 75.210  118.313 1.00 107.42 ? 108 GLU C CA  1 
ATOM 3813  C C   . GLU C 1 108 ? 134.222 75.680  118.328 1.00 97.36  ? 108 GLU C C   1 
ATOM 3814  O O   . GLU C 1 108 ? 134.562 76.687  117.702 1.00 99.71  ? 108 GLU C O   1 
ATOM 3815  C CB  . GLU C 1 108 ? 132.490 74.439  117.028 1.00 30.00  ? 108 GLU C CB  1 
ATOM 3816  C CG  . GLU C 1 108 ? 133.333 73.186  116.801 1.00 30.00  ? 108 GLU C CG  1 
ATOM 3817  C CD  . GLU C 1 108 ? 133.071 72.079  117.812 1.00 30.00  ? 108 GLU C CD  1 
ATOM 3818  O OE1 . GLU C 1 108 ? 131.961 72.029  118.380 1.00 30.00  ? 108 GLU C OE1 1 
ATOM 3819  O OE2 . GLU C 1 108 ? 133.977 71.247  118.033 1.00 30.00  ? 108 GLU C OE2 1 
ATOM 3820  N N   . LYS C 1 109 ? 135.068 74.942  119.044 1.00 87.60  ? 109 LYS C N   1 
ATOM 3821  C CA  . LYS C 1 109 ? 136.497 75.202  119.077 1.00 83.82  ? 109 LYS C CA  1 
ATOM 3822  C C   . LYS C 1 109 ? 137.161 74.644  117.819 1.00 93.03  ? 109 LYS C C   1 
ATOM 3823  O O   . LYS C 1 109 ? 136.498 74.159  116.897 1.00 117.66 ? 109 LYS C O   1 
ATOM 3824  C CB  . LYS C 1 109 ? 137.116 74.582  120.326 1.00 30.00  ? 109 LYS C CB  1 
ATOM 3825  C CG  . LYS C 1 109 ? 136.588 75.137  121.635 1.00 30.00  ? 109 LYS C CG  1 
ATOM 3826  C CD  . LYS C 1 109 ? 137.214 74.413  122.821 1.00 30.00  ? 109 LYS C CD  1 
ATOM 3827  C CE  . LYS C 1 109 ? 136.638 74.891  124.148 1.00 30.00  ? 109 LYS C CE  1 
ATOM 3828  N NZ  . LYS C 1 109 ? 137.221 74.159  125.309 1.00 30.00  ? 109 LYS C NZ  1 
ATOM 3829  N N   . THR C 1 110 ? 138.495 74.715  117.802 1.00 94.95  ? 110 THR C N   1 
ATOM 3830  C CA  . THR C 1 110 ? 139.379 74.144  116.770 1.00 121.68 ? 110 THR C CA  1 
ATOM 3831  C C   . THR C 1 110 ? 139.017 74.609  115.361 1.00 133.18 ? 110 THR C C   1 
ATOM 3832  O O   . THR C 1 110 ? 139.127 73.858  114.390 1.00 143.94 ? 110 THR C O   1 
ATOM 3833  C CB  . THR C 1 110 ? 139.404 72.612  116.823 1.00 30.00  ? 110 THR C CB  1 
ATOM 3834  O OG1 . THR C 1 110 ? 138.135 72.088  116.416 1.00 30.00  ? 110 THR C OG1 1 
ATOM 3835  C CG2 . THR C 1 110 ? 139.717 72.130  118.228 1.00 30.00  ? 110 THR C CG2 1 
ATOM 3836  N N   . ALA C 1 111 ? 138.551 75.854  115.249 1.00 106.50 ? 111 ALA C N   1 
ATOM 3837  C CA  . ALA C 1 111 ? 138.160 76.351  113.931 1.00 107.45 ? 111 ALA C CA  1 
ATOM 3838  C C   . ALA C 1 111 ? 138.473 77.846  113.827 1.00 124.52 ? 111 ALA C C   1 
ATOM 3839  O O   . ALA C 1 111 ? 137.596 78.671  114.070 1.00 140.43 ? 111 ALA C O   1 
ATOM 3840  C CB  . ALA C 1 111 ? 136.682 76.077  113.693 1.00 30.00  ? 111 ALA C CB  1 
ATOM 3841  N N   . TYR C 1 112 ? 139.695 78.188  113.395 1.00 30.00  ? 112 TYR C N   1 
ATOM 3842  C CA  . TYR C 1 112 ? 139.987 79.581  113.054 1.00 30.00  ? 112 TYR C CA  1 
ATOM 3843  C C   . TYR C 1 112 ? 140.329 79.804  111.588 1.00 30.00  ? 112 TYR C C   1 
ATOM 3844  O O   . TYR C 1 112 ? 139.517 80.412  110.891 1.00 30.00  ? 112 TYR C O   1 
ATOM 3845  C CB  . TYR C 1 112 ? 141.115 80.153  113.919 1.00 30.00  ? 112 TYR C CB  1 
ATOM 3846  C CG  . TYR C 1 112 ? 140.653 80.676  115.250 1.00 30.00  ? 112 TYR C CG  1 
ATOM 3847  C CD1 . TYR C 1 112 ? 139.308 80.803  115.520 1.00 30.00  ? 112 TYR C CD1 1 
ATOM 3848  C CD2 . TYR C 1 112 ? 141.559 81.114  116.205 1.00 30.00  ? 112 TYR C CD2 1 
ATOM 3849  C CE1 . TYR C 1 112 ? 138.867 81.287  116.705 1.00 30.00  ? 112 TYR C CE1 1 
ATOM 3850  C CE2 . TYR C 1 112 ? 141.121 81.619  117.411 1.00 30.00  ? 112 TYR C CE2 1 
ATOM 3851  C CZ  . TYR C 1 112 ? 139.765 81.696  117.646 1.00 30.00  ? 112 TYR C CZ  1 
ATOM 3852  O OH  . TYR C 1 112 ? 139.258 82.181  118.818 1.00 30.00  ? 112 TYR C OH  1 
ATOM 3853  N N   . HIS C 1 113 ? 141.451 79.275  111.087 1.00 30.00  ? 113 HIS C N   1 
ATOM 3854  C CA  . HIS C 1 113 ? 141.926 79.498  109.709 1.00 30.00  ? 113 HIS C CA  1 
ATOM 3855  C C   . HIS C 1 113 ? 141.972 80.993  109.347 1.00 30.00  ? 113 HIS C C   1 
ATOM 3856  O O   . HIS C 1 113 ? 141.128 81.523  108.623 1.00 30.00  ? 113 HIS C O   1 
ATOM 3857  C CB  . HIS C 1 113 ? 141.098 78.667  108.716 1.00 30.00  ? 113 HIS C CB  1 
ATOM 3858  C CG  . HIS C 1 113 ? 141.428 78.915  107.280 1.00 30.00  ? 113 HIS C CG  1 
ATOM 3859  N ND1 . HIS C 1 113 ? 142.647 78.594  106.725 1.00 30.00  ? 113 HIS C ND1 1 
ATOM 3860  C CD2 . HIS C 1 113 ? 140.693 79.465  106.287 1.00 30.00  ? 113 HIS C CD2 1 
ATOM 3861  C CE1 . HIS C 1 113 ? 142.649 78.941  105.451 1.00 30.00  ? 113 HIS C CE1 1 
ATOM 3862  N NE2 . HIS C 1 113 ? 141.473 79.466  105.158 1.00 30.00  ? 113 HIS C NE2 1 
ATOM 3863  N N   . LYS C 1 114 ? 142.912 81.708  109.960 1.00 30.00  ? 114 LYS C N   1 
ATOM 3864  C CA  . LYS C 1 114 ? 142.985 83.151  109.769 1.00 30.00  ? 114 LYS C CA  1 
ATOM 3865  C C   . LYS C 1 114 ? 144.173 83.616  108.936 1.00 30.00  ? 114 LYS C C   1 
ATOM 3866  O O   . LYS C 1 114 ? 144.425 84.823  108.878 1.00 30.00  ? 114 LYS C O   1 
ATOM 3867  C CB  . LYS C 1 114 ? 143.009 83.861  111.125 1.00 30.00  ? 114 LYS C CB  1 
ATOM 3868  C CG  . LYS C 1 114 ? 144.237 83.589  111.965 1.00 30.00  ? 114 LYS C CG  1 
ATOM 3869  C CD  . LYS C 1 114 ? 144.168 84.340  113.289 1.00 30.00  ? 114 LYS C CD  1 
ATOM 3870  C CE  . LYS C 1 114 ? 145.418 84.107  114.123 1.00 30.00  ? 114 LYS C CE  1 
ATOM 3871  N NZ  . LYS C 1 114 ? 145.377 84.837  115.417 1.00 30.00  ? 114 LYS C NZ  1 
ATOM 3872  N N   . GLY C 1 115 ? 144.903 82.713  108.283 1.00 30.00  ? 115 GLY C N   1 
ATOM 3873  C CA  . GLY C 1 115 ? 146.083 83.126  107.539 1.00 30.00  ? 115 GLY C CA  1 
ATOM 3874  C C   . GLY C 1 115 ? 146.038 82.971  106.030 1.00 30.00  ? 115 GLY C C   1 
ATOM 3875  O O   . GLY C 1 115 ? 146.593 83.799  105.302 1.00 30.00  ? 115 GLY C O   1 
ATOM 3876  N N   . ALA C 1 116 ? 145.376 81.922  105.546 1.00 30.00  ? 116 ALA C N   1 
ATOM 3877  C CA  . ALA C 1 116 ? 145.260 81.623  104.118 1.00 30.00  ? 116 ALA C CA  1 
ATOM 3878  C C   . ALA C 1 116 ? 143.881 81.990  103.591 1.00 30.00  ? 116 ALA C C   1 
ATOM 3879  O O   . ALA C 1 116 ? 143.288 81.274  102.780 1.00 30.00  ? 116 ALA C O   1 
ATOM 3880  C CB  . ALA C 1 116 ? 145.569 80.155  103.851 1.00 30.00  ? 116 ALA C CB  1 
ATOM 3881  N N   . VAL C 1 117 ? 143.372 83.136  104.038 1.00 30.00  ? 117 VAL C N   1 
ATOM 3882  C CA  . VAL C 1 117 ? 141.962 83.510  103.996 1.00 30.00  ? 117 VAL C CA  1 
ATOM 3883  C C   . VAL C 1 117 ? 141.543 83.985  102.601 1.00 30.00  ? 117 VAL C C   1 
ATOM 3884  O O   . VAL C 1 117 ? 140.389 84.367  102.380 1.00 30.00  ? 117 VAL C O   1 
ATOM 3885  C CB  . VAL C 1 117 ? 141.726 84.579  105.086 1.00 30.00  ? 117 VAL C CB  1 
ATOM 3886  C CG1 . VAL C 1 117 ? 142.376 85.901  104.703 1.00 30.00  ? 117 VAL C CG1 1 
ATOM 3887  C CG2 . VAL C 1 117 ? 140.256 84.705  105.528 1.00 30.00  ? 117 VAL C CG2 1 
ATOM 3888  N N   . GLY C 1 118 ? 142.460 83.922  101.633 1.00 30.00  ? 118 GLY C N   1 
ATOM 3889  C CA  . GLY C 1 118 ? 142.193 84.415  100.289 1.00 30.00  ? 118 GLY C CA  1 
ATOM 3890  C C   . GLY C 1 118 ? 141.149 83.639  99.518  1.00 30.00  ? 118 GLY C C   1 
ATOM 3891  O O   . GLY C 1 118 ? 140.627 84.150  98.525  1.00 30.00  ? 118 GLY C O   1 
ATOM 3892  N N   . ASP C 1 119 ? 140.837 82.423  99.943  1.00 30.00  ? 119 ASP C N   1 
ATOM 3893  C CA  . ASP C 1 119 ? 139.694 81.669  99.444  1.00 30.00  ? 119 ASP C CA  1 
ATOM 3894  C C   . ASP C 1 119 ? 138.883 81.268  100.669 1.00 30.00  ? 119 ASP C C   1 
ATOM 3895  O O   . ASP C 1 119 ? 139.288 80.366  101.409 1.00 30.00  ? 119 ASP C O   1 
ATOM 3896  C CB  . ASP C 1 119 ? 140.138 80.446  98.642  1.00 30.00  ? 119 ASP C CB  1 
ATOM 3897  C CG  . ASP C 1 119 ? 140.855 80.813  97.349  1.00 30.00  ? 119 ASP C CG  1 
ATOM 3898  O OD1 . ASP C 1 119 ? 140.551 81.874  96.772  1.00 30.00  ? 119 ASP C OD1 1 
ATOM 3899  O OD2 . ASP C 1 119 ? 141.726 80.036  96.904  1.00 30.00  ? 119 ASP C OD2 1 
ATOM 3900  N N   . VAL C 1 120 ? 137.749 81.947  100.882 1.00 30.00  ? 120 VAL C N   1 
ATOM 3901  C CA  . VAL C 1 120 ? 137.027 81.847  102.151 1.00 30.00  ? 120 VAL C CA  1 
ATOM 3902  C C   . VAL C 1 120 ? 136.417 80.461  102.318 1.00 30.00  ? 120 VAL C C   1 
ATOM 3903  O O   . VAL C 1 120 ? 136.406 79.894  103.418 1.00 30.00  ? 120 VAL C O   1 
ATOM 3904  C CB  . VAL C 1 120 ? 135.955 82.949  102.234 1.00 30.00  ? 120 VAL C CB  1 
ATOM 3905  C CG1 . VAL C 1 120 ? 135.231 82.911  103.561 1.00 30.00  ? 120 VAL C CG1 1 
ATOM 3906  C CG2 . VAL C 1 120 ? 136.571 84.304  102.011 1.00 30.00  ? 120 VAL C CG2 1 
ATOM 3907  N N   . PHE C 1 121 ? 135.957 79.870  101.220 1.00 30.00  ? 121 PHE C N   1 
ATOM 3908  C CA  . PHE C 1 121 ? 135.259 78.594  101.238 1.00 30.00  ? 121 PHE C CA  1 
ATOM 3909  C C   . PHE C 1 121 ? 136.188 77.419  100.976 1.00 30.00  ? 121 PHE C C   1 
ATOM 3910  O O   . PHE C 1 121 ? 135.722 76.317  100.670 1.00 30.00  ? 121 PHE C O   1 
ATOM 3911  C CB  . PHE C 1 121 ? 134.131 78.632  100.217 1.00 30.00  ? 121 PHE C CB  1 
ATOM 3912  C CG  . PHE C 1 121 ? 133.040 79.566  100.587 1.00 30.00  ? 121 PHE C CG  1 
ATOM 3913  C CD1 . PHE C 1 121 ? 132.763 79.825  101.913 1.00 30.00  ? 121 PHE C CD1 1 
ATOM 3914  C CD2 . PHE C 1 121 ? 132.357 80.261  99.617  1.00 30.00  ? 121 PHE C CD2 1 
ATOM 3915  C CE1 . PHE C 1 121 ? 131.774 80.698  102.260 1.00 30.00  ? 121 PHE C CE1 1 
ATOM 3916  C CE2 . PHE C 1 121 ? 131.365 81.140  99.960  1.00 30.00  ? 121 PHE C CE2 1 
ATOM 3917  C CZ  . PHE C 1 121 ? 131.076 81.356  101.282 1.00 30.00  ? 121 PHE C CZ  1 
ATOM 3918  N N   . ASN C 1 122 ? 137.495 77.641  101.068 1.00 30.00  ? 122 ASN C N   1 
ATOM 3919  C CA  . ASN C 1 122 ? 138.442 76.542  100.987 1.00 30.00  ? 122 ASN C CA  1 
ATOM 3920  C C   . ASN C 1 122 ? 138.284 75.663  102.221 1.00 30.00  ? 122 ASN C C   1 
ATOM 3921  O O   . ASN C 1 122 ? 138.164 76.163  103.343 1.00 30.00  ? 122 ASN C O   1 
ATOM 3922  C CB  . ASN C 1 122 ? 139.870 77.080  100.883 1.00 30.00  ? 122 ASN C CB  1 
ATOM 3923  C CG  . ASN C 1 122 ? 140.872 76.021  100.451 1.00 30.00  ? 122 ASN C CG  1 
ATOM 3924  O OD1 . ASN C 1 122 ? 140.511 74.880  100.161 1.00 30.00  ? 122 ASN C OD1 1 
ATOM 3925  N ND2 . ASN C 1 122 ? 142.144 76.398  100.410 1.00 30.00  ? 122 ASN C ND2 1 
ATOM 3926  N N   . ALA C 1 123 ? 138.286 74.344  102.013 1.00 30.00  ? 123 ALA C N   1 
ATOM 3927  C CA  . ALA C 1 123 ? 137.950 73.387  103.065 1.00 30.00  ? 123 ALA C CA  1 
ATOM 3928  C C   . ALA C 1 123 ? 139.073 73.233  104.083 1.00 30.00  ? 123 ALA C C   1 
ATOM 3929  O O   . ALA C 1 123 ? 139.612 72.137  104.263 1.00 30.00  ? 123 ALA C O   1 
ATOM 3930  C CB  . ALA C 1 123 ? 137.612 72.026  102.453 1.00 30.00  ? 123 ALA C CB  1 
ATOM 3931  N N   . SER C 1 124 ? 139.400 74.318  104.773 1.00 30.00  ? 124 SER C N   1 
ATOM 3932  C CA  . SER C 1 124 ? 140.581 74.411  105.612 1.00 30.00  ? 124 SER C CA  1 
ATOM 3933  C C   . SER C 1 124 ? 140.250 73.996  107.039 1.00 30.00  ? 124 SER C C   1 
ATOM 3934  O O   . SER C 1 124 ? 139.224 73.366  107.306 1.00 30.00  ? 124 SER C O   1 
ATOM 3935  C CB  . SER C 1 124 ? 141.154 75.819  105.565 1.00 30.00  ? 124 SER C CB  1 
ATOM 3936  O OG  . SER C 1 124 ? 142.267 75.934  106.430 1.00 30.00  ? 124 SER C OG  1 
ATOM 3937  N N   . THR C 1 125 ? 141.144 74.350  107.970 1.00 30.00  ? 125 THR C N   1 
ATOM 3938  C CA  . THR C 1 125 ? 141.078 73.905  109.358 1.00 30.00  ? 125 THR C CA  1 
ATOM 3939  C C   . THR C 1 125 ? 139.841 74.393  110.097 1.00 30.00  ? 125 THR C C   1 
ATOM 3940  O O   . THR C 1 125 ? 139.517 73.841  111.153 1.00 30.00  ? 125 THR C O   1 
ATOM 3941  C CB  . THR C 1 125 ? 142.314 74.379  110.115 1.00 30.00  ? 125 THR C CB  1 
ATOM 3942  O OG1 . THR C 1 125 ? 142.331 75.811  110.132 1.00 30.00  ? 125 THR C OG1 1 
ATOM 3943  C CG2 . THR C 1 125 ? 143.576 73.876  109.435 1.00 30.00  ? 125 THR C CG2 1 
ATOM 3944  N N   . ALA C 1 126 ? 139.151 75.406  109.584 1.00 30.00  ? 126 ALA C N   1 
ATOM 3945  C CA  . ALA C 1 126 ? 137.962 75.924  110.240 1.00 30.00  ? 126 ALA C CA  1 
ATOM 3946  C C   . ALA C 1 126 ? 136.670 75.510  109.563 1.00 30.00  ? 126 ALA C C   1 
ATOM 3947  O O   . ALA C 1 126 ? 135.766 76.338  109.416 1.00 30.00  ? 126 ALA C O   1 
ATOM 3948  C CB  . ALA C 1 126 ? 138.032 77.439  110.332 1.00 30.00  ? 126 ALA C CB  1 
ATOM 3949  N N   . TRP C 1 127 ? 136.579 74.259  109.124 1.00 30.00  ? 127 TRP C N   1 
ATOM 3950  C CA  . TRP C 1 127 ? 135.362 73.714  108.543 1.00 30.00  ? 127 TRP C CA  1 
ATOM 3951  C C   . TRP C 1 127 ? 135.086 72.297  109.015 1.00 30.00  ? 127 TRP C C   1 
ATOM 3952  O O   . TRP C 1 127 ? 134.165 71.653  108.504 1.00 30.00  ? 127 TRP C O   1 
ATOM 3953  C CB  . TRP C 1 127 ? 135.454 73.748  107.023 1.00 30.00  ? 127 TRP C CB  1 
ATOM 3954  C CG  . TRP C 1 127 ? 135.384 75.114  106.446 1.00 30.00  ? 127 TRP C CG  1 
ATOM 3955  C CD1 . TRP C 1 127 ? 136.417 75.982  106.262 1.00 30.00  ? 127 TRP C CD1 1 
ATOM 3956  C CD2 . TRP C 1 127 ? 134.231 75.739  105.887 1.00 30.00  ? 127 TRP C CD2 1 
ATOM 3957  N NE1 . TRP C 1 127 ? 135.966 77.132  105.663 1.00 30.00  ? 127 TRP C NE1 1 
ATOM 3958  C CE2 . TRP C 1 127 ? 134.626 77.004  105.418 1.00 30.00  ? 127 TRP C CE2 1 
ATOM 3959  C CE3 . TRP C 1 127 ? 132.900 75.358  105.750 1.00 30.00  ? 127 TRP C CE3 1 
ATOM 3960  C CZ2 . TRP C 1 127 ? 133.738 77.886  104.825 1.00 30.00  ? 127 TRP C CZ2 1 
ATOM 3961  C CZ3 . TRP C 1 127 ? 132.025 76.236  105.177 1.00 30.00  ? 127 TRP C CZ3 1 
ATOM 3962  C CH2 . TRP C 1 127 ? 132.447 77.475  104.694 1.00 30.00  ? 127 TRP C CH2 1 
ATOM 3963  N N   . ASN C 1 128 ? 135.866 71.788  109.963 1.00 30.00  ? 128 ASN C N   1 
ATOM 3964  C CA  . ASN C 1 128 ? 135.595 70.489  110.569 1.00 30.00  ? 128 ASN C CA  1 
ATOM 3965  C C   . ASN C 1 128 ? 134.603 70.735  111.694 1.00 30.00  ? 128 ASN C C   1 
ATOM 3966  O O   . ASN C 1 128 ? 134.959 70.771  112.872 1.00 30.00  ? 128 ASN C O   1 
ATOM 3967  C CB  . ASN C 1 128 ? 136.877 69.841  111.074 1.00 30.00  ? 128 ASN C CB  1 
ATOM 3968  C CG  . ASN C 1 128 ? 136.687 68.382  111.471 1.00 30.00  ? 128 ASN C CG  1 
ATOM 3969  O OD1 . ASN C 1 128 ? 135.600 67.819  111.336 1.00 30.00  ? 128 ASN C OD1 1 
ATOM 3970  N ND2 . ASN C 1 128 ? 137.753 67.764  111.968 1.00 30.00  ? 128 ASN C ND2 1 
ATOM 3971  N N   . LEU C 1 129 ? 133.340 70.912  111.322 1.00 30.00  ? 129 LEU C N   1 
ATOM 3972  C CA  . LEU C 1 129 ? 132.304 71.239  112.286 1.00 30.00  ? 129 LEU C CA  1 
ATOM 3973  C C   . LEU C 1 129 ? 131.090 70.365  112.010 1.00 30.00  ? 129 LEU C C   1 
ATOM 3974  O O   . LEU C 1 129 ? 131.034 69.631  111.022 1.00 30.00  ? 129 LEU C O   1 
ATOM 3975  C CB  . LEU C 1 129 ? 131.980 72.739  112.249 1.00 30.00  ? 129 LEU C CB  1 
ATOM 3976  C CG  . LEU C 1 129 ? 131.410 73.418  111.002 1.00 30.00  ? 129 LEU C CG  1 
ATOM 3977  C CD1 . LEU C 1 129 ? 129.903 73.473  111.049 1.00 30.00  ? 129 LEU C CD1 1 
ATOM 3978  C CD2 . LEU C 1 129 ? 131.985 74.806  110.832 1.00 30.00  ? 129 LEU C CD2 1 
ATOM 3979  N N   . SER C 1 130 ? 130.113 70.458  112.903 1.00 30.00  ? 130 SER C N   1 
ATOM 3980  C CA  . SER C 1 130 ? 128.964 69.564  112.885 1.00 30.00  ? 130 SER C CA  1 
ATOM 3981  C C   . SER C 1 130 ? 127.670 70.364  112.929 1.00 30.00  ? 130 SER C C   1 
ATOM 3982  O O   . SER C 1 130 ? 127.677 71.561  112.624 1.00 30.00  ? 130 SER C O   1 
ATOM 3983  C CB  . SER C 1 130 ? 129.033 68.562  114.040 1.00 30.00  ? 130 SER C CB  1 
ATOM 3984  O OG  . SER C 1 130 ? 128.931 69.205  115.295 1.00 30.00  ? 130 SER C OG  1 
ATOM 3985  N N   . ASN C 1 131 ? 126.567 69.678  113.254 1.00 30.00  ? 131 ASN C N   1 
ATOM 3986  C CA  . ASN C 1 131 ? 125.211 70.221  113.150 1.00 30.00  ? 131 ASN C CA  1 
ATOM 3987  C C   . ASN C 1 131 ? 125.034 71.506  113.954 1.00 30.00  ? 131 ASN C C   1 
ATOM 3988  O O   . ASN C 1 131 ? 124.695 72.558  113.402 1.00 30.00  ? 131 ASN C O   1 
ATOM 3989  C CB  . ASN C 1 131 ? 124.211 69.173  113.633 1.00 30.00  ? 131 ASN C CB  1 
ATOM 3990  C CG  . ASN C 1 131 ? 124.237 67.920  112.800 1.00 30.00  ? 131 ASN C CG  1 
ATOM 3991  O OD1 . ASN C 1 131 ? 124.358 67.975  111.580 1.00 30.00  ? 131 ASN C OD1 1 
ATOM 3992  N ND2 . ASN C 1 131 ? 124.129 66.774  113.459 1.00 30.00  ? 131 ASN C ND2 1 
ATOM 3993  N N   . THR C 1 132 ? 125.282 71.442  115.259 1.00 30.00  ? 132 THR C N   1 
ATOM 3994  C CA  . THR C 1 132 ? 124.968 72.532  116.181 1.00 30.00  ? 132 THR C CA  1 
ATOM 3995  C C   . THR C 1 132 ? 126.154 73.463  116.374 1.00 30.00  ? 132 THR C C   1 
ATOM 3996  O O   . THR C 1 132 ? 126.329 74.045  117.447 1.00 30.00  ? 132 THR C O   1 
ATOM 3997  C CB  . THR C 1 132 ? 124.527 71.969  117.524 1.00 30.00  ? 132 THR C CB  1 
ATOM 3998  O OG1 . THR C 1 132 ? 125.654 71.378  118.176 1.00 30.00  ? 132 THR C OG1 1 
ATOM 3999  C CG2 . THR C 1 132 ? 123.500 70.889  117.313 1.00 30.00  ? 132 THR C CG2 1 
ATOM 4000  N N   . ASN C 1 133 ? 126.985 73.622  115.351 1.00 30.00  ? 133 ASN C N   1 
ATOM 4001  C CA  . ASN C 1 133 ? 128.235 74.347  115.475 1.00 30.00  ? 133 ASN C CA  1 
ATOM 4002  C C   . ASN C 1 133 ? 128.351 75.391  114.375 1.00 30.00  ? 133 ASN C C   1 
ATOM 4003  O O   . ASN C 1 133 ? 127.758 75.258  113.305 1.00 30.00  ? 133 ASN C O   1 
ATOM 4004  C CB  . ASN C 1 133 ? 129.413 73.382  115.419 1.00 30.00  ? 133 ASN C CB  1 
ATOM 4005  C CG  . ASN C 1 133 ? 129.403 72.402  116.565 1.00 30.00  ? 133 ASN C CG  1 
ATOM 4006  O OD1 . ASN C 1 133 ? 129.274 71.198  116.368 1.00 30.00  ? 133 ASN C OD1 1 
ATOM 4007  N ND2 . ASN C 1 133 ? 129.522 72.917  117.779 1.00 30.00  ? 133 ASN C ND2 1 
ATOM 4008  N N   . PHE C 1 134 ? 129.125 76.440  114.648 1.00 30.00  ? 134 PHE C N   1 
ATOM 4009  C CA  . PHE C 1 134 ? 129.408 77.442  113.635 1.00 30.00  ? 134 PHE C CA  1 
ATOM 4010  C C   . PHE C 1 134 ? 130.889 77.793  113.646 1.00 30.00  ? 134 PHE C C   1 
ATOM 4011  O O   . PHE C 1 134 ? 131.518 77.857  114.703 1.00 30.00  ? 134 PHE C O   1 
ATOM 4012  C CB  . PHE C 1 134 ? 128.538 78.704  113.803 1.00 30.00  ? 134 PHE C CB  1 
ATOM 4013  C CG  . PHE C 1 134 ? 128.719 79.430  115.112 1.00 30.00  ? 134 PHE C CG  1 
ATOM 4014  C CD1 . PHE C 1 134 ? 127.943 79.106  116.206 1.00 30.00  ? 134 PHE C CD1 1 
ATOM 4015  C CD2 . PHE C 1 134 ? 129.621 80.478  115.230 1.00 30.00  ? 134 PHE C CD2 1 
ATOM 4016  C CE1 . PHE C 1 134 ? 128.084 79.790  117.398 1.00 30.00  ? 134 PHE C CE1 1 
ATOM 4017  C CE2 . PHE C 1 134 ? 129.771 81.156  116.425 1.00 30.00  ? 134 PHE C CE2 1 
ATOM 4018  C CZ  . PHE C 1 134 ? 129.006 80.809  117.508 1.00 30.00  ? 134 PHE C CZ  1 
ATOM 4019  N N   . GLY C 1 135 ? 131.437 78.022  112.447 1.00 30.00  ? 135 GLY C N   1 
ATOM 4020  C CA  . GLY C 1 135 ? 132.827 78.386  112.281 1.00 30.00  ? 135 GLY C CA  1 
ATOM 4021  C C   . GLY C 1 135 ? 133.026 79.885  112.367 1.00 30.00  ? 135 GLY C C   1 
ATOM 4022  O O   . GLY C 1 135 ? 132.112 80.663  112.132 1.00 30.00  ? 135 GLY C O   1 
ATOM 4023  N N   . ILE C 1 136 ? 134.235 80.286  112.746 1.00 30.00  ? 136 ILE C N   1 
ATOM 4024  C CA  . ILE C 1 136 ? 134.456 81.648  113.212 1.00 30.00  ? 136 ILE C CA  1 
ATOM 4025  C C   . ILE C 1 136 ? 135.700 82.284  112.563 1.00 30.00  ? 136 ILE C C   1 
ATOM 4026  O O   . ILE C 1 136 ? 136.512 82.928  113.241 1.00 30.00  ? 136 ILE C O   1 
ATOM 4027  C CB  . ILE C 1 136 ? 134.433 81.639  114.759 1.00 30.00  ? 136 ILE C CB  1 
ATOM 4028  C CG1 . ILE C 1 136 ? 134.211 83.036  115.342 1.00 30.00  ? 136 ILE C CG1 1 
ATOM 4029  C CG2 . ILE C 1 136 ? 135.568 80.824  115.374 1.00 30.00  ? 136 ILE C CG2 1 
ATOM 4030  C CD1 . ILE C 1 136 ? 132.919 83.605  114.883 1.00 30.00  ? 136 ILE C CD1 1 
ATOM 4031  N N   . ILE C 1 137 ? 135.901 82.041  111.255 1.00 30.00  ? 137 ILE C N   1 
ATOM 4032  C CA  . ILE C 1 137 ? 137.099 82.527  110.560 1.00 30.00  ? 137 ILE C CA  1 
ATOM 4033  C C   . ILE C 1 137 ? 137.172 84.045  110.645 1.00 30.00  ? 137 ILE C C   1 
ATOM 4034  O O   . ILE C 1 137 ? 136.172 84.751  110.466 1.00 30.00  ? 137 ILE C O   1 
ATOM 4035  C CB  . ILE C 1 137 ? 137.146 81.996  109.112 1.00 30.00  ? 137 ILE C CB  1 
ATOM 4036  C CG1 . ILE C 1 137 ? 136.152 82.628  108.140 1.00 30.00  ? 137 ILE C CG1 1 
ATOM 4037  C CG2 . ILE C 1 137 ? 136.739 80.576  109.084 1.00 30.00  ? 137 ILE C CG2 1 
ATOM 4038  C CD1 . ILE C 1 137 ? 136.751 83.706  107.251 1.00 30.00  ? 137 ILE C CD1 1 
ATOM 4039  N N   . VAL C 1 138 ? 138.330 84.548  111.050 1.00 30.00  ? 138 VAL C N   1 
ATOM 4040  C CA  . VAL C 1 138 ? 138.430 85.905  111.563 1.00 30.00  ? 138 VAL C CA  1 
ATOM 4041  C C   . VAL C 1 138 ? 139.308 86.730  110.635 1.00 30.00  ? 138 VAL C C   1 
ATOM 4042  O O   . VAL C 1 138 ? 140.313 86.247  110.102 1.00 30.00  ? 138 VAL C O   1 
ATOM 4043  C CB  . VAL C 1 138 ? 138.931 85.920  113.029 1.00 30.00  ? 138 VAL C CB  1 
ATOM 4044  C CG1 . VAL C 1 138 ? 140.334 85.354  113.175 1.00 30.00  ? 138 VAL C CG1 1 
ATOM 4045  C CG2 . VAL C 1 138 ? 138.835 87.309  113.634 1.00 30.00  ? 138 VAL C CG2 1 
ATOM 4046  N N   . LEU C 1 139 ? 138.870 87.954  110.381 1.00 30.00  ? 139 LEU C N   1 
ATOM 4047  C CA  . LEU C 1 139 ? 139.593 88.908  109.569 1.00 30.00  ? 139 LEU C CA  1 
ATOM 4048  C C   . LEU C 1 139 ? 139.336 90.293  110.139 1.00 30.00  ? 139 LEU C C   1 
ATOM 4049  O O   . LEU C 1 139 ? 138.276 90.554  110.711 1.00 30.00  ? 139 LEU C O   1 
ATOM 4050  C CB  . LEU C 1 139 ? 139.186 88.789  108.087 1.00 30.00  ? 139 LEU C CB  1 
ATOM 4051  C CG  . LEU C 1 139 ? 137.724 88.892  107.629 1.00 30.00  ? 139 LEU C CG  1 
ATOM 4052  C CD1 . LEU C 1 139 ? 137.276 90.316  107.342 1.00 30.00  ? 139 LEU C CD1 1 
ATOM 4053  C CD2 . LEU C 1 139 ? 137.493 88.016  106.413 1.00 30.00  ? 139 LEU C CD2 1 
ATOM 4054  N N   . GLN C 1 140 ? 140.330 91.168  109.976 1.00 30.00  ? 140 GLN C N   1 
ATOM 4055  C CA  . GLN C 1 140 ? 140.386 92.504  110.577 1.00 30.00  ? 140 GLN C CA  1 
ATOM 4056  C C   . GLN C 1 140 ? 140.201 92.421  112.097 1.00 30.00  ? 140 GLN C C   1 
ATOM 4057  O O   . GLN C 1 140 ? 139.194 92.833  112.666 1.00 30.00  ? 140 GLN C O   1 
ATOM 4058  C CB  . GLN C 1 140 ? 139.371 93.458  109.930 1.00 30.00  ? 140 GLN C CB  1 
ATOM 4059  C CG  . GLN C 1 140 ? 139.550 94.933  110.300 1.00 30.00  ? 140 GLN C CG  1 
ATOM 4060  C CD  . GLN C 1 140 ? 138.498 95.826  109.682 1.00 30.00  ? 140 GLN C CD  1 
ATOM 4061  O OE1 . GLN C 1 140 ? 137.590 95.356  109.002 1.00 30.00  ? 140 GLN C OE1 1 
ATOM 4062  N NE2 . GLN C 1 140 ? 138.611 97.123  109.921 1.00 30.00  ? 140 GLN C NE2 1 
ATOM 4063  N N   . ASP C 1 141 ? 141.181 91.795  112.737 1.00 30.00  ? 141 ASP C N   1 
ATOM 4064  C CA  . ASP C 1 141 ? 141.322 91.865  114.183 1.00 30.00  ? 141 ASP C CA  1 
ATOM 4065  C C   . ASP C 1 141 ? 142.451 92.832  114.510 1.00 30.00  ? 141 ASP C C   1 
ATOM 4066  O O   . ASP C 1 141 ? 143.573 92.684  114.016 1.00 30.00  ? 141 ASP C O   1 
ATOM 4067  C CB  . ASP C 1 141 ? 141.546 90.478  114.806 1.00 30.00  ? 141 ASP C CB  1 
ATOM 4068  C CG  . ASP C 1 141 ? 142.634 89.678  114.117 1.00 30.00  ? 141 ASP C CG  1 
ATOM 4069  O OD1 . ASP C 1 141 ? 143.083 90.076  113.023 1.00 30.00  ? 141 ASP C OD1 1 
ATOM 4070  O OD2 . ASP C 1 141 ? 143.047 88.640  114.680 1.00 30.00  ? 141 ASP C OD2 1 
ATOM 4071  N N   . ALA C 1 142 ? 142.138 93.842  115.315 1.00 30.00  ? 142 ALA C N   1 
ATOM 4072  C CA  . ALA C 1 142 ? 143.063 94.952  115.502 1.00 30.00  ? 142 ALA C CA  1 
ATOM 4073  C C   . ALA C 1 142 ? 144.041 94.683  116.637 1.00 30.00  ? 142 ALA C C   1 
ATOM 4074  O O   . ALA C 1 142 ? 145.257 94.630  116.426 1.00 30.00  ? 142 ALA C O   1 
ATOM 4075  C CB  . ALA C 1 142 ? 142.277 96.235  115.760 1.00 30.00  ? 142 ALA C CB  1 
ATOM 4076  N N   . ASP C 1 143 ? 143.524 94.500  117.850 1.00 30.00  ? 143 ASP C N   1 
ATOM 4077  C CA  . ASP C 1 143 ? 144.332 94.248  119.038 1.00 30.00  ? 143 ASP C CA  1 
ATOM 4078  C C   . ASP C 1 143 ? 144.486 92.754  119.295 1.00 30.00  ? 143 ASP C C   1 
ATOM 4079  O O   . ASP C 1 143 ? 144.747 92.333  120.425 1.00 30.00  ? 143 ASP C O   1 
ATOM 4080  C CB  . ASP C 1 143 ? 143.727 94.930  120.260 1.00 30.00  ? 143 ASP C CB  1 
ATOM 4081  C CG  . ASP C 1 143 ? 143.780 96.435  120.167 1.00 30.00  ? 143 ASP C CG  1 
ATOM 4082  O OD1 . ASP C 1 143 ? 144.704 96.953  119.509 1.00 30.00  ? 143 ASP C OD1 1 
ATOM 4083  O OD2 . ASP C 1 143 ? 142.898 97.100  120.750 1.00 30.00  ? 143 ASP C OD2 1 
ATOM 4084  N N   . ASN C 1 144 ? 144.338 91.960  118.226 1.00 30.00  ? 144 ASN C N   1 
ATOM 4085  C CA  . ASN C 1 144 ? 144.285 90.498  118.264 1.00 30.00  ? 144 ASN C CA  1 
ATOM 4086  C C   . ASN C 1 144 ? 143.229 90.022  119.257 1.00 30.00  ? 144 ASN C C   1 
ATOM 4087  O O   . ASN C 1 144 ? 143.448 89.108  120.050 1.00 30.00  ? 144 ASN C O   1 
ATOM 4088  C CB  . ASN C 1 144 ? 145.657 89.897  118.568 1.00 30.00  ? 144 ASN C CB  1 
ATOM 4089  C CG  . ASN C 1 144 ? 146.670 90.210  117.492 1.00 30.00  ? 144 ASN C CG  1 
ATOM 4090  O OD1 . ASN C 1 144 ? 146.349 90.215  116.307 1.00 30.00  ? 144 ASN C OD1 1 
ATOM 4091  N ND2 . ASN C 1 144 ? 147.901 90.478  117.899 1.00 30.00  ? 144 ASN C ND2 1 
ATOM 4092  N N   . SER C 1 145 ? 142.066 90.669  119.203 1.00 30.00  ? 145 SER C N   1 
ATOM 4093  C CA  . SER C 1 145 ? 141.009 90.460  120.179 1.00 30.00  ? 145 SER C CA  1 
ATOM 4094  C C   . SER C 1 145 ? 140.236 89.166  119.967 1.00 30.00  ? 145 SER C C   1 
ATOM 4095  O O   . SER C 1 145 ? 139.332 88.874  120.756 1.00 30.00  ? 145 SER C O   1 
ATOM 4096  C CB  . SER C 1 145 ? 140.051 91.653  120.158 1.00 30.00  ? 145 SER C CB  1 
ATOM 4097  O OG  . SER C 1 145 ? 139.430 91.791  118.893 1.00 30.00  ? 145 SER C OG  1 
ATOM 4098  N N   . VAL C 1 146 ? 140.555 88.390  118.933 1.00 30.00  ? 146 VAL C N   1 
ATOM 4099  C CA  . VAL C 1 146 ? 139.977 87.061  118.779 1.00 30.00  ? 146 VAL C CA  1 
ATOM 4100  C C   . VAL C 1 146 ? 141.101 86.039  118.906 1.00 30.00  ? 146 VAL C C   1 
ATOM 4101  O O   . VAL C 1 146 ? 141.763 85.694  117.921 1.00 30.00  ? 146 VAL C O   1 
ATOM 4102  C CB  . VAL C 1 146 ? 139.231 86.923  117.437 1.00 30.00  ? 146 VAL C CB  1 
ATOM 4103  C CG1 . VAL C 1 146 ? 138.594 85.545  117.300 1.00 30.00  ? 146 VAL C CG1 1 
ATOM 4104  C CG2 . VAL C 1 146 ? 138.182 88.006  117.303 1.00 30.00  ? 146 VAL C CG2 1 
ATOM 4105  N N   . ASP C 1 147 ? 141.346 85.575  120.122 1.00 30.00  ? 147 ASP C N   1 
ATOM 4106  C CA  . ASP C 1 147 ? 142.262 84.475  120.368 1.00 30.00  ? 147 ASP C CA  1 
ATOM 4107  C C   . ASP C 1 147 ? 141.466 83.203  120.592 1.00 30.00  ? 147 ASP C C   1 
ATOM 4108  O O   . ASP C 1 147 ? 140.235 83.222  120.662 1.00 30.00  ? 147 ASP C O   1 
ATOM 4109  C CB  . ASP C 1 147 ? 143.164 84.765  121.567 1.00 30.00  ? 147 ASP C CB  1 
ATOM 4110  C CG  . ASP C 1 147 ? 144.221 85.791  121.258 1.00 30.00  ? 147 ASP C CG  1 
ATOM 4111  O OD1 . ASP C 1 147 ? 144.665 85.843  120.092 1.00 30.00  ? 147 ASP C OD1 1 
ATOM 4112  O OD2 . ASP C 1 147 ? 144.605 86.547  122.174 1.00 30.00  ? 147 ASP C OD2 1 
ATOM 4113  N N   . GLN C 1 148 ? 142.178 82.082  120.664 1.00 30.00  ? 148 GLN C N   1 
ATOM 4114  C CA  . GLN C 1 148 ? 141.526 80.802  120.897 1.00 30.00  ? 148 GLN C CA  1 
ATOM 4115  C C   . GLN C 1 148 ? 140.964 80.773  122.312 1.00 30.00  ? 148 GLN C C   1 
ATOM 4116  O O   . GLN C 1 148 ? 141.522 81.394  123.221 1.00 30.00  ? 148 GLN C O   1 
ATOM 4117  C CB  . GLN C 1 148 ? 142.516 79.658  120.681 1.00 30.00  ? 148 GLN C CB  1 
ATOM 4118  C CG  . GLN C 1 148 ? 141.884 78.285  120.637 1.00 30.00  ? 148 GLN C CG  1 
ATOM 4119  C CD  . GLN C 1 148 ? 141.006 78.110  119.424 1.00 30.00  ? 148 GLN C CD  1 
ATOM 4120  O OE1 . GLN C 1 148 ? 141.351 78.547  118.329 1.00 30.00  ? 148 GLN C OE1 1 
ATOM 4121  N NE2 . GLN C 1 148 ? 139.862 77.473  119.610 1.00 30.00  ? 148 GLN C NE2 1 
ATOM 4122  N N   . ASN C 1 149 ? 139.792 80.138  122.454 1.00 30.00  ? 149 ASN C N   1 
ATOM 4123  C CA  . ASN C 1 149 ? 138.993 79.990  123.673 1.00 30.00  ? 149 ASN C CA  1 
ATOM 4124  C C   . ASN C 1 149 ? 138.392 81.304  124.169 1.00 30.00  ? 149 ASN C C   1 
ATOM 4125  O O   . ASN C 1 149 ? 137.668 81.308  125.168 1.00 30.00  ? 149 ASN C O   1 
ATOM 4126  C CB  . ASN C 1 149 ? 139.795 79.330  124.806 1.00 30.00  ? 149 ASN C CB  1 
ATOM 4127  C CG  . ASN C 1 149 ? 140.259 77.933  124.457 1.00 30.00  ? 149 ASN C CG  1 
ATOM 4128  O OD1 . ASN C 1 149 ? 141.456 77.674  124.342 1.00 30.00  ? 149 ASN C OD1 1 
ATOM 4129  N ND2 . ASN C 1 149 ? 139.313 77.019  124.296 1.00 30.00  ? 149 ASN C ND2 1 
ATOM 4130  N N   . TYR C 1 150 ? 138.665 82.419  123.493 1.00 30.00  ? 150 TYR C N   1 
ATOM 4131  C CA  . TYR C 1 150 ? 138.083 83.718  123.838 1.00 30.00  ? 150 TYR C CA  1 
ATOM 4132  C C   . TYR C 1 150 ? 137.829 84.543  122.579 1.00 30.00  ? 150 TYR C C   1 
ATOM 4133  O O   . TYR C 1 150 ? 138.576 85.479  122.275 1.00 30.00  ? 150 TYR C O   1 
ATOM 4134  C CB  . TYR C 1 150 ? 139.002 84.481  124.796 1.00 30.00  ? 150 TYR C CB  1 
ATOM 4135  C CG  . TYR C 1 150 ? 139.129 83.877  126.173 1.00 30.00  ? 150 TYR C CG  1 
ATOM 4136  C CD1 . TYR C 1 150 ? 138.173 84.123  127.148 1.00 30.00  ? 150 TYR C CD1 1 
ATOM 4137  C CD2 . TYR C 1 150 ? 140.201 83.061  126.496 1.00 30.00  ? 150 TYR C CD2 1 
ATOM 4138  C CE1 . TYR C 1 150 ? 138.281 83.576  128.407 1.00 30.00  ? 150 TYR C CE1 1 
ATOM 4139  C CE2 . TYR C 1 150 ? 140.316 82.504  127.752 1.00 30.00  ? 150 TYR C CE2 1 
ATOM 4140  C CZ  . TYR C 1 150 ? 139.353 82.767  128.704 1.00 30.00  ? 150 TYR C CZ  1 
ATOM 4141  O OH  . TYR C 1 150 ? 139.461 82.218  129.959 1.00 30.00  ? 150 TYR C OH  1 
ATOM 4142  N N   . PRO C 1 151 ? 136.766 84.232  121.816 1.00 118.75 ? 151 PRO C N   1 
ATOM 4143  C CA  . PRO C 1 151 ? 136.416 85.123  120.707 1.00 118.46 ? 151 PRO C CA  1 
ATOM 4144  C C   . PRO C 1 151 ? 135.690 86.354  121.211 1.00 119.90 ? 151 PRO C C   1 
ATOM 4145  O O   . PRO C 1 151 ? 134.505 86.278  121.545 1.00 131.05 ? 151 PRO C O   1 
ATOM 4146  C CB  . PRO C 1 151 ? 135.496 84.262  119.833 1.00 30.00  ? 151 PRO C CB  1 
ATOM 4147  C CG  . PRO C 1 151 ? 135.742 82.871  120.263 1.00 30.00  ? 151 PRO C CG  1 
ATOM 4148  C CD  . PRO C 1 151 ? 136.008 82.975  121.725 1.00 30.00  ? 151 PRO C CD  1 
ATOM 4149  N N   . THR C 1 152 ? 136.373 87.495  121.252 1.00 103.12 ? 152 THR C N   1 
ATOM 4150  C CA  . THR C 1 152 ? 135.797 88.741  121.741 1.00 94.10  ? 152 THR C CA  1 
ATOM 4151  C C   . THR C 1 152 ? 135.761 89.745  120.602 1.00 104.71 ? 152 THR C C   1 
ATOM 4152  O O   . THR C 1 152 ? 136.611 89.704  119.708 1.00 113.36 ? 152 THR C O   1 
ATOM 4153  C CB  . THR C 1 152 ? 136.600 89.298  122.914 1.00 30.00  ? 152 THR C CB  1 
ATOM 4154  O OG1 . THR C 1 152 ? 137.936 89.580  122.483 1.00 30.00  ? 152 THR C OG1 1 
ATOM 4155  C CG2 . THR C 1 152 ? 136.641 88.291  124.051 1.00 30.00  ? 152 THR C CG2 1 
ATOM 4156  N N   . LEU C 1 153 ? 134.776 90.635  120.630 1.00 105.17 ? 153 LEU C N   1 
ATOM 4157  C CA  . LEU C 1 153 ? 134.618 91.633  119.583 1.00 86.31  ? 153 LEU C CA  1 
ATOM 4158  C C   . LEU C 1 153 ? 134.748 93.045  120.137 1.00 100.45 ? 153 LEU C C   1 
ATOM 4159  O O   . LEU C 1 153 ? 134.433 93.319  121.295 1.00 121.22 ? 153 LEU C O   1 
ATOM 4160  C CB  . LEU C 1 153 ? 133.274 91.457  118.876 1.00 85.43  ? 153 LEU C CB  1 
ATOM 4161  C CG  . LEU C 1 153 ? 133.253 90.682  117.559 1.00 104.80 ? 153 LEU C CG  1 
ATOM 4162  C CD1 . LEU C 1 153 ? 133.882 89.337  117.681 1.00 109.08 ? 153 LEU C CD1 1 
ATOM 4163  C CD2 . LEU C 1 153 ? 131.812 90.492  117.147 1.00 104.18 ? 153 LEU C CD2 1 
ATOM 4164  N N   . ASN C 1 154 ? 135.245 93.939  119.291 1.00 92.73  ? 154 ASN C N   1 
ATOM 4165  C CA  . ASN C 1 154 ? 135.417 95.339  119.642 1.00 102.94 ? 154 ASN C CA  1 
ATOM 4166  C C   . ASN C 1 154 ? 135.169 96.200  118.412 1.00 103.88 ? 154 ASN C C   1 
ATOM 4167  O O   . ASN C 1 154 ? 134.613 95.714  117.425 1.00 114.48 ? 154 ASN C O   1 
ATOM 4168  C CB  . ASN C 1 154 ? 136.804 95.558  120.250 1.00 108.28 ? 154 ASN C CB  1 
ATOM 4169  C CG  . ASN C 1 154 ? 137.919 94.940  119.419 1.00 136.92 ? 154 ASN C CG  1 
ATOM 4170  O OD1 . ASN C 1 154 ? 137.690 94.419  118.331 1.00 143.53 ? 154 ASN C OD1 1 
ATOM 4171  N ND2 . ASN C 1 154 ? 139.137 94.986  119.944 1.00 139.78 ? 154 ASN C ND2 1 
ATOM 4172  N N   . LYS C 1 155 ? 135.553 97.470  118.461 1.00 95.21  ? 155 LYS C N   1 
ATOM 4173  C CA  . LYS C 1 155 ? 135.323 98.361  117.333 1.00 95.36  ? 155 LYS C CA  1 
ATOM 4174  C C   . LYS C 1 155 ? 136.216 97.992  116.150 1.00 115.83 ? 155 LYS C C   1 
ATOM 4175  O O   . LYS C 1 155 ? 137.400 97.680  116.301 1.00 123.08 ? 155 LYS C O   1 
ATOM 4176  C CB  . LYS C 1 155 ? 135.541 99.816  117.758 1.00 30.00  ? 155 LYS C CB  1 
ATOM 4177  C CG  . LYS C 1 155 ? 136.933 100.140 118.292 1.00 30.00  ? 155 LYS C CG  1 
ATOM 4178  C CD  . LYS C 1 155 ? 137.037 101.577 118.747 1.00 30.00  ? 155 LYS C CD  1 
ATOM 4179  C CE  . LYS C 1 155 ? 136.268 101.785 120.037 1.00 30.00  ? 155 LYS C CE  1 
ATOM 4180  N NZ  . LYS C 1 155 ? 136.466 103.154 120.574 1.00 30.00  ? 155 LYS C NZ  1 
ATOM 4181  N N   . GLY C 1 156 ? 135.615 97.994  114.965 1.00 120.22 ? 156 GLY C N   1 
ATOM 4182  C CA  . GLY C 1 156 ? 136.330 97.653  113.747 1.00 108.72 ? 156 GLY C CA  1 
ATOM 4183  C C   . GLY C 1 156 ? 136.808 96.220  113.691 1.00 114.31 ? 156 GLY C C   1 
ATOM 4184  O O   . GLY C 1 156 ? 138.019 95.976  113.729 1.00 129.66 ? 156 GLY C O   1 
ATOM 4185  N N   . ASP C 1 157 ? 135.889 95.265  113.610 1.00 108.95 ? 157 ASP C N   1 
ATOM 4186  C CA  . ASP C 1 157 ? 136.233 93.852  113.717 1.00 110.20 ? 157 ASP C CA  1 
ATOM 4187  C C   . ASP C 1 157 ? 135.154 93.059  112.996 1.00 98.60  ? 157 ASP C C   1 
ATOM 4188  O O   . ASP C 1 157 ? 134.064 92.868  113.540 1.00 104.60 ? 157 ASP C O   1 
ATOM 4189  C CB  . ASP C 1 157 ? 136.340 93.442  115.187 1.00 30.00  ? 157 ASP C CB  1 
ATOM 4190  C CG  . ASP C 1 157 ? 136.992 92.091  115.382 1.00 30.00  ? 157 ASP C CG  1 
ATOM 4191  O OD1 . ASP C 1 157 ? 137.332 91.426  114.385 1.00 30.00  ? 157 ASP C OD1 1 
ATOM 4192  O OD2 . ASP C 1 157 ? 137.173 91.693  116.550 1.00 30.00  ? 157 ASP C OD2 1 
ATOM 4193  N N   . ILE C 1 158 ? 135.448 92.592  111.790 1.00 93.46  ? 158 ILE C N   1 
ATOM 4194  C CA  . ILE C 1 158 ? 134.469 91.887  110.971 1.00 94.83  ? 158 ILE C CA  1 
ATOM 4195  C C   . ILE C 1 158 ? 134.814 90.406  111.011 1.00 87.24  ? 158 ILE C C   1 
ATOM 4196  O O   . ILE C 1 158 ? 135.565 89.909  110.167 1.00 105.72 ? 158 ILE C O   1 
ATOM 4197  C CB  . ILE C 1 158 ? 134.461 92.411  109.532 1.00 30.00  ? 158 ILE C CB  1 
ATOM 4198  C CG1 . ILE C 1 158 ? 134.257 93.914  109.520 1.00 30.00  ? 158 ILE C CG1 1 
ATOM 4199  C CG2 . ILE C 1 158 ? 133.321 91.797  108.746 1.00 30.00  ? 158 ILE C CG2 1 
ATOM 4200  C CD1 . ILE C 1 158 ? 134.482 94.516  108.166 1.00 30.00  ? 158 ILE C CD1 1 
ATOM 4201  N N   . VAL C 1 159 ? 134.257 89.682  111.970 1.00 72.04  ? 159 VAL C N   1 
ATOM 4202  C CA  . VAL C 1 159 ? 134.481 88.251  112.053 1.00 85.77  ? 159 VAL C CA  1 
ATOM 4203  C C   . VAL C 1 159 ? 133.422 87.578  111.190 1.00 98.46  ? 159 VAL C C   1 
ATOM 4204  O O   . VAL C 1 159 ? 132.317 88.090  110.997 1.00 103.95 ? 159 VAL C O   1 
ATOM 4205  C CB  . VAL C 1 159 ? 134.466 87.743  113.514 1.00 96.17  ? 159 VAL C CB  1 
ATOM 4206  C CG1 . VAL C 1 159 ? 133.069 87.770  114.118 1.00 92.70  ? 159 VAL C CG1 1 
ATOM 4207  C CG2 . VAL C 1 159 ? 135.119 86.374  113.642 1.00 104.55 ? 159 VAL C CG2 1 
ATOM 4208  N N   . VAL C 1 160 ? 133.788 86.452  110.603 1.00 95.14  ? 160 VAL C N   1 
ATOM 4209  C CA  . VAL C 1 160 ? 132.912 85.737  109.691 1.00 101.45 ? 160 VAL C CA  1 
ATOM 4210  C C   . VAL C 1 160 ? 132.385 84.519  110.425 1.00 102.27 ? 160 VAL C C   1 
ATOM 4211  O O   . VAL C 1 160 ? 133.091 83.514  110.562 1.00 103.82 ? 160 VAL C O   1 
ATOM 4212  C CB  . VAL C 1 160 ? 133.637 85.331  108.409 1.00 30.00  ? 160 VAL C CB  1 
ATOM 4213  C CG1 . VAL C 1 160 ? 132.704 84.580  107.480 1.00 30.00  ? 160 VAL C CG1 1 
ATOM 4214  C CG2 . VAL C 1 160 ? 134.242 86.542  107.744 1.00 30.00  ? 160 VAL C CG2 1 
ATOM 4215  N N   . ILE C 1 161 ? 131.156 84.608  110.917 1.00 90.95  ? 161 ILE C N   1 
ATOM 4216  C CA  . ILE C 1 161 ? 130.475 83.431  111.437 1.00 81.94  ? 161 ILE C CA  1 
ATOM 4217  C C   . ILE C 1 161 ? 130.183 82.518  110.256 1.00 79.66  ? 161 ILE C C   1 
ATOM 4218  O O   . ILE C 1 161 ? 129.727 82.977  109.205 1.00 99.72  ? 161 ILE C O   1 
ATOM 4219  C CB  . ILE C 1 161 ? 129.202 83.813  112.207 1.00 30.00  ? 161 ILE C CB  1 
ATOM 4220  C CG1 . ILE C 1 161 ? 129.588 84.547  113.487 1.00 30.00  ? 161 ILE C CG1 1 
ATOM 4221  C CG2 . ILE C 1 161 ? 128.352 82.600  112.533 1.00 30.00  ? 161 ILE C CG2 1 
ATOM 4222  C CD1 . ILE C 1 161 ? 128.432 85.021  114.299 1.00 30.00  ? 161 ILE C CD1 1 
ATOM 4223  N N   . THR C 1 162 ? 130.516 81.240  110.398 1.00 81.25  ? 162 THR C N   1 
ATOM 4224  C CA  . THR C 1 162 ? 130.448 80.296  109.295 1.00 79.19  ? 162 THR C CA  1 
ATOM 4225  C C   . THR C 1 162 ? 129.626 79.082  109.689 1.00 81.11  ? 162 THR C C   1 
ATOM 4226  O O   . THR C 1 162 ? 130.005 78.345  110.598 1.00 116.53 ? 162 THR C O   1 
ATOM 4227  C CB  . THR C 1 162 ? 131.851 79.860  108.896 1.00 105.99 ? 162 THR C CB  1 
ATOM 4228  O OG1 . THR C 1 162 ? 132.578 80.989  108.402 1.00 101.14 ? 162 THR C OG1 1 
ATOM 4229  C CG2 . THR C 1 162 ? 131.780 78.809  107.847 1.00 102.00 ? 162 THR C CG2 1 
ATOM 4230  N N   . VAL C 1 163 ? 128.524 78.854  108.986 1.00 74.05  ? 163 VAL C N   1 
ATOM 4231  C CA  . VAL C 1 163 ? 127.573 77.814  109.349 1.00 59.01  ? 163 VAL C CA  1 
ATOM 4232  C C   . VAL C 1 163 ? 127.487 76.826  108.202 1.00 74.94  ? 163 VAL C C   1 
ATOM 4233  O O   . VAL C 1 163 ? 127.110 77.204  107.088 1.00 100.06 ? 163 VAL C O   1 
ATOM 4234  C CB  . VAL C 1 163 ? 126.185 78.394  109.648 1.00 30.00  ? 163 VAL C CB  1 
ATOM 4235  C CG1 . VAL C 1 163 ? 125.221 77.286  109.950 1.00 30.00  ? 163 VAL C CG1 1 
ATOM 4236  C CG2 . VAL C 1 163 ? 126.254 79.373  110.797 1.00 30.00  ? 163 VAL C CG2 1 
ATOM 4237  N N   . LYS C 1 164 ? 127.830 75.569  108.462 1.00 74.88  ? 164 LYS C N   1 
ATOM 4238  C CA  . LYS C 1 164 ? 127.622 74.537  107.458 1.00 83.69  ? 164 LYS C CA  1 
ATOM 4239  C C   . LYS C 1 164 ? 126.199 74.019  107.553 1.00 106.81 ? 164 LYS C C   1 
ATOM 4240  O O   . LYS C 1 164 ? 125.701 73.727  108.642 1.00 129.13 ? 164 LYS C O   1 
ATOM 4241  C CB  . LYS C 1 164 ? 128.609 73.387  107.625 1.00 30.00  ? 164 LYS C CB  1 
ATOM 4242  C CG  . LYS C 1 164 ? 128.500 72.350  106.530 1.00 30.00  ? 164 LYS C CG  1 
ATOM 4243  C CD  . LYS C 1 164 ? 129.573 71.306  106.651 1.00 30.00  ? 164 LYS C CD  1 
ATOM 4244  C CE  . LYS C 1 164 ? 129.484 70.318  105.514 1.00 30.00  ? 164 LYS C CE  1 
ATOM 4245  N NZ  . LYS C 1 164 ? 130.565 69.302  105.601 1.00 30.00  ? 164 LYS C NZ  1 
ATOM 4246  N N   . VAL C 1 165 ? 125.540 73.915  106.403 1.00 100.36 ? 165 VAL C N   1 
ATOM 4247  C CA  . VAL C 1 165 ? 124.112 73.645  106.334 1.00 103.79 ? 165 VAL C CA  1 
ATOM 4248  C C   . VAL C 1 165 ? 123.820 72.346  105.590 1.00 97.79  ? 165 VAL C C   1 
ATOM 4249  O O   . VAL C 1 165 ? 123.137 71.459  106.110 1.00 106.74 ? 165 VAL C O   1 
ATOM 4250  C CB  . VAL C 1 165 ? 123.353 74.822  105.685 1.00 30.00  ? 165 VAL C CB  1 
ATOM 4251  C CG1 . VAL C 1 165 ? 121.892 74.516  105.610 1.00 30.00  ? 165 VAL C CG1 1 
ATOM 4252  C CG2 . VAL C 1 165 ? 123.586 76.100  106.453 1.00 30.00  ? 165 VAL C CG2 1 
ATOM 4253  N N   . GLY C 1 166 ? 124.329 72.218  104.368 1.00 79.70  ? 166 GLY C N   1 
ATOM 4254  C CA  . GLY C 1 166 ? 123.747 71.299  103.409 1.00 92.16  ? 166 GLY C CA  1 
ATOM 4255  C C   . GLY C 1 166 ? 124.071 69.824  103.338 1.00 91.30  ? 166 GLY C C   1 
ATOM 4256  O O   . GLY C 1 166 ? 123.178 69.004  103.560 1.00 97.71  ? 166 GLY C O   1 
ATOM 4257  N N   . GLU C 1 167 ? 125.315 69.462  103.023 1.00 104.44 ? 167 GLU C N   1 
ATOM 4258  C CA  . GLU C 1 167 ? 125.577 68.144  102.452 1.00 121.81 ? 167 GLU C CA  1 
ATOM 4259  C C   . GLU C 1 167 ? 125.498 67.044  103.512 1.00 118.30 ? 167 GLU C C   1 
ATOM 4260  O O   . GLU C 1 167 ? 126.219 67.066  104.514 1.00 118.15 ? 167 GLU C O   1 
ATOM 4261  C CB  . GLU C 1 167 ? 126.920 68.136  101.702 1.00 30.00  ? 167 GLU C CB  1 
ATOM 4262  C CG  . GLU C 1 167 ? 128.211 68.465  102.465 1.00 30.00  ? 167 GLU C CG  1 
ATOM 4263  C CD  . GLU C 1 167 ? 128.884 67.226  103.033 1.00 30.00  ? 167 GLU C CD  1 
ATOM 4264  O OE1 . GLU C 1 167 ? 128.572 66.112  102.565 1.00 30.00  ? 167 GLU C OE1 1 
ATOM 4265  O OE2 . GLU C 1 167 ? 129.721 67.363  103.947 1.00 30.00  ? 167 GLU C OE2 1 
ATOM 4266  N N   . GLY C 1 168 ? 124.576 66.104  103.300 1.00 30.00  ? 168 GLY C N   1 
ATOM 4267  C CA  . GLY C 1 168 ? 124.323 65.039  104.250 1.00 30.00  ? 168 GLY C CA  1 
ATOM 4268  C C   . GLY C 1 168 ? 123.808 65.558  105.573 1.00 30.00  ? 168 GLY C C   1 
ATOM 4269  O O   . GLY C 1 168 ? 122.658 65.989  105.685 1.00 30.00  ? 168 GLY C O   1 
ATOM 4270  N N   . ASN C 1 169 ? 124.666 65.513  106.585 1.00 30.00  ? 169 ASN C N   1 
ATOM 4271  C CA  . ASN C 1 169 ? 124.357 66.114  107.869 1.00 30.00  ? 169 ASN C CA  1 
ATOM 4272  C C   . ASN C 1 169 ? 124.574 67.621  107.829 1.00 30.00  ? 169 ASN C C   1 
ATOM 4273  O O   . ASN C 1 169 ? 125.304 68.146  106.988 1.00 30.00  ? 169 ASN C O   1 
ATOM 4274  C CB  . ASN C 1 169 ? 125.196 65.478  108.984 1.00 30.00  ? 169 ASN C CB  1 
ATOM 4275  C CG  . ASN C 1 169 ? 126.704 65.518  108.714 1.00 30.00  ? 169 ASN C CG  1 
ATOM 4276  O OD1 . ASN C 1 169 ? 127.172 66.060  107.714 1.00 30.00  ? 169 ASN C OD1 1 
ATOM 4277  N ND2 . ASN C 1 169 ? 127.469 64.937  109.629 1.00 30.00  ? 169 ASN C ND2 1 
ATOM 4278  N N   . GLY C 1 170 ? 123.931 68.316  108.754 1.00 30.00  ? 170 GLY C N   1 
ATOM 4279  C CA  . GLY C 1 170 ? 124.109 69.748  108.829 1.00 30.00  ? 170 GLY C CA  1 
ATOM 4280  C C   . GLY C 1 170 ? 122.978 70.372  109.606 1.00 30.00  ? 170 GLY C C   1 
ATOM 4281  O O   . GLY C 1 170 ? 122.308 69.712  110.404 1.00 30.00  ? 170 GLY C O   1 
ATOM 4282  N N   . VAL C 1 171 ? 122.787 71.668  109.367 1.00 30.00  ? 171 VAL C N   1 
ATOM 4283  C CA  . VAL C 1 171 ? 121.651 72.371  109.948 1.00 30.00  ? 171 VAL C CA  1 
ATOM 4284  C C   . VAL C 1 171 ? 120.352 71.841  109.367 1.00 30.00  ? 171 VAL C C   1 
ATOM 4285  O O   . VAL C 1 171 ? 119.396 71.558  110.098 1.00 30.00  ? 171 VAL C O   1 
ATOM 4286  C CB  . VAL C 1 171 ? 121.804 73.884  109.725 1.00 30.00  ? 171 VAL C CB  1 
ATOM 4287  C CG1 . VAL C 1 171 ? 120.568 74.617  110.161 1.00 30.00  ? 171 VAL C CG1 1 
ATOM 4288  C CG2 . VAL C 1 171 ? 122.990 74.383  110.509 1.00 30.00  ? 171 VAL C CG2 1 
ATOM 4289  N N   . PHE C 1 172 ? 120.317 71.647  108.056 1.00 30.00  ? 172 PHE C N   1 
ATOM 4290  C CA  . PHE C 1 172 ? 119.113 71.249  107.348 1.00 30.00  ? 172 PHE C CA  1 
ATOM 4291  C C   . PHE C 1 172 ? 119.380 69.990  106.541 1.00 30.00  ? 172 PHE C C   1 
ATOM 4292  O O   . PHE C 1 172 ? 120.511 69.729  106.123 1.00 30.00  ? 172 PHE C O   1 
ATOM 4293  C CB  . PHE C 1 172 ? 118.652 72.368  106.423 1.00 30.00  ? 172 PHE C CB  1 
ATOM 4294  C CG  . PHE C 1 172 ? 118.189 73.589  107.148 1.00 30.00  ? 172 PHE C CG  1 
ATOM 4295  C CD1 . PHE C 1 172 ? 117.574 73.494  108.378 1.00 30.00  ? 172 PHE C CD1 1 
ATOM 4296  C CD2 . PHE C 1 172 ? 118.460 74.840  106.639 1.00 30.00  ? 172 PHE C CD2 1 
ATOM 4297  C CE1 . PHE C 1 172 ? 117.176 74.621  109.043 1.00 30.00  ? 172 PHE C CE1 1 
ATOM 4298  C CE2 . PHE C 1 172 ? 118.076 75.965  107.306 1.00 30.00  ? 172 PHE C CE2 1 
ATOM 4299  C CZ  . PHE C 1 172 ? 117.447 75.858  108.510 1.00 30.00  ? 172 PHE C CZ  1 
ATOM 4300  N N   . GLY C 1 173 ? 118.325 69.205  106.335 1.00 90.87  ? 173 GLY C N   1 
ATOM 4301  C CA  . GLY C 1 173 ? 118.408 68.068  105.443 1.00 106.12 ? 173 GLY C CA  1 
ATOM 4302  C C   . GLY C 1 173 ? 118.583 68.544  104.018 1.00 110.53 ? 173 GLY C C   1 
ATOM 4303  O O   . GLY C 1 173 ? 117.668 69.163  103.450 1.00 115.60 ? 173 GLY C O   1 
ATOM 4304  N N   . LYS C 1 174 ? 119.770 68.315  103.447 1.00 97.87  ? 174 LYS C N   1 
ATOM 4305  C CA  . LYS C 1 174 ? 120.219 68.715  102.112 1.00 80.02  ? 174 LYS C CA  1 
ATOM 4306  C C   . LYS C 1 174 ? 120.321 70.231  101.936 1.00 94.77  ? 174 LYS C C   1 
ATOM 4307  O O   . LYS C 1 174 ? 120.495 70.702  100.811 1.00 96.54  ? 174 LYS C O   1 
ATOM 4308  C CB  . LYS C 1 174 ? 119.341 68.114  100.998 1.00 30.00  ? 174 LYS C CB  1 
ATOM 4309  C CG  . LYS C 1 174 ? 119.243 66.596  101.027 1.00 30.00  ? 174 LYS C CG  1 
ATOM 4310  C CD  . LYS C 1 174 ? 120.580 65.929  100.765 1.00 30.00  ? 174 LYS C CD  1 
ATOM 4311  C CE  . LYS C 1 174 ? 121.018 66.129  99.325  1.00 30.00  ? 174 LYS C CE  1 
ATOM 4312  N NZ  . LYS C 1 174 ? 120.086 65.460  98.376  1.00 30.00  ? 174 LYS C NZ  1 
ATOM 4313  N N   . GLY C 1 175 ? 120.225 71.012  103.011 1.00 111.68 ? 175 GLY C N   1 
ATOM 4314  C CA  . GLY C 1 175 ? 120.390 72.451  102.922 1.00 81.48  ? 175 GLY C CA  1 
ATOM 4315  C C   . GLY C 1 175 ? 119.222 73.186  102.294 1.00 95.21  ? 175 GLY C C   1 
ATOM 4316  O O   . GLY C 1 175 ? 118.283 72.599  101.764 1.00 97.91  ? 175 GLY C O   1 
ATOM 4317  N N   . ILE C 1 176 ? 119.308 74.511  102.363 1.00 83.15  ? 176 ILE C N   1 
ATOM 4318  C CA  . ILE C 1 176 ? 118.251 75.387  101.863 1.00 78.96  ? 176 ILE C CA  1 
ATOM 4319  C C   . ILE C 1 176 ? 118.169 75.333  100.341 1.00 94.93  ? 176 ILE C C   1 
ATOM 4320  O O   . ILE C 1 176 ? 119.170 75.547  99.648  1.00 88.90  ? 176 ILE C O   1 
ATOM 4321  C CB  . ILE C 1 176 ? 118.427 76.825  102.384 1.00 30.00  ? 176 ILE C CB  1 
ATOM 4322  C CG1 . ILE C 1 176 ? 119.869 77.301  102.272 1.00 30.00  ? 176 ILE C CG1 1 
ATOM 4323  C CG2 . ILE C 1 176 ? 117.972 76.945  103.808 1.00 30.00  ? 176 ILE C CG2 1 
ATOM 4324  C CD1 . ILE C 1 176 ? 120.050 78.753  102.627 1.00 30.00  ? 176 ILE C CD1 1 
ATOM 4325  N N   . PRO C 1 177 ? 117.011 74.998  99.784  1.00 104.13 ? 177 PRO C N   1 
ATOM 4326  C CA  . PRO C 1 177 ? 116.851 74.997  98.332  1.00 102.32 ? 177 PRO C CA  1 
ATOM 4327  C C   . PRO C 1 177 ? 116.588 76.404  97.827  1.00 111.82 ? 177 PRO C C   1 
ATOM 4328  O O   . PRO C 1 177 ? 116.386 77.319  98.636  1.00 109.13 ? 177 PRO C O   1 
ATOM 4329  C CB  . PRO C 1 177 ? 115.634 74.078  98.125  1.00 30.00  ? 177 PRO C CB  1 
ATOM 4330  C CG  . PRO C 1 177 ? 114.865 74.206  99.364  1.00 30.00  ? 177 PRO C CG  1 
ATOM 4331  C CD  . PRO C 1 177 ? 115.860 74.381  100.463 1.00 30.00  ? 177 PRO C CD  1 
ATOM 4332  N N   . PRO C 1 178 ? 116.626 76.635  96.513  1.00 116.59 ? 178 PRO C N   1 
ATOM 4333  C CA  . PRO C 1 178 ? 116.186 77.928  95.984  1.00 103.53 ? 178 PRO C CA  1 
ATOM 4334  C C   . PRO C 1 178 ? 114.703 78.160  96.210  1.00 98.48  ? 178 PRO C C   1 
ATOM 4335  O O   . PRO C 1 178 ? 113.915 77.229  96.390  1.00 99.69  ? 178 PRO C O   1 
ATOM 4336  C CB  . PRO C 1 178 ? 116.503 77.836  94.490  1.00 30.00  ? 178 PRO C CB  1 
ATOM 4337  C CG  . PRO C 1 178 ? 116.617 76.404  94.206  1.00 30.00  ? 178 PRO C CG  1 
ATOM 4338  C CD  . PRO C 1 178 ? 117.214 75.812  95.443  1.00 30.00  ? 178 PRO C CD  1 
ATOM 4339  N N   . ARG C 1 179 ? 114.352 79.451  96.196  1.00 103.48 ? 179 ARG C N   1 
ATOM 4340  C CA  . ARG C 1 179 ? 112.990 79.962  96.349  1.00 103.58 ? 179 ARG C CA  1 
ATOM 4341  C C   . ARG C 1 179 ? 112.388 79.497  97.680  1.00 107.40 ? 179 ARG C C   1 
ATOM 4342  O O   . ARG C 1 179 ? 111.400 78.762  97.740  1.00 119.87 ? 179 ARG C O   1 
ATOM 4343  C CB  . ARG C 1 179 ? 112.132 79.574  95.134  1.00 30.00  ? 179 ARG C CB  1 
ATOM 4344  C CG  . ARG C 1 179 ? 110.786 80.279  94.989  1.00 30.00  ? 179 ARG C CG  1 
ATOM 4345  C CD  . ARG C 1 179 ? 110.101 79.884  93.688  1.00 30.00  ? 179 ARG C CD  1 
ATOM 4346  N NE  . ARG C 1 179 ? 109.823 78.452  93.625  1.00 30.00  ? 179 ARG C NE  1 
ATOM 4347  C CZ  . ARG C 1 179 ? 110.416 77.613  92.781  1.00 30.00  ? 179 ARG C CZ  1 
ATOM 4348  N NH1 . ARG C 1 179 ? 111.314 78.067  91.918  1.00 30.00  ? 179 ARG C NH1 1 
ATOM 4349  N NH2 . ARG C 1 179 ? 110.105 76.323  92.791  1.00 30.00  ? 179 ARG C NH2 1 
ATOM 4350  N N   . THR C 1 180 ? 113.053 79.901  98.760  1.00 92.25  ? 180 THR C N   1 
ATOM 4351  C CA  . THR C 1 180 ? 112.574 79.638  100.108 1.00 103.08 ? 180 THR C CA  1 
ATOM 4352  C C   . THR C 1 180 ? 112.802 80.872  100.958 1.00 94.35  ? 180 THR C C   1 
ATOM 4353  O O   . THR C 1 180 ? 113.484 81.812  100.542 1.00 104.26 ? 180 THR C O   1 
ATOM 4354  C CB  . THR C 1 180 ? 113.279 78.455  100.772 1.00 30.00  ? 180 THR C CB  1 
ATOM 4355  O OG1 . THR C 1 180 ? 112.640 78.170  102.022 1.00 30.00  ? 180 THR C OG1 1 
ATOM 4356  C CG2 . THR C 1 180 ? 114.729 78.793  101.047 1.00 30.00  ? 180 THR C CG2 1 
ATOM 4357  N N   . LYS C 1 181 ? 112.230 80.857  102.155 1.00 87.17  ? 181 LYS C N   1 
ATOM 4358  C CA  . LYS C 1 181 ? 112.532 81.858  103.164 1.00 109.98 ? 181 LYS C CA  1 
ATOM 4359  C C   . LYS C 1 181 ? 113.357 81.208  104.265 1.00 103.75 ? 181 LYS C C   1 
ATOM 4360  O O   . LYS C 1 181 ? 113.049 80.099  104.712 1.00 108.59 ? 181 LYS C O   1 
ATOM 4361  C CB  . LYS C 1 181 ? 111.263 82.486  103.733 1.00 30.00  ? 181 LYS C CB  1 
ATOM 4362  C CG  . LYS C 1 181 ? 111.544 83.642  104.663 1.00 30.00  ? 181 LYS C CG  1 
ATOM 4363  C CD  . LYS C 1 181 ? 110.267 84.269  105.154 1.00 30.00  ? 181 LYS C CD  1 
ATOM 4364  C CE  . LYS C 1 181 ? 109.565 84.985  104.020 1.00 30.00  ? 181 LYS C CE  1 
ATOM 4365  N NZ  . LYS C 1 181 ? 110.368 86.139  103.535 1.00 30.00  ? 181 LYS C NZ  1 
ATOM 4366  N N   . ILE C 1 182 ? 114.422 81.890  104.664 1.00 87.71  ? 182 ILE C N   1 
ATOM 4367  C CA  . ILE C 1 182 ? 115.417 81.413  105.614 1.00 85.86  ? 182 ILE C CA  1 
ATOM 4368  C C   . ILE C 1 182 ? 115.842 82.602  106.461 1.00 85.66  ? 182 ILE C C   1 
ATOM 4369  O O   . ILE C 1 182 ? 116.521 83.513  105.981 1.00 101.40 ? 182 ILE C O   1 
ATOM 4370  C CB  . ILE C 1 182 ? 116.575 80.730  104.855 1.00 30.00  ? 182 ILE C CB  1 
ATOM 4371  C CG1 . ILE C 1 182 ? 117.830 80.537  105.706 1.00 30.00  ? 182 ILE C CG1 1 
ATOM 4372  C CG2 . ILE C 1 182 ? 116.802 81.347  103.492 1.00 30.00  ? 182 ILE C CG2 1 
ATOM 4373  C CD1 . ILE C 1 182 ? 117.723 79.503  106.710 1.00 30.00  ? 182 ILE C CD1 1 
ATOM 4374  N N   . THR C 1 183 ? 115.395 82.630  107.715 1.00 68.96  ? 183 THR C N   1 
ATOM 4375  C CA  . THR C 1 183 ? 115.319 83.857  108.495 1.00 83.69  ? 183 THR C CA  1 
ATOM 4376  C C   . THR C 1 183 ? 115.493 83.563  109.980 1.00 82.58  ? 183 THR C C   1 
ATOM 4377  O O   . THR C 1 183 ? 114.886 82.633  110.512 1.00 95.81  ? 183 THR C O   1 
ATOM 4378  C CB  . THR C 1 183 ? 113.960 84.545  108.270 1.00 30.00  ? 183 THR C CB  1 
ATOM 4379  O OG1 . THR C 1 183 ? 113.776 84.810  106.876 1.00 30.00  ? 183 THR C OG1 1 
ATOM 4380  C CG2 . THR C 1 183 ? 113.851 85.854  109.029 1.00 30.00  ? 183 THR C CG2 1 
ATOM 4381  N N   . GLY C 1 184 ? 116.305 84.363  110.655 1.00 79.97  ? 184 GLY C N   1 
ATOM 4382  C CA  . GLY C 1 184 ? 116.470 84.200  112.080 1.00 78.59  ? 184 GLY C CA  1 
ATOM 4383  C C   . GLY C 1 184 ? 116.859 85.481  112.777 1.00 88.15  ? 184 GLY C C   1 
ATOM 4384  O O   . GLY C 1 184 ? 116.310 86.548  112.503 1.00 103.22 ? 184 GLY C O   1 
ATOM 4385  N N   . LYS C 1 185 ? 117.829 85.356  113.683 1.00 86.13  ? 185 LYS C N   1 
ATOM 4386  C CA  . LYS C 1 185 ? 118.433 86.482  114.384 1.00 94.37  ? 185 LYS C CA  1 
ATOM 4387  C C   . LYS C 1 185 ? 119.760 86.026  114.975 1.00 83.41  ? 185 LYS C C   1 
ATOM 4388  O O   . LYS C 1 185 ? 119.928 84.857  115.327 1.00 95.27  ? 185 LYS C O   1 
ATOM 4389  C CB  . LYS C 1 185 ? 117.508 87.023  115.478 1.00 30.00  ? 185 LYS C CB  1 
ATOM 4390  C CG  . LYS C 1 185 ? 117.227 86.045  116.592 1.00 30.00  ? 185 LYS C CG  1 
ATOM 4391  C CD  . LYS C 1 185 ? 116.166 86.561  117.518 1.00 30.00  ? 185 LYS C CD  1 
ATOM 4392  C CE  . LYS C 1 185 ? 116.653 87.727  118.337 1.00 30.00  ? 185 LYS C CE  1 
ATOM 4393  N NZ  . LYS C 1 185 ? 115.619 88.196  119.293 1.00 30.00  ? 185 LYS C NZ  1 
ATOM 4394  N N   . VAL C 1 186 ? 120.710 86.946  115.064 1.00 72.23  ? 186 VAL C N   1 
ATOM 4395  C CA  . VAL C 1 186 ? 121.990 86.670  115.705 1.00 76.48  ? 186 VAL C CA  1 
ATOM 4396  C C   . VAL C 1 186 ? 122.001 87.443  117.013 1.00 91.96  ? 186 VAL C C   1 
ATOM 4397  O O   . VAL C 1 186 ? 122.169 88.669  117.018 1.00 98.46  ? 186 VAL C O   1 
ATOM 4398  C CB  . VAL C 1 186 ? 123.180 87.055  114.819 1.00 30.00  ? 186 VAL C CB  1 
ATOM 4399  C CG1 . VAL C 1 186 ? 124.474 86.737  115.536 1.00 30.00  ? 186 VAL C CG1 1 
ATOM 4400  C CG2 . VAL C 1 186 ? 123.110 86.331  113.497 1.00 30.00  ? 186 VAL C CG2 1 
ATOM 4401  N N   . ILE C 1 187 ? 121.818 86.740  118.120 1.00 77.25  ? 187 ILE C N   1 
ATOM 4402  C CA  . ILE C 1 187 ? 121.609 87.362  119.425 1.00 61.12  ? 187 ILE C CA  1 
ATOM 4403  C C   . ILE C 1 187 ? 122.910 87.303  120.218 1.00 80.93  ? 187 ILE C C   1 
ATOM 4404  O O   . ILE C 1 187 ? 123.599 86.277  120.179 1.00 97.89  ? 187 ILE C O   1 
ATOM 4405  C CB  . ILE C 1 187 ? 120.440 86.704  120.189 1.00 30.00  ? 187 ILE C CB  1 
ATOM 4406  C CG1 . ILE C 1 187 ? 120.176 87.416  121.517 1.00 30.00  ? 187 ILE C CG1 1 
ATOM 4407  C CG2 . ILE C 1 187 ? 120.602 85.192  120.342 1.00 30.00  ? 187 ILE C CG2 1 
ATOM 4408  C CD1 . ILE C 1 187 ? 118.832 87.073  122.132 1.00 30.00  ? 187 ILE C CD1 1 
ATOM 4409  N N   . PRO C 1 188 ? 123.318 88.383  120.860 1.00 79.27  ? 188 PRO C N   1 
ATOM 4410  C CA  . PRO C 1 188 ? 124.535 88.346  121.674 1.00 92.71  ? 188 PRO C CA  1 
ATOM 4411  C C   . PRO C 1 188 ? 124.280 87.787  123.058 1.00 106.31 ? 188 PRO C C   1 
ATOM 4412  O O   . PRO C 1 188 ? 123.196 87.266  123.338 1.00 120.75 ? 188 PRO C O   1 
ATOM 4413  C CB  . PRO C 1 188 ? 124.950 89.818  121.756 1.00 30.00  ? 188 PRO C CB  1 
ATOM 4414  C CG  . PRO C 1 188 ? 124.227 90.487  120.650 1.00 30.00  ? 188 PRO C CG  1 
ATOM 4415  C CD  . PRO C 1 188 ? 122.930 89.760  120.537 1.00 30.00  ? 188 PRO C CD  1 
ATOM 4416  N N   . GLU C 1 189 ? 125.293 87.879  123.920 1.00 104.74 ? 189 GLU C N   1 
ATOM 4417  C CA  . GLU C 1 189 ? 125.104 87.599  125.338 1.00 101.76 ? 189 GLU C CA  1 
ATOM 4418  C C   . GLU C 1 189 ? 124.096 88.555  125.951 1.00 111.14 ? 189 GLU C C   1 
ATOM 4419  O O   . GLU C 1 189 ? 123.016 88.149  126.394 1.00 104.62 ? 189 GLU C O   1 
ATOM 4420  C CB  . GLU C 1 189 ? 126.441 87.696  126.071 1.00 30.00  ? 189 GLU C CB  1 
ATOM 4421  C CG  . GLU C 1 189 ? 126.341 87.491  127.569 1.00 30.00  ? 189 GLU C CG  1 
ATOM 4422  C CD  . GLU C 1 189 ? 127.688 87.552  128.258 1.00 30.00  ? 189 GLU C CD  1 
ATOM 4423  O OE1 . GLU C 1 189 ? 128.707 87.730  127.560 1.00 30.00  ? 189 GLU C OE1 1 
ATOM 4424  O OE2 . GLU C 1 189 ? 127.728 87.433  129.499 1.00 30.00  ? 189 GLU C OE2 1 
ATOM 4425  N N   . PHE C 1 190 ? 124.428 89.839  125.964 1.00 129.13 ? 190 PHE C N   1 
ATOM 4426  C CA  . PHE C 1 190 ? 123.562 90.856  126.529 1.00 141.21 ? 190 PHE C CA  1 
ATOM 4427  C C   . PHE C 1 190 ? 123.258 91.980  125.550 1.00 124.26 ? 190 PHE C C   1 
ATOM 4428  O O   . PHE C 1 190 ? 122.411 92.827  125.850 1.00 113.63 ? 190 PHE C O   1 
ATOM 4429  C CB  . PHE C 1 190 ? 124.179 91.426  127.822 1.00 30.00  ? 190 PHE C CB  1 
ATOM 4430  C CG  . PHE C 1 190 ? 125.564 92.000  127.648 1.00 30.00  ? 190 PHE C CG  1 
ATOM 4431  C CD1 . PHE C 1 190 ? 126.687 91.201  127.807 1.00 30.00  ? 190 PHE C CD1 1 
ATOM 4432  C CD2 . PHE C 1 190 ? 125.744 93.343  127.359 1.00 30.00  ? 190 PHE C CD2 1 
ATOM 4433  C CE1 . PHE C 1 190 ? 127.960 91.727  127.654 1.00 30.00  ? 190 PHE C CE1 1 
ATOM 4434  C CE2 . PHE C 1 190 ? 127.011 93.873  127.203 1.00 30.00  ? 190 PHE C CE2 1 
ATOM 4435  C CZ  . PHE C 1 190 ? 128.121 93.064  127.355 1.00 30.00  ? 190 PHE C CZ  1 
ATOM 4436  N N   . GLY C 1 191 ? 123.898 91.996  124.386 1.00 111.32 ? 191 GLY C N   1 
ATOM 4437  C CA  . GLY C 1 191 ? 123.790 93.101  123.462 1.00 115.22 ? 191 GLY C CA  1 
ATOM 4438  C C   . GLY C 1 191 ? 122.486 93.123  122.690 1.00 110.01 ? 191 GLY C C   1 
ATOM 4439  O O   . GLY C 1 191 ? 121.494 92.481  123.037 1.00 109.59 ? 191 GLY C O   1 
ATOM 4440  N N   . ALA C 1 192 ? 122.501 93.895  121.623 1.00 108.77 ? 192 ALA C N   1 
ATOM 4441  C CA  . ALA C 1 192 ? 121.342 94.040  120.754 1.00 106.70 ? 192 ALA C CA  1 
ATOM 4442  C C   . ALA C 1 192 ? 121.404 93.009  119.640 1.00 76.53  ? 192 ALA C C   1 
ATOM 4443  O O   . ALA C 1 192 ? 122.471 92.809  119.051 1.00 78.88  ? 192 ALA C O   1 
ATOM 4444  C CB  . ALA C 1 192 ? 121.282 95.437  120.160 1.00 30.00  ? 192 ALA C CB  1 
ATOM 4445  N N   . PRO C 1 193 ? 120.299 92.343  119.319 1.00 77.98  ? 193 PRO C N   1 
ATOM 4446  C CA  . PRO C 1 193 ? 120.351 91.254  118.338 1.00 87.61  ? 193 PRO C CA  1 
ATOM 4447  C C   . PRO C 1 193 ? 120.338 91.771  116.907 1.00 84.24  ? 193 PRO C C   1 
ATOM 4448  O O   . PRO C 1 193 ? 119.562 92.663  116.560 1.00 100.83 ? 193 PRO C O   1 
ATOM 4449  C CB  . PRO C 1 193 ? 119.090 90.445  118.647 1.00 30.00  ? 193 PRO C CB  1 
ATOM 4450  C CG  . PRO C 1 193 ? 118.167 91.423  119.247 1.00 30.00  ? 193 PRO C CG  1 
ATOM 4451  C CD  . PRO C 1 193 ? 119.008 92.388  120.020 1.00 30.00  ? 193 PRO C CD  1 
ATOM 4452  N N   . GLY C 1 194 ? 121.207 91.200  116.077 1.00 86.21  ? 194 GLY C N   1 
ATOM 4453  C CA  . GLY C 1 194 ? 121.204 91.487  114.655 1.00 97.13  ? 194 GLY C CA  1 
ATOM 4454  C C   . GLY C 1 194 ? 120.373 90.457  113.912 1.00 91.83  ? 194 GLY C C   1 
ATOM 4455  O O   . GLY C 1 194 ? 120.362 89.278  114.259 1.00 103.47 ? 194 GLY C O   1 
ATOM 4456  N N   . VAL C 1 195 ? 119.681 90.916  112.883 1.00 73.79  ? 195 VAL C N   1 
ATOM 4457  C CA  . VAL C 1 195 ? 118.664 90.104  112.243 1.00 78.62  ? 195 VAL C CA  1 
ATOM 4458  C C   . VAL C 1 195 ? 119.178 89.652  110.881 1.00 87.46  ? 195 VAL C C   1 
ATOM 4459  O O   . VAL C 1 195 ? 120.134 90.200  110.332 1.00 109.43 ? 195 VAL C O   1 
ATOM 4460  C CB  . VAL C 1 195 ? 117.342 90.892  112.139 1.00 30.00  ? 195 VAL C CB  1 
ATOM 4461  C CG1 . VAL C 1 195 ? 117.395 91.894  111.003 1.00 30.00  ? 195 VAL C CG1 1 
ATOM 4462  C CG2 . VAL C 1 195 ? 116.118 89.978  112.094 1.00 30.00  ? 195 VAL C CG2 1 
ATOM 4463  N N   . ILE C 1 196 ? 118.551 88.614  110.342 1.00 80.94  ? 196 ILE C N   1 
ATOM 4464  C CA  . ILE C 1 196 ? 119.026 87.917  109.155 1.00 81.29  ? 196 ILE C CA  1 
ATOM 4465  C C   . ILE C 1 196 ? 117.837 87.354  108.384 1.00 89.24  ? 196 ILE C C   1 
ATOM 4466  O O   . ILE C 1 196 ? 117.067 86.553  108.918 1.00 98.54  ? 196 ILE C O   1 
ATOM 4467  C CB  . ILE C 1 196 ? 120.039 86.828  109.573 1.00 30.00  ? 196 ILE C CB  1 
ATOM 4468  C CG1 . ILE C 1 196 ? 120.381 85.867  108.442 1.00 30.00  ? 196 ILE C CG1 1 
ATOM 4469  C CG2 . ILE C 1 196 ? 119.633 86.109  110.839 1.00 30.00  ? 196 ILE C CG2 1 
ATOM 4470  C CD1 . ILE C 1 196 ? 121.399 84.821  108.871 1.00 30.00  ? 196 ILE C CD1 1 
ATOM 4471  N N   . GLU C 1 197 ? 117.602 87.881  107.190 1.00 100.52 ? 197 GLU C N   1 
ATOM 4472  C CA  . GLU C 1 197 ? 116.523 87.376  106.356 1.00 92.70  ? 197 GLU C CA  1 
ATOM 4473  C C   . GLU C 1 197 ? 116.927 87.347  104.890 1.00 91.79  ? 197 GLU C C   1 
ATOM 4474  O O   . GLU C 1 197 ? 117.156 88.392  104.294 1.00 115.82 ? 197 GLU C O   1 
ATOM 4475  C CB  . GLU C 1 197 ? 115.274 88.231  106.536 1.00 30.00  ? 197 GLU C CB  1 
ATOM 4476  C CG  . GLU C 1 197 ? 114.124 87.832  105.634 1.00 30.00  ? 197 GLU C CG  1 
ATOM 4477  C CD  . GLU C 1 197 ? 112.917 88.729  105.803 1.00 30.00  ? 197 GLU C CD  1 
ATOM 4478  O OE1 . GLU C 1 197 ? 112.991 89.669  106.620 1.00 30.00  ? 197 GLU C OE1 1 
ATOM 4479  O OE2 . GLU C 1 197 ? 111.897 88.495  105.121 1.00 30.00  ? 197 GLU C OE2 1 
ATOM 4480  N N   . PHE C 1 198 ? 117.071 86.169  104.316 1.00 80.89  ? 198 PHE C N   1 
ATOM 4481  C CA  . PHE C 1 198 ? 117.457 86.118  102.925 1.00 87.10  ? 198 PHE C CA  1 
ATOM 4482  C C   . PHE C 1 198 ? 116.563 85.227  102.096 1.00 99.66  ? 198 PHE C C   1 
ATOM 4483  O O   . PHE C 1 198 ? 116.250 84.112  102.489 1.00 107.35 ? 198 PHE C O   1 
ATOM 4484  C CB  . PHE C 1 198 ? 118.903 85.656  102.800 1.00 30.00  ? 198 PHE C CB  1 
ATOM 4485  C CG  . PHE C 1 198 ? 119.280 84.602  103.788 1.00 30.00  ? 198 PHE C CG  1 
ATOM 4486  C CD1 . PHE C 1 198 ? 120.460 84.692  104.495 1.00 30.00  ? 198 PHE C CD1 1 
ATOM 4487  C CD2 . PHE C 1 198 ? 118.440 83.533  104.022 1.00 30.00  ? 198 PHE C CD2 1 
ATOM 4488  C CE1 . PHE C 1 198 ? 120.807 83.724  105.410 1.00 30.00  ? 198 PHE C CE1 1 
ATOM 4489  C CE2 . PHE C 1 198 ? 118.777 82.558  104.937 1.00 30.00  ? 198 PHE C CE2 1 
ATOM 4490  C CZ  . PHE C 1 198 ? 119.964 82.654  105.632 1.00 30.00  ? 198 PHE C CZ  1 
ATOM 4491  N N   . THR C 1 199 ? 116.146 85.729  100.945 1.00 95.30  ? 199 THR C N   1 
ATOM 4492  C CA  . THR C 1 199 ? 115.353 84.931  100.043 1.00 87.27  ? 199 THR C CA  1 
ATOM 4493  C C   . THR C 1 199 ? 116.338 84.576  98.944  1.00 91.37  ? 199 THR C C   1 
ATOM 4494  O O   . THR C 1 199 ? 116.785 85.445  98.194  1.00 118.25 ? 199 THR C O   1 
ATOM 4495  C CB  . THR C 1 199 ? 114.211 85.752  99.456  1.00 30.00  ? 199 THR C CB  1 
ATOM 4496  O OG1 . THR C 1 199 ? 114.755 86.782  98.624  1.00 30.00  ? 199 THR C OG1 1 
ATOM 4497  C CG2 . THR C 1 199 ? 113.413 86.384  100.572 1.00 30.00  ? 199 THR C CG2 1 
ATOM 4498  N N   . THR C 1 200 ? 116.650 83.293  98.832  1.00 66.50  ? 200 THR C N   1 
ATOM 4499  C CA  . THR C 1 200 ? 117.623 82.815  97.861  1.00 93.24  ? 200 THR C CA  1 
ATOM 4500  C C   . THR C 1 200 ? 117.122 82.991  96.438  1.00 108.13 ? 200 THR C C   1 
ATOM 4501  O O   . THR C 1 200 ? 115.929 82.889  96.179  1.00 112.01 ? 200 THR C O   1 
ATOM 4502  C CB  . THR C 1 200 ? 117.978 81.351  98.152  1.00 30.00  ? 200 THR C CB  1 
ATOM 4503  O OG1 . THR C 1 200 ? 118.185 81.197  99.559  1.00 30.00  ? 200 THR C OG1 1 
ATOM 4504  C CG2 . THR C 1 200 ? 119.241 80.933  97.432  1.00 30.00  ? 200 THR C CG2 1 
ATOM 4505  N N   . PRO C 1 201 ? 118.039 83.252  95.515  1.00 98.08  ? 201 PRO C N   1 
ATOM 4506  C CA  . PRO C 1 201 ? 117.687 83.465  94.116  1.00 101.37 ? 201 PRO C CA  1 
ATOM 4507  C C   . PRO C 1 201 ? 117.007 82.249  93.504  1.00 96.67  ? 201 PRO C C   1 
ATOM 4508  O O   . PRO C 1 201 ? 117.404 81.112  93.732  1.00 97.22  ? 201 PRO C O   1 
ATOM 4509  C CB  . PRO C 1 201 ? 119.048 83.705  93.472  1.00 30.00  ? 201 PRO C CB  1 
ATOM 4510  C CG  . PRO C 1 201 ? 119.865 84.332  94.561  1.00 30.00  ? 201 PRO C CG  1 
ATOM 4511  C CD  . PRO C 1 201 ? 119.211 84.048  95.891  1.00 30.00  ? 201 PRO C CD  1 
ATOM 4512  N N   . SER C 1 202 ? 115.982 82.528  92.711  1.00 84.53  ? 202 SER C N   1 
ATOM 4513  C CA  . SER C 1 202 ? 115.153 81.533  92.070  1.00 96.04  ? 202 SER C CA  1 
ATOM 4514  C C   . SER C 1 202 ? 115.882 80.752  90.994  1.00 107.48 ? 202 SER C C   1 
ATOM 4515  O O   . SER C 1 202 ? 115.987 81.190  89.854  1.00 120.32 ? 202 SER C O   1 
ATOM 4516  C CB  . SER C 1 202 ? 113.907 82.183  91.486  1.00 30.00  ? 202 SER C CB  1 
ATOM 4517  O OG  . SER C 1 202 ? 114.257 83.329  90.739  1.00 30.00  ? 202 SER C OG  1 
ATOM 4518  N N   . THR C 1 203 ? 116.385 79.583  91.374  1.00 102.41 ? 203 THR C N   1 
ATOM 4519  C CA  . THR C 1 203 ? 117.017 78.683  90.404  1.00 89.41  ? 203 THR C CA  1 
ATOM 4520  C C   . THR C 1 203 ? 118.288 79.321  89.832  1.00 95.49  ? 203 THR C C   1 
ATOM 4521  O O   . THR C 1 203 ? 118.375 79.722  88.673  1.00 116.57 ? 203 THR C O   1 
ATOM 4522  C CB  . THR C 1 203 ? 116.020 78.273  89.316  1.00 30.00  ? 203 THR C CB  1 
ATOM 4523  O OG1 . THR C 1 203 ? 114.777 77.917  89.932  1.00 30.00  ? 203 THR C OG1 1 
ATOM 4524  C CG2 . THR C 1 203 ? 116.515 77.028  88.607  1.00 30.00  ? 203 THR C CG2 1 
ATOM 4525  N N   . TYR C 1 204 ? 119.259 79.438  90.723  1.00 87.34  ? 204 TYR C N   1 
ATOM 4526  C CA  . TYR C 1 204 ? 120.346 80.394  90.630  1.00 85.33  ? 204 TYR C CA  1 
ATOM 4527  C C   . TYR C 1 204 ? 121.595 79.821  89.979  1.00 90.64  ? 204 TYR C C   1 
ATOM 4528  O O   . TYR C 1 204 ? 121.680 78.642  89.634  1.00 110.75 ? 204 TYR C O   1 
ATOM 4529  C CB  . TYR C 1 204 ? 120.684 80.919  92.027  1.00 30.00  ? 204 TYR C CB  1 
ATOM 4530  C CG  . TYR C 1 204 ? 120.838 79.838  93.085  1.00 30.00  ? 204 TYR C CG  1 
ATOM 4531  C CD1 . TYR C 1 204 ? 122.024 79.141  93.240  1.00 30.00  ? 204 TYR C CD1 1 
ATOM 4532  C CD2 . TYR C 1 204 ? 119.785 79.525  93.938  1.00 30.00  ? 204 TYR C CD2 1 
ATOM 4533  C CE1 . TYR C 1 204 ? 122.150 78.175  94.206  1.00 30.00  ? 204 TYR C CE1 1 
ATOM 4534  C CE2 . TYR C 1 204 ? 119.911 78.568  94.908  1.00 30.00  ? 204 TYR C CE2 1 
ATOM 4535  C CZ  . TYR C 1 204 ? 121.089 77.894  95.034  1.00 30.00  ? 204 TYR C CZ  1 
ATOM 4536  O OH  . TYR C 1 204 ? 121.200 76.928  95.997  1.00 30.00  ? 204 TYR C OH  1 
ATOM 4537  N N   . THR C 1 205 ? 122.565 80.714  89.817  1.00 82.57  ? 205 THR C N   1 
ATOM 4538  C CA  . THR C 1 205 ? 123.949 80.432  89.481  1.00 83.12  ? 205 THR C CA  1 
ATOM 4539  C C   . THR C 1 205 ? 124.770 80.463  90.766  1.00 89.17  ? 205 THR C C   1 
ATOM 4540  O O   . THR C 1 205 ? 124.278 80.863  91.822  1.00 113.02 ? 205 THR C O   1 
ATOM 4541  C CB  . THR C 1 205 ? 124.466 81.451  88.468  1.00 30.00  ? 205 THR C CB  1 
ATOM 4542  O OG1 . THR C 1 205 ? 124.458 82.753  89.066  1.00 30.00  ? 205 THR C OG1 1 
ATOM 4543  C CG2 . THR C 1 205 ? 123.565 81.468  87.243  1.00 30.00  ? 205 THR C CG2 1 
ATOM 4544  N N   . SER C 1 206 ? 126.036 80.060  90.670  1.00 77.54  ? 206 SER C N   1 
ATOM 4545  C CA  . SER C 1 206 ? 126.802 79.738  91.868  1.00 75.49  ? 206 SER C CA  1 
ATOM 4546  C C   . SER C 1 206 ? 127.243 80.991  92.626  1.00 85.95  ? 206 SER C C   1 
ATOM 4547  O O   . SER C 1 206 ? 127.312 82.089  92.067  1.00 96.77  ? 206 SER C O   1 
ATOM 4548  C CB  . SER C 1 206 ? 128.012 78.877  91.509  1.00 30.00  ? 206 SER C CB  1 
ATOM 4549  O OG  . SER C 1 206 ? 127.608 77.622  90.995  1.00 30.00  ? 206 SER C OG  1 
ATOM 4550  N N   . GLU C 1 207 ? 127.530 80.799  93.925  1.00 92.70  ? 207 GLU C N   1 
ATOM 4551  C CA  . GLU C 1 207 ? 127.951 81.842  94.875  1.00 84.94  ? 207 GLU C CA  1 
ATOM 4552  C C   . GLU C 1 207 ? 126.883 82.939  94.986  1.00 75.08  ? 207 GLU C C   1 
ATOM 4553  O O   . GLU C 1 207 ? 126.931 83.981  94.340  1.00 99.39  ? 207 GLU C O   1 
ATOM 4554  C CB  . GLU C 1 207 ? 129.337 82.397  94.535  1.00 30.00  ? 207 GLU C CB  1 
ATOM 4555  C CG  . GLU C 1 207 ? 129.987 83.117  95.696  1.00 30.00  ? 207 GLU C CG  1 
ATOM 4556  C CD  . GLU C 1 207 ? 129.623 84.579  95.771  1.00 30.00  ? 207 GLU C CD  1 
ATOM 4557  O OE1 . GLU C 1 207 ? 129.434 85.203  94.708  1.00 30.00  ? 207 GLU C OE1 1 
ATOM 4558  O OE2 . GLU C 1 207 ? 129.505 85.098  96.895  1.00 30.00  ? 207 GLU C OE2 1 
ATOM 4559  N N   . VAL C 1 208 ? 125.867 82.622  95.781  1.00 54.53  ? 208 VAL C N   1 
ATOM 4560  C CA  . VAL C 1 208 ? 124.494 83.088  95.611  1.00 74.84  ? 208 VAL C CA  1 
ATOM 4561  C C   . VAL C 1 208 ? 124.216 84.365  96.417  1.00 90.59  ? 208 VAL C C   1 
ATOM 4562  O O   . VAL C 1 208 ? 123.057 84.682  96.694  1.00 111.15 ? 208 VAL C O   1 
ATOM 4563  C CB  . VAL C 1 208 ? 123.550 81.936  96.020  1.00 30.00  ? 208 VAL C CB  1 
ATOM 4564  C CG1 . VAL C 1 208 ? 122.164 82.026  95.375  1.00 30.00  ? 208 VAL C CG1 1 
ATOM 4565  C CG2 . VAL C 1 208 ? 124.203 80.596  95.758  1.00 30.00  ? 208 VAL C CG2 1 
ATOM 4566  N N   . ILE C 1 209 ? 125.271 85.127  96.751  1.00 82.05  ? 209 ILE C N   1 
ATOM 4567  C CA  . ILE C 1 209 ? 125.319 86.193  97.768  1.00 100.57 ? 209 ILE C CA  1 
ATOM 4568  C C   . ILE C 1 209 ? 124.105 87.124  97.843  1.00 110.18 ? 209 ILE C C   1 
ATOM 4569  O O   . ILE C 1 209 ? 123.677 87.702  96.838  1.00 121.76 ? 209 ILE C O   1 
ATOM 4570  C CB  . ILE C 1 209 ? 126.603 87.030  97.560  1.00 30.00  ? 209 ILE C CB  1 
ATOM 4571  C CG1 . ILE C 1 209 ? 126.638 88.234  98.508  1.00 30.00  ? 209 ILE C CG1 1 
ATOM 4572  C CG2 . ILE C 1 209 ? 126.805 87.422  96.092  1.00 30.00  ? 209 ILE C CG2 1 
ATOM 4573  C CD1 . ILE C 1 209 ? 127.911 89.037  98.439  1.00 30.00  ? 209 ILE C CD1 1 
ATOM 4574  N N   . GLU C 1 210 ? 123.521 87.238  99.037  1.00 30.00  ? 210 GLU C N   1 
ATOM 4575  C CA  . GLU C 1 210 ? 122.296 87.998  99.238  1.00 30.00  ? 210 GLU C CA  1 
ATOM 4576  C C   . GLU C 1 210 ? 122.338 88.645  100.613 1.00 30.00  ? 210 GLU C C   1 
ATOM 4577  O O   . GLU C 1 210 ? 123.047 88.183  101.508 1.00 30.00  ? 210 GLU C O   1 
ATOM 4578  C CB  . GLU C 1 210 ? 121.067 87.103  99.095  1.00 30.00  ? 210 GLU C CB  1 
ATOM 4579  C CG  . GLU C 1 210 ? 120.826 86.175  100.251 1.00 30.00  ? 210 GLU C CG  1 
ATOM 4580  C CD  . GLU C 1 210 ? 121.653 84.900  100.230 1.00 30.00  ? 210 GLU C CD  1 
ATOM 4581  O OE1 . GLU C 1 210 ? 122.655 84.813  99.499  1.00 30.00  ? 210 GLU C OE1 1 
ATOM 4582  O OE2 . GLU C 1 210 ? 121.296 83.964  100.968 1.00 30.00  ? 210 GLU C OE2 1 
ATOM 4583  N N   . LEU C 1 211 ? 121.565 89.709  100.780 1.00 30.00  ? 211 LEU C N   1 
ATOM 4584  C CA  . LEU C 1 211 ? 121.830 90.684  101.828 1.00 30.00  ? 211 LEU C CA  1 
ATOM 4585  C C   . LEU C 1 211 ? 121.059 90.409  103.113 1.00 30.00  ? 211 LEU C C   1 
ATOM 4586  O O   . LEU C 1 211 ? 119.896 89.999  103.095 1.00 30.00  ? 211 LEU C O   1 
ATOM 4587  C CB  . LEU C 1 211 ? 121.503 92.093  101.326 1.00 30.00  ? 211 LEU C CB  1 
ATOM 4588  C CG  . LEU C 1 211 ? 122.356 92.613  100.166 1.00 30.00  ? 211 LEU C CG  1 
ATOM 4589  C CD1 . LEU C 1 211 ? 121.830 93.953  99.674  1.00 30.00  ? 211 LEU C CD1 1 
ATOM 4590  C CD2 . LEU C 1 211 ? 123.815 92.722  100.577 1.00 30.00  ? 211 LEU C CD2 1 
ATOM 4591  N N   . GLN C 1 212 ? 121.746 90.672  104.225 1.00 30.00  ? 212 GLN C N   1 
ATOM 4592  C CA  . GLN C 1 212 ? 121.301 90.600  105.624 1.00 30.00  ? 212 GLN C CA  1 
ATOM 4593  C C   . GLN C 1 212 ? 120.480 89.358  105.979 1.00 30.00  ? 212 GLN C C   1 
ATOM 4594  O O   . GLN C 1 212 ? 119.259 89.408  106.094 1.00 30.00  ? 212 GLN C O   1 
ATOM 4595  C CB  . GLN C 1 212 ? 120.522 91.867  105.995 1.00 30.00  ? 212 GLN C CB  1 
ATOM 4596  C CG  . GLN C 1 212 ? 120.387 92.058  107.508 1.00 30.00  ? 212 GLN C CG  1 
ATOM 4597  C CD  . GLN C 1 212 ? 119.724 93.359  107.903 1.00 30.00  ? 212 GLN C CD  1 
ATOM 4598  O OE1 . GLN C 1 212 ? 119.258 94.110  107.059 1.00 30.00  ? 212 GLN C OE1 1 
ATOM 4599  N NE2 . GLN C 1 212 ? 119.708 93.641  109.199 1.00 30.00  ? 212 GLN C NE2 1 
ATOM 4600  N N   . ALA D 1 6   ? 109.875 117.737 181.012 1.00 30.00  ? 6   ALA D N   1 
ATOM 4601  C CA  . ALA D 1 6   ? 109.621 116.324 180.775 1.00 30.00  ? 6   ALA D CA  1 
ATOM 4602  C C   . ALA D 1 6   ? 109.715 115.996 179.292 1.00 30.00  ? 6   ALA D C   1 
ATOM 4603  O O   . ALA D 1 6   ? 109.873 116.886 178.457 1.00 30.00  ? 6   ALA D O   1 
ATOM 4604  C CB  . ALA D 1 6   ? 108.266 115.934 181.317 1.00 30.00  ? 6   ALA D CB  1 
ATOM 4605  N N   . VAL D 1 7   ? 109.597 114.708 178.974 1.00 176.07 ? 7   VAL D N   1 
ATOM 4606  C CA  . VAL D 1 7   ? 109.840 114.199 177.629 1.00 158.44 ? 7   VAL D CA  1 
ATOM 4607  C C   . VAL D 1 7   ? 108.651 114.566 176.743 1.00 137.52 ? 7   VAL D C   1 
ATOM 4608  O O   . VAL D 1 7   ? 108.791 114.739 175.527 1.00 139.74 ? 7   VAL D O   1 
ATOM 4609  C CB  . VAL D 1 7   ? 110.102 112.679 177.680 1.00 30.00  ? 7   VAL D CB  1 
ATOM 4610  C CG1 . VAL D 1 7   ? 110.419 112.101 176.313 1.00 30.00  ? 7   VAL D CG1 1 
ATOM 4611  C CG2 . VAL D 1 7   ? 111.239 112.386 178.637 1.00 30.00  ? 7   VAL D CG2 1 
ATOM 4612  N N   . GLY D 1 8   ? 107.484 114.756 177.358 1.00 131.64 ? 8   GLY D N   1 
ATOM 4613  C CA  . GLY D 1 8   ? 106.331 115.246 176.626 1.00 139.85 ? 8   GLY D CA  1 
ATOM 4614  C C   . GLY D 1 8   ? 106.438 116.675 176.136 1.00 132.89 ? 8   GLY D C   1 
ATOM 4615  O O   . GLY D 1 8   ? 105.695 117.067 175.233 1.00 133.27 ? 8   GLY D O   1 
ATOM 4616  N N   . ILE D 1 9   ? 107.348 117.461 176.705 1.00 131.26 ? 9   ILE D N   1 
ATOM 4617  C CA  . ILE D 1 9   ? 107.556 118.820 176.225 1.00 135.93 ? 9   ILE D CA  1 
ATOM 4618  C C   . ILE D 1 9   ? 108.502 118.823 175.032 1.00 126.64 ? 9   ILE D C   1 
ATOM 4619  O O   . ILE D 1 9   ? 108.279 119.543 174.050 1.00 121.41 ? 9   ILE D O   1 
ATOM 4620  C CB  . ILE D 1 9   ? 108.066 119.716 177.376 1.00 30.00  ? 9   ILE D CB  1 
ATOM 4621  C CG1 . ILE D 1 9   ? 106.975 119.947 178.427 1.00 30.00  ? 9   ILE D CG1 1 
ATOM 4622  C CG2 . ILE D 1 9   ? 108.570 121.055 176.878 1.00 30.00  ? 9   ILE D CG2 1 
ATOM 4623  C CD1 . ILE D 1 9   ? 107.021 119.024 179.620 1.00 30.00  ? 9   ILE D CD1 1 
ATOM 4624  N N   . GLY D 1 10  ? 109.541 117.983 175.080 1.00 116.23 ? 10  GLY D N   1 
ATOM 4625  C CA  . GLY D 1 10  ? 110.568 117.995 174.050 1.00 108.48 ? 10  GLY D CA  1 
ATOM 4626  C C   . GLY D 1 10  ? 110.090 117.539 172.686 1.00 119.42 ? 10  GLY D C   1 
ATOM 4627  O O   . GLY D 1 10  ? 110.572 118.033 171.664 1.00 124.33 ? 10  GLY D O   1 
ATOM 4628  N N   . THR D 1 11  ? 109.131 116.611 172.643 1.00 133.79 ? 11  THR D N   1 
ATOM 4629  C CA  . THR D 1 11  ? 108.597 116.177 171.357 1.00 134.97 ? 11  THR D CA  1 
ATOM 4630  C C   . THR D 1 11  ? 107.671 117.218 170.754 1.00 126.74 ? 11  THR D C   1 
ATOM 4631  O O   . THR D 1 11  ? 107.398 117.174 169.552 1.00 132.88 ? 11  THR D O   1 
ATOM 4632  C CB  . THR D 1 11  ? 107.853 114.856 171.504 1.00 30.00  ? 11  THR D CB  1 
ATOM 4633  O OG1 . THR D 1 11  ? 106.763 115.028 172.415 1.00 30.00  ? 11  THR D OG1 1 
ATOM 4634  C CG2 . THR D 1 11  ? 108.782 113.798 172.035 1.00 30.00  ? 11  THR D CG2 1 
ATOM 4635  N N   . LEU D 1 12  ? 107.168 118.145 171.567 1.00 118.09 ? 12  LEU D N   1 
ATOM 4636  C CA  . LEU D 1 12  ? 106.398 119.259 171.030 1.00 128.80 ? 12  LEU D CA  1 
ATOM 4637  C C   . LEU D 1 12  ? 107.316 120.291 170.392 1.00 127.81 ? 12  LEU D C   1 
ATOM 4638  O O   . LEU D 1 12  ? 107.003 120.848 169.335 1.00 112.49 ? 12  LEU D O   1 
ATOM 4639  C CB  . LEU D 1 12  ? 105.561 119.897 172.136 1.00 30.00  ? 12  LEU D CB  1 
ATOM 4640  C CG  . LEU D 1 12  ? 104.467 119.021 172.737 1.00 30.00  ? 12  LEU D CG  1 
ATOM 4641  C CD1 . LEU D 1 12  ? 103.821 119.722 173.910 1.00 30.00  ? 12  LEU D CD1 1 
ATOM 4642  C CD2 . LEU D 1 12  ? 103.434 118.677 171.682 1.00 30.00  ? 12  LEU D CD2 1 
ATOM 4643  N N   . ILE D 1 13  ? 108.461 120.549 171.023 1.00 134.37 ? 13  ILE D N   1 
ATOM 4644  C CA  . ILE D 1 13  ? 109.362 121.592 170.553 1.00 120.65 ? 13  ILE D CA  1 
ATOM 4645  C C   . ILE D 1 13  ? 110.052 121.164 169.262 1.00 125.25 ? 13  ILE D C   1 
ATOM 4646  O O   . ILE D 1 13  ? 110.224 121.971 168.339 1.00 127.06 ? 13  ILE D O   1 
ATOM 4647  C CB  . ILE D 1 13  ? 110.364 121.944 171.667 1.00 30.00  ? 13  ILE D CB  1 
ATOM 4648  C CG1 . ILE D 1 13  ? 109.607 122.452 172.891 1.00 30.00  ? 13  ILE D CG1 1 
ATOM 4649  C CG2 . ILE D 1 13  ? 111.355 123.000 171.213 1.00 30.00  ? 13  ILE D CG2 1 
ATOM 4650  C CD1 . ILE D 1 13  ? 110.472 122.649 174.095 1.00 30.00  ? 13  ILE D CD1 1 
ATOM 4651  N N   . VAL D 1 14  ? 110.426 119.885 169.162 1.00 120.61 ? 14  VAL D N   1 
ATOM 4652  C CA  . VAL D 1 14  ? 110.989 119.362 167.918 1.00 119.27 ? 14  VAL D CA  1 
ATOM 4653  C C   . VAL D 1 14  ? 109.926 119.333 166.823 1.00 125.86 ? 14  VAL D C   1 
ATOM 4654  O O   . VAL D 1 14  ? 110.225 119.580 165.646 1.00 127.57 ? 14  VAL D O   1 
ATOM 4655  C CB  . VAL D 1 14  ? 111.609 117.975 168.180 1.00 30.00  ? 14  VAL D CB  1 
ATOM 4656  C CG1 . VAL D 1 14  ? 112.126 117.332 166.903 1.00 30.00  ? 14  VAL D CG1 1 
ATOM 4657  C CG2 . VAL D 1 14  ? 112.740 118.103 169.182 1.00 30.00  ? 14  VAL D CG2 1 
ATOM 4658  N N   . PHE D 1 15  ? 108.668 119.087 167.197 1.00 120.93 ? 15  PHE D N   1 
ATOM 4659  C CA  . PHE D 1 15  ? 107.562 119.208 166.252 1.00 130.25 ? 15  PHE D CA  1 
ATOM 4660  C C   . PHE D 1 15  ? 107.392 120.641 165.767 1.00 137.12 ? 15  PHE D C   1 
ATOM 4661  O O   . PHE D 1 15  ? 107.063 120.867 164.599 1.00 136.10 ? 15  PHE D O   1 
ATOM 4662  C CB  . PHE D 1 15  ? 106.272 118.699 166.891 1.00 30.00  ? 15  PHE D CB  1 
ATOM 4663  C CG  . PHE D 1 15  ? 105.055 118.918 166.054 1.00 30.00  ? 15  PHE D CG  1 
ATOM 4664  C CD1 . PHE D 1 15  ? 104.843 118.172 164.908 1.00 30.00  ? 15  PHE D CD1 1 
ATOM 4665  C CD2 . PHE D 1 15  ? 104.106 119.856 166.430 1.00 30.00  ? 15  PHE D CD2 1 
ATOM 4666  C CE1 . PHE D 1 15  ? 103.715 118.373 164.140 1.00 30.00  ? 15  PHE D CE1 1 
ATOM 4667  C CE2 . PHE D 1 15  ? 102.975 120.062 165.668 1.00 30.00  ? 15  PHE D CE2 1 
ATOM 4668  C CZ  . PHE D 1 15  ? 102.777 119.320 164.520 1.00 30.00  ? 15  PHE D CZ  1 
ATOM 4669  N N   . ILE D 1 16  ? 107.612 121.623 166.646 1.00 132.37 ? 16  ILE D N   1 
ATOM 4670  C CA  . ILE D 1 16  ? 107.664 123.011 166.196 1.00 131.31 ? 16  ILE D CA  1 
ATOM 4671  C C   . ILE D 1 16  ? 108.893 123.231 165.325 1.00 126.36 ? 16  ILE D C   1 
ATOM 4672  O O   . ILE D 1 16  ? 108.839 123.959 164.325 1.00 114.96 ? 16  ILE D O   1 
ATOM 4673  C CB  . ILE D 1 16  ? 107.632 123.964 167.409 1.00 30.00  ? 16  ILE D CB  1 
ATOM 4674  C CG1 . ILE D 1 16  ? 106.326 123.805 168.173 1.00 30.00  ? 16  ILE D CG1 1 
ATOM 4675  C CG2 . ILE D 1 16  ? 107.754 125.415 166.990 1.00 30.00  ? 16  ILE D CG2 1 
ATOM 4676  C CD1 . ILE D 1 16  ? 106.308 124.547 169.478 1.00 30.00  ? 16  ILE D CD1 1 
ATOM 4677  N N   . ALA D 1 17  ? 109.997 122.558 165.647 1.00 123.07 ? 17  ALA D N   1 
ATOM 4678  C CA  . ALA D 1 17  ? 111.237 122.760 164.908 1.00 113.60 ? 17  ALA D CA  1 
ATOM 4679  C C   . ALA D 1 17  ? 111.181 122.113 163.529 1.00 122.78 ? 17  ALA D C   1 
ATOM 4680  O O   . ALA D 1 17  ? 111.545 122.739 162.528 1.00 135.51 ? 17  ALA D O   1 
ATOM 4681  C CB  . ALA D 1 17  ? 112.414 122.210 165.709 1.00 30.00  ? 17  ALA D CB  1 
ATOM 4682  N N   . MET D 1 18  ? 110.720 120.863 163.456 1.00 110.98 ? 18  MET D N   1 
ATOM 4683  C CA  . MET D 1 18  ? 110.824 120.101 162.216 1.00 128.27 ? 18  MET D CA  1 
ATOM 4684  C C   . MET D 1 18  ? 109.859 120.585 161.140 1.00 133.84 ? 18  MET D C   1 
ATOM 4685  O O   . MET D 1 18  ? 110.209 120.561 159.954 1.00 141.63 ? 18  MET D O   1 
ATOM 4686  C CB  . MET D 1 18  ? 110.601 118.616 162.507 1.00 30.00  ? 18  MET D CB  1 
ATOM 4687  C CG  . MET D 1 18  ? 110.718 117.710 161.301 1.00 30.00  ? 18  MET D CG  1 
ATOM 4688  S SD  . MET D 1 18  ? 110.587 115.968 161.681 1.00 30.00  ? 18  MET D SD  1 
ATOM 4689  C CE  . MET D 1 18  ? 110.572 115.316 160.021 1.00 30.00  ? 18  MET D CE  1 
ATOM 4690  N N   . VAL D 1 19  ? 108.672 121.049 161.527 1.00 128.57 ? 19  VAL D N   1 
ATOM 4691  C CA  . VAL D 1 19  ? 107.712 121.540 160.546 1.00 124.82 ? 19  VAL D CA  1 
ATOM 4692  C C   . VAL D 1 19  ? 108.215 122.828 159.901 1.00 121.88 ? 19  VAL D C   1 
ATOM 4693  O O   . VAL D 1 19  ? 108.058 123.033 158.692 1.00 114.40 ? 19  VAL D O   1 
ATOM 4694  C CB  . VAL D 1 19  ? 106.336 121.711 161.216 1.00 30.00  ? 19  VAL D CB  1 
ATOM 4695  C CG1 . VAL D 1 19  ? 105.350 122.345 160.279 1.00 30.00  ? 19  VAL D CG1 1 
ATOM 4696  C CG2 . VAL D 1 19  ? 105.808 120.361 161.651 1.00 30.00  ? 19  VAL D CG2 1 
ATOM 4697  N N   . LEU D 1 20  ? 108.871 123.691 160.685 1.00 123.94 ? 20  LEU D N   1 
ATOM 4698  C CA  . LEU D 1 20  ? 109.529 124.866 160.120 1.00 120.76 ? 20  LEU D CA  1 
ATOM 4699  C C   . LEU D 1 20  ? 110.672 124.482 159.191 1.00 118.82 ? 20  LEU D C   1 
ATOM 4700  O O   . LEU D 1 20  ? 110.893 125.151 158.175 1.00 128.24 ? 20  LEU D O   1 
ATOM 4701  C CB  . LEU D 1 20  ? 110.043 125.765 161.238 1.00 30.00  ? 20  LEU D CB  1 
ATOM 4702  C CG  . LEU D 1 20  ? 108.951 126.395 162.089 1.00 30.00  ? 20  LEU D CG  1 
ATOM 4703  C CD1 . LEU D 1 20  ? 109.565 127.153 163.245 1.00 30.00  ? 20  LEU D CD1 1 
ATOM 4704  C CD2 . LEU D 1 20  ? 108.101 127.305 161.235 1.00 30.00  ? 20  LEU D CD2 1 
ATOM 4705  N N   . VAL D 1 21  ? 111.403 123.416 159.524 1.00 118.89 ? 21  VAL D N   1 
ATOM 4706  C CA  . VAL D 1 21  ? 112.377 122.851 158.596 1.00 124.09 ? 21  VAL D CA  1 
ATOM 4707  C C   . VAL D 1 21  ? 111.665 122.239 157.395 1.00 132.71 ? 21  VAL D C   1 
ATOM 4708  O O   . VAL D 1 21  ? 112.143 122.341 156.258 1.00 133.89 ? 21  VAL D O   1 
ATOM 4709  C CB  . VAL D 1 21  ? 113.270 121.839 159.342 1.00 30.00  ? 21  VAL D CB  1 
ATOM 4710  C CG1 . VAL D 1 21  ? 114.198 121.100 158.398 1.00 30.00  ? 21  VAL D CG1 1 
ATOM 4711  C CG2 . VAL D 1 21  ? 114.086 122.561 160.394 1.00 30.00  ? 21  VAL D CG2 1 
ATOM 4712  N N   . ALA D 1 22  ? 110.494 121.641 157.612 1.00 119.64 ? 22  ALA D N   1 
ATOM 4713  C CA  . ALA D 1 22  ? 109.704 121.162 156.485 1.00 121.63 ? 22  ALA D CA  1 
ATOM 4714  C C   . ALA D 1 22  ? 109.132 122.323 155.683 1.00 121.50 ? 22  ALA D C   1 
ATOM 4715  O O   . ALA D 1 22  ? 109.030 122.241 154.454 1.00 124.27 ? 22  ALA D O   1 
ATOM 4716  C CB  . ALA D 1 22  ? 108.587 120.246 156.978 1.00 30.00  ? 22  ALA D CB  1 
ATOM 4717  N N   . ALA D 1 23  ? 108.565 123.270 156.423 1.00 123.64 ? 23  ALA D N   1 
ATOM 4718  C CA  . ALA D 1 23  ? 107.936 124.435 155.838 1.00 136.43 ? 23  ALA D CA  1 
ATOM 4719  C C   . ALA D 1 23  ? 108.987 125.233 155.126 1.00 124.63 ? 23  ALA D C   1 
ATOM 4720  O O   . ALA D 1 23  ? 108.737 125.770 154.064 1.00 135.97 ? 23  ALA D O   1 
ATOM 4721  C CB  . ALA D 1 23  ? 107.255 125.275 156.905 1.00 30.00  ? 23  ALA D CB  1 
ATOM 4722  N N   . VAL D 1 24  ? 110.154 125.359 155.740 1.00 119.23 ? 24  VAL D N   1 
ATOM 4723  C CA  . VAL D 1 24  ? 111.224 126.081 155.089 1.00 115.14 ? 24  VAL D CA  1 
ATOM 4724  C C   . VAL D 1 24  ? 111.635 125.324 153.836 1.00 115.95 ? 24  VAL D C   1 
ATOM 4725  O O   . VAL D 1 24  ? 111.719 125.893 152.750 1.00 121.87 ? 24  VAL D O   1 
ATOM 4726  C CB  . VAL D 1 24  ? 112.437 126.236 156.021 1.00 30.00  ? 24  VAL D CB  1 
ATOM 4727  C CG1 . VAL D 1 24  ? 112.338 127.532 156.806 1.00 30.00  ? 24  VAL D CG1 1 
ATOM 4728  C CG2 . VAL D 1 24  ? 112.536 125.048 156.966 1.00 30.00  ? 24  VAL D CG2 1 
ATOM 4729  N N   . ALA D 1 25  ? 111.797 124.015 153.976 1.00 113.08 ? 25  ALA D N   1 
ATOM 4730  C CA  . ALA D 1 25  ? 112.212 123.195 152.853 1.00 132.88 ? 25  ALA D CA  1 
ATOM 4731  C C   . ALA D 1 25  ? 111.160 123.226 151.771 1.00 125.56 ? 25  ALA D C   1 
ATOM 4732  O O   . ALA D 1 25  ? 111.461 123.421 150.594 1.00 130.11 ? 25  ALA D O   1 
ATOM 4733  C CB  . ALA D 1 25  ? 112.449 121.769 153.310 1.00 30.00  ? 25  ALA D CB  1 
ATOM 4734  N N   . ALA D 1 26  ? 109.907 123.100 152.180 1.00 112.05 ? 26  ALA D N   1 
ATOM 4735  C CA  . ALA D 1 26  ? 108.829 123.097 151.214 1.00 121.96 ? 26  ALA D CA  1 
ATOM 4736  C C   . ALA D 1 26  ? 108.771 124.423 150.484 1.00 122.57 ? 26  ALA D C   1 
ATOM 4737  O O   . ALA D 1 26  ? 108.634 124.459 149.266 1.00 124.18 ? 26  ALA D O   1 
ATOM 4738  C CB  . ALA D 1 26  ? 107.505 122.814 151.902 1.00 30.00  ? 26  ALA D CB  1 
ATOM 4739  N N   . ALA D 1 27  ? 108.924 125.514 151.224 1.00 120.74 ? 27  ALA D N   1 
ATOM 4740  C CA  . ALA D 1 27  ? 108.854 126.827 150.620 1.00 112.14 ? 27  ALA D CA  1 
ATOM 4741  C C   . ALA D 1 27  ? 109.970 126.989 149.617 1.00 126.27 ? 27  ALA D C   1 
ATOM 4742  O O   . ALA D 1 27  ? 109.737 127.459 148.515 1.00 129.46 ? 27  ALA D O   1 
ATOM 4743  C CB  . ALA D 1 27  ? 108.926 127.916 151.675 1.00 30.00  ? 27  ALA D CB  1 
ATOM 4744  N N   . VAL D 1 28  ? 111.175 126.551 149.968 1.00 128.89 ? 28  VAL D N   1 
ATOM 4745  C CA  . VAL D 1 28  ? 112.286 126.697 149.041 1.00 113.05 ? 28  VAL D CA  1 
ATOM 4746  C C   . VAL D 1 28  ? 112.048 125.888 147.785 1.00 121.90 ? 28  VAL D C   1 
ATOM 4747  O O   . VAL D 1 28  ? 112.288 126.354 146.674 1.00 122.20 ? 28  VAL D O   1 
ATOM 4748  C CB  . VAL D 1 28  ? 113.611 126.250 149.658 1.00 30.00  ? 28  VAL D CB  1 
ATOM 4749  C CG1 . VAL D 1 28  ? 114.700 126.285 148.603 1.00 30.00  ? 28  VAL D CG1 1 
ATOM 4750  C CG2 . VAL D 1 28  ? 113.976 127.144 150.827 1.00 30.00  ? 28  VAL D CG2 1 
ATOM 4751  N N   . LEU D 1 29  ? 111.538 124.679 147.963 1.00 114.96 ? 29  LEU D N   1 
ATOM 4752  C CA  . LEU D 1 29  ? 111.288 123.819 146.829 1.00 129.81 ? 29  LEU D CA  1 
ATOM 4753  C C   . LEU D 1 29  ? 110.262 124.465 145.909 1.00 140.90 ? 29  LEU D C   1 
ATOM 4754  O O   . LEU D 1 29  ? 110.435 124.476 144.693 1.00 135.21 ? 29  LEU D O   1 
ATOM 4755  C CB  . LEU D 1 29  ? 110.797 122.452 147.312 1.00 30.00  ? 29  LEU D CB  1 
ATOM 4756  C CG  . LEU D 1 29  ? 111.109 121.232 146.445 1.00 30.00  ? 29  LEU D CG  1 
ATOM 4757  C CD1 . LEU D 1 29  ? 111.209 119.982 147.302 1.00 30.00  ? 29  LEU D CD1 1 
ATOM 4758  C CD2 . LEU D 1 29  ? 110.082 121.052 145.340 1.00 30.00  ? 29  LEU D CD2 1 
ATOM 4759  N N   . ILE D 1 30  ? 109.201 125.027 146.480 1.00 133.11 ? 30  ILE D N   1 
ATOM 4760  C CA  . ILE D 1 30  ? 108.193 125.663 145.648 1.00 124.38 ? 30  ILE D CA  1 
ATOM 4761  C C   . ILE D 1 30  ? 108.776 126.867 144.927 1.00 127.80 ? 30  ILE D C   1 
ATOM 4762  O O   . ILE D 1 30  ? 108.560 127.063 143.735 1.00 124.15 ? 30  ILE D O   1 
ATOM 4763  C CB  . ILE D 1 30  ? 106.992 126.131 146.484 1.00 30.00  ? 30  ILE D CB  1 
ATOM 4764  C CG1 . ILE D 1 30  ? 106.286 124.936 147.121 1.00 30.00  ? 30  ILE D CG1 1 
ATOM 4765  C CG2 . ILE D 1 30  ? 106.016 126.909 145.618 1.00 30.00  ? 30  ILE D CG2 1 
ATOM 4766  C CD1 . ILE D 1 30  ? 105.158 125.324 148.051 1.00 30.00  ? 30  ILE D CD1 1 
ATOM 4767  N N   . GLN D 1 31  ? 109.539 127.662 145.665 1.00 132.79 ? 31  GLN D N   1 
ATOM 4768  C CA  . GLN D 1 31  ? 110.149 128.862 145.127 1.00 126.31 ? 31  GLN D CA  1 
ATOM 4769  C C   . GLN D 1 31  ? 111.163 128.545 144.047 1.00 126.39 ? 31  GLN D C   1 
ATOM 4770  O O   . GLN D 1 31  ? 111.176 129.186 143.000 1.00 134.06 ? 31  GLN D O   1 
ATOM 4771  C CB  . GLN D 1 31  ? 110.802 129.668 146.248 1.00 30.00  ? 31  GLN D CB  1 
ATOM 4772  C CG  . GLN D 1 31  ? 111.392 130.991 145.800 1.00 30.00  ? 31  GLN D CG  1 
ATOM 4773  C CD  . GLN D 1 31  ? 111.976 131.775 146.954 1.00 30.00  ? 31  GLN D CD  1 
ATOM 4774  O OE1 . GLN D 1 31  ? 112.104 131.263 148.064 1.00 30.00  ? 31  GLN D OE1 1 
ATOM 4775  N NE2 . GLN D 1 31  ? 112.333 133.026 146.698 1.00 30.00  ? 31  GLN D NE2 1 
ATOM 4776  N N   . THR D 1 32  ? 112.000 127.539 144.272 1.00 112.61 ? 32  THR D N   1 
ATOM 4777  C CA  . THR D 1 32  ? 112.966 127.221 143.226 1.00 127.34 ? 32  THR D CA  1 
ATOM 4778  C C   . THR D 1 32  ? 112.307 126.552 142.034 1.00 131.45 ? 32  THR D C   1 
ATOM 4779  O O   . THR D 1 32  ? 112.651 126.868 140.892 1.00 120.85 ? 32  THR D O   1 
ATOM 4780  C CB  . THR D 1 32  ? 114.081 126.323 143.760 1.00 30.00  ? 32  THR D CB  1 
ATOM 4781  O OG1 . THR D 1 32  ? 113.509 125.166 144.385 1.00 30.00  ? 32  THR D OG1 1 
ATOM 4782  C CG2 . THR D 1 32  ? 114.944 127.071 144.752 1.00 30.00  ? 32  THR D CG2 1 
ATOM 4783  N N   . SER D 1 33  ? 111.354 125.648 142.276 1.00 130.67 ? 33  SER D N   1 
ATOM 4784  C CA  . SER D 1 33  ? 110.534 125.143 141.183 1.00 132.42 ? 33  SER D CA  1 
ATOM 4785  C C   . SER D 1 33  ? 109.615 126.223 140.644 1.00 131.30 ? 33  SER D C   1 
ATOM 4786  O O   . SER D 1 33  ? 109.243 126.184 139.468 1.00 133.84 ? 33  SER D O   1 
ATOM 4787  C CB  . SER D 1 33  ? 109.714 123.941 141.636 1.00 30.00  ? 33  SER D CB  1 
ATOM 4788  O OG  . SER D 1 33  ? 110.559 122.861 141.982 1.00 30.00  ? 33  SER D OG  1 
ATOM 4789  N N   . GLY D 1 34  ? 109.245 127.192 141.486 1.00 129.56 ? 34  GLY D N   1 
ATOM 4790  C CA  . GLY D 1 34  ? 108.491 128.339 141.008 1.00 121.87 ? 34  GLY D CA  1 
ATOM 4791  C C   . GLY D 1 34  ? 109.290 129.204 140.056 1.00 127.99 ? 34  GLY D C   1 
ATOM 4792  O O   . GLY D 1 34  ? 108.739 129.775 139.114 1.00 136.74 ? 34  GLY D O   1 
ATOM 4793  N N   . TYR D 1 35  ? 110.601 129.309 140.287 1.00 111.57 ? 35  TYR D N   1 
ATOM 4794  C CA  . TYR D 1 35  ? 111.469 129.988 139.331 1.00 115.71 ? 35  TYR D CA  1 
ATOM 4795  C C   . TYR D 1 35  ? 111.514 129.256 137.996 1.00 122.18 ? 35  TYR D C   1 
ATOM 4796  O O   . TYR D 1 35  ? 111.644 129.890 136.942 1.00 127.53 ? 35  TYR D O   1 
ATOM 4797  C CB  . TYR D 1 35  ? 112.881 130.136 139.902 1.00 30.00  ? 35  TYR D CB  1 
ATOM 4798  C CG  . TYR D 1 35  ? 113.867 130.661 138.888 1.00 30.00  ? 35  TYR D CG  1 
ATOM 4799  C CD1 . TYR D 1 35  ? 113.829 131.981 138.476 1.00 30.00  ? 35  TYR D CD1 1 
ATOM 4800  C CD2 . TYR D 1 35  ? 114.823 129.826 138.327 1.00 30.00  ? 35  TYR D CD2 1 
ATOM 4801  C CE1 . TYR D 1 35  ? 114.715 132.456 137.536 1.00 30.00  ? 35  TYR D CE1 1 
ATOM 4802  C CE2 . TYR D 1 35  ? 115.711 130.292 137.389 1.00 30.00  ? 35  TYR D CE2 1 
ATOM 4803  C CZ  . TYR D 1 35  ? 115.657 131.605 137.001 1.00 30.00  ? 35  TYR D CZ  1 
ATOM 4804  O OH  . TYR D 1 35  ? 116.552 132.068 136.067 1.00 30.00  ? 35  TYR D OH  1 
ATOM 4805  N N   . LEU D 1 36  ? 111.397 127.928 138.019 1.00 116.21 ? 36  LEU D N   1 
ATOM 4806  C CA  . LEU D 1 36  ? 111.598 127.128 136.820 1.00 130.01 ? 36  LEU D CA  1 
ATOM 4807  C C   . LEU D 1 36  ? 110.531 127.343 135.762 1.00 123.78 ? 36  LEU D C   1 
ATOM 4808  O O   . LEU D 1 36  ? 110.836 127.197 134.577 1.00 118.51 ? 36  LEU D O   1 
ATOM 4809  C CB  . LEU D 1 36  ? 111.645 125.645 137.173 1.00 30.00  ? 36  LEU D CB  1 
ATOM 4810  C CG  . LEU D 1 36  ? 112.803 125.230 138.070 1.00 30.00  ? 36  LEU D CG  1 
ATOM 4811  C CD1 . LEU D 1 36  ? 112.715 123.759 138.415 1.00 30.00  ? 36  LEU D CD1 1 
ATOM 4812  C CD2 . LEU D 1 36  ? 114.119 125.545 137.425 1.00 30.00  ? 36  LEU D CD2 1 
ATOM 4813  N N   . GLN D 1 37  ? 109.303 127.702 136.149 1.00 123.38 ? 37  GLN D N   1 
ATOM 4814  C CA  . GLN D 1 37  ? 108.252 127.801 135.143 1.00 117.62 ? 37  GLN D CA  1 
ATOM 4815  C C   . GLN D 1 37  ? 108.417 129.038 134.275 1.00 110.58 ? 37  GLN D C   1 
ATOM 4816  O O   . GLN D 1 37  ? 108.168 128.972 133.066 1.00 111.88 ? 37  GLN D O   1 
ATOM 4817  C CB  . GLN D 1 37  ? 106.857 127.808 135.768 1.00 30.00  ? 37  GLN D CB  1 
ATOM 4818  C CG  . GLN D 1 37  ? 106.529 126.614 136.627 1.00 30.00  ? 37  GLN D CG  1 
ATOM 4819  C CD  . GLN D 1 37  ? 106.624 126.937 138.088 1.00 30.00  ? 37  GLN D CD  1 
ATOM 4820  O OE1 . GLN D 1 37  ? 106.486 128.090 138.480 1.00 30.00  ? 37  GLN D OE1 1 
ATOM 4821  N NE2 . GLN D 1 37  ? 106.877 125.928 138.907 1.00 30.00  ? 37  GLN D NE2 1 
ATOM 4822  N N   . GLN D 1 38  ? 108.848 130.165 134.858 1.00 110.77 ? 38  GLN D N   1 
ATOM 4823  C CA  . GLN D 1 38  ? 108.951 131.400 134.083 1.00 125.53 ? 38  GLN D CA  1 
ATOM 4824  C C   . GLN D 1 38  ? 110.087 131.318 133.076 1.00 131.29 ? 38  GLN D C   1 
ATOM 4825  O O   . GLN D 1 38  ? 110.037 131.946 132.013 1.00 143.08 ? 38  GLN D O   1 
ATOM 4826  C CB  . GLN D 1 38  ? 109.132 132.624 134.991 1.00 30.00  ? 38  GLN D CB  1 
ATOM 4827  C CG  . GLN D 1 38  ? 110.421 132.696 135.792 1.00 30.00  ? 38  GLN D CG  1 
ATOM 4828  C CD  . GLN D 1 38  ? 110.578 134.020 136.517 1.00 30.00  ? 38  GLN D CD  1 
ATOM 4829  O OE1 . GLN D 1 38  ? 109.775 134.931 136.343 1.00 30.00  ? 38  GLN D OE1 1 
ATOM 4830  N NE2 . GLN D 1 38  ? 111.619 134.134 137.331 1.00 30.00  ? 38  GLN D NE2 1 
ATOM 4831  N N   . LYS D 1 39  ? 111.117 130.534 133.384 1.00 115.39 ? 39  LYS D N   1 
ATOM 4832  C CA  . LYS D 1 39  ? 112.183 130.361 132.414 1.00 122.69 ? 39  LYS D CA  1 
ATOM 4833  C C   . LYS D 1 39  ? 111.822 129.285 131.403 1.00 122.92 ? 39  LYS D C   1 
ATOM 4834  O O   . LYS D 1 39  ? 112.185 129.394 130.227 1.00 119.94 ? 39  LYS D O   1 
ATOM 4835  C CB  . LYS D 1 39  ? 113.487 130.031 133.130 1.00 30.00  ? 39  LYS D CB  1 
ATOM 4836  C CG  . LYS D 1 39  ? 114.688 130.043 132.227 1.00 30.00  ? 39  LYS D CG  1 
ATOM 4837  C CD  . LYS D 1 39  ? 114.896 131.444 131.702 1.00 30.00  ? 39  LYS D CD  1 
ATOM 4838  C CE  . LYS D 1 39  ? 116.173 131.537 130.920 1.00 30.00  ? 39  LYS D CE  1 
ATOM 4839  N NZ  . LYS D 1 39  ? 116.081 130.677 129.728 1.00 30.00  ? 39  LYS D NZ  1 
ATOM 4840  N N   . SER D 1 40  ? 111.082 128.259 131.829 1.00 115.71 ? 40  SER D N   1 
ATOM 4841  C CA  . SER D 1 40  ? 110.704 127.198 130.903 1.00 125.17 ? 40  SER D CA  1 
ATOM 4842  C C   . SER D 1 40  ? 109.631 127.670 129.936 1.00 124.47 ? 40  SER D C   1 
ATOM 4843  O O   . SER D 1 40  ? 109.763 127.495 128.721 1.00 117.25 ? 40  SER D O   1 
ATOM 4844  C CB  . SER D 1 40  ? 110.221 125.966 131.661 1.00 30.00  ? 40  SER D CB  1 
ATOM 4845  O OG  . SER D 1 40  ? 109.014 126.243 132.342 1.00 30.00  ? 40  SER D OG  1 
ATOM 4846  N N   . GLN D 1 41  ? 108.565 128.285 130.455 1.00 124.77 ? 41  GLN D N   1 
ATOM 4847  C CA  . GLN D 1 41  ? 107.440 128.649 129.598 1.00 118.76 ? 41  GLN D CA  1 
ATOM 4848  C C   . GLN D 1 41  ? 107.779 129.848 128.721 1.00 112.40 ? 41  GLN D C   1 
ATOM 4849  O O   . GLN D 1 41  ? 107.128 130.070 127.693 1.00 107.21 ? 41  GLN D O   1 
ATOM 4850  C CB  . GLN D 1 41  ? 106.195 128.886 130.459 1.00 30.00  ? 41  GLN D CB  1 
ATOM 4851  C CG  . GLN D 1 41  ? 104.881 129.065 129.713 1.00 30.00  ? 41  GLN D CG  1 
ATOM 4852  C CD  . GLN D 1 41  ? 103.685 129.027 130.635 1.00 30.00  ? 41  GLN D CD  1 
ATOM 4853  O OE1 . GLN D 1 41  ? 103.820 128.843 131.842 1.00 30.00  ? 41  GLN D OE1 1 
ATOM 4854  N NE2 . GLN D 1 41  ? 102.502 129.196 130.068 1.00 30.00  ? 41  GLN D NE2 1 
ATOM 4855  N N   . ALA D 1 42  ? 108.812 130.609 129.084 1.00 117.08 ? 42  ALA D N   1 
ATOM 4856  C CA  . ALA D 1 42  ? 109.465 131.452 128.091 1.00 121.87 ? 42  ALA D CA  1 
ATOM 4857  C C   . ALA D 1 42  ? 110.078 130.595 126.991 1.00 124.60 ? 42  ALA D C   1 
ATOM 4858  O O   . ALA D 1 42  ? 109.625 130.627 125.843 1.00 129.32 ? 42  ALA D O   1 
ATOM 4859  C CB  . ALA D 1 42  ? 110.526 132.332 128.749 1.00 30.00  ? 42  ALA D CB  1 
ATOM 4860  N N   . THR D 1 43  ? 111.057 129.756 127.344 1.00 122.18 ? 43  THR D N   1 
ATOM 4861  C CA  . THR D 1 43  ? 111.748 128.923 126.364 1.00 129.90 ? 43  THR D CA  1 
ATOM 4862  C C   . THR D 1 43  ? 110.862 127.854 125.736 1.00 121.89 ? 43  THR D C   1 
ATOM 4863  O O   . THR D 1 43  ? 111.216 127.334 124.673 1.00 106.94 ? 43  THR D O   1 
ATOM 4864  C CB  . THR D 1 43  ? 112.961 128.250 127.000 1.00 30.00  ? 43  THR D CB  1 
ATOM 4865  O OG1 . THR D 1 43  ? 112.538 127.475 128.126 1.00 30.00  ? 43  THR D OG1 1 
ATOM 4866  C CG2 . THR D 1 43  ? 113.964 129.279 127.443 1.00 30.00  ? 43  THR D CG2 1 
ATOM 4867  N N   . GLY D 1 44  ? 109.732 127.518 126.354 1.00 116.35 ? 44  GLY D N   1 
ATOM 4868  C CA  . GLY D 1 44  ? 108.774 126.623 125.739 1.00 102.42 ? 44  GLY D CA  1 
ATOM 4869  C C   . GLY D 1 44  ? 108.116 127.262 124.539 1.00 107.16 ? 44  GLY D C   1 
ATOM 4870  O O   . GLY D 1 44  ? 107.752 126.579 123.579 1.00 105.71 ? 44  GLY D O   1 
ATOM 4871  N N   . ARG D 1 45  ? 107.955 128.584 124.587 1.00 121.34 ? 45  ARG D N   1 
ATOM 4872  C CA  . ARG D 1 45  ? 107.316 129.282 123.480 1.00 118.64 ? 45  ARG D CA  1 
ATOM 4873  C C   . ARG D 1 45  ? 108.341 129.803 122.483 1.00 114.49 ? 45  ARG D C   1 
ATOM 4874  O O   . ARG D 1 45  ? 108.165 129.647 121.268 1.00 119.78 ? 45  ARG D O   1 
ATOM 4875  C CB  . ARG D 1 45  ? 106.479 130.445 124.002 1.00 30.00  ? 45  ARG D CB  1 
ATOM 4876  C CG  . ARG D 1 45  ? 105.324 130.085 124.916 1.00 30.00  ? 45  ARG D CG  1 
ATOM 4877  C CD  . ARG D 1 45  ? 104.527 131.337 125.247 1.00 30.00  ? 45  ARG D CD  1 
ATOM 4878  N NE  . ARG D 1 45  ? 105.315 132.312 125.995 1.00 30.00  ? 45  ARG D NE  1 
ATOM 4879  C CZ  . ARG D 1 45  ? 105.744 133.467 125.493 1.00 30.00  ? 45  ARG D CZ  1 
ATOM 4880  N NH1 . ARG D 1 45  ? 105.472 133.783 124.236 1.00 30.00  ? 45  ARG D NH1 1 
ATOM 4881  N NH2 . ARG D 1 45  ? 106.457 134.296 126.239 1.00 30.00  ? 45  ARG D NH2 1 
ATOM 4882  N N   . GLU D 1 46  ? 109.411 130.433 122.988 1.00 110.36 ? 46  GLU D N   1 
ATOM 4883  C CA  . GLU D 1 46  ? 110.280 131.288 122.180 1.00 120.39 ? 46  GLU D CA  1 
ATOM 4884  C C   . GLU D 1 46  ? 111.006 130.523 121.089 1.00 123.08 ? 46  GLU D C   1 
ATOM 4885  O O   . GLU D 1 46  ? 111.286 131.081 120.025 1.00 126.45 ? 46  GLU D O   1 
ATOM 4886  C CB  . GLU D 1 46  ? 111.311 131.970 123.070 1.00 30.00  ? 46  GLU D CB  1 
ATOM 4887  C CG  . GLU D 1 46  ? 110.758 132.982 124.030 1.00 30.00  ? 46  GLU D CG  1 
ATOM 4888  C CD  . GLU D 1 46  ? 111.799 133.389 125.035 1.00 30.00  ? 46  GLU D CD  1 
ATOM 4889  O OE1 . GLU D 1 46  ? 112.926 132.867 124.955 1.00 30.00  ? 46  GLU D OE1 1 
ATOM 4890  O OE2 . GLU D 1 46  ? 111.491 134.180 125.939 1.00 30.00  ? 46  GLU D OE2 1 
ATOM 4891  N N   . THR D 1 47  ? 111.316 129.258 121.323 1.00 109.60 ? 47  THR D N   1 
ATOM 4892  C CA  . THR D 1 47  ? 112.050 128.514 120.317 1.00 114.97 ? 47  THR D CA  1 
ATOM 4893  C C   . THR D 1 47  ? 111.168 128.036 119.178 1.00 122.24 ? 47  THR D C   1 
ATOM 4894  O O   . THR D 1 47  ? 111.667 127.873 118.061 1.00 126.78 ? 47  THR D O   1 
ATOM 4895  C CB  . THR D 1 47  ? 112.759 127.345 120.970 1.00 30.00  ? 47  THR D CB  1 
ATOM 4896  O OG1 . THR D 1 47  ? 111.785 126.543 121.643 1.00 30.00  ? 47  THR D OG1 1 
ATOM 4897  C CG2 . THR D 1 47  ? 113.780 127.880 121.955 1.00 30.00  ? 47  THR D CG2 1 
ATOM 4898  N N   . THR D 1 48  ? 109.877 127.819 119.425 1.00 106.63 ? 48  THR D N   1 
ATOM 4899  C CA  . THR D 1 48  ? 108.960 127.615 118.312 1.00 106.27 ? 48  THR D CA  1 
ATOM 4900  C C   . THR D 1 48  ? 108.763 128.907 117.537 1.00 112.60 ? 48  THR D C   1 
ATOM 4901  O O   . THR D 1 48  ? 108.517 128.879 116.328 1.00 117.23 ? 48  THR D O   1 
ATOM 4902  C CB  . THR D 1 48  ? 107.621 127.091 118.814 1.00 30.00  ? 48  THR D CB  1 
ATOM 4903  O OG1 . THR D 1 48  ? 107.053 128.046 119.714 1.00 30.00  ? 48  THR D OG1 1 
ATOM 4904  C CG2 . THR D 1 48  ? 107.817 125.778 119.536 1.00 30.00  ? 48  THR D CG2 1 
ATOM 4905  N N   . GLN D 1 49  ? 108.870 130.047 118.220 1.00 120.76 ? 49  GLN D N   1 
ATOM 4906  C CA  . GLN D 1 49  ? 108.925 131.326 117.527 1.00 129.15 ? 49  GLN D CA  1 
ATOM 4907  C C   . GLN D 1 49  ? 110.246 131.491 116.791 1.00 124.57 ? 49  GLN D C   1 
ATOM 4908  O O   . GLN D 1 49  ? 110.297 132.139 115.741 1.00 134.69 ? 49  GLN D O   1 
ATOM 4909  C CB  . GLN D 1 49  ? 108.740 132.460 118.529 1.00 30.00  ? 49  GLN D CB  1 
ATOM 4910  C CG  . GLN D 1 49  ? 107.437 132.412 119.277 1.00 30.00  ? 49  GLN D CG  1 
ATOM 4911  C CD  . GLN D 1 49  ? 107.362 133.471 120.347 1.00 30.00  ? 49  GLN D CD  1 
ATOM 4912  O OE1 . GLN D 1 49  ? 108.326 134.197 120.585 1.00 30.00  ? 49  GLN D OE1 1 
ATOM 4913  N NE2 . GLN D 1 49  ? 106.212 133.570 121.001 1.00 30.00  ? 49  GLN D NE2 1 
ATOM 4914  N N   . GLU D 1 50  ? 111.318 130.906 117.328 1.00 118.17 ? 50  GLU D N   1 
ATOM 4915  C CA  . GLU D 1 50  ? 112.649 131.080 116.768 1.00 122.89 ? 50  GLU D CA  1 
ATOM 4916  C C   . GLU D 1 50  ? 112.836 130.303 115.474 1.00 108.02 ? 50  GLU D C   1 
ATOM 4917  O O   . GLU D 1 50  ? 113.606 130.736 114.611 1.00 108.64 ? 50  GLU D O   1 
ATOM 4918  C CB  . GLU D 1 50  ? 113.694 130.627 117.789 1.00 30.00  ? 50  GLU D CB  1 
ATOM 4919  C CG  . GLU D 1 50  ? 115.136 130.972 117.467 1.00 30.00  ? 50  GLU D CG  1 
ATOM 4920  C CD  . GLU D 1 50  ? 115.439 132.439 117.683 1.00 30.00  ? 50  GLU D CD  1 
ATOM 4921  O OE1 . GLU D 1 50  ? 114.781 133.052 118.549 1.00 30.00  ? 50  GLU D OE1 1 
ATOM 4922  O OE2 . GLU D 1 50  ? 116.331 132.973 116.992 1.00 30.00  ? 50  GLU D OE2 1 
ATOM 4923  N N   . VAL D 1 51  ? 112.145 129.179 115.307 1.00 112.66 ? 51  VAL D N   1 
ATOM 4924  C CA  . VAL D 1 51  ? 112.387 128.307 114.167 1.00 114.59 ? 51  VAL D CA  1 
ATOM 4925  C C   . VAL D 1 51  ? 111.283 128.368 113.122 1.00 112.54 ? 51  VAL D C   1 
ATOM 4926  O O   . VAL D 1 51  ? 111.544 128.032 111.957 1.00 128.80 ? 51  VAL D O   1 
ATOM 4927  C CB  . VAL D 1 51  ? 112.616 126.848 114.613 1.00 30.00  ? 51  VAL D CB  1 
ATOM 4928  C CG1 . VAL D 1 51  ? 113.759 126.784 115.603 1.00 30.00  ? 51  VAL D CG1 1 
ATOM 4929  C CG2 . VAL D 1 51  ? 111.357 126.237 115.199 1.00 30.00  ? 51  VAL D CG2 1 
ATOM 4930  N N   . ALA D 1 52  ? 110.070 128.786 113.481 1.00 30.00  ? 52  ALA D N   1 
ATOM 4931  C CA  . ALA D 1 52  ? 108.997 128.820 112.495 1.00 30.00  ? 52  ALA D CA  1 
ATOM 4932  C C   . ALA D 1 52  ? 109.046 130.104 111.683 1.00 30.00  ? 52  ALA D C   1 
ATOM 4933  O O   . ALA D 1 52  ? 108.793 130.097 110.474 1.00 30.00  ? 52  ALA D O   1 
ATOM 4934  C CB  . ALA D 1 52  ? 107.642 128.666 113.181 1.00 30.00  ? 52  ALA D CB  1 
ATOM 4935  N N   . SER D 1 53  ? 109.362 131.214 112.337 1.00 113.33 ? 53  SER D N   1 
ATOM 4936  C CA  . SER D 1 53  ? 109.403 132.503 111.669 1.00 119.89 ? 53  SER D CA  1 
ATOM 4937  C C   . SER D 1 53  ? 110.604 132.599 110.739 1.00 124.17 ? 53  SER D C   1 
ATOM 4938  O O   . SER D 1 53  ? 111.682 132.076 111.024 1.00 123.77 ? 53  SER D O   1 
ATOM 4939  C CB  . SER D 1 53  ? 109.448 133.618 112.708 1.00 135.93 ? 53  SER D CB  1 
ATOM 4940  O OG  . SER D 1 53  ? 110.587 133.499 113.534 1.00 150.89 ? 53  SER D OG  1 
ATOM 4941  N N   . GLY D 1 54  ? 110.410 133.275 109.613 1.00 126.56 ? 54  GLY D N   1 
ATOM 4942  C CA  . GLY D 1 54  ? 111.494 133.389 108.662 1.00 107.25 ? 54  GLY D CA  1 
ATOM 4943  C C   . GLY D 1 54  ? 111.201 134.158 107.392 1.00 106.60 ? 54  GLY D C   1 
ATOM 4944  O O   . GLY D 1 54  ? 110.047 134.311 106.984 1.00 103.76 ? 54  GLY D O   1 
ATOM 4945  N N   . ILE D 1 55  ? 112.272 134.625 106.758 1.00 100.38 ? 55  ILE D N   1 
ATOM 4946  C CA  . ILE D 1 55  ? 112.229 135.432 105.545 1.00 80.06  ? 55  ILE D CA  1 
ATOM 4947  C C   . ILE D 1 55  ? 112.601 134.547 104.361 1.00 98.77  ? 55  ILE D C   1 
ATOM 4948  O O   . ILE D 1 55  ? 113.483 133.693 104.480 1.00 111.05 ? 55  ILE D O   1 
ATOM 4949  C CB  . ILE D 1 55  ? 113.171 136.643 105.687 1.00 30.00  ? 55  ILE D CB  1 
ATOM 4950  C CG1 . ILE D 1 55  ? 112.557 137.676 106.631 1.00 30.00  ? 55  ILE D CG1 1 
ATOM 4951  C CG2 . ILE D 1 55  ? 113.593 137.246 104.361 1.00 30.00  ? 55  ILE D CG2 1 
ATOM 4952  C CD1 . ILE D 1 55  ? 113.438 138.870 106.872 1.00 30.00  ? 55  ILE D CD1 1 
ATOM 4953  N N   . LYS D 1 56  ? 111.894 134.706 103.241 1.00 98.92  ? 56  LYS D N   1 
ATOM 4954  C CA  . LYS D 1 56  ? 112.315 134.115 101.980 1.00 91.81  ? 56  LYS D CA  1 
ATOM 4955  C C   . LYS D 1 56  ? 112.426 135.193 100.910 1.00 85.75  ? 56  LYS D C   1 
ATOM 4956  O O   . LYS D 1 56  ? 111.658 136.159 100.898 1.00 101.89 ? 56  LYS D O   1 
ATOM 4957  C CB  . LYS D 1 56  ? 111.368 132.991 101.535 1.00 30.00  ? 56  LYS D CB  1 
ATOM 4958  C CG  . LYS D 1 56  ? 109.944 133.386 101.199 1.00 30.00  ? 56  LYS D CG  1 
ATOM 4959  C CD  . LYS D 1 56  ? 109.155 132.141 100.824 1.00 30.00  ? 56  LYS D CD  1 
ATOM 4960  C CE  . LYS D 1 56  ? 107.699 132.444 100.560 1.00 30.00  ? 56  LYS D CE  1 
ATOM 4961  N NZ  . LYS D 1 56  ? 107.530 133.280 99.354  1.00 30.00  ? 56  LYS D NZ  1 
ATOM 4962  N N   . VAL D 1 57  ? 113.402 135.018 100.024 1.00 72.52  ? 57  VAL D N   1 
ATOM 4963  C CA  . VAL D 1 57  ? 113.794 136.013 99.033  1.00 81.55  ? 57  VAL D CA  1 
ATOM 4964  C C   . VAL D 1 57  ? 113.365 135.520 97.663  1.00 102.46 ? 57  VAL D C   1 
ATOM 4965  O O   . VAL D 1 57  ? 113.703 134.400 97.267  1.00 103.19 ? 57  VAL D O   1 
ATOM 4966  C CB  . VAL D 1 57  ? 115.306 136.265 99.071  1.00 30.00  ? 57  VAL D CB  1 
ATOM 4967  C CG1 . VAL D 1 57  ? 115.728 137.127 97.915  1.00 30.00  ? 57  VAL D CG1 1 
ATOM 4968  C CG2 . VAL D 1 57  ? 115.686 136.917 100.373 1.00 30.00  ? 57  VAL D CG2 1 
ATOM 4969  N N   . LEU D 1 58  ? 112.630 136.354 96.937  1.00 92.19  ? 58  LEU D N   1 
ATOM 4970  C CA  . LEU D 1 58  ? 112.168 136.021 95.600  1.00 86.93  ? 58  LEU D CA  1 
ATOM 4971  C C   . LEU D 1 58  ? 112.350 137.214 94.674  1.00 105.85 ? 58  LEU D C   1 
ATOM 4972  O O   . LEU D 1 58  ? 112.038 138.343 95.057  1.00 120.09 ? 58  LEU D O   1 
ATOM 4973  C CB  . LEU D 1 58  ? 110.704 135.553 95.649  1.00 30.00  ? 58  LEU D CB  1 
ATOM 4974  C CG  . LEU D 1 58  ? 109.615 136.374 96.360  1.00 30.00  ? 58  LEU D CG  1 
ATOM 4975  C CD1 . LEU D 1 58  ? 108.944 137.430 95.499  1.00 30.00  ? 58  LEU D CD1 1 
ATOM 4976  C CD2 . LEU D 1 58  ? 108.570 135.439 96.917  1.00 30.00  ? 58  LEU D CD2 1 
ATOM 4977  N N   . SER D 1 59  ? 112.909 136.958 93.487  1.00 102.02 ? 59  SER D N   1 
ATOM 4978  C CA  . SER D 1 59  ? 112.844 137.832 92.309  1.00 101.26 ? 59  SER D CA  1 
ATOM 4979  C C   . SER D 1 59  ? 113.433 139.222 92.573  1.00 100.91 ? 59  SER D C   1 
ATOM 4980  O O   . SER D 1 59  ? 112.738 140.235 92.594  1.00 93.78  ? 59  SER D O   1 
ATOM 4981  C CB  . SER D 1 59  ? 111.405 137.940 91.796  1.00 30.00  ? 59  SER D CB  1 
ATOM 4982  O OG  . SER D 1 59  ? 110.953 136.683 91.327  1.00 30.00  ? 59  SER D OG  1 
ATOM 4983  N N   . VAL D 1 60  ? 114.731 139.236 92.790  1.00 114.53 ? 60  VAL D N   1 
ATOM 4984  C CA  . VAL D 1 60  ? 115.447 140.494 92.932  1.00 106.73 ? 60  VAL D CA  1 
ATOM 4985  C C   . VAL D 1 60  ? 115.630 141.096 91.542  1.00 97.61  ? 60  VAL D C   1 
ATOM 4986  O O   . VAL D 1 60  ? 115.724 140.372 90.548  1.00 91.29  ? 60  VAL D O   1 
ATOM 4987  C CB  . VAL D 1 60  ? 116.788 140.253 93.643  1.00 30.00  ? 60  VAL D CB  1 
ATOM 4988  C CG1 . VAL D 1 60  ? 117.429 141.558 94.069  1.00 30.00  ? 60  VAL D CG1 1 
ATOM 4989  C CG2 . VAL D 1 60  ? 116.601 139.327 94.819  1.00 30.00  ? 60  VAL D CG2 1 
ATOM 4990  N N   . VAL D 1 61  ? 115.656 142.422 91.455  1.00 91.21  ? 61  VAL D N   1 
ATOM 4991  C CA  . VAL D 1 61  ? 115.725 143.120 90.182  1.00 75.96  ? 61  VAL D CA  1 
ATOM 4992  C C   . VAL D 1 61  ? 116.962 144.010 90.150  1.00 85.19  ? 61  VAL D C   1 
ATOM 4993  O O   . VAL D 1 61  ? 117.530 144.360 91.186  1.00 107.80 ? 61  VAL D O   1 
ATOM 4994  C CB  . VAL D 1 61  ? 114.448 143.930 89.940  1.00 30.00  ? 61  VAL D CB  1 
ATOM 4995  C CG1 . VAL D 1 61  ? 113.314 142.997 89.659  1.00 30.00  ? 61  VAL D CG1 1 
ATOM 4996  C CG2 . VAL D 1 61  ? 114.108 144.672 91.190  1.00 30.00  ? 61  VAL D CG2 1 
ATOM 4997  N N   . GLY D 1 62  ? 117.398 144.356 88.936  1.00 70.41  ? 62  GLY D N   1 
ATOM 4998  C CA  . GLY D 1 62  ? 118.680 145.023 88.781  1.00 74.08  ? 62  GLY D CA  1 
ATOM 4999  C C   . GLY D 1 62  ? 118.747 146.537 88.689  1.00 71.97  ? 62  GLY D C   1 
ATOM 5000  O O   . GLY D 1 62  ? 119.345 147.160 89.568  1.00 101.24 ? 62  GLY D O   1 
ATOM 5001  N N   . LYS D 1 63  ? 118.095 147.137 87.682  1.00 30.00  ? 63  LYS D N   1 
ATOM 5002  C CA  . LYS D 1 63  ? 118.214 148.556 87.319  1.00 30.00  ? 63  LYS D CA  1 
ATOM 5003  C C   . LYS D 1 63  ? 119.661 148.994 87.105  1.00 30.00  ? 63  LYS D C   1 
ATOM 5004  O O   . LYS D 1 63  ? 120.273 149.600 87.990  1.00 30.00  ? 63  LYS D O   1 
ATOM 5005  C CB  . LYS D 1 63  ? 117.538 149.486 88.335  1.00 30.00  ? 63  LYS D CB  1 
ATOM 5006  C CG  . LYS D 1 63  ? 117.419 150.953 87.873  1.00 30.00  ? 63  LYS D CG  1 
ATOM 5007  C CD  . LYS D 1 63  ? 116.552 151.093 86.641  1.00 30.00  ? 63  LYS D CD  1 
ATOM 5008  C CE  . LYS D 1 63  ? 116.557 152.520 86.131  1.00 30.00  ? 63  LYS D CE  1 
ATOM 5009  N NZ  . LYS D 1 63  ? 115.961 153.471 87.102  1.00 30.00  ? 63  LYS D NZ  1 
ATOM 5010  N N   . THR D 1 64  ? 120.266 148.607 85.988  1.00 74.75  ? 64  THR D N   1 
ATOM 5011  C CA  . THR D 1 64  ? 121.555 149.200 85.686  1.00 85.42  ? 64  THR D CA  1 
ATOM 5012  C C   . THR D 1 64  ? 121.388 150.642 85.214  1.00 94.58  ? 64  THR D C   1 
ATOM 5013  O O   . THR D 1 64  ? 120.279 151.139 85.001  1.00 107.53 ? 64  THR D O   1 
ATOM 5014  C CB  . THR D 1 64  ? 122.305 148.387 84.639  1.00 30.00  ? 64  THR D CB  1 
ATOM 5015  O OG1 . THR D 1 64  ? 123.657 148.846 84.563  1.00 30.00  ? 64  THR D OG1 1 
ATOM 5016  C CG2 . THR D 1 64  ? 121.691 148.567 83.295  1.00 30.00  ? 64  THR D CG2 1 
ATOM 5017  N N   . ASP D 1 65  ? 122.524 151.313 85.046  1.00 92.95  ? 65  ASP D N   1 
ATOM 5018  C CA  . ASP D 1 65  ? 122.572 152.709 84.636  1.00 78.92  ? 65  ASP D CA  1 
ATOM 5019  C C   . ASP D 1 65  ? 122.176 152.809 83.160  1.00 87.53  ? 65  ASP D C   1 
ATOM 5020  O O   . ASP D 1 65  ? 122.143 151.811 82.436  1.00 108.21 ? 65  ASP D O   1 
ATOM 5021  C CB  . ASP D 1 65  ? 123.963 153.269 84.928  1.00 30.00  ? 65  ASP D CB  1 
ATOM 5022  C CG  . ASP D 1 65  ? 124.015 154.781 84.895  1.00 30.00  ? 65  ASP D CG  1 
ATOM 5023  O OD1 . ASP D 1 65  ? 122.981 155.418 84.604  1.00 30.00  ? 65  ASP D OD1 1 
ATOM 5024  O OD2 . ASP D 1 65  ? 125.100 155.337 85.166  1.00 30.00  ? 65  ASP D OD2 1 
ATOM 5025  N N   . SER D 1 66  ? 121.861 154.023 82.694  1.00 82.88  ? 66  SER D N   1 
ATOM 5026  C CA  . SER D 1 66  ? 121.491 154.243 81.300  1.00 100.10 ? 66  SER D CA  1 
ATOM 5027  C C   . SER D 1 66  ? 122.629 153.947 80.333  1.00 99.91  ? 66  SER D C   1 
ATOM 5028  O O   . SER D 1 66  ? 122.367 153.670 79.159  1.00 105.10 ? 66  SER D O   1 
ATOM 5029  C CB  . SER D 1 66  ? 121.009 155.679 81.106  1.00 30.00  ? 66  SER D CB  1 
ATOM 5030  O OG  . SER D 1 66  ? 119.832 155.919 81.857  1.00 30.00  ? 66  SER D OG  1 
ATOM 5031  N N   . ASN D 1 67  ? 123.872 154.001 80.793  1.00 97.83  ? 67  ASN D N   1 
ATOM 5032  C CA  . ASN D 1 67  ? 124.976 153.271 80.181  1.00 107.23 ? 67  ASN D CA  1 
ATOM 5033  C C   . ASN D 1 67  ? 124.985 151.944 80.932  1.00 118.78 ? 67  ASN D C   1 
ATOM 5034  O O   . ASN D 1 67  ? 125.086 151.934 82.161  1.00 119.03 ? 67  ASN D O   1 
ATOM 5035  C CB  . ASN D 1 67  ? 126.293 154.028 80.312  1.00 30.00  ? 67  ASN D CB  1 
ATOM 5036  C CG  . ASN D 1 67  ? 127.397 153.430 79.468  1.00 30.00  ? 67  ASN D CG  1 
ATOM 5037  O OD1 . ASN D 1 67  ? 127.194 152.445 78.761  1.00 30.00  ? 67  ASN D OD1 1 
ATOM 5038  N ND2 . ASN D 1 67  ? 128.574 154.034 79.531  1.00 30.00  ? 67  ASN D ND2 1 
ATOM 5039  N N   . LYS D 1 68  ? 124.885 150.833 80.195  1.00 119.07 ? 68  LYS D N   1 
ATOM 5040  C CA  . LYS D 1 68  ? 124.485 149.526 80.721  1.00 123.65 ? 68  LYS D CA  1 
ATOM 5041  C C   . LYS D 1 68  ? 125.395 148.942 81.801  1.00 120.01 ? 68  LYS D C   1 
ATOM 5042  O O   . LYS D 1 68  ? 124.992 148.023 82.519  1.00 120.34 ? 68  LYS D O   1 
ATOM 5043  C CB  . LYS D 1 68  ? 124.395 148.521 79.574  1.00 30.00  ? 68  LYS D CB  1 
ATOM 5044  C CG  . LYS D 1 68  ? 123.510 148.942 78.413  1.00 30.00  ? 68  LYS D CG  1 
ATOM 5045  C CD  . LYS D 1 68  ? 122.067 149.121 78.815  1.00 30.00  ? 68  LYS D CD  1 
ATOM 5046  C CE  . LYS D 1 68  ? 121.189 149.232 77.583  1.00 30.00  ? 68  LYS D CE  1 
ATOM 5047  N NZ  . LYS D 1 68  ? 121.479 150.442 76.784  1.00 30.00  ? 68  LYS D NZ  1 
ATOM 5048  N N   . THR D 1 69  ? 126.611 149.461 81.929  1.00 104.67 ? 69  THR D N   1 
ATOM 5049  C CA  . THR D 1 69  ? 127.590 148.935 82.867  1.00 117.77 ? 69  THR D CA  1 
ATOM 5050  C C   . THR D 1 69  ? 127.330 149.500 84.270  1.00 114.76 ? 69  THR D C   1 
ATOM 5051  O O   . THR D 1 69  ? 126.728 150.567 84.427  1.00 113.10 ? 69  THR D O   1 
ATOM 5052  C CB  . THR D 1 69  ? 128.995 149.294 82.359  1.00 30.00  ? 69  THR D CB  1 
ATOM 5053  O OG1 . THR D 1 69  ? 129.081 148.952 80.972  1.00 30.00  ? 69  THR D OG1 1 
ATOM 5054  C CG2 . THR D 1 69  ? 130.101 148.517 83.072  1.00 30.00  ? 69  THR D CG2 1 
ATOM 5055  N N   . TYR D 1 70  ? 127.773 148.750 85.292  1.00 95.58  ? 70  TYR D N   1 
ATOM 5056  C CA  . TYR D 1 70  ? 127.855 149.179 86.693  1.00 91.75  ? 70  TYR D CA  1 
ATOM 5057  C C   . TYR D 1 70  ? 126.474 149.491 87.278  1.00 97.36  ? 70  TYR D C   1 
ATOM 5058  O O   . TYR D 1 70  ? 126.118 150.638 87.554  1.00 106.50 ? 70  TYR D O   1 
ATOM 5059  C CB  . TYR D 1 70  ? 128.803 150.375 86.845  1.00 30.00  ? 70  TYR D CB  1 
ATOM 5060  C CG  . TYR D 1 70  ? 130.264 150.049 86.638  1.00 30.00  ? 70  TYR D CG  1 
ATOM 5061  C CD1 . TYR D 1 70  ? 130.724 148.739 86.696  1.00 30.00  ? 70  TYR D CD1 1 
ATOM 5062  C CD2 . TYR D 1 70  ? 131.187 151.056 86.386  1.00 30.00  ? 70  TYR D CD2 1 
ATOM 5063  C CE1 . TYR D 1 70  ? 132.064 148.443 86.511  1.00 30.00  ? 70  TYR D CE1 1 
ATOM 5064  C CE2 . TYR D 1 70  ? 132.526 150.771 86.198  1.00 30.00  ? 70  TYR D CE2 1 
ATOM 5065  C CZ  . TYR D 1 70  ? 132.959 149.463 86.261  1.00 30.00  ? 70  TYR D CZ  1 
ATOM 5066  O OH  . TYR D 1 70  ? 134.291 149.176 86.074  1.00 30.00  ? 70  TYR D OH  1 
ATOM 5067  N N   . VAL D 1 71  ? 125.695 148.416 87.424  1.00 94.49  ? 71  VAL D N   1 
ATOM 5068  C CA  . VAL D 1 71  ? 124.342 148.435 87.981  1.00 80.78  ? 71  VAL D CA  1 
ATOM 5069  C C   . VAL D 1 71  ? 124.327 148.978 89.409  1.00 87.45  ? 71  VAL D C   1 
ATOM 5070  O O   . VAL D 1 71  ? 125.185 148.634 90.228  1.00 96.24  ? 71  VAL D O   1 
ATOM 5071  C CB  . VAL D 1 71  ? 123.718 147.026 87.873  1.00 30.00  ? 71  VAL D CB  1 
ATOM 5072  C CG1 . VAL D 1 71  ? 124.599 145.988 88.481  1.00 30.00  ? 71  VAL D CG1 1 
ATOM 5073  C CG2 . VAL D 1 71  ? 122.383 146.963 88.542  1.00 30.00  ? 71  VAL D CG2 1 
ATOM 5074  N N   . GLU D 1 72  ? 123.382 149.874 89.706  1.00 85.64  ? 72  GLU D N   1 
ATOM 5075  C CA  . GLU D 1 72  ? 123.411 150.616 90.957  1.00 94.43  ? 72  GLU D CA  1 
ATOM 5076  C C   . GLU D 1 72  ? 122.195 150.415 91.854  1.00 97.09  ? 72  GLU D C   1 
ATOM 5077  O O   . GLU D 1 72  ? 122.357 150.309 93.069  1.00 121.72 ? 72  GLU D O   1 
ATOM 5078  C CB  . GLU D 1 72  ? 123.622 152.117 90.670  1.00 30.00  ? 72  GLU D CB  1 
ATOM 5079  C CG  . GLU D 1 72  ? 122.535 152.863 89.919  1.00 30.00  ? 72  GLU D CG  1 
ATOM 5080  C CD  . GLU D 1 72  ? 122.681 152.794 88.421  1.00 30.00  ? 72  GLU D CD  1 
ATOM 5081  O OE1 . GLU D 1 72  ? 123.452 151.947 87.926  1.00 30.00  ? 72  GLU D OE1 1 
ATOM 5082  O OE2 . GLU D 1 72  ? 122.020 153.603 87.740  1.00 30.00  ? 72  GLU D OE2 1 
ATOM 5083  N N   . LYS D 1 73  ? 120.979 150.360 91.322  1.00 88.72  ? 73  LYS D N   1 
ATOM 5084  C CA  . LYS D 1 73  ? 119.776 150.492 92.146  1.00 76.19  ? 73  LYS D CA  1 
ATOM 5085  C C   . LYS D 1 73  ? 119.080 149.148 92.304  1.00 76.39  ? 73  LYS D C   1 
ATOM 5086  O O   . LYS D 1 73  ? 118.156 148.827 91.556  1.00 99.03  ? 73  LYS D O   1 
ATOM 5087  C CB  . LYS D 1 73  ? 118.838 151.534 91.553  1.00 30.00  ? 73  LYS D CB  1 
ATOM 5088  C CG  . LYS D 1 73  ? 119.341 152.950 91.741  1.00 30.00  ? 73  LYS D CG  1 
ATOM 5089  C CD  . LYS D 1 73  ? 118.279 153.992 91.433  1.00 30.00  ? 73  LYS D CD  1 
ATOM 5090  C CE  . LYS D 1 73  ? 118.017 154.124 89.946  1.00 30.00  ? 73  LYS D CE  1 
ATOM 5091  N NZ  . LYS D 1 73  ? 117.058 155.231 89.665  1.00 30.00  ? 73  LYS D NZ  1 
ATOM 5092  N N   . LEU D 1 74  ? 119.489 148.393 93.315  1.00 86.10  ? 74  LEU D N   1 
ATOM 5093  C CA  . LEU D 1 74  ? 118.976 147.053 93.551  1.00 69.89  ? 74  LEU D CA  1 
ATOM 5094  C C   . LEU D 1 74  ? 117.736 147.108 94.434  1.00 74.51  ? 74  LEU D C   1 
ATOM 5095  O O   . LEU D 1 74  ? 117.569 148.016 95.251  1.00 105.24 ? 74  LEU D O   1 
ATOM 5096  C CB  . LEU D 1 74  ? 120.063 146.188 94.194  1.00 30.00  ? 74  LEU D CB  1 
ATOM 5097  C CG  . LEU D 1 74  ? 119.951 144.681 94.409  1.00 30.00  ? 74  LEU D CG  1 
ATOM 5098  C CD1 . LEU D 1 74  ? 121.339 144.098 94.318  1.00 30.00  ? 74  LEU D CD1 1 
ATOM 5099  C CD2 . LEU D 1 74  ? 119.371 144.359 95.768  1.00 30.00  ? 74  LEU D CD2 1 
ATOM 5100  N N   . ALA D 1 75  ? 116.860 146.124 94.251  1.00 74.85  ? 75  ALA D N   1 
ATOM 5101  C CA  . ALA D 1 75  ? 115.636 146.002 95.030  1.00 71.52  ? 75  ALA D CA  1 
ATOM 5102  C C   . ALA D 1 75  ? 115.323 144.529 95.220  1.00 78.01  ? 75  ALA D C   1 
ATOM 5103  O O   . ALA D 1 75  ? 115.010 143.831 94.254  1.00 114.52 ? 75  ALA D O   1 
ATOM 5104  C CB  . ALA D 1 75  ? 114.462 146.705 94.345  1.00 30.00  ? 75  ALA D CB  1 
ATOM 5105  N N   . ILE D 1 76  ? 115.395 144.066 96.461  1.00 65.73  ? 76  ILE D N   1 
ATOM 5106  C CA  . ILE D 1 76  ? 115.170 142.670 96.815  1.00 91.48  ? 76  ILE D CA  1 
ATOM 5107  C C   . ILE D 1 76  ? 113.763 142.522 97.384  1.00 89.44  ? 76  ILE D C   1 
ATOM 5108  O O   . ILE D 1 76  ? 113.438 143.110 98.422  1.00 103.39 ? 76  ILE D O   1 
ATOM 5109  C CB  . ILE D 1 76  ? 116.250 142.177 97.792  1.00 30.00  ? 76  ILE D CB  1 
ATOM 5110  C CG1 . ILE D 1 76  ? 115.863 140.853 98.444  1.00 30.00  ? 76  ILE D CG1 1 
ATOM 5111  C CG2 . ILE D 1 76  ? 116.673 143.250 98.765  1.00 30.00  ? 76  ILE D CG2 1 
ATOM 5112  C CD1 . ILE D 1 76  ? 116.926 140.328 99.381  1.00 30.00  ? 76  ILE D CD1 1 
ATOM 5113  N N   . TYR D 1 77  ? 112.916 141.756 96.692  1.00 92.49  ? 77  TYR D N   1 
ATOM 5114  C CA  . TYR D 1 77  ? 111.543 141.542 97.133  1.00 95.04  ? 77  TYR D CA  1 
ATOM 5115  C C   . TYR D 1 77  ? 111.533 140.491 98.233  1.00 90.68  ? 77  TYR D C   1 
ATOM 5116  O O   . TYR D 1 77  ? 112.088 139.404 98.066  1.00 88.28  ? 77  TYR D O   1 
ATOM 5117  C CB  . TYR D 1 77  ? 110.629 141.060 96.001  1.00 30.00  ? 77  TYR D CB  1 
ATOM 5118  C CG  . TYR D 1 77  ? 110.404 141.962 94.802  1.00 30.00  ? 77  TYR D CG  1 
ATOM 5119  C CD1 . TYR D 1 77  ? 110.833 143.274 94.783  1.00 30.00  ? 77  TYR D CD1 1 
ATOM 5120  C CD2 . TYR D 1 77  ? 109.718 141.488 93.690  1.00 30.00  ? 77  TYR D CD2 1 
ATOM 5121  C CE1 . TYR D 1 77  ? 110.612 144.088 93.687  1.00 30.00  ? 77  TYR D CE1 1 
ATOM 5122  C CE2 . TYR D 1 77  ? 109.490 142.291 92.590  1.00 30.00  ? 77  TYR D CE2 1 
ATOM 5123  C CZ  . TYR D 1 77  ? 109.940 143.588 92.595  1.00 30.00  ? 77  TYR D CZ  1 
ATOM 5124  O OH  . TYR D 1 77  ? 109.715 144.387 91.500  1.00 30.00  ? 77  TYR D OH  1 
ATOM 5125  N N   . ILE D 1 78  ? 110.885 140.804 99.350  1.00 100.82 ? 78  ILE D N   1 
ATOM 5126  C CA  . ILE D 1 78  ? 110.850 139.911 100.501 1.00 80.56  ? 78  ILE D CA  1 
ATOM 5127  C C   . ILE D 1 78  ? 109.422 139.738 100.989 1.00 87.00  ? 78  ILE D C   1 
ATOM 5128  O O   . ILE D 1 78  ? 108.726 140.722 101.257 1.00 104.52 ? 78  ILE D O   1 
ATOM 5129  C CB  . ILE D 1 78  ? 111.759 140.410 101.640 1.00 30.00  ? 78  ILE D CB  1 
ATOM 5130  C CG1 . ILE D 1 78  ? 113.210 140.101 101.305 1.00 30.00  ? 78  ILE D CG1 1 
ATOM 5131  C CG2 . ILE D 1 78  ? 111.370 139.834 102.989 1.00 30.00  ? 78  ILE D CG2 1 
ATOM 5132  C CD1 . ILE D 1 78  ? 114.169 140.559 102.336 1.00 30.00  ? 78  ILE D CD1 1 
ATOM 5133  N N   . SER D 1 79  ? 108.992 138.485 101.094 1.00 77.59  ? 79  SER D N   1 
ATOM 5134  C CA  . SER D 1 79  ? 107.812 138.047 101.816 1.00 81.74  ? 79  SER D CA  1 
ATOM 5135  C C   . SER D 1 79  ? 108.256 137.053 102.876 1.00 98.36  ? 79  SER D C   1 
ATOM 5136  O O   . SER D 1 79  ? 109.196 136.288 102.647 1.00 117.87 ? 79  SER D O   1 
ATOM 5137  C CB  . SER D 1 79  ? 106.792 137.390 100.873 1.00 30.00  ? 79  SER D CB  1 
ATOM 5138  O OG  . SER D 1 79  ? 105.654 136.914 101.571 1.00 30.00  ? 79  SER D OG  1 
ATOM 5139  N N   . PRO D 1 80  ? 107.624 137.046 104.040 1.00 92.20  ? 80  PRO D N   1 
ATOM 5140  C CA  . PRO D 1 80  ? 108.001 136.091 105.079 1.00 88.75  ? 80  PRO D CA  1 
ATOM 5141  C C   . PRO D 1 80  ? 107.442 134.713 104.756 1.00 95.71  ? 80  PRO D C   1 
ATOM 5142  O O   . PRO D 1 80  ? 106.713 134.518 103.787 1.00 117.12 ? 80  PRO D O   1 
ATOM 5143  C CB  . PRO D 1 80  ? 107.360 136.667 106.333 1.00 30.00  ? 80  PRO D CB  1 
ATOM 5144  C CG  . PRO D 1 80  ? 106.189 137.373 105.841 1.00 30.00  ? 80  PRO D CG  1 
ATOM 5145  C CD  . PRO D 1 80  ? 106.576 137.958 104.519 1.00 30.00  ? 80  PRO D CD  1 
ATOM 5146  N N   . ASN D 1 81  ? 107.761 133.757 105.620 1.00 89.04  ? 81  ASN D N   1 
ATOM 5147  C CA  . ASN D 1 81  ? 107.357 132.375 105.407 1.00 119.16 ? 81  ASN D CA  1 
ATOM 5148  C C   . ASN D 1 81  ? 105.890 132.190 105.789 1.00 129.92 ? 81  ASN D C   1 
ATOM 5149  O O   . ASN D 1 81  ? 105.133 133.153 105.943 1.00 123.56 ? 81  ASN D O   1 
ATOM 5150  C CB  . ASN D 1 81  ? 108.276 131.427 106.168 1.00 30.00  ? 81  ASN D CB  1 
ATOM 5151  C CG  . ASN D 1 81  ? 109.631 131.288 105.515 1.00 30.00  ? 81  ASN D CG  1 
ATOM 5152  O OD1 . ASN D 1 81  ? 109.741 131.265 104.292 1.00 30.00  ? 81  ASN D OD1 1 
ATOM 5153  N ND2 . ASN D 1 81  ? 110.667 131.158 106.325 1.00 30.00  ? 81  ASN D ND2 1 
ATOM 5154  N N   . ALA D 1 82  ? 105.470 130.928 105.906 1.00 129.27 ? 82  ALA D N   1 
ATOM 5155  C CA  . ALA D 1 82  ? 104.063 130.610 106.131 1.00 116.73 ? 82  ALA D CA  1 
ATOM 5156  C C   . ALA D 1 82  ? 103.589 131.103 107.493 1.00 106.52 ? 82  ALA D C   1 
ATOM 5157  O O   . ALA D 1 82  ? 102.690 131.945 107.584 1.00 96.85  ? 82  ALA D O   1 
ATOM 5158  C CB  . ALA D 1 82  ? 103.844 129.103 105.993 1.00 30.00  ? 82  ALA D CB  1 
ATOM 5159  N N   . GLY D 1 83  ? 104.197 130.610 108.562 1.00 114.15 ? 83  GLY D N   1 
ATOM 5160  C CA  . GLY D 1 83  ? 103.772 131.029 109.877 1.00 114.95 ? 83  GLY D CA  1 
ATOM 5161  C C   . GLY D 1 83  ? 104.829 131.808 110.618 1.00 115.25 ? 83  GLY D C   1 
ATOM 5162  O O   . GLY D 1 83  ? 105.985 131.385 110.681 1.00 115.65 ? 83  GLY D O   1 
ATOM 5163  N N   . SER D 1 84  ? 104.448 132.949 111.181 1.00 112.07 ? 84  SER D N   1 
ATOM 5164  C CA  . SER D 1 84  ? 105.362 133.741 111.985 1.00 124.31 ? 84  SER D CA  1 
ATOM 5165  C C   . SER D 1 84  ? 104.599 134.618 112.957 1.00 115.58 ? 84  SER D C   1 
ATOM 5166  O O   . SER D 1 84  ? 103.453 134.993 112.701 1.00 106.26 ? 84  SER D O   1 
ATOM 5167  C CB  . SER D 1 84  ? 106.246 134.643 111.139 1.00 30.00  ? 84  SER D CB  1 
ATOM 5168  O OG  . SER D 1 84  ? 106.934 135.522 112.006 1.00 30.00  ? 84  SER D OG  1 
ATOM 5169  N N   . GLU D 1 85  ? 105.246 134.935 114.075 1.00 118.56 ? 85  GLU D N   1 
ATOM 5170  C CA  . GLU D 1 85  ? 104.740 135.947 114.993 1.00 105.86 ? 85  GLU D CA  1 
ATOM 5171  C C   . GLU D 1 85  ? 105.547 137.240 114.844 1.00 107.85 ? 85  GLU D C   1 
ATOM 5172  O O   . GLU D 1 85  ? 106.368 137.598 115.687 1.00 104.84 ? 85  GLU D O   1 
ATOM 5173  C CB  . GLU D 1 85  ? 104.771 135.415 116.422 1.00 30.00  ? 85  GLU D CB  1 
ATOM 5174  C CG  . GLU D 1 85  ? 103.908 134.175 116.618 1.00 30.00  ? 85  GLU D CG  1 
ATOM 5175  C CD  . GLU D 1 85  ? 103.953 133.637 118.037 1.00 30.00  ? 85  GLU D CD  1 
ATOM 5176  O OE1 . GLU D 1 85  ? 104.698 134.201 118.863 1.00 30.00  ? 85  GLU D OE1 1 
ATOM 5177  O OE2 . GLU D 1 85  ? 103.256 132.641 118.324 1.00 30.00  ? 85  GLU D OE2 1 
ATOM 5178  N N   . GLY D 1 86  ? 105.294 137.946 113.740 1.00 113.31 ? 86  GLY D N   1 
ATOM 5179  C CA  . GLY D 1 86  ? 105.726 139.329 113.616 1.00 111.17 ? 86  GLY D CA  1 
ATOM 5180  C C   . GLY D 1 86  ? 107.207 139.637 113.478 1.00 101.55 ? 86  GLY D C   1 
ATOM 5181  O O   . GLY D 1 86  ? 107.818 140.089 114.450 1.00 106.00 ? 86  GLY D O   1 
ATOM 5182  N N   . ILE D 1 87  ? 107.808 139.369 112.316 1.00 75.80  ? 87  ILE D N   1 
ATOM 5183  C CA  . ILE D 1 87  ? 109.185 139.790 112.054 1.00 73.31  ? 87  ILE D CA  1 
ATOM 5184  C C   . ILE D 1 87  ? 109.235 141.314 112.034 1.00 100.35 ? 87  ILE D C   1 
ATOM 5185  O O   . ILE D 1 87  ? 108.351 141.968 111.468 1.00 117.40 ? 87  ILE D O   1 
ATOM 5186  C CB  . ILE D 1 87  ? 109.702 139.225 110.722 1.00 30.00  ? 87  ILE D CB  1 
ATOM 5187  C CG1 . ILE D 1 87  ? 109.567 137.714 110.643 1.00 30.00  ? 87  ILE D CG1 1 
ATOM 5188  C CG2 . ILE D 1 87  ? 111.152 139.563 110.497 1.00 30.00  ? 87  ILE D CG2 1 
ATOM 5189  C CD1 . ILE D 1 87  ? 108.434 137.294 109.782 1.00 30.00  ? 87  ILE D CD1 1 
ATOM 5190  N N   . ASP D 1 88  ? 110.260 141.887 112.657 1.00 103.88 ? 88  ASP D N   1 
ATOM 5191  C CA  . ASP D 1 88  ? 110.504 143.319 112.579 1.00 95.71  ? 88  ASP D CA  1 
ATOM 5192  C C   . ASP D 1 88  ? 111.496 143.592 111.454 1.00 94.42  ? 88  ASP D C   1 
ATOM 5193  O O   . ASP D 1 88  ? 112.180 142.685 110.978 1.00 101.39 ? 88  ASP D O   1 
ATOM 5194  C CB  . ASP D 1 88  ? 111.049 143.838 113.912 1.00 30.00  ? 88  ASP D CB  1 
ATOM 5195  C CG  . ASP D 1 88  ? 111.002 145.355 114.027 1.00 30.00  ? 88  ASP D CG  1 
ATOM 5196  O OD1 . ASP D 1 88  ? 110.491 146.013 113.099 1.00 30.00  ? 88  ASP D OD1 1 
ATOM 5197  O OD2 . ASP D 1 88  ? 111.483 145.893 115.045 1.00 30.00  ? 88  ASP D OD2 1 
ATOM 5198  N N   . LEU D 1 89  ? 111.562 144.848 111.017 1.00 99.19  ? 89  LEU D N   1 
ATOM 5199  C CA  . LEU D 1 89  ? 112.583 145.265 110.067 1.00 104.74 ? 89  LEU D CA  1 
ATOM 5200  C C   . LEU D 1 89  ? 113.510 146.348 110.604 1.00 110.40 ? 89  LEU D C   1 
ATOM 5201  O O   . LEU D 1 89  ? 114.556 146.593 109.999 1.00 132.98 ? 89  LEU D O   1 
ATOM 5202  C CB  . LEU D 1 89  ? 111.949 145.735 108.766 1.00 30.00  ? 89  LEU D CB  1 
ATOM 5203  C CG  . LEU D 1 89  ? 111.213 144.634 108.023 1.00 30.00  ? 89  LEU D CG  1 
ATOM 5204  C CD1 . LEU D 1 89  ? 110.565 145.245 106.828 1.00 30.00  ? 89  LEU D CD1 1 
ATOM 5205  C CD2 . LEU D 1 89  ? 112.158 143.525 107.619 1.00 30.00  ? 89  LEU D CD2 1 
ATOM 5206  N N   . ASN D 1 90  ? 113.157 147.012 111.707 1.00 101.49 ? 90  ASN D N   1 
ATOM 5207  C CA  . ASN D 1 90  ? 114.143 147.854 112.369 1.00 104.71 ? 90  ASN D CA  1 
ATOM 5208  C C   . ASN D 1 90  ? 115.232 146.993 112.984 1.00 105.99 ? 90  ASN D C   1 
ATOM 5209  O O   . ASN D 1 90  ? 116.399 147.396 113.012 1.00 109.37 ? 90  ASN D O   1 
ATOM 5210  C CB  . ASN D 1 90  ? 113.470 148.726 113.431 1.00 30.00  ? 90  ASN D CB  1 
ATOM 5211  C CG  . ASN D 1 90  ? 114.240 150.017 113.726 1.00 30.00  ? 90  ASN D CG  1 
ATOM 5212  O OD1 . ASN D 1 90  ? 113.690 150.952 114.308 1.00 30.00  ? 90  ASN D OD1 1 
ATOM 5213  N ND2 . ASN D 1 90  ? 115.499 150.080 113.311 1.00 30.00  ? 90  ASN D ND2 1 
ATOM 5214  N N   . ASN D 1 91  ? 114.870 145.811 113.478 1.00 96.80  ? 91  ASN D N   1 
ATOM 5215  C CA  . ASN D 1 91  ? 115.837 144.791 113.866 1.00 97.18  ? 91  ASN D CA  1 
ATOM 5216  C C   . ASN D 1 91  ? 115.908 143.745 112.758 1.00 103.39 ? 91  ASN D C   1 
ATOM 5217  O O   . ASN D 1 91  ? 115.425 142.622 112.888 1.00 107.67 ? 91  ASN D O   1 
ATOM 5218  C CB  . ASN D 1 91  ? 115.450 144.175 115.201 1.00 30.00  ? 91  ASN D CB  1 
ATOM 5219  C CG  . ASN D 1 91  ? 115.541 145.157 116.332 1.00 30.00  ? 91  ASN D CG  1 
ATOM 5220  O OD1 . ASN D 1 91  ? 114.535 145.526 116.928 1.00 30.00  ? 91  ASN D OD1 1 
ATOM 5221  N ND2 . ASN D 1 91  ? 116.754 145.588 116.639 1.00 30.00  ? 91  ASN D ND2 1 
ATOM 5222  N N   . THR D 1 92  ? 116.531 144.130 111.648 1.00 101.15 ? 92  THR D N   1 
ATOM 5223  C CA  . THR D 1 92  ? 116.765 143.213 110.541 1.00 84.54  ? 92  THR D CA  1 
ATOM 5224  C C   . THR D 1 92  ? 117.962 143.706 109.754 1.00 86.65  ? 92  THR D C   1 
ATOM 5225  O O   . THR D 1 92  ? 117.891 144.756 109.112 1.00 106.48 ? 92  THR D O   1 
ATOM 5226  C CB  . THR D 1 92  ? 115.553 143.103 109.621 1.00 30.00  ? 92  THR D CB  1 
ATOM 5227  O OG1 . THR D 1 92  ? 114.457 142.528 110.339 1.00 30.00  ? 92  THR D OG1 1 
ATOM 5228  C CG2 . THR D 1 92  ? 115.874 142.237 108.425 1.00 30.00  ? 92  THR D CG2 1 
ATOM 5229  N N   . ARG D 1 93  ? 119.050 142.955 109.800 1.00 78.31  ? 93  ARG D N   1 
ATOM 5230  C CA  . ARG D 1 93  ? 120.270 143.327 109.109 1.00 89.86  ? 93  ARG D CA  1 
ATOM 5231  C C   . ARG D 1 93  ? 120.400 142.501 107.841 1.00 89.07  ? 93  ARG D C   1 
ATOM 5232  O O   . ARG D 1 93  ? 120.469 141.270 107.893 1.00 106.87 ? 93  ARG D O   1 
ATOM 5233  C CB  . ARG D 1 93  ? 121.481 143.133 110.010 1.00 30.00  ? 93  ARG D CB  1 
ATOM 5234  C CG  . ARG D 1 93  ? 121.401 143.966 111.269 1.00 30.00  ? 93  ARG D CG  1 
ATOM 5235  C CD  . ARG D 1 93  ? 121.361 145.433 110.920 1.00 30.00  ? 93  ARG D CD  1 
ATOM 5236  N NE  . ARG D 1 93  ? 121.390 146.298 112.093 1.00 30.00  ? 93  ARG D NE  1 
ATOM 5237  C CZ  . ARG D 1 93  ? 120.309 146.672 112.764 1.00 30.00  ? 93  ARG D CZ  1 
ATOM 5238  N NH1 . ARG D 1 93  ? 119.118 146.232 112.398 1.00 30.00  ? 93  ARG D NH1 1 
ATOM 5239  N NH2 . ARG D 1 93  ? 120.417 147.477 113.808 1.00 30.00  ? 93  ARG D NH2 1 
ATOM 5240  N N   . VAL D 1 94  ? 120.426 143.187 106.701 1.00 84.22  ? 94  VAL D N   1 
ATOM 5241  C CA  . VAL D 1 94  ? 120.521 142.544 105.397 1.00 73.51  ? 94  VAL D CA  1 
ATOM 5242  C C   . VAL D 1 94  ? 121.978 142.507 104.978 1.00 86.10  ? 94  VAL D C   1 
ATOM 5243  O O   . VAL D 1 94  ? 122.552 143.532 104.598 1.00 102.58 ? 94  VAL D O   1 
ATOM 5244  C CB  . VAL D 1 94  ? 119.672 143.283 104.358 1.00 30.00  ? 94  VAL D CB  1 
ATOM 5245  C CG1 . VAL D 1 94  ? 119.836 142.653 102.997 1.00 30.00  ? 94  VAL D CG1 1 
ATOM 5246  C CG2 . VAL D 1 94  ? 118.236 143.268 104.786 1.00 30.00  ? 94  VAL D CG2 1 
ATOM 5247  N N   . VAL D 1 95  ? 122.588 141.331 105.052 1.00 80.17  ? 95  VAL D N   1 
ATOM 5248  C CA  . VAL D 1 95  ? 124.031 141.199 104.927 1.00 77.28  ? 95  VAL D CA  1 
ATOM 5249  C C   . VAL D 1 95  ? 124.315 140.573 103.569 1.00 86.14  ? 95  VAL D C   1 
ATOM 5250  O O   . VAL D 1 95  ? 124.213 139.361 103.402 1.00 98.38  ? 95  VAL D O   1 
ATOM 5251  C CB  . VAL D 1 95  ? 124.614 140.355 106.057 1.00 30.00  ? 95  VAL D CB  1 
ATOM 5252  C CG1 . VAL D 1 95  ? 126.121 140.294 105.943 1.00 30.00  ? 95  VAL D CG1 1 
ATOM 5253  C CG2 . VAL D 1 95  ? 124.171 140.887 107.397 1.00 30.00  ? 95  VAL D CG2 1 
ATOM 5254  N N   . LEU D 1 96  ? 124.674 141.398 102.597 1.00 91.86  ? 96  LEU D N   1 
ATOM 5255  C CA  . LEU D 1 96  ? 125.155 140.910 101.315 1.00 76.62  ? 96  LEU D CA  1 
ATOM 5256  C C   . LEU D 1 96  ? 126.637 141.222 101.198 1.00 90.23  ? 96  LEU D C   1 
ATOM 5257  O O   . LEU D 1 96  ? 127.071 142.332 101.514 1.00 122.98 ? 96  LEU D O   1 
ATOM 5258  C CB  . LEU D 1 96  ? 124.354 141.503 100.151 1.00 30.00  ? 96  LEU D CB  1 
ATOM 5259  C CG  . LEU D 1 96  ? 124.259 142.997 99.830  1.00 30.00  ? 96  LEU D CG  1 
ATOM 5260  C CD1 . LEU D 1 96  ? 125.354 143.470 98.884  1.00 30.00  ? 96  LEU D CD1 1 
ATOM 5261  C CD2 . LEU D 1 96  ? 122.886 143.320 99.265  1.00 30.00  ? 96  LEU D CD2 1 
ATOM 5262  N N   . SER D 1 97  ? 127.409 140.236 100.753 1.00 77.79  ? 97  SER D N   1 
ATOM 5263  C CA  . SER D 1 97  ? 128.847 140.395 100.579 1.00 80.19  ? 97  SER D CA  1 
ATOM 5264  C C   . SER D 1 97  ? 129.150 141.094 99.268  1.00 99.22  ? 97  SER D C   1 
ATOM 5265  O O   . SER D 1 97  ? 128.254 141.671 98.662  1.00 107.37 ? 97  SER D O   1 
ATOM 5266  C CB  . SER D 1 97  ? 129.541 139.042 100.597 1.00 30.00  ? 97  SER D CB  1 
ATOM 5267  O OG  . SER D 1 97  ? 129.154 138.259 99.484  1.00 30.00  ? 97  SER D OG  1 
ATOM 5268  N N   . ASN D 1 98  ? 130.407 141.069 98.836  1.00 30.00  ? 98  ASN D N   1 
ATOM 5269  C CA  . ASN D 1 98  ? 130.747 141.389 97.457  1.00 30.00  ? 98  ASN D CA  1 
ATOM 5270  C C   . ASN D 1 98  ? 131.548 140.197 96.971  1.00 30.00  ? 98  ASN D C   1 
ATOM 5271  O O   . ASN D 1 98  ? 131.571 139.156 97.630  1.00 30.00  ? 98  ASN D O   1 
ATOM 5272  C CB  . ASN D 1 98  ? 131.566 142.684 97.343  1.00 30.00  ? 98  ASN D CB  1 
ATOM 5273  C CG  . ASN D 1 98  ? 131.475 143.339 95.963  1.00 30.00  ? 98  ASN D CG  1 
ATOM 5274  O OD1 . ASN D 1 98  ? 130.790 142.841 95.077  1.00 30.00  ? 98  ASN D OD1 1 
ATOM 5275  N ND2 . ASN D 1 98  ? 132.169 144.458 95.786  1.00 30.00  ? 98  ASN D ND2 1 
ATOM 5276  N N   . GLY D 1 99  ? 132.202 140.328 95.821  1.00 30.00  ? 99  GLY D N   1 
ATOM 5277  C CA  . GLY D 1 99  ? 133.323 139.462 95.546  1.00 30.00  ? 99  GLY D CA  1 
ATOM 5278  C C   . GLY D 1 99  ? 134.569 139.831 96.322  1.00 30.00  ? 99  GLY D C   1 
ATOM 5279  O O   . GLY D 1 99  ? 135.553 139.089 96.270  1.00 30.00  ? 99  GLY D O   1 
ATOM 5280  N N   . THR D 1 100 ? 134.567 140.973 97.014  1.00 85.87  ? 100 THR D N   1 
ATOM 5281  C CA  . THR D 1 100 ? 135.707 141.372 97.829  1.00 102.79 ? 100 THR D CA  1 
ATOM 5282  C C   . THR D 1 100 ? 135.334 141.804 99.242  1.00 104.11 ? 100 THR D C   1 
ATOM 5283  O O   . THR D 1 100 ? 136.019 141.426 100.200 1.00 96.07  ? 100 THR D O   1 
ATOM 5284  C CB  . THR D 1 100 ? 136.453 142.502 97.103  1.00 30.00  ? 100 THR D CB  1 
ATOM 5285  O OG1 . THR D 1 100 ? 136.803 142.062 95.785  1.00 30.00  ? 100 THR D OG1 1 
ATOM 5286  C CG2 . THR D 1 100 ? 137.724 142.879 97.838  1.00 30.00  ? 100 THR D CG2 1 
ATOM 5287  N N   . VAL D 1 101 ? 134.241 142.549 99.414  1.00 97.64  ? 101 VAL D N   1 
ATOM 5288  C CA  . VAL D 1 101 ? 133.997 143.344 100.617 1.00 100.35 ? 101 VAL D CA  1 
ATOM 5289  C C   . VAL D 1 101 ? 132.619 143.019 101.181 1.00 117.38 ? 101 VAL D C   1 
ATOM 5290  O O   . VAL D 1 101 ? 131.609 143.205 100.497 1.00 123.46 ? 101 VAL D O   1 
ATOM 5291  C CB  . VAL D 1 101 ? 134.095 144.854 100.320 1.00 30.00  ? 101 VAL D CB  1 
ATOM 5292  C CG1 . VAL D 1 101 ? 133.758 145.663 101.549 1.00 30.00  ? 101 VAL D CG1 1 
ATOM 5293  C CG2 . VAL D 1 101 ? 135.476 145.234 99.798  1.00 30.00  ? 101 VAL D CG2 1 
ATOM 5294  N N   . GLN D 1 102 ? 132.576 142.569 102.435 1.00 107.35 ? 102 GLN D N   1 
ATOM 5295  C CA  . GLN D 1 102 ? 131.318 142.384 103.152 1.00 99.10  ? 102 GLN D CA  1 
ATOM 5296  C C   . GLN D 1 102 ? 130.558 143.697 103.308 1.00 93.31  ? 102 GLN D C   1 
ATOM 5297  O O   . GLN D 1 102 ? 131.121 144.791 103.269 1.00 114.39 ? 102 GLN D O   1 
ATOM 5298  C CB  . GLN D 1 102 ? 131.561 141.792 104.536 1.00 30.00  ? 102 GLN D CB  1 
ATOM 5299  C CG  . GLN D 1 102 ? 131.736 140.305 104.575 1.00 30.00  ? 102 GLN D CG  1 
ATOM 5300  C CD  . GLN D 1 102 ? 130.420 139.597 104.384 1.00 30.00  ? 102 GLN D CD  1 
ATOM 5301  O OE1 . GLN D 1 102 ? 129.386 140.056 104.858 1.00 30.00  ? 102 GLN D OE1 1 
ATOM 5302  N NE2 . GLN D 1 102 ? 130.449 138.472 103.703 1.00 30.00  ? 102 GLN D NE2 1 
ATOM 5303  N N   . ALA D 1 103 ? 129.251 143.572 103.505 1.00 90.25  ? 103 ALA D N   1 
ATOM 5304  C CA  . ALA D 1 103 ? 128.424 144.736 103.763 1.00 88.34  ? 103 ALA D CA  1 
ATOM 5305  C C   . ALA D 1 103 ? 127.235 144.310 104.600 1.00 104.79 ? 103 ALA D C   1 
ATOM 5306  O O   . ALA D 1 103 ? 126.651 143.254 104.356 1.00 117.96 ? 103 ALA D O   1 
ATOM 5307  C CB  . ALA D 1 103 ? 127.951 145.389 102.464 1.00 30.00  ? 103 ALA D CB  1 
ATOM 5308  N N   . VAL D 1 104 ? 126.893 145.122 105.594 1.00 94.80  ? 104 VAL D N   1 
ATOM 5309  C CA  . VAL D 1 104 ? 125.666 144.937 106.354 1.00 109.96 ? 104 VAL D CA  1 
ATOM 5310  C C   . VAL D 1 104 ? 124.840 146.202 106.192 1.00 89.25  ? 104 VAL D C   1 
ATOM 5311  O O   . VAL D 1 104 ? 125.363 147.262 105.836 1.00 75.68  ? 104 VAL D O   1 
ATOM 5312  C CB  . VAL D 1 104 ? 125.923 144.630 107.843 1.00 30.00  ? 104 VAL D CB  1 
ATOM 5313  C CG1 . VAL D 1 104 ? 126.787 143.400 107.989 1.00 30.00  ? 104 VAL D CG1 1 
ATOM 5314  C CG2 . VAL D 1 104 ? 126.571 145.796 108.513 1.00 30.00  ? 104 VAL D CG2 1 
ATOM 5315  N N   . LEU D 1 105 ? 123.537 146.084 106.412 1.00 88.49  ? 105 LEU D N   1 
ATOM 5316  C CA  . LEU D 1 105 ? 122.609 147.162 106.094 1.00 98.24  ? 105 LEU D CA  1 
ATOM 5317  C C   . LEU D 1 105 ? 121.653 147.373 107.261 1.00 91.87  ? 105 LEU D C   1 
ATOM 5318  O O   . LEU D 1 105 ? 120.851 146.491 107.581 1.00 103.67 ? 105 LEU D O   1 
ATOM 5319  C CB  . LEU D 1 105 ? 121.843 146.864 104.805 1.00 30.00  ? 105 LEU D CB  1 
ATOM 5320  C CG  . LEU D 1 105 ? 122.460 147.148 103.421 1.00 30.00  ? 105 LEU D CG  1 
ATOM 5321  C CD1 . LEU D 1 105 ? 122.918 148.590 103.316 1.00 30.00  ? 105 LEU D CD1 1 
ATOM 5322  C CD2 . LEU D 1 105 ? 123.557 146.201 102.969 1.00 30.00  ? 105 LEU D CD2 1 
ATOM 5323  N N   . LYS D 1 106 ? 121.744 148.540 107.888 1.00 80.59  ? 106 LYS D N   1 
ATOM 5324  C CA  . LYS D 1 106 ? 120.850 148.948 108.959 1.00 95.20  ? 106 LYS D CA  1 
ATOM 5325  C C   . LYS D 1 106 ? 119.563 149.490 108.355 1.00 109.74 ? 106 LYS D C   1 
ATOM 5326  O O   . LYS D 1 106 ? 119.559 150.007 107.236 1.00 125.41 ? 106 LYS D O   1 
ATOM 5327  C CB  . LYS D 1 106 ? 121.530 150.012 109.832 1.00 30.00  ? 106 LYS D CB  1 
ATOM 5328  C CG  . LYS D 1 106 ? 120.783 150.451 111.090 1.00 30.00  ? 106 LYS D CG  1 
ATOM 5329  C CD  . LYS D 1 106 ? 121.633 151.377 111.943 1.00 30.00  ? 106 LYS D CD  1 
ATOM 5330  C CE  . LYS D 1 106 ? 121.782 152.754 111.321 1.00 30.00  ? 106 LYS D CE  1 
ATOM 5331  N NZ  . LYS D 1 106 ? 120.513 153.526 111.355 1.00 30.00  ? 106 LYS D NZ  1 
ATOM 5332  N N   . TYR D 1 107 ? 118.461 149.334 109.086 1.00 113.92 ? 107 TYR D N   1 
ATOM 5333  C CA  . TYR D 1 107 ? 117.203 149.940 108.677 1.00 120.86 ? 107 TYR D CA  1 
ATOM 5334  C C   . TYR D 1 107 ? 117.299 151.456 108.705 1.00 104.10 ? 107 TYR D C   1 
ATOM 5335  O O   . TYR D 1 107 ? 117.887 152.042 109.616 1.00 105.66 ? 107 TYR D O   1 
ATOM 5336  C CB  . TYR D 1 107 ? 116.070 149.482 109.587 1.00 30.00  ? 107 TYR D CB  1 
ATOM 5337  C CG  . TYR D 1 107 ? 114.737 150.103 109.243 1.00 30.00  ? 107 TYR D CG  1 
ATOM 5338  C CD1 . TYR D 1 107 ? 114.017 149.675 108.142 1.00 30.00  ? 107 TYR D CD1 1 
ATOM 5339  C CD2 . TYR D 1 107 ? 114.196 151.122 110.023 1.00 30.00  ? 107 TYR D CD2 1 
ATOM 5340  C CE1 . TYR D 1 107 ? 112.799 150.238 107.831 1.00 30.00  ? 107 TYR D CE1 1 
ATOM 5341  C CE2 . TYR D 1 107 ? 112.976 151.693 109.710 1.00 30.00  ? 107 TYR D CE2 1 
ATOM 5342  C CZ  . TYR D 1 107 ? 112.287 151.247 108.613 1.00 30.00  ? 107 TYR D CZ  1 
ATOM 5343  O OH  . TYR D 1 107 ? 111.076 151.810 108.306 1.00 30.00  ? 107 TYR D OH  1 
ATOM 5344  N N   . GLU D 1 108 ? 116.717 152.091 107.698 1.00 101.18 ? 108 GLU D N   1 
ATOM 5345  C CA  . GLU D 1 108 ? 116.694 153.537 107.603 1.00 107.42 ? 108 GLU D CA  1 
ATOM 5346  C C   . GLU D 1 108 ? 115.248 153.999 107.650 1.00 97.36  ? 108 GLU D C   1 
ATOM 5347  O O   . GLU D 1 108 ? 114.349 153.294 107.185 1.00 99.71  ? 108 GLU D O   1 
ATOM 5348  C CB  . GLU D 1 108 ? 117.393 153.999 106.316 1.00 30.00  ? 108 GLU D CB  1 
ATOM 5349  C CG  . GLU D 1 108 ? 117.528 155.508 106.107 1.00 30.00  ? 108 GLU D CG  1 
ATOM 5350  C CD  . GLU D 1 108 ? 118.431 156.191 107.122 1.00 30.00  ? 108 GLU D CD  1 
ATOM 5351  O OE1 . GLU D 1 108 ? 119.319 155.526 107.687 1.00 30.00  ? 108 GLU D OE1 1 
ATOM 5352  O OE2 . GLU D 1 108 ? 118.256 157.405 107.354 1.00 30.00  ? 108 GLU D OE2 1 
ATOM 5353  N N   . LYS D 1 109 ? 115.023 155.166 108.251 1.00 87.60  ? 109 LYS D N   1 
ATOM 5354  C CA  . LYS D 1 109 ? 113.723 155.814 108.220 1.00 83.82  ? 109 LYS D CA  1 
ATOM 5355  C C   . LYS D 1 109 ? 113.553 156.578 106.912 1.00 93.03  ? 109 LYS D C   1 
ATOM 5356  O O   . LYS D 1 109 ? 114.354 156.459 105.981 1.00 117.66 ? 109 LYS D O   1 
ATOM 5357  C CB  . LYS D 1 109 ? 113.571 156.763 109.405 1.00 30.00  ? 109 LYS D CB  1 
ATOM 5358  C CG  . LYS D 1 109 ? 113.579 156.086 110.755 1.00 30.00  ? 109 LYS D CG  1 
ATOM 5359  C CD  . LYS D 1 109 ? 113.448 157.098 111.879 1.00 30.00  ? 109 LYS D CD  1 
ATOM 5360  C CE  . LYS D 1 109 ? 113.511 156.412 113.234 1.00 30.00  ? 109 LYS D CE  1 
ATOM 5361  N NZ  . LYS D 1 109 ? 113.426 157.375 114.365 1.00 30.00  ? 109 LYS D NZ  1 
ATOM 5362  N N   . THR D 1 110 ? 112.485 157.377 106.865 1.00 94.95  ? 110 THR D N   1 
ATOM 5363  C CA  . THR D 1 110 ? 112.240 158.427 105.866 1.00 121.68 ? 110 THR D CA  1 
ATOM 5364  C C   . THR D 1 110 ? 112.262 157.898 104.434 1.00 133.18 ? 110 THR D C   1 
ATOM 5365  O O   . THR D 1 110 ? 112.699 158.579 103.504 1.00 143.94 ? 110 THR D O   1 
ATOM 5366  C CB  . THR D 1 110 ? 113.230 159.585 106.018 1.00 30.00  ? 110 THR D CB  1 
ATOM 5367  O OG1 . THR D 1 110 ? 114.548 159.161 105.649 1.00 30.00  ? 110 THR D OG1 1 
ATOM 5368  C CG2 . THR D 1 110 ? 113.250 160.076 107.454 1.00 30.00  ? 110 THR D CG2 1 
ATOM 5369  N N   . ALA D 1 111 ? 111.792 156.662 104.256 1.00 106.50 ? 111 ALA D N   1 
ATOM 5370  C CA  . ALA D 1 111 ? 111.812 156.062 102.922 1.00 107.45 ? 111 ALA D CA  1 
ATOM 5371  C C   . ALA D 1 111 ? 110.651 155.072 102.786 1.00 124.52 ? 111 ALA D C   1 
ATOM 5372  O O   . ALA D 1 111 ? 110.816 153.890 103.066 1.00 140.43 ? 111 ALA D O   1 
ATOM 5373  C CB  . ALA D 1 111 ? 113.151 155.379 102.675 1.00 30.00  ? 111 ALA D CB  1 
ATOM 5374  N N   . TYR D 1 112 ? 109.494 155.545 102.310 1.00 30.00  ? 112 TYR D N   1 
ATOM 5375  C CA  . TYR D 1 112 ? 108.413 154.614 101.986 1.00 30.00  ? 112 TYR D CA  1 
ATOM 5376  C C   . TYR D 1 112 ? 108.008 154.585 100.518 1.00 30.00  ? 112 TYR D C   1 
ATOM 5377  O O   . TYR D 1 112 ? 108.225 153.555 99.878  1.00 30.00  ? 112 TYR D O   1 
ATOM 5378  C CB  . TYR D 1 112 ? 107.178 154.878 102.851 1.00 30.00  ? 112 TYR D CB  1 
ATOM 5379  C CG  . TYR D 1 112 ? 107.128 154.045 104.105 1.00 30.00  ? 112 TYR D CG  1 
ATOM 5380  C CD1 . TYR D 1 112 ? 108.032 153.019 104.303 1.00 30.00  ? 112 TYR D CD1 1 
ATOM 5381  C CD2 . TYR D 1 112 ? 106.113 154.212 105.036 1.00 30.00  ? 112 TYR D CD2 1 
ATOM 5382  C CE1 . TYR D 1 112 ? 107.976 152.227 105.414 1.00 30.00  ? 112 TYR D CE1 1 
ATOM 5383  C CE2 . TYR D 1 112 ? 106.044 153.416 106.161 1.00 30.00  ? 112 TYR D CE2 1 
ATOM 5384  C CZ  . TYR D 1 112 ? 106.982 152.427 106.339 1.00 30.00  ? 112 TYR D CZ  1 
ATOM 5385  O OH  . TYR D 1 112 ? 106.944 151.618 107.440 1.00 30.00  ? 112 TYR D OH  1 
ATOM 5386  N N   . HIS D 1 113 ? 107.479 155.679 99.956  1.00 30.00  ? 113 HIS D N   1 
ATOM 5387  C CA  . HIS D 1 113 ? 106.942 155.734 98.583  1.00 30.00  ? 113 HIS D CA  1 
ATOM 5388  C C   . HIS D 1 113 ? 105.952 154.592 98.312  1.00 30.00  ? 113 HIS D C   1 
ATOM 5389  O O   . HIS D 1 113 ? 106.230 153.639 97.582  1.00 30.00  ? 113 HIS D O   1 
ATOM 5390  C CB  . HIS D 1 113 ? 108.081 155.768 97.560  1.00 30.00  ? 113 HIS D CB  1 
ATOM 5391  C CG  . HIS D 1 113 ? 107.634 155.850 96.136  1.00 30.00  ? 113 HIS D CG  1 
ATOM 5392  N ND1 . HIS D 1 113 ? 107.003 156.957 95.615  1.00 30.00  ? 113 HIS D ND1 1 
ATOM 5393  C CD2 . HIS D 1 113 ? 107.772 154.976 95.112  1.00 30.00  ? 113 HIS D CD2 1 
ATOM 5394  C CE1 . HIS D 1 113 ? 106.751 156.754 94.335  1.00 30.00  ? 113 HIS D CE1 1 
ATOM 5395  N NE2 . HIS D 1 113 ? 107.208 155.559 94.005  1.00 30.00  ? 113 HIS D NE2 1 
ATOM 5396  N N   . LYS D 1 114 ? 104.811 154.660 98.988  1.00 30.00  ? 114 LYS D N   1 
ATOM 5397  C CA  . LYS D 1 114 ? 103.857 153.562 98.996  1.00 30.00  ? 114 LYS D CA  1 
ATOM 5398  C C   . LYS D 1 114 ? 102.527 153.882 98.326  1.00 30.00  ? 114 LYS D C   1 
ATOM 5399  O O   . LYS D 1 114 ? 101.582 153.099 98.464  1.00 30.00  ? 114 LYS D O   1 
ATOM 5400  C CB  . LYS D 1 114 ? 103.621 153.110 100.438 1.00 30.00  ? 114 LYS D CB  1 
ATOM 5401  C CG  . LYS D 1 114 ? 103.066 154.192 101.339 1.00 30.00  ? 114 LYS D CG  1 
ATOM 5402  C CD  . LYS D 1 114 ? 102.976 153.706 102.769 1.00 30.00  ? 114 LYS D CD  1 
ATOM 5403  C CE  . LYS D 1 114 ? 102.445 154.792 103.676 1.00 30.00  ? 114 LYS D CE  1 
ATOM 5404  N NZ  . LYS D 1 114 ? 102.374 154.334 105.085 1.00 30.00  ? 114 LYS D NZ  1 
ATOM 5405  N N   . GLY D 1 115 ? 102.420 154.997 97.604  1.00 30.00  ? 115 GLY D N   1 
ATOM 5406  C CA  . GLY D 1 115 ? 101.185 155.324 96.915  1.00 30.00  ? 115 GLY D CA  1 
ATOM 5407  C C   . GLY D 1 115 ? 101.302 155.399 95.404  1.00 30.00  ? 115 GLY D C   1 
ATOM 5408  O O   . GLY D 1 115 ? 100.349 155.088 94.685  1.00 30.00  ? 115 GLY D O   1 
ATOM 5409  N N   . ALA D 1 116 ? 102.469 155.814 94.914  1.00 30.00  ? 116 ALA D N   1 
ATOM 5410  C CA  . ALA D 1 116 ? 102.771 155.898 93.486  1.00 30.00  ? 116 ALA D CA  1 
ATOM 5411  C C   . ALA D 1 116 ? 103.679 154.758 93.052  1.00 30.00  ? 116 ALA D C   1 
ATOM 5412  O O   . ALA D 1 116 ? 104.603 154.941 92.256  1.00 30.00  ? 116 ALA D O   1 
ATOM 5413  C CB  . ALA D 1 116 ? 103.399 157.246 93.149  1.00 30.00  ? 116 ALA D CB  1 
ATOM 5414  N N   . VAL D 1 117 ? 103.401 153.563 93.574  1.00 30.00  ? 117 VAL D N   1 
ATOM 5415  C CA  . VAL D 1 117 ? 104.293 152.405 93.620  1.00 30.00  ? 117 VAL D CA  1 
ATOM 5416  C C   . VAL D 1 117 ? 104.628 151.850 92.234  1.00 30.00  ? 117 VAL D C   1 
ATOM 5417  O O   . VAL D 1 117 ? 105.612 151.121 92.067  1.00 30.00  ? 117 VAL D O   1 
ATOM 5418  C CB  . VAL D 1 117 ? 103.643 151.338 94.530  1.00 30.00  ? 117 VAL D CB  1 
ATOM 5419  C CG1 . VAL D 1 117 ? 102.375 150.773 93.895  1.00 30.00  ? 117 VAL D CG1 1 
ATOM 5420  C CG2 . VAL D 1 117 ? 104.625 150.252 94.977  1.00 30.00  ? 117 VAL D CG2 1 
ATOM 5421  N N   . GLY D 1 118 ? 103.864 152.248 91.214  1.00 30.00  ? 118 GLY D N   1 
ATOM 5422  C CA  . GLY D 1 118 ? 103.997 151.677 89.881  1.00 30.00  ? 118 GLY D CA  1 
ATOM 5423  C C   . GLY D 1 118 ? 105.277 152.029 89.148  1.00 30.00  ? 118 GLY D C   1 
ATOM 5424  O O   . GLY D 1 118 ? 105.531 151.474 88.076  1.00 30.00  ? 118 GLY D O   1 
ATOM 5425  N N   . ASP D 1 119 ? 106.078 152.938 89.685  1.00 30.00  ? 119 ASP D N   1 
ATOM 5426  C CA  . ASP D 1 119 ? 107.434 153.171 89.205  1.00 30.00  ? 119 ASP D CA  1 
ATOM 5427  C C   . ASP D 1 119 ? 108.375 152.925 90.376  1.00 30.00  ? 119 ASP D C   1 
ATOM 5428  O O   . ASP D 1 119 ? 108.602 153.822 91.196  1.00 30.00  ? 119 ASP D O   1 
ATOM 5429  C CB  . ASP D 1 119 ? 107.590 154.576 88.635  1.00 30.00  ? 119 ASP D CB  1 
ATOM 5430  C CG  . ASP D 1 119 ? 106.841 154.756 87.329  1.00 30.00  ? 119 ASP D CG  1 
ATOM 5431  O OD1 . ASP D 1 119 ? 106.657 153.753 86.609  1.00 30.00  ? 119 ASP D OD1 1 
ATOM 5432  O OD2 . ASP D 1 119 ? 106.444 155.899 87.017  1.00 30.00  ? 119 ASP D OD2 1 
ATOM 5433  N N   . VAL D 1 120 ? 108.906 151.700 90.451  1.00 30.00  ? 120 VAL D N   1 
ATOM 5434  C CA  . VAL D 1 120 ? 109.712 151.280 91.594  1.00 30.00  ? 120 VAL D CA  1 
ATOM 5435  C C   . VAL D 1 120 ? 111.044 152.017 91.605  1.00 30.00  ? 120 VAL D C   1 
ATOM 5436  O O   . VAL D 1 120 ? 111.562 152.392 92.665  1.00 30.00  ? 120 VAL D O   1 
ATOM 5437  C CB  . VAL D 1 120 ? 109.898 149.750 91.559  1.00 30.00  ? 120 VAL D CB  1 
ATOM 5438  C CG1 . VAL D 1 120 ? 110.717 149.265 92.734  1.00 30.00  ? 120 VAL D CG1 1 
ATOM 5439  C CG2 . VAL D 1 120 ? 108.557 149.055 91.534  1.00 30.00  ? 120 VAL D CG2 1 
ATOM 5440  N N   . PHE D 1 121 ? 111.585 152.299 90.425  1.00 30.00  ? 121 PHE D N   1 
ATOM 5441  C CA  . PHE D 1 121 ? 112.931 152.831 90.288  1.00 30.00  ? 121 PHE D CA  1 
ATOM 5442  C C   . PHE D 1 121 ? 112.947 154.314 89.952  1.00 30.00  ? 121 PHE D C   1 
ATOM 5443  O O   . PHE D 1 121 ? 113.978 154.843 89.527  1.00 30.00  ? 121 PHE D O   1 
ATOM 5444  C CB  . PHE D 1 121 ? 113.676 152.020 89.235  1.00 30.00  ? 121 PHE D CB  1 
ATOM 5445  C CG  . PHE D 1 121 ? 114.005 150.637 89.684  1.00 30.00  ? 121 PHE D CG  1 
ATOM 5446  C CD1 . PHE D 1 121 ? 114.176 150.367 91.025  1.00 30.00  ? 121 PHE D CD1 1 
ATOM 5447  C CD2 . PHE D 1 121 ? 114.060 149.594 88.786  1.00 30.00  ? 121 PHE D CD2 1 
ATOM 5448  C CE1 . PHE D 1 121 ? 114.464 149.103 91.453  1.00 30.00  ? 121 PHE D CE1 1 
ATOM 5449  C CE2 . PHE D 1 121 ? 114.343 148.319 89.215  1.00 30.00  ? 121 PHE D CE2 1 
ATOM 5450  C CZ  . PHE D 1 121 ? 114.550 148.086 90.547  1.00 30.00  ? 121 PHE D CZ  1 
ATOM 5451  N N   . ASN D 1 122 ? 111.824 154.998 90.141  1.00 30.00  ? 122 ASN D N   1 
ATOM 5452  C CA  . ASN D 1 122 ? 111.804 156.443 89.976  1.00 30.00  ? 122 ASN D CA  1 
ATOM 5453  C C   . ASN D 1 122 ? 112.508 157.093 91.161  1.00 30.00  ? 122 ASN D C   1 
ATOM 5454  O O   . ASN D 1 122 ? 112.559 156.529 92.257  1.00 30.00  ? 122 ASN D O   1 
ATOM 5455  C CB  . ASN D 1 122 ? 110.361 156.944 89.862  1.00 30.00  ? 122 ASN D CB  1 
ATOM 5456  C CG  . ASN D 1 122 ? 110.268 158.379 89.365  1.00 30.00  ? 122 ASN D CG  1 
ATOM 5457  O OD1 . ASN D 1 122 ? 111.272 159.008 89.033  1.00 30.00  ? 122 ASN D OD1 1 
ATOM 5458  N ND2 . ASN D 1 122 ? 109.051 158.904 89.321  1.00 30.00  ? 122 ASN D ND2 1 
ATOM 5459  N N   . ALA D 1 123 ? 113.056 158.286 90.938  1.00 30.00  ? 123 ALA D N   1 
ATOM 5460  C CA  . ALA D 1 123 ? 113.742 159.014 91.998  1.00 30.00  ? 123 ALA D CA  1 
ATOM 5461  C C   . ALA D 1 123 ? 112.744 159.630 92.968  1.00 30.00  ? 123 ALA D C   1 
ATOM 5462  O O   . ALA D 1 123 ? 112.547 160.848 92.977  1.00 30.00  ? 123 ALA D O   1 
ATOM 5463  C CB  . ALA D 1 123 ? 114.643 160.098 91.405  1.00 30.00  ? 123 ALA D CB  1 
ATOM 5464  N N   . SER D 1 124 ? 112.115 158.796 93.790  1.00 30.00  ? 124 SER D N   1 
ATOM 5465  C CA  . SER D 1 124 ? 111.076 159.234 94.706  1.00 30.00  ? 124 SER D CA  1 
ATOM 5466  C C   . SER D 1 124 ? 111.681 159.630 96.048  1.00 30.00  ? 124 SER D C   1 
ATOM 5467  O O   . SER D 1 124 ? 112.892 159.822 96.181  1.00 30.00  ? 124 SER D O   1 
ATOM 5468  C CB  . SER D 1 124 ? 110.031 158.144 94.889  1.00 30.00  ? 124 SER D CB  1 
ATOM 5469  O OG  . SER D 1 124 ? 109.060 158.562 95.830  1.00 30.00  ? 124 SER D OG  1 
ATOM 5470  N N   . THR D 1 125 ? 110.825 159.772 97.061  1.00 30.00  ? 125 THR D N   1 
ATOM 5471  C CA  . THR D 1 125 ? 111.301 160.081 98.402  1.00 30.00  ? 125 THR D CA  1 
ATOM 5472  C C   . THR D 1 125 ? 112.007 158.904 99.052  1.00 30.00  ? 125 THR D C   1 
ATOM 5473  O O   . THR D 1 125 ? 112.793 159.108 99.982  1.00 30.00  ? 125 THR D O   1 
ATOM 5474  C CB  . THR D 1 125 ? 110.141 160.514 99.293  1.00 30.00  ? 125 THR D CB  1 
ATOM 5475  O OG1 . THR D 1 125 ? 109.207 159.433 99.411  1.00 30.00  ? 125 THR D OG1 1 
ATOM 5476  C CG2 . THR D 1 125 ? 109.439 161.720 98.697  1.00 30.00  ? 125 THR D CG2 1 
ATOM 5477  N N   . ALA D 1 126 ? 111.752 157.685 98.590  1.00 30.00  ? 126 ALA D N   1 
ATOM 5478  C CA  . ALA D 1 126 ? 112.292 156.510 99.250  1.00 30.00  ? 126 ALA D CA  1 
ATOM 5479  C C   . ALA D 1 126 ? 113.558 155.987 98.607  1.00 30.00  ? 126 ALA D C   1 
ATOM 5480  O O   . ALA D 1 126 ? 113.749 154.769 98.550  1.00 30.00  ? 126 ALA D O   1 
ATOM 5481  C CB  . ALA D 1 126 ? 111.248 155.406 99.297  1.00 30.00  ? 126 ALA D CB  1 
ATOM 5482  N N   . TRP D 1 127 ? 114.409 156.871 98.101  1.00 30.00  ? 127 TRP D N   1 
ATOM 5483  C CA  . TRP D 1 127 ? 115.722 156.499 97.599  1.00 30.00  ? 127 TRP D CA  1 
ATOM 5484  C C   . TRP D 1 127 ? 116.801 157.455 98.080  1.00 30.00  ? 127 TRP D C   1 
ATOM 5485  O O   . TRP D 1 127 ? 117.956 157.332 97.664  1.00 30.00  ? 127 TRP D O   1 
ATOM 5486  C CB  . TRP D 1 127 ? 115.695 156.433 96.075  1.00 30.00  ? 127 TRP D CB  1 
ATOM 5487  C CG  . TRP D 1 127 ? 114.966 155.238 95.567  1.00 30.00  ? 127 TRP D CG  1 
ATOM 5488  C CD1 . TRP D 1 127 ? 113.620 155.104 95.404  1.00 30.00  ? 127 TRP D CD1 1 
ATOM 5489  C CD2 . TRP D 1 127 ? 115.548 154.034 95.075  1.00 30.00  ? 127 TRP D CD2 1 
ATOM 5490  N NE1 . TRP D 1 127 ? 113.326 153.868 94.887  1.00 30.00  ? 127 TRP D NE1 1 
ATOM 5491  C CE2 . TRP D 1 127 ? 114.496 153.195 94.668  1.00 30.00  ? 127 TRP D CE2 1 
ATOM 5492  C CE3 . TRP D 1 127 ? 116.858 153.579 94.948  1.00 30.00  ? 127 TRP D CE3 1 
ATOM 5493  C CZ2 . TRP D 1 127 ? 114.714 151.932 94.144  1.00 30.00  ? 127 TRP D CZ2 1 
ATOM 5494  C CZ3 . TRP D 1 127 ? 117.071 152.327 94.442  1.00 30.00  ? 127 TRP D CZ3 1 
ATOM 5495  C CH2 . TRP D 1 127 ? 116.009 151.518 94.030  1.00 30.00  ? 127 TRP D CH2 1 
ATOM 5496  N N   . ASN D 1 128 ? 116.452 158.399 98.950  1.00 30.00  ? 128 ASN D N   1 
ATOM 5497  C CA  . ASN D 1 128 ? 117.429 159.238 99.638  1.00 30.00  ? 128 ASN D CA  1 
ATOM 5498  C C   . ASN D 1 128 ? 118.044 158.385 100.738 1.00 30.00  ? 128 ASN D C   1 
ATOM 5499  O O   . ASN D 1 128 ? 117.645 158.450 101.901 1.00 30.00  ? 128 ASN D O   1 
ATOM 5500  C CB  . ASN D 1 128 ? 116.765 160.488 100.203 1.00 30.00  ? 128 ASN D CB  1 
ATOM 5501  C CG  . ASN D 1 128 ? 117.765 161.500 100.743 1.00 30.00  ? 128 ASN D CG  1 
ATOM 5502  O OD1 . ASN D 1 128 ? 118.978 161.320 100.636 1.00 30.00  ? 128 ASN D OD1 1 
ATOM 5503  N ND2 . ASN D 1 128 ? 117.254 162.567 101.343 1.00 30.00  ? 128 ASN D ND2 1 
ATOM 5504  N N   . LEU D 1 129 ? 119.033 157.575 100.373 1.00 30.00  ? 129 LEU D N   1 
ATOM 5505  C CA  . LEU D 1 129 ? 119.594 156.615 101.308 1.00 30.00  ? 129 LEU D CA  1 
ATOM 5506  C C   . LEU D 1 129 ? 121.091 156.506 101.057 1.00 30.00  ? 129 LEU D C   1 
ATOM 5507  O O   . LEU D 1 129 ? 121.629 157.100 100.120 1.00 30.00  ? 129 LEU D O   1 
ATOM 5508  C CB  . LEU D 1 129 ? 118.859 155.275 101.200 1.00 30.00  ? 129 LEU D CB  1 
ATOM 5509  C CG  . LEU D 1 129 ? 118.863 154.464 99.908  1.00 30.00  ? 129 LEU D CG  1 
ATOM 5510  C CD1 . LEU D 1 129 ? 119.948 153.413 99.942  1.00 30.00  ? 129 LEU D CD1 1 
ATOM 5511  C CD2 . LEU D 1 129 ? 117.511 153.836 99.677  1.00 30.00  ? 129 LEU D CD2 1 
ATOM 5512  N N   . SER D 1 130 ? 121.763 155.737 101.911 1.00 30.00  ? 130 SER D N   1 
ATOM 5513  C CA  . SER D 1 130 ? 123.214 155.823 102.031 1.00 30.00  ? 130 SER D CA  1 
ATOM 5514  C C   . SER D 1 130 ? 123.896 154.462 101.972 1.00 30.00  ? 130 SER D C   1 
ATOM 5515  O O   . SER D 1 130 ? 123.294 153.478 101.531 1.00 30.00  ? 130 SER D O   1 
ATOM 5516  C CB  . SER D 1 130 ? 123.588 156.544 103.327 1.00 30.00  ? 130 SER D CB  1 
ATOM 5517  O OG  . SER D 1 130 ? 123.176 155.805 104.461 1.00 30.00  ? 130 SER D OG  1 
ATOM 5518  N N   . ASN D 1 131 ? 125.175 154.432 102.369 1.00 30.00  ? 131 ASN D N   1 
ATOM 5519  C CA  . ASN D 1 131 ? 125.992 153.221 102.311 1.00 30.00  ? 131 ASN D CA  1 
ATOM 5520  C C   . ASN D 1 131 ? 125.418 152.110 103.183 1.00 30.00  ? 131 ASN D C   1 
ATOM 5521  O O   . ASN D 1 131 ? 125.051 151.038 102.691 1.00 30.00  ? 131 ASN D O   1 
ATOM 5522  C CB  . ASN D 1 131 ? 127.418 153.530 102.769 1.00 30.00  ? 131 ASN D CB  1 
ATOM 5523  C CG  . ASN D 1 131 ? 128.072 154.604 101.948 1.00 30.00  ? 131 ASN D CG  1 
ATOM 5524  O OD1 . ASN D 1 131 ? 127.857 154.700 100.745 1.00 30.00  ? 131 ASN D OD1 1 
ATOM 5525  N ND2 . ASN D 1 131 ? 128.887 155.422 102.597 1.00 30.00  ? 131 ASN D ND2 1 
ATOM 5526  N N   . THR D 1 132 ? 125.330 152.356 104.487 1.00 30.00  ? 132 THR D N   1 
ATOM 5527  C CA  . THR D 1 132 ? 125.016 151.326 105.474 1.00 30.00  ? 132 THR D CA  1 
ATOM 5528  C C   . THR D 1 132 ? 123.519 151.196 105.700 1.00 30.00  ? 132 THR D C   1 
ATOM 5529  O O   . THR D 1 132 ? 123.086 150.677 106.731 1.00 30.00  ? 132 THR D O   1 
ATOM 5530  C CB  . THR D 1 132 ? 125.709 151.644 106.790 1.00 30.00  ? 132 THR D CB  1 
ATOM 5531  O OG1 . THR D 1 132 ? 125.054 152.757 107.404 1.00 30.00  ? 132 THR D OG1 1 
ATOM 5532  C CG2 . THR D 1 132 ? 127.135 152.057 106.529 1.00 30.00  ? 132 THR D CG2 1 
ATOM 5533  N N   . ASN D 1 133 ? 122.700 151.662 104.765 1.00 30.00  ? 133 ASN D N   1 
ATOM 5534  C CA  . ASN D 1 133 ? 121.268 151.755 104.982 1.00 30.00  ? 133 ASN D CA  1 
ATOM 5535  C C   . ASN D 1 133 ? 120.527 151.225 103.766 1.00 30.00  ? 133 ASN D C   1 
ATOM 5536  O O   . ASN D 1 133 ? 121.021 151.286 102.640 1.00 30.00  ? 133 ASN D O   1 
ATOM 5537  C CB  . ASN D 1 133 ? 120.854 153.202 105.260 1.00 30.00  ? 133 ASN D CB  1 
ATOM 5538  C CG  . ASN D 1 133 ? 121.556 153.783 106.465 1.00 30.00  ? 133 ASN D CG  1 
ATOM 5539  O OD1 . ASN D 1 133 ? 122.328 154.733 106.350 1.00 30.00  ? 133 ASN D OD1 1 
ATOM 5540  N ND2 . ASN D 1 133 ? 121.298 153.208 107.632 1.00 30.00  ? 133 ASN D ND2 1 
ATOM 5541  N N   . PHE D 1 134 ? 119.329 150.700 104.002 1.00 30.00  ? 134 PHE D N   1 
ATOM 5542  C CA  . PHE D 1 134 ? 118.489 150.236 102.913 1.00 30.00  ? 134 PHE D CA  1 
ATOM 5543  C C   . PHE D 1 134 ? 117.146 150.949 102.945 1.00 30.00  ? 134 PHE D C   1 
ATOM 5544  O O   . PHE D 1 134 ? 116.686 151.386 104.001 1.00 30.00  ? 134 PHE D O   1 
ATOM 5545  C CB  . PHE D 1 134 ? 118.285 148.710 102.938 1.00 30.00  ? 134 PHE D CB  1 
ATOM 5546  C CG  . PHE D 1 134 ? 117.634 148.179 104.189 1.00 30.00  ? 134 PHE D CG  1 
ATOM 5547  C CD1 . PHE D 1 134 ? 118.408 147.769 105.253 1.00 30.00  ? 134 PHE D CD1 1 
ATOM 5548  C CD2 . PHE D 1 134 ? 116.257 148.037 104.283 1.00 30.00  ? 134 PHE D CD2 1 
ATOM 5549  C CE1 . PHE D 1 134 ? 117.827 147.255 106.392 1.00 30.00  ? 134 PHE D CE1 1 
ATOM 5550  C CE2 . PHE D 1 134 ? 115.671 147.531 105.423 1.00 30.00  ? 134 PHE D CE2 1 
ATOM 5551  C CZ  . PHE D 1 134 ? 116.455 147.142 106.477 1.00 30.00  ? 134 PHE D CZ  1 
ATOM 5552  N N   . GLY D 1 135 ? 116.516 151.051 101.772 1.00 30.00  ? 135 GLY D N   1 
ATOM 5553  C CA  . GLY D 1 135 ? 115.177 151.584 101.653 1.00 30.00  ? 135 GLY D CA  1 
ATOM 5554  C C   . GLY D 1 135 ? 114.137 150.484 101.742 1.00 30.00  ? 135 GLY D C   1 
ATOM 5555  O O   . GLY D 1 135 ? 114.410 149.324 101.461 1.00 30.00  ? 135 GLY D O   1 
ATOM 5556  N N   . ILE D 1 136 ? 112.936 150.860 102.168 1.00 30.00  ? 136 ILE D N   1 
ATOM 5557  C CA  . ILE D 1 136 ? 111.975 149.871 102.635 1.00 30.00  ? 136 ILE D CA  1 
ATOM 5558  C C   . ILE D 1 136 ? 110.617 150.020 101.929 1.00 30.00  ? 136 ILE D C   1 
ATOM 5559  O O   . ILE D 1 136 ? 109.555 149.955 102.562 1.00 30.00  ? 136 ILE D O   1 
ATOM 5560  C CB  . ILE D 1 136 ? 111.938 149.914 104.183 1.00 30.00  ? 136 ILE D CB  1 
ATOM 5561  C CG1 . ILE D 1 136 ? 111.327 148.640 104.770 1.00 30.00  ? 136 ILE D CG1 1 
ATOM 5562  C CG2 . ILE D 1 136 ? 111.415 151.237 104.751 1.00 30.00  ? 136 ILE D CG2 1 
ATOM 5563  C CD1 . ILE D 1 136 ? 112.115 147.443 104.380 1.00 30.00  ? 136 ILE D CD1 1 
ATOM 5564  N N   . ILE D 1 137 ? 110.647 150.274 100.610 1.00 30.00  ? 137 ILE D N   1 
ATOM 5565  C CA  . ILE D 1 137 ? 109.420 150.544 99.852  1.00 30.00  ? 137 ILE D CA  1 
ATOM 5566  C C   . ILE D 1 137 ? 108.495 149.335 99.911  1.00 30.00  ? 137 ILE D C   1 
ATOM 5567  O O   . ILE D 1 137 ? 108.942 148.183 99.889  1.00 30.00  ? 137 ILE D O   1 
ATOM 5568  C CB  . ILE D 1 137 ? 109.759 150.982 98.413  1.00 30.00  ? 137 ILE D CB  1 
ATOM 5569  C CG1 . ILE D 1 137 ? 110.178 149.858 97.469  1.00 30.00  ? 137 ILE D CG1 1 
ATOM 5570  C CG2 . ILE D 1 137 ? 110.940 151.886 98.434  1.00 30.00  ? 137 ILE D CG2 1 
ATOM 5571  C CD1 . ILE D 1 137 ? 109.074 149.428 96.512  1.00 30.00  ? 137 ILE D CD1 1 
ATOM 5572  N N   . VAL D 1 138 ? 107.206 149.593 100.095 1.00 30.00  ? 138 VAL D N   1 
ATOM 5573  C CA  . VAL D 1 138 ? 106.304 148.599 100.657 1.00 30.00  ? 138 VAL D CA  1 
ATOM 5574  C C   . VAL D 1 138 ? 105.062 148.474 99.786  1.00 30.00  ? 138 VAL D C   1 
ATOM 5575  O O   . VAL D 1 138 ? 104.581 149.457 99.212  1.00 30.00  ? 138 VAL D O   1 
ATOM 5576  C CB  . VAL D 1 138 ? 105.966 148.953 102.125 1.00 30.00  ? 138 VAL D CB  1 
ATOM 5577  C CG1 . VAL D 1 138 ? 105.243 150.286 102.239 1.00 30.00  ? 138 VAL D CG1 1 
ATOM 5578  C CG2 . VAL D 1 138 ? 105.199 147.839 102.818 1.00 30.00  ? 138 VAL D CG2 1 
ATOM 5579  N N   . LEU D 1 139 ? 104.591 147.242 99.633  1.00 30.00  ? 139 LEU D N   1 
ATOM 5580  C CA  . LEU D 1 139 ? 103.383 146.926 98.896  1.00 30.00  ? 139 LEU D CA  1 
ATOM 5581  C C   . LEU D 1 139 ? 102.760 145.678 99.507  1.00 30.00  ? 139 LEU D C   1 
ATOM 5582  O O   . LEU D 1 139 ? 103.435 144.912 100.195 1.00 30.00  ? 139 LEU D O   1 
ATOM 5583  C CB  . LEU D 1 139 ? 103.691 146.769 97.396  1.00 30.00  ? 139 LEU D CB  1 
ATOM 5584  C CG  . LEU D 1 139 ? 104.827 145.863 96.909  1.00 30.00  ? 139 LEU D CG  1 
ATOM 5585  C CD1 . LEU D 1 139 ? 104.409 144.423 96.701  1.00 30.00  ? 139 LEU D CD1 1 
ATOM 5586  C CD2 . LEU D 1 139 ? 105.435 146.422 95.638  1.00 30.00  ? 139 LEU D CD2 1 
ATOM 5587  N N   . GLN D 1 140 ? 101.457 145.510 99.266  1.00 30.00  ? 140 GLN D N   1 
ATOM 5588  C CA  . GLN D 1 140 ? 100.626 144.440 99.831  1.00 30.00  ? 140 GLN D CA  1 
ATOM 5589  C C   . GLN D 1 140 ? 100.699 144.439 101.364 1.00 30.00  ? 140 GLN D C   1 
ATOM 5590  O O   . GLN D 1 140 ? 101.290 143.570 101.997 1.00 30.00  ? 140 GLN D O   1 
ATOM 5591  C CB  . GLN D 1 140 ? 100.994 143.069 99.247  1.00 30.00  ? 140 GLN D CB  1 
ATOM 5592  C CG  . GLN D 1 140 ? 100.024 141.944 99.610  1.00 30.00  ? 140 GLN D CG  1 
ATOM 5593  C CD  . GLN D 1 140 ? 100.485 140.597 99.128  1.00 30.00  ? 140 GLN D CD  1 
ATOM 5594  O OE1 . GLN D 1 140 ? 101.518 140.480 98.484  1.00 30.00  ? 140 GLN D OE1 1 
ATOM 5595  N NE2 . GLN D 1 140 ? 99.737  139.563 99.469  1.00 30.00  ? 140 GLN D NE2 1 
ATOM 5596  N N   . ASP D 1 141 ? 100.149 145.489 101.953 1.00 30.00  ? 141 ASP D N   1 
ATOM 5597  C CA  . ASP D 1 141 ? 99.937  145.527 103.392 1.00 30.00  ? 141 ASP D CA  1 
ATOM 5598  C C   . ASP D 1 141 ? 98.452  145.359 103.677 1.00 30.00  ? 141 ASP D C   1 
ATOM 5599  O O   . ASP D 1 141 ? 97.623  146.126 103.179 1.00 30.00  ? 141 ASP D O   1 
ATOM 5600  C CB  . ASP D 1 141 ? 100.509 146.809 104.018 1.00 30.00  ? 141 ASP D CB  1 
ATOM 5601  C CG  . ASP D 1 141 ? 100.084 148.076 103.294 1.00 30.00  ? 141 ASP D CG  1 
ATOM 5602  O OD1 . ASP D 1 141 ? 99.507  147.989 102.191 1.00 30.00  ? 141 ASP D OD1 1 
ATOM 5603  O OD2 . ASP D 1 141 ? 100.336 149.172 103.838 1.00 30.00  ? 141 ASP D OD2 1 
ATOM 5604  N N   . ALA D 1 142 ? 98.117  144.337 104.461 1.00 30.00  ? 142 ALA D N   1 
ATOM 5605  C CA  . ALA D 1 142 ? 96.721  143.950 104.616 1.00 30.00  ? 142 ALA D CA  1 
ATOM 5606  C C   . ALA D 1 142 ? 95.972  144.898 105.545 1.00 30.00  ? 142 ALA D C   1 
ATOM 5607  O O   . ALA D 1 142 ? 95.052  145.604 105.119 1.00 30.00  ? 142 ALA D O   1 
ATOM 5608  C CB  . ALA D 1 142 ? 96.637  142.513 105.134 1.00 30.00  ? 142 ALA D CB  1 
ATOM 5609  N N   . ASP D 1 143 ? 96.361  144.939 106.815 1.00 30.00  ? 143 ASP D N   1 
ATOM 5610  C CA  . ASP D 1 143 ? 95.706  145.771 107.818 1.00 30.00  ? 143 ASP D CA  1 
ATOM 5611  C C   . ASP D 1 143 ? 96.508  147.035 108.094 1.00 30.00  ? 143 ASP D C   1 
ATOM 5612  O O   . ASP D 1 143 ? 96.479  147.568 109.206 1.00 30.00  ? 143 ASP D O   1 
ATOM 5613  C CB  . ASP D 1 143 ? 95.491  144.993 109.112 1.00 30.00  ? 143 ASP D CB  1 
ATOM 5614  C CG  . ASP D 1 143 ? 94.448  143.913 108.971 1.00 30.00  ? 143 ASP D CG  1 
ATOM 5615  O OD1 . ASP D 1 143 ? 93.508  144.098 108.172 1.00 30.00  ? 143 ASP D OD1 1 
ATOM 5616  O OD2 . ASP D 1 143 ? 94.572  142.876 109.653 1.00 30.00  ? 143 ASP D OD2 1 
ATOM 5617  N N   . ASN D 1 144 ? 97.221  147.510 107.062 1.00 30.00  ? 144 ASN D N   1 
ATOM 5618  C CA  . ASN D 1 144 ? 98.184  148.613 107.146 1.00 30.00  ? 144 ASN D CA  1 
ATOM 5619  C C   . ASN D 1 144 ? 99.222  148.345 108.232 1.00 30.00  ? 144 ASN D C   1 
ATOM 5620  O O   . ASN D 1 144 ? 99.630  149.238 108.976 1.00 30.00  ? 144 ASN D O   1 
ATOM 5621  C CB  . ASN D 1 144 ? 97.484  149.958 107.359 1.00 30.00  ? 144 ASN D CB  1 
ATOM 5622  C CG  . ASN D 1 144 ? 96.618  150.351 106.184 1.00 30.00  ? 144 ASN D CG  1 
ATOM 5623  O OD1 . ASN D 1 144 ? 96.994  150.157 105.031 1.00 30.00  ? 144 ASN D OD1 1 
ATOM 5624  N ND2 . ASN D 1 144 ? 95.446  150.903 106.471 1.00 30.00  ? 144 ASN D ND2 1 
ATOM 5625  N N   . SER D 1 145 ? 99.650  147.086 108.314 1.00 30.00  ? 145 SER D N   1 
ATOM 5626  C CA  . SER D 1 145 ? 100.499 146.619 109.398 1.00 30.00  ? 145 SER D CA  1 
ATOM 5627  C C   . SER D 1 145 ? 101.936 147.094 109.277 1.00 30.00  ? 145 SER D C   1 
ATOM 5628  O O   . SER D 1 145 ? 102.703 146.931 110.230 1.00 30.00  ? 145 SER D O   1 
ATOM 5629  C CB  . SER D 1 145 ? 100.458 145.089 109.467 1.00 30.00  ? 145 SER D CB  1 
ATOM 5630  O OG  . SER D 1 145 ? 101.012 144.496 108.306 1.00 30.00  ? 145 SER D OG  1 
ATOM 5631  N N   . VAL D 1 146 ? 102.319 147.676 108.144 1.00 30.00  ? 146 VAL D N   1 
ATOM 5632  C CA  . VAL D 1 146 ? 103.636 148.283 108.016 1.00 30.00  ? 146 VAL D CA  1 
ATOM 5633  C C   . VAL D 1 146 ? 103.459 149.791 108.114 1.00 30.00  ? 146 VAL D C   1 
ATOM 5634  O O   . VAL D 1 146 ? 103.236 150.471 107.106 1.00 30.00  ? 146 VAL D O   1 
ATOM 5635  C CB  . VAL D 1 146 ? 104.316 147.889 106.692 1.00 30.00  ? 146 VAL D CB  1 
ATOM 5636  C CG1 . VAL D 1 146 ? 105.734 148.447 106.623 1.00 30.00  ? 146 VAL D CG1 1 
ATOM 5637  C CG2 . VAL D 1 146 ? 104.310 146.392 106.520 1.00 30.00  ? 146 VAL D CG2 1 
ATOM 5638  N N   . ASP D 1 147 ? 103.532 150.323 109.326 1.00 30.00  ? 147 ASP D N   1 
ATOM 5639  C CA  . ASP D 1 147 ? 103.525 151.760 109.535 1.00 30.00  ? 147 ASP D CA  1 
ATOM 5640  C C   . ASP D 1 147 ? 104.955 152.255 109.630 1.00 30.00  ? 147 ASP D C   1 
ATOM 5641  O O   . ASP D 1 147 ? 105.901 151.471 109.725 1.00 30.00  ? 147 ASP D O   1 
ATOM 5642  C CB  . ASP D 1 147 ? 102.739 152.136 110.794 1.00 30.00  ? 147 ASP D CB  1 
ATOM 5643  C CG  . ASP D 1 147 ? 101.243 151.977 110.618 1.00 30.00  ? 147 ASP D CG  1 
ATOM 5644  O OD1 . ASP D 1 147 ? 100.756 152.173 109.485 1.00 30.00  ? 147 ASP D OD1 1 
ATOM 5645  O OD2 . ASP D 1 147 ? 100.557 151.654 111.611 1.00 30.00  ? 147 ASP D OD2 1 
ATOM 5646  N N   . GLN D 1 148 ? 105.106 153.573 109.551 1.00 30.00  ? 148 GLN D N   1 
ATOM 5647  C CA  . GLN D 1 148 ? 106.408 154.195 109.741 1.00 30.00  ? 148 GLN D CA  1 
ATOM 5648  C C   . GLN D 1 148 ? 106.867 153.963 111.174 1.00 30.00  ? 148 GLN D C   1 
ATOM 5649  O O   . GLN D 1 148 ? 106.040 153.863 112.085 1.00 30.00  ? 148 GLN D O   1 
ATOM 5650  C CB  . GLN D 1 148 ? 106.321 155.690 109.429 1.00 30.00  ? 148 GLN D CB  1 
ATOM 5651  C CG  . GLN D 1 148 ? 107.643 156.412 109.415 1.00 30.00  ? 148 GLN D CG  1 
ATOM 5652  C CD  . GLN D 1 148 ? 108.523 155.945 108.289 1.00 30.00  ? 148 GLN D CD  1 
ATOM 5653  O OE1 . GLN D 1 148 ? 108.063 155.752 107.168 1.00 30.00  ? 148 GLN D OE1 1 
ATOM 5654  N NE2 . GLN D 1 148 ? 109.797 155.743 108.583 1.00 30.00  ? 148 GLN D NE2 1 
ATOM 5655  N N   . ASN D 1 149 ? 108.184 153.759 111.335 1.00 30.00  ? 149 ASN D N   1 
ATOM 5656  C CA  . ASN D 1 149 ? 108.922 153.499 112.575 1.00 30.00  ? 149 ASN D CA  1 
ATOM 5657  C C   . ASN D 1 149 ? 108.662 152.103 113.139 1.00 30.00  ? 149 ASN D C   1 
ATOM 5658  O O   . ASN D 1 149 ? 109.306 151.706 114.114 1.00 30.00  ? 149 ASN D O   1 
ATOM 5659  C CB  . ASN D 1 149 ? 108.623 154.544 113.663 1.00 30.00  ? 149 ASN D CB  1 
ATOM 5660  C CG  . ASN D 1 149 ? 108.861 155.960 113.194 1.00 30.00  ? 149 ASN D CG  1 
ATOM 5661  O OD1 . ASN D 1 149 ? 107.929 156.757 113.111 1.00 30.00  ? 149 ASN D OD1 1 
ATOM 5662  N ND2 . ASN D 1 149 ? 110.108 156.283 112.884 1.00 30.00  ? 149 ASN D ND2 1 
ATOM 5663  N N   . TYR D 1 150 ? 107.736 151.345 112.552 1.00 30.00  ? 150 TYR D N   1 
ATOM 5664  C CA  . TYR D 1 150 ? 107.361 150.021 113.053 1.00 30.00  ? 150 TYR D CA  1 
ATOM 5665  C C   . TYR D 1 150 ? 106.973 149.127 111.882 1.00 30.00  ? 150 TYR D C   1 
ATOM 5666  O O   . TYR D 1 150 ? 105.802 149.055 111.498 1.00 30.00  ? 150 TYR D O   1 
ATOM 5667  C CB  . TYR D 1 150 ? 106.203 150.124 114.051 1.00 30.00  ? 150 TYR D CB  1 
ATOM 5668  C CG  . TYR D 1 150 ? 106.506 150.913 115.300 1.00 30.00  ? 150 TYR D CG  1 
ATOM 5669  C CD1 . TYR D 1 150 ? 107.193 150.340 116.358 1.00 30.00  ? 150 TYR D CD1 1 
ATOM 5670  C CD2 . TYR D 1 150 ? 106.109 152.237 115.412 1.00 30.00  ? 150 TYR D CD2 1 
ATOM 5671  C CE1 . TYR D 1 150 ? 107.473 151.063 117.498 1.00 30.00  ? 150 TYR D CE1 1 
ATOM 5672  C CE2 . TYR D 1 150 ? 106.386 152.968 116.542 1.00 30.00  ? 150 TYR D CE2 1 
ATOM 5673  C CZ  . TYR D 1 150 ? 107.066 152.377 117.583 1.00 30.00  ? 150 TYR D CZ  1 
ATOM 5674  O OH  . TYR D 1 150 ? 107.343 153.107 118.715 1.00 30.00  ? 150 TYR D OH  1 
ATOM 5675  N N   . PRO D 1 151 ? 107.938 148.433 111.278 1.00 118.75 ? 151 PRO D N   1 
ATOM 5676  C CA  . PRO D 1 151 ? 107.579 147.479 110.222 1.00 118.46 ? 151 PRO D CA  1 
ATOM 5677  C C   . PRO D 1 151 ? 107.295 146.089 110.763 1.00 119.90 ? 151 PRO D C   1 
ATOM 5678  O O   . PRO D 1 151 ? 108.037 145.581 111.607 1.00 131.05 ? 151 PRO D O   1 
ATOM 5679  C CB  . PRO D 1 151 ? 108.816 147.467 109.321 1.00 30.00  ? 151 PRO D CB  1 
ATOM 5680  C CG  . PRO D 1 151 ? 109.603 148.672 109.706 1.00 30.00  ? 151 PRO D CG  1 
ATOM 5681  C CD  . PRO D 1 151 ? 109.351 148.822 111.171 1.00 30.00  ? 151 PRO D CD  1 
ATOM 5682  N N   . THR D 1 152 ? 106.219 145.469 110.285 1.00 103.12 ? 152 THR D N   1 
ATOM 5683  C CA  . THR D 1 152 ? 105.841 144.108 110.648 1.00 94.10  ? 152 THR D CA  1 
ATOM 5684  C C   . THR D 1 152 ? 105.685 143.299 109.371 1.00 104.71 ? 152 THR D C   1 
ATOM 5685  O O   . THR D 1 152 ? 105.139 143.799 108.384 1.00 113.36 ? 152 THR D O   1 
ATOM 5686  C CB  . THR D 1 152 ? 104.529 144.080 111.433 1.00 30.00  ? 152 THR D CB  1 
ATOM 5687  O OG1 . THR D 1 152 ? 103.484 144.627 110.623 1.00 30.00  ? 152 THR D OG1 1 
ATOM 5688  C CG2 . THR D 1 152 ? 104.628 144.893 112.701 1.00 30.00  ? 152 THR D CG2 1 
ATOM 5689  N N   . LEU D 1 153 ? 106.167 142.064 109.378 1.00 105.17 ? 153 LEU D N   1 
ATOM 5690  C CA  . LEU D 1 153 ? 105.854 141.166 108.276 1.00 86.31  ? 153 LEU D CA  1 
ATOM 5691  C C   . LEU D 1 153 ? 104.933 140.043 108.725 1.00 100.45 ? 153 LEU D C   1 
ATOM 5692  O O   . LEU D 1 153 ? 105.369 138.982 109.175 1.00 121.22 ? 153 LEU D O   1 
ATOM 5693  C CB  . LEU D 1 153 ? 107.120 140.595 107.639 1.00 85.43  ? 153 LEU D CB  1 
ATOM 5694  C CG  . LEU D 1 153 ? 107.579 141.324 106.375 1.00 104.80 ? 153 LEU D CG  1 
ATOM 5695  C CD1 . LEU D 1 153 ? 107.925 142.745 106.640 1.00 109.08 ? 153 LEU D CD1 1 
ATOM 5696  C CD2 . LEU D 1 153 ? 108.772 140.627 105.767 1.00 104.18 ? 153 LEU D CD2 1 
ATOM 5697  N N   . ASN D 1 154 ? 103.638 140.288 108.563 1.00 92.73  ? 154 ASN D N   1 
ATOM 5698  C CA  . ASN D 1 154 ? 102.613 139.285 108.799 1.00 102.94 ? 154 ASN D CA  1 
ATOM 5699  C C   . ASN D 1 154 ? 102.441 138.431 107.551 1.00 103.88 ? 154 ASN D C   1 
ATOM 5700  O O   . ASN D 1 154 ? 103.205 138.576 106.594 1.00 114.48 ? 154 ASN D O   1 
ATOM 5701  C CB  . ASN D 1 154 ? 101.308 139.971 109.218 1.00 108.28 ? 154 ASN D CB  1 
ATOM 5702  C CG  . ASN D 1 154 ? 100.930 141.137 108.307 1.00 136.92 ? 154 ASN D CG  1 
ATOM 5703  O OD1 . ASN D 1 154 ? 101.592 141.405 107.309 1.00 143.53 ? 154 ASN D OD1 1 
ATOM 5704  N ND2 . ASN D 1 154 ? 99.862  141.838 108.660 1.00 139.78 ? 154 ASN D ND2 1 
ATOM 5705  N N   . LYS D 1 155 ? 101.465 137.532 107.552 1.00 95.21  ? 155 LYS D N   1 
ATOM 5706  C CA  . LYS D 1 155 ? 101.243 136.694 106.384 1.00 95.36  ? 155 LYS D CA  1 
ATOM 5707  C C   . LYS D 1 155 ? 100.650 137.511 105.240 1.00 115.83 ? 155 LYS D C   1 
ATOM 5708  O O   . LYS D 1 155 ? 99.836  138.416 105.441 1.00 123.08 ? 155 LYS D O   1 
ATOM 5709  C CB  . LYS D 1 155 ? 100.341 135.510 106.740 1.00 30.00  ? 155 LYS D CB  1 
ATOM 5710  C CG  . LYS D 1 155 ? 98.957  135.883 107.244 1.00 30.00  ? 155 LYS D CG  1 
ATOM 5711  C CD  . LYS D 1 155 ? 98.168  134.658 107.637 1.00 30.00  ? 155 LYS D CD  1 
ATOM 5712  C CE  . LYS D 1 155 ? 98.725  134.062 108.911 1.00 30.00  ? 155 LYS D CE  1 
ATOM 5713  N NZ  . LYS D 1 155 ? 97.893  132.937 109.402 1.00 30.00  ? 155 LYS D NZ  1 
ATOM 5714  N N   . GLY D 1 156 ? 101.103 137.205 104.031 1.00 120.22 ? 156 GLY D N   1 
ATOM 5715  C CA  . GLY D 1 156 ? 100.663 137.938 102.860 1.00 108.72 ? 156 GLY D CA  1 
ATOM 5716  C C   . GLY D 1 156 ? 101.160 139.364 102.815 1.00 114.31 ? 156 GLY D C   1 
ATOM 5717  O O   . GLY D 1 156 ? 100.354 140.296 102.891 1.00 129.66 ? 156 GLY D O   1 
ATOM 5718  N N   . ASP D 1 157 ? 102.470 139.559 102.696 1.00 108.95 ? 157 ASP D N   1 
ATOM 5719  C CA  . ASP D 1 157 ? 103.057 140.891 102.779 1.00 110.20 ? 157 ASP D CA  1 
ATOM 5720  C C   . ASP D 1 157 ? 104.393 140.854 102.053 1.00 98.60  ? 157 ASP D C   1 
ATOM 5721  O O   . ASP D 1 157 ? 105.283 140.095 102.436 1.00 104.60 ? 157 ASP D O   1 
ATOM 5722  C CB  . ASP D 1 157 ? 103.217 141.310 104.242 1.00 30.00  ? 157 ASP D CB  1 
ATOM 5723  C CG  . ASP D 1 157 ? 103.508 142.789 104.415 1.00 30.00  ? 157 ASP D CG  1 
ATOM 5724  O OD1 . ASP D 1 157 ? 103.743 143.500 103.419 1.00 30.00  ? 157 ASP D OD1 1 
ATOM 5725  O OD2 . ASP D 1 157 ? 103.472 143.255 105.571 1.00 30.00  ? 157 ASP D OD2 1 
ATOM 5726  N N   . ILE D 1 158 ? 104.534 141.659 101.006 1.00 93.46  ? 158 ILE D N   1 
ATOM 5727  C CA  . ILE D 1 158 ? 105.769 141.721 100.235 1.00 94.83  ? 158 ILE D CA  1 
ATOM 5728  C C   . ILE D 1 158 ? 106.351 143.116 100.395 1.00 87.24  ? 158 ILE D C   1 
ATOM 5729  O O   . ILE D 1 158 ? 106.058 144.017 99.603  1.00 105.72 ? 158 ILE D O   1 
ATOM 5730  C CB  . ILE D 1 158 ? 105.541 141.414 98.752  1.00 30.00  ? 158 ILE D CB  1 
ATOM 5731  C CG1 . ILE D 1 158 ? 104.827 140.091 98.559  1.00 30.00  ? 158 ILE D CG1 1 
ATOM 5732  C CG2 . ILE D 1 158 ? 106.871 141.300 98.034  1.00 30.00  ? 158 ILE D CG2 1 
ATOM 5733  C CD1 . ILE D 1 158 ? 104.418 139.895 97.131  1.00 30.00  ? 158 ILE D CD1 1 
ATOM 5734  N N   . VAL D 1 159 ? 107.198 143.312 101.389 1.00 72.04  ? 159 VAL D N   1 
ATOM 5735  C CA  . VAL D 1 159 ? 107.951 144.546 101.460 1.00 85.77  ? 159 VAL D CA  1 
ATOM 5736  C C   . VAL D 1 159 ? 109.130 144.380 100.510 1.00 98.46  ? 159 VAL D C   1 
ATOM 5737  O O   . VAL D 1 159 ? 109.603 143.270 100.251 1.00 103.95 ? 159 VAL D O   1 
ATOM 5738  C CB  . VAL D 1 159 ? 108.388 144.899 102.903 1.00 96.17  ? 159 VAL D CB  1 
ATOM 5739  C CG1 . VAL D 1 159 ? 109.471 143.964 103.418 1.00 92.70  ? 159 VAL D CG1 1 
ATOM 5740  C CG2 . VAL D 1 159 ? 108.792 146.367 103.028 1.00 104.55 ? 159 VAL D CG2 1 
ATOM 5741  N N   . VAL D 1 160 ? 109.554 145.485 99.919  1.00 95.14  ? 160 VAL D N   1 
ATOM 5742  C CA  . VAL D 1 160 ? 110.644 145.487 98.956  1.00 101.45 ? 160 VAL D CA  1 
ATOM 5743  C C   . VAL D 1 160 ? 111.798 146.239 99.584  1.00 102.27 ? 160 VAL D C   1 
ATOM 5744  O O   . VAL D 1 160 ? 111.745 147.465 99.730  1.00 103.82 ? 160 VAL D O   1 
ATOM 5745  C CB  . VAL D 1 160 ? 110.232 146.135 97.635  1.00 30.00  ? 160 VAL D CB  1 
ATOM 5746  C CG1 . VAL D 1 160 ? 111.416 146.216 96.694  1.00 30.00  ? 160 VAL D CG1 1 
ATOM 5747  C CG2 . VAL D 1 160 ? 109.074 145.388 97.030  1.00 30.00  ? 160 VAL D CG2 1 
ATOM 5748  N N   . ILE D 1 161 ? 112.841 145.513 99.967  1.00 90.95  ? 161 ILE D N   1 
ATOM 5749  C CA  . ILE D 1 161 ? 114.017 146.171 100.509 1.00 81.94  ? 161 ILE D CA  1 
ATOM 5750  C C   . ILE D 1 161 ? 114.788 146.811 99.366  1.00 79.66  ? 161 ILE D C   1 
ATOM 5751  O O   . ILE D 1 161 ? 115.169 146.142 98.400  1.00 99.72  ? 161 ILE D O   1 
ATOM 5752  C CB  . ILE D 1 161 ? 114.870 145.194 101.324 1.00 30.00  ? 161 ILE D CB  1 
ATOM 5753  C CG1 . ILE D 1 161 ? 114.148 144.895 102.633 1.00 30.00  ? 161 ILE D CG1 1 
ATOM 5754  C CG2 . ILE D 1 161 ? 116.270 145.733 101.551 1.00 30.00  ? 161 ILE D CG2 1 
ATOM 5755  C CD1 . ILE D 1 161 ? 114.836 143.939 103.518 1.00 30.00  ? 161 ILE D CD1 1 
ATOM 5756  N N   . THR D 1 162 ? 114.969 148.123 99.452  1.00 81.25  ? 162 THR D N   1 
ATOM 5757  C CA  . THR D 1 162 ? 115.630 148.923 98.433  1.00 79.19  ? 162 THR D CA  1 
ATOM 5758  C C   . THR D 1 162 ? 117.056 149.224 98.861  1.00 81.11  ? 162 THR D C   1 
ATOM 5759  O O   . THR D 1 162 ? 117.277 149.750 99.950  1.00 116.53 ? 162 THR D O   1 
ATOM 5760  C CB  . THR D 1 162 ? 114.844 150.216 98.224  1.00 105.99 ? 162 THR D CB  1 
ATOM 5761  O OG1 . THR D 1 162 ? 113.636 149.941 97.507  1.00 101.14 ? 162 THR D OG1 1 
ATOM 5762  C CG2 . THR D 1 162 ? 115.650 151.262 97.525  1.00 102.00 ? 162 THR D CG2 1 
ATOM 5763  N N   . VAL D 1 163 ? 118.025 148.876 98.018  1.00 74.05  ? 163 VAL D N   1 
ATOM 5764  C CA  . VAL D 1 163 ? 119.437 149.076 98.329  1.00 59.01  ? 163 VAL D CA  1 
ATOM 5765  C C   . VAL D 1 163 ? 120.083 149.802 97.165  1.00 74.94  ? 163 VAL D C   1 
ATOM 5766  O O   . VAL D 1 163 ? 120.191 149.241 96.069  1.00 100.06 ? 163 VAL D O   1 
ATOM 5767  C CB  . VAL D 1 163 ? 120.177 147.753 98.583  1.00 30.00  ? 163 VAL D CB  1 
ATOM 5768  C CG1 . VAL D 1 163 ? 121.639 148.026 98.811  1.00 30.00  ? 163 VAL D CG1 1 
ATOM 5769  C CG2 . VAL D 1 163 ? 119.599 147.013 99.765  1.00 30.00  ? 163 VAL D CG2 1 
ATOM 5770  N N   . LYS D 1 164 ? 120.518 151.037 97.390  1.00 74.88  ? 164 LYS D N   1 
ATOM 5771  C CA  . LYS D 1 164 ? 121.363 151.701 96.409  1.00 83.69  ? 164 LYS D CA  1 
ATOM 5772  C C   . LYS D 1 164 ? 122.788 151.202 96.561  1.00 106.81 ? 164 LYS D C   1 
ATOM 5773  O O   . LYS D 1 164 ? 123.342 151.201 97.661  1.00 129.13 ? 164 LYS D O   1 
ATOM 5774  C CB  . LYS D 1 164 ? 121.331 153.217 96.573  1.00 30.00  ? 164 LYS D CB  1 
ATOM 5775  C CG  . LYS D 1 164 ? 122.194 153.946 95.568  1.00 30.00  ? 164 LYS D CG  1 
ATOM 5776  C CD  . LYS D 1 164 ? 122.154 155.430 95.792  1.00 30.00  ? 164 LYS D CD  1 
ATOM 5777  C CE  . LYS D 1 164 ? 123.074 156.137 94.833  1.00 30.00  ? 164 LYS D CE  1 
ATOM 5778  N NZ  . LYS D 1 164 ? 123.076 157.600 95.087  1.00 30.00  ? 164 LYS D NZ  1 
ATOM 5779  N N   . VAL D 1 165 ? 123.385 150.778 95.451  1.00 100.36 ? 165 VAL D N   1 
ATOM 5780  C CA  . VAL D 1 165 ? 124.674 150.100 95.468  1.00 103.79 ? 165 VAL D CA  1 
ATOM 5781  C C   . VAL D 1 165 ? 125.755 150.927 94.778  1.00 97.79  ? 165 VAL D C   1 
ATOM 5782  O O   . VAL D 1 165 ? 126.797 151.223 95.368  1.00 106.74 ? 165 VAL D O   1 
ATOM 5783  C CB  . VAL D 1 165 ? 124.573 148.695 94.835  1.00 30.00  ? 165 VAL D CB  1 
ATOM 5784  C CG1 . VAL D 1 165 ? 125.896 147.999 94.895  1.00 30.00  ? 165 VAL D CG1 1 
ATOM 5785  C CG2 . VAL D 1 165 ? 123.514 147.874 95.525  1.00 30.00  ? 165 VAL D CG2 1 
ATOM 5786  N N   . GLY D 1 166 ? 125.530 151.298 93.520  1.00 79.70  ? 166 GLY D N   1 
ATOM 5787  C CA  . GLY D 1 166 ? 126.614 151.717 92.649  1.00 92.16  ? 166 GLY D CA  1 
ATOM 5788  C C   . GLY D 1 166 ? 127.190 153.118 92.633  1.00 91.30  ? 166 GLY D C   1 
ATOM 5789  O O   . GLY D 1 166 ? 128.353 153.306 92.995  1.00 97.71  ? 166 GLY D O   1 
ATOM 5790  N N   . GLU D 1 167 ? 126.405 154.108 92.215  1.00 104.44 ? 167 GLU D N   1 
ATOM 5791  C CA  . GLU D 1 167 ? 126.984 155.330 91.667  1.00 121.81 ? 167 GLU D CA  1 
ATOM 5792  C C   . GLU D 1 167 ? 127.460 156.266 92.773  1.00 118.30 ? 167 GLU D C   1 
ATOM 5793  O O   . GLU D 1 167 ? 126.792 156.425 93.799  1.00 118.15 ? 167 GLU D O   1 
ATOM 5794  C CB  . GLU D 1 167 ? 125.982 156.027 90.737  1.00 30.00  ? 167 GLU D CB  1 
ATOM 5795  C CG  . GLU D 1 167 ? 124.680 156.546 91.354  1.00 30.00  ? 167 GLU D CG  1 
ATOM 5796  C CD  . GLU D 1 167 ? 124.784 157.994 91.819  1.00 30.00  ? 167 GLU D CD  1 
ATOM 5797  O OE1 . GLU D 1 167 ? 125.713 158.699 91.371  1.00 30.00  ? 167 GLU D OE1 1 
ATOM 5798  O OE2 . GLU D 1 167 ? 123.936 158.437 92.619  1.00 30.00  ? 167 GLU D OE2 1 
ATOM 5799  N N   . GLY D 1 168 ? 128.633 156.866 92.562  1.00 30.00  ? 168 GLY D N   1 
ATOM 5800  C CA  . GLY D 1 168 ? 129.228 157.789 93.509  1.00 30.00  ? 168 GLY D CA  1 
ATOM 5801  C C   . GLY D 1 168 ? 129.590 157.127 94.818  1.00 30.00  ? 168 GLY D C   1 
ATOM 5802  O O   . GLY D 1 168 ? 130.519 156.318 94.882  1.00 30.00  ? 168 GLY D O   1 
ATOM 5803  N N   . ASN D 1 169 ? 128.861 157.467 95.872  1.00 30.00  ? 169 ASN D N   1 
ATOM 5804  C CA  . ASN D 1 169 ? 128.934 156.700 97.101  1.00 30.00  ? 169 ASN D CA  1 
ATOM 5805  C C   . ASN D 1 169 ? 127.812 155.670 97.145  1.00 30.00  ? 169 ASN D C   1 
ATOM 5806  O O   . ASN D 1 169 ? 126.701 155.900 96.662  1.00 30.00  ? 169 ASN D O   1 
ATOM 5807  C CB  . ASN D 1 169 ? 128.896 157.619 98.330  1.00 30.00  ? 169 ASN D CB  1 
ATOM 5808  C CG  . ASN D 1 169 ? 127.714 158.591 98.334  1.00 30.00  ? 169 ASN D CG  1 
ATOM 5809  O OD1 . ASN D 1 169 ? 126.876 158.598 97.435  1.00 30.00  ? 169 ASN D OD1 1 
ATOM 5810  N ND2 . ASN D 1 169 ? 127.648 159.416 99.373  1.00 30.00  ? 169 ASN D ND2 1 
ATOM 5811  N N   . GLY D 1 170 ? 128.122 154.509 97.701  1.00 30.00  ? 170 GLY D N   1 
ATOM 5812  C CA  . GLY D 1 170 ? 127.142 153.447 97.749  1.00 30.00  ? 170 GLY D CA  1 
ATOM 5813  C C   . GLY D 1 170 ? 127.678 152.283 98.542  1.00 30.00  ? 170 GLY D C   1 
ATOM 5814  O O   . GLY D 1 170 ? 128.666 152.410 99.267  1.00 30.00  ? 170 GLY D O   1 
ATOM 5815  N N   . VAL D 1 171 ? 127.000 151.141 98.401  1.00 30.00  ? 171 VAL D N   1 
ATOM 5816  C CA  . VAL D 1 171 ? 127.445 149.924 99.072  1.00 30.00  ? 171 VAL D CA  1 
ATOM 5817  C C   . VAL D 1 171 ? 128.798 149.490 98.532  1.00 30.00  ? 171 VAL D C   1 
ATOM 5818  O O   . VAL D 1 171 ? 129.715 149.164 99.295  1.00 30.00  ? 171 VAL D O   1 
ATOM 5819  C CB  . VAL D 1 171 ? 126.386 148.817 98.926  1.00 30.00  ? 171 VAL D CB  1 
ATOM 5820  C CG1 . VAL D 1 171 ? 126.883 147.523 99.504  1.00 30.00  ? 171 VAL D CG1 1 
ATOM 5821  C CG2 . VAL D 1 171 ? 125.124 149.224 99.643  1.00 30.00  ? 171 VAL D CG2 1 
ATOM 5822  N N   . PHE D 1 172 ? 128.961 149.531 97.216  1.00 30.00  ? 172 PHE D N   1 
ATOM 5823  C CA  . PHE D 1 172 ? 130.212 149.177 96.567  1.00 30.00  ? 172 PHE D CA  1 
ATOM 5824  C C   . PHE D 1 172 ? 130.710 150.374 95.775  1.00 30.00  ? 172 PHE D C   1 
ATOM 5825  O O   . PHE D 1 172 ? 129.928 151.242 95.380  1.00 30.00  ? 172 PHE D O   1 
ATOM 5826  C CB  . PHE D 1 172 ? 130.027 147.995 95.619  1.00 30.00  ? 172 PHE D CB  1 
ATOM 5827  C CG  . PHE D 1 172 ? 129.558 146.748 96.292  1.00 30.00  ? 172 PHE D CG  1 
ATOM 5828  C CD1 . PHE D 1 172 ? 129.882 146.475 97.606  1.00 30.00  ? 172 PHE D CD1 1 
ATOM 5829  C CD2 . PHE D 1 172 ? 128.714 145.884 95.627  1.00 30.00  ? 172 PHE D CD2 1 
ATOM 5830  C CE1 . PHE D 1 172 ? 129.411 145.352 98.216  1.00 30.00  ? 172 PHE D CE1 1 
ATOM 5831  C CE2 . PHE D 1 172 ? 128.242 144.764 96.243  1.00 30.00  ? 172 PHE D CE2 1 
ATOM 5832  C CZ  . PHE D 1 172 ? 128.581 144.505 97.531  1.00 30.00  ? 172 PHE D CZ  1 
ATOM 5833  N N   . GLY D 1 173 ? 132.020 150.418 95.549  1.00 90.87  ? 173 GLY D N   1 
ATOM 5834  C CA  . GLY D 1 173 ? 132.570 151.355 94.592  1.00 106.12 ? 173 GLY D CA  1 
ATOM 5835  C C   . GLY D 1 173 ? 132.097 150.980 93.204  1.00 110.53 ? 173 GLY D C   1 
ATOM 5836  O O   . GLY D 1 173 ? 132.417 149.884 92.712  1.00 115.60 ? 173 GLY D O   1 
ATOM 5837  N N   . LYS D 1 174 ? 131.265 151.833 92.596  1.00 97.87  ? 174 LYS D N   1 
ATOM 5838  C CA  . LYS D 1 174 ? 130.638 151.680 91.280  1.00 80.02  ? 174 LYS D CA  1 
ATOM 5839  C C   . LYS D 1 174 ? 129.665 150.501 91.196  1.00 94.77  ? 174 LYS D C   1 
ATOM 5840  O O   . LYS D 1 174 ? 129.138 150.225 90.114  1.00 96.54  ? 174 LYS D O   1 
ATOM 5841  C CB  . LYS D 1 174 ? 131.677 151.572 90.148  1.00 30.00  ? 174 LYS D CB  1 
ATOM 5842  C CG  . LYS D 1 174 ? 132.643 152.742 90.068  1.00 30.00  ? 174 LYS D CG  1 
ATOM 5843  C CD  . LYS D 1 174 ? 131.934 154.045 89.757  1.00 30.00  ? 174 LYS D CD  1 
ATOM 5844  C CE  . LYS D 1 174 ? 131.377 154.052 88.345  1.00 30.00  ? 174 LYS D CE  1 
ATOM 5845  N NZ  . LYS D 1 174 ? 132.463 153.973 87.328  1.00 30.00  ? 174 LYS D NZ  1 
ATOM 5846  N N   . GLY D 1 175 ? 129.401 149.799 92.300  1.00 111.68 ? 175 GLY D N   1 
ATOM 5847  C CA  . GLY D 1 175 ? 128.497 148.665 92.286  1.00 81.48  ? 175 GLY D CA  1 
ATOM 5848  C C   . GLY D 1 175 ? 129.066 147.440 91.594  1.00 95.21  ? 175 GLY D C   1 
ATOM 5849  O O   . GLY D 1 175 ? 130.190 147.424 91.097  1.00 97.91  ? 175 GLY D O   1 
ATOM 5850  N N   . ILE D 1 176 ? 128.246 146.395 91.570  1.00 83.15  ? 176 ILE D N   1 
ATOM 5851  C CA  . ILE D 1 176 ? 128.654 145.116 90.999  1.00 78.96  ? 176 ILE D CA  1 
ATOM 5852  C C   . ILE D 1 176 ? 128.756 145.210 89.481  1.00 94.93  ? 176 ILE D C   1 
ATOM 5853  O O   . ILE D 1 176 ? 127.873 145.777 88.825  1.00 88.90  ? 176 ILE D O   1 
ATOM 5854  C CB  . ILE D 1 176 ? 127.712 143.984 91.443  1.00 30.00  ? 176 ILE D CB  1 
ATOM 5855  C CG1 . ILE D 1 176 ? 126.253 144.377 91.272  1.00 30.00  ? 176 ILE D CG1 1 
ATOM 5856  C CG2 . ILE D 1 176 ? 127.978 143.595 92.871  1.00 30.00  ? 176 ILE D CG2 1 
ATOM 5857  C CD1 . ILE D 1 176 ? 125.290 143.247 91.514  1.00 30.00  ? 176 ILE D CD1 1 
ATOM 5858  N N   . PRO D 1 177 ? 129.841 144.717 88.894  1.00 104.13 ? 177 PRO D N   1 
ATOM 5859  C CA  . PRO D 1 177 ? 129.964 144.684 87.441  1.00 102.32 ? 177 PRO D CA  1 
ATOM 5860  C C   . PRO D 1 177 ? 129.218 143.487 86.884  1.00 111.82 ? 177 PRO D C   1 
ATOM 5861  O O   . PRO D 1 177 ? 128.729 142.655 87.661  1.00 109.13 ? 177 PRO D O   1 
ATOM 5862  C CB  . PRO D 1 177 ? 131.480 144.550 87.233  1.00 30.00  ? 177 PRO D CB  1 
ATOM 5863  C CG  . PRO D 1 177 ? 131.942 143.843 88.430  1.00 30.00  ? 177 PRO D CG  1 
ATOM 5864  C CD  . PRO D 1 177 ? 131.095 144.334 89.559  1.00 30.00  ? 177 PRO D CD  1 
ATOM 5865  N N   . PRO D 1 178 ? 129.074 143.366 85.562  1.00 116.59 ? 178 PRO D N   1 
ATOM 5866  C CA  . PRO D 1 178 ? 128.614 142.096 84.996  1.00 103.53 ? 178 PRO D CA  1 
ATOM 5867  C C   . PRO D 1 178 ? 129.625 140.992 85.246  1.00 98.48  ? 178 PRO D C   1 
ATOM 5868  O O   . PRO D 1 178 ? 130.817 141.244 85.440  1.00 99.69  ? 178 PRO D O   1 
ATOM 5869  C CB  . PRO D 1 178 ? 128.478 142.391 83.501  1.00 30.00  ? 178 PRO D CB  1 
ATOM 5870  C CG  . PRO D 1 178 ? 129.313 143.580 83.265  1.00 30.00  ? 178 PRO D CG  1 
ATOM 5871  C CD  . PRO D 1 178 ? 129.192 144.394 84.512  1.00 30.00  ? 178 PRO D CD  1 
ATOM 5872  N N   . ARG D 1 179 ? 129.107 139.759 85.263  1.00 103.48 ? 179 ARG D N   1 
ATOM 5873  C CA  . ARG D 1 179 ? 129.890 138.525 85.341  1.00 103.58 ? 179 ARG D CA  1 
ATOM 5874  C C   . ARG D 1 179 ? 130.725 138.494 86.628  1.00 107.40 ? 179 ARG D C   1 
ATOM 5875  O O   . ARG D 1 179 ? 131.956 138.471 86.615  1.00 119.87 ? 179 ARG D O   1 
ATOM 5876  C CB  . ARG D 1 179 ? 130.747 138.364 84.074  1.00 30.00  ? 179 ARG D CB  1 
ATOM 5877  C CG  . ARG D 1 179 ? 131.437 137.026 83.841  1.00 30.00  ? 179 ARG D CG  1 
ATOM 5878  C CD  . ARG D 1 179 ? 132.263 137.072 82.563  1.00 30.00  ? 179 ARG D CD  1 
ATOM 5879  N NE  . ARG D 1 179 ? 133.312 138.088 82.616  1.00 30.00  ? 179 ARG D NE  1 
ATOM 5880  C CZ  . ARG D 1 179 ? 133.338 139.178 81.853  1.00 30.00  ? 179 ARG D CZ  1 
ATOM 5881  N NH1 . ARG D 1 179 ? 132.373 139.395 80.971  1.00 30.00  ? 179 ARG D NH1 1 
ATOM 5882  N NH2 . ARG D 1 179 ? 134.329 140.049 81.971  1.00 30.00  ? 179 ARG D NH2 1 
ATOM 5883  N N   . THR D 1 180 ? 130.023 138.568 87.755  1.00 92.25  ? 180 THR D N   1 
ATOM 5884  C CA  . THR D 1 180 ? 130.659 138.394 89.052  1.00 103.08 ? 180 THR D CA  1 
ATOM 5885  C C   . THR D 1 180 ? 129.631 137.869 90.037  1.00 94.35  ? 180 THR D C   1 
ATOM 5886  O O   . THR D 1 180 ? 128.420 138.004 89.838  1.00 104.26 ? 180 THR D O   1 
ATOM 5887  C CB  . THR D 1 180 ? 131.287 139.687 89.594  1.00 30.00  ? 180 THR D CB  1 
ATOM 5888  O OG1 . THR D 1 180 ? 131.999 139.395 90.801  1.00 30.00  ? 180 THR D OG1 1 
ATOM 5889  C CG2 . THR D 1 180 ? 130.229 140.719 89.899  1.00 30.00  ? 180 THR D CG2 1 
ATOM 5890  N N   . LYS D 1 181 ? 130.132 137.251 91.099  1.00 87.17  ? 181 LYS D N   1 
ATOM 5891  C CA  . LYS D 1 181 ? 129.282 136.664 92.119  1.00 109.98 ? 181 LYS D CA  1 
ATOM 5892  C C   . LYS D 1 181 ? 129.088 137.666 93.247  1.00 103.75 ? 181 LYS D C   1 
ATOM 5893  O O   . LYS D 1 181 ? 130.032 138.345 93.661  1.00 108.59 ? 181 LYS D O   1 
ATOM 5894  C CB  . LYS D 1 181 ? 129.865 135.353 92.646  1.00 30.00  ? 181 LYS D CB  1 
ATOM 5895  C CG  . LYS D 1 181 ? 128.925 134.605 93.565  1.00 30.00  ? 181 LYS D CG  1 
ATOM 5896  C CD  . LYS D 1 181 ? 129.513 133.297 94.028  1.00 30.00  ? 181 LYS D CD  1 
ATOM 5897  C CE  . LYS D 1 181 ? 129.554 132.298 92.893  1.00 30.00  ? 181 LYS D CE  1 
ATOM 5898  N NZ  . LYS D 1 181 ? 128.179 131.930 92.460  1.00 30.00  ? 181 LYS D NZ  1 
ATOM 5899  N N   . ILE D 1 182 ? 127.848 137.770 93.706  1.00 87.71  ? 182 ILE D N   1 
ATOM 5900  C CA  . ILE D 1 182 ? 127.392 138.719 94.711  1.00 85.86  ? 182 ILE D CA  1 
ATOM 5901  C C   . ILE D 1 182 ? 126.374 137.996 95.584  1.00 85.66  ? 182 ILE D C   1 
ATOM 5902  O O   . ILE D 1 182 ? 125.242 137.731 95.168  1.00 101.40 ? 182 ILE D O   1 
ATOM 5903  C CB  . ILE D 1 182 ? 126.865 139.997 94.019  1.00 30.00  ? 182 ILE D CB  1 
ATOM 5904  C CG1 . ILE D 1 182 ? 125.989 140.876 94.908  1.00 30.00  ? 182 ILE D CG1 1 
ATOM 5905  C CG2 . ILE D 1 182 ? 126.296 139.714 92.669  1.00 30.00  ? 182 ILE D CG2 1 
ATOM 5906  C CD1 . ILE D 1 182 ? 126.695 141.574 95.914  1.00 30.00  ? 182 ILE D CD1 1 
ATOM 5907  N N   . THR D 1 183 ? 126.798 137.632 96.787  1.00 68.96  ? 183 THR D N   1 
ATOM 5908  C CA  . THR D 1 183 ? 126.154 136.621 97.610  1.00 83.69  ? 183 THR D CA  1 
ATOM 5909  C C   . THR D 1 183 ? 125.845 137.210 98.976  1.00 82.58  ? 183 THR D C   1 
ATOM 5910  O O   . THR D 1 183 ? 126.646 137.966 99.527  1.00 95.81  ? 183 THR D O   1 
ATOM 5911  C CB  . THR D 1 183 ? 127.082 135.402 97.754  1.00 30.00  ? 183 THR D CB  1 
ATOM 5912  O OG1 . THR D 1 183 ? 127.403 134.901 96.453  1.00 30.00  ? 183 THR D OG1 1 
ATOM 5913  C CG2 . THR D 1 183 ? 126.450 134.280 98.567  1.00 30.00  ? 183 THR D CG2 1 
ATOM 5914  N N   . GLY D 1 184 ? 124.691 136.876 99.526  1.00 79.97  ? 184 GLY D N   1 
ATOM 5915  C CA  . GLY D 1 184 ? 124.379 137.367 100.844 1.00 78.59  ? 184 GLY D CA  1 
ATOM 5916  C C   . GLY D 1 184 ? 123.374 136.550 101.609 1.00 88.15  ? 184 GLY D C   1 
ATOM 5917  O O   . GLY D 1 184 ? 123.090 135.401 101.275 1.00 103.22 ? 184 GLY D O   1 
ATOM 5918  N N   . LYS D 1 185 ? 122.827 137.176 102.646 1.00 86.13  ? 185 LYS D N   1 
ATOM 5919  C CA  . LYS D 1 185 ? 121.774 136.583 103.449 1.00 94.37  ? 185 LYS D CA  1 
ATOM 5920  C C   . LYS D 1 185 ? 121.005 137.707 104.124 1.00 83.41  ? 185 LYS D C   1 
ATOM 5921  O O   . LYS D 1 185 ? 121.551 138.781 104.384 1.00 95.27  ? 185 LYS D O   1 
ATOM 5922  C CB  . LYS D 1 185 ? 122.333 135.605 104.485 1.00 30.00  ? 185 LYS D CB  1 
ATOM 5923  C CG  . LYS D 1 185 ? 123.200 136.230 105.554 1.00 30.00  ? 185 LYS D CG  1 
ATOM 5924  C CD  . LYS D 1 185 ? 123.736 135.163 106.478 1.00 30.00  ? 185 LYS D CD  1 
ATOM 5925  C CE  . LYS D 1 185 ? 122.619 134.563 107.303 1.00 30.00  ? 185 LYS D CE  1 
ATOM 5926  N NZ  . LYS D 1 185 ? 123.108 133.535 108.255 1.00 30.00  ? 185 LYS D NZ  1 
ATOM 5927  N N   . VAL D 1 186 ? 119.727 137.461 104.378 1.00 72.23  ? 186 VAL D N   1 
ATOM 5928  C CA  . VAL D 1 186 ? 118.849 138.423 105.028 1.00 76.48  ? 186 VAL D CA  1 
ATOM 5929  C C   . VAL D 1 186 ? 118.371 137.772 106.311 1.00 91.96  ? 186 VAL D C   1 
ATOM 5930  O O   . VAL D 1 186 ? 117.567 136.835 106.269 1.00 98.46  ? 186 VAL D O   1 
ATOM 5931  C CB  . VAL D 1 186 ? 117.660 138.803 104.141 1.00 30.00  ? 186 VAL D CB  1 
ATOM 5932  C CG1 . VAL D 1 186 ? 116.771 139.786 104.865 1.00 30.00  ? 186 VAL D CG1 1 
ATOM 5933  C CG2 . VAL D 1 186 ? 118.134 139.360 102.821 1.00 30.00  ? 186 VAL D CG2 1 
ATOM 5934  N N   . ILE D 1 187 ? 118.848 138.253 107.449 1.00 77.25  ? 187 ILE D N   1 
ATOM 5935  C CA  . ILE D 1 187 ? 118.566 137.630 108.739 1.00 61.12  ? 187 ILE D CA  1 
ATOM 5936  C C   . ILE D 1 187 ? 117.644 138.539 109.544 1.00 80.93  ? 187 ILE D C   1 
ATOM 5937  O O   . ILE D 1 187 ? 117.829 139.761 109.527 1.00 97.89  ? 187 ILE D O   1 
ATOM 5938  C CB  . ILE D 1 187 ? 119.861 137.301 109.513 1.00 30.00  ? 187 ILE D CB  1 
ATOM 5939  C CG1 . ILE D 1 187 ? 119.539 136.581 110.827 1.00 30.00  ? 187 ILE D CG1 1 
ATOM 5940  C CG2 . ILE D 1 187 ? 120.768 138.517 109.696 1.00 30.00  ? 187 ILE D CG2 1 
ATOM 5941  C CD1 . ILE D 1 187 ? 120.728 135.897 111.468 1.00 30.00  ? 187 ILE D CD1 1 
ATOM 5942  N N   . PRO D 1 188 ? 116.608 138.005 110.169 1.00 79.27  ? 188 PRO D N   1 
ATOM 5943  C CA  . PRO D 1 188 ? 115.790 138.804 111.084 1.00 92.71  ? 188 PRO D CA  1 
ATOM 5944  C C   . PRO D 1 188 ? 116.387 138.886 112.474 1.00 106.31 ? 188 PRO D C   1 
ATOM 5945  O O   . PRO D 1 188 ? 117.528 138.475 112.707 1.00 120.75 ? 188 PRO D O   1 
ATOM 5946  C CB  . PRO D 1 188 ? 114.462 138.043 111.124 1.00 30.00  ? 188 PRO D CB  1 
ATOM 5947  C CG  . PRO D 1 188 ? 114.471 137.182 109.935 1.00 30.00  ? 188 PRO D CG  1 
ATOM 5948  C CD  . PRO D 1 188 ? 115.896 136.801 109.728 1.00 30.00  ? 188 PRO D CD  1 
ATOM 5949  N N   . GLU D 1 189 ? 115.607 139.453 113.395 1.00 104.74 ? 189 GLU D N   1 
ATOM 5950  C CA  . GLU D 1 189 ? 115.911 139.368 114.818 1.00 101.76 ? 189 GLU D CA  1 
ATOM 5951  C C   . GLU D 1 189 ? 115.999 137.921 115.278 1.00 111.14 ? 189 GLU D C   1 
ATOM 5952  O O   . GLU D 1 189 ? 117.063 137.444 115.686 1.00 104.62 ? 189 GLU D O   1 
ATOM 5953  C CB  . GLU D 1 189 ? 114.838 140.105 115.612 1.00 30.00  ? 189 GLU D CB  1 
ATOM 5954  C CG  . GLU D 1 189 ? 114.976 139.969 117.109 1.00 30.00  ? 189 GLU D CG  1 
ATOM 5955  C CD  . GLU D 1 189 ? 113.874 140.686 117.846 1.00 30.00  ? 189 GLU D CD  1 
ATOM 5956  O OE1 . GLU D 1 189 ? 113.041 141.332 117.179 1.00 30.00  ? 189 GLU D OE1 1 
ATOM 5957  O OE2 . GLU D 1 189 ? 113.827 140.585 119.087 1.00 30.00  ? 189 GLU D OE2 1 
ATOM 5958  N N   . PHE D 1 190 ? 114.883 137.201 115.203 1.00 129.13 ? 190 PHE D N   1 
ATOM 5959  C CA  . PHE D 1 190 ? 114.824 135.835 115.686 1.00 141.21 ? 190 PHE D CA  1 
ATOM 5960  C C   . PHE D 1 190 ? 114.342 134.856 114.629 1.00 124.26 ? 190 PHE D C   1 
ATOM 5961  O O   . PHE D 1 190 ? 114.285 133.652 114.903 1.00 113.63 ? 190 PHE D O   1 
ATOM 5962  C CB  . PHE D 1 190 ? 113.926 135.743 116.938 1.00 30.00  ? 190 PHE D CB  1 
ATOM 5963  C CG  . PHE D 1 190 ? 112.473 136.074 116.696 1.00 30.00  ? 190 PHE D CG  1 
ATOM 5964  C CD1 . PHE D 1 190 ? 112.024 137.383 116.768 1.00 30.00  ? 190 PHE D CD1 1 
ATOM 5965  C CD2 . PHE D 1 190 ? 111.546 135.067 116.456 1.00 30.00  ? 190 PHE D CD2 1 
ATOM 5966  C CE1 . PHE D 1 190 ? 110.689 137.684 116.564 1.00 30.00  ? 190 PHE D CE1 1 
ATOM 5967  C CE2 . PHE D 1 190 ? 110.215 135.365 116.249 1.00 30.00  ? 190 PHE D CE2 1 
ATOM 5968  C CZ  . PHE D 1 190 ? 109.785 136.674 116.306 1.00 30.00  ? 190 PHE D CZ  1 
ATOM 5969  N N   . GLY D 1 191 ? 114.010 135.329 113.434 1.00 111.32 ? 191 GLY D N   1 
ATOM 5970  C CA  . GLY D 1 191 ? 113.468 134.481 112.399 1.00 115.22 ? 191 GLY D CA  1 
ATOM 5971  C C   . GLY D 1 191 ? 114.508 133.586 111.758 1.00 110.01 ? 191 GLY D C   1 
ATOM 5972  O O   . GLY D 1 191 ? 115.656 133.481 112.191 1.00 109.59 ? 191 GLY D O   1 
ATOM 5973  N N   . ALA D 1 192 ? 114.086 132.932 110.719 1.00 108.77 ? 192 ALA D N   1 
ATOM 5974  C CA  . ALA D 1 192 ? 115.033 132.146 109.948 1.00 106.70 ? 192 ALA D CA  1 
ATOM 5975  C C   . ALA D 1 192 ? 115.666 133.025 108.883 1.00 76.53  ? 192 ALA D C   1 
ATOM 5976  O O   . ALA D 1 192 ? 114.957 133.788 108.222 1.00 78.88  ? 192 ALA D O   1 
ATOM 5977  C CB  . ALA D 1 192 ? 114.351 130.954 109.299 1.00 30.00  ? 192 ALA D CB  1 
ATOM 5978  N N   . PRO D 1 193 ? 116.983 132.959 108.704 1.00 77.98  ? 193 PRO D N   1 
ATOM 5979  C CA  . PRO D 1 193 ? 117.646 133.839 107.738 1.00 87.61  ? 193 PRO D CA  1 
ATOM 5980  C C   . PRO D 1 193 ? 117.346 133.443 106.299 1.00 84.24  ? 193 PRO D C   1 
ATOM 5981  O O   . PRO D 1 193 ? 117.574 132.303 105.892 1.00 100.83 ? 193 PRO D O   1 
ATOM 5982  C CB  . PRO D 1 193 ? 119.131 133.665 108.068 1.00 30.00  ? 193 PRO D CB  1 
ATOM 5983  C CG  . PRO D 1 193 ? 119.221 132.352 108.727 1.00 30.00  ? 193 PRO D CG  1 
ATOM 5984  C CD  . PRO D 1 193 ? 117.951 132.187 109.495 1.00 30.00  ? 193 PRO D CD  1 
ATOM 5985  N N   . GLY D 1 194 ? 116.830 134.401 105.532 1.00 86.21  ? 194 GLY D N   1 
ATOM 5986  C CA  . GLY D 1 194 ? 116.617 134.207 104.110 1.00 97.13  ? 194 GLY D CA  1 
ATOM 5987  C C   . GLY D 1 194 ? 117.876 134.543 103.332 1.00 91.83  ? 194 GLY D C   1 
ATOM 5988  O O   . GLY D 1 194 ? 118.624 135.442 103.699 1.00 103.47 ? 194 GLY D O   1 
ATOM 5989  N N   . VAL D 1 195 ? 118.098 133.814 102.251 1.00 73.79  ? 195 VAL D N   1 
ATOM 5990  C CA  . VAL D 1 195 ? 119.400 133.826 101.610 1.00 78.62  ? 195 VAL D CA  1 
ATOM 5991  C C   . VAL D 1 195 ? 119.279 134.444 100.220 1.00 87.46  ? 195 VAL D C   1 
ATOM 5992  O O   . VAL D 1 195 ? 118.195 134.524 99.637  1.00 109.43 ? 195 VAL D O   1 
ATOM 5993  C CB  . VAL D 1 195 ? 119.977 132.397 101.564 1.00 30.00  ? 195 VAL D CB  1 
ATOM 5994  C CG1 . VAL D 1 195 ? 119.348 131.592 100.443 1.00 30.00  ? 195 VAL D CG1 1 
ATOM 5995  C CG2 . VAL D 1 195 ? 121.498 132.396 101.542 1.00 30.00  ? 195 VAL D CG2 1 
ATOM 5996  N N   . ILE D 1 196 ? 120.406 134.921 99.695  1.00 80.94  ? 196 ILE D N   1 
ATOM 5997  C CA  . ILE D 1 196 ? 120.455 135.571 98.391  1.00 81.29  ? 196 ILE D CA  1 
ATOM 5998  C C   . ILE D 1 196 ? 121.825 135.378 97.750  1.00 89.24  ? 196 ILE D C   1 
ATOM 5999  O O   . ILE D 1 196 ? 122.861 135.652 98.365  1.00 98.54  ? 196 ILE D O   1 
ATOM 6000  C CB  . ILE D 1 196 ? 120.073 137.061 98.518  1.00 30.00  ? 196 ILE D CB  1 
ATOM 6001  C CG1 . ILE D 1 196 ? 120.230 137.796 97.192  1.00 30.00  ? 196 ILE D CG1 1 
ATOM 6002  C CG2 . ILE D 1 196 ? 120.788 137.761 99.660  1.00 30.00  ? 196 ILE D CG2 1 
ATOM 6003  C CD1 . ILE D 1 196 ? 119.678 139.185 97.247  1.00 30.00  ? 196 ILE D CD1 1 
ATOM 6004  N N   . GLU D 1 197 ? 121.846 134.881 96.514  1.00 100.52 ? 197 GLU D N   1 
ATOM 6005  C CA  . GLU D 1 197 ? 123.098 134.614 95.807  1.00 92.70  ? 197 GLU D CA  1 
ATOM 6006  C C   . GLU D 1 197 ? 122.880 134.831 94.319  1.00 91.79  ? 197 GLU D C   1 
ATOM 6007  O O   . GLU D 1 197 ? 122.378 133.938 93.631  1.00 115.82 ? 197 GLU D O   1 
ATOM 6008  C CB  . GLU D 1 197 ? 123.593 133.194 96.063  1.00 30.00  ? 197 GLU D CB  1 
ATOM 6009  C CG  . GLU D 1 197 ? 124.924 132.901 95.396  1.00 30.00  ? 197 GLU D CG  1 
ATOM 6010  C CD  . GLU D 1 197 ? 125.397 131.485 95.618  1.00 30.00  ? 197 GLU D CD  1 
ATOM 6011  O OE1 . GLU D 1 197 ? 124.662 130.709 96.258  1.00 30.00  ? 197 GLU D OE1 1 
ATOM 6012  O OE2 . GLU D 1 197 ? 126.507 131.148 95.154  1.00 30.00  ? 197 GLU D OE2 1 
ATOM 6013  N N   . PHE D 1 198 ? 123.287 135.987 93.811  1.00 80.89  ? 198 PHE D N   1 
ATOM 6014  C CA  . PHE D 1 198 ? 123.122 136.297 92.401  1.00 87.10  ? 198 PHE D CA  1 
ATOM 6015  C C   . PHE D 1 198 ? 124.136 135.543 91.562  1.00 99.66  ? 198 PHE D C   1 
ATOM 6016  O O   . PHE D 1 198 ? 125.004 134.839 92.082  1.00 107.35 ? 198 PHE D O   1 
ATOM 6017  C CB  . PHE D 1 198 ? 123.325 137.774 92.104  1.00 30.00  ? 198 PHE D CB  1 
ATOM 6018  C CG  . PHE D 1 198 ? 122.432 138.689 92.846  1.00 30.00  ? 198 PHE D CG  1 
ATOM 6019  C CD1 . PHE D 1 198 ? 121.120 138.834 92.487  1.00 30.00  ? 198 PHE D CD1 1 
ATOM 6020  C CD2 . PHE D 1 198 ? 122.935 139.473 93.858  1.00 30.00  ? 198 PHE D CD2 1 
ATOM 6021  C CE1 . PHE D 1 198 ? 120.314 139.704 93.151  1.00 30.00  ? 198 PHE D CE1 1 
ATOM 6022  C CE2 . PHE D 1 198 ? 122.140 140.353 94.532  1.00 30.00  ? 198 PHE D CE2 1 
ATOM 6023  C CZ  . PHE D 1 198 ? 120.829 140.471 94.171  1.00 30.00  ? 198 PHE D CZ  1 
ATOM 6024  N N   . THR D 1 199 ? 124.021 135.710 90.248  1.00 95.30  ? 199 THR D N   1 
ATOM 6025  C CA  . THR D 1 199 ? 125.125 135.409 89.353  1.00 87.27  ? 199 THR D CA  1 
ATOM 6026  C C   . THR D 1 199 ? 125.505 136.621 88.514  1.00 91.37  ? 199 THR D C   1 
ATOM 6027  O O   . THR D 1 199 ? 126.623 136.666 87.989  1.00 118.25 ? 199 THR D O   1 
ATOM 6028  C CB  . THR D 1 199 ? 124.773 134.240 88.434  1.00 30.00  ? 199 THR D CB  1 
ATOM 6029  O OG1 . THR D 1 199 ? 123.633 134.584 87.639  1.00 30.00  ? 199 THR D OG1 1 
ATOM 6030  C CG2 . THR D 1 199 ? 124.466 132.993 89.243  1.00 30.00  ? 199 THR D CG2 1 
ATOM 6031  N N   . THR D 1 200 ? 124.598 137.615 88.410  1.00 66.50  ? 200 THR D N   1 
ATOM 6032  C CA  . THR D 1 200 ? 124.694 138.825 87.593  1.00 93.24  ? 200 THR D CA  1 
ATOM 6033  C C   . THR D 1 200 ? 124.985 138.446 86.148  1.00 108.13 ? 200 THR D C   1 
ATOM 6034  O O   . THR D 1 200 ? 126.155 138.425 85.745  1.00 112.01 ? 200 THR D O   1 
ATOM 6035  C CB  . THR D 1 200 ? 125.752 139.789 88.127  1.00 30.00  ? 200 THR D CB  1 
ATOM 6036  O OG1 . THR D 1 200 ? 125.528 139.996 89.519  1.00 30.00  ? 200 THR D OG1 1 
ATOM 6037  C CG2 . THR D 1 200 ? 125.617 141.141 87.446  1.00 30.00  ? 200 THR D CG2 1 
ATOM 6038  N N   . PRO D 1 201 ? 123.966 138.035 85.390  1.00 98.08  ? 201 PRO D N   1 
ATOM 6039  C CA  . PRO D 1 201 ? 124.191 137.472 84.051  1.00 101.37 ? 201 PRO D CA  1 
ATOM 6040  C C   . PRO D 1 201 ? 124.846 138.464 83.104  1.00 96.67  ? 201 PRO D C   1 
ATOM 6041  O O   . PRO D 1 201 ? 124.477 139.634 83.049  1.00 97.22  ? 201 PRO D O   1 
ATOM 6042  C CB  . PRO D 1 201 ? 122.780 137.106 83.586  1.00 30.00  ? 201 PRO D CB  1 
ATOM 6043  C CG  . PRO D 1 201 ? 121.897 138.027 84.339  1.00 30.00  ? 201 PRO D CG  1 
ATOM 6044  C CD  . PRO D 1 201 ? 122.536 138.215 85.678  1.00 30.00  ? 201 PRO D CD  1 
ATOM 6045  N N   . SER D 1 202 ? 125.825 137.970 82.353  1.00 84.53  ? 202 SER D N   1 
ATOM 6046  C CA  . SER D 1 202 ? 126.879 138.824 81.828  1.00 96.04  ? 202 SER D CA  1 
ATOM 6047  C C   . SER D 1 202 ? 126.432 139.618 80.610  1.00 107.48 ? 202 SER D C   1 
ATOM 6048  O O   . SER D 1 202 ? 125.665 139.128 79.776  1.00 120.32 ? 202 SER D O   1 
ATOM 6049  C CB  . SER D 1 202 ? 128.097 137.984 81.465  1.00 30.00  ? 202 SER D CB  1 
ATOM 6050  O OG  . SER D 1 202 ? 127.797 137.117 80.390  1.00 30.00  ? 202 SER D OG  1 
ATOM 6051  N N   . THR D 1 203 ? 126.928 140.858 80.536  1.00 102.41 ? 203 THR D N   1 
ATOM 6052  C CA  . THR D 1 203 ? 126.908 141.737 79.363  1.00 89.41  ? 203 THR D CA  1 
ATOM 6053  C C   . THR D 1 203 ? 125.469 142.021 78.917  1.00 95.49  ? 203 THR D C   1 
ATOM 6054  O O   . THR D 1 203 ? 125.004 141.596 77.861  1.00 116.57 ? 203 THR D O   1 
ATOM 6055  C CB  . THR D 1 203 ? 127.753 141.129 78.239  1.00 30.00  ? 203 THR D CB  1 
ATOM 6056  O OG1 . THR D 1 203 ? 128.966 140.622 78.801  1.00 30.00  ? 203 THR D OG1 1 
ATOM 6057  C CG2 . THR D 1 203 ? 128.157 142.196 77.266  1.00 30.00  ? 203 THR D CG2 1 
ATOM 6058  N N   . TYR D 1 204 ? 124.768 142.740 79.784  1.00 87.34  ? 204 TYR D N   1 
ATOM 6059  C CA  . TYR D 1 204 ? 123.315 142.778 79.805  1.00 85.33  ? 204 TYR D CA  1 
ATOM 6060  C C   . TYR D 1 204 ? 122.747 144.104 79.315  1.00 90.64  ? 204 TYR D C   1 
ATOM 6061  O O   . TYR D 1 204 ? 123.468 145.056 79.012  1.00 110.75 ? 204 TYR D O   1 
ATOM 6062  C CB  . TYR D 1 204 ? 122.814 142.484 81.221  1.00 30.00  ? 204 TYR D CB  1 
ATOM 6063  C CG  . TYR D 1 204 ? 123.496 143.290 82.315  1.00 30.00  ? 204 TYR D CG  1 
ATOM 6064  C CD1 . TYR D 1 204 ? 123.084 144.571 82.637  1.00 30.00  ? 204 TYR D CD1 1 
ATOM 6065  C CD2 . TYR D 1 204 ? 124.562 142.758 83.026  1.00 30.00  ? 204 TYR D CD2 1 
ATOM 6066  C CE1 . TYR D 1 204 ? 123.714 145.287 83.634  1.00 30.00  ? 204 TYR D CE1 1 
ATOM 6067  C CE2 . TYR D 1 204 ? 125.182 143.463 84.029  1.00 30.00  ? 204 TYR D CE2 1 
ATOM 6068  C CZ  . TYR D 1 204 ? 124.761 144.726 84.325  1.00 30.00  ? 204 TYR D CZ  1 
ATOM 6069  O OH  . TYR D 1 204 ? 125.396 145.425 85.319  1.00 30.00  ? 204 TYR D OH  1 
ATOM 6070  N N   . THR D 1 205 ? 121.417 144.133 79.241  1.00 82.57  ? 205 THR D N   1 
ATOM 6071  C CA  . THR D 1 205 ? 120.603 145.320 79.026  1.00 83.12  ? 205 THR D CA  1 
ATOM 6072  C C   . THR D 1 205 ? 119.985 145.732 80.358  1.00 89.17  ? 205 THR D C   1 
ATOM 6073  O O   . THR D 1 205 ? 120.199 145.085 81.383  1.00 113.02 ? 205 THR D O   1 
ATOM 6074  C CB  . THR D 1 205 ? 119.522 145.055 77.981  1.00 30.00  ? 205 THR D CB  1 
ATOM 6075  O OG1 . THR D 1 205 ? 118.633 144.043 78.466  1.00 30.00  ? 205 THR D OG1 1 
ATOM 6076  C CG2 . THR D 1 205 ? 120.154 144.579 76.686  1.00 30.00  ? 205 THR D CG2 1 
ATOM 6077  N N   . SER D 1 206 ? 119.197 146.804 80.340  1.00 77.54  ? 206 SER D N   1 
ATOM 6078  C CA  . SER D 1 206 ? 118.720 147.373 81.593  1.00 75.49  ? 206 SER D CA  1 
ATOM 6079  C C   . SER D 1 206 ? 117.616 146.518 82.203  1.00 85.95  ? 206 SER D C   1 
ATOM 6080  O O   . SER D 1 206 ? 116.957 145.736 81.514  1.00 96.77  ? 206 SER D O   1 
ATOM 6081  C CB  . SER D 1 206 ? 118.236 148.803 81.387  1.00 30.00  ? 206 SER D CB  1 
ATOM 6082  O OG  . SER D 1 206 ? 119.297 149.639 80.967  1.00 30.00  ? 206 SER D OG  1 
ATOM 6083  N N   . GLU D 1 207 ? 117.441 146.676 83.524  1.00 92.70  ? 207 GLU D N   1 
ATOM 6084  C CA  . GLU D 1 207 ? 116.536 145.879 84.363  1.00 84.94  ? 207 GLU D CA  1 
ATOM 6085  C C   . GLU D 1 207 ? 116.910 144.393 84.281  1.00 75.08  ? 207 GLU D C   1 
ATOM 6086  O O   . GLU D 1 207 ? 116.306 143.589 83.577  1.00 99.39  ? 207 GLU D O   1 
ATOM 6087  C CB  . GLU D 1 207 ? 115.067 146.159 84.026  1.00 30.00  ? 207 GLU D CB  1 
ATOM 6088  C CG  . GLU D 1 207 ? 114.096 145.722 85.092  1.00 30.00  ? 207 GLU D CG  1 
ATOM 6089  C CD  . GLU D 1 207 ? 113.611 144.313 84.904  1.00 30.00  ? 207 GLU D CD  1 
ATOM 6090  O OE1 . GLU D 1 207 ? 113.525 143.867 83.744  1.00 30.00  ? 207 GLU D OE1 1 
ATOM 6091  O OE2 . GLU D 1 207 ? 113.307 143.656 85.916  1.00 30.00  ? 207 GLU D OE2 1 
ATOM 6092  N N   . VAL D 1 208 ? 117.996 144.079 84.983  1.00 54.53  ? 208 VAL D N   1 
ATOM 6093  C CA  . VAL D 1 208 ? 118.878 142.938 84.742  1.00 74.84  ? 208 VAL D CA  1 
ATOM 6094  C C   . VAL D 1 208 ? 118.275 141.602 85.204  1.00 90.59  ? 208 VAL D C   1 
ATOM 6095  O O   . VAL D 1 208 ? 118.864 140.544 84.959  1.00 111.15 ? 208 VAL D O   1 
ATOM 6096  C CB  . VAL D 1 208 ? 120.221 143.237 85.449  1.00 30.00  ? 208 VAL D CB  1 
ATOM 6097  C CG1 . VAL D 1 208 ? 121.387 142.376 84.962  1.00 30.00  ? 208 VAL D CG1 1 
ATOM 6098  C CG2 . VAL D 1 208 ? 120.561 144.701 85.327  1.00 30.00  ? 208 VAL D CG2 1 
ATOM 6099  N N   . ILE D 1 209 ? 117.019 141.621 85.681  1.00 82.05  ? 209 ILE D N   1 
ATOM 6100  C CA  . ILE D 1 209 ? 116.452 140.775 86.744  1.00 100.57 ? 209 ILE D CA  1 
ATOM 6101  C C   . ILE D 1 209 ? 116.938 139.328 86.805  1.00 110.18 ? 209 ILE D C   1 
ATOM 6102  O O   . ILE D 1 209 ? 116.909 138.592 85.813  1.00 121.76 ? 209 ILE D O   1 
ATOM 6103  C CB  . ILE D 1 209 ? 114.911 140.795 86.632  1.00 30.00  ? 209 ILE D CB  1 
ATOM 6104  C CG1 . ILE D 1 209 ? 114.267 139.838 87.638  1.00 30.00  ? 209 ILE D CG1 1 
ATOM 6105  C CG2 . ILE D 1 209 ? 114.434 140.550 85.198  1.00 30.00  ? 209 ILE D CG2 1 
ATOM 6106  C CD1 . ILE D 1 209 ? 112.763 139.906 87.674  1.00 30.00  ? 209 ILE D CD1 1 
ATOM 6107  N N   . GLU D 1 210 ? 117.418 138.931 87.982  1.00 30.00  ? 210 GLU D N   1 
ATOM 6108  C CA  . GLU D 1 210 ? 117.954 137.600 88.210  1.00 30.00  ? 210 GLU D CA  1 
ATOM 6109  C C   . GLU D 1 210 ? 117.493 137.129 89.580  1.00 30.00  ? 210 GLU D C   1 
ATOM 6110  O O   . GLU D 1 210 ? 117.435 137.902 90.539  1.00 30.00  ? 210 GLU D O   1 
ATOM 6111  C CB  . GLU D 1 210 ? 119.485 137.592 88.072  1.00 30.00  ? 210 GLU D CB  1 
ATOM 6112  C CG  . GLU D 1 210 ? 120.257 138.337 89.141  1.00 30.00  ? 210 GLU D CG  1 
ATOM 6113  C CD  . GLU D 1 210 ? 120.343 139.840 88.926  1.00 30.00  ? 210 GLU D CD  1 
ATOM 6114  O OE1 . GLU D 1 210 ? 119.622 140.385 88.068  1.00 30.00  ? 210 GLU D OE1 1 
ATOM 6115  O OE2 . GLU D 1 210 ? 121.129 140.491 89.643  1.00 30.00  ? 210 GLU D OE2 1 
ATOM 6116  N N   . LEU D 1 211 ? 117.121 135.862 89.654  1.00 30.00  ? 211 LEU D N   1 
ATOM 6117  C CA  . LEU D 1 211 ? 116.378 135.359 90.797  1.00 30.00  ? 211 LEU D CA  1 
ATOM 6118  C C   . LEU D 1 211 ? 117.305 135.070 91.969  1.00 30.00  ? 211 LEU D C   1 
ATOM 6119  O O   . LEU D 1 211 ? 118.417 134.567 91.797  1.00 30.00  ? 211 LEU D O   1 
ATOM 6120  C CB  . LEU D 1 211 ? 115.599 134.097 90.418  1.00 30.00  ? 211 LEU D CB  1 
ATOM 6121  C CG  . LEU D 1 211 ? 114.484 134.274 89.384  1.00 30.00  ? 211 LEU D CG  1 
ATOM 6122  C CD1 . LEU D 1 211 ? 113.897 132.927 88.993  1.00 30.00  ? 211 LEU D CD1 1 
ATOM 6123  C CD2 . LEU D 1 211 ? 113.402 135.203 89.914  1.00 30.00  ? 211 LEU D CD2 1 
ATOM 6124  N N   . GLN D 1 212 ? 116.820 135.416 93.162  1.00 30.00  ? 212 GLN D N   1 
ATOM 6125  C CA  . GLN D 1 212 ? 117.384 135.051 94.467  1.00 30.00  ? 212 GLN D CA  1 
ATOM 6126  C C   . GLN D 1 212 ? 118.837 135.469 94.668  1.00 30.00  ? 212 GLN D C   1 
ATOM 6127  O O   . GLN D 1 212 ? 119.758 134.733 94.334  1.00 30.00  ? 212 GLN D O   1 
ATOM 6128  C CB  . GLN D 1 212 ? 117.232 133.543 94.699  1.00 30.00  ? 212 GLN D CB  1 
ATOM 6129  C CG  . GLN D 1 212 ? 117.622 133.090 96.097  1.00 30.00  ? 212 GLN D CG  1 
ATOM 6130  C CD  . GLN D 1 212 ? 117.265 131.649 96.364  1.00 30.00  ? 212 GLN D CD  1 
ATOM 6131  O OE1 . GLN D 1 212 ? 116.696 130.973 95.515  1.00 30.00  ? 212 GLN D OE1 1 
ATOM 6132  N NE2 . GLN D 1 212 ? 117.592 131.172 97.556  1.00 30.00  ? 212 GLN D NE2 1 
ATOM 6133  N N   . ALA E 1 6   ? 106.806 113.822 220.073 1.00 30.00  ? 6   ALA E N   1 
ATOM 6134  C CA  . ALA E 1 6   ? 107.475 112.637 219.552 1.00 30.00  ? 6   ALA E CA  1 
ATOM 6135  C C   . ALA E 1 6   ? 108.206 112.948 218.248 1.00 30.00  ? 6   ALA E C   1 
ATOM 6136  O O   . ALA E 1 6   ? 108.685 114.063 218.045 1.00 30.00  ? 6   ALA E O   1 
ATOM 6137  C CB  . ALA E 1 6   ? 106.472 111.509 219.346 1.00 30.00  ? 6   ALA E CB  1 
ATOM 6138  N N   . VAL E 1 7   ? 108.287 111.951 217.368 1.00 176.07 ? 7   VAL E N   1 
ATOM 6139  C CA  . VAL E 1 7   ? 108.985 112.089 216.095 1.00 158.44 ? 7   VAL E CA  1 
ATOM 6140  C C   . VAL E 1 7   ? 107.936 112.144 214.989 1.00 137.52 ? 7   VAL E C   1 
ATOM 6141  O O   . VAL E 1 7   ? 108.140 112.774 213.943 1.00 139.74 ? 7   VAL E O   1 
ATOM 6142  C CB  . VAL E 1 7   ? 109.985 110.927 215.901 1.00 30.00  ? 7   VAL E CB  1 
ATOM 6143  C CG1 . VAL E 1 7   ? 110.777 111.056 214.599 1.00 30.00  ? 7   VAL E CG1 1 
ATOM 6144  C CG2 . VAL E 1 7   ? 110.928 110.839 217.093 1.00 30.00  ? 7   VAL E CG2 1 
ATOM 6145  N N   . GLY E 1 8   ? 106.771 111.543 215.246 1.00 131.64 ? 8   GLY E N   1 
ATOM 6146  C CA  . GLY E 1 8   ? 105.708 111.441 214.261 1.00 139.85 ? 8   GLY E CA  1 
ATOM 6147  C C   . GLY E 1 8   ? 105.010 112.736 213.901 1.00 132.89 ? 8   GLY E C   1 
ATOM 6148  O O   . GLY E 1 8   ? 104.245 112.757 212.932 1.00 133.27 ? 8   GLY E O   1 
ATOM 6149  N N   . ILE E 1 9   ? 105.246 113.812 214.654 1.00 131.26 ? 9   ILE E N   1 
ATOM 6150  C CA  . ILE E 1 9   ? 104.677 115.108 214.301 1.00 135.93 ? 9   ILE E CA  1 
ATOM 6151  C C   . ILE E 1 9   ? 105.398 115.693 213.091 1.00 126.64 ? 9   ILE E C   1 
ATOM 6152  O O   . ILE E 1 9   ? 104.762 116.187 212.153 1.00 121.41 ? 9   ILE E O   1 
ATOM 6153  C CB  . ILE E 1 9   ? 104.713 116.067 215.513 1.00 30.00  ? 9   ILE E CB  1 
ATOM 6154  C CG1 . ILE E 1 9   ? 103.787 115.591 216.644 1.00 30.00  ? 9   ILE E CG1 1 
ATOM 6155  C CG2 . ILE E 1 9   ? 104.335 117.489 215.111 1.00 30.00  ? 9   ILE E CG2 1 
ATOM 6156  C CD1 . ILE E 1 9   ? 104.453 114.753 217.730 1.00 30.00  ? 9   ILE E CD1 1 
ATOM 6157  N N   . GLY E 1 10  ? 106.732 115.609 213.076 1.00 116.23 ? 10  GLY E N   1 
ATOM 6158  C CA  . GLY E 1 10  ? 107.496 116.137 211.957 1.00 108.48 ? 10  GLY E CA  1 
ATOM 6159  C C   . GLY E 1 10  ? 107.360 115.323 210.686 1.00 119.42 ? 10  GLY E C   1 
ATOM 6160  O O   . GLY E 1 10  ? 107.620 115.831 209.591 1.00 124.33 ? 10  GLY E O   1 
ATOM 6161  N N   . THR E 1 11  ? 106.962 114.053 210.807 1.00 133.79 ? 11  THR E N   1 
ATOM 6162  C CA  . THR E 1 11  ? 106.710 113.241 209.620 1.00 134.97 ? 11  THR E CA  1 
ATOM 6163  C C   . THR E 1 11  ? 105.438 113.677 208.904 1.00 126.74 ? 11  THR E C   1 
ATOM 6164  O O   . THR E 1 11  ? 105.317 113.489 207.688 1.00 132.88 ? 11  THR E O   1 
ATOM 6165  C CB  . THR E 1 11  ? 106.622 111.763 209.997 1.00 30.00  ? 11  THR E CB  1 
ATOM 6166  O OG1 . THR E 1 11  ? 105.533 111.564 210.907 1.00 30.00  ? 11  THR E OG1 1 
ATOM 6167  C CG2 . THR E 1 11  ? 107.915 111.303 210.654 1.00 30.00  ? 11  THR E CG2 1 
ATOM 6168  N N   . LEU E 1 12  ? 104.483 114.254 209.636 1.00 118.09 ? 12  LEU E N   1 
ATOM 6169  C CA  . LEU E 1 12  ? 103.277 114.777 209.003 1.00 128.80 ? 12  LEU E CA  1 
ATOM 6170  C C   . LEU E 1 12  ? 103.537 116.141 208.377 1.00 127.81 ? 12  LEU E C   1 
ATOM 6171  O O   . LEU E 1 12  ? 102.800 116.578 207.486 1.00 112.49 ? 12  LEU E O   1 
ATOM 6172  C CB  . LEU E 1 12  ? 102.141 114.858 210.024 1.00 30.00  ? 12  LEU E CB  1 
ATOM 6173  C CG  . LEU E 1 12  ? 101.639 113.530 210.595 1.00 30.00  ? 12  LEU E CG  1 
ATOM 6174  C CD1 . LEU E 1 12  ? 100.598 113.769 211.677 1.00 30.00  ? 12  LEU E CD1 1 
ATOM 6175  C CD2 . LEU E 1 12  ? 101.077 112.647 209.491 1.00 30.00  ? 12  LEU E CD2 1 
ATOM 6176  N N   . ILE E 1 13  ? 104.584 116.832 208.836 1.00 134.37 ? 13  ILE E N   1 
ATOM 6177  C CA  . ILE E 1 13  ? 104.921 118.141 208.284 1.00 120.65 ? 13  ILE E CA  1 
ATOM 6178  C C   . ILE E 1 13  ? 105.519 117.994 206.888 1.00 125.25 ? 13  ILE E C   1 
ATOM 6179  O O   . ILE E 1 13  ? 105.202 118.770 205.977 1.00 127.06 ? 13  ILE E O   1 
ATOM 6180  C CB  . ILE E 1 13  ? 105.867 118.887 209.246 1.00 30.00  ? 13  ILE E CB  1 
ATOM 6181  C CG1 . ILE E 1 13  ? 105.177 119.115 210.593 1.00 30.00  ? 13  ILE E CG1 1 
ATOM 6182  C CG2 . ILE E 1 13  ? 106.313 120.224 208.668 1.00 30.00  ? 13  ILE E CG2 1 
ATOM 6183  C CD1 . ILE E 1 13  ? 106.097 119.646 211.671 1.00 30.00  ? 13  ILE E CD1 1 
ATOM 6184  N N   . VAL E 1 14  ? 106.372 116.983 206.694 1.00 120.61 ? 14  VAL E N   1 
ATOM 6185  C CA  . VAL E 1 14  ? 106.965 116.717 205.384 1.00 119.27 ? 14  VAL E CA  1 
ATOM 6186  C C   . VAL E 1 14  ? 105.900 116.244 204.398 1.00 125.86 ? 14  VAL E C   1 
ATOM 6187  O O   . VAL E 1 14  ? 105.961 116.564 203.202 1.00 127.57 ? 14  VAL E O   1 
ATOM 6188  C CB  . VAL E 1 14  ? 108.113 115.697 205.541 1.00 30.00  ? 14  VAL E CB  1 
ATOM 6189  C CG1 . VAL E 1 14  ? 108.784 115.382 204.205 1.00 30.00  ? 14  VAL E CG1 1 
ATOM 6190  C CG2 . VAL E 1 14  ? 109.136 116.205 206.546 1.00 30.00  ? 14  VAL E CG2 1 
ATOM 6191  N N   . PHE E 1 15  ? 104.893 115.513 204.888 1.00 120.93 ? 15  PHE E N   1 
ATOM 6192  C CA  . PHE E 1 15  ? 103.797 115.067 204.032 1.00 130.25 ? 15  PHE E CA  1 
ATOM 6193  C C   . PHE E 1 15  ? 102.957 116.237 203.535 1.00 137.12 ? 15  PHE E C   1 
ATOM 6194  O O   . PHE E 1 15  ? 102.544 116.259 202.371 1.00 136.10 ? 15  PHE E O   1 
ATOM 6195  C CB  . PHE E 1 15  ? 102.917 114.063 204.777 1.00 30.00  ? 15  PHE E CB  1 
ATOM 6196  C CG  . PHE E 1 15  ? 101.721 113.611 203.990 1.00 30.00  ? 15  PHE E CG  1 
ATOM 6197  C CD1 . PHE E 1 15  ? 101.868 112.736 202.926 1.00 30.00  ? 15  PHE E CD1 1 
ATOM 6198  C CD2 . PHE E 1 15  ? 100.450 114.059 204.316 1.00 30.00  ? 15  PHE E CD2 1 
ATOM 6199  C CE1 . PHE E 1 15  ? 100.769 112.321 202.196 1.00 30.00  ? 15  PHE E CE1 1 
ATOM 6200  C CE2 . PHE E 1 15  ? 99.348  113.647 203.591 1.00 30.00  ? 15  PHE E CE2 1 
ATOM 6201  C CZ  . PHE E 1 15  ? 99.508  112.776 202.530 1.00 30.00  ? 15  PHE E CZ  1 
ATOM 6202  N N   . ILE E 1 16  ? 102.676 117.210 204.403 1.00 132.37 ? 16  ILE E N   1 
ATOM 6203  C CA  . ILE E 1 16  ? 101.943 118.391 203.961 1.00 131.31 ? 16  ILE E CA  1 
ATOM 6204  C C   . ILE E 1 16  ? 102.809 119.234 203.035 1.00 126.36 ? 16  ILE E C   1 
ATOM 6205  O O   . ILE E 1 16  ? 102.325 119.747 202.020 1.00 114.96 ? 16  ILE E O   1 
ATOM 6206  C CB  . ILE E 1 16  ? 101.442 119.194 205.181 1.00 30.00  ? 16  ILE E CB  1 
ATOM 6207  C CG1 . ILE E 1 16  ? 100.461 118.355 206.000 1.00 30.00  ? 16  ILE E CG1 1 
ATOM 6208  C CG2 . ILE E 1 16  ? 100.762 120.491 204.758 1.00 30.00  ? 16  ILE E CG2 1 
ATOM 6209  C CD1 . ILE E 1 16  ? 100.085 118.974 207.327 1.00 30.00  ? 16  ILE E CD1 1 
ATOM 6210  N N   . ALA E 1 17  ? 104.109 119.330 203.326 1.00 123.07 ? 17  ALA E N   1 
ATOM 6211  C CA  . ALA E 1 17  ? 104.985 120.214 202.563 1.00 113.60 ? 17  ALA E CA  1 
ATOM 6212  C C   . ALA E 1 17  ? 105.258 119.669 201.165 1.00 122.78 ? 17  ALA E C   1 
ATOM 6213  O O   . ALA E 1 17  ? 105.044 120.368 200.168 1.00 135.51 ? 17  ALA E O   1 
ATOM 6214  C CB  . ALA E 1 17  ? 106.296 120.434 203.317 1.00 30.00  ? 17  ALA E CB  1 
ATOM 6215  N N   . MET E 1 18  ? 105.716 118.419 201.071 1.00 110.98 ? 18  MET E N   1 
ATOM 6216  C CA  . MET E 1 18  ? 106.180 117.890 199.792 1.00 128.27 ? 18  MET E CA  1 
ATOM 6217  C C   . MET E 1 18  ? 105.033 117.609 198.821 1.00 133.84 ? 18  MET E C   1 
ATOM 6218  O O   . MET E 1 18  ? 105.227 117.718 197.605 1.00 141.63 ? 18  MET E O   1 
ATOM 6219  C CB  . MET E 1 18  ? 107.023 116.631 200.032 1.00 30.00  ? 18  MET E CB  1 
ATOM 6220  C CG  . MET E 1 18  ? 107.679 116.060 198.782 1.00 30.00  ? 18  MET E CG  1 
ATOM 6221  S SD  . MET E 1 18  ? 108.725 114.630 199.053 1.00 30.00  ? 18  MET E SD  1 
ATOM 6222  C CE  . MET E 1 18  ? 109.076 114.185 197.353 1.00 30.00  ? 18  MET E CE  1 
ATOM 6223  N N   . VAL E 1 19  ? 103.841 117.278 199.320 1.00 128.57 ? 19  VAL E N   1 
ATOM 6224  C CA  . VAL E 1 19  ? 102.693 117.138 198.430 1.00 124.82 ? 19  VAL E CA  1 
ATOM 6225  C C   . VAL E 1 19  ? 102.295 118.498 197.864 1.00 121.88 ? 19  VAL E C   1 
ATOM 6226  O O   . VAL E 1 19  ? 101.910 118.612 196.693 1.00 114.40 ? 19  VAL E O   1 
ATOM 6227  C CB  . VAL E 1 19  ? 101.540 116.431 199.169 1.00 30.00  ? 19  VAL E CB  1 
ATOM 6228  C CG1 . VAL E 1 19  ? 100.243 116.449 198.367 1.00 30.00  ? 19  VAL E CG1 1 
ATOM 6229  C CG2 . VAL E 1 19  ? 101.931 114.986 199.437 1.00 30.00  ? 19  VAL E CG2 1 
ATOM 6230  N N   . LEU E 1 20  ? 102.453 119.561 198.655 1.00 123.94 ? 20  LEU E N   1 
ATOM 6231  C CA  . LEU E 1 20  ? 102.306 120.900 198.096 1.00 120.76 ? 20  LEU E CA  1 
ATOM 6232  C C   . LEU E 1 20  ? 103.464 121.251 197.169 1.00 118.82 ? 20  LEU E C   1 
ATOM 6233  O O   . LEU E 1 20  ? 103.291 122.053 196.244 1.00 128.24 ? 20  LEU E O   1 
ATOM 6234  C CB  . LEU E 1 20  ? 102.168 121.929 199.214 1.00 30.00  ? 20  LEU E CB  1 
ATOM 6235  C CG  . LEU E 1 20  ? 100.850 121.822 199.983 1.00 30.00  ? 20  LEU E CG  1 
ATOM 6236  C CD1 . LEU E 1 20  ? 100.824 122.774 201.169 1.00 30.00  ? 20  LEU E CD1 1 
ATOM 6237  C CD2 . LEU E 1 20  ? 99.668  122.067 199.057 1.00 30.00  ? 20  LEU E CD2 1 
ATOM 6238  N N   . VAL E 1 21  ? 104.643 120.663 197.391 1.00 118.89 ? 21  VAL E N   1 
ATOM 6239  C CA  . VAL E 1 21  ? 105.707 120.761 196.396 1.00 124.09 ? 21  VAL E CA  1 
ATOM 6240  C C   . VAL E 1 21  ? 105.382 119.866 195.204 1.00 132.71 ? 21  VAL E C   1 
ATOM 6241  O O   . VAL E 1 21  ? 105.677 120.212 194.054 1.00 133.89 ? 21  VAL E O   1 
ATOM 6242  C CB  . VAL E 1 21  ? 107.067 120.426 197.043 1.00 30.00  ? 21  VAL E CB  1 
ATOM 6243  C CG1 . VAL E 1 21  ? 108.196 120.404 196.021 1.00 30.00  ? 21  VAL E CG1 1 
ATOM 6244  C CG2 . VAL E 1 21  ? 107.389 121.437 198.129 1.00 30.00  ? 21  VAL E CG2 1 
ATOM 6245  N N   . ALA E 1 22  ? 104.723 118.731 195.446 1.00 119.64 ? 22  ALA E N   1 
ATOM 6246  C CA  . ALA E 1 22  ? 104.213 117.933 194.337 1.00 121.63 ? 22  ALA E CA  1 
ATOM 6247  C C   . ALA E 1 22  ? 103.065 118.643 193.633 1.00 121.50 ? 22  ALA E C   1 
ATOM 6248  O O   . ALA E 1 22  ? 102.846 118.437 192.434 1.00 124.27 ? 22  ALA E O   1 
ATOM 6249  C CB  . ALA E 1 22  ? 103.766 116.561 194.832 1.00 30.00  ? 22  ALA E CB  1 
ATOM 6250  N N   . ALA E 1 23  ? 102.322 119.480 194.363 1.00 123.64 ? 23  ALA E N   1 
ATOM 6251  C CA  . ALA E 1 23  ? 101.266 120.284 193.763 1.00 136.43 ? 23  ALA E CA  1 
ATOM 6252  C C   . ALA E 1 23  ? 101.808 121.336 192.810 1.00 124.63 ? 23  ALA E C   1 
ATOM 6253  O O   . ALA E 1 23  ? 101.252 121.505 191.720 1.00 135.97 ? 23  ALA E O   1 
ATOM 6254  C CB  . ALA E 1 23  ? 100.428 120.968 194.844 1.00 30.00  ? 23  ALA E CB  1 
ATOM 6255  N N   . VAL E 1 24  ? 102.881 122.032 193.182 1.00 119.23 ? 24  VAL E N   1 
ATOM 6256  C CA  . VAL E 1 24  ? 103.513 122.967 192.263 1.00 115.14 ? 24  VAL E CA  1 
ATOM 6257  C C   . VAL E 1 24  ? 104.400 122.250 191.254 1.00 115.95 ? 24  VAL E C   1 
ATOM 6258  O O   . VAL E 1 24  ? 104.782 122.857 190.243 1.00 121.87 ? 24  VAL E O   1 
ATOM 6259  C CB  . VAL E 1 24  ? 104.316 124.050 193.013 1.00 30.00  ? 24  VAL E CB  1 
ATOM 6260  C CG1 . VAL E 1 24  ? 103.412 124.803 193.974 1.00 30.00  ? 24  VAL E CG1 1 
ATOM 6261  C CG2 . VAL E 1 24  ? 105.498 123.452 193.737 1.00 30.00  ? 24  VAL E CG2 1 
ATOM 6262  N N   . ALA E 1 25  ? 104.910 121.065 191.552 1.00 113.08 ? 25  ALA E N   1 
ATOM 6263  C CA  . ALA E 1 25  ? 105.715 120.441 190.513 1.00 132.88 ? 25  ALA E CA  1 
ATOM 6264  C C   . ALA E 1 25  ? 104.804 120.045 189.364 1.00 125.56 ? 25  ALA E C   1 
ATOM 6265  O O   . ALA E 1 25  ? 105.036 120.371 188.188 1.00 130.11 ? 25  ALA E O   1 
ATOM 6266  C CB  . ALA E 1 25  ? 106.427 119.219 191.061 1.00 30.00  ? 25  ALA E CB  1 
ATOM 6267  N N   . ALA E 1 26  ? 103.725 119.371 189.743 1.00 112.05 ? 26  ALA E N   1 
ATOM 6268  C CA  . ALA E 1 26  ? 102.727 118.912 188.796 1.00 121.96 ? 26  ALA E CA  1 
ATOM 6269  C C   . ALA E 1 26  ? 101.937 120.043 188.177 1.00 122.57 ? 26  ALA E C   1 
ATOM 6270  O O   . ALA E 1 26  ? 101.738 120.076 186.974 1.00 124.18 ? 26  ALA E O   1 
ATOM 6271  C CB  . ALA E 1 26  ? 101.791 117.909 189.452 1.00 30.00  ? 26  ALA E CB  1 
ATOM 6272  N N   . ALA E 1 27  ? 101.520 120.998 188.997 1.00 120.74 ? 27  ALA E N   1 
ATOM 6273  C CA  . ALA E 1 27  ? 100.721 122.082 188.466 1.00 112.14 ? 27  ALA E CA  1 
ATOM 6274  C C   . ALA E 1 27  ? 101.522 122.867 187.453 1.00 126.27 ? 27  ALA E C   1 
ATOM 6275  O O   . ALA E 1 27  ? 101.055 123.108 186.341 1.00 129.46 ? 27  ALA E O   1 
ATOM 6276  C CB  . ALA E 1 27  ? 100.257 122.990 189.588 1.00 30.00  ? 27  ALA E CB  1 
ATOM 6277  N N   . VAL E 1 28  ? 102.761 123.191 187.799 1.00 128.89 ? 28  VAL E N   1 
ATOM 6278  C CA  . VAL E 1 28  ? 103.596 123.951 186.884 1.00 113.05 ? 28  VAL E CA  1 
ATOM 6279  C C   . VAL E 1 28  ? 103.866 123.152 185.624 1.00 121.90 ? 28  VAL E C   1 
ATOM 6280  O O   . VAL E 1 28  ? 103.807 123.690 184.516 1.00 122.20 ? 28  VAL E O   1 
ATOM 6281  C CB  . VAL E 1 28  ? 104.929 124.377 187.516 1.00 30.00  ? 28  VAL E CB  1 
ATOM 6282  C CG1 . VAL E 1 28  ? 105.819 125.019 186.465 1.00 30.00  ? 28  VAL E CG1 1 
ATOM 6283  C CG2 . VAL E 1 28  ? 104.679 125.341 188.664 1.00 30.00  ? 28  VAL E CG2 1 
ATOM 6284  N N   . LEU E 1 29  ? 104.125 121.858 185.783 1.00 114.96 ? 29  LEU E N   1 
ATOM 6285  C CA  . LEU E 1 29  ? 104.408 121.061 184.603 1.00 129.81 ? 29  LEU E CA  1 
ATOM 6286  C C   . LEU E 1 29  ? 103.201 121.049 183.669 1.00 140.90 ? 29  LEU E C   1 
ATOM 6287  O O   . LEU E 1 29  ? 103.331 121.277 182.464 1.00 135.21 ? 29  LEU E O   1 
ATOM 6288  C CB  . LEU E 1 29  ? 104.806 119.641 185.003 1.00 30.00  ? 29  LEU E CB  1 
ATOM 6289  C CG  . LEU E 1 29  ? 105.102 118.668 183.865 1.00 30.00  ? 29  LEU E CG  1 
ATOM 6290  C CD1 . LEU E 1 29  ? 105.802 119.372 182.716 1.00 30.00  ? 29  LEU E CD1 1 
ATOM 6291  C CD2 . LEU E 1 29  ? 105.929 117.499 184.374 1.00 30.00  ? 29  LEU E CD2 1 
ATOM 6292  N N   . ILE E 1 30  ? 102.013 120.873 184.234 1.00 133.11 ? 30  ILE E N   1 
ATOM 6293  C CA  . ILE E 1 30  ? 100.807 120.829 183.426 1.00 124.38 ? 30  ILE E CA  1 
ATOM 6294  C C   . ILE E 1 30  ? 100.584 122.155 182.733 1.00 127.80 ? 30  ILE E C   1 
ATOM 6295  O O   . ILE E 1 30  ? 100.233 122.199 181.564 1.00 124.15 ? 30  ILE E O   1 
ATOM 6296  C CB  . ILE E 1 30  ? 99.554  120.521 184.263 1.00 30.00  ? 30  ILE E CB  1 
ATOM 6297  C CG1 . ILE E 1 30  ? 99.587  119.090 184.793 1.00 30.00  ? 30  ILE E CG1 1 
ATOM 6298  C CG2 . ILE E 1 30  ? 98.302  120.721 183.424 1.00 30.00  ? 30  ILE E CG2 1 
ATOM 6299  C CD1 . ILE E 1 30  ? 98.311  118.674 185.493 1.00 30.00  ? 30  ILE E CD1 1 
ATOM 6300  N N   . GLN E 1 31  ? 100.814 123.240 183.458 1.00 132.79 ? 31  GLN E N   1 
ATOM 6301  C CA  . GLN E 1 31  ? 100.596 124.559 182.909 1.00 126.31 ? 31  GLN E CA  1 
ATOM 6302  C C   . GLN E 1 31  ? 101.521 124.782 181.723 1.00 126.39 ? 31  GLN E C   1 
ATOM 6303  O O   . GLN E 1 31  ? 101.095 125.248 180.661 1.00 134.06 ? 31  GLN E O   1 
ATOM 6304  C CB  . GLN E 1 31  ? 100.880 125.591 183.999 1.00 30.00  ? 31  GLN E CB  1 
ATOM 6305  C CG  . GLN E 1 31  ? 99.869  126.718 184.106 1.00 30.00  ? 31  GLN E CG  1 
ATOM 6306  C CD  . GLN E 1 31  ? 99.948  127.431 185.442 1.00 30.00  ? 31  GLN E CD  1 
ATOM 6307  O OE1 . GLN E 1 31  ? 100.121 126.800 186.484 1.00 30.00  ? 31  GLN E OE1 1 
ATOM 6308  N NE2 . GLN E 1 31  ? 99.819  128.752 185.418 1.00 30.00  ? 31  GLN E NE2 1 
ATOM 6309  N N   . THR E 1 32  ? 102.781 124.392 181.882 1.00 112.61 ? 32  THR E N   1 
ATOM 6310  C CA  . THR E 1 32  ? 103.751 124.573 180.813 1.00 127.34 ? 32  THR E CA  1 
ATOM 6311  C C   . THR E 1 32  ? 103.367 123.747 179.600 1.00 131.45 ? 32  THR E C   1 
ATOM 6312  O O   . THR E 1 32  ? 103.445 124.212 178.460 1.00 120.85 ? 32  THR E O   1 
ATOM 6313  C CB  . THR E 1 32  ? 105.173 124.219 181.270 1.00 30.00  ? 32  THR E CB  1 
ATOM 6314  O OG1 . THR E 1 32  ? 105.151 122.979 181.984 1.00 30.00  ? 32  THR E OG1 1 
ATOM 6315  C CG2 . THR E 1 32  ? 105.708 125.302 182.184 1.00 30.00  ? 32  THR E CG2 1 
ATOM 6316  N N   . SER E 1 33  ? 102.911 122.526 179.828 1.00 130.67 ? 33  SER E N   1 
ATOM 6317  C CA  . SER E 1 33  ? 102.558 121.663 178.714 1.00 132.42 ? 33  SER E CA  1 
ATOM 6318  C C   . SER E 1 33  ? 101.435 122.229 177.865 1.00 131.30 ? 33  SER E C   1 
ATOM 6319  O O   . SER E 1 33  ? 101.502 122.183 176.645 1.00 133.84 ? 33  SER E O   1 
ATOM 6320  C CB  . SER E 1 33  ? 102.170 120.275 179.219 1.00 30.00  ? 33  SER E CB  1 
ATOM 6321  O OG  . SER E 1 33  ? 103.296 119.600 179.748 1.00 30.00  ? 33  SER E OG  1 
ATOM 6322  N N   . GLY E 1 34  ? 100.422 122.799 178.504 1.00 129.56 ? 34  GLY E N   1 
ATOM 6323  C CA  . GLY E 1 34  ? 99.288  123.327 177.768 1.00 121.87 ? 34  GLY E CA  1 
ATOM 6324  C C   . GLY E 1 34  ? 99.605  124.454 176.806 1.00 127.99 ? 34  GLY E C   1 
ATOM 6325  O O   . GLY E 1 34  ? 99.108  124.466 175.677 1.00 136.74 ? 34  GLY E O   1 
ATOM 6326  N N   . TYR E 1 35  ? 100.442 125.393 177.237 1.00 111.57 ? 35  TYR E N   1 
ATOM 6327  C CA  . TYR E 1 35  ? 100.808 126.520 176.386 1.00 115.71 ? 35  TYR E CA  1 
ATOM 6328  C C   . TYR E 1 35  ? 101.540 126.008 175.153 1.00 122.18 ? 35  TYR E C   1 
ATOM 6329  O O   . TYR E 1 35  ? 101.244 126.400 174.014 1.00 127.53 ? 35  TYR E O   1 
ATOM 6330  C CB  . TYR E 1 35  ? 101.668 127.512 177.175 1.00 30.00  ? 35  TYR E CB  1 
ATOM 6331  C CG  . TYR E 1 35  ? 102.597 128.360 176.338 1.00 30.00  ? 35  TYR E CG  1 
ATOM 6332  C CD1 . TYR E 1 35  ? 102.137 129.035 175.218 1.00 30.00  ? 35  TYR E CD1 1 
ATOM 6333  C CD2 . TYR E 1 35  ? 103.932 128.503 176.684 1.00 30.00  ? 35  TYR E CD2 1 
ATOM 6334  C CE1 . TYR E 1 35  ? 102.987 129.816 174.458 1.00 30.00  ? 35  TYR E CE1 1 
ATOM 6335  C CE2 . TYR E 1 35  ? 104.788 129.282 175.933 1.00 30.00  ? 35  TYR E CE2 1 
ATOM 6336  C CZ  . TYR E 1 35  ? 104.311 129.936 174.821 1.00 30.00  ? 35  TYR E CZ  1 
ATOM 6337  O OH  . TYR E 1 35  ? 105.165 130.711 174.071 1.00 30.00  ? 35  TYR E OH  1 
ATOM 6338  N N   . LEU E 1 36  ? 102.454 125.067 175.371 1.00 116.21 ? 36  LEU E N   1 
ATOM 6339  C CA  . LEU E 1 36  ? 103.197 124.493 174.264 1.00 130.01 ? 36  LEU E CA  1 
ATOM 6340  C C   . LEU E 1 36  ? 102.256 123.761 173.329 1.00 123.78 ? 36  LEU E C   1 
ATOM 6341  O O   . LEU E 1 36  ? 102.365 123.891 172.121 1.00 118.51 ? 36  LEU E O   1 
ATOM 6342  C CB  . LEU E 1 36  ? 104.316 123.581 174.755 1.00 30.00  ? 36  LEU E CB  1 
ATOM 6343  C CG  . LEU E 1 36  ? 105.551 124.380 175.167 1.00 30.00  ? 36  LEU E CG  1 
ATOM 6344  C CD1 . LEU E 1 36  ? 106.775 123.486 175.276 1.00 30.00  ? 36  LEU E CD1 1 
ATOM 6345  C CD2 . LEU E 1 36  ? 105.796 125.486 174.156 1.00 30.00  ? 36  LEU E CD2 1 
ATOM 6346  N N   . GLN E 1 37  ? 101.294 123.036 173.885 1.00 123.38 ? 37  GLN E N   1 
ATOM 6347  C CA  . GLN E 1 37  ? 100.359 122.314 173.051 1.00 117.62 ? 37  GLN E CA  1 
ATOM 6348  C C   . GLN E 1 37  ? 99.592  123.283 172.172 1.00 110.58 ? 37  GLN E C   1 
ATOM 6349  O O   . GLN E 1 37  ? 99.509  123.089 170.954 1.00 111.88 ? 37  GLN E O   1 
ATOM 6350  C CB  . GLN E 1 37  ? 99.350  121.579 173.932 1.00 30.00  ? 37  GLN E CB  1 
ATOM 6351  C CG  . GLN E 1 37  ? 99.877  120.318 174.591 1.00 30.00  ? 37  GLN E CG  1 
ATOM 6352  C CD  . GLN E 1 37  ? 99.105  119.955 175.844 1.00 30.00  ? 37  GLN E CD  1 
ATOM 6353  O OE1 . GLN E 1 37  ? 98.214  120.689 176.267 1.00 30.00  ? 37  GLN E OE1 1 
ATOM 6354  N NE2 . GLN E 1 37  ? 99.446  118.819 176.446 1.00 30.00  ? 37  GLN E NE2 1 
ATOM 6355  N N   . GLN E 1 38  ? 99.103  124.375 172.754 1.00 110.77 ? 38  GLN E N   1 
ATOM 6356  C CA  . GLN E 1 38  ? 98.328  125.303 171.939 1.00 125.53 ? 38  GLN E CA  1 
ATOM 6357  C C   . GLN E 1 38  ? 99.188  125.911 170.836 1.00 131.29 ? 38  GLN E C   1 
ATOM 6358  O O   . GLN E 1 38  ? 98.775  125.958 169.664 1.00 143.08 ? 38  GLN E O   1 
ATOM 6359  C CB  . GLN E 1 38  ? 97.559  126.348 172.782 1.00 30.00  ? 38  GLN E CB  1 
ATOM 6360  C CG  . GLN E 1 38  ? 98.332  127.552 173.301 1.00 30.00  ? 38  GLN E CG  1 
ATOM 6361  C CD  . GLN E 1 38  ? 97.626  128.252 174.442 1.00 30.00  ? 38  GLN E CD  1 
ATOM 6362  O OE1 . GLN E 1 38  ? 96.406  128.172 174.573 1.00 30.00  ? 38  GLN E OE1 1 
ATOM 6363  N NE2 . GLN E 1 38  ? 98.392  128.945 175.276 1.00 30.00  ? 38  GLN E NE2 1 
ATOM 6364  N N   . LYS E 1 39  ? 100.420 126.280 171.180 1.00 115.39 ? 39  LYS E N   1 
ATOM 6365  C CA  . LYS E 1 39  ? 101.275 126.897 170.185 1.00 122.69 ? 39  LYS E CA  1 
ATOM 6366  C C   . LYS E 1 39  ? 101.558 125.922 169.055 1.00 122.92 ? 39  LYS E C   1 
ATOM 6367  O O   . LYS E 1 39  ? 101.450 126.262 167.874 1.00 119.94 ? 39  LYS E O   1 
ATOM 6368  C CB  . LYS E 1 39  ? 102.575 127.373 170.820 1.00 30.00  ? 39  LYS E CB  1 
ATOM 6369  C CG  . LYS E 1 39  ? 103.531 128.029 169.842 1.00 30.00  ? 39  LYS E CG  1 
ATOM 6370  C CD  . LYS E 1 39  ? 102.976 129.332 169.299 1.00 30.00  ? 39  LYS E CD  1 
ATOM 6371  C CE  . LYS E 1 39  ? 103.926 129.927 168.274 1.00 30.00  ? 39  LYS E CE  1 
ATOM 6372  N NZ  . LYS E 1 39  ? 103.546 131.314 167.899 1.00 30.00  ? 39  LYS E NZ  1 
ATOM 6373  N N   . SER E 1 40  ? 101.837 124.681 169.420 1.00 115.71 ? 40  SER E N   1 
ATOM 6374  C CA  . SER E 1 40  ? 102.158 123.691 168.426 1.00 125.17 ? 40  SER E CA  1 
ATOM 6375  C C   . SER E 1 40  ? 100.983 123.489 167.508 1.00 124.47 ? 40  SER E C   1 
ATOM 6376  O O   . SER E 1 40  ? 101.148 123.517 166.299 1.00 117.25 ? 40  SER E O   1 
ATOM 6377  C CB  . SER E 1 40  ? 102.520 122.369 169.093 1.00 30.00  ? 40  SER E CB  1 
ATOM 6378  O OG  . SER E 1 40  ? 101.427 121.865 169.834 1.00 30.00  ? 40  SER E OG  1 
ATOM 6379  N N   . GLN E 1 41  ? 99.785  123.388 168.066 1.00 124.77 ? 41  GLN E N   1 
ATOM 6380  C CA  . GLN E 1 41  ? 98.632  123.150 167.218 1.00 118.76 ? 41  GLN E CA  1 
ATOM 6381  C C   . GLN E 1 41  ? 98.420  124.287 166.239 1.00 112.40 ? 41  GLN E C   1 
ATOM 6382  O O   . GLN E 1 41  ? 98.270  124.057 165.025 1.00 107.21 ? 41  GLN E O   1 
ATOM 6383  C CB  . GLN E 1 41  ? 97.382  122.989 168.077 1.00 30.00  ? 41  GLN E CB  1 
ATOM 6384  C CG  . GLN E 1 41  ? 97.391  121.742 168.940 1.00 30.00  ? 41  GLN E CG  1 
ATOM 6385  C CD  . GLN E 1 41  ? 96.602  121.914 170.221 1.00 30.00  ? 41  GLN E CD  1 
ATOM 6386  O OE1 . GLN E 1 41  ? 96.411  123.031 170.703 1.00 30.00  ? 41  GLN E OE1 1 
ATOM 6387  N NE2 . GLN E 1 41  ? 96.144  120.803 170.784 1.00 30.00  ? 41  GLN E NE2 1 
ATOM 6388  N N   . ALA E 1 42  ? 98.508  125.519 166.737 1.00 117.08 ? 42  ALA E N   1 
ATOM 6389  C CA  . ALA E 1 42  ? 98.267  126.639 165.838 1.00 121.87 ? 42  ALA E CA  1 
ATOM 6390  C C   . ALA E 1 42  ? 99.313  126.681 164.736 1.00 124.60 ? 42  ALA E C   1 
ATOM 6391  O O   . ALA E 1 42  ? 98.990  126.829 163.553 1.00 129.32 ? 42  ALA E O   1 
ATOM 6392  C CB  . ALA E 1 42  ? 98.232  127.954 166.603 1.00 30.00  ? 42  ALA E CB  1 
ATOM 6393  N N   . THR E 1 43  ? 100.563 126.469 165.119 1.00 122.18 ? 43  THR E N   1 
ATOM 6394  C CA  . THR E 1 43  ? 101.641 126.528 164.156 1.00 129.90 ? 43  THR E CA  1 
ATOM 6395  C C   . THR E 1 43  ? 101.490 125.445 163.101 1.00 121.89 ? 43  THR E C   1 
ATOM 6396  O O   . THR E 1 43  ? 101.701 125.684 161.913 1.00 106.94 ? 43  THR E O   1 
ATOM 6397  C CB  . THR E 1 43  ? 102.998 126.422 164.852 1.00 30.00  ? 43  THR E CB  1 
ATOM 6398  O OG1 . THR E 1 43  ? 102.970 125.319 165.762 1.00 30.00  ? 43  THR E OG1 1 
ATOM 6399  C CG2 . THR E 1 43  ? 103.272 127.689 165.634 1.00 30.00  ? 43  THR E CG2 1 
ATOM 6400  N N   . GLY E 1 44  ? 101.107 124.254 163.533 1.00 116.35 ? 44  GLY E N   1 
ATOM 6401  C CA  . GLY E 1 44  ? 100.946 123.157 162.609 1.00 102.42 ? 44  GLY E CA  1 
ATOM 6402  C C   . GLY E 1 44  ? 99.848  123.438 161.614 1.00 107.16 ? 44  GLY E C   1 
ATOM 6403  O O   . GLY E 1 44  ? 100.012 123.207 160.417 1.00 105.71 ? 44  GLY E O   1 
ATOM 6404  N N   . ARG E 1 45  ? 98.730  123.971 162.094 1.00 121.34 ? 45  ARG E N   1 
ATOM 6405  C CA  . ARG E 1 45  ? 97.638  124.242 161.169 1.00 118.64 ? 45  ARG E CA  1 
ATOM 6406  C C   . ARG E 1 45  ? 98.005  125.297 160.135 1.00 114.49 ? 45  ARG E C   1 
ATOM 6407  O O   . ARG E 1 45  ? 97.651  125.193 158.963 1.00 119.78 ? 45  ARG E O   1 
ATOM 6408  C CB  . ARG E 1 45  ? 96.335  124.581 161.900 1.00 30.00  ? 45  ARG E CB  1 
ATOM 6409  C CG  . ARG E 1 45  ? 95.501  123.349 162.228 1.00 30.00  ? 45  ARG E CG  1 
ATOM 6410  C CD  . ARG E 1 45  ? 94.042  123.694 162.466 1.00 30.00  ? 45  ARG E CD  1 
ATOM 6411  N NE  . ARG E 1 45  ? 93.884  124.587 163.606 1.00 30.00  ? 45  ARG E NE  1 
ATOM 6412  C CZ  . ARG E 1 45  ? 93.906  125.912 163.523 1.00 30.00  ? 45  ARG E CZ  1 
ATOM 6413  N NH1 . ARG E 1 45  ? 94.077  126.502 162.349 1.00 30.00  ? 45  ARG E NH1 1 
ATOM 6414  N NH2 . ARG E 1 45  ? 93.755  126.647 164.615 1.00 30.00  ? 45  ARG E NH2 1 
ATOM 6415  N N   . GLU E 1 46  ? 98.733  126.306 160.582 1.00 110.36 ? 46  GLU E N   1 
ATOM 6416  C CA  . GLU E 1 46  ? 99.117  127.426 159.729 1.00 120.39 ? 46  GLU E CA  1 
ATOM 6417  C C   . GLU E 1 46  ? 100.362 127.115 158.913 1.00 123.08 ? 46  GLU E C   1 
ATOM 6418  O O   . GLU E 1 46  ? 100.450 127.509 157.745 1.00 126.45 ? 46  GLU E O   1 
ATOM 6419  C CB  . GLU E 1 46  ? 99.337  128.673 160.577 1.00 30.00  ? 46  GLU E CB  1 
ATOM 6420  C CG  . GLU E 1 46  ? 98.070  129.213 161.195 1.00 30.00  ? 46  GLU E CG  1 
ATOM 6421  C CD  . GLU E 1 46  ? 98.334  130.391 162.096 1.00 30.00  ? 46  GLU E CD  1 
ATOM 6422  O OE1 . GLU E 1 46  ? 99.522  130.703 162.322 1.00 30.00  ? 46  GLU E OE1 1 
ATOM 6423  O OE2 . GLU E 1 46  ? 97.359  131.002 162.582 1.00 30.00  ? 46  GLU E OE2 1 
ATOM 6424  N N   . THR E 1 47  ? 101.315 126.390 159.492 1.00 109.60 ? 47  THR E N   1 
ATOM 6425  C CA  . THR E 1 47  ? 102.496 125.976 158.750 1.00 114.97 ? 47  THR E CA  1 
ATOM 6426  C C   . THR E 1 47  ? 102.224 124.814 157.808 1.00 122.24 ? 47  THR E C   1 
ATOM 6427  O O   . THR E 1 47  ? 103.114 124.437 157.039 1.00 126.78 ? 47  THR E O   1 
ATOM 6428  C CB  . THR E 1 47  ? 103.618 125.617 159.718 1.00 30.00  ? 47  THR E CB  1 
ATOM 6429  O OG1 . THR E 1 47  ? 103.121 124.685 160.686 1.00 30.00  ? 47  THR E OG1 1 
ATOM 6430  C CG2 . THR E 1 47  ? 104.139 126.862 160.414 1.00 30.00  ? 47  THR E CG2 1 
ATOM 6431  N N   . THR E 1 48  ? 101.030 124.227 157.860 1.00 106.63 ? 48  THR E N   1 
ATOM 6432  C CA  . THR E 1 48  ? 100.564 123.436 156.731 1.00 106.27 ? 48  THR E CA  1 
ATOM 6433  C C   . THR E 1 48  ? 99.792  124.303 155.747 1.00 112.60 ? 48  THR E C   1 
ATOM 6434  O O   . THR E 1 48  ? 99.814  124.043 154.542 1.00 117.23 ? 48  THR E O   1 
ATOM 6435  C CB  . THR E 1 48  ? 99.698  122.272 157.209 1.00 30.00  ? 48  THR E CB  1 
ATOM 6436  O OG1 . THR E 1 48  ? 98.604  122.780 157.978 1.00 30.00  ? 48  THR E OG1 1 
ATOM 6437  C CG2 . THR E 1 48  ? 100.512 121.311 158.051 1.00 30.00  ? 48  THR E CG2 1 
ATOM 6438  N N   . GLN E 1 49  ? 99.105  125.337 156.239 1.00 120.76 ? 49  GLN E N   1 
ATOM 6439  C CA  . GLN E 1 49  ? 98.442  126.264 155.329 1.00 129.15 ? 49  GLN E CA  1 
ATOM 6440  C C   . GLN E 1 49  ? 99.440  127.178 154.639 1.00 124.57 ? 49  GLN E C   1 
ATOM 6441  O O   . GLN E 1 49  ? 99.158  127.680 153.546 1.00 134.69 ? 49  GLN E O   1 
ATOM 6442  C CB  . GLN E 1 49  ? 97.393  127.091 156.068 1.00 30.00  ? 49  GLN E CB  1 
ATOM 6443  C CG  . GLN E 1 49  ? 96.177  126.305 156.497 1.00 30.00  ? 49  GLN E CG  1 
ATOM 6444  C CD  . GLN E 1 49  ? 95.144  127.173 157.175 1.00 30.00  ? 49  GLN E CD  1 
ATOM 6445  O OE1 . GLN E 1 49  ? 95.360  128.365 157.387 1.00 30.00  ? 49  GLN E OE1 1 
ATOM 6446  N NE2 . GLN E 1 49  ? 94.007  126.582 157.513 1.00 30.00  ? 49  GLN E NE2 1 
ATOM 6447  N N   . GLU E 1 50  ? 100.601 127.406 155.260 1.00 118.17 ? 50  GLU E N   1 
ATOM 6448  C CA  . GLU E 1 50  ? 101.690 128.129 154.614 1.00 122.89 ? 50  GLU E CA  1 
ATOM 6449  C C   . GLU E 1 50  ? 102.179 127.423 153.357 1.00 108.02 ? 50  GLU E C   1 
ATOM 6450  O O   . GLU E 1 50  ? 102.583 128.088 152.397 1.00 108.64 ? 50  GLU E O   1 
ATOM 6451  C CB  . GLU E 1 50  ? 102.847 128.302 155.608 1.00 30.00  ? 50  GLU E CB  1 
ATOM 6452  C CG  . GLU E 1 50  ? 104.082 129.052 155.098 1.00 30.00  ? 50  GLU E CG  1 
ATOM 6453  C CD  . GLU E 1 50  ? 103.829 130.524 154.854 1.00 30.00  ? 50  GLU E CD  1 
ATOM 6454  O OE1 . GLU E 1 50  ? 102.949 131.099 155.529 1.00 30.00  ? 50  GLU E OE1 1 
ATOM 6455  O OE2 . GLU E 1 50  ? 104.508 131.105 153.981 1.00 30.00  ? 50  GLU E OE2 1 
ATOM 6456  N N   . VAL E 1 51  ? 102.106 126.099 153.322 1.00 112.66 ? 51  VAL E N   1 
ATOM 6457  C CA  . VAL E 1 51  ? 102.649 125.340 152.209 1.00 114.59 ? 51  VAL E CA  1 
ATOM 6458  C C   . VAL E 1 51  ? 101.569 124.822 151.270 1.00 112.54 ? 51  VAL E C   1 
ATOM 6459  O O   . VAL E 1 51  ? 101.892 124.468 150.127 1.00 128.80 ? 51  VAL E O   1 
ATOM 6460  C CB  . VAL E 1 51  ? 103.527 124.176 152.714 1.00 30.00  ? 51  VAL E CB  1 
ATOM 6461  C CG1 . VAL E 1 51  ? 104.546 124.695 153.713 1.00 30.00  ? 51  VAL E CG1 1 
ATOM 6462  C CG2 . VAL E 1 51  ? 102.694 123.075 153.330 1.00 30.00  ? 51  VAL E CG2 1 
ATOM 6463  N N   . ALA E 1 52  ? 100.304 124.778 151.698 1.00 30.00  ? 52  ALA E N   1 
ATOM 6464  C CA  . ALA E 1 52  ? 99.267  124.162 150.876 1.00 30.00  ? 52  ALA E CA  1 
ATOM 6465  C C   . ALA E 1 52  ? 98.679  125.152 149.883 1.00 30.00  ? 52  ALA E C   1 
ATOM 6466  O O   . ALA E 1 52  ? 98.600  124.865 148.685 1.00 30.00  ? 52  ALA E O   1 
ATOM 6467  C CB  . ALA E 1 52  ? 98.164  123.580 151.757 1.00 30.00  ? 52  ALA E CB  1 
ATOM 6468  N N   . SER E 1 53  ? 98.226  126.306 150.364 1.00 113.33 ? 53  SER E N   1 
ATOM 6469  C CA  . SER E 1 53  ? 97.595  127.280 149.488 1.00 119.89 ? 53  SER E CA  1 
ATOM 6470  C C   . SER E 1 53  ? 98.619  127.888 148.541 1.00 124.17 ? 53  SER E C   1 
ATOM 6471  O O   . SER E 1 53  ? 99.781  128.093 148.894 1.00 123.77 ? 53  SER E O   1 
ATOM 6472  C CB  . SER E 1 53  ? 96.921  128.379 150.304 1.00 135.93 ? 53  SER E CB  1 
ATOM 6473  O OG  . SER E 1 53  ? 97.878  129.152 150.998 1.00 150.89 ? 53  SER E OG  1 
ATOM 6474  N N   . GLY E 1 54  ? 98.183  128.150 147.318 1.00 126.56 ? 54  GLY E N   1 
ATOM 6475  C CA  . GLY E 1 54  ? 99.097  128.669 146.329 1.00 107.25 ? 54  GLY E CA  1 
ATOM 6476  C C   . GLY E 1 54  ? 98.421  129.286 145.127 1.00 106.60 ? 54  GLY E C   1 
ATOM 6477  O O   . GLY E 1 54  ? 97.553  128.675 144.501 1.00 103.76 ? 54  GLY E O   1 
ATOM 6478  N N   . ILE E 1 55  ? 98.840  130.501 144.796 1.00 100.38 ? 55  ILE E N   1 
ATOM 6479  C CA  . ILE E 1 55  ? 98.323  131.266 143.672 1.00 80.06  ? 55  ILE E CA  1 
ATOM 6480  C C   . ILE E 1 55  ? 99.220  131.022 142.472 1.00 98.77  ? 55  ILE E C   1 
ATOM 6481  O O   . ILE E 1 55  ? 100.436 131.211 142.559 1.00 111.05 ? 55  ILE E O   1 
ATOM 6482  C CB  . ILE E 1 55  ? 98.247  132.760 144.027 1.00 30.00  ? 55  ILE E CB  1 
ATOM 6483  C CG1 . ILE E 1 55  ? 97.083  133.010 144.988 1.00 30.00  ? 55  ILE E CG1 1 
ATOM 6484  C CG2 . ILE E 1 55  ? 98.211  133.633 142.793 1.00 30.00  ? 55  ILE E CG2 1 
ATOM 6485  C CD1 . ILE E 1 55  ? 97.000  134.424 145.497 1.00 30.00  ? 55  ILE E CD1 1 
ATOM 6486  N N   . LYS E 1 56  ? 98.633  130.581 141.363 1.00 98.92  ? 56  LYS E N   1 
ATOM 6487  C CA  . LYS E 1 56  ? 99.383  130.345 140.139 1.00 91.81  ? 56  LYS E CA  1 
ATOM 6488  C C   . LYS E 1 56  ? 98.810  131.180 139.004 1.00 85.75  ? 56  LYS E C   1 
ATOM 6489  O O   . LYS E 1 56  ? 97.640  131.572 139.034 1.00 101.89 ? 56  LYS E O   1 
ATOM 6490  C CB  . LYS E 1 56  ? 99.396  128.862 139.759 1.00 30.00  ? 56  LYS E CB  1 
ATOM 6491  C CG  . LYS E 1 56  ? 98.073  128.276 139.323 1.00 30.00  ? 56  LYS E CG  1 
ATOM 6492  C CD  . LYS E 1 56  ? 98.258  126.800 139.011 1.00 30.00  ? 56  LYS E CD  1 
ATOM 6493  C CE  . LYS E 1 56  ? 96.963  126.141 138.595 1.00 30.00  ? 56  LYS E CE  1 
ATOM 6494  N NZ  . LYS E 1 56  ? 96.490  126.659 137.291 1.00 30.00  ? 56  LYS E NZ  1 
ATOM 6495  N N   . VAL E 1 57  ? 99.646  131.440 138.003 1.00 72.52  ? 57  VAL E N   1 
ATOM 6496  C CA  . VAL E 1 57  ? 99.391  132.434 136.969 1.00 81.55  ? 57  VAL E CA  1 
ATOM 6497  C C   . VAL E 1 57  ? 99.316  131.730 135.625 1.00 102.46 ? 57  VAL E C   1 
ATOM 6498  O O   . VAL E 1 57  ? 100.219 130.967 135.267 1.00 103.19 ? 57  VAL E O   1 
ATOM 6499  C CB  . VAL E 1 57  ? 100.482 133.512 136.964 1.00 30.00  ? 57  VAL E CB  1 
ATOM 6500  C CG1 . VAL E 1 57  ? 100.330 134.433 135.777 1.00 30.00  ? 57  VAL E CG1 1 
ATOM 6501  C CG2 . VAL E 1 57  ? 100.430 134.300 138.250 1.00 30.00  ? 57  VAL E CG2 1 
ATOM 6502  N N   . LEU E 1 58  ? 98.246  131.988 134.876 1.00 92.19  ? 58  LEU E N   1 
ATOM 6503  C CA  . LEU E 1 58  ? 98.069  131.413 133.552 1.00 86.93  ? 58  LEU E CA  1 
ATOM 6504  C C   . LEU E 1 58  ? 97.497  132.449 132.595 1.00 105.85 ? 58  LEU E C   1 
ATOM 6505  O O   . LEU E 1 58  ? 96.556  133.165 132.950 1.00 120.09 ? 58  LEU E O   1 
ATOM 6506  C CB  . LEU E 1 58  ? 97.172  130.167 133.630 1.00 30.00  ? 58  LEU E CB  1 
ATOM 6507  C CG  . LEU E 1 58  ? 95.744  130.213 134.195 1.00 30.00  ? 58  LEU E CG  1 
ATOM 6508  C CD1 . LEU E 1 58  ? 94.678  130.475 133.139 1.00 30.00  ? 58  LEU E CD1 1 
ATOM 6509  C CD2 . LEU E 1 58  ? 95.434  128.935 134.941 1.00 30.00  ? 58  LEU E CD2 1 
ATOM 6510  N N   . SER E 1 59  ? 98.099  132.544 131.403 1.00 102.02 ? 59  SER E N   1 
ATOM 6511  C CA  . SER E 1 59  ? 97.504  133.128 130.194 1.00 101.26 ? 59  SER E CA  1 
ATOM 6512  C C   . SER E 1 59  ? 97.109  134.596 130.386 1.00 100.91 ? 59  SER E C   1 
ATOM 6513  O O   . SER E 1 59  ? 95.938  134.959 130.437 1.00 93.78  ? 59  SER E O   1 
ATOM 6514  C CB  . SER E 1 59  ? 96.308  132.293 129.728 1.00 30.00  ? 59  SER E CB  1 
ATOM 6515  O OG  . SER E 1 59  ? 96.724  131.000 129.327 1.00 30.00  ? 59  SER E OG  1 
ATOM 6516  N N   . VAL E 1 60  ? 98.120  135.422 130.519 1.00 114.53 ? 60  VAL E N   1 
ATOM 6517  C CA  . VAL E 1 60  ? 97.904  136.847 130.714 1.00 106.73 ? 60  VAL E CA  1 
ATOM 6518  C C   . VAL E 1 60  ? 97.778  137.537 129.359 1.00 97.61  ? 60  VAL E C   1 
ATOM 6519  O O   . VAL E 1 60  ? 98.482  137.198 128.404 1.00 91.29  ? 60  VAL E O   1 
ATOM 6520  C CB  . VAL E 1 60  ? 99.056  137.414 131.551 1.00 30.00  ? 60  VAL E CB  1 
ATOM 6521  C CG1 . VAL E 1 60  ? 98.810  138.860 131.906 1.00 30.00  ? 60  VAL E CG1 1 
ATOM 6522  C CG2 . VAL E 1 60  ? 99.240  136.557 132.780 1.00 30.00  ? 60  VAL E CG2 1 
ATOM 6523  N N   . VAL E 1 61  ? 96.882  138.517 129.265 1.00 91.21  ? 61  VAL E N   1 
ATOM 6524  C CA  . VAL E 1 61  ? 96.520  139.134 127.998 1.00 75.96  ? 61  VAL E CA  1 
ATOM 6525  C C   . VAL E 1 61  ? 96.985  140.586 127.971 1.00 85.19  ? 61  VAL E C   1 
ATOM 6526  O O   . VAL E 1 61  ? 97.171  141.221 129.009 1.00 107.80 ? 61  VAL E O   1 
ATOM 6527  C CB  . VAL E 1 61  ? 95.010  139.027 127.768 1.00 30.00  ? 61  VAL E CB  1 
ATOM 6528  C CG1 . VAL E 1 61  ? 94.640  137.588 127.557 1.00 30.00  ? 61  VAL E CG1 1 
ATOM 6529  C CG2 . VAL E 1 61  ? 94.299  139.497 128.997 1.00 30.00  ? 61  VAL E CG2 1 
ATOM 6530  N N   . GLY E 1 62  ? 97.191  141.106 126.758 1.00 70.41  ? 62  GLY E N   1 
ATOM 6531  C CA  . GLY E 1 62  ? 97.914  142.360 126.605 1.00 74.08  ? 62  GLY E CA  1 
ATOM 6532  C C   . GLY E 1 62  ? 97.201  143.697 126.477 1.00 71.97  ? 62  GLY E C   1 
ATOM 6533  O O   . GLY E 1 62  ? 97.417  144.562 127.328 1.00 101.24 ? 62  GLY E O   1 
ATOM 6534  N N   . LYS E 1 63  ? 96.354  143.872 125.450 1.00 30.00  ? 63  LYS E N   1 
ATOM 6535  C CA  . LYS E 1 63  ? 95.654  145.124 125.127 1.00 30.00  ? 63  LYS E CA  1 
ATOM 6536  C C   . LYS E 1 63  ? 96.588  146.313 124.906 1.00 30.00  ? 63  LYS E C   1 
ATOM 6537  O O   . LYS E 1 63  ? 96.806  147.119 125.817 1.00 30.00  ? 63  LYS E O   1 
ATOM 6538  C CB  . LYS E 1 63  ? 94.594  145.474 126.177 1.00 30.00  ? 63  LYS E CB  1 
ATOM 6539  C CG  . LYS E 1 63  ? 93.705  146.680 125.837 1.00 30.00  ? 63  LYS E CG  1 
ATOM 6540  C CD  . LYS E 1 63  ? 92.908  146.474 124.584 1.00 30.00  ? 63  LYS E CD  1 
ATOM 6541  C CE  . LYS E 1 63  ? 92.149  147.735 124.261 1.00 30.00  ? 63  LYS E CE  1 
ATOM 6542  N NZ  . LYS E 1 63  ? 91.175  148.042 125.333 1.00 30.00  ? 63  LYS E NZ  1 
ATOM 6543  N N   . THR E 1 64  ? 97.247  146.383 123.757 1.00 74.75  ? 64  THR E N   1 
ATOM 6544  C CA  . THR E 1 64  ? 97.941  147.625 123.463 1.00 85.42  ? 64  THR E CA  1 
ATOM 6545  C C   . THR E 1 64  ? 96.963  148.696 122.988 1.00 94.58  ? 64  THR E C   1 
ATOM 6546  O O   . THR E 1 64  ? 95.758  148.472 122.856 1.00 107.53 ? 64  THR E O   1 
ATOM 6547  C CB  . THR E 1 64  ? 99.029  147.423 122.419 1.00 30.00  ? 64  THR E CB  1 
ATOM 6548  O OG1 . THR E 1 64  ? 99.794  148.627 122.302 1.00 30.00  ? 64  THR E OG1 1 
ATOM 6549  C CG2 . THR E 1 64  ? 98.435  147.126 121.081 1.00 30.00  ? 64  THR E CG2 1 
ATOM 6550  N N   . ASP E 1 65  ? 97.508  149.879 122.720 1.00 92.95  ? 65  ASP E N   1 
ATOM 6551  C CA  . ASP E 1 65  ? 96.718  151.020 122.286 1.00 78.92  ? 65  ASP E CA  1 
ATOM 6552  C C   . ASP E 1 65  ? 96.443  150.889 120.788 1.00 87.53  ? 65  ASP E C   1 
ATOM 6553  O O   . ASP E 1 65  ? 97.089  150.107 120.085 1.00 108.21 ? 65  ASP E O   1 
ATOM 6554  C CB  . ASP E 1 65  ? 97.451  152.311 122.636 1.00 30.00  ? 65  ASP E CB  1 
ATOM 6555  C CG  . ASP E 1 65  ? 96.557  153.527 122.579 1.00 30.00  ? 65  ASP E CG  1 
ATOM 6556  O OD1 . ASP E 1 65  ? 95.346  153.368 122.320 1.00 30.00  ? 65  ASP E OD1 1 
ATOM 6557  O OD2 . ASP E 1 65  ? 97.068  154.646 122.794 1.00 30.00  ? 65  ASP E OD2 1 
ATOM 6558  N N   . SER E 1 66  ? 95.468  151.652 120.279 1.00 82.88  ? 66  SER E N   1 
ATOM 6559  C CA  . SER E 1 66  ? 95.153  151.672 118.855 1.00 100.10 ? 66  SER E CA  1 
ATOM 6560  C C   . SER E 1 66  ? 96.290  152.224 118.008 1.00 99.91  ? 66  SER E C   1 
ATOM 6561  O O   . SER E 1 66  ? 96.414  151.850 116.838 1.00 105.10 ? 66  SER E O   1 
ATOM 6562  C CB  . SER E 1 66  ? 93.890  152.499 118.607 1.00 30.00  ? 66  SER E CB  1 
ATOM 6563  O OG  . SER E 1 66  ? 92.771  151.925 119.255 1.00 30.00  ? 66  SER E OG  1 
ATOM 6564  N N   . ASN E 1 67  ? 97.113  153.098 118.568 1.00 97.83  ? 67  ASN E N   1 
ATOM 6565  C CA  . ASN E 1 67  ? 98.393  153.478 117.986 1.00 107.23 ? 67  ASN E CA  1 
ATOM 6566  C C   . ASN E 1 67  ? 99.398  152.586 118.708 1.00 118.78 ? 67  ASN E C   1 
ATOM 6567  O O   . ASN E 1 67  ? 99.805  152.891 119.833 1.00 119.03 ? 67  ASN E O   1 
ATOM 6568  C CB  . ASN E 1 67  ? 98.655  154.967 118.177 1.00 30.00  ? 67  ASN E CB  1 
ATOM 6569  C CG  . ASN E 1 67  ? 99.767  155.485 117.296 1.00 30.00  ? 67  ASN E CG  1 
ATOM 6570  O OD1 . ASN E 1 67  ? 100.410 154.723 116.576 1.00 30.00  ? 67  ASN E OD1 1 
ATOM 6571  N ND2 . ASN E 1 67  ? 99.975  156.798 117.318 1.00 30.00  ? 67  ASN E ND2 1 
ATOM 6572  N N   . LYS E 1 68  ? 99.816  151.504 118.037 1.00 119.07 ? 68  LYS E N   1 
ATOM 6573  C CA  . LYS E 1 68  ? 100.265 150.231 118.616 1.00 123.65 ? 68  LYS E CA  1 
ATOM 6574  C C   . LYS E 1 68  ? 101.356 150.271 119.686 1.00 120.01 ? 68  LYS E C   1 
ATOM 6575  O O   . LYS E 1 68  ? 101.613 149.255 120.337 1.00 120.34 ? 68  LYS E O   1 
ATOM 6576  C CB  . LYS E 1 68  ? 100.759 149.311 117.499 1.00 30.00  ? 68  LYS E CB  1 
ATOM 6577  C CG  . LYS E 1 68  ? 99.743  148.994 116.426 1.00 30.00  ? 68  LYS E CG  1 
ATOM 6578  C CD  . LYS E 1 68  ? 98.570  148.219 116.971 1.00 30.00  ? 68  LYS E CD  1 
ATOM 6579  C CE  . LYS E 1 68  ? 97.734  147.670 115.832 1.00 30.00  ? 68  LYS E CE  1 
ATOM 6580  N NZ  . LYS E 1 68  ? 97.121  148.752 115.030 1.00 30.00  ? 68  LYS E NZ  1 
ATOM 6581  N N   . THR E 1 69  ? 102.026 151.404 119.852 1.00 104.67 ? 69  THR E N   1 
ATOM 6582  C CA  . THR E 1 69  ? 103.061 151.544 120.860 1.00 117.77 ? 69  THR E CA  1 
ATOM 6583  C C   . THR E 1 69  ? 102.423 151.572 122.253 1.00 114.76 ? 69  THR E C   1 
ATOM 6584  O O   . THR E 1 69  ? 101.236 151.878 122.400 1.00 113.10 ? 69  THR E O   1 
ATOM 6585  C CB  . THR E 1 69  ? 103.843 152.833 120.584 1.00 30.00  ? 69  THR E CB  1 
ATOM 6586  O OG1 . THR E 1 69  ? 104.073 152.940 119.175 1.00 30.00  ? 69  THR E OG1 1 
ATOM 6587  C CG2 . THR E 1 69  ? 105.216 152.820 121.242 1.00 30.00  ? 69  THR E CG2 1 
ATOM 6588  N N   . TYR E 1 70  ? 103.223 151.231 123.274 1.00 95.58  ? 70  TYR E N   1 
ATOM 6589  C CA  . TYR E 1 70  ? 102.938 151.494 124.689 1.00 91.75  ? 70  TYR E CA  1 
ATOM 6590  C C   . TYR E 1 70  ? 101.677 150.770 125.176 1.00 97.36  ? 70  TYR E C   1 
ATOM 6591  O O   . TYR E 1 70  ? 100.638 151.385 125.408 1.00 106.50 ? 70  TYR E O   1 
ATOM 6592  C CB  . TYR E 1 70  ? 102.801 153.000 124.952 1.00 30.00  ? 70  TYR E CB  1 
ATOM 6593  C CG  . TYR E 1 70  ? 104.062 153.822 124.816 1.00 30.00  ? 70  TYR E CG  1 
ATOM 6594  C CD1 . TYR E 1 70  ? 105.317 153.228 124.799 1.00 30.00  ? 70  TYR E CD1 1 
ATOM 6595  C CD2 . TYR E 1 70  ? 103.992 155.208 124.713 1.00 30.00  ? 70  TYR E CD2 1 
ATOM 6596  C CE1 . TYR E 1 70  ? 106.468 153.992 124.671 1.00 30.00  ? 70  TYR E CE1 1 
ATOM 6597  C CE2 . TYR E 1 70  ? 105.132 155.977 124.587 1.00 30.00  ? 70  TYR E CE2 1 
ATOM 6598  C CZ  . TYR E 1 70  ? 106.364 155.365 124.567 1.00 30.00  ? 70  TYR E CZ  1 
ATOM 6599  O OH  . TYR E 1 70  ? 107.498 156.131 124.443 1.00 30.00  ? 70  TYR E OH  1 
ATOM 6600  N N   . VAL E 1 71  ? 101.781 149.440 125.275 1.00 94.49  ? 71  VAL E N   1 
ATOM 6601  C CA  . VAL E 1 71  ? 100.688 148.596 125.770 1.00 80.78  ? 71  VAL E CA  1 
ATOM 6602  C C   . VAL E 1 71  ? 100.296 148.960 127.204 1.00 87.45  ? 71  VAL E C   1 
ATOM 6603  O O   . VAL E 1 71  ? 101.145 149.032 128.099 1.00 96.24  ? 71  VAL E O   1 
ATOM 6604  C CB  . VAL E 1 71  ? 101.042 147.099 125.617 1.00 30.00  ? 71  VAL E CB  1 
ATOM 6605  C CG1 . VAL E 1 71  ? 102.370 146.758 126.215 1.00 30.00  ? 71  VAL E CG1 1 
ATOM 6606  C CG2 . VAL E 1 71  ? 100.004 146.245 126.275 1.00 30.00  ? 71  VAL E CG2 1 
ATOM 6607  N N   . GLU E 1 72  ? 99.009  149.246 127.425 1.00 85.64  ? 72  GLU E N   1 
ATOM 6608  C CA  . GLU E 1 72  ? 98.602  149.928 128.648 1.00 94.43  ? 72  GLU E CA  1 
ATOM 6609  C C   . GLU E 1 72  ? 97.771  149.092 129.615 1.00 97.09  ? 72  GLU E C   1 
ATOM 6610  O O   . GLU E 1 72  ? 98.060  149.098 130.811 1.00 121.72 ? 72  GLU E O   1 
ATOM 6611  C CB  . GLU E 1 72  ? 97.875  151.250 128.311 1.00 30.00  ? 72  GLU E CB  1 
ATOM 6612  C CG  . GLU E 1 72  ? 96.552  151.218 127.576 1.00 30.00  ? 72  GLU E CG  1 
ATOM 6613  C CD  . GLU E 1 72  ? 96.708  151.222 126.081 1.00 30.00  ? 72  GLU E CD  1 
ATOM 6614  O OE1 . GLU E 1 72  ? 97.790  150.852 125.586 1.00 30.00  ? 72  GLU E OE1 1 
ATOM 6615  O OE2 . GLU E 1 72  ? 95.749  151.633 125.398 1.00 30.00  ? 72  GLU E OE2 1 
ATOM 6616  N N   . LYS E 1 73  ? 96.747  148.378 129.172 1.00 88.72  ? 73  LYS E N   1 
ATOM 6617  C CA  . LYS E 1 73  ? 95.772  147.802 130.095 1.00 76.19  ? 73  LYS E CA  1 
ATOM 6618  C C   . LYS E 1 73  ? 95.988  146.297 130.200 1.00 76.39  ? 73  LYS E C   1 
ATOM 6619  O O   . LYS E 1 73  ? 95.588  145.543 129.313 1.00 99.03  ? 73  LYS E O   1 
ATOM 6620  C CB  . LYS E 1 73  ? 94.358  148.143 129.643 1.00 30.00  ? 73  LYS E CB  1 
ATOM 6621  C CG  . LYS E 1 73  ? 94.031  149.623 129.772 1.00 30.00  ? 73  LYS E CG  1 
ATOM 6622  C CD  . LYS E 1 73  ? 92.553  149.930 129.551 1.00 30.00  ? 73  LYS E CD  1 
ATOM 6623  C CE  . LYS E 1 73  ? 92.151  149.813 128.098 1.00 30.00  ? 73  LYS E CE  1 
ATOM 6624  N NZ  . LYS E 1 73  ? 90.738  150.235 127.898 1.00 30.00  ? 73  LYS E NZ  1 
ATOM 6625  N N   . LEU E 1 74  ? 96.598  145.861 131.296 1.00 86.10  ? 74  LEU E N   1 
ATOM 6626  C CA  . LEU E 1 74  ? 96.943  144.459 131.486 1.00 69.89  ? 74  LEU E CA  1 
ATOM 6627  C C   . LEU E 1 74  ? 95.874  143.763 132.322 1.00 74.51  ? 74  LEU E C   1 
ATOM 6628  O O   . LEU E 1 74  ? 95.140  144.400 133.081 1.00 105.24 ? 74  LEU E O   1 
ATOM 6629  C CB  . LEU E 1 74  ? 98.317  144.345 132.155 1.00 30.00  ? 74  LEU E CB  1 
ATOM 6630  C CG  . LEU E 1 74  ? 99.108  143.043 132.270 1.00 30.00  ? 74  LEU E CG  1 
ATOM 6631  C CD1 . LEU E 1 74  ? 100.570 143.395 132.266 1.00 30.00  ? 74  LEU E CD1 1 
ATOM 6632  C CD2 . LEU E 1 74  ? 98.797  142.287 133.538 1.00 30.00  ? 74  LEU E CD2 1 
ATOM 6633  N N   . ALA E 1 75  ? 95.777  142.443 132.156 1.00 74.85  ? 75  ALA E N   1 
ATOM 6634  C CA  . ALA E 1 75  ? 94.865  141.618 132.938 1.00 71.52  ? 75  ALA E CA  1 
ATOM 6635  C C   . ALA E 1 75  ? 95.461  140.231 133.098 1.00 78.01  ? 75  ALA E C   1 
ATOM 6636  O O   . ALA E 1 75  ? 95.607  139.503 132.114 1.00 114.52 ? 75  ALA E O   1 
ATOM 6637  C CB  . ALA E 1 75  ? 93.488  141.524 132.276 1.00 30.00  ? 75  ALA E CB  1 
ATOM 6638  N N   . ILE E 1 76  ? 95.771  139.861 134.335 1.00 65.73  ? 76  ILE E N   1 
ATOM 6639  C CA  . ILE E 1 76  ? 96.409  138.592 134.663 1.00 91.48  ? 76  ILE E CA  1 
ATOM 6640  C C   . ILE E 1 76  ? 95.367  137.636 135.233 1.00 89.44  ? 76  ILE E C   1 
ATOM 6641  O O   . ILE E 1 76  ? 94.722  137.940 136.243 1.00 103.39 ? 76  ILE E O   1 
ATOM 6642  C CB  . ILE E 1 76  ? 97.586  138.806 135.629 1.00 30.00  ? 76  ILE E CB  1 
ATOM 6643  C CG1 . ILE E 1 76  ? 98.048  137.494 136.253 1.00 30.00  ? 76  ILE E CG1 1 
ATOM 6644  C CG2 . ILE E 1 76  ? 97.312  139.892 136.635 1.00 30.00  ? 76  ILE E CG2 1 
ATOM 6645  C CD1 . ILE E 1 76  ? 99.218  137.682 137.188 1.00 30.00  ? 76  ILE E CD1 1 
ATOM 6646  N N   . TYR E 1 77  ? 95.192  136.485 134.578 1.00 92.49  ? 77  TYR E N   1 
ATOM 6647  C CA  . TYR E 1 77  ? 94.204  135.496 134.999 1.00 95.04  ? 77  TYR E CA  1 
ATOM 6648  C C   . TYR E 1 77  ? 94.820  134.617 136.076 1.00 90.68  ? 77  TYR E C   1 
ATOM 6649  O O   . TYR E 1 77  ? 95.829  133.952 135.839 1.00 88.28  ? 77  TYR E O   1 
ATOM 6650  C CB  . TYR E 1 77  ? 93.752  134.591 133.846 1.00 30.00  ? 77  TYR E CB  1 
ATOM 6651  C CG  . TYR E 1 77  ? 93.123  135.227 132.618 1.00 30.00  ? 77  TYR E CG  1 
ATOM 6652  C CD1 . TYR E 1 77  ? 92.707  136.546 132.604 1.00 30.00  ? 77  TYR E CD1 1 
ATOM 6653  C CD2 . TYR E 1 77  ? 92.943  134.479 131.462 1.00 30.00  ? 77  TYR E CD2 1 
ATOM 6654  C CE1 . TYR E 1 77  ? 92.142  137.111 131.476 1.00 30.00  ? 77  TYR E CE1 1 
ATOM 6655  C CE2 . TYR E 1 77  ? 92.382  135.032 130.329 1.00 30.00  ? 77  TYR E CE2 1 
ATOM 6656  C CZ  . TYR E 1 77  ? 91.981  136.346 130.343 1.00 30.00  ? 77  TYR E CZ  1 
ATOM 6657  O OH  . TYR E 1 77  ? 91.421  136.896 129.215 1.00 30.00  ? 77  TYR E OH  1 
ATOM 6658  N N   . ILE E 1 78  ? 94.208  134.596 137.252 1.00 100.82 ? 78  ILE E N   1 
ATOM 6659  C CA  . ILE E 1 78  ? 94.770  133.895 138.398 1.00 80.56  ? 78  ILE E CA  1 
ATOM 6660  C C   . ILE E 1 78  ? 93.765  132.903 138.960 1.00 87.00  ? 78  ILE E C   1 
ATOM 6661  O O   . ILE E 1 78  ? 92.601  133.245 139.194 1.00 104.52 ? 78  ILE E O   1 
ATOM 6662  C CB  . ILE E 1 78  ? 95.261  134.882 139.476 1.00 30.00  ? 78  ILE E CB  1 
ATOM 6663  C CG1 . ILE E 1 78  ? 96.663  135.368 139.110 1.00 30.00  ? 78  ILE E CG1 1 
ATOM 6664  C CG2 . ILE E 1 78  ? 95.169  134.324 140.889 1.00 30.00  ? 78  ILE E CG2 1 
ATOM 6665  C CD1 . ILE E 1 78  ? 97.256  136.325 140.087 1.00 30.00  ? 78  ILE E CD1 1 
ATOM 6666  N N   . SER E 1 79  ? 94.220  131.668 139.149 1.00 77.59  ? 79  SER E N   1 
ATOM 6667  C CA  . SER E 1 79  ? 93.524  130.607 139.850 1.00 81.74  ? 79  SER E CA  1 
ATOM 6668  C C   . SER E 1 79  ? 94.383  130.126 141.006 1.00 98.36  ? 79  SER E C   1 
ATOM 6669  O O   . SER E 1 79  ? 95.612  130.094 140.896 1.00 117.87 ? 79  SER E O   1 
ATOM 6670  C CB  . SER E 1 79  ? 93.221  129.427 138.916 1.00 30.00  ? 79  SER E CB  1 
ATOM 6671  O OG  . SER E 1 79  ? 92.617  128.358 139.626 1.00 30.00  ? 79  SER E OG  1 
ATOM 6672  N N   . PRO E 1 80  ? 93.774  129.759 142.122 1.00 92.20  ? 80  PRO E N   1 
ATOM 6673  C CA  . PRO E 1 80  ? 94.526  129.159 143.221 1.00 88.75  ? 80  PRO E CA  1 
ATOM 6674  C C   . PRO E 1 80  ? 94.715  127.671 142.959 1.00 95.71  ? 80  PRO E C   1 
ATOM 6675  O O   . PRO E 1 80  ? 94.047  127.072 142.120 1.00 117.12 ? 80  PRO E O   1 
ATOM 6676  C CB  . PRO E 1 80  ? 93.631  129.407 144.431 1.00 30.00  ? 80  PRO E CB  1 
ATOM 6677  C CG  . PRO E 1 80  ? 92.275  129.392 143.867 1.00 30.00  ? 80  PRO E CG  1 
ATOM 6678  C CD  . PRO E 1 80  ? 92.375  130.009 142.501 1.00 30.00  ? 80  PRO E CD  1 
ATOM 6679  N N   . ASN E 1 81  ? 95.634  127.074 143.711 1.00 89.04  ? 81  ASN E N   1 
ATOM 6680  C CA  . ASN E 1 81  ? 95.955  125.661 143.559 1.00 119.16 ? 81  ASN E CA  1 
ATOM 6681  C C   . ASN E 1 81  ? 94.847  124.795 144.153 1.00 129.92 ? 81  ASN E C   1 
ATOM 6682  O O   . ASN E 1 81  ? 93.799  125.282 144.586 1.00 123.56 ? 81  ASN E O   1 
ATOM 6683  C CB  . ASN E 1 81  ? 97.313  125.356 144.182 1.00 30.00  ? 81  ASN E CB  1 
ATOM 6684  C CG  . ASN E 1 81  ? 98.464  125.810 143.315 1.00 30.00  ? 81  ASN E CG  1 
ATOM 6685  O OD1 . ASN E 1 81  ? 98.440  125.638 142.099 1.00 30.00  ? 81  ASN E OD1 1 
ATOM 6686  N ND2 . ASN E 1 81  ? 99.483  126.383 143.933 1.00 30.00  ? 81  ASN E ND2 1 
ATOM 6687  N N   . ALA E 1 82  ? 95.081  123.481 144.168 1.00 129.27 ? 82  ALA E N   1 
ATOM 6688  C CA  . ALA E 1 82  ? 94.058  122.528 144.584 1.00 116.73 ? 82  ALA E CA  1 
ATOM 6689  C C   . ALA E 1 82  ? 93.748  122.664 146.069 1.00 106.52 ? 82  ALA E C   1 
ATOM 6690  O O   . ALA E 1 82  ? 92.614  122.968 146.454 1.00 96.85  ? 82  ALA E O   1 
ATOM 6691  C CB  . ALA E 1 82  ? 94.508  121.106 144.250 1.00 30.00  ? 82  ALA E CB  1 
ATOM 6692  N N   . GLY E 1 83  ? 94.750  122.478 146.916 1.00 114.15 ? 83  GLY E N   1 
ATOM 6693  C CA  . GLY E 1 83  ? 94.521  122.648 148.331 1.00 114.95 ? 83  GLY E CA  1 
ATOM 6694  C C   . GLY E 1 83  ? 94.639  124.102 148.718 1.00 115.25 ? 83  GLY E C   1 
ATOM 6695  O O   . GLY E 1 83  ? 95.742  124.614 148.906 1.00 115.65 ? 83  GLY E O   1 
ATOM 6696  N N   . SER E 1 84  ? 93.503  124.776 148.851 1.00 112.07 ? 84  SER E N   1 
ATOM 6697  C CA  . SER E 1 84  ? 93.489  126.198 149.151 1.00 124.31 ? 84  SER E CA  1 
ATOM 6698  C C   . SER E 1 84  ? 92.349  126.512 150.099 1.00 115.58 ? 84  SER E C   1 
ATOM 6699  O O   . SER E 1 84  ? 91.180  126.346 149.746 1.00 106.26 ? 84  SER E O   1 
ATOM 6700  C CB  . SER E 1 84  ? 93.329  127.027 147.880 1.00 30.00  ? 84  SER E CB  1 
ATOM 6701  O OG  . SER E 1 84  ? 93.069  128.374 148.210 1.00 30.00  ? 84  SER E OG  1 
ATOM 6702  N N   . GLU E 1 85  ? 92.688  126.959 151.302 1.00 118.56 ? 85  GLU E N   1 
ATOM 6703  C CA  . GLU E 1 85  ? 91.673  127.445 152.228 1.00 105.86 ? 85  GLU E CA  1 
ATOM 6704  C C   . GLU E 1 85  ? 91.676  128.973 152.251 1.00 107.85 ? 85  GLU E C   1 
ATOM 6705  O O   . GLU E 1 85  ? 92.123  129.617 153.200 1.00 104.84 ? 85  GLU E O   1 
ATOM 6706  C CB  . GLU E 1 85  ? 91.889  126.845 153.613 1.00 30.00  ? 85  GLU E CB  1 
ATOM 6707  C CG  . GLU E 1 85  ? 91.631  125.349 153.662 1.00 30.00  ? 85  GLU E CG  1 
ATOM 6708  C CD  . GLU E 1 85  ? 91.834  124.765 155.043 1.00 30.00  ? 85  GLU E CD  1 
ATOM 6709  O OE1 . GLU E 1 85  ? 92.297  125.500 155.939 1.00 30.00  ? 85  GLU E OE1 1 
ATOM 6710  O OE2 . GLU E 1 85  ? 91.527  123.570 155.235 1.00 30.00  ? 85  GLU E OE2 1 
ATOM 6711  N N   . GLY E 1 86  ? 91.159  129.544 151.164 1.00 113.31 ? 86  GLY E N   1 
ATOM 6712  C CA  . GLY E 1 86  ? 90.749  130.936 151.153 1.00 111.17 ? 86  GLY E CA  1 
ATOM 6713  C C   . GLY E 1 86  ? 91.818  132.006 151.246 1.00 101.55 ? 86  GLY E C   1 
ATOM 6714  O O   . GLY E 1 86  ? 91.944  132.642 152.297 1.00 106.00 ? 86  GLY E O   1 
ATOM 6715  N N   . ILE E 1 87  ? 92.614  132.209 150.197 1.00 75.80  ? 87  ILE E N   1 
ATOM 6716  C CA  . ILE E 1 87  ? 93.495  133.370 150.185 1.00 73.31  ? 87  ILE E CA  1 
ATOM 6717  C C   . ILE E 1 87  ? 92.645  134.614 149.988 1.00 100.35 ? 87  ILE E C   1 
ATOM 6718  O O   . ILE E 1 87  ? 92.030  134.798 148.932 1.00 117.40 ? 87  ILE E O   1 
ATOM 6719  C CB  . ILE E 1 87  ? 94.557  133.284 149.083 1.00 30.00  ? 87  ILE E CB  1 
ATOM 6720  C CG1 . ILE E 1 87  ? 95.406  132.027 149.186 1.00 30.00  ? 87  ILE E CG1 1 
ATOM 6721  C CG2 . ILE E 1 87  ? 95.463  134.484 149.162 1.00 30.00  ? 87  ILE E CG2 1 
ATOM 6722  C CD1 . ILE E 1 87  ? 95.003  130.966 148.217 1.00 30.00  ? 87  ILE E CD1 1 
ATOM 6723  N N   . ASP E 1 88  ? 92.605  135.469 151.000 1.00 103.88 ? 88  ASP E N   1 
ATOM 6724  C CA  . ASP E 1 88  ? 91.961  136.765 150.881 1.00 95.71  ? 88  ASP E CA  1 
ATOM 6725  C C   . ASP E 1 88  ? 92.769  137.615 149.914 1.00 94.42  ? 88  ASP E C   1 
ATOM 6726  O O   . ASP E 1 88  ? 93.990  137.486 149.823 1.00 101.39 ? 88  ASP E O   1 
ATOM 6727  C CB  . ASP E 1 88  ? 91.871  137.445 152.251 1.00 30.00  ? 88  ASP E CB  1 
ATOM 6728  C CG  . ASP E 1 88  ? 90.939  138.645 152.264 1.00 30.00  ? 88  ASP E CG  1 
ATOM 6729  O OD1 . ASP E 1 88  ? 90.363  138.992 151.212 1.00 30.00  ? 88  ASP E OD1 1 
ATOM 6730  O OD2 . ASP E 1 88  ? 90.782  139.246 153.347 1.00 30.00  ? 88  ASP E OD2 1 
ATOM 6731  N N   . LEU E 1 89  ? 92.084  138.482 149.182 1.00 99.19  ? 89  LEU E N   1 
ATOM 6732  C CA  . LEU E 1 89  ? 92.771  139.298 148.197 1.00 104.74 ? 89  LEU E CA  1 
ATOM 6733  C C   . LEU E 1 89  ? 92.909  140.757 148.605 1.00 110.40 ? 89  LEU E C   1 
ATOM 6734  O O   . LEU E 1 89  ? 93.636  141.500 147.940 1.00 132.98 ? 89  LEU E O   1 
ATOM 6735  C CB  . LEU E 1 89  ? 92.074  139.199 146.847 1.00 30.00  ? 89  LEU E CB  1 
ATOM 6736  C CG  . LEU E 1 89  ? 92.151  137.806 146.243 1.00 30.00  ? 89  LEU E CG  1 
ATOM 6737  C CD1 . LEU E 1 89  ? 91.439  137.831 144.932 1.00 30.00  ? 89  LEU E CD1 1 
ATOM 6738  C CD2 . LEU E 1 89  ? 93.584  137.374 146.060 1.00 30.00  ? 89  LEU E CD2 1 
ATOM 6739  N N   . ASN E 1 90  ? 92.229  141.189 149.670 1.00 101.49 ? 90  ASN E N   1 
ATOM 6740  C CA  . ASN E 1 90  ? 92.564  142.477 150.260 1.00 104.71 ? 90  ASN E CA  1 
ATOM 6741  C C   . ASN E 1 90  ? 93.977  142.441 150.830 1.00 105.99 ? 90  ASN E C   1 
ATOM 6742  O O   . ASN E 1 90  ? 94.697  143.443 150.767 1.00 109.37 ? 90  ASN E O   1 
ATOM 6743  C CB  . ASN E 1 90  ? 91.540  142.842 151.339 1.00 30.00  ? 90  ASN E CB  1 
ATOM 6744  C CG  . ASN E 1 90  ? 91.419  144.349 151.570 1.00 30.00  ? 90  ASN E CG  1 
ATOM 6745  O OD1 . ASN E 1 90  ? 90.459  144.810 152.187 1.00 30.00  ? 90  ASN E OD1 1 
ATOM 6746  N ND2 . ASN E 1 90  ? 92.372  145.117 151.060 1.00 30.00  ? 90  ASN E ND2 1 
ATOM 6747  N N   . ASN E 1 91  ? 94.390  141.297 151.375 1.00 96.80  ? 91  ASN E N   1 
ATOM 6748  C CA  . ASN E 1 91  ? 95.778  141.060 151.760 1.00 97.18  ? 91  ASN E CA  1 
ATOM 6749  C C   . ASN E 1 91  ? 96.452  140.236 150.667 1.00 103.39 ? 91  ASN E C   1 
ATOM 6750  O O   . ASN E 1 91  ? 96.793  139.070 150.852 1.00 107.67 ? 91  ASN E O   1 
ATOM 6751  C CB  . ASN E 1 91  ? 95.852  140.356 153.108 1.00 30.00  ? 91  ASN E CB  1 
ATOM 6752  C CG  . ASN E 1 91  ? 95.299  141.193 154.232 1.00 30.00  ? 91  ASN E CG  1 
ATOM 6753  O OD1 . ASN E 1 91  ? 94.304  140.832 154.857 1.00 30.00  ? 91  ASN E OD1 1 
ATOM 6754  N ND2 . ASN E 1 91  ? 95.940  142.320 154.498 1.00 30.00  ? 91  ASN E ND2 1 
ATOM 6755  N N   . THR E 1 92  ? 96.646  140.857 149.506 1.00 101.15 ? 92  THR E N   1 
ATOM 6756  C CA  . THR E 1 92  ? 97.399  140.222 148.430 1.00 84.54  ? 92  THR E CA  1 
ATOM 6757  C C   . THR E 1 92  ? 98.108  141.286 147.616 1.00 86.65  ? 92  THR E C   1 
ATOM 6758  O O   . THR E 1 92  ? 97.456  142.116 146.979 1.00 106.48 ? 92  THR E O   1 
ATOM 6759  C CB  . THR E 1 92  ? 96.502  139.397 147.515 1.00 30.00  ? 92  THR E CB  1 
ATOM 6760  O OG1 . THR E 1 92  ? 95.936  138.319 148.260 1.00 30.00  ? 92  THR E OG1 1 
ATOM 6761  C CG2 . THR E 1 92  ? 97.310  138.836 146.364 1.00 30.00  ? 92  THR E CG2 1 
ATOM 6762  N N   . ARG E 1 93  ? 99.431  141.246 147.624 1.00 78.31  ? 93  ARG E N   1 
ATOM 6763  C CA  . ARG E 1 93  ? 100.245 142.178 146.867 1.00 89.86  ? 93  ARG E CA  1 
ATOM 6764  C C   . ARG E 1 93  ? 100.609 141.537 145.540 1.00 89.07  ? 93  ARG E C   1 
ATOM 6765  O O   . ARG E 1 93  ? 101.108 140.411 145.504 1.00 106.87 ? 93  ARG E O   1 
ATOM 6766  C CB  . ARG E 1 93  ? 101.500 142.540 147.638 1.00 30.00  ? 93  ARG E CB  1 
ATOM 6767  C CG  . ARG E 1 93  ? 101.211 143.111 149.009 1.00 30.00  ? 93  ARG E CG  1 
ATOM 6768  C CD  . ARG E 1 93  ? 100.535 144.466 148.942 1.00 30.00  ? 93  ARG E CD  1 
ATOM 6769  N NE  . ARG E 1 93  ? 100.392 145.043 150.275 1.00 30.00  ? 93  ARG E NE  1 
ATOM 6770  C CZ  . ARG E 1 93  ? 99.314  144.907 151.038 1.00 30.00  ? 93  ARG E CZ  1 
ATOM 6771  N NH1 . ARG E 1 93  ? 98.268  144.229 150.593 1.00 30.00  ? 93  ARG E NH1 1 
ATOM 6772  N NH2 . ARG E 1 93  ? 99.280  145.459 152.241 1.00 30.00  ? 93  ARG E NH2 1 
ATOM 6773  N N   . VAL E 1 94  ? 100.342 142.245 144.449 1.00 84.22  ? 94  VAL E N   1 
ATOM 6774  C CA  . VAL E 1 94  ? 100.674 141.731 143.127 1.00 73.51  ? 94  VAL E CA  1 
ATOM 6775  C C   . VAL E 1 94  ? 101.869 142.522 142.620 1.00 86.10  ? 94  VAL E C   1 
ATOM 6776  O O   . VAL E 1 94  ? 101.712 143.584 142.012 1.00 102.58 ? 94  VAL E O   1 
ATOM 6777  C CB  . VAL E 1 94  ? 99.473  141.833 142.173 1.00 30.00  ? 94  VAL E CB  1 
ATOM 6778  C CG1 . VAL E 1 94  ? 99.800  141.237 140.817 1.00 30.00  ? 94  VAL E CG1 1 
ATOM 6779  C CG2 . VAL E 1 94  ? 98.277  141.147 142.781 1.00 30.00  ? 94  VAL E CG2 1 
ATOM 6780  N N   . VAL E 1 95  ? 103.073 142.022 142.885 1.00 80.17  ? 95  VAL E N   1 
ATOM 6781  C CA  . VAL E 1 95  ? 104.298 142.757 142.594 1.00 77.28  ? 95  VAL E CA  1 
ATOM 6782  C C   . VAL E 1 95  ? 104.702 142.410 141.169 1.00 86.14  ? 95  VAL E C   1 
ATOM 6783  O O   . VAL E 1 95  ? 104.794 141.240 140.806 1.00 98.38  ? 95  VAL E O   1 
ATOM 6784  C CB  . VAL E 1 95  ? 105.411 142.429 143.588 1.00 30.00  ? 95  VAL E CB  1 
ATOM 6785  C CG1 . VAL E 1 95  ? 106.674 143.182 143.230 1.00 30.00  ? 95  VAL E CG1 1 
ATOM 6786  C CG2 . VAL E 1 95  ? 104.975 142.773 144.989 1.00 30.00  ? 95  VAL E CG2 1 
ATOM 6787  N N   . LEU E 1 96  ? 104.917 143.434 140.354 1.00 91.86  ? 96  LEU E N   1 
ATOM 6788  C CA  . LEU E 1 96  ? 105.542 143.286 139.050 1.00 76.62  ? 96  LEU E CA  1 
ATOM 6789  C C   . LEU E 1 96  ? 106.603 144.363 138.893 1.00 90.23  ? 96  LEU E C   1 
ATOM 6790  O O   . LEU E 1 96  ? 106.357 145.534 139.191 1.00 122.98 ? 96  LEU E O   1 
ATOM 6791  C CB  . LEU E 1 96  ? 104.500 143.337 137.926 1.00 30.00  ? 96  LEU E CB  1 
ATOM 6792  C CG  . LEU E 1 96  ? 103.528 144.497 137.682 1.00 30.00  ? 96  LEU E CG  1 
ATOM 6793  C CD1 . LEU E 1 96  ? 104.096 145.580 136.786 1.00 30.00  ? 96  LEU E CD1 1 
ATOM 6794  C CD2 . LEU E 1 96  ? 102.233 143.958 137.100 1.00 30.00  ? 96  LEU E CD2 1 
ATOM 6795  N N   . SER E 1 97  ? 107.791 143.955 138.457 1.00 77.79  ? 97  SER E N   1 
ATOM 6796  C CA  . SER E 1 97  ? 108.913 144.869 138.299 1.00 80.19  ? 97  SER E CA  1 
ATOM 6797  C C   . SER E 1 97  ? 108.885 145.502 136.921 1.00 99.22  ? 97  SER E C   1 
ATOM 6798  O O   . SER E 1 97  ? 107.867 145.458 136.236 1.00 107.37 ? 97  SER E O   1 
ATOM 6799  C CB  . SER E 1 97  ? 110.237 144.140 138.505 1.00 30.00  ? 97  SER E CB  1 
ATOM 6800  O OG  . SER E 1 97  ? 110.468 143.206 137.468 1.00 30.00  ? 97  SER E OG  1 
ATOM 6801  N N   . ASN E 1 98  ? 109.985 146.129 136.528 1.00 30.00  ? 98  ASN E N   1 
ATOM 6802  C CA  . ASN E 1 98  ? 110.178 146.601 135.166 1.00 30.00  ? 98  ASN E CA  1 
ATOM 6803  C C   . ASN E 1 98  ? 111.647 146.353 134.874 1.00 30.00  ? 98  ASN E C   1 
ATOM 6804  O O   . ASN E 1 98  ? 112.290 145.568 135.575 1.00 30.00  ? 98  ASN E O   1 
ATOM 6805  C CB  . ASN E 1 98  ? 109.806 148.083 135.033 1.00 30.00  ? 98  ASN E CB  1 
ATOM 6806  C CG  . ASN E 1 98  ? 109.529 148.507 133.593 1.00 30.00  ? 98  ASN E CG  1 
ATOM 6807  O OD1 . ASN E 1 98  ? 109.570 147.687 132.681 1.00 30.00  ? 98  ASN E OD1 1 
ATOM 6808  N ND2 . ASN E 1 98  ? 109.272 149.794 133.388 1.00 30.00  ? 98  ASN E ND2 1 
ATOM 6809  N N   . GLY E 1 99  ? 112.191 146.984 133.839 1.00 30.00  ? 99  GLY E N   1 
ATOM 6810  C CA  . GLY E 1 99  ? 113.620 147.202 133.832 1.00 30.00  ? 99  GLY E CA  1 
ATOM 6811  C C   . GLY E 1 99  ? 114.075 148.188 134.888 1.00 30.00  ? 99  GLY E C   1 
ATOM 6812  O O   . GLY E 1 99  ? 115.224 148.117 135.335 1.00 30.00  ? 99  GLY E O   1 
ATOM 6813  N N   . THR E 1 100 ? 113.200 149.102 135.307 1.00 85.87  ? 100 THR E N   1 
ATOM 6814  C CA  . THR E 1 100 ? 113.591 150.162 136.224 1.00 102.79 ? 100 THR E CA  1 
ATOM 6815  C C   . THR E 1 100 ? 112.787 150.189 137.515 1.00 104.11 ? 100 THR E C   1 
ATOM 6816  O O   . THR E 1 100 ? 113.376 150.249 138.600 1.00 96.07  ? 100 THR E O   1 
ATOM 6817  C CB  . THR E 1 100 ? 113.482 151.508 135.504 1.00 30.00  ? 100 THR E CB  1 
ATOM 6818  O OG1 . THR E 1 100 ? 114.319 151.484 134.342 1.00 30.00  ? 100 THR E OG1 1 
ATOM 6819  C CG2 . THR E 1 100 ? 113.929 152.636 136.413 1.00 30.00  ? 100 THR E CG2 1 
ATOM 6820  N N   . VAL E 1 101 ? 111.461 150.132 137.445 1.00 97.64  ? 101 VAL E N   1 
ATOM 6821  C CA  . VAL E 1 101 ? 110.600 150.499 138.565 1.00 100.35 ? 101 VAL E CA  1 
ATOM 6822  C C   . VAL E 1 101 ? 109.934 149.259 139.141 1.00 117.38 ? 101 VAL E C   1 
ATOM 6823  O O   . VAL E 1 101 ? 109.110 148.625 138.475 1.00 123.46 ? 101 VAL E O   1 
ATOM 6824  C CB  . VAL E 1 101 ? 109.536 151.523 138.136 1.00 30.00  ? 101 VAL E CB  1 
ATOM 6825  C CG1 . VAL E 1 101 ? 108.604 151.836 139.288 1.00 30.00  ? 101 VAL E CG1 1 
ATOM 6826  C CG2 . VAL E 1 101 ? 110.198 152.789 137.623 1.00 30.00  ? 101 VAL E CG2 1 
ATOM 6827  N N   . GLN E 1 102 ? 110.285 148.921 140.379 1.00 107.35 ? 102 GLN E N   1 
ATOM 6828  C CA  . GLN E 1 102 ? 109.502 147.969 141.149 1.00 99.10  ? 102 GLN E CA  1 
ATOM 6829  C C   . GLN E 1 102 ? 108.193 148.619 141.584 1.00 93.31  ? 102 GLN E C   1 
ATOM 6830  O O   . GLN E 1 102 ? 108.128 149.819 141.853 1.00 114.39 ? 102 GLN E O   1 
ATOM 6831  C CB  . GLN E 1 102 ? 110.262 147.517 142.395 1.00 30.00  ? 102 GLN E CB  1 
ATOM 6832  C CG  . GLN E 1 102 ? 111.604 146.845 142.170 1.00 30.00  ? 102 GLN E CG  1 
ATOM 6833  C CD  . GLN E 1 102 ? 111.496 145.478 141.546 1.00 30.00  ? 102 GLN E CD  1 
ATOM 6834  O OE1 . GLN E 1 102 ? 110.550 144.737 141.803 1.00 30.00  ? 102 GLN E OE1 1 
ATOM 6835  N NE2 . GLN E 1 102 ? 112.491 145.118 140.748 1.00 30.00  ? 102 GLN E NE2 1 
ATOM 6836  N N   . ALA E 1 103 ? 107.140 147.812 141.685 1.00 90.25  ? 103 ALA E N   1 
ATOM 6837  C CA  . ALA E 1 103 ? 105.871 148.331 142.175 1.00 88.34  ? 103 ALA E CA  1 
ATOM 6838  C C   . ALA E 1 103 ? 105.102 147.224 142.877 1.00 104.79 ? 103 ALA E C   1 
ATOM 6839  O O   . ALA E 1 103 ? 105.035 146.098 142.382 1.00 117.96 ? 103 ALA E O   1 
ATOM 6840  C CB  . ALA E 1 103 ? 105.025 148.917 141.040 1.00 30.00  ? 103 ALA E CB  1 
ATOM 6841  N N   . VAL E 1 104 ? 104.544 147.550 144.037 1.00 94.80  ? 104 VAL E N   1 
ATOM 6842  C CA  . VAL E 1 104 ? 103.547 146.714 144.686 1.00 109.96 ? 104 VAL E CA  1 
ATOM 6843  C C   . VAL E 1 104 ? 102.185 147.205 144.235 1.00 89.25  ? 104 VAL E C   1 
ATOM 6844  O O   . VAL E 1 104 ? 102.035 148.346 143.790 1.00 75.68  ? 104 VAL E O   1 
ATOM 6845  C CB  . VAL E 1 104 ? 103.651 146.741 146.224 1.00 30.00  ? 104 VAL E CB  1 
ATOM 6846  C CG1 . VAL E 1 104 ? 104.971 146.155 146.676 1.00 30.00  ? 104 VAL E CG1 1 
ATOM 6847  C CG2 . VAL E 1 104 ? 103.496 148.160 146.737 1.00 30.00  ? 104 VAL E CG2 1 
ATOM 6848  N N   . LEU E 1 105 ? 101.190 146.330 144.320 1.00 88.49  ? 105 LEU E N   1 
ATOM 6849  C CA  . LEU E 1 105 ? 99.831  146.658 143.906 1.00 98.24  ? 105 LEU E CA  1 
ATOM 6850  C C   . LEU E 1 105 ? 98.882  146.336 145.051 1.00 91.87  ? 105 LEU E C   1 
ATOM 6851  O O   . LEU E 1 105 ? 98.552  145.169 145.280 1.00 103.67 ? 105 LEU E O   1 
ATOM 6852  C CB  . LEU E 1 105 ? 99.440  145.903 142.636 1.00 30.00  ? 105 LEU E CB  1 
ATOM 6853  C CG  . LEU E 1 105 ? 99.761  146.473 141.243 1.00 30.00  ? 105 LEU E CG  1 
ATOM 6854  C CD1 . LEU E 1 105 ? 99.046  147.789 141.028 1.00 30.00  ? 105 LEU E CD1 1 
ATOM 6855  C CD2 . LEU E 1 105 ? 101.240 146.633 140.934 1.00 30.00  ? 105 LEU E CD2 1 
ATOM 6856  N N   . LYS E 1 106 ? 98.457  147.365 145.774 1.00 80.59  ? 106 LYS E N   1 
ATOM 6857  C CA  . LYS E 1 106 ? 97.498  147.222 146.858 1.00 95.20  ? 106 LYS E CA  1 
ATOM 6858  C C   . LYS E 1 106 ? 96.132  146.909 146.265 1.00 109.74 ? 106 LYS E C   1 
ATOM 6859  O O   . LYS E 1 106 ? 95.833  147.286 145.130 1.00 125.41 ? 106 LYS E O   1 
ATOM 6860  C CB  . LYS E 1 106 ? 97.445  148.507 147.694 1.00 30.00  ? 106 LYS E CB  1 
ATOM 6861  C CG  . LYS E 1 106 ? 96.651  148.433 148.997 1.00 30.00  ? 106 LYS E CG  1 
ATOM 6862  C CD  . LYS E 1 106 ? 96.733  149.727 149.786 1.00 30.00  ? 106 LYS E CD  1 
ATOM 6863  C CE  . LYS E 1 106 ? 95.888  150.814 149.152 1.00 30.00  ? 106 LYS E CE  1 
ATOM 6864  N NZ  . LYS E 1 106 ? 94.439  150.507 149.268 1.00 30.00  ? 106 LYS E NZ  1 
ATOM 6865  N N   . TYR E 1 107 ? 95.313  146.191 147.028 1.00 113.92 ? 107 TYR E N   1 
ATOM 6866  C CA  . TYR E 1 107 ? 93.972  145.863 146.568 1.00 120.86 ? 107 TYR E CA  1 
ATOM 6867  C C   . TYR E 1 107 ? 93.084  147.100 146.533 1.00 104.10 ? 107 TYR E C   1 
ATOM 6868  O O   . TYR E 1 107 ? 93.161  147.969 147.404 1.00 105.66 ? 107 TYR E O   1 
ATOM 6869  C CB  . TYR E 1 107 ? 93.351  144.792 147.458 1.00 30.00  ? 107 TYR E CB  1 
ATOM 6870  C CG  . TYR E 1 107 ? 91.941  144.444 147.060 1.00 30.00  ? 107 TYR E CG  1 
ATOM 6871  C CD1 . TYR E 1 107 ? 91.687  143.722 145.908 1.00 30.00  ? 107 TYR E CD1 1 
ATOM 6872  C CD2 . TYR E 1 107 ? 90.864  144.844 147.834 1.00 30.00  ? 107 TYR E CD2 1 
ATOM 6873  C CE1 . TYR E 1 107 ? 90.398  143.408 145.539 1.00 30.00  ? 107 TYR E CE1 1 
ATOM 6874  C CE2 . TYR E 1 107 ? 89.569  144.533 147.469 1.00 30.00  ? 107 TYR E CE2 1 
ATOM 6875  C CZ  . TYR E 1 107 ? 89.344  143.816 146.323 1.00 30.00  ? 107 TYR E CZ  1 
ATOM 6876  O OH  . TYR E 1 107 ? 88.057  143.506 145.966 1.00 30.00  ? 107 TYR E OH  1 
ATOM 6877  N N   . GLU E 1 108 ? 92.244  147.172 145.510 1.00 101.18 ? 108 GLU E N   1 
ATOM 6878  C CA  . GLU E 1 108 ? 91.333  148.282 145.304 1.00 107.42 ? 108 GLU E CA  1 
ATOM 6879  C C   . GLU E 1 108 ? 89.905  147.763 145.366 1.00 97.36  ? 108 GLU E C   1 
ATOM 6880  O O   . GLU E 1 108 ? 89.626  146.643 144.928 1.00 99.71  ? 108 GLU E O   1 
ATOM 6881  C CB  . GLU E 1 108 ? 91.617  148.950 143.954 1.00 30.00  ? 108 GLU E CB  1 
ATOM 6882  C CG  . GLU E 1 108 ? 90.776  150.166 143.608 1.00 30.00  ? 108 GLU E CG  1 
ATOM 6883  C CD  . GLU E 1 108 ? 91.046  151.357 144.501 1.00 30.00  ? 108 GLU E CD  1 
ATOM 6884  O OE1 . GLU E 1 108 ? 92.166  151.461 145.038 1.00 30.00  ? 108 GLU E OE1 1 
ATOM 6885  O OE2 . GLU E 1 108 ? 90.136  152.198 144.661 1.00 30.00  ? 108 GLU E OE2 1 
ATOM 6886  N N   . LYS E 1 109 ? 89.011  148.564 145.942 1.00 87.60  ? 109 LYS E N   1 
ATOM 6887  C CA  . LYS E 1 109 ? 87.587  148.271 145.925 1.00 83.82  ? 109 LYS E CA  1 
ATOM 6888  C C   . LYS E 1 109 ? 86.965  148.757 144.618 1.00 93.03  ? 109 LYS E C   1 
ATOM 6889  O O   . LYS E 1 109 ? 87.658  149.175 143.686 1.00 117.66 ? 109 LYS E O   1 
ATOM 6890  C CB  . LYS E 1 109 ? 86.889  148.930 147.112 1.00 30.00  ? 109 LYS E CB  1 
ATOM 6891  C CG  . LYS E 1 109 ? 87.291  148.403 148.472 1.00 30.00  ? 109 LYS E CG  1 
ATOM 6892  C CD  . LYS E 1 109 ? 86.539  149.153 149.563 1.00 30.00  ? 109 LYS E CD  1 
ATOM 6893  C CE  . LYS E 1 109 ? 86.945  148.692 150.953 1.00 30.00  ? 109 LYS E CE  1 
ATOM 6894  N NZ  . LYS E 1 109 ? 86.233  149.447 152.026 1.00 30.00  ? 109 LYS E NZ  1 
ATOM 6895  N N   . THR E 1 110 ? 85.631  148.701 144.570 1.00 94.95  ? 110 THR E N   1 
ATOM 6896  C CA  . THR E 1 110 ? 84.782  149.347 143.557 1.00 121.68 ? 110 THR E CA  1 
ATOM 6897  C C   . THR E 1 110 ? 85.122  148.916 142.132 1.00 133.18 ? 110 THR E C   1 
ATOM 6898  O O   . THR E 1 110 ? 85.091  149.718 141.197 1.00 143.94 ? 110 THR E O   1 
ATOM 6899  C CB  . THR E 1 110 ? 84.833  150.876 143.669 1.00 30.00  ? 110 THR E CB  1 
ATOM 6900  O OG1 . THR E 1 110 ? 86.128  151.360 143.291 1.00 30.00  ? 110 THR E OG1 1 
ATOM 6901  C CG2 . THR E 1 110 ? 84.532  151.317 145.088 1.00 30.00  ? 110 THR E CG2 1 
ATOM 6902  N N   . ALA E 1 111 ? 85.460  147.638 141.960 1.00 106.50 ? 111 ALA E N   1 
ATOM 6903  C CA  . ALA E 1 111 ? 85.839  147.189 140.620 1.00 107.45 ? 111 ALA E CA  1 
ATOM 6904  C C   . ALA E 1 111 ? 85.447  145.722 140.433 1.00 124.52 ? 111 ALA E C   1 
ATOM 6905  O O   . ALA E 1 111 ? 86.263  144.834 140.669 1.00 140.43 ? 111 ALA E O   1 
ATOM 6906  C CB  . ALA E 1 111 ? 87.333  147.388 140.413 1.00 30.00  ? 111 ALA E CB  1 
ATOM 6907  N N   . TYR E 1 112 ? 84.226  145.475 139.944 1.00 30.00  ? 112 TYR E N   1 
ATOM 6908  C CA  . TYR E 1 112 ? 83.836  144.100 139.628 1.00 30.00  ? 112 TYR E CA  1 
ATOM 6909  C C   . TYR E 1 112 ? 83.496  143.861 138.163 1.00 30.00  ? 112 TYR E C   1 
ATOM 6910  O O   . TYR E 1 112 ? 84.265  143.165 137.497 1.00 30.00  ? 112 TYR E O   1 
ATOM 6911  C CB  . TYR E 1 112 ? 82.680  143.671 140.535 1.00 30.00  ? 112 TYR E CB  1 
ATOM 6912  C CG  . TYR E 1 112 ? 83.169  143.245 141.894 1.00 30.00  ? 112 TYR E CG  1 
ATOM 6913  C CD1 . TYR E 1 112 ? 84.447  142.738 142.048 1.00 30.00  ? 112 TYR E CD1 1 
ATOM 6914  C CD2 . TYR E 1 112 ? 82.382  143.391 143.021 1.00 30.00  ? 112 TYR E CD2 1 
ATOM 6915  C CE1 . TYR E 1 112 ? 84.916  142.363 143.260 1.00 30.00  ? 112 TYR E CE1 1 
ATOM 6916  C CE2 . TYR E 1 112 ? 82.852  143.014 144.253 1.00 30.00  ? 112 TYR E CE2 1 
ATOM 6917  C CZ  . TYR E 1 112 ? 84.125  142.503 144.361 1.00 30.00  ? 112 TYR E CZ  1 
ATOM 6918  O OH  . TYR E 1 112 ? 84.639  142.122 145.569 1.00 30.00  ? 112 TYR E OH  1 
ATOM 6919  N N   . HIS E 1 113 ? 82.430  144.469 137.627 1.00 30.00  ? 113 HIS E N   1 
ATOM 6920  C CA  . HIS E 1 113 ? 81.967  144.285 136.239 1.00 30.00  ? 113 HIS E CA  1 
ATOM 6921  C C   . HIS E 1 113 ? 81.852  142.800 135.866 1.00 30.00  ? 113 HIS E C   1 
ATOM 6922  O O   . HIS E 1 113 ? 82.623  142.262 135.070 1.00 30.00  ? 113 HIS E O   1 
ATOM 6923  C CB  . HIS E 1 113 ? 82.882  145.058 135.284 1.00 30.00  ? 113 HIS E CB  1 
ATOM 6924  C CG  . HIS E 1 113 ? 82.493  144.994 133.840 1.00 30.00  ? 113 HIS E CG  1 
ATOM 6925  N ND1 . HIS E 1 113 ? 81.360  145.599 133.343 1.00 30.00  ? 113 HIS E ND1 1 
ATOM 6926  C CD2 . HIS E 1 113 ? 83.122  144.439 132.778 1.00 30.00  ? 113 HIS E CD2 1 
ATOM 6927  C CE1 . HIS E 1 113 ? 81.299  145.404 132.039 1.00 30.00  ? 113 HIS E CE1 1 
ATOM 6928  N NE2 . HIS E 1 113 ? 82.353  144.699 131.671 1.00 30.00  ? 113 HIS E NE2 1 
ATOM 6929  N N   . LYS E 1 114 ? 80.915  142.116 136.516 1.00 30.00  ? 114 LYS E N   1 
ATOM 6930  C CA  . LYS E 1 114 ? 80.864  140.662 136.458 1.00 30.00  ? 114 LYS E CA  1 
ATOM 6931  C C   . LYS E 1 114 ? 79.732  140.104 135.605 1.00 30.00  ? 114 LYS E C   1 
ATOM 6932  O O   . LYS E 1 114 ? 79.589  138.880 135.527 1.00 30.00  ? 114 LYS E O   1 
ATOM 6933  C CB  . LYS E 1 114 ? 80.768  140.091 137.874 1.00 30.00  ? 114 LYS E CB  1 
ATOM 6934  C CG  . LYS E 1 114 ? 79.521  140.480 138.625 1.00 30.00  ? 114 LYS E CG  1 
ATOM 6935  C CD  . LYS E 1 114 ? 79.551  139.913 140.028 1.00 30.00  ? 114 LYS E CD  1 
ATOM 6936  C CE  . LYS E 1 114 ? 78.296  140.274 140.792 1.00 30.00  ? 114 LYS E CE  1 
ATOM 6937  N NZ  . LYS E 1 114 ? 78.317  139.707 142.166 1.00 30.00  ? 114 LYS E NZ  1 
ATOM 6938  N N   . GLY E 1 115 ? 78.934  140.950 134.959 1.00 30.00  ? 115 GLY E N   1 
ATOM 6939  C CA  . GLY E 1 115 ? 77.830  140.454 134.158 1.00 30.00  ? 115 GLY E CA  1 
ATOM 6940  C C   . GLY E 1 115 ? 77.889  140.848 132.697 1.00 30.00  ? 115 GLY E C   1 
ATOM 6941  O O   . GLY E 1 115 ? 77.382  140.128 131.832 1.00 30.00  ? 115 GLY E O   1 
ATOM 6942  N N   . ALA E 1 116 ? 78.514  141.986 132.408 1.00 30.00  ? 116 ALA E N   1 
ATOM 6943  C CA  . ALA E 1 116 ? 78.669  142.496 131.047 1.00 30.00  ? 116 ALA E CA  1 
ATOM 6944  C C   . ALA E 1 116 ? 80.084  142.266 130.533 1.00 30.00  ? 116 ALA E C   1 
ATOM 6945  O O   . ALA E 1 116 ? 80.678  143.116 129.863 1.00 30.00  ? 116 ALA E O   1 
ATOM 6946  C CB  . ALA E 1 116 ? 78.291  143.972 130.985 1.00 30.00  ? 116 ALA E CB  1 
ATOM 6947  N N   . VAL E 1 117 ? 80.624  141.084 130.825 1.00 30.00  ? 117 VAL E N   1 
ATOM 6948  C CA  . VAL E 1 117 ? 82.046  140.756 130.776 1.00 30.00  ? 117 VAL E CA  1 
ATOM 6949  C C   . VAL E 1 117 ? 82.452  140.337 129.360 1.00 30.00  ? 117 VAL E C   1 
ATOM 6950  O O   . VAL E 1 117 ? 83.560  139.839 129.130 1.00 30.00  ? 117 VAL E O   1 
ATOM 6951  C CB  . VAL E 1 117 ? 82.317  139.667 131.841 1.00 30.00  ? 117 VAL E CB  1 
ATOM 6952  C CG1 . VAL E 1 117 ? 81.675  138.343 131.447 1.00 30.00  ? 117 VAL E CG1 1 
ATOM 6953  C CG2 . VAL E 1 117 ? 83.795  139.558 132.272 1.00 30.00  ? 117 VAL E CG2 1 
ATOM 6954  N N   . GLY E 1 118 ? 81.560  140.557 128.393 1.00 30.00  ? 118 GLY E N   1 
ATOM 6955  C CA  . GLY E 1 118 ? 81.801  140.161 127.016 1.00 30.00  ? 118 GLY E CA  1 
ATOM 6956  C C   . GLY E 1 118 ? 82.946  140.876 126.336 1.00 30.00  ? 118 GLY E C   1 
ATOM 6957  O O   . GLY E 1 118 ? 83.561  140.309 125.431 1.00 30.00  ? 118 GLY E O   1 
ATOM 6958  N N   . ASP E 1 119 ? 83.241  142.104 126.738 1.00 30.00  ? 119 ASP E N   1 
ATOM 6959  C CA  . ASP E 1 119 ? 84.431  142.812 126.283 1.00 30.00  ? 119 ASP E CA  1 
ATOM 6960  C C   . ASP E 1 119 ? 85.220  143.147 127.540 1.00 30.00  ? 119 ASP E C   1 
ATOM 6961  O O   . ASP E 1 119 ? 84.860  144.082 128.262 1.00 30.00  ? 119 ASP E O   1 
ATOM 6962  C CB  . ASP E 1 119 ? 84.072  144.070 125.495 1.00 30.00  ? 119 ASP E CB  1 
ATOM 6963  C CG  . ASP E 1 119 ? 83.252  143.769 124.249 1.00 30.00  ? 119 ASP E CG  1 
ATOM 6964  O OD1 . ASP E 1 119 ? 83.333  142.641 123.729 1.00 30.00  ? 119 ASP E OD1 1 
ATOM 6965  O OD2 . ASP E 1 119 ? 82.527  144.670 123.777 1.00 30.00  ? 119 ASP E OD2 1 
ATOM 6966  N N   . VAL E 1 120 ? 86.283  142.372 127.800 1.00 30.00  ? 120 VAL E N   1 
ATOM 6967  C CA  . VAL E 1 120 ? 86.959  142.385 129.100 1.00 30.00  ? 120 VAL E CA  1 
ATOM 6968  C C   . VAL E 1 120 ? 87.616  143.736 129.350 1.00 30.00  ? 120 VAL E C   1 
ATOM 6969  O O   . VAL E 1 120 ? 87.678  144.221 130.486 1.00 30.00  ? 120 VAL E O   1 
ATOM 6970  C CB  . VAL E 1 120 ? 87.978  141.230 129.164 1.00 30.00  ? 120 VAL E CB  1 
ATOM 6971  C CG1 . VAL E 1 120 ? 88.643  141.144 130.520 1.00 30.00  ? 120 VAL E CG1 1 
ATOM 6972  C CG2 . VAL E 1 120 ? 87.318  139.919 128.828 1.00 30.00  ? 120 VAL E CG2 1 
ATOM 6973  N N   . PHE E 1 121 ? 88.033  144.402 128.281 1.00 30.00  ? 121 PHE E N   1 
ATOM 6974  C CA  . PHE E 1 121 ? 88.779  145.646 128.360 1.00 30.00  ? 121 PHE E CA  1 
ATOM 6975  C C   . PHE E 1 121 ? 87.902  146.867 128.120 1.00 30.00  ? 121 PHE E C   1 
ATOM 6976  O O   . PHE E 1 121 ? 88.412  147.953 127.831 1.00 30.00  ? 121 PHE E O   1 
ATOM 6977  C CB  . PHE E 1 121 ? 89.931  145.573 127.367 1.00 30.00  ? 121 PHE E CB  1 
ATOM 6978  C CG  . PHE E 1 121 ? 90.954  144.557 127.746 1.00 30.00  ? 121 PHE E CG  1 
ATOM 6979  C CD1 . PHE E 1 121 ? 91.205  144.291 129.079 1.00 30.00  ? 121 PHE E CD1 1 
ATOM 6980  C CD2 . PHE E 1 121 ? 91.569  143.782 126.788 1.00 30.00  ? 121 PHE E CD2 1 
ATOM 6981  C CE1 . PHE E 1 121 ? 92.119  143.346 129.443 1.00 30.00  ? 121 PHE E CE1 1 
ATOM 6982  C CE2 . PHE E 1 121 ? 92.481  142.824 127.154 1.00 30.00  ? 121 PHE E CE2 1 
ATOM 6983  C CZ  . PHE E 1 121 ? 92.753  142.614 128.481 1.00 30.00  ? 121 PHE E CZ  1 
ATOM 6984  N N   . ASN E 1 122 ? 86.588  146.708 128.237 1.00 30.00  ? 122 ASN E N   1 
ATOM 6985  C CA  . ASN E 1 122 ? 85.695  147.850 128.135 1.00 30.00  ? 122 ASN E CA  1 
ATOM 6986  C C   . ASN E 1 122 ? 85.784  148.664 129.419 1.00 30.00  ? 122 ASN E C   1 
ATOM 6987  O O   . ASN E 1 122 ? 85.810  148.109 130.521 1.00 30.00  ? 122 ASN E O   1 
ATOM 6988  C CB  . ASN E 1 122 ? 84.258  147.386 127.891 1.00 30.00  ? 122 ASN E CB  1 
ATOM 6989  C CG  . ASN E 1 122 ? 83.357  148.498 127.386 1.00 30.00  ? 122 ASN E CG  1 
ATOM 6990  O OD1 . ASN E 1 122 ? 83.804  149.617 127.149 1.00 30.00  ? 122 ASN E OD1 1 
ATOM 6991  N ND2 . ASN E 1 122 ? 82.080  148.190 127.220 1.00 30.00  ? 122 ASN E ND2 1 
ATOM 6992  N N   . ALA E 1 123 ? 85.838  149.988 129.272 1.00 30.00  ? 123 ALA E N   1 
ATOM 6993  C CA  . ALA E 1 123 ? 86.044  150.880 130.408 1.00 30.00  ? 123 ALA E CA  1 
ATOM 6994  C C   . ALA E 1 123 ? 84.793  150.994 131.269 1.00 30.00  ? 123 ALA E C   1 
ATOM 6995  O O   . ALA E 1 123 ? 84.099  152.015 131.238 1.00 30.00  ? 123 ALA E O   1 
ATOM 6996  C CB  . ALA E 1 123 ? 86.478  152.267 129.930 1.00 30.00  ? 123 ALA E CB  1 
ATOM 6997  N N   . SER E 1 124 ? 84.514  149.956 132.051 1.00 30.00  ? 124 SER E N   1 
ATOM 6998  C CA  . SER E 1 124 ? 83.389  149.924 132.972 1.00 30.00  ? 124 SER E CA  1 
ATOM 6999  C C   . SER E 1 124 ? 83.757  150.663 134.254 1.00 30.00  ? 124 SER E C   1 
ATOM 7000  O O   . SER E 1 124 ? 84.749  151.393 134.320 1.00 30.00  ? 124 SER E O   1 
ATOM 7001  C CB  . SER E 1 124 ? 82.983  148.485 133.266 1.00 30.00  ? 124 SER E CB  1 
ATOM 7002  O OG  . SER E 1 124 ? 81.934  148.429 134.217 1.00 30.00  ? 124 SER E OG  1 
ATOM 7003  N N   . THR E 1 125 ? 82.955  150.469 135.305 1.00 30.00  ? 125 THR E N   1 
ATOM 7004  C CA  . THR E 1 125 ? 83.337  150.959 136.624 1.00 30.00  ? 125 THR E CA  1 
ATOM 7005  C C   . THR E 1 125 ? 84.490  150.166 137.228 1.00 30.00  ? 125 THR E C   1 
ATOM 7006  O O   . THR E 1 125 ? 85.028  150.574 138.262 1.00 30.00  ? 125 THR E O   1 
ATOM 7007  C CB  . THR E 1 125 ? 82.143  150.925 137.577 1.00 30.00  ? 125 THR E CB  1 
ATOM 7008  O OG1 . THR E 1 125 ? 81.662  149.580 137.694 1.00 30.00  ? 125 THR E OG1 1 
ATOM 7009  C CG2 . THR E 1 125 ? 81.028  151.824 137.066 1.00 30.00  ? 125 THR E CG2 1 
ATOM 7010  N N   . ALA E 1 126 ? 84.886  149.055 136.607 1.00 30.00  ? 126 ALA E N   1 
ATOM 7011  C CA  . ALA E 1 126 ? 85.978  148.229 137.090 1.00 30.00  ? 126 ALA E CA  1 
ATOM 7012  C C   . ALA E 1 126 ? 87.322  148.605 136.499 1.00 30.00  ? 126 ALA E C   1 
ATOM 7013  O O   . ALA E 1 126 ? 88.165  147.725 136.299 1.00 30.00  ? 126 ALA E O   1 
ATOM 7014  C CB  . ALA E 1 126 ? 85.689  146.763 136.813 1.00 30.00  ? 126 ALA E CB  1 
ATOM 7015  N N   . TRP E 1 127 ? 87.525  149.883 136.194 1.00 30.00  ? 127 TRP E N   1 
ATOM 7016  C CA  . TRP E 1 127 ? 88.823  150.418 135.809 1.00 30.00  ? 127 TRP E CA  1 
ATOM 7017  C C   . TRP E 1 127 ? 89.092  151.755 136.477 1.00 30.00  ? 127 TRP E C   1 
ATOM 7018  O O   . TRP E 1 127 ? 90.128  152.372 136.211 1.00 30.00  ? 127 TRP E O   1 
ATOM 7019  C CB  . TRP E 1 127 ? 88.906  150.561 134.292 1.00 30.00  ? 127 TRP E CB  1 
ATOM 7020  C CG  . TRP E 1 127 ? 88.948  149.259 133.579 1.00 30.00  ? 127 TRP E CG  1 
ATOM 7021  C CD1 . TRP E 1 127 ? 87.883  148.497 133.208 1.00 30.00  ? 127 TRP E CD1 1 
ATOM 7022  C CD2 . TRP E 1 127 ? 90.108  148.596 133.078 1.00 30.00  ? 127 TRP E CD2 1 
ATOM 7023  N NE1 . TRP E 1 127 ? 88.311  147.375 132.544 1.00 30.00  ? 127 TRP E NE1 1 
ATOM 7024  C CE2 . TRP E 1 127 ? 89.675  147.416 132.446 1.00 30.00  ? 127 TRP E CE2 1 
ATOM 7025  C CE3 . TRP E 1 127 ? 91.470  148.879 133.113 1.00 30.00  ? 127 TRP E CE3 1 
ATOM 7026  C CZ2 . TRP E 1 127 ? 90.556  146.522 131.857 1.00 30.00  ? 127 TRP E CZ2 1 
ATOM 7027  C CZ3 . TRP E 1 127 ? 92.340  147.988 132.536 1.00 30.00  ? 127 TRP E CZ3 1 
ATOM 7028  C CH2 . TRP E 1 127 ? 91.881  146.832 131.896 1.00 30.00  ? 127 TRP E CH2 1 
ATOM 7029  N N   . ASN E 1 128 ? 88.186  152.214 137.337 1.00 30.00  ? 128 ASN E N   1 
ATOM 7030  C CA  . ASN E 1 128 ? 88.339  153.480 138.051 1.00 30.00  ? 128 ASN E CA  1 
ATOM 7031  C C   . ASN E 1 128 ? 89.380  153.244 139.137 1.00 30.00  ? 128 ASN E C   1 
ATOM 7032  O O   . ASN E 1 128 ? 89.059  152.967 140.293 1.00 30.00  ? 128 ASN E O   1 
ATOM 7033  C CB  . ASN E 1 128 ? 86.999  153.939 138.623 1.00 30.00  ? 128 ASN E CB  1 
ATOM 7034  C CG  . ASN E 1 128 ? 87.020  155.388 139.108 1.00 30.00  ? 128 ASN E CG  1 
ATOM 7035  O OD1 . ASN E 1 128 ? 88.035  156.079 139.014 1.00 30.00  ? 128 ASN E OD1 1 
ATOM 7036  N ND2 . ASN E 1 128 ? 85.885  155.855 139.617 1.00 30.00  ? 128 ASN E ND2 1 
ATOM 7037  N N   . LEU E 1 129 ? 90.650  153.355 138.757 1.00 30.00  ? 129 LEU E N   1 
ATOM 7038  C CA  . LEU E 1 129 ? 91.730  152.943 139.637 1.00 30.00  ? 129 LEU E CA  1 
ATOM 7039  C C   . LEU E 1 129 ? 92.906  153.895 139.470 1.00 30.00  ? 129 LEU E C   1 
ATOM 7040  O O   . LEU E 1 129 ? 92.871  154.829 138.666 1.00 30.00  ? 129 LEU E O   1 
ATOM 7041  C CB  . LEU E 1 129 ? 92.106  151.481 139.370 1.00 30.00  ? 129 LEU E CB  1 
ATOM 7042  C CG  . LEU E 1 129 ? 92.661  151.043 138.015 1.00 30.00  ? 129 LEU E CG  1 
ATOM 7043  C CD1 . LEU E 1 129 ? 94.176  151.009 138.020 1.00 30.00  ? 129 LEU E CD1 1 
ATOM 7044  C CD2 . LEU E 1 129 ? 92.091  149.702 137.602 1.00 30.00  ? 129 LEU E CD2 1 
ATOM 7045  N N   . SER E 1 130 ? 93.962  153.630 140.239 1.00 30.00  ? 130 SER E N   1 
ATOM 7046  C CA  . SER E 1 130 ? 95.049  154.581 140.435 1.00 30.00  ? 130 SER E CA  1 
ATOM 7047  C C   . SER E 1 130 ? 96.393  153.956 140.096 1.00 30.00  ? 130 SER E C   1 
ATOM 7048  O O   . SER E 1 130 ? 96.447  152.937 139.403 1.00 30.00  ? 130 SER E O   1 
ATOM 7049  C CB  . SER E 1 130 ? 95.060  155.106 141.871 1.00 30.00  ? 130 SER E CB  1 
ATOM 7050  O OG  . SER E 1 130 ? 95.382  154.076 142.785 1.00 30.00  ? 130 SER E OG  1 
ATOM 7051  N N   . ASN E 1 131 ? 97.473  154.610 140.534 1.00 30.00  ? 131 ASN E N   1 
ATOM 7052  C CA  . ASN E 1 131 ? 98.835  154.185 140.214 1.00 30.00  ? 131 ASN E CA  1 
ATOM 7053  C C   . ASN E 1 131 ? 99.134  152.779 140.726 1.00 30.00  ? 131 ASN E C   1 
ATOM 7054  O O   . ASN E 1 131 ? 99.484  151.883 139.951 1.00 30.00  ? 131 ASN E O   1 
ATOM 7055  C CB  . ASN E 1 131 ? 99.835  155.180 140.801 1.00 30.00  ? 131 ASN E CB  1 
ATOM 7056  C CG  . ASN E 1 131 ? 99.764  156.535 140.139 1.00 30.00  ? 131 ASN E CG  1 
ATOM 7057  O OD1 . ASN E 1 131 ? 99.632  156.634 138.921 1.00 30.00  ? 131 ASN E OD1 1 
ATOM 7058  N ND2 . ASN E 1 131 ? 99.846  157.590 140.939 1.00 30.00  ? 131 ASN E ND2 1 
ATOM 7059  N N   . THR E 1 132 ? 98.999  152.564 142.032 1.00 30.00  ? 132 THR E N   1 
ATOM 7060  C CA  . THR E 1 132 ? 99.436  151.323 142.667 1.00 30.00  ? 132 THR E CA  1 
ATOM 7061  C C   . THR E 1 132 ? 98.269  150.462 143.131 1.00 30.00  ? 132 THR E C   1 
ATOM 7062  O O   . THR E 1 132 ? 98.325  149.868 144.209 1.00 30.00  ? 132 THR E O   1 
ATOM 7063  C CB  . THR E 1 132 ? 100.357 151.636 143.835 1.00 30.00  ? 132 THR E CB  1 
ATOM 7064  O OG1 . THR E 1 132 ? 99.628  152.363 144.828 1.00 30.00  ? 132 THR E OG1 1 
ATOM 7065  C CG2 . THR E 1 132 ? 101.521 152.484 143.366 1.00 30.00  ? 132 THR E CG2 1 
ATOM 7066  N N   . ASN E 1 133 ? 97.203  150.364 142.339 1.00 30.00  ? 133 ASN E N   1 
ATOM 7067  C CA  . ASN E 1 133 ? 96.041  149.558 142.685 1.00 30.00  ? 133 ASN E CA  1 
ATOM 7068  C C   . ASN E 1 133 ? 95.606  148.735 141.480 1.00 30.00  ? 133 ASN E C   1 
ATOM 7069  O O   . ASN E 1 133 ? 95.835  149.118 140.331 1.00 30.00  ? 133 ASN E O   1 
ATOM 7070  C CB  . ASN E 1 133 ? 94.886  150.439 143.172 1.00 30.00  ? 133 ASN E CB  1 
ATOM 7071  C CG  . ASN E 1 133 ? 95.234  151.206 144.429 1.00 30.00  ? 133 ASN E CG  1 
ATOM 7072  O OD1 . ASN E 1 133 ? 95.304  152.434 144.423 1.00 30.00  ? 133 ASN E OD1 1 
ATOM 7073  N ND2 . ASN E 1 133 ? 95.458  150.483 145.518 1.00 30.00  ? 133 ASN E ND2 1 
ATOM 7074  N N   . PHE E 1 134 ? 94.966  147.596 141.744 1.00 30.00  ? 134 PHE E N   1 
ATOM 7075  C CA  . PHE E 1 134 ? 94.556  146.706 140.670 1.00 30.00  ? 134 PHE E CA  1 
ATOM 7076  C C   . PHE E 1 134 ? 93.055  146.459 140.707 1.00 30.00  ? 134 PHE E C   1 
ATOM 7077  O O   . PHE E 1 134 ? 92.420  146.556 141.758 1.00 30.00  ? 134 PHE E O   1 
ATOM 7078  C CB  . PHE E 1 134 ? 95.309  145.363 140.708 1.00 30.00  ? 134 PHE E CB  1 
ATOM 7079  C CG  . PHE E 1 134 ? 95.089  144.550 141.957 1.00 30.00  ? 134 PHE E CG  1 
ATOM 7080  C CD1 . PHE E 1 134 ? 95.921  144.707 143.042 1.00 30.00  ? 134 PHE E CD1 1 
ATOM 7081  C CD2 . PHE E 1 134 ? 94.092  143.588 142.025 1.00 30.00  ? 134 PHE E CD2 1 
ATOM 7082  C CE1 . PHE E 1 134 ? 95.748  143.944 144.174 1.00 30.00  ? 134 PHE E CE1 1 
ATOM 7083  C CE2 . PHE E 1 134 ? 93.910  142.832 143.160 1.00 30.00  ? 134 PHE E CE2 1 
ATOM 7084  C CZ  . PHE E 1 134 ? 94.736  143.012 144.235 1.00 30.00  ? 134 PHE E CZ  1 
ATOM 7085  N N   . GLY E 1 135 ? 92.494  146.122 139.541 1.00 30.00  ? 135 GLY E N   1 
ATOM 7086  C CA  . GLY E 1 135 ? 91.111  145.715 139.433 1.00 30.00  ? 135 GLY E CA  1 
ATOM 7087  C C   . GLY E 1 135 ? 90.965  144.214 139.596 1.00 30.00  ? 135 GLY E C   1 
ATOM 7088  O O   . GLY E 1 135 ? 91.881  143.449 139.321 1.00 30.00  ? 135 GLY E O   1 
ATOM 7089  N N   . ILE E 1 136 ? 89.794  143.797 140.071 1.00 30.00  ? 136 ILE E N   1 
ATOM 7090  C CA  . ILE E 1 136 ? 89.594  142.431 140.542 1.00 30.00  ? 136 ILE E CA  1 
ATOM 7091  C C   . ILE E 1 136 ? 88.395  141.795 139.824 1.00 30.00  ? 136 ILE E C   1 
ATOM 7092  O O   . ILE E 1 136 ? 87.536  141.156 140.445 1.00 30.00  ? 136 ILE E O   1 
ATOM 7093  C CB  . ILE E 1 136 ? 89.525  142.434 142.090 1.00 30.00  ? 136 ILE E CB  1 
ATOM 7094  C CG1 . ILE E 1 136 ? 89.698  141.033 142.692 1.00 30.00  ? 136 ILE E CG1 1 
ATOM 7095  C CG2 . ILE E 1 136 ? 88.359  143.273 142.638 1.00 30.00  ? 136 ILE E CG2 1 
ATOM 7096  C CD1 . ILE E 1 136 ? 91.028  140.447 142.374 1.00 30.00  ? 136 ILE E CD1 1 
ATOM 7097  N N   . ILE E 1 137 ? 88.289  142.040 138.509 1.00 30.00  ? 137 ILE E N   1 
ATOM 7098  C CA  . ILE E 1 137 ? 87.128  141.590 137.736 1.00 30.00  ? 137 ILE E CA  1 
ATOM 7099  C C   . ILE E 1 137 ? 87.040  140.068 137.766 1.00 30.00  ? 137 ILE E C   1 
ATOM 7100  O O   . ILE E 1 137 ? 88.048  139.360 137.652 1.00 30.00  ? 137 ILE E O   1 
ATOM 7101  C CB  . ILE E 1 137 ? 87.170  142.172 136.308 1.00 30.00  ? 137 ILE E CB  1 
ATOM 7102  C CG1 . ILE E 1 137 ? 88.199  141.543 135.366 1.00 30.00  ? 137 ILE E CG1 1 
ATOM 7103  C CG2 . ILE E 1 137 ? 87.512  143.628 136.366 1.00 30.00  ? 137 ILE E CG2 1 
ATOM 7104  C CD1 . ILE E 1 137 ? 87.602  140.531 134.398 1.00 30.00  ? 137 ILE E CD1 1 
ATOM 7105  N N   . VAL E 1 138 ? 85.841  139.561 138.022 1.00 30.00  ? 138 VAL E N   1 
ATOM 7106  C CA  . VAL E 1 138 ? 85.669  138.190 138.473 1.00 30.00  ? 138 VAL E CA  1 
ATOM 7107  C C   . VAL E 1 138 ? 84.897  137.418 137.415 1.00 30.00  ? 138 VAL E C   1 
ATOM 7108  O O   . VAL E 1 138 ? 84.102  137.993 136.664 1.00 30.00  ? 138 VAL E O   1 
ATOM 7109  C CB  . VAL E 1 138 ? 84.973  138.148 139.855 1.00 30.00  ? 138 VAL E CB  1 
ATOM 7110  C CG1 . VAL E 1 138 ? 83.525  138.581 139.778 1.00 30.00  ? 138 VAL E CG1 1 
ATOM 7111  C CG2 . VAL E 1 138 ? 85.125  136.790 140.539 1.00 30.00  ? 138 VAL E CG2 1 
ATOM 7112  N N   . LEU E 1 139 ? 85.197  136.129 137.310 1.00 30.00  ? 139 LEU E N   1 
ATOM 7113  C CA  . LEU E 1 139 ? 84.479  135.199 136.459 1.00 30.00  ? 139 LEU E CA  1 
ATOM 7114  C C   . LEU E 1 139 ? 84.639  133.799 137.030 1.00 30.00  ? 139 LEU E C   1 
ATOM 7115  O O   . LEU E 1 139 ? 85.630  133.501 137.701 1.00 30.00  ? 139 LEU E O   1 
ATOM 7116  C CB  . LEU E 1 139 ? 84.959  135.300 135.000 1.00 30.00  ? 139 LEU E CB  1 
ATOM 7117  C CG  . LEU E 1 139 ? 86.439  135.235 134.620 1.00 30.00  ? 139 LEU E CG  1 
ATOM 7118  C CD1 . LEU E 1 139 ? 86.943  133.827 134.415 1.00 30.00  ? 139 LEU E CD1 1 
ATOM 7119  C CD2 . LEU E 1 139 ? 86.657  136.056 133.374 1.00 30.00  ? 139 LEU E CD2 1 
ATOM 7120  N N   . GLN E 1 140 ? 83.635  132.959 136.768 1.00 30.00  ? 140 GLN E N   1 
ATOM 7121  C CA  . GLN E 1 140 ? 83.505  131.603 137.313 1.00 30.00  ? 140 GLN E CA  1 
ATOM 7122  C C   . GLN E 1 140 ? 83.543  131.626 138.847 1.00 30.00  ? 140 GLN E C   1 
ATOM 7123  O O   . GLN E 1 140 ? 84.478  131.163 139.494 1.00 30.00  ? 140 GLN E O   1 
ATOM 7124  C CB  . GLN E 1 140 ? 84.567  130.664 136.718 1.00 30.00  ? 140 GLN E CB  1 
ATOM 7125  C CG  . GLN E 1 140 ? 84.397  129.178 137.042 1.00 30.00  ? 140 GLN E CG  1 
ATOM 7126  C CD  . GLN E 1 140 ? 85.513  128.334 136.485 1.00 30.00  ? 140 GLN E CD  1 
ATOM 7127  O OE1 . GLN E 1 140 ? 86.423  128.837 135.835 1.00 30.00  ? 140 GLN E OE1 1 
ATOM 7128  N NE2 . GLN E 1 140 ? 85.463  127.043 136.758 1.00 30.00  ? 140 GLN E NE2 1 
ATOM 7129  N N   . ASP E 1 141 ? 82.512  132.240 139.421 1.00 30.00  ? 141 ASP E N   1 
ATOM 7130  C CA  . ASP E 1 141 ? 82.300  132.209 140.863 1.00 30.00  ? 141 ASP E CA  1 
ATOM 7131  C C   . ASP E 1 141 ? 81.307  131.105 141.211 1.00 30.00  ? 141 ASP E C   1 
ATOM 7132  O O   . ASP E 1 141 ? 80.143  131.149 140.802 1.00 30.00  ? 141 ASP E O   1 
ATOM 7133  C CB  . ASP E 1 141 ? 81.846  133.576 141.402 1.00 30.00  ? 141 ASP E CB  1 
ATOM 7134  C CG  . ASP E 1 141 ? 80.697  134.185 140.616 1.00 30.00  ? 141 ASP E CG  1 
ATOM 7135  O OD1 . ASP E 1 141 ? 80.371  133.681 139.523 1.00 30.00  ? 141 ASP E OD1 1 
ATOM 7136  O OD2 . ASP E 1 141 ? 80.114  135.176 141.105 1.00 30.00  ? 141 ASP E OD2 1 
ATOM 7137  N N   . ALA E 1 142 ? 81.781  130.102 141.948 1.00 30.00  ? 142 ALA E N   1 
ATOM 7138  C CA  . ALA E 1 142 ? 80.945  128.946 142.246 1.00 30.00  ? 142 ALA E CA  1 
ATOM 7139  C C   . ALA E 1 142 ? 80.050  129.196 143.452 1.00 30.00  ? 142 ALA E C   1 
ATOM 7140  O O   . ALA E 1 142 ? 78.821  129.205 143.335 1.00 30.00  ? 142 ALA E O   1 
ATOM 7141  C CB  . ALA E 1 142 ? 81.819  127.714 142.477 1.00 30.00  ? 142 ALA E CB  1 
ATOM 7142  N N   . ASP E 1 143 ? 80.651  129.413 144.620 1.00 30.00  ? 143 ASP E N   1 
ATOM 7143  C CA  . ASP E 1 143 ? 79.923  129.523 145.880 1.00 30.00  ? 143 ASP E CA  1 
ATOM 7144  C C   . ASP E 1 143 ? 79.634  130.975 146.241 1.00 30.00  ? 143 ASP E C   1 
ATOM 7145  O O   . ASP E 1 143 ? 79.374  131.290 147.405 1.00 30.00  ? 143 ASP E O   1 
ATOM 7146  C CB  . ASP E 1 143 ? 80.697  128.856 147.014 1.00 30.00  ? 143 ASP E CB  1 
ATOM 7147  C CG  . ASP E 1 143 ? 80.827  127.363 146.831 1.00 30.00  ? 143 ASP E CG  1 
ATOM 7148  O OD1 . ASP E 1 143 ? 79.941  126.763 146.191 1.00 30.00  ? 143 ASP E OD1 1 
ATOM 7149  O OD2 . ASP E 1 143 ? 81.816  126.787 147.331 1.00 30.00  ? 143 ASP E OD2 1 
ATOM 7150  N N   . ASN E 1 144 ? 79.666  131.855 145.229 1.00 30.00  ? 144 ASN E N   1 
ATOM 7151  C CA  . ASN E 1 144 ? 79.625  133.314 145.384 1.00 30.00  ? 144 ASN E CA  1 
ATOM 7152  C C   . ASN E 1 144 ? 80.708  133.792 146.349 1.00 30.00  ? 144 ASN E C   1 
ATOM 7153  O O   . ASN E 1 144 ? 80.485  134.660 147.192 1.00 30.00  ? 144 ASN E O   1 
ATOM 7154  C CB  . ASN E 1 144 ? 78.242  133.804 145.827 1.00 30.00  ? 144 ASN E CB  1 
ATOM 7155  C CG  . ASN E 1 144 ? 77.182  133.589 144.774 1.00 30.00  ? 144 ASN E CG  1 
ATOM 7156  O OD1 . ASN E 1 144 ? 77.436  133.740 143.581 1.00 30.00  ? 144 ASN E OD1 1 
ATOM 7157  N ND2 . ASN E 1 144 ? 75.975  133.255 145.211 1.00 30.00  ? 144 ASN E ND2 1 
ATOM 7158  N N   . SER E 1 145 ? 81.897  133.208 146.219 1.00 30.00  ? 145 SER E N   1 
ATOM 7159  C CA  . SER E 1 145 ? 82.964  133.449 147.177 1.00 30.00  ? 145 SER E CA  1 
ATOM 7160  C C   . SER E 1 145 ? 83.700  134.756 146.935 1.00 30.00  ? 145 SER E C   1 
ATOM 7161  O O   . SER E 1 145 ? 84.589  135.094 147.721 1.00 30.00  ? 145 SER E O   1 
ATOM 7162  C CB  . SER E 1 145 ? 83.955  132.285 147.160 1.00 30.00  ? 145 SER E CB  1 
ATOM 7163  O OG  . SER E 1 145 ? 84.586  132.166 145.899 1.00 30.00  ? 145 SER E OG  1 
ATOM 7164  N N   . VAL E 1 146 ? 83.366  135.492 145.874 1.00 30.00  ? 146 VAL E N   1 
ATOM 7165  C CA  . VAL E 1 146 ? 83.941  136.815 145.656 1.00 30.00  ? 146 VAL E CA  1 
ATOM 7166  C C   . VAL E 1 146 ? 82.807  137.833 145.623 1.00 30.00  ? 146 VAL E C   1 
ATOM 7167  O O   . VAL E 1 146 ? 82.208  138.088 144.571 1.00 30.00  ? 146 VAL E O   1 
ATOM 7168  C CB  . VAL E 1 146 ? 84.775  136.876 144.360 1.00 30.00  ? 146 VAL E CB  1 
ATOM 7169  C CG1 . VAL E 1 146 ? 85.428  138.241 144.209 1.00 30.00  ? 146 VAL E CG1 1 
ATOM 7170  C CG2 . VAL E 1 146 ? 85.826  135.784 144.331 1.00 30.00  ? 146 VAL E CG2 1 
ATOM 7171  N N   . ASP E 1 147 ? 82.478  138.390 146.780 1.00 30.00  ? 147 ASP E N   1 
ATOM 7172  C CA  . ASP E 1 147 ? 81.611  139.551 146.876 1.00 30.00  ? 147 ASP E CA  1 
ATOM 7173  C C   . ASP E 1 147 ? 82.444  140.780 147.192 1.00 30.00  ? 147 ASP E C   1 
ATOM 7174  O O   . ASP E 1 147 ? 83.676  140.740 147.194 1.00 30.00  ? 147 ASP E O   1 
ATOM 7175  C CB  . ASP E 1 147 ? 80.528  139.352 147.937 1.00 30.00  ? 147 ASP E CB  1 
ATOM 7176  C CG  . ASP E 1 147 ? 79.440  138.415 147.481 1.00 30.00  ? 147 ASP E CG  1 
ATOM 7177  O OD1 . ASP E 1 147 ? 79.180  138.368 146.261 1.00 30.00  ? 147 ASP E OD1 1 
ATOM 7178  O OD2 . ASP E 1 147 ? 78.841  137.732 148.336 1.00 30.00  ? 147 ASP E OD2 1 
ATOM 7179  N N   . GLN E 1 148 ? 81.752  141.889 147.436 1.00 30.00  ? 148 GLN E N   1 
ATOM 7180  C CA  . GLN E 1 148 ? 82.422  143.127 147.807 1.00 30.00  ? 148 GLN E CA  1 
ATOM 7181  C C   . GLN E 1 148 ? 83.065  142.958 149.176 1.00 30.00  ? 148 GLN E C   1 
ATOM 7182  O O   . GLN E 1 148 ? 82.593  142.167 149.998 1.00 30.00  ? 148 GLN E O   1 
ATOM 7183  C CB  . GLN E 1 148 ? 81.415  144.282 147.814 1.00 30.00  ? 148 GLN E CB  1 
ATOM 7184  C CG  . GLN E 1 148 ? 82.013  145.671 147.942 1.00 30.00  ? 148 GLN E CG  1 
ATOM 7185  C CD  . GLN E 1 148 ? 82.763  146.096 146.700 1.00 30.00  ? 148 GLN E CD  1 
ATOM 7186  O OE1 . GLN E 1 148 ? 82.322  145.845 145.581 1.00 30.00  ? 148 GLN E OE1 1 
ATOM 7187  N NE2 . GLN E 1 148 ? 83.898  146.754 146.891 1.00 30.00  ? 148 GLN E NE2 1 
ATOM 7188  N N   . ASN E 1 149 ? 84.219  143.610 149.360 1.00 30.00  ? 149 ASN E N   1 
ATOM 7189  C CA  . ASN E 1 149 ? 84.963  143.742 150.614 1.00 30.00  ? 149 ASN E CA  1 
ATOM 7190  C C   . ASN E 1 149 ? 85.589  142.437 151.106 1.00 30.00  ? 149 ASN E C   1 
ATOM 7191  O O   . ASN E 1 149 ? 86.324  142.451 152.098 1.00 30.00  ? 149 ASN E O   1 
ATOM 7192  C CB  . ASN E 1 149 ? 84.079  144.318 151.730 1.00 30.00  ? 149 ASN E CB  1 
ATOM 7193  C CG  . ASN E 1 149 ? 83.422  145.623 151.341 1.00 30.00  ? 149 ASN E CG  1 
ATOM 7194  O OD1 . ASN E 1 149 ? 82.198  145.709 151.253 1.00 30.00  ? 149 ASN E OD1 1 
ATOM 7195  N ND2 . ASN E 1 149 ? 84.229  146.647 151.106 1.00 30.00  ? 149 ASN E ND2 1 
ATOM 7196  N N   . TYR E 1 150 ? 85.331  141.314 150.436 1.00 30.00  ? 150 TYR E N   1 
ATOM 7197  C CA  . TYR E 1 150 ? 85.858  140.006 150.839 1.00 30.00  ? 150 TYR E CA  1 
ATOM 7198  C C   . TYR E 1 150 ? 86.030  139.105 149.623 1.00 30.00  ? 150 TYR E C   1 
ATOM 7199  O O   . TYR E 1 150 ? 85.184  138.249 149.343 1.00 30.00  ? 150 TYR E O   1 
ATOM 7200  C CB  . TYR E 1 150 ? 84.935  139.332 151.859 1.00 30.00  ? 150 TYR E CB  1 
ATOM 7201  C CG  . TYR E 1 150 ? 84.873  139.977 153.221 1.00 30.00  ? 150 TYR E CG  1 
ATOM 7202  C CD1 . TYR E 1 150 ? 85.863  139.741 154.164 1.00 30.00  ? 150 TYR E CD1 1 
ATOM 7203  C CD2 . TYR E 1 150 ? 83.820  140.812 153.567 1.00 30.00  ? 150 TYR E CD2 1 
ATOM 7204  C CE1 . TYR E 1 150 ? 85.813  140.324 155.412 1.00 30.00  ? 150 TYR E CE1 1 
ATOM 7205  C CE2 . TYR E 1 150 ? 83.759  141.402 154.812 1.00 30.00  ? 150 TYR E CE2 1 
ATOM 7206  C CZ  . TYR E 1 150 ? 84.760  141.153 155.731 1.00 30.00  ? 150 TYR E CZ  1 
ATOM 7207  O OH  . TYR E 1 150 ? 84.709  141.732 156.978 1.00 30.00  ? 150 TYR E OH  1 
ATOM 7208  N N   . PRO E 1 151 ? 87.122  139.260 148.874 1.00 118.75 ? 151 PRO E N   1 
ATOM 7209  C CA  . PRO E 1 151 ? 87.425  138.250 147.858 1.00 118.46 ? 151 PRO E CA  1 
ATOM 7210  C C   . PRO E 1 151 ? 88.099  137.054 148.497 1.00 119.90 ? 151 PRO E C   1 
ATOM 7211  O O   . PRO E 1 151 ? 89.112  137.218 149.182 1.00 131.05 ? 151 PRO E O   1 
ATOM 7212  C CB  . PRO E 1 151 ? 88.379  138.976 146.902 1.00 30.00  ? 151 PRO E CB  1 
ATOM 7213  C CG  . PRO E 1 151 ? 88.227  140.417 147.213 1.00 30.00  ? 151 PRO E CG  1 
ATOM 7214  C CD  . PRO E 1 151 ? 87.955  140.457 148.681 1.00 30.00  ? 151 PRO E CD  1 
ATOM 7215  N N   . THR E 1 152 ? 87.551  135.856 148.311 1.00 103.12 ? 152 THR E N   1 
ATOM 7216  C CA  . THR E 1 152 ? 88.188  134.618 148.747 1.00 94.10  ? 152 THR E CA  1 
ATOM 7217  C C   . THR E 1 152 ? 88.241  133.663 147.567 1.00 104.71 ? 152 THR E C   1 
ATOM 7218  O O   . THR E 1 152 ? 87.253  133.512 146.843 1.00 113.36 ? 152 THR E O   1 
ATOM 7219  C CB  . THR E 1 152 ? 87.440  133.975 149.914 1.00 30.00  ? 152 THR E CB  1 
ATOM 7220  O OG1 . THR E 1 152 ? 86.082  133.732 149.529 1.00 30.00  ? 152 THR E OG1 1 
ATOM 7221  C CG2 . THR E 1 152 ? 87.481  134.861 151.153 1.00 30.00  ? 152 THR E CG2 1 
ATOM 7222  N N   . LEU E 1 153 ? 89.389  133.029 147.370 1.00 105.17 ? 153 LEU E N   1 
ATOM 7223  C CA  . LEU E 1 153 ? 89.545  132.093 146.269 1.00 86.31  ? 153 LEU E CA  1 
ATOM 7224  C C   . LEU E 1 153 ? 89.598  130.651 146.757 1.00 100.45 ? 153 LEU E C   1 
ATOM 7225  O O   . LEU E 1 153 ? 90.393  130.285 147.628 1.00 121.22 ? 153 LEU E O   1 
ATOM 7226  C CB  . LEU E 1 153 ? 90.788  132.429 145.453 1.00 85.43  ? 153 LEU E CB  1 
ATOM 7227  C CG  . LEU E 1 153 ? 90.552  133.256 144.195 1.00 104.80 ? 153 LEU E CG  1 
ATOM 7228  C CD1 . LEU E 1 153 ? 89.872  134.557 144.476 1.00 109.08 ? 153 LEU E CD1 1 
ATOM 7229  C CD2 . LEU E 1 153 ? 91.889  133.516 143.546 1.00 104.18 ? 153 LEU E CD2 1 
ATOM 7230  N N   . ASN E 1 154 ? 88.739  129.829 146.164 1.00 92.73  ? 154 ASN E N   1 
ATOM 7231  C CA  . ASN E 1 154 ? 88.586  128.428 146.517 1.00 102.94 ? 154 ASN E CA  1 
ATOM 7232  C C   . ASN E 1 154 ? 88.785  127.580 145.271 1.00 103.88 ? 154 ASN E C   1 
ATOM 7233  O O   . ASN E 1 154 ? 89.276  128.095 144.262 1.00 114.48 ? 154 ASN E O   1 
ATOM 7234  C CB  . ASN E 1 154 ? 87.224  128.206 147.177 1.00 108.28 ? 154 ASN E CB  1 
ATOM 7235  C CG  . ASN E 1 154 ? 86.078  128.823 146.391 1.00 136.92 ? 154 ASN E CG  1 
ATOM 7236  O OD1 . ASN E 1 154 ? 86.257  129.326 145.284 1.00 143.53 ? 154 ASN E OD1 1 
ATOM 7237  N ND2 . ASN E 1 154 ? 84.891  128.808 146.980 1.00 139.78 ? 154 ASN E ND2 1 
ATOM 7238  N N   . LYS E 1 155 ? 88.449  126.292 145.335 1.00 95.21  ? 155 LYS E N   1 
ATOM 7239  C CA  . LYS E 1 155 ? 88.730  125.380 144.231 1.00 95.36  ? 155 LYS E CA  1 
ATOM 7240  C C   . LYS E 1 155 ? 87.927  125.737 142.977 1.00 115.83 ? 155 LYS E C   1 
ATOM 7241  O O   . LYS E 1 155 ? 86.700  125.879 143.000 1.00 123.08 ? 155 LYS E O   1 
ATOM 7242  C CB  . LYS E 1 155 ? 88.479  123.922 144.649 1.00 30.00  ? 155 LYS E CB  1 
ATOM 7243  C CG  . LYS E 1 155 ? 87.082  123.592 145.178 1.00 30.00  ? 155 LYS E CG  1 
ATOM 7244  C CD  . LYS E 1 155 ? 86.875  122.095 145.363 1.00 30.00  ? 155 LYS E CD  1 
ATOM 7245  C CE  . LYS E 1 155 ? 87.656  121.543 146.534 1.00 30.00  ? 155 LYS E CE  1 
ATOM 7246  N NZ  . LYS E 1 155 ? 87.334  120.104 146.747 1.00 30.00  ? 155 LYS E NZ  1 
ATOM 7247  N N   . GLY E 1 156 ? 88.657  125.932 141.883 1.00 120.22 ? 156 GLY E N   1 
ATOM 7248  C CA  . GLY E 1 156 ? 88.061  126.289 140.609 1.00 108.72 ? 156 GLY E CA  1 
ATOM 7249  C C   . GLY E 1 156 ? 87.418  127.658 140.580 1.00 114.31 ? 156 GLY E C   1 
ATOM 7250  O O   . GLY E 1 156 ? 86.193  127.758 140.446 1.00 129.66 ? 156 GLY E O   1 
ATOM 7251  N N   . ASP E 1 157 ? 88.211  128.718 140.708 1.00 108.95 ? 157 ASP E N   1 
ATOM 7252  C CA  . ASP E 1 157 ? 87.674  130.073 140.767 1.00 110.20 ? 157 ASP E CA  1 
ATOM 7253  C C   . ASP E 1 157 ? 88.723  130.999 140.169 1.00 98.60  ? 157 ASP E C   1 
ATOM 7254  O O   . ASP E 1 157 ? 89.681  131.377 140.846 1.00 104.60 ? 157 ASP E O   1 
ATOM 7255  C CB  . ASP E 1 157 ? 87.323  130.442 142.209 1.00 30.00  ? 157 ASP E CB  1 
ATOM 7256  C CG  . ASP E 1 157 ? 86.429  131.666 142.316 1.00 30.00  ? 157 ASP E CG  1 
ATOM 7257  O OD1 . ASP E 1 157 ? 86.242  132.389 141.319 1.00 30.00  ? 157 ASP E OD1 1 
ATOM 7258  O OD2 . ASP E 1 157 ? 85.864  131.881 143.409 1.00 30.00  ? 157 ASP E OD2 1 
ATOM 7259  N N   . ILE E 1 158 ? 88.542  131.355 138.903 1.00 93.46  ? 158 ILE E N   1 
ATOM 7260  C CA  . ILE E 1 158 ? 89.532  132.096 138.133 1.00 94.83  ? 158 ILE E CA  1 
ATOM 7261  C C   . ILE E 1 158 ? 89.177  133.572 138.218 1.00 87.24  ? 158 ILE E C   1 
ATOM 7262  O O   . ILE E 1 158 ? 88.398  134.079 137.406 1.00 105.72 ? 158 ILE E O   1 
ATOM 7263  C CB  . ILE E 1 158 ? 89.567  131.634 136.671 1.00 30.00  ? 158 ILE E CB  1 
ATOM 7264  C CG1 . ILE E 1 158 ? 89.816  130.142 136.580 1.00 30.00  ? 158 ILE E CG1 1 
ATOM 7265  C CG2 . ILE E 1 158 ? 90.683  132.317 135.915 1.00 30.00  ? 158 ILE E CG2 1 
ATOM 7266  C CD1 . ILE E 1 158 ? 89.631  129.626 135.188 1.00 30.00  ? 158 ILE E CD1 1 
ATOM 7267  N N   . VAL E 1 159 ? 89.737  134.279 139.187 1.00 72.04  ? 159 VAL E N   1 
ATOM 7268  C CA  . VAL E 1 159 ? 89.574  135.720 139.234 1.00 85.77  ? 159 VAL E CA  1 
ATOM 7269  C C   . VAL E 1 159 ? 90.602  136.309 138.277 1.00 98.46  ? 159 VAL E C   1 
ATOM 7270  O O   . VAL E 1 159 ? 91.648  135.719 138.002 1.00 103.95 ? 159 VAL E O   1 
ATOM 7271  C CB  . VAL E 1 159 ? 89.713  136.287 140.666 1.00 96.17  ? 159 VAL E CB  1 
ATOM 7272  C CG1 . VAL E 1 159 ? 91.148  136.264 141.145 1.00 92.70  ? 159 VAL E CG1 1 
ATOM 7273  C CG2 . VAL E 1 159 ? 89.100  137.673 140.787 1.00 104.55 ? 159 VAL E CG2 1 
ATOM 7274  N N   . VAL E 1 160 ? 90.262  137.449 137.700 1.00 95.14  ? 160 VAL E N   1 
ATOM 7275  C CA  . VAL E 1 160 ? 91.128  138.131 136.755 1.00 101.45 ? 160 VAL E CA  1 
ATOM 7276  C C   . VAL E 1 160 ? 91.593  139.414 137.412 1.00 102.27 ? 160 VAL E C   1 
ATOM 7277  O O   . VAL E 1 160 ? 90.838  140.390 137.502 1.00 103.82 ? 160 VAL E O   1 
ATOM 7278  C CB  . VAL E 1 160 ? 90.414  138.411 135.433 1.00 30.00  ? 160 VAL E CB  1 
ATOM 7279  C CG1 . VAL E 1 160 ? 91.305  139.212 134.498 1.00 30.00  ? 160 VAL E CG1 1 
ATOM 7280  C CG2 . VAL E 1 160 ? 89.985  137.111 134.808 1.00 30.00  ? 160 VAL E CG2 1 
ATOM 7281  N N   . ILE E 1 161 ? 92.825  139.406 137.898 1.00 90.95  ? 161 ILE E N   1 
ATOM 7282  C CA  . ILE E 1 161 ? 93.426  140.608 138.449 1.00 81.94  ? 161 ILE E CA  1 
ATOM 7283  C C   . ILE E 1 161 ? 93.707  141.564 137.301 1.00 79.66  ? 161 ILE E C   1 
ATOM 7284  O O   . ILE E 1 161 ? 94.357  141.200 136.319 1.00 99.72  ? 161 ILE E O   1 
ATOM 7285  C CB  . ILE E 1 161 ? 94.688  140.279 139.252 1.00 30.00  ? 161 ILE E CB  1 
ATOM 7286  C CG1 . ILE E 1 161 ? 94.281  139.590 140.552 1.00 30.00  ? 161 ILE E CG1 1 
ATOM 7287  C CG2 . ILE E 1 161 ? 95.523  141.514 139.496 1.00 30.00  ? 161 ILE E CG2 1 
ATOM 7288  C CD1 . ILE E 1 161 ? 95.410  139.172 141.410 1.00 30.00  ? 161 ILE E CD1 1 
ATOM 7289  N N   . THR E 1 162 ? 93.154  142.763 137.394 1.00 81.25  ? 162 THR E N   1 
ATOM 7290  C CA  . THR E 1 162 ? 93.229  143.750 136.332 1.00 79.19  ? 162 THR E CA  1 
ATOM 7291  C C   . THR E 1 162 ? 94.172  144.871 136.731 1.00 81.11  ? 162 THR E C   1 
ATOM 7292  O O   . THR E 1 162 ? 93.921  145.573 137.709 1.00 116.53 ? 162 THR E O   1 
ATOM 7293  C CB  . THR E 1 162 ? 91.839  144.308 136.057 1.00 105.99 ? 162 THR E CB  1 
ATOM 7294  O OG1 . THR E 1 162 ? 91.005  143.268 135.541 1.00 101.14 ? 162 THR E OG1 1 
ATOM 7295  C CG2 . THR E 1 162 ? 91.903  145.433 135.088 1.00 102.00 ? 162 THR E CG2 1 
ATOM 7296  N N   . VAL E 1 163 ? 95.242  145.053 135.966 1.00 74.05  ? 163 VAL E N   1 
ATOM 7297  C CA  . VAL E 1 163 ? 96.257  146.048 136.281 1.00 59.01  ? 163 VAL E CA  1 
ATOM 7298  C C   . VAL E 1 163 ? 96.326  147.026 135.123 1.00 74.94  ? 163 VAL E C   1 
ATOM 7299  O O   . VAL E 1 163 ? 96.786  146.666 134.034 1.00 100.06 ? 163 VAL E O   1 
ATOM 7300  C CB  . VAL E 1 163 ? 97.635  145.414 136.521 1.00 30.00  ? 163 VAL E CB  1 
ATOM 7301  C CG1 . VAL E 1 163 ? 98.662  146.485 136.792 1.00 30.00  ? 163 VAL E CG1 1 
ATOM 7302  C CG2 . VAL E 1 163 ? 97.577  144.432 137.664 1.00 30.00  ? 163 VAL E CG2 1 
ATOM 7303  N N   . LYS E 1 164 ? 95.858  148.250 135.341 1.00 74.88  ? 164 LYS E N   1 
ATOM 7304  C CA  . LYS E 1 164 ? 96.088  149.300 134.364 1.00 83.69  ? 164 LYS E CA  1 
ATOM 7305  C C   . LYS E 1 164 ? 97.494  149.845 134.530 1.00 106.81 ? 164 LYS E C   1 
ATOM 7306  O O   . LYS E 1 164 ? 97.899  150.230 135.628 1.00 129.13 ? 164 LYS E O   1 
ATOM 7307  C CB  . LYS E 1 164 ? 95.081  150.433 134.512 1.00 30.00  ? 164 LYS E CB  1 
ATOM 7308  C CG  . LYS E 1 164 ? 95.302  151.530 133.496 1.00 30.00  ? 164 LYS E CG  1 
ATOM 7309  C CD  . LYS E 1 164 ? 94.276  152.618 133.612 1.00 30.00  ? 164 LYS E CD  1 
ATOM 7310  C CE  . LYS E 1 164 ? 94.535  153.689 132.584 1.00 30.00  ? 164 LYS E CE  1 
ATOM 7311  N NZ  . LYS E 1 164 ? 93.521  154.767 132.672 1.00 30.00  ? 164 LYS E NZ  1 
ATOM 7312  N N   . VAL E 1 165 ? 98.240  149.881 133.434 1.00 100.36 ? 165 VAL E N   1 
ATOM 7313  C CA  . VAL E 1 165 ? 99.636  150.272 133.521 1.00 103.79 ? 165 VAL E CA  1 
ATOM 7314  C C   . VAL E 1 165 ? 99.860  151.611 132.835 1.00 97.79  ? 165 VAL E C   1 
ATOM 7315  O O   . VAL E 1 165 ? 100.287 152.580 133.471 1.00 106.74 ? 165 VAL E O   1 
ATOM 7316  C CB  . VAL E 1 165 ? 100.542 149.191 132.913 1.00 30.00  ? 165 VAL E CB  1 
ATOM 7317  C CG1 . VAL E 1 165 ? 101.968 149.624 132.978 1.00 30.00  ? 165 VAL E CG1 1 
ATOM 7318  C CG2 . VAL E 1 165 ? 100.351 147.876 133.626 1.00 30.00  ? 165 VAL E CG2 1 
ATOM 7319  N N   . GLY E 1 166 ? 99.562  151.678 131.542 1.00 79.70  ? 166 GLY E N   1 
ATOM 7320  C CA  . GLY E 1 166 ? 100.183 152.674 130.690 1.00 92.16  ? 166 GLY E CA  1 
ATOM 7321  C C   . GLY E 1 166 ? 99.724  154.113 130.620 1.00 91.30  ? 166 GLY E C   1 
ATOM 7322  O O   . GLY E 1 166 ? 100.463 155.004 131.049 1.00 97.71  ? 166 GLY E O   1 
ATOM 7323  N N   . GLU E 1 167 ? 98.526  154.363 130.095 1.00 104.44 ? 167 GLU E N   1 
ATOM 7324  C CA  . GLU E 1 167 ? 98.219  155.678 129.542 1.00 121.81 ? 167 GLU E CA  1 
ATOM 7325  C C   . GLU E 1 167 ? 97.964  156.696 130.650 1.00 118.30 ? 167 GLU E C   1 
ATOM 7326  O O   . GLU E 1 167 ? 97.279  156.404 131.637 1.00 118.15 ? 167 GLU E O   1 
ATOM 7327  C CB  . GLU E 1 167 ? 97.038  155.589 128.568 1.00 30.00  ? 167 GLU E CB  1 
ATOM 7328  C CG  . GLU E 1 167 ? 95.694  155.132 129.126 1.00 30.00  ? 167 GLU E CG  1 
ATOM 7329  C CD  . GLU E 1 167 ? 94.832  156.290 129.597 1.00 30.00  ? 167 GLU E CD  1 
ATOM 7330  O OE1 . GLU E 1 167 ? 95.113  157.441 129.201 1.00 30.00  ? 167 GLU E OE1 1 
ATOM 7331  O OE2 . GLU E 1 167 ? 93.866  156.051 130.350 1.00 30.00  ? 167 GLU E OE2 1 
ATOM 7332  N N   . GLY E 1 168 ? 98.549  157.884 130.491 1.00 30.00  ? 168 GLY E N   1 
ATOM 7333  C CA  . GLY E 1 168 ? 98.580  158.886 131.540 1.00 30.00  ? 168 GLY E CA  1 
ATOM 7334  C C   . GLY E 1 168 ? 99.337  158.397 132.756 1.00 30.00  ? 168 GLY E C   1 
ATOM 7335  O O   . GLY E 1 168 ? 100.453 157.884 132.641 1.00 30.00  ? 168 GLY E O   1 
ATOM 7336  N N   . ASN E 1 169 ? 98.732  158.538 133.928 1.00 30.00  ? 169 ASN E N   1 
ATOM 7337  C CA  . ASN E 1 169 ? 99.284  157.929 135.124 1.00 30.00  ? 169 ASN E CA  1 
ATOM 7338  C C   . ASN E 1 169 ? 98.898  156.457 135.198 1.00 30.00  ? 169 ASN E C   1 
ATOM 7339  O O   . ASN E 1 169 ? 98.024  155.983 134.469 1.00 30.00  ? 169 ASN E O   1 
ATOM 7340  C CB  . ASN E 1 169 ? 98.828  158.685 136.378 1.00 30.00  ? 169 ASN E CB  1 
ATOM 7341  C CG  . ASN E 1 169 ? 97.308  158.821 136.488 1.00 30.00  ? 169 ASN E CG  1 
ATOM 7342  O OD1 . ASN E 1 169 ? 96.548  158.296 135.674 1.00 30.00  ? 169 ASN E OD1 1 
ATOM 7343  N ND2 . ASN E 1 169 ? 96.864  159.537 137.514 1.00 30.00  ? 169 ASN E ND2 1 
ATOM 7344  N N   . GLY E 1 170 ? 99.564  155.735 136.088 1.00 30.00  ? 170 GLY E N   1 
ATOM 7345  C CA  . GLY E 1 170 ? 99.310  154.317 136.228 1.00 30.00  ? 170 GLY E CA  1 
ATOM 7346  C C   . GLY E 1 170 ? 100.461 153.661 136.951 1.00 30.00  ? 170 GLY E C   1 
ATOM 7347  O O   . GLY E 1 170 ? 101.113 154.274 137.798 1.00 30.00  ? 170 GLY E O   1 
ATOM 7348  N N   . VAL E 1 171 ? 100.715 152.401 136.601 1.00 30.00  ? 171 VAL E N   1 
ATOM 7349  C CA  . VAL E 1 171 ? 101.851 151.706 137.196 1.00 30.00  ? 171 VAL E CA  1 
ATOM 7350  C C   . VAL E 1 171 ? 103.153 152.231 136.612 1.00 30.00  ? 171 VAL E C   1 
ATOM 7351  O O   . VAL E 1 171 ? 104.072 152.614 137.345 1.00 30.00  ? 171 VAL E O   1 
ATOM 7352  C CB  . VAL E 1 171 ? 101.716 150.186 137.007 1.00 30.00  ? 171 VAL E CB  1 
ATOM 7353  C CG1 . VAL E 1 171 ? 102.929 149.480 137.575 1.00 30.00  ? 171 VAL E CG1 1 
ATOM 7354  C CG2 . VAL E 1 171 ? 100.460 149.684 137.684 1.00 30.00  ? 171 VAL E CG2 1 
ATOM 7355  N N   . PHE E 1 172 ? 103.252 152.270 135.292 1.00 30.00  ? 172 PHE E N   1 
ATOM 7356  C CA  . PHE E 1 172 ? 104.449 152.742 134.619 1.00 30.00  ? 172 PHE E CA  1 
ATOM 7357  C C   . PHE E 1 172 ? 104.121 154.020 133.866 1.00 30.00  ? 172 PHE E C   1 
ATOM 7358  O O   . PHE E 1 172 ? 102.979 154.237 133.453 1.00 30.00  ? 172 PHE E O   1 
ATOM 7359  C CB  . PHE E 1 172 ? 104.989 151.695 133.644 1.00 30.00  ? 172 PHE E CB  1 
ATOM 7360  C CG  . PHE E 1 172 ? 105.475 150.438 134.303 1.00 30.00  ? 172 PHE E CG  1 
ATOM 7361  C CD1 . PHE E 1 172 ? 105.859 150.428 135.629 1.00 30.00  ? 172 PHE E CD1 1 
ATOM 7362  C CD2 . PHE E 1 172 ? 105.514 149.252 133.597 1.00 30.00  ? 172 PHE E CD2 1 
ATOM 7363  C CE1 . PHE E 1 172 ? 106.288 149.267 136.223 1.00 30.00  ? 172 PHE E CE1 1 
ATOM 7364  C CE2 . PHE E 1 172 ? 105.940 148.090 134.194 1.00 30.00  ? 172 PHE E CE2 1 
ATOM 7365  C CZ  . PHE E 1 172 ? 106.320 148.101 135.502 1.00 30.00  ? 172 PHE E CZ  1 
ATOM 7366  N N   . GLY E 1 173 ? 105.125 154.877 133.706 1.00 90.87  ? 173 GLY E N   1 
ATOM 7367  C CA  . GLY E 1 173 ? 104.986 156.028 132.837 1.00 106.12 ? 173 GLY E CA  1 
ATOM 7368  C C   . GLY E 1 173 ? 104.896 155.562 131.400 1.00 110.53 ? 173 GLY E C   1 
ATOM 7369  O O   . GLY E 1 173 ? 105.863 154.988 130.870 1.00 115.60 ? 173 GLY E O   1 
ATOM 7370  N N   . LYS E 1 174 ? 103.719 155.725 130.783 1.00 97.87  ? 174 LYS E N   1 
ATOM 7371  C CA  . LYS E 1 174 ? 103.344 155.308 129.428 1.00 80.02  ? 174 LYS E CA  1 
ATOM 7372  C C   . LYS E 1 174 ? 103.297 153.787 129.251 1.00 94.77  ? 174 LYS E C   1 
ATOM 7373  O O   . LYS E 1 174 ? 102.981 153.314 128.160 1.00 96.54  ? 174 LYS E O   1 
ATOM 7374  C CB  . LYS E 1 174 ? 104.252 155.931 128.348 1.00 30.00  ? 174 LYS E CB  1 
ATOM 7375  C CG  . LYS E 1 174 ? 104.356 157.456 128.402 1.00 30.00  ? 174 LYS E CG  1 
ATOM 7376  C CD  . LYS E 1 174 ? 103.039 158.157 128.107 1.00 30.00  ? 174 LYS E CD  1 
ATOM 7377  C CE  . LYS E 1 174 ? 102.658 158.024 126.642 1.00 30.00  ? 174 LYS E CE  1 
ATOM 7378  N NZ  . LYS E 1 174 ? 103.633 158.719 125.757 1.00 30.00  ? 174 LYS E NZ  1 
ATOM 7379  N N   . GLY E 1 175 ? 103.577 153.005 130.293 1.00 111.68 ? 175 GLY E N   1 
ATOM 7380  C CA  . GLY E 1 175 ? 103.542 151.558 130.194 1.00 81.48  ? 175 GLY E CA  1 
ATOM 7381  C C   . GLY E 1 175 ? 104.721 150.965 129.450 1.00 95.21  ? 175 GLY E C   1 
ATOM 7382  O O   . GLY E 1 175 ? 105.593 151.660 128.937 1.00 97.91  ? 175 GLY E O   1 
ATOM 7383  N N   . ILE E 1 176 ? 104.723 149.636 129.396 1.00 83.15  ? 176 ILE E N   1 
ATOM 7384  C CA  . ILE E 1 176 ? 105.849 148.885 128.846 1.00 78.96  ? 176 ILE E CA  1 
ATOM 7385  C C   . ILE E 1 176 ? 105.929 149.011 127.328 1.00 94.93  ? 176 ILE E C   1 
ATOM 7386  O O   . ILE E 1 176 ? 104.974 148.686 126.614 1.00 88.90  ? 176 ILE E O   1 
ATOM 7387  C CB  . ILE E 1 176 ? 105.809 147.417 129.305 1.00 30.00  ? 176 ILE E CB  1 
ATOM 7388  C CG1 . ILE E 1 176 ? 104.399 146.842 129.233 1.00 30.00  ? 176 ILE E CG1 1 
ATOM 7389  C CG2 . ILE E 1 176 ? 106.362 147.272 130.694 1.00 30.00  ? 176 ILE E CG2 1 
ATOM 7390  C CD1 . ILE E 1 176 ? 104.331 145.367 129.538 1.00 30.00  ? 176 ILE E CD1 1 
ATOM 7391  N N   . PRO E 1 177 ? 107.050 149.497 126.803 1.00 104.13 ? 177 PRO E N   1 
ATOM 7392  C CA  . PRO E 1 177 ? 107.257 149.543 125.354 1.00 102.32 ? 177 PRO E CA  1 
ATOM 7393  C C   . PRO E 1 177 ? 107.500 148.147 124.802 1.00 111.82 ? 177 PRO E C   1 
ATOM 7394  O O   . PRO E 1 177 ? 107.630 147.195 125.586 1.00 109.13 ? 177 PRO E O   1 
ATOM 7395  C CB  . PRO E 1 177 ? 108.500 150.445 125.223 1.00 30.00  ? 177 PRO E CB  1 
ATOM 7396  C CG  . PRO E 1 177 ? 109.205 150.299 126.491 1.00 30.00  ? 177 PRO E CG  1 
ATOM 7397  C CD  . PRO E 1 177 ? 108.156 150.133 127.535 1.00 30.00  ? 177 PRO E CD  1 
ATOM 7398  N N   . PRO E 1 178 ? 107.522 147.960 123.476 1.00 116.59 ? 178 PRO E N   1 
ATOM 7399  C CA  . PRO E 1 178 ? 107.797 146.626 122.929 1.00 103.53 ? 178 PRO E CA  1 
ATOM 7400  C C   . PRO E 1 178 ? 109.198 146.134 123.251 1.00 98.48  ? 178 PRO E C   1 
ATOM 7401  O O   . PRO E 1 178 ? 110.149 146.904 123.393 1.00 99.69  ? 178 PRO E O   1 
ATOM 7402  C CB  . PRO E 1 178 ? 107.617 146.809 121.420 1.00 30.00  ? 178 PRO E CB  1 
ATOM 7403  C CG  . PRO E 1 178 ? 107.720 148.251 121.182 1.00 30.00  ? 178 PRO E CG  1 
ATOM 7404  C CD  . PRO E 1 178 ? 107.118 148.877 122.392 1.00 30.00  ? 178 PRO E CD  1 
ATOM 7405  N N   . ARG E 1 179 ? 109.277 144.807 123.393 1.00 103.48 ? 179 ARG E N   1 
ATOM 7406  C CA  . ARG E 1 179 ? 110.511 144.038 123.555 1.00 103.58 ? 179 ARG E CA  1 
ATOM 7407  C C   . ARG E 1 179 ? 111.260 144.467 124.819 1.00 107.40 ? 179 ARG E C   1 
ATOM 7408  O O   . ARG E 1 179 ? 112.386 144.965 124.789 1.00 119.87 ? 179 ARG E O   1 
ATOM 7409  C CB  . ARG E 1 179 ? 111.373 144.140 122.291 1.00 30.00  ? 179 ARG E CB  1 
ATOM 7410  C CG  . ARG E 1 179 ? 112.522 143.153 122.178 1.00 30.00  ? 179 ARG E CG  1 
ATOM 7411  C CD  . ARG E 1 179 ? 113.230 143.313 120.847 1.00 30.00  ? 179 ARG E CD  1 
ATOM 7412  N NE  . ARG E 1 179 ? 113.805 144.643 120.684 1.00 30.00  ? 179 ARG E NE  1 
ATOM 7413  C CZ  . ARG E 1 179 ? 113.366 145.537 119.806 1.00 30.00  ? 179 ARG E CZ  1 
ATOM 7414  N NH1 . ARG E 1 179 ? 112.345 145.242 119.013 1.00 30.00  ? 179 ARG E NH1 1 
ATOM 7415  N NH2 . ARG E 1 179 ? 113.944 146.725 119.722 1.00 30.00  ? 179 ARG E NH2 1 
ATOM 7416  N N   . THR E 1 180 ? 110.577 144.309 125.946 1.00 92.25  ? 180 THR E N   1 
ATOM 7417  C CA  . THR E 1 180 ? 111.194 144.543 127.240 1.00 103.08 ? 180 THR E CA  1 
ATOM 7418  C C   . THR E 1 180 ? 110.850 143.388 128.156 1.00 94.35  ? 180 THR E C   1 
ATOM 7419  O O   . THR E 1 180 ? 109.874 142.669 127.934 1.00 104.26 ? 180 THR E O   1 
ATOM 7420  C CB  . THR E 1 180 ? 110.744 145.858 127.881 1.00 30.00  ? 180 THR E CB  1 
ATOM 7421  O OG1 . THR E 1 180 ? 111.460 146.050 129.105 1.00 30.00  ? 180 THR E OG1 1 
ATOM 7422  C CG2 . THR E 1 180 ? 109.256 145.843 128.176 1.00 30.00  ? 180 THR E CG2 1 
ATOM 7423  N N   . LYS E 1 181 ? 111.664 143.203 129.183 1.00 87.17  ? 181 LYS E N   1 
ATOM 7424  C CA  . LYS E 1 181 ? 111.381 142.190 130.181 1.00 109.98 ? 181 LYS E CA  1 
ATOM 7425  C C   . LYS E 1 181 ? 110.560 142.827 131.288 1.00 103.75 ? 181 LYS E C   1 
ATOM 7426  O O   . LYS E 1 181 ? 110.901 143.902 131.789 1.00 108.59 ? 181 LYS E O   1 
ATOM 7427  C CB  . LYS E 1 181 ? 112.655 141.558 130.736 1.00 30.00  ? 181 LYS E CB  1 
ATOM 7428  C CG  . LYS E 1 181 ? 112.368 140.383 131.654 1.00 30.00  ? 181 LYS E CG  1 
ATOM 7429  C CD  . LYS E 1 181 ? 113.638 139.716 132.131 1.00 30.00  ? 181 LYS E CD  1 
ATOM 7430  C CE  . LYS E 1 181 ? 114.296 138.945 131.007 1.00 30.00  ? 181 LYS E CE  1 
ATOM 7431  N NZ  . LYS E 1 181 ? 113.456 137.792 130.587 1.00 30.00  ? 181 LYS E NZ  1 
ATOM 7432  N N   . ILE E 1 182 ? 109.462 142.171 131.629 1.00 87.71  ? 182 ILE E N   1 
ATOM 7433  C CA  . ILE E 1 182 ? 108.495 142.624 132.616 1.00 85.86  ? 182 ILE E CA  1 
ATOM 7434  C C   . ILE E 1 182 ? 108.196 141.448 133.531 1.00 85.66  ? 182 ILE E C   1 
ATOM 7435  O O   . ILE E 1 182 ? 107.519 140.487 133.149 1.00 101.40 ? 182 ILE E O   1 
ATOM 7436  C CB  . ILE E 1 182 ? 107.260 143.222 131.909 1.00 30.00  ? 182 ILE E CB  1 
ATOM 7437  C CG1 . ILE E 1 182 ? 106.024 143.334 132.805 1.00 30.00  ? 182 ILE E CG1 1 
ATOM 7438  C CG2 . ILE E 1 182 ? 107.044 142.607 130.557 1.00 30.00  ? 182 ILE E CG2 1 
ATOM 7439  C CD1 . ILE E 1 182 ? 106.096 144.362 133.824 1.00 30.00  ? 182 ILE E CD1 1 
ATOM 7440  N N   . THR E 1 183 ? 108.746 141.515 134.736 1.00 68.96  ? 183 THR E N   1 
ATOM 7441  C CA  . THR E 1 183 ? 108.920 140.385 135.632 1.00 83.69  ? 183 THR E CA  1 
ATOM 7442  C C   . THR E 1 183 ? 108.135 140.640 136.909 1.00 82.58  ? 183 THR E C   1 
ATOM 7443  O O   . THR E 1 183 ? 108.128 141.756 137.432 1.00 95.81  ? 183 THR E O   1 
ATOM 7444  C CB  . THR E 1 183 ? 110.421 140.197 135.958 1.00 30.00  ? 183 THR E CB  1 
ATOM 7445  O OG1 . THR E 1 183 ? 111.160 140.042 134.742 1.00 30.00  ? 183 THR E OG1 1 
ATOM 7446  C CG2 . THR E 1 183 ? 110.671 138.983 136.843 1.00 30.00  ? 183 THR E CG2 1 
ATOM 7447  N N   . GLY E 1 184 ? 107.469 139.616 137.409 1.00 79.97  ? 184 GLY E N   1 
ATOM 7448  C CA  . GLY E 1 184 ? 106.764 139.770 138.656 1.00 78.59  ? 184 GLY E CA  1 
ATOM 7449  C C   . GLY E 1 184 ? 106.519 138.463 139.353 1.00 88.15  ? 184 GLY E C   1 
ATOM 7450  O O   . GLY E 1 184 ? 106.797 137.391 138.819 1.00 103.22 ? 184 GLY E O   1 
ATOM 7451  N N   . LYS E 1 185 ? 105.968 138.563 140.556 1.00 86.13  ? 185 LYS E N   1 
ATOM 7452  C CA  . LYS E 1 185 ? 105.542 137.393 141.303 1.00 94.37  ? 185 LYS E CA  1 
ATOM 7453  C C   . LYS E 1 185 ? 104.387 137.808 142.201 1.00 83.41  ? 185 LYS E C   1 
ATOM 7454  O O   . LYS E 1 185 ? 104.424 138.862 142.842 1.00 95.27  ? 185 LYS E O   1 
ATOM 7455  C CB  . LYS E 1 185 ? 106.712 136.772 142.085 1.00 30.00  ? 185 LYS E CB  1 
ATOM 7456  C CG  . LYS E 1 185 ? 107.366 137.658 143.133 1.00 30.00  ? 185 LYS E CG  1 
ATOM 7457  C CD  . LYS E 1 185 ? 108.647 137.049 143.670 1.00 30.00  ? 185 LYS E CD  1 
ATOM 7458  C CE  . LYS E 1 185 ? 108.383 135.835 144.526 1.00 30.00  ? 185 LYS E CE  1 
ATOM 7459  N NZ  . LYS E 1 185 ? 109.640 135.287 145.097 1.00 30.00  ? 185 LYS E NZ  1 
ATOM 7460  N N   . VAL E 1 186 ? 103.334 137.004 142.186 1.00 72.23  ? 186 VAL E N   1 
ATOM 7461  C CA  . VAL E 1 186 ? 102.110 137.309 142.911 1.00 76.48  ? 186 VAL E CA  1 
ATOM 7462  C C   . VAL E 1 186 ? 102.219 136.628 144.264 1.00 91.96  ? 186 VAL E C   1 
ATOM 7463  O O   . VAL E 1 186 ? 102.023 135.412 144.375 1.00 98.46  ? 186 VAL E O   1 
ATOM 7464  C CB  . VAL E 1 186 ? 100.861 136.848 142.148 1.00 30.00  ? 186 VAL E CB  1 
ATOM 7465  C CG1 . VAL E 1 186 ? 99.610  137.185 142.929 1.00 30.00  ? 186 VAL E CG1 1 
ATOM 7466  C CG2 . VAL E 1 186 ? 100.811 137.489 140.781 1.00 30.00  ? 186 VAL E CG2 1 
ATOM 7467  N N   . ILE E 1 187 ? 102.548 137.397 145.289 1.00 77.25  ? 187 ILE E N   1 
ATOM 7468  C CA  . ILE E 1 187 ? 102.683 136.883 146.648 1.00 61.12  ? 187 ILE E CA  1 
ATOM 7469  C C   . ILE E 1 187 ? 101.311 136.884 147.314 1.00 80.93  ? 187 ILE E C   1 
ATOM 7470  O O   . ILE E 1 187 ? 100.605 137.897 147.248 1.00 97.89  ? 187 ILE E O   1 
ATOM 7471  C CB  . ILE E 1 187 ? 103.716 137.683 147.468 1.00 30.00  ? 187 ILE E CB  1 
ATOM 7472  C CG1 . ILE E 1 187 ? 103.783 137.174 148.911 1.00 30.00  ? 187 ILE E CG1 1 
ATOM 7473  C CG2 . ILE E 1 187 ? 103.529 139.194 147.354 1.00 30.00  ? 187 ILE E CG2 1 
ATOM 7474  C CD1 . ILE E 1 187 ? 104.953 137.722 149.704 1.00 30.00  ? 187 ILE E CD1 1 
ATOM 7475  N N   . PRO E 1 188 ? 100.875 135.774 147.882 1.00 79.27  ? 188 PRO E N   1 
ATOM 7476  C CA  . PRO E 1 188 ? 99.608  135.767 148.621 1.00 92.71  ? 188 PRO E CA  1 
ATOM 7477  C C   . PRO E 1 188 ? 99.802  136.252 150.044 1.00 106.31 ? 188 PRO E C   1 
ATOM 7478  O O   . PRO E 1 188 ? 100.872 136.764 150.387 1.00 120.75 ? 188 PRO E O   1 
ATOM 7479  C CB  . PRO E 1 188 ? 99.193  134.293 148.596 1.00 30.00  ? 188 PRO E CB  1 
ATOM 7480  C CG  . PRO E 1 188 ? 100.010 133.678 147.509 1.00 30.00  ? 188 PRO E CG  1 
ATOM 7481  C CD  . PRO E 1 188 ? 101.304 134.415 147.531 1.00 30.00  ? 188 PRO E CD  1 
ATOM 7482  N N   . GLU E 1 189 ? 98.765  136.116 150.872 1.00 104.74 ? 189 GLU E N   1 
ATOM 7483  C CA  . GLU E 1 189 ? 98.911  136.363 152.304 1.00 101.76 ? 189 GLU E CA  1 
ATOM 7484  C C   . GLU E 1 189 ? 99.917  135.403 152.927 1.00 111.14 ? 189 GLU E C   1 
ATOM 7485  O O   . GLU E 1 189 ? 100.973 135.814 153.418 1.00 104.62 ? 189 GLU E O   1 
ATOM 7486  C CB  . GLU E 1 189 ? 97.554  136.235 152.992 1.00 30.00  ? 189 GLU E CB  1 
ATOM 7487  C CG  . GLU E 1 189 ? 97.616  136.420 154.490 1.00 30.00  ? 189 GLU E CG  1 
ATOM 7488  C CD  . GLU E 1 189 ? 96.257  136.336 155.133 1.00 30.00  ? 189 GLU E CD  1 
ATOM 7489  O OE1 . GLU E 1 189 ? 95.270  136.145 154.398 1.00 30.00  ? 189 GLU E OE1 1 
ATOM 7490  O OE2 . GLU E 1 189 ? 96.173  136.454 156.371 1.00 30.00  ? 189 GLU E OE2 1 
ATOM 7491  N N   . PHE E 1 190 ? 99.605  134.111 152.901 1.00 129.13 ? 190 PHE E N   1 
ATOM 7492  C CA  . PHE E 1 190 ? 100.510 133.083 153.386 1.00 141.21 ? 190 PHE E CA  1 
ATOM 7493  C C   . PHE E 1 190 ? 100.846 132.032 152.338 1.00 124.26 ? 190 PHE E C   1 
ATOM 7494  O O   . PHE E 1 190 ? 101.700 131.177 152.598 1.00 113.63 ? 190 PHE E O   1 
ATOM 7495  C CB  . PHE E 1 190 ? 99.933  132.407 154.643 1.00 30.00  ? 190 PHE E CB  1 
ATOM 7496  C CG  . PHE E 1 190 ? 98.509  131.935 154.497 1.00 30.00  ? 190 PHE E CG  1 
ATOM 7497  C CD1 . PHE E 1 190 ? 98.213  130.701 153.935 1.00 30.00  ? 190 PHE E CD1 1 
ATOM 7498  C CD2 . PHE E 1 190 ? 97.460  132.735 154.929 1.00 30.00  ? 190 PHE E CD2 1 
ATOM 7499  C CE1 . PHE E 1 190 ? 96.901  130.274 153.806 1.00 30.00  ? 190 PHE E CE1 1 
ATOM 7500  C CE2 . PHE E 1 190 ? 96.144  132.312 154.807 1.00 30.00  ? 190 PHE E CE2 1 
ATOM 7501  C CZ  . PHE E 1 190 ? 95.865  131.080 154.243 1.00 30.00  ? 190 PHE E CZ  1 
ATOM 7502  N N   . GLY E 1 191 ? 100.216 132.072 151.170 1.00 111.32 ? 191 GLY E N   1 
ATOM 7503  C CA  . GLY E 1 191 ? 100.420 131.067 150.153 1.00 115.22 ? 191 GLY E CA  1 
ATOM 7504  C C   . GLY E 1 191 ? 101.752 131.198 149.442 1.00 110.01 ? 191 GLY E C   1 
ATOM 7505  O O   . GLY E 1 191 ? 102.565 132.082 149.711 1.00 109.59 ? 191 GLY E O   1 
ATOM 7506  N N   . ALA E 1 192 ? 101.967 130.291 148.520 1.00 108.77 ? 192 ALA E N   1 
ATOM 7507  C CA  . ALA E 1 192 ? 103.208 130.283 147.761 1.00 106.70 ? 192 ALA E CA  1 
ATOM 7508  C C   . ALA E 1 192 ? 103.152 131.345 146.676 1.00 76.53  ? 192 ALA E C   1 
ATOM 7509  O O   . ALA E 1 192 ? 102.115 131.497 146.025 1.00 78.88  ? 192 ALA E O   1 
ATOM 7510  C CB  . ALA E 1 192 ? 103.451 128.921 147.132 1.00 30.00  ? 192 ALA E CB  1 
ATOM 7511  N N   . PRO E 1 193 ? 104.225 132.103 146.464 1.00 77.98  ? 193 PRO E N   1 
ATOM 7512  C CA  . PRO E 1 193 ? 104.219 133.101 145.391 1.00 87.61  ? 193 PRO E CA  1 
ATOM 7513  C C   . PRO E 1 193 ? 104.292 132.449 144.017 1.00 84.24  ? 193 PRO E C   1 
ATOM 7514  O O   . PRO E 1 193 ? 105.195 131.662 143.730 1.00 100.83 ? 193 PRO E O   1 
ATOM 7515  C CB  . PRO E 1 193 ? 105.467 133.939 145.684 1.00 30.00  ? 193 PRO E CB  1 
ATOM 7516  C CG  . PRO E 1 193 ? 106.350 133.050 146.469 1.00 30.00  ? 193 PRO E CG  1 
ATOM 7517  C CD  . PRO E 1 193 ? 105.438 132.192 147.291 1.00 30.00  ? 193 PRO E CD  1 
ATOM 7518  N N   . GLY E 1 194 ? 103.320 132.778 143.170 1.00 86.21  ? 194 GLY E N   1 
ATOM 7519  C CA  . GLY E 1 194 ? 103.337 132.343 141.788 1.00 97.13  ? 194 GLY E CA  1 
ATOM 7520  C C   . GLY E 1 194 ? 103.891 133.438 140.896 1.00 91.83  ? 194 GLY E C   1 
ATOM 7521  O O   . GLY E 1 194 ? 103.578 134.614 141.063 1.00 103.47 ? 194 GLY E O   1 
ATOM 7522  N N   . VAL E 1 195 ? 104.705 133.034 139.951 1.00 73.79  ? 195 VAL E N   1 
ATOM 7523  C CA  . VAL E 1 195 ? 105.596 133.961 139.283 1.00 78.62  ? 195 VAL E CA  1 
ATOM 7524  C C   . VAL E 1 195 ? 105.011 134.307 137.920 1.00 87.46  ? 195 VAL E C   1 
ATOM 7525  O O   . VAL E 1 195 ? 104.120 133.627 137.408 1.00 109.43 ? 195 VAL E O   1 
ATOM 7526  C CB  . VAL E 1 195 ? 107.009 133.345 139.171 1.00 30.00  ? 195 VAL E CB  1 
ATOM 7527  C CG1 . VAL E 1 195 ? 107.079 132.358 138.027 1.00 30.00  ? 195 VAL E CG1 1 
ATOM 7528  C CG2 . VAL E 1 195 ? 108.119 134.398 139.132 1.00 30.00  ? 195 VAL E CG2 1 
ATOM 7529  N N   . ILE E 1 196 ? 105.503 135.395 137.335 1.00 80.94  ? 196 ILE E N   1 
ATOM 7530  C CA  . ILE E 1 196 ? 105.057 135.838 136.022 1.00 81.29  ? 196 ILE E CA  1 
ATOM 7531  C C   . ILE E 1 196 ? 106.177 136.573 135.292 1.00 89.24  ? 196 ILE E C   1 
ATOM 7532  O O   . ILE E 1 196 ? 106.783 137.509 135.823 1.00 98.54  ? 196 ILE E O   1 
ATOM 7533  C CB  . ILE E 1 196 ? 103.778 136.692 136.147 1.00 30.00  ? 196 ILE E CB  1 
ATOM 7534  C CG1 . ILE E 1 196 ? 103.356 137.248 134.799 1.00 30.00  ? 196 ILE E CG1 1 
ATOM 7535  C CG2 . ILE E 1 196 ? 103.885 137.778 137.205 1.00 30.00  ? 196 ILE E CG2 1 
ATOM 7536  C CD1 . ILE E 1 196 ? 102.021 137.859 134.857 1.00 30.00  ? 196 ILE E CD1 1 
ATOM 7537  N N   . GLU E 1 197 ? 106.477 136.130 134.073 1.00 100.52 ? 197 GLU E N   1 
ATOM 7538  C CA  . GLU E 1 197 ? 107.528 136.731 133.256 1.00 92.70  ? 197 GLU E CA  1 
ATOM 7539  C C   . GLU E 1 197 ? 107.066 136.768 131.809 1.00 91.79  ? 197 GLU E C   1 
ATOM 7540  O O   . GLU E 1 197 ? 107.035 135.731 131.139 1.00 115.82 ? 197 GLU E O   1 
ATOM 7541  C CB  . GLU E 1 197 ? 108.840 135.962 133.368 1.00 30.00  ? 197 GLU E CB  1 
ATOM 7542  C CG  . GLU E 1 197 ? 109.951 136.550 132.513 1.00 30.00  ? 197 GLU E CG  1 
ATOM 7543  C CD  . GLU E 1 197 ? 111.252 135.789 132.631 1.00 30.00  ? 197 GLU E CD  1 
ATOM 7544  O OE1 . GLU E 1 197 ? 111.287 134.787 133.373 1.00 30.00  ? 197 GLU E OE1 1 
ATOM 7545  O OE2 . GLU E 1 197 ? 112.240 136.190 131.978 1.00 30.00  ? 197 GLU E OE2 1 
ATOM 7546  N N   . PHE E 1 198 ? 106.734 137.954 131.318 1.00 80.89  ? 198 PHE E N   1 
ATOM 7547  C CA  . PHE E 1 198 ? 106.425 138.141 129.913 1.00 87.10  ? 198 PHE E CA  1 
ATOM 7548  C C   . PHE E 1 198 ? 107.721 138.266 129.139 1.00 99.66  ? 198 PHE E C   1 
ATOM 7549  O O   . PHE E 1 198 ? 108.809 138.251 129.719 1.00 107.35 ? 198 PHE E O   1 
ATOM 7550  C CB  . PHE E 1 198 ? 105.640 139.417 129.664 1.00 30.00  ? 198 PHE E CB  1 
ATOM 7551  C CG  . PHE E 1 198 ? 104.441 139.583 130.512 1.00 30.00  ? 198 PHE E CG  1 
ATOM 7552  C CD1 . PHE E 1 198 ? 103.256 138.989 130.182 1.00 30.00  ? 198 PHE E CD1 1 
ATOM 7553  C CD2 . PHE E 1 198 ? 104.497 140.384 131.626 1.00 30.00  ? 198 PHE E CD2 1 
ATOM 7554  C CE1 . PHE E 1 198 ? 102.161 139.175 130.950 1.00 30.00  ? 198 PHE E CE1 1 
ATOM 7555  C CE2 . PHE E 1 198 ? 103.400 140.578 132.407 1.00 30.00  ? 198 PHE E CE2 1 
ATOM 7556  C CZ  . PHE E 1 198 ? 102.230 139.976 132.061 1.00 30.00  ? 198 PHE E CZ  1 
ATOM 7557  N N   . THR E 1 199 ? 107.599 138.417 127.824 1.00 95.30  ? 199 THR E N   1 
ATOM 7558  C CA  . THR E 1 199 ? 108.686 138.998 127.049 1.00 87.27  ? 199 THR E CA  1 
ATOM 7559  C C   . THR E 1 199 ? 108.213 140.186 126.228 1.00 91.37  ? 199 THR E C   1 
ATOM 7560  O O   . THR E 1 199 ? 109.046 140.992 125.802 1.00 118.25 ? 199 THR E O   1 
ATOM 7561  C CB  . THR E 1 199 ? 109.315 137.968 126.115 1.00 30.00  ? 199 THR E CB  1 
ATOM 7562  O OG1 . THR E 1 199 ? 108.320 137.463 125.220 1.00 30.00  ? 199 THR E OG1 1 
ATOM 7563  C CG2 . THR E 1 199 ? 109.909 136.832 126.896 1.00 30.00  ? 199 THR E CG2 1 
ATOM 7564  N N   . THR E 1 200 ? 106.885 140.304 126.010 1.00 66.50  ? 200 THR E N   1 
ATOM 7565  C CA  . THR E 1 200 ? 106.198 141.333 125.232 1.00 93.24  ? 200 THR E CA  1 
ATOM 7566  C C   . THR E 1 200 ? 106.819 141.416 123.843 1.00 108.13 ? 200 THR E C   1 
ATOM 7567  O O   . THR E 1 200 ? 107.651 142.298 123.597 1.00 112.01 ? 200 THR E O   1 
ATOM 7568  C CB  . THR E 1 200 ? 106.253 142.680 125.947 1.00 30.00  ? 200 THR E CB  1 
ATOM 7569  O OG1 . THR E 1 200 ? 105.838 142.500 127.302 1.00 30.00  ? 200 THR E OG1 1 
ATOM 7570  C CG2 . THR E 1 200 ? 105.286 143.655 125.307 1.00 30.00  ? 200 THR E CG2 1 
ATOM 7571  N N   . PRO E 1 201 ? 106.499 140.475 122.949 1.00 98.08  ? 201 PRO E N   1 
ATOM 7572  C CA  . PRO E 1 201 ? 107.358 140.213 121.783 1.00 101.37 ? 201 PRO E CA  1 
ATOM 7573  C C   . PRO E 1 201 ? 107.406 141.369 120.797 1.00 96.67  ? 201 PRO E C   1 
ATOM 7574  O O   . PRO E 1 201 ? 106.565 142.265 120.823 1.00 97.22  ? 201 PRO E O   1 
ATOM 7575  C CB  . PRO E 1 201 ? 106.720 138.971 121.156 1.00 30.00  ? 201 PRO E CB  1 
ATOM 7576  C CG  . PRO E 1 201 ? 105.299 139.033 121.578 1.00 30.00  ? 201 PRO E CG  1 
ATOM 7577  C CD  . PRO E 1 201 ? 105.298 139.629 122.953 1.00 30.00  ? 201 PRO E CD  1 
ATOM 7578  N N   . SER E 1 202 ? 108.410 141.331 119.926 1.00 84.53  ? 202 SER E N   1 
ATOM 7579  C CA  . SER E 1 202 ? 108.865 142.530 119.237 1.00 96.04  ? 202 SER E CA  1 
ATOM 7580  C C   . SER E 1 202 ? 107.906 142.969 118.140 1.00 107.48 ? 202 SER E C   1 
ATOM 7581  O O   . SER E 1 202 ? 107.538 142.181 117.265 1.00 120.32 ? 202 SER E O   1 
ATOM 7582  C CB  . SER E 1 202 ? 110.240 142.290 118.631 1.00 30.00  ? 202 SER E CB  1 
ATOM 7583  O OG  . SER E 1 202 ? 110.159 141.317 117.606 1.00 30.00  ? 202 SER E OG  1 
ATOM 7584  N N   . THR E 1 203 ? 107.521 144.248 118.209 1.00 102.41 ? 203 THR E N   1 
ATOM 7585  C CA  . THR E 1 203 ? 106.785 144.991 117.183 1.00 89.41  ? 203 THR E CA  1 
ATOM 7586  C C   . THR E 1 203 ? 105.450 144.305 116.879 1.00 95.49  ? 203 THR E C   1 
ATOM 7587  O O   . THR E 1 203 ? 105.210 143.749 115.809 1.00 116.57 ? 203 THR E O   1 
ATOM 7588  C CB  . THR E 1 203 ? 107.653 145.176 115.934 1.00 30.00  ? 203 THR E CB  1 
ATOM 7589  O OG1 . THR E 1 203 ? 108.952 145.607 116.348 1.00 30.00  ? 203 THR E OG1 1 
ATOM 7590  C CG2 . THR E 1 203 ? 107.089 146.276 115.059 1.00 30.00  ? 203 THR E CG2 1 
ATOM 7591  N N   . TYR E 1 204 ? 104.606 144.321 117.898 1.00 87.34  ? 204 TYR E N   1 
ATOM 7592  C CA  . TYR E 1 204 ? 103.403 143.513 117.968 1.00 85.33  ? 204 TYR E CA  1 
ATOM 7593  C C   . TYR E 1 204 ? 102.194 144.236 117.393 1.00 90.64  ? 204 TYR E C   1 
ATOM 7594  O O   . TYR E 1 204 ? 102.266 145.383 116.950 1.00 110.75 ? 204 TYR E O   1 
ATOM 7595  C CB  . TYR E 1 204 ? 103.134 143.099 119.417 1.00 30.00  ? 204 TYR E CB  1 
ATOM 7596  C CG  . TYR E 1 204 ? 103.205 144.235 120.429 1.00 30.00  ? 204 TYR E CG  1 
ATOM 7597  C CD1 . TYR E 1 204 ? 102.129 145.083 120.652 1.00 30.00  ? 204 TYR E CD1 1 
ATOM 7598  C CD2 . TYR E 1 204 ? 104.362 144.457 121.160 1.00 30.00  ? 204 TYR E CD2 1 
ATOM 7599  C CE1 . TYR E 1 204 ? 102.216 146.110 121.570 1.00 30.00  ? 204 TYR E CE1 1 
ATOM 7600  C CE2 . TYR E 1 204 ? 104.443 145.466 122.083 1.00 30.00  ? 204 TYR E CE2 1 
ATOM 7601  C CZ  . TYR E 1 204 ? 103.375 146.292 122.279 1.00 30.00  ? 204 TYR E CZ  1 
ATOM 7602  O OH  . TYR E 1 204 ? 103.476 147.306 123.195 1.00 30.00  ? 204 TYR E OH  1 
ATOM 7603  N N   . THR E 1 205 ? 101.074 143.524 117.412 1.00 82.57  ? 205 THR E N   1 
ATOM 7604  C CA  . THR E 1 205 ? 99.757  144.026 117.057 1.00 83.12  ? 205 THR E CA  1 
ATOM 7605  C C   . THR E 1 205 ? 98.875  144.042 118.305 1.00 89.17  ? 205 THR E C   1 
ATOM 7606  O O   . THR E 1 205 ? 99.341  143.784 119.417 1.00 113.02 ? 205 THR E O   1 
ATOM 7607  C CB  . THR E 1 205 ? 99.147  143.172 115.949 1.00 30.00  ? 205 THR E CB  1 
ATOM 7608  O OG1 . THR E 1 205 ? 99.024  141.821 116.409 1.00 30.00  ? 205 THR E OG1 1 
ATOM 7609  C CG2 . THR E 1 205 ? 100.037 143.199 114.714 1.00 30.00  ? 205 THR E CG2 1 
ATOM 7610  N N   . SER E 1 206 ? 97.594  144.355 118.120 1.00 77.54  ? 206 SER E N   1 
ATOM 7611  C CA  . SER E 1 206 ? 96.701  144.504 119.261 1.00 75.49  ? 206 SER E CA  1 
ATOM 7612  C C   . SER E 1 206 ? 96.358  143.149 119.870 1.00 85.95  ? 206 SER E C   1 
ATOM 7613  O O   . SER E 1 206 ? 96.388  142.117 119.192 1.00 96.77  ? 206 SER E O   1 
ATOM 7614  C CB  . SER E 1 206 ? 95.430  145.246 118.856 1.00 30.00  ? 206 SER E CB  1 
ATOM 7615  O OG  . SER E 1 206 ? 95.723  146.563 118.434 1.00 30.00  ? 206 SER E OG  1 
ATOM 7616  N N   . GLU E 1 207 ? 96.052  143.172 121.177 1.00 92.70  ? 207 GLU E N   1 
ATOM 7617  C CA  . GLU E 1 207 ? 95.698  141.999 121.992 1.00 84.94  ? 207 GLU E CA  1 
ATOM 7618  C C   . GLU E 1 207 ? 96.833  140.966 121.973 1.00 75.08  ? 207 GLU E C   1 
ATOM 7619  O O   . GLU E 1 207 ? 96.796  139.940 121.300 1.00 99.39  ? 207 GLU E O   1 
ATOM 7620  C CB  . GLU E 1 207 ? 94.341  141.429 121.565 1.00 30.00  ? 207 GLU E CB  1 
ATOM 7621  C CG  . GLU E 1 207 ? 93.729  140.444 122.532 1.00 30.00  ? 207 GLU E CG  1 
ATOM 7622  C CD  . GLU E 1 207 ? 94.030  139.007 122.182 1.00 30.00  ? 207 GLU E CD  1 
ATOM 7623  O OE1 . GLU E 1 207 ? 94.204  138.717 120.982 1.00 30.00  ? 207 GLU E OE1 1 
ATOM 7624  O OE2 . GLU E 1 207 ? 94.079  138.167 123.100 1.00 30.00  ? 207 GLU E OE2 1 
ATOM 7625  N N   . VAL E 1 208 ? 97.881  141.314 122.716 1.00 54.53  ? 208 VAL E N   1 
ATOM 7626  C CA  . VAL E 1 208 ? 99.262  140.906 122.479 1.00 74.84  ? 208 VAL E CA  1 
ATOM 7627  C C   . VAL E 1 208 ? 99.550  139.514 123.061 1.00 90.59  ? 208 VAL E C   1 
ATOM 7628  O O   . VAL E 1 208 ? 100.688 139.038 122.987 1.00 111.15 ? 208 VAL E O   1 
ATOM 7629  C CB  . VAL E 1 208 ? 100.178 142.008 123.067 1.00 30.00  ? 208 VAL E CB  1 
ATOM 7630  C CG1 . VAL E 1 208 ? 101.616 141.964 122.569 1.00 30.00  ? 208 VAL E CG1 1 
ATOM 7631  C CG2 . VAL E 1 208 ? 99.592  143.374 122.787 1.00 30.00  ? 208 VAL E CG2 1 
ATOM 7632  N N   . ILE E 1 209 ? 98.496  138.782 123.470 1.00 82.05  ? 209 ILE E N   1 
ATOM 7633  C CA  . ILE E 1 209 ? 98.473  137.730 124.504 1.00 100.57 ? 209 ILE E CA  1 
ATOM 7634  C C   . ILE E 1 209 ? 99.691  136.809 124.572 1.00 110.18 ? 209 ILE E C   1 
ATOM 7635  O O   . ILE E 1 209 ? 100.096 136.198 123.578 1.00 121.76 ? 209 ILE E O   1 
ATOM 7636  C CB  . ILE E 1 209 ? 97.195  136.875 124.330 1.00 30.00  ? 209 ILE E CB  1 
ATOM 7637  C CG1 . ILE E 1 209 ? 97.180  135.687 125.303 1.00 30.00  ? 209 ILE E CG1 1 
ATOM 7638  C CG2 . ILE E 1 209 ? 96.976  136.454 122.872 1.00 30.00  ? 209 ILE E CG2 1 
ATOM 7639  C CD1 . ILE E 1 209 ? 95.884  134.896 125.312 1.00 30.00  ? 209 ILE E CD1 1 
ATOM 7640  N N   . GLU E 1 210 ? 100.297 136.732 125.756 1.00 30.00  ? 210 GLU E N   1 
ATOM 7641  C CA  . GLU E 1 210 ? 101.548 136.015 125.933 1.00 30.00  ? 210 GLU E CA  1 
ATOM 7642  C C   . GLU E 1 210 ? 101.539 135.342 127.297 1.00 30.00  ? 210 GLU E C   1 
ATOM 7643  O O   . GLU E 1 210 ? 101.032 135.887 128.279 1.00 30.00  ? 210 GLU E O   1 
ATOM 7644  C CB  . GLU E 1 210 ? 102.755 136.950 125.759 1.00 30.00  ? 210 GLU E CB  1 
ATOM 7645  C CG  . GLU E 1 210 ? 102.956 137.991 126.832 1.00 30.00  ? 210 GLU E CG  1 
ATOM 7646  C CD  . GLU E 1 210 ? 102.151 139.254 126.625 1.00 30.00  ? 210 GLU E CD  1 
ATOM 7647  O OE1 . GLU E 1 210 ? 101.230 139.263 125.793 1.00 30.00  ? 210 GLU E OE1 1 
ATOM 7648  O OE2 . GLU E 1 210 ? 102.436 140.253 127.313 1.00 30.00  ? 210 GLU E OE2 1 
ATOM 7649  N N   . LEU E 1 211 ? 102.088 134.139 127.340 1.00 30.00  ? 211 LEU E N   1 
ATOM 7650  C CA  . LEU E 1 211 ? 101.815 133.205 128.419 1.00 30.00  ? 211 LEU E CA  1 
ATOM 7651  C C   . LEU E 1 211 ? 102.668 133.505 129.643 1.00 30.00  ? 211 LEU E C   1 
ATOM 7652  O O   . LEU E 1 211 ? 103.791 134.004 129.535 1.00 30.00  ? 211 LEU E O   1 
ATOM 7653  C CB  . LEU E 1 211 ? 102.053 131.766 127.954 1.00 30.00  ? 211 LEU E CB  1 
ATOM 7654  C CG  . LEU E 1 211 ? 101.123 131.247 126.854 1.00 30.00  ? 211 LEU E CG  1 
ATOM 7655  C CD1 . LEU E 1 211 ? 101.562 129.868 126.387 1.00 30.00  ? 211 LEU E CD1 1 
ATOM 7656  C CD2 . LEU E 1 211 ? 99.681  131.221 127.337 1.00 30.00  ? 211 LEU E CD2 1 
ATOM 7657  N N   . GLN E 1 212 ? 102.107 133.167 130.806 1.00 30.00  ? 212 GLN E N   1 
ATOM 7658  C CA  . GLN E 1 212 ? 102.680 133.314 132.150 1.00 30.00  ? 212 GLN E CA  1 
ATOM 7659  C C   . GLN E 1 212 ? 103.281 134.687 132.420 1.00 30.00  ? 212 GLN E C   1 
ATOM 7660  O O   . GLN E 1 212 ? 104.468 134.915 132.187 1.00 30.00  ? 212 GLN E O   1 
ATOM 7661  C CB  . GLN E 1 212 ? 103.737 132.240 132.416 1.00 30.00  ? 212 GLN E CB  1 
ATOM 7662  C CG  . GLN E 1 212 ? 104.148 132.175 133.885 1.00 30.00  ? 212 GLN E CG  1 
ATOM 7663  C CD  . GLN E 1 212 ? 105.170 131.103 134.177 1.00 30.00  ? 212 GLN E CD  1 
ATOM 7664  O OE1 . GLN E 1 212 ? 105.688 130.461 133.272 1.00 30.00  ? 212 GLN E OE1 1 
ATOM 7665  N NE2 . GLN E 1 212 ? 105.450 130.888 135.453 1.00 30.00  ? 212 GLN E NE2 1 
ATOM 7666  N N   . ALA F 1 6   ? 106.714 110.911 203.415 1.00 30.00  ? 6   ALA F N   1 
ATOM 7667  C CA  . ALA F 1 6   ? 108.081 110.779 202.927 1.00 30.00  ? 6   ALA F CA  1 
ATOM 7668  C C   . ALA F 1 6   ? 108.183 111.186 201.461 1.00 30.00  ? 6   ALA F C   1 
ATOM 7669  O O   . ALA F 1 6   ? 107.337 111.913 200.943 1.00 30.00  ? 6   ALA F O   1 
ATOM 7670  C CB  . ALA F 1 6   ? 108.578 109.354 203.119 1.00 30.00  ? 6   ALA F CB  1 
ATOM 7671  N N   . VAL F 1 7   ? 109.225 110.697 200.796 1.00 176.07 ? 7   VAL F N   1 
ATOM 7672  C CA  . VAL F 1 7   ? 109.515 111.065 199.417 1.00 158.44 ? 7   VAL F CA  1 
ATOM 7673  C C   . VAL F 1 7   ? 108.691 110.184 198.483 1.00 137.52 ? 7   VAL F C   1 
ATOM 7674  O O   . VAL F 1 7   ? 108.256 110.628 197.413 1.00 139.74 ? 7   VAL F O   1 
ATOM 7675  C CB  . VAL F 1 7   ? 111.033 110.959 199.153 1.00 30.00  ? 7   VAL F CB  1 
ATOM 7676  C CG1 . VAL F 1 7   ? 111.386 111.221 197.707 1.00 30.00  ? 7   VAL F CG1 1 
ATOM 7677  C CG2 . VAL F 1 7   ? 111.778 111.945 200.034 1.00 30.00  ? 7   VAL F CG2 1 
ATOM 7678  N N   . GLY F 1 8   ? 108.405 108.955 198.921 1.00 131.64 ? 8   GLY F N   1 
ATOM 7679  C CA  . GLY F 1 8   ? 107.706 107.963 198.118 1.00 139.85 ? 8   GLY F CA  1 
ATOM 7680  C C   . GLY F 1 8   ? 106.295 108.319 197.698 1.00 132.89 ? 8   GLY F C   1 
ATOM 7681  O O   . GLY F 1 8   ? 105.788 107.739 196.734 1.00 133.27 ? 8   GLY F O   1 
ATOM 7682  N N   . ILE F 1 9   ? 105.650 109.255 198.389 1.00 131.26 ? 9   ILE F N   1 
ATOM 7683  C CA  . ILE F 1 9   ? 104.350 109.737 197.939 1.00 135.93 ? 9   ILE F CA  1 
ATOM 7684  C C   . ILE F 1 9   ? 104.506 110.587 196.683 1.00 126.64 ? 9   ILE F C   1 
ATOM 7685  O O   . ILE F 1 9   ? 103.773 110.406 195.703 1.00 121.41 ? 9   ILE F O   1 
ATOM 7686  C CB  . ILE F 1 9   ? 103.638 110.515 199.068 1.00 30.00  ? 9   ILE F CB  1 
ATOM 7687  C CG1 . ILE F 1 9   ? 103.274 109.605 200.250 1.00 30.00  ? 9   ILE F CG1 1 
ATOM 7688  C CG2 . ILE F 1 9   ? 102.388 111.211 198.555 1.00 30.00  ? 9   ILE F CG2 1 
ATOM 7689  C CD1 . ILE F 1 9   ? 104.268 109.601 201.396 1.00 30.00  ? 9   ILE F CD1 1 
ATOM 7690  N N   . GLY F 1 10  ? 105.491 111.491 196.681 1.00 116.23 ? 10  GLY F N   1 
ATOM 7691  C CA  . GLY F 1 10  ? 105.603 112.483 195.623 1.00 108.48 ? 10  GLY F CA  1 
ATOM 7692  C C   . GLY F 1 10  ? 106.025 111.917 194.285 1.00 119.42 ? 10  GLY F C   1 
ATOM 7693  O O   . GLY F 1 10  ? 105.642 112.449 193.240 1.00 124.33 ? 10  GLY F O   1 
ATOM 7694  N N   . THR F 1 11  ? 106.801 110.830 194.291 1.00 133.79 ? 11  THR F N   1 
ATOM 7695  C CA  . THR F 1 11  ? 107.168 110.177 193.039 1.00 134.97 ? 11  THR F CA  1 
ATOM 7696  C C   . THR F 1 11  ? 105.980 109.465 192.409 1.00 126.74 ? 11  THR F C   1 
ATOM 7697  O O   . THR F 1 11  ? 105.998 109.178 191.207 1.00 132.88 ? 11  THR F O   1 
ATOM 7698  C CB  . THR F 1 11  ? 108.305 109.188 193.269 1.00 30.00  ? 11  THR F CB  1 
ATOM 7699  O OG1 . THR F 1 11  ? 107.878 108.185 194.196 1.00 30.00  ? 11  THR F OG1 1 
ATOM 7700  C CG2 . THR F 1 11  ? 109.516 109.897 193.833 1.00 30.00  ? 11  THR F CG2 1 
ATOM 7701  N N   . LEU F 1 12  ? 104.949 109.164 193.204 1.00 118.09 ? 12  LEU F N   1 
ATOM 7702  C CA  . LEU F 1 12  ? 103.703 108.641 192.654 1.00 128.80 ? 12  LEU F CA  1 
ATOM 7703  C C   . LEU F 1 12  ? 102.823 109.770 192.131 1.00 127.81 ? 12  LEU F C   1 
ATOM 7704  O O   . LEU F 1 12  ? 102.019 109.573 191.214 1.00 112.49 ? 12  LEU F O   1 
ATOM 7705  C CB  . LEU F 1 12  ? 102.969 107.829 193.720 1.00 30.00  ? 12  LEU F CB  1 
ATOM 7706  C CG  . LEU F 1 12  ? 103.716 106.584 194.196 1.00 30.00  ? 12  LEU F CG  1 
ATOM 7707  C CD1 . LEU F 1 12  ? 102.998 105.934 195.361 1.00 30.00  ? 12  LEU F CD1 1 
ATOM 7708  C CD2 . LEU F 1 12  ? 103.884 105.598 193.053 1.00 30.00  ? 12  LEU F CD2 1 
ATOM 7709  N N   . ILE F 1 13  ? 102.963 110.965 192.708 1.00 134.37 ? 13  ILE F N   1 
ATOM 7710  C CA  . ILE F 1 13  ? 102.186 112.107 192.244 1.00 120.65 ? 13  ILE F CA  1 
ATOM 7711  C C   . ILE F 1 13  ? 102.752 112.636 190.934 1.00 125.25 ? 13  ILE F C   1 
ATOM 7712  O O   . ILE F 1 13  ? 102.001 112.969 190.008 1.00 127.06 ? 13  ILE F O   1 
ATOM 7713  C CB  . ILE F 1 13  ? 102.138 113.189 193.339 1.00 30.00  ? 13  ILE F CB  1 
ATOM 7714  C CG1 . ILE F 1 13  ? 101.440 112.638 194.583 1.00 30.00  ? 13  ILE F CG1 1 
ATOM 7715  C CG2 . ILE F 1 13  ? 101.402 114.426 192.859 1.00 30.00  ? 13  ILE F CG2 1 
ATOM 7716  C CD1 . ILE F 1 13  ? 101.491 113.565 195.771 1.00 30.00  ? 13  ILE F CD1 1 
ATOM 7717  N N   . VAL F 1 14  ? 104.082 112.697 190.823 1.00 120.61 ? 14  VAL F N   1 
ATOM 7718  C CA  . VAL F 1 14  ? 104.723 113.048 189.557 1.00 119.27 ? 14  VAL F CA  1 
ATOM 7719  C C   . VAL F 1 14  ? 104.453 111.971 188.508 1.00 125.86 ? 14  VAL F C   1 
ATOM 7720  O O   . VAL F 1 14  ? 104.346 112.272 187.311 1.00 127.57 ? 14  VAL F O   1 
ATOM 7721  C CB  . VAL F 1 14  ? 106.231 113.294 189.794 1.00 30.00  ? 14  VAL F CB  1 
ATOM 7722  C CG1 . VAL F 1 14  ? 106.995 113.574 188.497 1.00 30.00  ? 14  VAL F CG1 1 
ATOM 7723  C CG2 . VAL F 1 14  ? 106.422 114.462 190.748 1.00 30.00  ? 14  VAL F CG2 1 
ATOM 7724  N N   . PHE F 1 15  ? 104.277 110.718 188.943 1.00 120.93 ? 15  PHE F N   1 
ATOM 7725  C CA  . PHE F 1 15  ? 103.828 109.660 188.038 1.00 130.25 ? 15  PHE F CA  1 
ATOM 7726  C C   . PHE F 1 15  ? 102.443 109.946 187.467 1.00 137.12 ? 15  PHE F C   1 
ATOM 7727  O O   . PHE F 1 15  ? 102.167 109.613 186.310 1.00 136.10 ? 15  PHE F O   1 
ATOM 7728  C CB  . PHE F 1 15  ? 103.841 108.308 188.753 1.00 30.00  ? 15  PHE F CB  1 
ATOM 7729  C CG  . PHE F 1 15  ? 103.183 107.209 187.969 1.00 30.00  ? 15  PHE F CG  1 
ATOM 7730  C CD1 . PHE F 1 15  ? 103.772 106.707 186.819 1.00 30.00  ? 15  PHE F CD1 1 
ATOM 7731  C CD2 . PHE F 1 15  ? 101.969 106.678 188.385 1.00 30.00  ? 15  PHE F CD2 1 
ATOM 7732  C CE1 . PHE F 1 15  ? 103.156 105.701 186.091 1.00 30.00  ? 15  PHE F CE1 1 
ATOM 7733  C CE2 . PHE F 1 15  ? 101.351 105.670 187.664 1.00 30.00  ? 15  PHE F CE2 1 
ATOM 7734  C CZ  . PHE F 1 15  ? 101.945 105.180 186.517 1.00 30.00  ? 15  PHE F CZ  1 
ATOM 7735  N N   . ILE F 1 16  ? 101.561 110.570 188.252 1.00 132.37 ? 16  ILE F N   1 
ATOM 7736  C CA  . ILE F 1 16  ? 100.240 110.908 187.731 1.00 131.31 ? 16  ILE F CA  1 
ATOM 7737  C C   . ILE F 1 16  ? 100.329 112.042 186.723 1.00 126.36 ? 16  ILE F C   1 
ATOM 7738  O O   . ILE F 1 16  ? 99.779  111.946 185.619 1.00 114.96 ? 16  ILE F O   1 
ATOM 7739  C CB  . ILE F 1 16  ? 99.281  111.267 188.879 1.00 30.00  ? 16  ILE F CB  1 
ATOM 7740  C CG1 . ILE F 1 16  ? 99.089  110.073 189.804 1.00 30.00  ? 16  ILE F CG1 1 
ATOM 7741  C CG2 . ILE F 1 16  ? 97.939  111.695 188.330 1.00 30.00  ? 16  ILE F CG2 1 
ATOM 7742  C CD1 . ILE F 1 16  ? 98.337  110.408 191.068 1.00 30.00  ? 16  ILE F CD1 1 
ATOM 7743  N N   . ALA F 1 17  ? 101.041 113.116 187.071 1.00 123.07 ? 17  ALA F N   1 
ATOM 7744  C CA  . ALA F 1 17  ? 101.010 114.334 186.267 1.00 113.60 ? 17  ALA F CA  1 
ATOM 7745  C C   . ALA F 1 17  ? 101.774 114.169 184.960 1.00 122.78 ? 17  ALA F C   1 
ATOM 7746  O O   . ALA F 1 17  ? 101.380 114.725 183.928 1.00 135.51 ? 17  ALA F O   1 
ATOM 7747  C CB  . ALA F 1 17  ? 101.573 115.503 187.075 1.00 30.00  ? 17  ALA F CB  1 
ATOM 7748  N N   . MET F 1 18  ? 102.864 113.400 184.977 1.00 110.98 ? 18  MET F N   1 
ATOM 7749  C CA  . MET F 1 18  ? 103.679 113.264 183.776 1.00 128.27 ? 18  MET F CA  1 
ATOM 7750  C C   . MET F 1 18  ? 103.001 112.393 182.721 1.00 133.84 ? 18  MET F C   1 
ATOM 7751  O O   . MET F 1 18  ? 103.255 112.577 181.526 1.00 141.63 ? 18  MET F O   1 
ATOM 7752  C CB  . MET F 1 18  ? 105.065 112.720 184.149 1.00 30.00  ? 18  MET F CB  1 
ATOM 7753  C CG  . MET F 1 18  ? 106.097 112.737 183.026 1.00 30.00  ? 18  MET F CG  1 
ATOM 7754  S SD  . MET F 1 18  ? 107.748 112.262 183.552 1.00 30.00  ? 18  MET F SD  1 
ATOM 7755  C CE  . MET F 1 18  ? 108.608 112.289 181.983 1.00 30.00  ? 18  MET F CE  1 
ATOM 7756  N N   . VAL F 1 19  ? 102.123 111.475 183.134 1.00 128.57 ? 19  VAL F N   1 
ATOM 7757  C CA  . VAL F 1 19  ? 101.291 110.750 182.176 1.00 124.82 ? 19  VAL F CA  1 
ATOM 7758  C C   . VAL F 1 19  ? 100.340 111.707 181.463 1.00 121.88 ? 19  VAL F C   1 
ATOM 7759  O O   . VAL F 1 19  ? 100.146 111.617 180.244 1.00 114.40 ? 19  VAL F O   1 
ATOM 7760  C CB  . VAL F 1 19  ? 100.544 109.607 182.888 1.00 30.00  ? 19  VAL F CB  1 
ATOM 7761  C CG1 . VAL F 1 19  ? 99.493  108.980 181.989 1.00 30.00  ? 19  VAL F CG1 1 
ATOM 7762  C CG2 . VAL F 1 19  ? 101.528 108.541 183.303 1.00 30.00  ? 19  VAL F CG2 1 
ATOM 7763  N N   . LEU F 1 20  ? 99.774  112.672 182.197 1.00 123.94 ? 20  LEU F N   1 
ATOM 7764  C CA  . LEU F 1 20  ? 98.908  113.667 181.569 1.00 120.76 ? 20  LEU F CA  1 
ATOM 7765  C C   . LEU F 1 20  ? 99.702  114.642 180.712 1.00 118.82 ? 20  LEU F C   1 
ATOM 7766  O O   . LEU F 1 20  ? 99.135  115.291 179.827 1.00 128.24 ? 20  LEU F O   1 
ATOM 7767  C CB  . LEU F 1 20  ? 98.111  114.422 182.628 1.00 30.00  ? 20  LEU F CB  1 
ATOM 7768  C CG  . LEU F 1 20  ? 97.086  113.578 183.380 1.00 30.00  ? 20  LEU F CG  1 
ATOM 7769  C CD1 . LEU F 1 20  ? 96.441  114.390 184.485 1.00 30.00  ? 20  LEU F CD1 1 
ATOM 7770  C CD2 . LEU F 1 20  ? 96.039  113.046 182.421 1.00 30.00  ? 20  LEU F CD2 1 
ATOM 7771  N N   . VAL F 1 21  ? 101.005 114.762 180.964 1.00 118.89 ? 21  VAL F N   1 
ATOM 7772  C CA  . VAL F 1 21  ? 101.877 115.478 180.043 1.00 124.09 ? 21  VAL F CA  1 
ATOM 7773  C C   . VAL F 1 21  ? 102.307 114.555 178.910 1.00 132.71 ? 21  VAL F C   1 
ATOM 7774  O O   . VAL F 1 21  ? 102.505 114.997 177.771 1.00 133.89 ? 21  VAL F O   1 
ATOM 7775  C CB  . VAL F 1 21  ? 103.058 116.067 180.835 1.00 30.00  ? 21  VAL F CB  1 
ATOM 7776  C CG1 . VAL F 1 21  ? 104.073 116.743 179.935 1.00 30.00  ? 21  VAL F CG1 1 
ATOM 7777  C CG2 . VAL F 1 21  ? 102.521 117.059 181.840 1.00 30.00  ? 21  VAL F CG2 1 
ATOM 7778  N N   . ALA F 1 22  ? 102.398 113.252 179.177 1.00 119.64 ? 22  ALA F N   1 
ATOM 7779  C CA  . ALA F 1 22  ? 102.598 112.301 178.091 1.00 121.63 ? 22  ALA F CA  1 
ATOM 7780  C C   . ALA F 1 22  ? 101.351 112.187 177.224 1.00 121.50 ? 22  ALA F C   1 
ATOM 7781  O O   . ALA F 1 22  ? 101.441 111.836 176.043 1.00 124.27 ? 22  ALA F O   1 
ATOM 7782  C CB  . ALA F 1 22  ? 102.987 110.935 178.649 1.00 30.00  ? 22  ALA F CB  1 
ATOM 7783  N N   . ALA F 1 23  ? 100.180 112.480 177.795 1.00 123.64 ? 23  ALA F N   1 
ATOM 7784  C CA  . ALA F 1 23  ? 98.937  112.472 177.036 1.00 136.43 ? 23  ALA F CA  1 
ATOM 7785  C C   . ALA F 1 23  ? 98.886  113.571 175.986 1.00 124.63 ? 23  ALA F C   1 
ATOM 7786  O O   . ALA F 1 23  ? 98.503  113.298 174.844 1.00 135.97 ? 23  ALA F O   1 
ATOM 7787  C CB  . ALA F 1 23  ? 97.740  112.602 177.979 1.00 30.00  ? 23  ALA F CB  1 
ATOM 7788  N N   . VAL F 1 24  ? 99.288  114.797 176.326 1.00 119.23 ? 24  VAL F N   1 
ATOM 7789  C CA  . VAL F 1 24  ? 99.329  115.870 175.340 1.00 115.14 ? 24  VAL F CA  1 
ATOM 7790  C C   . VAL F 1 24  ? 100.513 115.726 174.393 1.00 115.95 ? 24  VAL F C   1 
ATOM 7791  O O   . VAL F 1 24  ? 100.580 116.454 173.392 1.00 121.87 ? 24  VAL F O   1 
ATOM 7792  C CB  . VAL F 1 24  ? 99.349  117.260 176.008 1.00 30.00  ? 24  VAL F CB  1 
ATOM 7793  C CG1 . VAL F 1 24  ? 98.134  117.438 176.905 1.00 30.00  ? 24  VAL F CG1 1 
ATOM 7794  C CG2 . VAL F 1 24  ? 100.628 117.476 176.774 1.00 30.00  ? 24  VAL F CG2 1 
ATOM 7795  N N   . ALA F 1 25  ? 101.447 114.818 174.678 1.00 113.08 ? 25  ALA F N   1 
ATOM 7796  C CA  . ALA F 1 25  ? 102.409 114.395 173.673 1.00 132.88 ? 25  ALA F CA  1 
ATOM 7797  C C   . ALA F 1 25  ? 101.804 113.405 172.692 1.00 125.56 ? 25  ALA F C   1 
ATOM 7798  O O   . ALA F 1 25  ? 102.446 113.074 171.691 1.00 130.11 ? 25  ALA F O   1 
ATOM 7799  C CB  . ALA F 1 25  ? 103.635 113.773 174.338 1.00 30.00  ? 25  ALA F CB  1 
ATOM 7800  N N   . ALA F 1 26  ? 100.596 112.907 172.968 1.00 112.05 ? 26  ALA F N   1 
ATOM 7801  C CA  . ALA F 1 26  ? 99.907  112.001 172.061 1.00 121.96 ? 26  ALA F CA  1 
ATOM 7802  C C   . ALA F 1 26  ? 98.542  112.502 171.625 1.00 122.57 ? 26  ALA F C   1 
ATOM 7803  O O   . ALA F 1 26  ? 98.232  112.426 170.435 1.00 124.18 ? 26  ALA F O   1 
ATOM 7804  C CB  . ALA F 1 26  ? 99.738  110.623 172.709 1.00 30.00  ? 26  ALA F CB  1 
ATOM 7805  N N   . ALA F 1 27  ? 97.732  113.037 172.540 1.00 120.74 ? 27  ALA F N   1 
ATOM 7806  C CA  . ALA F 1 27  ? 96.389  113.477 172.182 1.00 112.14 ? 27  ALA F CA  1 
ATOM 7807  C C   . ALA F 1 27  ? 96.386  114.744 171.343 1.00 126.27 ? 27  ALA F C   1 
ATOM 7808  O O   . ALA F 1 27  ? 95.358  115.057 170.734 1.00 129.46 ? 27  ALA F O   1 
ATOM 7809  C CB  . ALA F 1 27  ? 95.544  113.699 173.436 1.00 30.00  ? 27  ALA F CB  1 
ATOM 7810  N N   . VAL F 1 28  ? 97.498  115.472 171.306 1.00 128.89 ? 28  VAL F N   1 
ATOM 7811  C CA  . VAL F 1 28  ? 97.674  116.605 170.408 1.00 113.05 ? 28  VAL F CA  1 
ATOM 7812  C C   . VAL F 1 28  ? 98.475  116.213 169.173 1.00 121.90 ? 28  VAL F C   1 
ATOM 7813  O O   . VAL F 1 28  ? 98.138  116.606 168.056 1.00 122.20 ? 28  VAL F O   1 
ATOM 7814  C CB  . VAL F 1 28  ? 98.351  117.766 171.167 1.00 30.00  ? 28  VAL F CB  1 
ATOM 7815  C CG1 . VAL F 1 28  ? 98.592  118.949 170.257 1.00 30.00  ? 28  VAL F CG1 1 
ATOM 7816  C CG2 . VAL F 1 28  ? 97.507  118.172 172.354 1.00 30.00  ? 28  VAL F CG2 1 
ATOM 7817  N N   . LEU F 1 29  ? 99.510  115.396 169.361 1.00 114.96 ? 29  LEU F N   1 
ATOM 7818  C CA  . LEU F 1 29  ? 100.425 115.082 168.273 1.00 129.81 ? 29  LEU F CA  1 
ATOM 7819  C C   . LEU F 1 29  ? 99.786  114.129 167.270 1.00 140.90 ? 29  LEU F C   1 
ATOM 7820  O O   . LEU F 1 29  ? 100.099 114.186 166.077 1.00 135.21 ? 29  LEU F O   1 
ATOM 7821  C CB  . LEU F 1 29  ? 101.723 114.514 168.851 1.00 30.00  ? 29  LEU F CB  1 
ATOM 7822  C CG  . LEU F 1 29  ? 103.012 114.422 168.030 1.00 30.00  ? 29  LEU F CG  1 
ATOM 7823  C CD1 . LEU F 1 29  ? 104.186 114.562 168.972 1.00 30.00  ? 29  LEU F CD1 1 
ATOM 7824  C CD2 . LEU F 1 29  ? 103.135 113.121 167.282 1.00 30.00  ? 29  LEU F CD2 1 
ATOM 7825  N N   . ILE F 1 30  ? 98.886  113.252 167.723 1.00 133.11 ? 30  ILE F N   1 
ATOM 7826  C CA  . ILE F 1 30  ? 98.051  112.523 166.772 1.00 124.38 ? 30  ILE F CA  1 
ATOM 7827  C C   . ILE F 1 30  ? 97.047  113.474 166.134 1.00 127.80 ? 30  ILE F C   1 
ATOM 7828  O O   . ILE F 1 30  ? 96.785  113.406 164.926 1.00 124.15 ? 30  ILE F O   1 
ATOM 7829  C CB  . ILE F 1 30  ? 97.356  111.328 167.456 1.00 30.00  ? 30  ILE F CB  1 
ATOM 7830  C CG1 . ILE F 1 30  ? 98.381  110.315 167.958 1.00 30.00  ? 30  ILE F CG1 1 
ATOM 7831  C CG2 . ILE F 1 30  ? 96.400  110.614 166.507 1.00 30.00  ? 30  ILE F CG2 1 
ATOM 7832  C CD1 . ILE F 1 30  ? 97.769  109.224 168.821 1.00 30.00  ? 30  ILE F CD1 1 
ATOM 7833  N N   . GLN F 1 31  ? 96.505  114.404 166.927 1.00 132.79 ? 31  GLN F N   1 
ATOM 7834  C CA  . GLN F 1 31  ? 95.491  115.337 166.445 1.00 126.31 ? 31  GLN F CA  1 
ATOM 7835  C C   . GLN F 1 31  ? 96.065  116.328 165.436 1.00 126.39 ? 31  GLN F C   1 
ATOM 7836  O O   . GLN F 1 31  ? 95.363  116.749 164.510 1.00 134.06 ? 31  GLN F O   1 
ATOM 7837  C CB  . GLN F 1 31  ? 94.864  116.072 167.632 1.00 30.00  ? 31  GLN F CB  1 
ATOM 7838  C CG  . GLN F 1 31  ? 93.719  117.008 167.287 1.00 30.00  ? 31  GLN F CG  1 
ATOM 7839  C CD  . GLN F 1 31  ? 93.152  117.706 168.504 1.00 30.00  ? 31  GLN F CD  1 
ATOM 7840  O OE1 . GLN F 1 31  ? 93.607  117.492 169.626 1.00 30.00  ? 31  GLN F OE1 1 
ATOM 7841  N NE2 . GLN F 1 31  ? 92.163  118.563 168.285 1.00 30.00  ? 31  GLN F NE2 1 
ATOM 7842  N N   . THR F 1 32  ? 97.337  116.703 165.585 1.00 112.61 ? 32  THR F N   1 
ATOM 7843  C CA  . THR F 1 32  ? 97.976  117.497 164.542 1.00 127.34 ? 32  THR F CA  1 
ATOM 7844  C C   . THR F 1 32  ? 98.173  116.695 163.267 1.00 131.45 ? 32  THR F C   1 
ATOM 7845  O O   . THR F 1 32  ? 97.973  117.224 162.169 1.00 120.85 ? 32  THR F O   1 
ATOM 7846  C CB  . THR F 1 32  ? 99.317  118.044 165.026 1.00 30.00  ? 32  THR F CB  1 
ATOM 7847  O OG1 . THR F 1 32  ? 100.128 116.966 165.507 1.00 30.00  ? 32  THR F OG1 1 
ATOM 7848  C CG2 . THR F 1 32  ? 99.117  119.077 166.116 1.00 30.00  ? 32  THR F CG2 1 
ATOM 7849  N N   . SER F 1 33  ? 98.540  115.419 163.387 1.00 130.67 ? 33  SER F N   1 
ATOM 7850  C CA  . SER F 1 33  ? 98.481  114.541 162.227 1.00 132.42 ? 33  SER F CA  1 
ATOM 7851  C C   . SER F 1 33  ? 97.042  114.212 161.871 1.00 131.30 ? 33  SER F C   1 
ATOM 7852  O O   . SER F 1 33  ? 96.757  113.832 160.732 1.00 133.84 ? 33  SER F O   1 
ATOM 7853  C CB  . SER F 1 33  ? 99.273  113.265 162.485 1.00 30.00  ? 33  SER F CB  1 
ATOM 7854  O OG  . SER F 1 33  ? 100.646 113.559 162.666 1.00 30.00  ? 33  SER F OG  1 
ATOM 7855  N N   . GLY F 1 34  ? 96.126  114.348 162.834 1.00 129.56 ? 34  GLY F N   1 
ATOM 7856  C CA  . GLY F 1 34  ? 94.709  114.254 162.523 1.00 121.87 ? 34  GLY F CA  1 
ATOM 7857  C C   . GLY F 1 34  ? 94.232  115.407 161.665 1.00 127.99 ? 34  GLY F C   1 
ATOM 7858  O O   . GLY F 1 34  ? 93.263  115.273 160.911 1.00 136.74 ? 34  GLY F O   1 
ATOM 7859  N N   . TYR F 1 35  ? 94.905  116.555 161.763 1.00 111.57 ? 35  TYR F N   1 
ATOM 7860  C CA  . TYR F 1 35  ? 94.657  117.627 160.809 1.00 115.71 ? 35  TYR F CA  1 
ATOM 7861  C C   . TYR F 1 35  ? 95.191  117.261 159.431 1.00 122.18 ? 35  TYR F C   1 
ATOM 7862  O O   . TYR F 1 35  ? 94.685  117.744 158.412 1.00 127.53 ? 35  TYR F O   1 
ATOM 7863  C CB  . TYR F 1 35  ? 95.285  118.933 161.297 1.00 30.00  ? 35  TYR F CB  1 
ATOM 7864  C CG  . TYR F 1 35  ? 95.007  120.104 160.386 1.00 30.00  ? 35  TYR F CG  1 
ATOM 7865  C CD1 . TYR F 1 35  ? 93.776  120.742 160.407 1.00 30.00  ? 35  TYR F CD1 1 
ATOM 7866  C CD2 . TYR F 1 35  ? 95.966  120.556 159.490 1.00 30.00  ? 35  TYR F CD2 1 
ATOM 7867  C CE1 . TYR F 1 35  ? 93.513  121.806 159.570 1.00 30.00  ? 35  TYR F CE1 1 
ATOM 7868  C CE2 . TYR F 1 35  ? 95.710  121.613 158.649 1.00 30.00  ? 35  TYR F CE2 1 
ATOM 7869  C CZ  . TYR F 1 35  ? 94.486  122.236 158.694 1.00 30.00  ? 35  TYR F CZ  1 
ATOM 7870  O OH  . TYR F 1 35  ? 94.235  123.295 157.855 1.00 30.00  ? 35  TYR F OH  1 
ATOM 7871  N N   . LEU F 1 36  ? 96.215  116.410 159.377 1.00 116.21 ? 36  LEU F N   1 
ATOM 7872  C CA  . LEU F 1 36  ? 96.821  116.076 158.098 1.00 130.01 ? 36  LEU F CA  1 
ATOM 7873  C C   . LEU F 1 36  ? 95.959  115.144 157.260 1.00 123.78 ? 36  LEU F C   1 
ATOM 7874  O O   . LEU F 1 36  ? 95.946  115.294 156.036 1.00 118.51 ? 36  LEU F O   1 
ATOM 7875  C CB  . LEU F 1 36  ? 98.204  115.466 158.312 1.00 30.00  ? 36  LEU F CB  1 
ATOM 7876  C CG  . LEU F 1 36  ? 99.197  116.432 158.955 1.00 30.00  ? 36  LEU F CG  1 
ATOM 7877  C CD1 . LEU F 1 36  ? 100.499 115.725 159.250 1.00 30.00  ? 36  LEU F CD1 1 
ATOM 7878  C CD2 . LEU F 1 36  ? 99.428  117.637 158.065 1.00 30.00  ? 36  LEU F CD2 1 
ATOM 7879  N N   . GLN F 1 37  ? 95.222  114.209 157.878 1.00 123.38 ? 37  GLN F N   1 
ATOM 7880  C CA  . GLN F 1 37  ? 94.355  113.334 157.090 1.00 117.62 ? 37  GLN F CA  1 
ATOM 7881  C C   . GLN F 1 37  ? 93.216  114.095 156.429 1.00 110.58 ? 37  GLN F C   1 
ATOM 7882  O O   . GLN F 1 37  ? 92.718  113.667 155.383 1.00 111.88 ? 37  GLN F O   1 
ATOM 7883  C CB  . GLN F 1 37  ? 93.773  112.188 157.923 1.00 30.00  ? 37  GLN F CB  1 
ATOM 7884  C CG  . GLN F 1 37  ? 94.747  111.070 158.224 1.00 30.00  ? 37  GLN F CG  1 
ATOM 7885  C CD  . GLN F 1 37  ? 95.412  111.198 159.561 1.00 30.00  ? 37  GLN F CD  1 
ATOM 7886  O OE1 . GLN F 1 37  ? 94.839  111.750 160.491 1.00 30.00  ? 37  GLN F OE1 1 
ATOM 7887  N NE2 . GLN F 1 37  ? 96.641  110.713 159.663 1.00 30.00  ? 37  GLN F NE2 1 
ATOM 7888  N N   . GLN F 1 38  ? 92.795  115.224 157.002 1.00 110.77 ? 38  GLN F N   1 
ATOM 7889  C CA  . GLN F 1 38  ? 91.783  116.029 156.328 1.00 125.53 ? 38  GLN F CA  1 
ATOM 7890  C C   . GLN F 1 38  ? 92.429  117.075 155.430 1.00 131.29 ? 38  GLN F C   1 
ATOM 7891  O O   . GLN F 1 38  ? 91.746  117.958 154.898 1.00 143.08 ? 38  GLN F O   1 
ATOM 7892  C CB  . GLN F 1 38  ? 90.835  116.677 157.345 1.00 30.00  ? 38  GLN F CB  1 
ATOM 7893  C CG  . GLN F 1 38  ? 91.437  117.738 158.247 1.00 30.00  ? 38  GLN F CG  1 
ATOM 7894  C CD  . GLN F 1 38  ? 90.432  118.282 159.253 1.00 30.00  ? 38  GLN F CD  1 
ATOM 7895  O OE1 . GLN F 1 38  ? 89.270  117.885 159.259 1.00 30.00  ? 38  GLN F OE1 1 
ATOM 7896  N NE2 . GLN F 1 38  ? 90.876  119.198 160.101 1.00 30.00  ? 38  GLN F NE2 1 
ATOM 7897  N N   . LYS F 1 39  ? 93.753  116.998 155.248 1.00 115.39 ? 39  LYS F N   1 
ATOM 7898  C CA  . LYS F 1 39  ? 94.391  117.907 154.303 1.00 122.69 ? 39  LYS F CA  1 
ATOM 7899  C C   . LYS F 1 39  ? 95.306  117.180 153.321 1.00 122.92 ? 39  LYS F C   1 
ATOM 7900  O O   . LYS F 1 39  ? 95.355  117.544 152.143 1.00 119.94 ? 39  LYS F O   1 
ATOM 7901  C CB  . LYS F 1 39  ? 95.155  118.995 155.054 1.00 30.00  ? 39  LYS F CB  1 
ATOM 7902  C CG  . LYS F 1 39  ? 95.675  120.077 154.140 1.00 30.00  ? 39  LYS F CG  1 
ATOM 7903  C CD  . LYS F 1 39  ? 94.496  120.766 153.483 1.00 30.00  ? 39  LYS F CD  1 
ATOM 7904  C CE  . LYS F 1 39  ? 94.926  121.876 152.562 1.00 30.00  ? 39  LYS F CE  1 
ATOM 7905  N NZ  . LYS F 1 39  ? 93.751  122.475 151.884 1.00 30.00  ? 39  LYS F NZ  1 
ATOM 7906  N N   . SER F 1 40  ? 96.022  116.147 153.763 1.00 115.71 ? 40  SER F N   1 
ATOM 7907  C CA  . SER F 1 40  ? 96.955  115.480 152.859 1.00 125.17 ? 40  SER F CA  1 
ATOM 7908  C C   . SER F 1 40  ? 96.230  114.555 151.892 1.00 124.47 ? 40  SER F C   1 
ATOM 7909  O O   . SER F 1 40  ? 96.618  114.440 150.724 1.00 117.25 ? 40  SER F O   1 
ATOM 7910  C CB  . SER F 1 40  ? 98.003  114.705 153.655 1.00 30.00  ? 40  SER F CB  1 
ATOM 7911  O OG  . SER F 1 40  ? 97.384  113.713 154.450 1.00 30.00  ? 40  SER F OG  1 
ATOM 7912  N N   . GLN F 1 41  ? 95.177  113.882 152.367 1.00 124.77 ? 41  GLN F N   1 
ATOM 7913  C CA  . GLN F 1 41  ? 94.473  112.896 151.550 1.00 118.76 ? 41  GLN F CA  1 
ATOM 7914  C C   . GLN F 1 41  ? 93.751  113.540 150.375 1.00 112.40 ? 41  GLN F C   1 
ATOM 7915  O O   . GLN F 1 41  ? 93.731  112.973 149.277 1.00 107.21 ? 41  GLN F O   1 
ATOM 7916  C CB  . GLN F 1 41  ? 93.472  112.125 152.410 1.00 30.00  ? 41  GLN F CB  1 
ATOM 7917  C CG  . GLN F 1 41  ? 94.089  111.275 153.502 1.00 30.00  ? 41  GLN F CG  1 
ATOM 7918  C CD  . GLN F 1 41  ? 93.043  110.589 154.360 1.00 30.00  ? 41  GLN F CD  1 
ATOM 7919  O OE1 . GLN F 1 41  ? 91.844  110.794 154.181 1.00 30.00  ? 41  GLN F OE1 1 
ATOM 7920  N NE2 . GLN F 1 41  ? 93.494  109.774 155.302 1.00 30.00  ? 41  GLN F NE2 1 
ATOM 7921  N N   . ALA F 1 42  ? 93.166  114.718 150.584 1.00 117.08 ? 42  ALA F N   1 
ATOM 7922  C CA  . ALA F 1 42  ? 92.438  115.389 149.513 1.00 121.87 ? 42  ALA F CA  1 
ATOM 7923  C C   . ALA F 1 42  ? 93.397  115.986 148.492 1.00 124.60 ? 42  ALA F C   1 
ATOM 7924  O O   . ALA F 1 42  ? 93.194  115.854 147.280 1.00 129.32 ? 42  ALA F O   1 
ATOM 7925  C CB  . ALA F 1 42  ? 91.523  116.465 150.099 1.00 30.00  ? 42  ALA F CB  1 
ATOM 7926  N N   . THR F 1 43  ? 94.465  116.633 148.966 1.00 122.18 ? 43  THR F N   1 
ATOM 7927  C CA  . THR F 1 43  ? 95.453  117.234 148.077 1.00 129.90 ? 43  THR F CA  1 
ATOM 7928  C C   . THR F 1 43  ? 96.226  116.210 147.261 1.00 121.89 ? 43  THR F C   1 
ATOM 7929  O O   . THR F 1 43  ? 96.793  116.573 146.226 1.00 106.94 ? 43  THR F O   1 
ATOM 7930  C CB  . THR F 1 43  ? 96.430  118.091 148.875 1.00 30.00  ? 43  THR F CB  1 
ATOM 7931  O OG1 . THR F 1 43  ? 96.988  117.312 149.940 1.00 30.00  ? 43  THR F OG1 1 
ATOM 7932  C CG2 . THR F 1 43  ? 95.731  119.316 149.432 1.00 30.00  ? 43  THR F CG2 1 
ATOM 7933  N N   . GLY F 1 44  ? 96.266  114.954 147.694 1.00 116.35 ? 44  GLY F N   1 
ATOM 7934  C CA  . GLY F 1 44  ? 96.809  113.904 146.861 1.00 102.42 ? 44  GLY F CA  1 
ATOM 7935  C C   . GLY F 1 44  ? 95.909  113.607 145.680 1.00 107.16 ? 44  GLY F C   1 
ATOM 7936  O O   . GLY F 1 44  ? 96.366  113.582 144.534 1.00 105.71 ? 44  GLY F O   1 
ATOM 7937  N N   . ARG F 1 45  ? 94.619  113.396 145.954 1.00 121.34 ? 45  ARG F N   1 
ATOM 7938  C CA  . ARG F 1 45  ? 93.699  112.967 144.906 1.00 118.64 ? 45  ARG F CA  1 
ATOM 7939  C C   . ARG F 1 45  ? 93.377  114.097 143.941 1.00 114.49 ? 45  ARG F C   1 
ATOM 7940  O O   . ARG F 1 45  ? 93.199  113.865 142.739 1.00 119.78 ? 45  ARG F O   1 
ATOM 7941  C CB  . ARG F 1 45  ? 92.407  112.434 145.519 1.00 30.00  ? 45  ARG F CB  1 
ATOM 7942  C CG  . ARG F 1 45  ? 92.547  111.167 146.329 1.00 30.00  ? 45  ARG F CG  1 
ATOM 7943  C CD  . ARG F 1 45  ? 91.184  110.688 146.786 1.00 30.00  ? 45  ARG F CD  1 
ATOM 7944  N NE  . ARG F 1 45  ? 90.574  111.612 147.735 1.00 30.00  ? 45  ARG F NE  1 
ATOM 7945  C CZ  . ARG F 1 45  ? 89.527  112.381 147.459 1.00 30.00  ? 45  ARG F CZ  1 
ATOM 7946  N NH1 . ARG F 1 45  ? 88.975  112.344 146.255 1.00 30.00  ? 45  ARG F NH1 1 
ATOM 7947  N NH2 . ARG F 1 45  ? 89.038  113.194 148.383 1.00 30.00  ? 45  ARG F NH2 1 
ATOM 7948  N N   . GLU F 1 46  ? 93.308  115.330 144.444 1.00 110.36 ? 46  GLU F N   1 
ATOM 7949  C CA  . GLU F 1 46  ? 92.839  116.439 143.622 1.00 120.39 ? 46  GLU F CA  1 
ATOM 7950  C C   . GLU F 1 46  ? 93.889  116.908 142.623 1.00 123.08 ? 46  GLU F C   1 
ATOM 7951  O O   . GLU F 1 46  ? 93.606  117.784 141.799 1.00 126.45 ? 46  GLU F O   1 
ATOM 7952  C CB  . GLU F 1 46  ? 92.398  117.593 144.517 1.00 30.00  ? 46  GLU F CB  1 
ATOM 7953  C CG  . GLU F 1 46  ? 91.120  117.317 145.276 1.00 30.00  ? 46  GLU F CG  1 
ATOM 7954  C CD  . GLU F 1 46  ? 90.785  118.413 146.256 1.00 30.00  ? 46  GLU F CD  1 
ATOM 7955  O OE1 . GLU F 1 46  ? 91.624  119.314 146.440 1.00 30.00  ? 46  GLU F OE1 1 
ATOM 7956  O OE2 . GLU F 1 46  ? 89.687  118.376 146.847 1.00 30.00  ? 46  GLU F OE2 1 
ATOM 7957  N N   . THR F 1 47  ? 95.097  116.352 142.674 1.00 109.60 ? 47  THR F N   1 
ATOM 7958  C CA  . THR F 1 47  ? 96.153  116.794 141.781 1.00 114.97 ? 47  THR F CA  1 
ATOM 7959  C C   . THR F 1 47  ? 96.517  115.771 140.720 1.00 122.24 ? 47  THR F C   1 
ATOM 7960  O O   . THR F 1 47  ? 97.475  115.992 139.975 1.00 126.78 ? 47  THR F O   1 
ATOM 7961  C CB  . THR F 1 47  ? 97.376  117.155 142.595 1.00 30.00  ? 47  THR F CB  1 
ATOM 7962  O OG1 . THR F 1 47  ? 97.711  116.035 143.417 1.00 30.00  ? 47  THR F OG1 1 
ATOM 7963  C CG2 . THR F 1 47  ? 97.064  118.367 143.450 1.00 30.00  ? 47  THR F CG2 1 
ATOM 7964  N N   . THR F 1 48  ? 95.801  114.653 140.647 1.00 106.63 ? 48  THR F N   1 
ATOM 7965  C CA  . THR F 1 48  ? 95.738  113.940 139.379 1.00 106.27 ? 48  THR F CA  1 
ATOM 7966  C C   . THR F 1 48  ? 94.602  114.489 138.534 1.00 112.60 ? 48  THR F C   1 
ATOM 7967  O O   . THR F 1 48  ? 94.749  114.659 137.320 1.00 117.23 ? 48  THR F O   1 
ATOM 7968  C CB  . THR F 1 48  ? 95.548  112.444 139.602 1.00 30.00  ? 48  THR F CB  1 
ATOM 7969  O OG1 . THR F 1 48  ? 94.308  112.223 140.281 1.00 30.00  ? 48  THR F OG1 1 
ATOM 7970  C CG2 . THR F 1 48  ? 96.671  111.900 140.434 1.00 30.00  ? 48  THR F CG2 1 
ATOM 7971  N N   . GLN F 1 49  ? 93.474  114.793 139.182 1.00 120.76 ? 49  GLN F N   1 
ATOM 7972  C CA  . GLN F 1 49  ? 92.336  115.403 138.508 1.00 129.15 ? 49  GLN F CA  1 
ATOM 7973  C C   . GLN F 1 49  ? 92.670  116.795 137.999 1.00 124.57 ? 49  GLN F C   1 
ATOM 7974  O O   . GLN F 1 49  ? 92.111  117.237 136.993 1.00 134.69 ? 49  GLN F O   1 
ATOM 7975  C CB  . GLN F 1 49  ? 91.153  115.458 139.469 1.00 30.00  ? 49  GLN F CB  1 
ATOM 7976  C CG  . GLN F 1 49  ? 90.684  114.096 139.929 1.00 30.00  ? 49  GLN F CG  1 
ATOM 7977  C CD  . GLN F 1 49  ? 89.580  114.183 140.953 1.00 30.00  ? 49  GLN F CD  1 
ATOM 7978  O OE1 . GLN F 1 49  ? 89.195  115.271 141.378 1.00 30.00  ? 49  GLN F OE1 1 
ATOM 7979  N NE2 . GLN F 1 49  ? 89.064  113.032 141.362 1.00 30.00  ? 49  GLN F NE2 1 
ATOM 7980  N N   . GLU F 1 50  ? 93.579  117.493 138.676 1.00 118.17 ? 50  GLU F N   1 
ATOM 7981  C CA  . GLU F 1 50  ? 94.077  118.763 138.172 1.00 122.89 ? 50  GLU F CA  1 
ATOM 7982  C C   . GLU F 1 50  ? 94.914  118.589 136.909 1.00 108.02 ? 50  GLU F C   1 
ATOM 7983  O O   . GLU F 1 50  ? 94.935  119.491 136.064 1.00 108.64 ? 50  GLU F O   1 
ATOM 7984  C CB  . GLU F 1 50  ? 94.892  119.459 139.270 1.00 30.00  ? 50  GLU F CB  1 
ATOM 7985  C CG  . GLU F 1 50  ? 95.437  120.851 138.946 1.00 30.00  ? 50  GLU F CG  1 
ATOM 7986  C CD  . GLU F 1 50  ? 94.353  121.899 138.806 1.00 30.00  ? 50  GLU F CD  1 
ATOM 7987  O OE1 . GLU F 1 50  ? 93.269  121.726 139.403 1.00 30.00  ? 50  GLU F OE1 1 
ATOM 7988  O OE2 . GLU F 1 50  ? 94.589  122.904 138.102 1.00 30.00  ? 50  GLU F OE2 1 
ATOM 7989  N N   . VAL F 1 51  ? 95.575  117.446 136.738 1.00 112.66 ? 51  VAL F N   1 
ATOM 7990  C CA  . VAL F 1 51  ? 96.535  117.287 135.655 1.00 114.59 ? 51  VAL F CA  1 
ATOM 7991  C C   . VAL F 1 51  ? 96.079  116.309 134.576 1.00 112.54 ? 51  VAL F C   1 
ATOM 7992  O O   . VAL F 1 51  ? 96.490  116.467 133.416 1.00 128.80 ? 51  VAL F O   1 
ATOM 7993  C CB  . VAL F 1 51  ? 97.925  116.884 136.194 1.00 30.00  ? 51  VAL F CB  1 
ATOM 7994  C CG1 . VAL F 1 51  ? 98.387  117.887 137.232 1.00 30.00  ? 51  VAL F CG1 1 
ATOM 7995  C CG2 . VAL F 1 51  ? 97.941  115.480 136.768 1.00 30.00  ? 51  VAL F CG2 1 
ATOM 7996  N N   . ALA F 1 52  ? 95.240  115.322 134.899 1.00 30.00  ? 52  ALA F N   1 
ATOM 7997  C CA  . ALA F 1 52  ? 94.873  114.327 133.896 1.00 30.00  ? 52  ALA F CA  1 
ATOM 7998  C C   . ALA F 1 52  ? 93.624  114.750 133.143 1.00 30.00  ? 52  ALA F C   1 
ATOM 7999  O O   . ALA F 1 52  ? 93.494  114.490 131.943 1.00 30.00  ? 52  ALA F O   1 
ATOM 8000  C CB  . ALA F 1 52  ? 94.669  112.958 134.543 1.00 30.00  ? 52  ALA F CB  1 
ATOM 8001  N N   . SER F 1 53  ? 92.690  115.389 133.837 1.00 113.33 ? 53  SER F N   1 
ATOM 8002  C CA  . SER F 1 53  ? 91.480  115.875 133.198 1.00 119.89 ? 53  SER F CA  1 
ATOM 8003  C C   . SER F 1 53  ? 91.803  117.030 132.263 1.00 124.17 ? 53  SER F C   1 
ATOM 8004  O O   . SER F 1 53  ? 92.540  117.955 132.610 1.00 123.77 ? 53  SER F O   1 
ATOM 8005  C CB  . SER F 1 53  ? 90.467  116.318 134.250 1.00 135.93 ? 53  SER F CB  1 
ATOM 8006  O OG  . SER F 1 53  ? 90.962  117.389 135.023 1.00 150.89 ? 53  SER F OG  1 
ATOM 8007  N N   . GLY F 1 54  ? 91.259  116.962 131.057 1.00 126.56 ? 54  GLY F N   1 
ATOM 8008  C CA  . GLY F 1 54  ? 91.564  117.995 130.096 1.00 107.25 ? 54  GLY F CA  1 
ATOM 8009  C C   . GLY F 1 54  ? 90.697  118.008 128.858 1.00 106.60 ? 54  GLY F C   1 
ATOM 8010  O O   . GLY F 1 54  ? 90.270  116.965 128.358 1.00 103.76 ? 54  GLY F O   1 
ATOM 8011  N N   . ILE F 1 55  ? 90.454  119.212 128.357 1.00 100.38 ? 55  ILE F N   1 
ATOM 8012  C CA  . ILE F 1 55  ? 89.653  119.463 127.169 1.00 80.06  ? 55  ILE F CA  1 
ATOM 8013  C C   . ILE F 1 55  ? 90.593  119.645 125.988 1.00 98.77  ? 55  ILE F C   1 
ATOM 8014  O O   . ILE F 1 55  ? 91.571  120.390 126.087 1.00 111.05 ? 55  ILE F O   1 
ATOM 8015  C CB  . ILE F 1 55  ? 88.768  120.702 127.385 1.00 30.00  ? 55  ILE F CB  1 
ATOM 8016  C CG1 . ILE F 1 55  ? 87.605  120.369 128.319 1.00 30.00  ? 55  ILE F CG1 1 
ATOM 8017  C CG2 . ILE F 1 55  ? 88.351  121.344 126.086 1.00 30.00  ? 55  ILE F CG2 1 
ATOM 8018  C CD1 . ILE F 1 55  ? 86.748  121.553 128.665 1.00 30.00  ? 55  ILE F CD1 1 
ATOM 8019  N N   . LYS F 1 56  ? 90.322  118.953 124.883 1.00 98.92  ? 56  LYS F N   1 
ATOM 8020  C CA  . LYS F 1 56  ? 91.081  119.149 123.655 1.00 91.81  ? 56  LYS F CA  1 
ATOM 8021  C C   . LYS F 1 56  ? 90.161  119.594 122.525 1.00 85.75  ? 56  LYS F C   1 
ATOM 8022  O O   . LYS F 1 56  ? 89.038  119.101 122.384 1.00 101.89 ? 56  LYS F O   1 
ATOM 8023  C CB  . LYS F 1 56  ? 91.869  117.884 123.272 1.00 30.00  ? 56  LYS F CB  1 
ATOM 8024  C CG  . LYS F 1 56  ? 91.066  116.645 122.936 1.00 30.00  ? 56  LYS F CG  1 
ATOM 8025  C CD  . LYS F 1 56  ? 92.004  115.492 122.639 1.00 30.00  ? 56  LYS F CD  1 
ATOM 8026  C CE  . LYS F 1 56  ? 91.252  114.208 122.386 1.00 30.00  ? 56  LYS F CE  1 
ATOM 8027  N NZ  . LYS F 1 56  ? 90.452  114.294 121.146 1.00 30.00  ? 56  LYS F NZ  1 
ATOM 8028  N N   . VAL F 1 57  ? 90.648  120.546 121.731 1.00 72.52  ? 57  VAL F N   1 
ATOM 8029  C CA  . VAL F 1 57  ? 89.868  121.236 120.710 1.00 81.55  ? 57  VAL F CA  1 
ATOM 8030  C C   . VAL F 1 57  ? 90.185  120.620 119.359 1.00 102.46 ? 57  VAL F C   1 
ATOM 8031  O O   . VAL F 1 57  ? 91.356  120.517 118.978 1.00 103.19 ? 57  VAL F O   1 
ATOM 8032  C CB  . VAL F 1 57  ? 90.176  122.738 120.704 1.00 30.00  ? 57  VAL F CB  1 
ATOM 8033  C CG1 . VAL F 1 57  ? 89.523  123.414 119.526 1.00 30.00  ? 57  VAL F CG1 1 
ATOM 8034  C CG2 . VAL F 1 57  ? 89.716  123.362 121.997 1.00 30.00  ? 57  VAL F CG2 1 
ATOM 8035  N N   . LEU F 1 58  ? 89.149  120.228 118.627 1.00 92.19  ? 58  LEU F N   1 
ATOM 8036  C CA  . LEU F 1 58  ? 89.315  119.653 117.302 1.00 86.93  ? 58  LEU F CA  1 
ATOM 8037  C C   . LEU F 1 58  ? 88.191  120.121 116.389 1.00 105.85 ? 58  LEU F C   1 
ATOM 8038  O O   . LEU F 1 58  ? 87.033  120.168 116.811 1.00 120.09 ? 58  LEU F O   1 
ATOM 8039  C CB  . LEU F 1 58  ? 89.369  118.121 117.391 1.00 30.00  ? 58  LEU F CB  1 
ATOM 8040  C CG  . LEU F 1 58  ? 88.244  117.308 118.050 1.00 30.00  ? 58  LEU F CG  1 
ATOM 8041  C CD1 . LEU F 1 58  ? 87.138  116.891 117.091 1.00 30.00  ? 58  LEU F CD1 1 
ATOM 8042  C CD2 . LEU F 1 58  ? 88.812  116.089 118.742 1.00 30.00  ? 58  LEU F CD2 1 
ATOM 8043  N N   . SER F 1 59  ? 88.553  120.490 115.156 1.00 102.02 ? 59  SER F N   1 
ATOM 8044  C CA  . SER F 1 59  ? 87.643  120.632 114.015 1.00 101.26 ? 59  SER F CA  1 
ATOM 8045  C C   . SER F 1 59  ? 86.550  121.676 114.268 1.00 100.91 ? 59  SER F C   1 
ATOM 8046  O O   . SER F 1 59  ? 85.370  121.368 114.416 1.00 93.78  ? 59  SER F O   1 
ATOM 8047  C CB  . SER F 1 59  ? 87.037  119.276 113.643 1.00 30.00  ? 59  SER F CB  1 
ATOM 8048  O OG  . SER F 1 59  ? 88.051  118.390 113.216 1.00 30.00  ? 59  SER F OG  1 
ATOM 8049  N N   . VAL F 1 60  ? 86.981  122.918 114.336 1.00 114.53 ? 60  VAL F N   1 
ATOM 8050  C CA  . VAL F 1 60  ? 86.055  124.024 114.527 1.00 106.73 ? 60  VAL F CA  1 
ATOM 8051  C C   . VAL F 1 60  ? 85.534  124.480 113.167 1.00 97.61  ? 60  VAL F C   1 
ATOM 8052  O O   . VAL F 1 60  ? 86.263  124.458 112.171 1.00 91.29  ? 60  VAL F O   1 
ATOM 8053  C CB  . VAL F 1 60  ? 86.764  125.154 115.283 1.00 30.00  ? 60  VAL F CB  1 
ATOM 8054  C CG1 . VAL F 1 60  ? 85.767  126.169 115.757 1.00 30.00  ? 60  VAL F CG1 1 
ATOM 8055  C CG2 . VAL F 1 60  ? 87.568  124.581 116.426 1.00 30.00  ? 60  VAL F CG2 1 
ATOM 8056  N N   . VAL F 1 61  ? 84.262  124.882 113.103 1.00 91.21  ? 61  VAL F N   1 
ATOM 8057  C CA  . VAL F 1 61  ? 83.590  125.157 111.838 1.00 75.96  ? 61  VAL F CA  1 
ATOM 8058  C C   . VAL F 1 61  ? 82.978  126.557 111.843 1.00 85.19  ? 61  VAL F C   1 
ATOM 8059  O O   . VAL F 1 61  ? 82.596  127.093 112.884 1.00 107.80 ? 61  VAL F O   1 
ATOM 8060  C CB  . VAL F 1 61  ? 82.527  124.090 111.547 1.00 30.00  ? 61  VAL F CB  1 
ATOM 8061  C CG1 . VAL F 1 61  ? 83.195  122.769 111.270 1.00 30.00  ? 61  VAL F CG1 1 
ATOM 8062  C CG2 . VAL F 1 61  ? 81.654  123.923 112.749 1.00 30.00  ? 61  VAL F CG2 1 
ATOM 8063  N N   . GLY F 1 62  ? 82.894  127.155 110.648 1.00 70.41  ? 62  GLY F N   1 
ATOM 8064  C CA  . GLY F 1 62  ? 82.664  128.588 110.531 1.00 74.08  ? 62  GLY F CA  1 
ATOM 8065  C C   . GLY F 1 62  ? 81.275  129.170 110.321 1.00 71.97  ? 62  GLY F C   1 
ATOM 8066  O O   . GLY F 1 62  ? 80.837  129.968 111.152 1.00 101.24 ? 62  GLY F O   1 
ATOM 8067  N N   . LYS F 1 63  ? 80.578  128.777 109.241 1.00 30.00  ? 63  LYS F N   1 
ATOM 8068  C CA  . LYS F 1 63  ? 79.264  129.301 108.836 1.00 30.00  ? 63  LYS F CA  1 
ATOM 8069  C C   . LYS F 1 63  ? 79.254  130.812 108.609 1.00 30.00  ? 63  LYS F C   1 
ATOM 8070  O O   . LYS F 1 63  ? 78.870  131.576 109.498 1.00 30.00  ? 63  LYS F O   1 
ATOM 8071  C CB  . LYS F 1 63  ? 78.157  128.911 109.825 1.00 30.00  ? 63  LYS F CB  1 
ATOM 8072  C CG  . LYS F 1 63  ? 76.731  129.251 109.376 1.00 30.00  ? 63  LYS F CG  1 
ATOM 8073  C CD  . LYS F 1 63  ? 76.347  128.489 108.136 1.00 30.00  ? 63  LYS F CD  1 
ATOM 8074  C CE  . LYS F 1 63  ? 74.954  128.868 107.686 1.00 30.00  ? 63  LYS F CE  1 
ATOM 8075  N NZ  . LYS F 1 63  ? 73.940  128.462 108.687 1.00 30.00  ? 63  LYS F NZ  1 
ATOM 8076  N N   . THR F 1 64  ? 79.782  131.272 107.479 1.00 74.75  ? 64  THR F N   1 
ATOM 8077  C CA  . THR F 1 64  ? 79.570  132.667 107.120 1.00 85.42  ? 64  THR F CA  1 
ATOM 8078  C C   . THR F 1 64  ? 78.123  132.911 106.695 1.00 94.58  ? 64  THR F C   1 
ATOM 8079  O O   . THR F 1 64  ? 77.306  131.994 106.588 1.00 107.53 ? 64  THR F O   1 
ATOM 8080  C CB  . THR F 1 64  ? 80.492  133.099 105.991 1.00 30.00  ? 64  THR F CB  1 
ATOM 8081  O OG1 . THR F 1 64  ? 80.340  134.506 105.779 1.00 30.00  ? 64  THR F OG1 1 
ATOM 8082  C CG2 . THR F 1 64  ? 80.115  132.401 104.725 1.00 30.00  ? 64  THR F CG2 1 
ATOM 8083  N N   . ASP F 1 65  ? 77.822  134.176 106.408 1.00 92.95  ? 65  ASP F N   1 
ATOM 8084  C CA  . ASP F 1 65  ? 76.469  134.599 106.074 1.00 78.92  ? 65  ASP F CA  1 
ATOM 8085  C C   . ASP F 1 65  ? 76.207  134.300 104.591 1.00 87.53  ? 65  ASP F C   1 
ATOM 8086  O O   . ASP F 1 65  ? 77.021  133.670 103.911 1.00 108.21 ? 65  ASP F O   1 
ATOM 8087  C CB  . ASP F 1 65  ? 76.304  136.075 106.436 1.00 30.00  ? 65  ASP F CB  1 
ATOM 8088  C CG  . ASP F 1 65  ? 74.855  136.481 106.622 1.00 30.00  ? 65  ASP F CG  1 
ATOM 8089  O OD1 . ASP F 1 65  ? 73.968  135.621 106.433 1.00 30.00  ? 65  ASP F OD1 1 
ATOM 8090  O OD2 . ASP F 1 65  ? 74.606  137.658 106.954 1.00 30.00  ? 65  ASP F OD2 1 
ATOM 8091  N N   . SER F 1 66  ? 75.055  134.738 104.069 1.00 82.88  ? 66  SER F N   1 
ATOM 8092  C CA  . SER F 1 66  ? 74.706  134.583 102.661 1.00 100.10 ? 66  SER F CA  1 
ATOM 8093  C C   . SER F 1 66  ? 75.655  135.318 101.728 1.00 99.91  ? 66  SER F C   1 
ATOM 8094  O O   . SER F 1 66  ? 75.912  134.833 100.622 1.00 105.10 ? 66  SER F O   1 
ATOM 8095  C CB  . SER F 1 66  ? 73.281  135.083 102.417 1.00 30.00  ? 66  SER F CB  1 
ATOM 8096  O OG  . SER F 1 66  ? 72.334  134.318 103.138 1.00 30.00  ? 66  SER F OG  1 
ATOM 8097  N N   . ASN F 1 67  ? 76.172  136.467 102.141 1.00 97.83  ? 67  ASN F N   1 
ATOM 8098  C CA  . ASN F 1 67  ? 77.217  137.179 101.416 1.00 107.23 ? 67  ASN F CA  1 
ATOM 8099  C C   . ASN F 1 67  ? 78.454  137.033 102.293 1.00 118.78 ? 67  ASN F C   1 
ATOM 8100  O O   . ASN F 1 67  ? 78.392  137.292 103.498 1.00 119.03 ? 67  ASN F O   1 
ATOM 8101  C CB  . ASN F 1 67  ? 76.831  138.633 101.170 1.00 30.00  ? 67  ASN F CB  1 
ATOM 8102  C CG  . ASN F 1 67  ? 77.697  139.296 100.120 1.00 30.00  ? 67  ASN F CG  1 
ATOM 8103  O OD1 . ASN F 1 67  ? 78.615  138.682 99.582  1.00 30.00  ? 67  ASN F OD1 1 
ATOM 8104  N ND2 . ASN F 1 67  ? 77.390  140.548 99.802  1.00 30.00  ? 67  ASN F ND2 1 
ATOM 8105  N N   . LYS F 1 68  ? 79.574  136.629 101.686 1.00 119.07 ? 68  LYS F N   1 
ATOM 8106  C CA  . LYS F 1 68  ? 80.708  135.999 102.365 1.00 123.65 ? 68  LYS F CA  1 
ATOM 8107  C C   . LYS F 1 68  ? 81.418  136.836 103.431 1.00 120.01 ? 68  LYS F C   1 
ATOM 8108  O O   . LYS F 1 68  ? 82.305  136.328 104.120 1.00 120.34 ? 68  LYS F O   1 
ATOM 8109  C CB  . LYS F 1 68  ? 81.742  135.571 101.326 1.00 30.00  ? 68  LYS F CB  1 
ATOM 8110  C CG  . LYS F 1 68  ? 81.195  134.713 100.193 1.00 30.00  ? 68  LYS F CG  1 
ATOM 8111  C CD  . LYS F 1 68  ? 80.643  133.386 100.666 1.00 30.00  ? 68  LYS F CD  1 
ATOM 8112  C CE  . LYS F 1 68  ? 80.334  132.486 99.478  1.00 30.00  ? 68  LYS F CE  1 
ATOM 8113  N NZ  . LYS F 1 68  ? 79.241  133.017 98.622  1.00 30.00  ? 68  LYS F NZ  1 
ATOM 8114  N N   . THR F 1 69  ? 81.074  138.113 103.551 1.00 104.67 ? 69  THR F N   1 
ATOM 8115  C CA  . THR F 1 69  ? 81.579  138.960 104.620 1.00 117.77 ? 69  THR F CA  1 
ATOM 8116  C C   . THR F 1 69  ? 81.040  138.478 105.972 1.00 114.76 ? 69  THR F C   1 
ATOM 8117  O O   . THR F 1 69  ? 79.923  137.961 106.062 1.00 113.10 ? 69  THR F O   1 
ATOM 8118  C CB  . THR F 1 69  ? 81.157  140.411 104.346 1.00 30.00  ? 69  THR F CB  1 
ATOM 8119  O OG1 . THR F 1 69  ? 81.518  140.757 103.005 1.00 30.00  ? 69  THR F OG1 1 
ATOM 8120  C CG2 . THR F 1 69  ? 81.843  141.403 105.270 1.00 30.00  ? 69  THR F CG2 1 
ATOM 8121  N N   . TYR F 1 70  ? 81.863  138.634 107.021 1.00 95.58  ? 70  TYR F N   1 
ATOM 8122  C CA  . TYR F 1 70  ? 81.441  138.588 108.428 1.00 91.75  ? 70  TYR F CA  1 
ATOM 8123  C C   . TYR F 1 70  ? 80.875  137.222 108.832 1.00 97.36  ? 70  TYR F C   1 
ATOM 8124  O O   . TYR F 1 70  ? 79.669  137.062 109.018 1.00 106.50 ? 70  TYR F O   1 
ATOM 8125  C CB  . TYR F 1 70  ? 80.401  139.675 108.726 1.00 30.00  ? 70  TYR F CB  1 
ATOM 8126  C CG  . TYR F 1 70  ? 80.904  141.095 108.720 1.00 30.00  ? 70  TYR F CG  1 
ATOM 8127  C CD1 . TYR F 1 70  ? 82.256  141.378 108.840 1.00 30.00  ? 70  TYR F CD1 1 
ATOM 8128  C CD2 . TYR F 1 70  ? 80.018  142.157 108.596 1.00 30.00  ? 70  TYR F CD2 1 
ATOM 8129  C CE1 . TYR F 1 70  ? 82.712  142.683 108.835 1.00 30.00  ? 70  TYR F CE1 1 
ATOM 8130  C CE2 . TYR F 1 70  ? 80.462  143.459 108.589 1.00 30.00  ? 70  TYR F CE2 1 
ATOM 8131  C CZ  . TYR F 1 70  ? 81.808  143.717 108.708 1.00 30.00  ? 70  TYR F CZ  1 
ATOM 8132  O OH  . TYR F 1 70  ? 82.254  145.017 108.701 1.00 30.00  ? 70  TYR F OH  1 
ATOM 8133  N N   . VAL F 1 71  ? 81.767  136.229 108.914 1.00 94.49  ? 71  VAL F N   1 
ATOM 8134  C CA  . VAL F 1 71  ? 81.403  134.909 109.439 1.00 80.78  ? 71  VAL F CA  1 
ATOM 8135  C C   . VAL F 1 71  ? 80.910  134.998 110.883 1.00 87.45  ? 71  VAL F C   1 
ATOM 8136  O O   . VAL F 1 71  ? 81.601  135.520 111.763 1.00 96.24  ? 71  VAL F O   1 
ATOM 8137  C CB  . VAL F 1 71  ? 82.568  133.909 109.282 1.00 30.00  ? 71  VAL F CB  1 
ATOM 8138  C CG1 . VAL F 1 71  ? 83.868  134.472 109.780 1.00 30.00  ? 71  VAL F CG1 1 
ATOM 8139  C CG2 . VAL F 1 71  ? 82.271  132.652 110.044 1.00 30.00  ? 71  VAL F CG2 1 
ATOM 8140  N N   . GLU F 1 72  ? 79.688  134.519 111.133 1.00 85.64  ? 72  GLU F N   1 
ATOM 8141  C CA  . GLU F 1 72  ? 78.969  134.915 112.336 1.00 94.43  ? 72  GLU F CA  1 
ATOM 8142  C C   . GLU F 1 72  ? 78.617  133.775 113.282 1.00 97.09  ? 72  GLU F C   1 
ATOM 8143  O O   . GLU F 1 72  ? 78.531  134.003 114.489 1.00 121.72 ? 72  GLU F O   1 
ATOM 8144  C CB  . GLU F 1 72  ? 77.691  135.695 111.962 1.00 30.00  ? 72  GLU F CB  1 
ATOM 8145  C CG  . GLU F 1 72  ? 76.531  134.912 111.377 1.00 30.00  ? 72  GLU F CG  1 
ATOM 8146  C CD  . GLU F 1 72  ? 76.571  134.794 109.872 1.00 30.00  ? 72  GLU F CD  1 
ATOM 8147  O OE1 . GLU F 1 72  ? 77.633  135.058 109.276 1.00 30.00  ? 72  GLU F OE1 1 
ATOM 8148  O OE2 . GLU F 1 72  ? 75.525  134.441 109.284 1.00 30.00  ? 72  GLU F OE2 1 
ATOM 8149  N N   . LYS F 1 73  ? 78.398  132.556 112.801 1.00 88.72  ? 73  LYS F N   1 
ATOM 8150  C CA  . LYS F 1 73  ? 77.860  131.492 113.650 1.00 76.19  ? 73  LYS F CA  1 
ATOM 8151  C C   . LYS F 1 73  ? 78.859  130.348 113.768 1.00 76.39  ? 73  LYS F C   1 
ATOM 8152  O O   . LYS F 1 73  ? 78.762  129.352 113.051 1.00 99.03  ? 73  LYS F O   1 
ATOM 8153  C CB  . LYS F 1 73  ? 76.521  131.006 113.113 1.00 30.00  ? 73  LYS F CB  1 
ATOM 8154  C CG  . LYS F 1 73  ? 75.404  132.013 113.303 1.00 30.00  ? 73  LYS F CG  1 
ATOM 8155  C CD  . LYS F 1 73  ? 74.036  131.445 112.962 1.00 30.00  ? 73  LYS F CD  1 
ATOM 8156  C CE  . LYS F 1 73  ? 73.831  131.312 111.467 1.00 30.00  ? 73  LYS F CE  1 
ATOM 8157  N NZ  . LYS F 1 73  ? 72.442  130.868 111.169 1.00 30.00  ? 73  LYS F NZ  1 
ATOM 8158  N N   . LEU F 1 74  ? 79.780  130.472 114.715 1.00 86.10  ? 74  LEU F N   1 
ATOM 8159  C CA  . LEU F 1 74  ? 80.852  129.507 114.909 1.00 69.89  ? 74  LEU F CA  1 
ATOM 8160  C C   . LEU F 1 74  ? 80.392  128.379 115.824 1.00 74.51  ? 74  LEU F C   1 
ATOM 8161  O O   . LEU F 1 74  ? 79.453  128.533 116.608 1.00 105.24 ? 74  LEU F O   1 
ATOM 8162  C CB  . LEU F 1 74  ? 82.083  130.212 115.490 1.00 30.00  ? 74  LEU F CB  1 
ATOM 8163  C CG  . LEU F 1 74  ? 83.461  129.573 115.673 1.00 30.00  ? 74  LEU F CG  1 
ATOM 8164  C CD1 . LEU F 1 74  ? 84.514  130.642 115.509 1.00 30.00  ? 74  LEU F CD1 1 
ATOM 8165  C CD2 . LEU F 1 74  ? 83.602  128.965 117.049 1.00 30.00  ? 74  LEU F CD2 1 
ATOM 8166  N N   . ALA F 1 75  ? 81.053  127.230 115.702 1.00 74.85  ? 75  ALA F N   1 
ATOM 8167  C CA  . ALA F 1 75  ? 80.832  126.110 116.605 1.00 71.52  ? 75  ALA F CA  1 
ATOM 8168  C C   . ALA F 1 75  ? 82.129  125.337 116.768 1.00 78.01  ? 75  ALA F C   1 
ATOM 8169  O O   . ALA F 1 75  ? 82.729  124.912 115.779 1.00 114.52 ? 75  ALA F O   1 
ATOM 8170  C CB  . ALA F 1 75  ? 79.725  125.185 116.090 1.00 30.00  ? 75  ALA F CB  1 
ATOM 8171  N N   . ILE F 1 76  ? 82.547  125.145 118.014 1.00 65.73  ? 76  ILE F N   1 
ATOM 8172  C CA  . ILE F 1 76  ? 83.771  124.432 118.359 1.00 91.48  ? 76  ILE F CA  1 
ATOM 8173  C C   . ILE F 1 76  ? 83.413  123.063 118.921 1.00 89.44  ? 76  ILE F C   1 
ATOM 8174  O O   . ILE F 1 76  ? 82.651  122.964 119.889 1.00 103.39 ? 76  ILE F O   1 
ATOM 8175  C CB  . ILE F 1 76  ? 84.620  125.249 119.346 1.00 30.00  ? 76  ILE F CB  1 
ATOM 8176  C CG1 . ILE F 1 76  ? 85.707  124.395 119.993 1.00 30.00  ? 76  ILE F CG1 1 
ATOM 8177  C CG2 . ILE F 1 76  ? 83.770  126.009 120.331 1.00 30.00  ? 76  ILE F CG2 1 
ATOM 8178  C CD1 . ILE F 1 76  ? 86.589  125.186 120.930 1.00 30.00  ? 76  ILE F CD1 1 
ATOM 8179  N N   . TYR F 1 77  ? 83.945  122.006 118.307 1.00 92.49  ? 77  TYR F N   1 
ATOM 8180  C CA  . TYR F 1 77  ? 83.733  120.648 118.794 1.00 95.04  ? 77  TYR F CA  1 
ATOM 8181  C C   . TYR F 1 77  ? 84.746  120.387 119.898 1.00 90.68  ? 77  TYR F C   1 
ATOM 8182  O O   . TYR F 1 77  ? 85.899  120.806 119.796 1.00 88.28  ? 77  TYR F O   1 
ATOM 8183  C CB  . TYR F 1 77  ? 83.930  119.589 117.702 1.00 30.00  ? 77  TYR F CB  1 
ATOM 8184  C CG  . TYR F 1 77  ? 83.074  119.654 116.449 1.00 30.00  ? 77  TYR F CG  1 
ATOM 8185  C CD1 . TYR F 1 77  ? 81.971  120.484 116.353 1.00 30.00  ? 77  TYR F CD1 1 
ATOM 8186  C CD2 . TYR F 1 77  ? 83.385  118.856 115.355 1.00 30.00  ? 77  TYR F CD2 1 
ATOM 8187  C CE1 . TYR F 1 77  ? 81.212  120.532 115.204 1.00 30.00  ? 77  TYR F CE1 1 
ATOM 8188  C CE2 . TYR F 1 77  ? 82.631  118.895 114.204 1.00 30.00  ? 77  TYR F CE2 1 
ATOM 8189  C CZ  . TYR F 1 77  ? 81.547  119.735 114.135 1.00 30.00  ? 77  TYR F CZ  1 
ATOM 8190  O OH  . TYR F 1 77  ? 80.793  119.778 112.989 1.00 30.00  ? 77  TYR F OH  1 
ATOM 8191  N N   . ILE F 1 78  ? 84.329  119.681 120.945 1.00 100.82 ? 78  ILE F N   1 
ATOM 8192  C CA  . ILE F 1 78  ? 85.195  119.382 122.081 1.00 80.56  ? 78  ILE F CA  1 
ATOM 8193  C C   . ILE F 1 78  ? 84.956  117.956 122.548 1.00 87.00  ? 78  ILE F C   1 
ATOM 8194  O O   . ILE F 1 78  ? 83.816  117.562 122.812 1.00 104.52 ? 78  ILE F O   1 
ATOM 8195  C CB  . ILE F 1 78  ? 84.996  120.380 123.242 1.00 30.00  ? 78  ILE F CB  1 
ATOM 8196  C CG1 . ILE F 1 78  ? 85.754  121.672 122.955 1.00 30.00  ? 78  ILE F CG1 1 
ATOM 8197  C CG2 . ILE F 1 78  ? 85.393  119.794 124.585 1.00 30.00  ? 78  ILE F CG2 1 
ATOM 8198  C CD1 . ILE F 1 78  ? 85.589  122.720 123.988 1.00 30.00  ? 78  ILE F CD1 1 
ATOM 8199  N N   . SER F 1 79  ? 86.029  117.183 122.634 1.00 77.59  ? 79  SER F N   1 
ATOM 8200  C CA  . SER F 1 79  ? 86.047  115.927 123.358 1.00 81.74  ? 79  SER F CA  1 
ATOM 8201  C C   . SER F 1 79  ? 87.053  116.053 124.488 1.00 98.36  ? 79  SER F C   1 
ATOM 8202  O O   . SER F 1 79  ? 88.093  116.694 124.320 1.00 117.87 ? 79  SER F O   1 
ATOM 8203  C CB  . SER F 1 79  ? 86.434  114.754 122.448 1.00 30.00  ? 79  SER F CB  1 
ATOM 8204  O OG  . SER F 1 79  ? 86.448  113.528 123.161 1.00 30.00  ? 79  SER F OG  1 
ATOM 8205  N N   . PRO F 1 80  ? 86.772  115.483 125.645 1.00 92.20  ? 80  PRO F N   1 
ATOM 8206  C CA  . PRO F 1 80  ? 87.717  115.556 126.755 1.00 88.75  ? 80  PRO F CA  1 
ATOM 8207  C C   . PRO F 1 80  ? 88.795  114.494 126.593 1.00 95.71  ? 80  PRO F C   1 
ATOM 8208  O O   . PRO F 1 80  ? 88.705  113.604 125.752 1.00 117.12 ? 80  PRO F O   1 
ATOM 8209  C CB  . PRO F 1 80  ? 86.843  115.283 127.970 1.00 30.00  ? 80  PRO F CB  1 
ATOM 8210  C CG  . PRO F 1 80  ? 85.803  114.398 127.457 1.00 30.00  ? 80  PRO F CG  1 
ATOM 8211  C CD  . PRO F 1 80  ? 85.513  114.846 126.054 1.00 30.00  ? 80  PRO F CD  1 
ATOM 8212  N N   . ASN F 1 81  ? 89.820  114.593 127.435 1.00 89.04  ? 81  ASN F N   1 
ATOM 8213  C CA  . ASN F 1 81  ? 90.930  113.649 127.406 1.00 119.16 ? 81  ASN F CA  1 
ATOM 8214  C C   . ASN F 1 81  ? 90.507  112.321 128.031 1.00 129.92 ? 81  ASN F C   1 
ATOM 8215  O O   . ASN F 1 81  ? 89.345  112.111 128.393 1.00 123.56 ? 81  ASN F O   1 
ATOM 8216  C CB  . ASN F 1 81  ? 92.160  114.240 128.094 1.00 30.00  ? 81  ASN F CB  1 
ATOM 8217  C CG  . ASN F 1 81  ? 92.864  115.274 127.241 1.00 30.00  ? 81  ASN F CG  1 
ATOM 8218  O OD1 . ASN F 1 81  ? 92.970  115.119 126.028 1.00 30.00  ? 81  ASN F OD1 1 
ATOM 8219  N ND2 . ASN F 1 81  ? 93.378  116.315 127.873 1.00 30.00  ? 81  ASN F ND2 1 
ATOM 8220  N N   . ALA F 1 82  ? 91.469  111.405 128.162 1.00 129.27 ? 82  ALA F N   1 
ATOM 8221  C CA  . ALA F 1 82  ? 91.164  110.039 128.571 1.00 116.73 ? 82  ALA F CA  1 
ATOM 8222  C C   . ALA F 1 82  ? 90.739  109.974 130.032 1.00 106.52 ? 82  ALA F C   1 
ATOM 8223  O O   . ALA F 1 82  ? 89.608  109.591 130.347 1.00 96.85  ? 82  ALA F O   1 
ATOM 8224  C CB  . ALA F 1 82  ? 92.375  109.141 128.320 1.00 30.00  ? 82  ALA F CB  1 
ATOM 8225  N N   . GLY F 1 83  ? 91.623  110.363 130.937 1.00 114.15 ? 83  GLY F N   1 
ATOM 8226  C CA  . GLY F 1 83  ? 91.310  110.230 132.340 1.00 114.95 ? 83  GLY F CA  1 
ATOM 8227  C C   . GLY F 1 83  ? 90.719  111.477 132.953 1.00 115.25 ? 83  GLY F C   1 
ATOM 8228  O O   . GLY F 1 83  ? 91.408  112.492 133.083 1.00 115.65 ? 83  GLY F O   1 
ATOM 8229  N N   . SER F 1 84  ? 89.448  111.415 133.340 1.00 112.07 ? 84  SER F N   1 
ATOM 8230  C CA  . SER F 1 84  ? 88.815  112.517 134.046 1.00 124.31 ? 84  SER F CA  1 
ATOM 8231  C C   . SER F 1 84  ? 87.609  112.027 134.822 1.00 115.58 ? 84  SER F C   1 
ATOM 8232  O O   . SER F 1 84  ? 86.900  111.121 134.377 1.00 106.26 ? 84  SER F O   1 
ATOM 8233  C CB  . SER F 1 84  ? 88.349  113.615 133.104 1.00 30.00  ? 84  SER F CB  1 
ATOM 8234  O OG  . SER F 1 84  ? 87.695  114.603 133.873 1.00 30.00  ? 84  SER F OG  1 
ATOM 8235  N N   . GLU F 1 85  ? 87.382  112.633 135.983 1.00 118.56 ? 85  GLU F N   1 
ATOM 8236  C CA  . GLU F 1 85  ? 86.152  112.409 136.738 1.00 105.86 ? 85  GLU F CA  1 
ATOM 8237  C C   . GLU F 1 85  ? 85.207  113.601 136.577 1.00 107.85 ? 85  GLU F C   1 
ATOM 8238  O O   . GLU F 1 85  ? 85.043  114.435 137.467 1.00 104.84 ? 85  GLU F O   1 
ATOM 8239  C CB  . GLU F 1 85  ? 86.479  112.123 138.201 1.00 30.00  ? 85  GLU F CB  1 
ATOM 8240  C CG  . GLU F 1 85  ? 87.230  110.808 138.392 1.00 30.00  ? 85  GLU F CG  1 
ATOM 8241  C CD  . GLU F 1 85  ? 87.571  110.516 139.841 1.00 30.00  ? 85  GLU F CD  1 
ATOM 8242  O OE1 . GLU F 1 85  ? 87.337  111.390 140.701 1.00 30.00  ? 85  GLU F OE1 1 
ATOM 8243  O OE2 . GLU F 1 85  ? 88.076  109.407 140.118 1.00 30.00  ? 85  GLU F OE2 1 
ATOM 8244  N N   . GLY F 1 86  ? 84.565  113.661 135.409 1.00 113.31 ? 86  GLY F N   1 
ATOM 8245  C CA  . GLY F 1 86  ? 83.467  114.588 135.208 1.00 111.17 ? 86  GLY F CA  1 
ATOM 8246  C C   . GLY F 1 86  ? 83.765  116.072 135.081 1.00 101.55 ? 86  GLY F C   1 
ATOM 8247  O O   . GLY F 1 86  ? 83.537  116.807 136.046 1.00 106.00 ? 86  GLY F O   1 
ATOM 8248  N N   . ILE F 1 87  ? 84.315  116.526 133.951 1.00 75.80  ? 87  ILE F N   1 
ATOM 8249  C CA  . ILE F 1 87  ? 84.427  117.966 133.707 1.00 73.31  ? 87  ILE F CA  1 
ATOM 8250  C C   . ILE F 1 87  ? 83.026  118.549 133.603 1.00 100.35 ? 87  ILE F C   1 
ATOM 8251  O O   . ILE F 1 87  ? 82.200  118.076 132.814 1.00 117.40 ? 87  ILE F O   1 
ATOM 8252  C CB  . ILE F 1 87  ? 85.211  118.281 132.426 1.00 30.00  ? 87  ILE F CB  1 
ATOM 8253  C CG1 . ILE F 1 87  ? 86.573  117.608 132.380 1.00 30.00  ? 87  ILE F CG1 1 
ATOM 8254  C CG2 . ILE F 1 87  ? 85.388  119.770 132.278 1.00 30.00  ? 87  ILE F CG2 1 
ATOM 8255  C CD1 . ILE F 1 87  ? 86.581  116.428 131.465 1.00 30.00  ? 87  ILE F CD1 1 
ATOM 8256  N N   . ASP F 1 88  ? 82.750  119.577 134.393 1.00 103.88 ? 88  ASP F N   1 
ATOM 8257  C CA  . ASP F 1 88  ? 81.452  120.229 134.352 1.00 95.71  ? 88  ASP F CA  1 
ATOM 8258  C C   . ASP F 1 88  ? 81.534  121.432 133.425 1.00 94.42  ? 88  ASP F C   1 
ATOM 8259  O O   . ASP F 1 88  ? 82.593  122.041 133.269 1.00 101.39 ? 88  ASP F O   1 
ATOM 8260  C CB  . ASP F 1 88  ? 81.025  120.653 135.758 1.00 30.00  ? 88  ASP F CB  1 
ATOM 8261  C CG  . ASP F 1 88  ? 79.546  120.980 135.856 1.00 30.00  ? 88  ASP F CG  1 
ATOM 8262  O OD1 . ASP F 1 88  ? 78.842  120.924 134.827 1.00 30.00  ? 88  ASP F OD1 1 
ATOM 8263  O OD2 . ASP F 1 88  ? 79.082  121.283 136.976 1.00 30.00  ? 88  ASP F OD2 1 
ATOM 8264  N N   . LEU F 1 89  ? 80.407  121.768 132.801 1.00 99.19  ? 89  LEU F N   1 
ATOM 8265  C CA  . LEU F 1 89  ? 80.368  122.863 131.841 1.00 104.74 ? 89  LEU F CA  1 
ATOM 8266  C C   . LEU F 1 89  ? 79.586  124.075 132.326 1.00 110.40 ? 89  LEU F C   1 
ATOM 8267  O O   . LEU F 1 89  ? 79.625  125.119 131.669 1.00 132.98 ? 89  LEU F O   1 
ATOM 8268  C CB  . LEU F 1 89  ? 79.789  122.387 130.515 1.00 30.00  ? 89  LEU F CB  1 
ATOM 8269  C CG  . LEU F 1 89  ? 80.632  121.332 129.821 1.00 30.00  ? 89  LEU F CG  1 
ATOM 8270  C CD1 . LEU F 1 89  ? 79.910  120.900 128.592 1.00 30.00  ? 89  LEU F CD1 1 
ATOM 8271  C CD2 . LEU F 1 89  ? 82.002  121.867 129.471 1.00 30.00  ? 89  LEU F CD2 1 
ATOM 8272  N N   . ASN F 1 90  ? 78.853  123.956 133.435 1.00 101.49 ? 90  ASN F N   1 
ATOM 8273  C CA  . ASN F 1 90  ? 78.355  125.148 134.106 1.00 104.71 ? 90  ASN F CA  1 
ATOM 8274  C C   . ASN F 1 90  ? 79.522  125.983 134.613 1.00 105.99 ? 90  ASN F C   1 
ATOM 8275  O O   . ASN F 1 90  ? 79.485  127.215 134.541 1.00 109.37 ? 90  ASN F O   1 
ATOM 8276  C CB  . ASN F 1 90  ? 77.421  124.745 135.251 1.00 30.00  ? 90  ASN F CB  1 
ATOM 8277  C CG  . ASN F 1 90  ? 76.391  125.813 135.591 1.00 30.00  ? 90  ASN F CG  1 
ATOM 8278  O OD1 . ASN F 1 90  ? 75.412  125.538 136.279 1.00 30.00  ? 90  ASN F OD1 1 
ATOM 8279  N ND2 . ASN F 1 90  ? 76.593  127.024 135.095 1.00 30.00  ? 90  ASN F ND2 1 
ATOM 8280  N N   . ASN F 1 91  ? 80.567  125.325 135.110 1.00 96.80  ? 91  ASN F N   1 
ATOM 8281  C CA  . ASN F 1 91  ? 81.841  125.971 135.393 1.00 97.18  ? 91  ASN F CA  1 
ATOM 8282  C C   . ASN F 1 91  ? 82.830  125.578 134.299 1.00 103.39 ? 91  ASN F C   1 
ATOM 8283  O O   . ASN F 1 91  ? 83.664  124.689 134.468 1.00 107.67 ? 91  ASN F O   1 
ATOM 8284  C CB  . ASN F 1 91  ? 82.346  125.572 136.772 1.00 30.00  ? 91  ASN F CB  1 
ATOM 8285  C CG  . ASN F 1 91  ? 81.426  126.019 137.876 1.00 30.00  ? 91  ASN F CG  1 
ATOM 8286  O OD1 . ASN F 1 91  ? 80.840  125.200 138.581 1.00 30.00  ? 91  ASN F OD1 1 
ATOM 8287  N ND2 . ASN F 1 91  ? 81.292  127.326 138.036 1.00 30.00  ? 91  ASN F ND2 1 
ATOM 8288  N N   . THR F 1 92  ? 82.729  126.260 133.158 1.00 101.15 ? 92  THR F N   1 
ATOM 8289  C CA  . THR F 1 92  ? 83.708  126.145 132.081 1.00 84.54  ? 92  THR F CA  1 
ATOM 8290  C C   . THR F 1 92  ? 83.629  127.390 131.219 1.00 86.65  ? 92  THR F C   1 
ATOM 8291  O O   . THR F 1 92  ? 82.603  127.637 130.583 1.00 106.48 ? 92  THR F O   1 
ATOM 8292  C CB  . THR F 1 92  ? 83.476  124.917 131.206 1.00 30.00  ? 92  THR F CB  1 
ATOM 8293  O OG1 . THR F 1 92  ? 83.634  123.730 131.986 1.00 30.00  ? 92  THR F OG1 1 
ATOM 8294  C CG2 . THR F 1 92  ? 84.474  124.897 130.074 1.00 30.00  ? 92  THR F CG2 1 
ATOM 8295  N N   . ARG F 1 93  ? 84.712  128.150 131.176 1.00 78.31  ? 93  ARG F N   1 
ATOM 8296  C CA  . ARG F 1 93  ? 84.733  129.437 130.504 1.00 89.86  ? 93  ARG F CA  1 
ATOM 8297  C C   . ARG F 1 93  ? 85.545  129.355 129.219 1.00 89.07  ? 93  ARG F C   1 
ATOM 8298  O O   . ARG F 1 93  ? 86.760  129.138 129.256 1.00 106.87 ? 93  ARG F O   1 
ATOM 8299  C CB  . ARG F 1 93  ? 85.320  130.495 131.427 1.00 30.00  ? 93  ARG F CB  1 
ATOM 8300  C CG  . ARG F 1 93  ? 84.506  130.721 132.683 1.00 30.00  ? 93  ARG F CG  1 
ATOM 8301  C CD  . ARG F 1 93  ? 83.207  131.425 132.362 1.00 30.00  ? 93  ARG F CD  1 
ATOM 8302  N NE  . ARG F 1 93  ? 82.458  131.785 133.560 1.00 30.00  ? 93  ARG F NE  1 
ATOM 8303  C CZ  . ARG F 1 93  ? 81.493  131.044 134.090 1.00 30.00  ? 93  ARG F CZ  1 
ATOM 8304  N NH1 . ARG F 1 93  ? 81.144  129.903 133.519 1.00 30.00  ? 93  ARG F NH1 1 
ATOM 8305  N NH2 . ARG F 1 93  ? 80.860  131.452 135.177 1.00 30.00  ? 93  ARG F NH2 1 
ATOM 8306  N N   . VAL F 1 94  ? 84.872  129.539 128.082 1.00 84.22  ? 94  VAL F N   1 
ATOM 8307  C CA  . VAL F 1 94  ? 85.548  129.623 126.791 1.00 73.51  ? 94  VAL F CA  1 
ATOM 8308  C C   . VAL F 1 94  ? 86.013  131.052 126.581 1.00 86.10  ? 94  VAL F C   1 
ATOM 8309  O O   . VAL F 1 94  ? 85.195  131.966 126.445 1.00 102.58 ? 94  VAL F O   1 
ATOM 8310  C CB  . VAL F 1 94  ? 84.638  129.181 125.638 1.00 30.00  ? 94  VAL F CB  1 
ATOM 8311  C CG1 . VAL F 1 94  ? 85.335  129.411 124.319 1.00 30.00  ? 94  VAL F CG1 1 
ATOM 8312  C CG2 . VAL F 1 94  ? 84.284  127.730 125.797 1.00 30.00  ? 94  VAL F CG2 1 
ATOM 8313  N N   . VAL F 1 95  ? 87.326  131.255 126.551 1.00 80.17  ? 95  VAL F N   1 
ATOM 8314  C CA  . VAL F 1 95  ? 87.904  132.590 126.517 1.00 77.28  ? 95  VAL F CA  1 
ATOM 8315  C C   . VAL F 1 95  ? 88.540  132.760 125.144 1.00 86.14  ? 95  VAL F C   1 
ATOM 8316  O O   . VAL F 1 95  ? 89.697  132.410 124.950 1.00 98.38  ? 95  VAL F O   1 
ATOM 8317  C CB  . VAL F 1 95  ? 88.933  132.781 127.631 1.00 30.00  ? 95  VAL F CB  1 
ATOM 8318  C CG1 . VAL F 1 95  ? 89.445  134.212 127.661 1.00 30.00  ? 95  VAL F CG1 1 
ATOM 8319  C CG2 . VAL F 1 95  ? 88.368  132.355 128.967 1.00 30.00  ? 95  VAL F CG2 1 
ATOM 8320  N N   . LEU F 1 96  ? 87.788  133.297 124.188 1.00 91.86  ? 96  LEU F N   1 
ATOM 8321  C CA  . LEU F 1 96  ? 88.295  133.540 122.843 1.00 76.62  ? 96  LEU F CA  1 
ATOM 8322  C C   . LEU F 1 96  ? 88.331  135.036 122.577 1.00 90.23  ? 96  LEU F C   1 
ATOM 8323  O O   . LEU F 1 96  ? 87.466  135.773 123.056 1.00 122.98 ? 96  LEU F O   1 
ATOM 8324  C CB  . LEU F 1 96  ? 87.457  132.811 121.787 1.00 30.00  ? 96  LEU F CB  1 
ATOM 8325  C CG  . LEU F 1 96  ? 85.943  132.983 121.611 1.00 30.00  ? 96  LEU F CG  1 
ATOM 8326  C CD1 . LEU F 1 96  ? 85.548  134.174 120.760 1.00 30.00  ? 96  LEU F CD1 1 
ATOM 8327  C CD2 . LEU F 1 96  ? 85.366  131.712 121.006 1.00 30.00  ? 96  LEU F CD2 1 
ATOM 8328  N N   . SER F 1 97  ? 89.325  135.479 121.811 1.00 77.79  ? 97  SER F N   1 
ATOM 8329  C CA  . SER F 1 97  ? 89.542  136.907 121.628 1.00 80.19  ? 97  SER F CA  1 
ATOM 8330  C C   . SER F 1 97  ? 89.718  137.320 120.175 1.00 99.22  ? 97  SER F C   1 
ATOM 8331  O O   . SER F 1 97  ? 90.367  136.617 119.399 1.00 107.37 ? 97  SER F O   1 
ATOM 8332  C CB  . SER F 1 97  ? 90.775  137.339 122.406 1.00 30.00  ? 97  SER F CB  1 
ATOM 8333  O OG  . SER F 1 97  ? 91.930  136.723 121.872 1.00 30.00  ? 97  SER F OG  1 
ATOM 8334  N N   . ASN F 1 98  ? 89.253  138.521 119.834 1.00 30.00  ? 98  ASN F N   1 
ATOM 8335  C CA  . ASN F 1 98  ? 89.428  139.076 118.498 1.00 30.00  ? 98  ASN F CA  1 
ATOM 8336  C C   . ASN F 1 98  ? 90.859  139.588 118.390 1.00 30.00  ? 98  ASN F C   1 
ATOM 8337  O O   . ASN F 1 98  ? 91.640  139.478 119.340 1.00 30.00  ? 98  ASN F O   1 
ATOM 8338  C CB  . ASN F 1 98  ? 88.389  140.188 118.260 1.00 30.00  ? 98  ASN F CB  1 
ATOM 8339  C CG  . ASN F 1 98  ? 88.213  140.557 116.787 1.00 30.00  ? 98  ASN F CG  1 
ATOM 8340  O OD1 . ASN F 1 98  ? 88.880  140.008 115.917 1.00 30.00  ? 98  ASN F OD1 1 
ATOM 8341  N ND2 . ASN F 1 98  ? 87.315  141.498 116.512 1.00 30.00  ? 98  ASN F ND2 1 
ATOM 8342  N N   . GLY F 1 99  ? 91.223  140.163 117.246 1.00 30.00  ? 99  GLY F N   1 
ATOM 8343  C CA  . GLY F 1 99  ? 92.495  140.844 117.148 1.00 30.00  ? 99  GLY F CA  1 
ATOM 8344  C C   . GLY F 1 99  ? 92.588  142.093 117.998 1.00 30.00  ? 99  GLY F C   1 
ATOM 8345  O O   . GLY F 1 99  ? 93.693  142.601 118.203 1.00 30.00  ? 99  GLY F O   1 
ATOM 8346  N N   . THR F 1 100 ? 91.458  142.602 118.492 1.00 85.87  ? 100 THR F N   1 
ATOM 8347  C CA  . THR F 1 100 ? 91.428  143.744 119.394 1.00 102.79 ? 100 THR F CA  1 
ATOM 8348  C C   . THR F 1 100 ? 90.756  143.426 120.721 1.00 104.11 ? 100 THR F C   1 
ATOM 8349  O O   . THR F 1 100 ? 91.279  143.792 121.780 1.00 96.07  ? 100 THR F O   1 
ATOM 8350  C CB  . THR F 1 100 ? 90.709  144.915 118.704 1.00 30.00  ? 100 THR F CB  1 
ATOM 8351  O OG1 . THR F 1 100 ? 91.358  145.206 117.460 1.00 30.00  ? 100 THR F OG1 1 
ATOM 8352  C CG2 . THR F 1 100 ? 90.751  146.154 119.566 1.00 30.00  ? 100 THR F CG2 1 
ATOM 8353  N N   . VAL F 1 101 ? 89.633  142.712 120.703 1.00 97.64  ? 101 VAL F N   1 
ATOM 8354  C CA  . VAL F 1 101 ? 88.707  142.661 121.830 1.00 100.35 ? 101 VAL F CA  1 
ATOM 8355  C C   . VAL F 1 101 ? 88.648  141.246 122.392 1.00 117.38 ? 101 VAL F C   1 
ATOM 8356  O O   . VAL F 1 101 ? 88.323  140.300 121.669 1.00 123.46 ? 101 VAL F O   1 
ATOM 8357  C CB  . VAL F 1 101 ? 87.302  143.127 121.408 1.00 30.00  ? 101 VAL F CB  1 
ATOM 8358  C CG1 . VAL F 1 101 ? 86.358  143.058 122.573 1.00 30.00  ? 101 VAL F CG1 1 
ATOM 8359  C CG2 . VAL F 1 101 ? 87.349  144.537 120.841 1.00 30.00  ? 101 VAL F CG2 1 
ATOM 8360  N N   . GLN F 1 102 ? 88.940  141.111 123.685 1.00 107.35 ? 102 GLN F N   1 
ATOM 8361  C CA  . GLN F 1 102 ? 88.788  139.850 124.403 1.00 99.10  ? 102 GLN F CA  1 
ATOM 8362  C C   . GLN F 1 102 ? 87.317  139.504 124.608 1.00 93.31  ? 102 GLN F C   1 
ATOM 8363  O O   . GLN F 1 102 ? 86.417  140.302 124.344 1.00 114.39 ? 102 GLN F O   1 
ATOM 8364  C CB  . GLN F 1 102 ? 89.458  139.922 125.774 1.00 30.00  ? 102 GLN F CB  1 
ATOM 8365  C CG  . GLN F 1 102 ? 90.966  139.860 125.809 1.00 30.00  ? 102 GLN F CG  1 
ATOM 8366  C CD  . GLN F 1 102 ? 91.492  138.457 125.628 1.00 30.00  ? 102 GLN F CD  1 
ATOM 8367  O OE1 . GLN F 1 102 ? 90.893  137.493 126.096 1.00 30.00  ? 102 GLN F OE1 1 
ATOM 8368  N NE2 . GLN F 1 102 ? 92.628  138.336 124.973 1.00 30.00  ? 102 GLN F NE2 1 
ATOM 8369  N N   . ALA F 1 103 ? 87.091  138.300 125.135 1.00 90.25  ? 103 ALA F N   1 
ATOM 8370  C CA  . ALA F 1 103 ? 85.774  137.842 125.556 1.00 88.34  ? 103 ALA F CA  1 
ATOM 8371  C C   . ALA F 1 103 ? 85.938  136.617 126.436 1.00 104.79 ? 103 ALA F C   1 
ATOM 8372  O O   . ALA F 1 103 ? 86.925  135.891 126.310 1.00 117.96 ? 103 ALA F O   1 
ATOM 8373  C CB  . ALA F 1 103 ? 84.878  137.483 124.369 1.00 30.00  ? 103 ALA F CB  1 
ATOM 8374  N N   . VAL F 1 104 ? 84.972  136.393 127.323 1.00 94.80  ? 104 VAL F N   1 
ATOM 8375  C CA  . VAL F 1 104 ? 84.803  135.103 127.978 1.00 109.96 ? 104 VAL F CA  1 
ATOM 8376  C C   . VAL F 1 104 ? 83.363  134.674 127.764 1.00 89.25  ? 104 VAL F C   1 
ATOM 8377  O O   . VAL F 1 104 ? 82.497  135.491 127.440 1.00 75.68  ? 104 VAL F O   1 
ATOM 8378  C CB  . VAL F 1 104 ? 85.143  135.120 129.482 1.00 30.00  ? 104 VAL F CB  1 
ATOM 8379  C CG1 . VAL F 1 104 ? 86.580  135.537 129.705 1.00 30.00  ? 104 VAL F CG1 1 
ATOM 8380  C CG2 . VAL F 1 104 ? 84.213  136.021 130.216 1.00 30.00  ? 104 VAL F CG2 1 
ATOM 8381  N N   . LEU F 1 105 ? 83.109  133.380 127.919 1.00 88.49  ? 105 LEU F N   1 
ATOM 8382  C CA  . LEU F 1 105 ? 81.808  132.805 127.596 1.00 98.24  ? 105 LEU F CA  1 
ATOM 8383  C C   . LEU F 1 105 ? 81.314  131.974 128.776 1.00 91.87  ? 105 LEU F C   1 
ATOM 8384  O O   . LEU F 1 105 ? 81.969  131.008 129.178 1.00 103.67 ? 105 LEU F O   1 
ATOM 8385  C CB  . LEU F 1 105 ? 81.882  131.962 126.322 1.00 30.00  ? 105 LEU F CB  1 
ATOM 8386  C CG  . LEU F 1 105 ? 81.782  132.587 124.917 1.00 30.00  ? 105 LEU F CG  1 
ATOM 8387  C CD1 . LEU F 1 105 ? 80.478  133.329 124.737 1.00 30.00  ? 105 LEU F CD1 1 
ATOM 8388  C CD2 . LEU F 1 105 ? 82.946  133.472 124.521 1.00 30.00  ? 105 LEU F CD2 1 
ATOM 8389  N N   . LYS F 1 106 ? 80.167  132.360 129.329 1.00 80.59  ? 106 LYS F N   1 
ATOM 8390  C CA  . LYS F 1 106 ? 79.524  131.668 130.437 1.00 95.20  ? 106 LYS F CA  1 
ATOM 8391  C C   . LYS F 1 106 ? 78.315  130.898 129.928 1.00 109.74 ? 106 LYS F C   1 
ATOM 8392  O O   . LYS F 1 106 ? 77.582  131.375 129.062 1.00 125.41 ? 106 LYS F O   1 
ATOM 8393  C CB  . LYS F 1 106 ? 79.090  132.679 131.503 1.00 30.00  ? 106 LYS F CB  1 
ATOM 8394  C CG  . LYS F 1 106 ? 78.409  132.101 132.732 1.00 30.00  ? 106 LYS F CG  1 
ATOM 8395  C CD  . LYS F 1 106 ? 78.109  133.189 133.750 1.00 30.00  ? 106 LYS F CD  1 
ATOM 8396  C CE  . LYS F 1 106 ? 76.986  134.102 133.282 1.00 30.00  ? 106 LYS F CE  1 
ATOM 8397  N NZ  . LYS F 1 106 ? 75.674  133.402 133.256 1.00 30.00  ? 106 LYS F NZ  1 
ATOM 8398  N N   . TYR F 1 107 ? 78.101  129.705 130.478 1.00 113.92 ? 107 TYR F N   1 
ATOM 8399  C CA  . TYR F 1 107 ? 77.036  128.841 129.984 1.00 120.86 ? 107 TYR F CA  1 
ATOM 8400  C C   . TYR F 1 107 ? 75.654  129.357 130.356 1.00 104.10 ? 107 TYR F C   1 
ATOM 8401  O O   . TYR F 1 107 ? 75.376  129.670 131.515 1.00 105.66 ? 107 TYR F O   1 
ATOM 8402  C CB  . TYR F 1 107 ? 77.217  127.422 130.511 1.00 30.00  ? 107 TYR F CB  1 
ATOM 8403  C CG  . TYR F 1 107 ? 76.061  126.516 130.185 1.00 30.00  ? 107 TYR F CG  1 
ATOM 8404  C CD1 . TYR F 1 107 ? 75.753  126.206 128.876 1.00 30.00  ? 107 TYR F CD1 1 
ATOM 8405  C CD2 . TYR F 1 107 ? 75.317  125.923 131.191 1.00 30.00  ? 107 TYR F CD2 1 
ATOM 8406  C CE1 . TYR F 1 107 ? 74.711  125.374 128.579 1.00 30.00  ? 107 TYR F CE1 1 
ATOM 8407  C CE2 . TYR F 1 107 ? 74.274  125.078 130.897 1.00 30.00  ? 107 TYR F CE2 1 
ATOM 8408  C CZ  . TYR F 1 107 ? 73.977  124.807 129.589 1.00 30.00  ? 107 TYR F CZ  1 
ATOM 8409  O OH  . TYR F 1 107 ? 72.936  123.967 129.294 1.00 30.00  ? 107 TYR F OH  1 
ATOM 8410  N N   . GLU F 1 108 ? 74.788  129.439 129.353 1.00 101.18 ? 108 GLU F N   1 
ATOM 8411  C CA  . GLU F 1 108 ? 73.405  129.848 129.520 1.00 107.42 ? 108 GLU F CA  1 
ATOM 8412  C C   . GLU F 1 108 ? 72.514  128.633 129.346 1.00 97.36  ? 108 GLU F C   1 
ATOM 8413  O O   . GLU F 1 108 ? 72.740  127.819 128.448 1.00 99.71  ? 108 GLU F O   1 
ATOM 8414  C CB  . GLU F 1 108 ? 73.019  130.923 128.502 1.00 30.00  ? 108 GLU F CB  1 
ATOM 8415  C CG  . GLU F 1 108 ? 71.578  131.435 128.585 1.00 30.00  ? 108 GLU F CG  1 
ATOM 8416  C CD  . GLU F 1 108 ? 71.280  132.226 129.850 1.00 30.00  ? 108 GLU F CD  1 
ATOM 8417  O OE1 . GLU F 1 108 ? 72.211  132.819 130.430 1.00 30.00  ? 108 GLU F OE1 1 
ATOM 8418  O OE2 . GLU F 1 108 ? 70.103  132.263 130.262 1.00 30.00  ? 108 GLU F OE2 1 
ATOM 8419  N N   . LYS F 1 109 ? 71.495  128.520 130.195 1.00 87.60  ? 109 LYS F N   1 
ATOM 8420  C CA  . LYS F 1 109 ? 70.561  127.408 130.134 1.00 83.82  ? 109 LYS F CA  1 
ATOM 8421  C C   . LYS F 1 109 ? 69.680  127.516 128.891 1.00 93.03  ? 109 LYS F C   1 
ATOM 8422  O O   . LYS F 1 109 ? 69.665  128.534 128.191 1.00 117.66 ? 109 LYS F O   1 
ATOM 8423  C CB  . LYS F 1 109 ? 69.727  127.358 131.409 1.00 30.00  ? 109 LYS F CB  1 
ATOM 8424  C CG  . LYS F 1 109 ? 70.553  127.051 132.643 1.00 30.00  ? 109 LYS F CG  1 
ATOM 8425  C CD  . LYS F 1 109 ? 69.699  126.978 133.895 1.00 30.00  ? 109 LYS F CD  1 
ATOM 8426  C CE  . LYS F 1 109 ? 70.550  126.666 135.118 1.00 30.00  ? 109 LYS F CE  1 
ATOM 8427  N NZ  . LYS F 1 109 ? 69.739  126.590 136.368 1.00 30.00  ? 109 LYS F NZ  1 
ATOM 8428  N N   . THR F 1 110 ? 68.934  126.439 128.633 1.00 94.95  ? 110 THR F N   1 
ATOM 8429  C CA  . THR F 1 110 ? 68.053  126.269 127.468 1.00 121.68 ? 110 THR F CA  1 
ATOM 8430  C C   . THR F 1 110 ? 68.798  126.468 126.149 1.00 133.18 ? 110 THR F C   1 
ATOM 8431  O O   . THR F 1 110 ? 68.530  127.400 125.389 1.00 143.94 ? 110 THR F O   1 
ATOM 8432  C CB  . THR F 1 110 ? 66.818  127.178 127.533 1.00 30.00  ? 110 THR F CB  1 
ATOM 8433  O OG1 . THR F 1 110 ? 67.212  128.551 127.427 1.00 30.00  ? 110 THR F OG1 1 
ATOM 8434  C CG2 . THR F 1 110 ? 66.076  126.967 128.841 1.00 30.00  ? 110 THR F CG2 1 
ATOM 8435  N N   . ALA F 1 111 ? 69.767  125.585 125.892 1.00 106.50 ? 111 ALA F N   1 
ATOM 8436  C CA  . ALA F 1 111 ? 70.345  125.445 124.554 1.00 107.45 ? 111 ALA F CA  1 
ATOM 8437  C C   . ALA F 1 111 ? 70.827  124.001 124.387 1.00 124.52 ? 111 ALA F C   1 
ATOM 8438  O O   . ALA F 1 111 ? 71.971  123.695 124.712 1.00 140.43 ? 111 ALA F O   1 
ATOM 8439  C CB  . ALA F 1 111 ? 71.484  126.432 124.345 1.00 30.00  ? 111 ALA F CB  1 
ATOM 8440  N N   . TYR F 1 112 ? 69.964  123.120 123.864 1.00 30.00  ? 112 TYR F N   1 
ATOM 8441  C CA  . TYR F 1 112 ? 70.413  121.751 123.606 1.00 30.00  ? 112 TYR F CA  1 
ATOM 8442  C C   . TYR F 1 112 ? 70.340  121.324 122.147 1.00 30.00  ? 112 TYR F C   1 
ATOM 8443  O O   . TYR F 1 112 ? 71.397  121.081 121.563 1.00 30.00  ? 112 TYR F O   1 
ATOM 8444  C CB  . TYR F 1 112 ? 69.652  120.768 124.494 1.00 30.00  ? 112 TYR F CB  1 
ATOM 8445  C CG  . TYR F 1 112 ? 70.150  120.848 125.900 1.00 30.00  ? 112 TYR F CG  1 
ATOM 8446  C CD1 . TYR F 1 112 ? 71.302  120.175 126.279 1.00 30.00  ? 112 TYR F CD1 1 
ATOM 8447  C CD2 . TYR F 1 112 ? 69.508  121.635 126.837 1.00 30.00  ? 112 TYR F CD2 1 
ATOM 8448  C CE1 . TYR F 1 112 ? 71.777  120.259 127.559 1.00 30.00  ? 112 TYR F CE1 1 
ATOM 8449  C CE2 . TYR F 1 112 ? 69.980  121.729 128.117 1.00 30.00  ? 112 TYR F CE2 1 
ATOM 8450  C CZ  . TYR F 1 112 ? 71.109  121.039 128.474 1.00 30.00  ? 112 TYR F CZ  1 
ATOM 8451  O OH  . TYR F 1 112 ? 71.579  121.142 129.756 1.00 30.00  ? 112 TYR F OH  1 
ATOM 8452  N N   . HIS F 1 113 ? 69.152  121.275 121.532 1.00 30.00  ? 113 HIS F N   1 
ATOM 8453  C CA  . HIS F 1 113 ? 68.944  120.795 120.153 1.00 30.00  ? 113 HIS F CA  1 
ATOM 8454  C C   . HIS F 1 113 ? 69.610  119.431 119.931 1.00 30.00  ? 113 HIS F C   1 
ATOM 8455  O O   . HIS F 1 113 ? 70.622  119.293 119.243 1.00 30.00  ? 113 HIS F O   1 
ATOM 8456  C CB  . HIS F 1 113 ? 69.420  121.859 119.154 1.00 30.00  ? 113 HIS F CB  1 
ATOM 8457  C CG  . HIS F 1 113 ? 69.274  121.486 117.714 1.00 30.00  ? 113 HIS F CG  1 
ATOM 8458  N ND1 . HIS F 1 113 ? 68.051  121.287 117.115 1.00 30.00  ? 113 HIS F ND1 1 
ATOM 8459  C CD2 . HIS F 1 113 ? 70.199  121.356 116.734 1.00 30.00  ? 113 HIS F CD2 1 
ATOM 8460  C CE1 . HIS F 1 113 ? 68.232  121.007 115.838 1.00 30.00  ? 113 HIS F CE1 1 
ATOM 8461  N NE2 . HIS F 1 113 ? 69.526  121.045 115.580 1.00 30.00  ? 113 HIS F NE2 1 
ATOM 8462  N N   . LYS F 1 114 ? 69.065  118.421 120.598 1.00 30.00  ? 114 LYS F N   1 
ATOM 8463  C CA  . LYS F 1 114 ? 69.742  117.139 120.716 1.00 30.00  ? 114 LYS F CA  1 
ATOM 8464  C C   . LYS F 1 114 ? 69.137  116.028 119.870 1.00 30.00  ? 114 LYS F C   1 
ATOM 8465  O O   . LYS F 1 114 ? 69.713  114.937 119.814 1.00 30.00  ? 114 LYS F O   1 
ATOM 8466  C CB  . LYS F 1 114 ? 69.778  116.715 122.185 1.00 30.00  ? 114 LYS F CB  1 
ATOM 8467  C CG  . LYS F 1 114 ? 68.420  116.543 122.833 1.00 30.00  ? 114 LYS F CG  1 
ATOM 8468  C CD  . LYS F 1 114 ? 68.582  116.219 124.311 1.00 30.00  ? 114 LYS F CD  1 
ATOM 8469  C CE  . LYS F 1 114 ? 67.243  116.058 125.007 1.00 30.00  ? 114 LYS F CE  1 
ATOM 8470  N NZ  . LYS F 1 114 ? 67.415  115.767 126.456 1.00 30.00  ? 114 LYS F NZ  1 
ATOM 8471  N N   . GLY F 1 115 ? 68.013  116.268 119.201 1.00 30.00  ? 115 GLY F N   1 
ATOM 8472  C CA  . GLY F 1 115 ? 67.354  115.209 118.459 1.00 30.00  ? 115 GLY F CA  1 
ATOM 8473  C C   . GLY F 1 115 ? 67.497  115.312 116.954 1.00 30.00  ? 115 GLY F C   1 
ATOM 8474  O O   . GLY F 1 115 ? 67.640  114.296 116.267 1.00 30.00  ? 115 GLY F O   1 
ATOM 8475  N N   . ALA F 1 116 ? 67.462  116.535 116.432 1.00 30.00  ? 116 ALA F N   1 
ATOM 8476  C CA  . ALA F 1 116 ? 67.628  116.809 115.005 1.00 30.00  ? 116 ALA F CA  1 
ATOM 8477  C C   . ALA F 1 116 ? 69.019  117.347 114.712 1.00 30.00  ? 116 ALA F C   1 
ATOM 8478  O O   . ALA F 1 116 ? 69.191  118.271 113.913 1.00 30.00  ? 116 ALA F O   1 
ATOM 8479  C CB  . ALA F 1 116 ? 66.559  117.778 114.516 1.00 30.00  ? 116 ALA F CB  1 
ATOM 8480  N N   . VAL F 1 117 ? 70.025  116.761 115.364 1.00 30.00  ? 117 VAL F N   1 
ATOM 8481  C CA  . VAL F 1 117 ? 71.392  117.266 115.452 1.00 30.00  ? 117 VAL F CA  1 
ATOM 8482  C C   . VAL F 1 117 ? 72.094  117.282 114.094 1.00 30.00  ? 117 VAL F C   1 
ATOM 8483  O O   . VAL F 1 117 ? 73.059  118.026 113.892 1.00 30.00  ? 117 VAL F O   1 
ATOM 8484  C CB  . VAL F 1 117 ? 72.162  116.428 116.496 1.00 30.00  ? 117 VAL F CB  1 
ATOM 8485  C CG1 . VAL F 1 117 ? 72.337  114.989 116.025 1.00 30.00  ? 117 VAL F CG1 1 
ATOM 8486  C CG2 . VAL F 1 117 ? 73.483  117.076 116.917 1.00 30.00  ? 117 VAL F CG2 1 
ATOM 8487  N N   . GLY F 1 118 ? 71.569  116.533 113.120 1.00 30.00  ? 118 GLY F N   1 
ATOM 8488  C CA  . GLY F 1 118 ? 72.214  116.403 111.821 1.00 30.00  ? 118 GLY F CA  1 
ATOM 8489  C C   . GLY F 1 118 ? 72.182  117.639 110.943 1.00 30.00  ? 118 GLY F C   1 
ATOM 8490  O O   . GLY F 1 118 ? 72.666  117.587 109.811 1.00 30.00  ? 118 GLY F O   1 
ATOM 8491  N N   . ASP F 1 119 ? 71.596  118.729 111.414 1.00 30.00  ? 119 ASP F N   1 
ATOM 8492  C CA  . ASP F 1 119 ? 71.863  120.062 110.888 1.00 30.00  ? 119 ASP F CA  1 
ATOM 8493  C C   . ASP F 1 119 ? 72.314  120.908 112.069 1.00 30.00  ? 119 ASP F C   1 
ATOM 8494  O O   . ASP F 1 119 ? 71.485  121.353 112.870 1.00 30.00  ? 119 ASP F O   1 
ATOM 8495  C CB  . ASP F 1 119 ? 70.640  120.661 110.200 1.00 30.00  ? 119 ASP F CB  1 
ATOM 8496  C CG  . ASP F 1 119 ? 70.352  120.018 108.858 1.00 30.00  ? 119 ASP F CG  1 
ATOM 8497  O OD1 . ASP F 1 119 ? 71.305  119.555 108.203 1.00 30.00  ? 119 ASP F OD1 1 
ATOM 8498  O OD2 . ASP F 1 119 ? 69.173  119.985 108.447 1.00 30.00  ? 119 ASP F OD2 1 
ATOM 8499  N N   . VAL F 1 120 ? 73.629  121.112 112.181 1.00 30.00  ? 120 VAL F N   1 
ATOM 8500  C CA  . VAL F 1 120 ? 74.198  121.768 113.355 1.00 30.00  ? 120 VAL F CA  1 
ATOM 8501  C C   . VAL F 1 120 ? 73.847  123.252 113.355 1.00 30.00  ? 120 VAL F C   1 
ATOM 8502  O O   . VAL F 1 120 ? 73.666  123.868 114.413 1.00 30.00  ? 120 VAL F O   1 
ATOM 8503  C CB  . VAL F 1 120 ? 75.721  121.532 113.391 1.00 30.00  ? 120 VAL F CB  1 
ATOM 8504  C CG1 . VAL F 1 120 ? 76.346  122.090 114.651 1.00 30.00  ? 120 VAL F CG1 1 
ATOM 8505  C CG2 . VAL F 1 120 ? 76.032  120.064 113.265 1.00 30.00  ? 120 VAL F CG2 1 
ATOM 8506  N N   . PHE F 1 121 ? 73.677  123.832 112.169 1.00 30.00  ? 121 PHE F N   1 
ATOM 8507  C CA  . PHE F 1 121 ? 73.529  125.271 112.010 1.00 30.00  ? 121 PHE F CA  1 
ATOM 8508  C C   . PHE F 1 121 ? 72.114  125.683 111.626 1.00 30.00  ? 121 PHE F C   1 
ATOM 8509  O O   . PHE F 1 121 ? 71.908  126.796 111.132 1.00 30.00  ? 121 PHE F O   1 
ATOM 8510  C CB  . PHE F 1 121 ? 74.532  125.772 110.978 1.00 30.00  ? 121 PHE F CB  1 
ATOM 8511  C CG  . PHE F 1 121 ? 75.944  125.715 111.448 1.00 30.00  ? 121 PHE F CG  1 
ATOM 8512  C CD1 . PHE F 1 121 ? 76.235  125.716 112.796 1.00 30.00  ? 121 PHE F CD1 1 
ATOM 8513  C CD2 . PHE F 1 121 ? 76.977  125.619 110.546 1.00 30.00  ? 121 PHE F CD2 1 
ATOM 8514  C CE1 . PHE F 1 121 ? 77.528  125.658 113.231 1.00 30.00  ? 121 PHE F CE1 1 
ATOM 8515  C CE2 . PHE F 1 121 ? 78.275  125.556 110.981 1.00 30.00  ? 121 PHE F CE2 1 
ATOM 8516  C CZ  . PHE F 1 121 ? 78.546  125.580 112.324 1.00 30.00  ? 121 PHE F CZ  1 
ATOM 8517  N N   . ASN F 1 122 ? 71.139  124.804 111.826 1.00 30.00  ? 122 ASN F N   1 
ATOM 8518  C CA  . ASN F 1 122 ? 69.749  125.215 111.715 1.00 30.00  ? 122 ASN F CA  1 
ATOM 8519  C C   . ASN F 1 122 ? 69.427  126.172 112.855 1.00 30.00  ? 122 ASN F C   1 
ATOM 8520  O O   . ASN F 1 122 ? 69.929  126.018 113.971 1.00 30.00  ? 122 ASN F O   1 
ATOM 8521  C CB  . ASN F 1 122 ? 68.826  123.997 111.762 1.00 30.00  ? 122 ASN F CB  1 
ATOM 8522  C CG  . ASN F 1 122 ? 67.394  124.323 111.361 1.00 30.00  ? 122 ASN F CG  1 
ATOM 8523  O OD1 . ASN F 1 122 ? 67.077  125.447 110.972 1.00 30.00  ? 122 ASN F OD1 1 
ATOM 8524  N ND2 . ASN F 1 122 ? 66.517  123.332 111.466 1.00 30.00  ? 122 ASN F ND2 1 
ATOM 8525  N N   . ALA F 1 123 ? 68.579  127.163 112.573 1.00 30.00  ? 123 ALA F N   1 
ATOM 8526  C CA  . ALA F 1 123 ? 68.236  128.183 113.560 1.00 30.00  ? 123 ALA F CA  1 
ATOM 8527  C C   . ALA F 1 123 ? 67.335  127.589 114.634 1.00 30.00  ? 123 ALA F C   1 
ATOM 8528  O O   . ALA F 1 123 ? 66.126  127.841 114.657 1.00 30.00  ? 123 ALA F O   1 
ATOM 8529  C CB  . ALA F 1 123 ? 67.551  129.373 112.887 1.00 30.00  ? 123 ALA F CB  1 
ATOM 8530  N N   . SER F 1 124 ? 67.925  126.807 115.531 1.00 30.00  ? 124 SER F N   1 
ATOM 8531  C CA  . SER F 1 124 ? 67.183  125.886 116.372 1.00 30.00  ? 124 SER F CA  1 
ATOM 8532  C C   . SER F 1 124 ? 66.912  126.472 117.752 1.00 30.00  ? 124 SER F C   1 
ATOM 8533  O O   . SER F 1 124 ? 67.095  127.666 118.006 1.00 30.00  ? 124 SER F O   1 
ATOM 8534  C CB  . SER F 1 124 ? 67.932  124.568 116.506 1.00 30.00  ? 124 SER F CB  1 
ATOM 8535  O OG  . SER F 1 124 ? 67.215  123.704 117.370 1.00 30.00  ? 124 SER F OG  1 
ATOM 8536  N N   . THR F 1 125 ? 66.453  125.603 118.655 1.00 30.00  ? 125 THR F N   1 
ATOM 8537  C CA  . THR F 1 125 ? 66.256  125.949 120.054 1.00 30.00  ? 125 THR F CA  1 
ATOM 8538  C C   . THR F 1 125 ? 67.558  126.286 120.763 1.00 30.00  ? 125 THR F C   1 
ATOM 8539  O O   . THR F 1 125 ? 67.533  127.009 121.764 1.00 30.00  ? 125 THR F O   1 
ATOM 8540  C CB  . THR F 1 125 ? 65.578  124.788 120.779 1.00 30.00  ? 125 THR F CB  1 
ATOM 8541  O OG1 . THR F 1 125 ? 66.431  123.638 120.721 1.00 30.00  ? 125 THR F OG1 1 
ATOM 8542  C CG2 . THR F 1 125 ? 64.255  124.452 120.116 1.00 30.00  ? 125 THR F CG2 1 
ATOM 8543  N N   . ALA F 1 126 ? 68.687  125.783 120.275 1.00 30.00  ? 126 ALA F N   1 
ATOM 8544  C CA  . ALA F 1 126 ? 69.966  126.003 120.928 1.00 30.00  ? 126 ALA F CA  1 
ATOM 8545  C C   . ALA F 1 126 ? 70.762  127.139 120.321 1.00 30.00  ? 126 ALA F C   1 
ATOM 8546  O O   . ALA F 1 126 ? 71.986  127.027 120.200 1.00 30.00  ? 126 ALA F O   1 
ATOM 8547  C CB  . ALA F 1 126 ? 70.796  124.731 120.907 1.00 30.00  ? 126 ALA F CB  1 
ATOM 8548  N N   . TRP F 1 127 ? 70.094  128.210 119.906 1.00 30.00  ? 127 TRP F N   1 
ATOM 8549  C CA  . TRP F 1 127 ? 70.755  129.422 119.448 1.00 30.00  ? 127 TRP F CA  1 
ATOM 8550  C C   . TRP F 1 127 ? 70.118  130.673 120.030 1.00 30.00  ? 127 TRP F C   1 
ATOM 8551  O O   . TRP F 1 127 ? 70.614  131.776 119.788 1.00 30.00  ? 127 TRP F O   1 
ATOM 8552  C CB  . TRP F 1 127 ? 70.735  129.478 117.924 1.00 30.00  ? 127 TRP F CB  1 
ATOM 8553  C CG  . TRP F 1 127 ? 71.632  128.481 117.276 1.00 30.00  ? 127 TRP F CG  1 
ATOM 8554  C CD1 . TRP F 1 127 ? 71.350  127.176 117.013 1.00 30.00  ? 127 TRP F CD1 1 
ATOM 8555  C CD2 . TRP F 1 127 ? 72.921  128.732 116.716 1.00 30.00  ? 127 TRP F CD2 1 
ATOM 8556  N NE1 . TRP F 1 127 ? 72.409  126.583 116.371 1.00 30.00  ? 127 TRP F NE1 1 
ATOM 8557  C CE2 . TRP F 1 127 ? 73.384  127.521 116.173 1.00 30.00  ? 127 TRP F CE2 1 
ATOM 8558  C CE3 . TRP F 1 127 ? 73.735  129.858 116.639 1.00 30.00  ? 127 TRP F CE3 1 
ATOM 8559  C CZ2 . TRP F 1 127 ? 74.616  127.409 115.552 1.00 30.00  ? 127 TRP F CZ2 1 
ATOM 8560  C CZ3 . TRP F 1 127 ? 74.959  129.742 116.040 1.00 30.00  ? 127 TRP F CZ3 1 
ATOM 8561  C CH2 . TRP F 1 127 ? 75.390  128.529 115.497 1.00 30.00  ? 127 TRP F CH2 1 
ATOM 8562  N N   . ASN F 1 128 ? 69.041  130.530 120.799 1.00 30.00  ? 128 ASN F N   1 
ATOM 8563  C CA  . ASN F 1 128 ? 68.391  131.660 121.462 1.00 30.00  ? 128 ASN F CA  1 
ATOM 8564  C C   . ASN F 1 128 ? 69.284  132.081 122.620 1.00 30.00  ? 128 ASN F C   1 
ATOM 8565  O O   . ASN F 1 128 ? 69.060  131.712 123.774 1.00 30.00  ? 128 ASN F O   1 
ATOM 8566  C CB  . ASN F 1 128 ? 66.996  131.276 121.943 1.00 30.00  ? 128 ASN F CB  1 
ATOM 8567  C CG  . ASN F 1 128 ? 66.184  132.473 122.425 1.00 30.00  ? 128 ASN F CG  1 
ATOM 8568  O OD1 . ASN F 1 128 ? 66.625  133.619 122.339 1.00 30.00  ? 128 ASN F OD1 1 
ATOM 8569  N ND2 . ASN F 1 128 ? 64.991  132.205 122.946 1.00 30.00  ? 128 ASN F ND2 1 
ATOM 8570  N N   . LEU F 1 129 ? 70.307  132.875 122.312 1.00 30.00  ? 129 LEU F N   1 
ATOM 8571  C CA  . LEU F 1 129 ? 71.333  133.200 123.288 1.00 30.00  ? 129 LEU F CA  1 
ATOM 8572  C C   . LEU F 1 129 ? 71.916  134.569 122.968 1.00 30.00  ? 129 LEU F C   1 
ATOM 8573  O O   . LEU F 1 129 ? 71.540  135.216 121.988 1.00 30.00  ? 129 LEU F O   1 
ATOM 8574  C CB  . LEU F 1 129 ? 72.395  132.095 123.332 1.00 30.00  ? 129 LEU F CB  1 
ATOM 8575  C CG  . LEU F 1 129 ? 73.171  131.714 122.073 1.00 30.00  ? 129 LEU F CG  1 
ATOM 8576  C CD1 . LEU F 1 129 ? 74.476  132.476 121.962 1.00 30.00  ? 129 LEU F CD1 1 
ATOM 8577  C CD2 . LEU F 1 129 ? 73.415  130.225 122.043 1.00 30.00  ? 129 LEU F CD2 1 
ATOM 8578  N N   . SER F 1 130 ? 72.855  134.999 123.811 1.00 30.00  ? 130 SER F N   1 
ATOM 8579  C CA  . SER F 1 130 ? 73.350  136.370 123.796 1.00 30.00  ? 130 SER F CA  1 
ATOM 8580  C C   . SER F 1 130 ? 74.867  136.413 123.679 1.00 30.00  ? 130 SER F C   1 
ATOM 8581  O O   . SER F 1 130 ? 75.485  135.430 123.257 1.00 30.00  ? 130 SER F O   1 
ATOM 8582  C CB  . SER F 1 130 ? 72.890  137.133 125.041 1.00 30.00  ? 130 SER F CB  1 
ATOM 8583  O OG  . SER F 1 130 ? 73.494  136.625 126.213 1.00 30.00  ? 130 SER F OG  1 
ATOM 8584  N N   . ASN F 1 131 ? 75.443  137.579 123.996 1.00 30.00  ? 131 ASN F N   1 
ATOM 8585  C CA  . ASN F 1 131 ? 76.865  137.855 123.790 1.00 30.00  ? 131 ASN F CA  1 
ATOM 8586  C C   . ASN F 1 131 ? 77.755  136.869 124.540 1.00 30.00  ? 131 ASN F C   1 
ATOM 8587  O O   . ASN F 1 131 ? 78.571  136.164 123.938 1.00 30.00  ? 131 ASN F O   1 
ATOM 8588  C CB  . ASN F 1 131 ? 77.183  139.279 124.250 1.00 30.00  ? 131 ASN F CB  1 
ATOM 8589  C CG  . ASN F 1 131 ? 76.375  140.331 123.519 1.00 30.00  ? 131 ASN F CG  1 
ATOM 8590  O OD1 . ASN F 1 131 ? 76.111  140.218 122.325 1.00 30.00  ? 131 ASN F OD1 1 
ATOM 8591  N ND2 . ASN F 1 131 ? 75.981  141.371 124.243 1.00 30.00  ? 131 ASN F ND2 1 
ATOM 8592  N N   . THR F 1 132 ? 77.598  136.794 125.858 1.00 30.00  ? 132 THR F N   1 
ATOM 8593  C CA  . THR F 1 132 ? 78.526  136.073 126.725 1.00 30.00  ? 132 THR F CA  1 
ATOM 8594  C C   . THR F 1 132 ? 78.098  134.633 126.948 1.00 30.00  ? 132 THR F C   1 
ATOM 8595  O O   . THR F 1 132 ? 78.406  134.044 127.987 1.00 30.00  ? 132 THR F O   1 
ATOM 8596  C CB  . THR F 1 132 ? 78.641  136.782 128.065 1.00 30.00  ? 132 THR F CB  1 
ATOM 8597  O OG1 . THR F 1 132 ? 77.421  136.603 128.792 1.00 30.00  ? 132 THR F OG1 1 
ATOM 8598  C CG2 . THR F 1 132 ? 78.820  138.251 127.842 1.00 30.00  ? 132 THR F CG2 1 
ATOM 8599  N N   . ASN F 1 133 ? 77.391  134.031 126.000 1.00 30.00  ? 133 ASN F N   1 
ATOM 8600  C CA  . ASN F 1 133 ? 76.810  132.720 126.217 1.00 30.00  ? 133 ASN F CA  1 
ATOM 8601  C C   . ASN F 1 133 ? 77.213  131.770 125.103 1.00 30.00  ? 133 ASN F C   1 
ATOM 8602  O O   . ASN F 1 133 ? 77.433  132.176 123.961 1.00 30.00  ? 133 ASN F O   1 
ATOM 8603  C CB  . ASN F 1 133 ? 75.292  132.812 126.317 1.00 30.00  ? 133 ASN F CB  1 
ATOM 8604  C CG  . ASN F 1 133 ? 74.852  133.724 127.432 1.00 30.00  ? 133 ASN F CG  1 
ATOM 8605  O OD1 . ASN F 1 133 ? 74.157  134.708 127.207 1.00 30.00  ? 133 ASN F OD1 1 
ATOM 8606  N ND2 . ASN F 1 133 ? 75.297  133.427 128.643 1.00 30.00  ? 133 ASN F ND2 1 
ATOM 8607  N N   . PHE F 1 134 ? 77.307  130.488 125.446 1.00 30.00  ? 134 PHE F N   1 
ATOM 8608  C CA  . PHE F 1 134 ? 77.646  129.482 124.457 1.00 30.00  ? 134 PHE F CA  1 
ATOM 8609  C C   . PHE F 1 134 ? 76.667  128.318 124.523 1.00 30.00  ? 134 PHE F C   1 
ATOM 8610  O O   . PHE F 1 134 ? 76.331  127.828 125.602 1.00 30.00  ? 134 PHE F O   1 
ATOM 8611  C CB  . PHE F 1 134 ? 79.100  128.991 124.602 1.00 30.00  ? 134 PHE F CB  1 
ATOM 8612  C CG  . PHE F 1 134 ? 79.423  128.343 125.922 1.00 30.00  ? 134 PHE F CG  1 
ATOM 8613  C CD1 . PHE F 1 134 ? 79.839  129.107 126.994 1.00 30.00  ? 134 PHE F CD1 1 
ATOM 8614  C CD2 . PHE F 1 134 ? 79.375  126.968 126.072 1.00 30.00  ? 134 PHE F CD2 1 
ATOM 8615  C CE1 . PHE F 1 134 ? 80.164  128.518 128.194 1.00 30.00  ? 134 PHE F CE1 1 
ATOM 8616  C CE2 . PHE F 1 134 ? 79.693  126.376 127.273 1.00 30.00  ? 134 PHE F CE2 1 
ATOM 8617  C CZ  . PHE F 1 134 ? 80.087  127.152 128.333 1.00 30.00  ? 134 PHE F CZ  1 
ATOM 8618  N N   . GLY F 1 135 ? 76.204  127.886 123.346 1.00 30.00  ? 135 GLY F N   1 
ATOM 8619  C CA  . GLY F 1 135 ? 75.303  126.762 123.231 1.00 30.00  ? 135 GLY F CA  1 
ATOM 8620  C C   . GLY F 1 135 ? 76.064  125.453 123.251 1.00 30.00  ? 135 GLY F C   1 
ATOM 8621  O O   . GLY F 1 135 ? 77.229  125.398 122.883 1.00 30.00  ? 135 GLY F O   1 
ATOM 8622  N N   . ILE F 1 136 ? 75.395  124.390 123.692 1.00 30.00  ? 136 ILE F N   1 
ATOM 8623  C CA  . ILE F 1 136 ? 76.121  123.215 124.157 1.00 30.00  ? 136 ILE F CA  1 
ATOM 8624  C C   . ILE F 1 136 ? 75.677  121.933 123.432 1.00 30.00  ? 136 ILE F C   1 
ATOM 8625  O O   . ILE F 1 136 ? 75.660  120.849 124.028 1.00 30.00  ? 136 ILE F O   1 
ATOM 8626  C CB  . ILE F 1 136 ? 76.018  123.161 125.703 1.00 30.00  ? 136 ILE F CB  1 
ATOM 8627  C CG1 . ILE F 1 136 ? 77.178  122.383 126.315 1.00 30.00  ? 136 ILE F CG1 1 
ATOM 8628  C CG2 . ILE F 1 136 ? 74.626  122.757 126.242 1.00 30.00  ? 136 ILE F CG2 1 
ATOM 8629  C CD1 . ILE F 1 136 ? 78.471  123.064 126.043 1.00 30.00  ? 136 ILE F CD1 1 
ATOM 8630  N N   . ILE F 1 137 ? 75.369  122.046 122.123 1.00 30.00  ? 137 ILE F N   1 
ATOM 8631  C CA  . ILE F 1 137 ? 74.624  121.011 121.390 1.00 30.00  ? 137 ILE F CA  1 
ATOM 8632  C C   . ILE F 1 137 ? 75.360  119.679 121.424 1.00 30.00  ? 137 ILE F C   1 
ATOM 8633  O O   . ILE F 1 137 ? 76.585  119.614 121.269 1.00 30.00  ? 137 ILE F O   1 
ATOM 8634  C CB  . ILE F 1 137 ? 74.304  121.475 119.953 1.00 30.00  ? 137 ILE F CB  1 
ATOM 8635  C CG1 . ILE F 1 137 ? 75.498  121.541 119.001 1.00 30.00  ? 137 ILE F CG1 1 
ATOM 8636  C CG2 . ILE F 1 137 ? 73.762  122.853 119.972 1.00 30.00  ? 137 ILE F CG2 1 
ATOM 8637  C CD1 . ILE F 1 137 ? 75.601  120.349 118.061 1.00 30.00  ? 137 ILE F CD1 1 
ATOM 8638  N N   . VAL F 1 138 ? 74.629  118.623 121.755 1.00 30.00  ? 138 VAL F N   1 
ATOM 8639  C CA  . VAL F 1 138 ? 75.236  117.410 122.277 1.00 30.00  ? 138 VAL F CA  1 
ATOM 8640  C C   . VAL F 1 138 ? 75.089  116.301 121.248 1.00 30.00  ? 138 VAL F C   1 
ATOM 8641  O O   . VAL F 1 138 ? 74.095  116.230 120.518 1.00 30.00  ? 138 VAL F O   1 
ATOM 8642  C CB  . VAL F 1 138 ? 74.637  117.022 123.652 1.00 30.00  ? 138 VAL F CB  1 
ATOM 8643  C CG1 . VAL F 1 138 ? 73.183  116.593 123.562 1.00 30.00  ? 138 VAL F CG1 1 
ATOM 8644  C CG2 . VAL F 1 138 ? 75.482  115.975 124.352 1.00 30.00  ? 138 VAL F CG2 1 
ATOM 8645  N N   . LEU F 1 139 ? 76.130  115.492 121.138 1.00 30.00  ? 139 LEU F N   1 
ATOM 8646  C CA  . LEU F 1 139 ? 76.162  114.339 120.264 1.00 30.00  ? 139 LEU F CA  1 
ATOM 8647  C C   . LEU F 1 139 ? 77.139  113.343 120.859 1.00 30.00  ? 139 LEU F C   1 
ATOM 8648  O O   . LEU F 1 139 ? 78.147  113.733 121.449 1.00 30.00  ? 139 LEU F O   1 
ATOM 8649  C CB  . LEU F 1 139 ? 76.541  114.739 118.827 1.00 30.00  ? 139 LEU F CB  1 
ATOM 8650  C CG  . LEU F 1 139 ? 77.808  115.544 118.508 1.00 30.00  ? 139 LEU F CG  1 
ATOM 8651  C CD1 . LEU F 1 139 ? 79.043  114.692 118.288 1.00 30.00  ? 139 LEU F CD1 1 
ATOM 8652  C CD2 . LEU F 1 139 ? 77.556  116.413 117.298 1.00 30.00  ? 139 LEU F CD2 1 
ATOM 8653  N N   . GLN F 1 140 ? 76.806  112.060 120.713 1.00 30.00  ? 140 GLN F N   1 
ATOM 8654  C CA  . GLN F 1 140 ? 77.570  110.932 121.254 1.00 30.00  ? 140 GLN F CA  1 
ATOM 8655  C C   . GLN F 1 140 ? 77.740  111.064 122.773 1.00 30.00  ? 140 GLN F C   1 
ATOM 8656  O O   . GLN F 1 140 ? 78.821  111.321 123.300 1.00 30.00  ? 140 GLN F O   1 
ATOM 8657  C CB  . GLN F 1 140 ? 78.921  110.785 120.542 1.00 30.00  ? 140 GLN F CB  1 
ATOM 8658  C CG  . GLN F 1 140 ? 79.690  109.517 120.863 1.00 30.00  ? 140 GLN F CG  1 
ATOM 8659  C CD  . GLN F 1 140 ? 81.052  109.529 120.250 1.00 30.00  ? 140 GLN F CD  1 
ATOM 8660  O OE1 . GLN F 1 140 ? 81.436  110.486 119.586 1.00 30.00  ? 140 GLN F OE1 1 
ATOM 8661  N NE2 . GLN F 1 140 ? 81.806  108.474 120.480 1.00 30.00  ? 140 GLN F NE2 1 
ATOM 8662  N N   . ASP F 1 141 ? 76.615  110.956 123.466 1.00 30.00  ? 141 ASP F N   1 
ATOM 8663  C CA  . ASP F 1 141 ? 76.621  110.817 124.913 1.00 30.00  ? 141 ASP F CA  1 
ATOM 8664  C C   . ASP F 1 141 ? 76.520  109.340 125.270 1.00 30.00  ? 141 ASP F C   1 
ATOM 8665  O O   . ASP F 1 141 ? 75.608  108.643 124.818 1.00 30.00  ? 141 ASP F O   1 
ATOM 8666  C CB  . ASP F 1 141 ? 75.504  111.644 125.558 1.00 30.00  ? 141 ASP F CB  1 
ATOM 8667  C CG  . ASP F 1 141 ? 74.159  111.442 124.897 1.00 30.00  ? 141 ASP F CG  1 
ATOM 8668  O OD1 . ASP F 1 141 ? 74.101  110.817 123.819 1.00 30.00  ? 141 ASP F OD1 1 
ATOM 8669  O OD2 . ASP F 1 141 ? 73.151  111.921 125.460 1.00 30.00  ? 141 ASP F OD2 1 
ATOM 8670  N N   . ALA F 1 142 ? 77.484  108.860 126.053 1.00 30.00  ? 142 ALA F N   1 
ATOM 8671  C CA  . ALA F 1 142 ? 77.537  107.440 126.377 1.00 30.00  ? 142 ALA F CA  1 
ATOM 8672  C C   . ALA F 1 142 ? 76.456  107.062 127.381 1.00 30.00  ? 142 ALA F C   1 
ATOM 8673  O O   . ALA F 1 142 ? 75.559  106.271 127.074 1.00 30.00  ? 142 ALA F O   1 
ATOM 8674  C CB  . ALA F 1 142 ? 78.922  107.078 126.915 1.00 30.00  ? 142 ALA F CB  1 
ATOM 8675  N N   . ASP F 1 143 ? 76.516  107.632 128.581 1.00 30.00  ? 143 ASP F N   1 
ATOM 8676  C CA  . ASP F 1 143 ? 75.572  107.334 129.652 1.00 30.00  ? 143 ASP F CA  1 
ATOM 8677  C C   . ASP F 1 143 ? 74.590  108.478 129.865 1.00 30.00  ? 143 ASP F C   1 
ATOM 8678  O O   . ASP F 1 143 ? 74.069  108.658 130.967 1.00 30.00  ? 143 ASP F O   1 
ATOM 8679  C CB  . ASP F 1 143 ? 76.305  107.028 130.954 1.00 30.00  ? 143 ASP F CB  1 
ATOM 8680  C CG  . ASP F 1 143 ? 77.065  105.723 130.900 1.00 30.00  ? 143 ASP F CG  1 
ATOM 8681  O OD1 . ASP F 1 143 ? 76.628  104.814 130.164 1.00 30.00  ? 143 ASP F OD1 1 
ATOM 8682  O OD2 . ASP F 1 143 ? 78.098  105.606 131.592 1.00 30.00  ? 143 ASP F OD2 1 
ATOM 8683  N N   . ASN F 1 144 ? 74.331  109.238 128.792 1.00 30.00  ? 144 ASN F N   1 
ATOM 8684  C CA  . ASN F 1 144 ? 73.495  110.445 128.801 1.00 30.00  ? 144 ASN F CA  1 
ATOM 8685  C C   . ASN F 1 144 ? 73.977  111.439 129.855 1.00 30.00  ? 144 ASN F C   1 
ATOM 8686  O O   . ASN F 1 144 ? 73.191  112.040 130.587 1.00 30.00  ? 144 ASN F O   1 
ATOM 8687  C CB  . ASN F 1 144 ? 72.015  110.103 128.993 1.00 30.00  ? 144 ASN F CB  1 
ATOM 8688  C CG  . ASN F 1 144 ? 71.436  109.352 127.816 1.00 30.00  ? 144 ASN F CG  1 
ATOM 8689  O OD1 . ASN F 1 144 ? 71.738  109.653 126.665 1.00 30.00  ? 144 ASN F OD1 1 
ATOM 8690  N ND2 . ASN F 1 144 ? 70.593  108.368 128.098 1.00 30.00  ? 144 ASN F ND2 1 
ATOM 8691  N N   . SER F 1 145 ? 75.296  111.603 129.927 1.00 30.00  ? 145 SER F N   1 
ATOM 8692  C CA  . SER F 1 145 ? 75.922  112.386 130.982 1.00 30.00  ? 145 SER F CA  1 
ATOM 8693  C C   . SER F 1 145 ? 75.760  113.888 130.803 1.00 30.00  ? 145 SER F C   1 
ATOM 8694  O O   . SER F 1 145 ? 76.153  114.640 131.699 1.00 30.00  ? 145 SER F O   1 
ATOM 8695  C CB  . SER F 1 145 ? 77.410  112.036 131.073 1.00 30.00  ? 145 SER F CB  1 
ATOM 8696  O OG  . SER F 1 145 ? 78.096  112.395 129.888 1.00 30.00  ? 145 SER F OG  1 
ATOM 8697  N N   . VAL F 1 146 ? 75.206  114.351 129.684 1.00 30.00  ? 146 VAL F N   1 
ATOM 8698  C CA  . VAL F 1 146 ? 74.962  115.777 129.504 1.00 30.00  ? 146 VAL F CA  1 
ATOM 8699  C C   . VAL F 1 146 ? 73.457  116.021 129.494 1.00 30.00  ? 146 VAL F C   1 
ATOM 8700  O O   . VAL F 1 146 ? 72.801  115.918 128.451 1.00 30.00  ? 146 VAL F O   1 
ATOM 8701  C CB  . VAL F 1 146 ? 75.628  116.302 128.219 1.00 30.00  ? 146 VAL F CB  1 
ATOM 8702  C CG1 . VAL F 1 146 ? 75.429  117.806 128.081 1.00 30.00  ? 146 VAL F CG1 1 
ATOM 8703  C CG2 . VAL F 1 146 ? 77.103  115.947 128.205 1.00 30.00  ? 146 VAL F CG2 1 
ATOM 8704  N N   . ASP F 1 147 ? 72.898  116.323 130.659 1.00 30.00  ? 147 ASP F N   1 
ATOM 8705  C CA  . ASP F 1 147 ? 71.482  116.615 130.807 1.00 30.00  ? 147 ASP F CA  1 
ATOM 8706  C C   . ASP F 1 147 ? 71.273  118.078 131.162 1.00 30.00  ? 147 ASP F C   1 
ATOM 8707  O O   . ASP F 1 147 ? 72.190  118.899 131.102 1.00 30.00  ? 147 ASP F O   1 
ATOM 8708  C CB  . ASP F 1 147 ? 70.846  115.720 131.872 1.00 30.00  ? 147 ASP F CB  1 
ATOM 8709  C CG  . ASP F 1 147 ? 70.681  114.293 131.408 1.00 30.00  ? 147 ASP F CG  1 
ATOM 8710  O OD1 . ASP F 1 147 ? 70.499  114.086 130.192 1.00 30.00  ? 147 ASP F OD1 1 
ATOM 8711  O OD2 . ASP F 1 147 ? 70.728  113.378 132.256 1.00 30.00  ? 147 ASP F OD2 1 
ATOM 8712  N N   . GLN F 1 148 ? 70.028  118.396 131.517 1.00 30.00  ? 148 GLN F N   1 
ATOM 8713  C CA  . GLN F 1 148 ? 69.687  119.741 131.957 1.00 30.00  ? 148 GLN F CA  1 
ATOM 8714  C C   . GLN F 1 148 ? 70.382  120.044 133.277 1.00 30.00  ? 148 GLN F C   1 
ATOM 8715  O O   . GLN F 1 148 ? 70.588  119.147 134.101 1.00 30.00  ? 148 GLN F O   1 
ATOM 8716  C CB  . GLN F 1 148 ? 68.171  119.884 132.104 1.00 30.00  ? 148 GLN F CB  1 
ATOM 8717  C CG  . GLN F 1 148 ? 67.711  121.306 132.354 1.00 30.00  ? 148 GLN F CG  1 
ATOM 8718  C CD  . GLN F 1 148 ? 67.900  122.183 131.145 1.00 30.00  ? 148 GLN F CD  1 
ATOM 8719  O OE1 . GLN F 1 148 ? 67.529  121.808 130.036 1.00 30.00  ? 148 GLN F OE1 1 
ATOM 8720  N NE2 . GLN F 1 148 ? 68.507  123.345 131.343 1.00 30.00  ? 148 GLN F NE2 1 
ATOM 8721  N N   . ASN F 1 149 ? 70.855  121.290 133.406 1.00 30.00  ? 149 ASN F N   1 
ATOM 8722  C CA  . ASN F 1 149 ? 71.398  121.917 134.612 1.00 30.00  ? 149 ASN F CA  1 
ATOM 8723  C C   . ASN F 1 149 ? 72.764  121.374 135.018 1.00 30.00  ? 149 ASN F C   1 
ATOM 8724  O O   . ASN F 1 149 ? 73.400  121.926 135.920 1.00 30.00  ? 149 ASN F O   1 
ATOM 8725  C CB  . ASN F 1 149 ? 70.439  121.785 135.804 1.00 30.00  ? 149 ASN F CB  1 
ATOM 8726  C CG  . ASN F 1 149 ? 69.062  122.338 135.515 1.00 30.00  ? 149 ASN F CG  1 
ATOM 8727  O OD1 . ASN F 1 149 ? 68.069  121.614 135.579 1.00 30.00  ? 149 ASN F OD1 1 
ATOM 8728  N ND2 . ASN F 1 149 ? 68.992  123.620 135.183 1.00 30.00  ? 149 ASN F ND2 1 
ATOM 8729  N N   . TYR F 1 150 ? 73.240  120.317 134.365 1.00 30.00  ? 150 TYR F N   1 
ATOM 8730  C CA  . TYR F 1 150 ? 74.542  119.719 134.663 1.00 30.00  ? 150 TYR F CA  1 
ATOM 8731  C C   . TYR F 1 150 ? 75.121  119.081 133.409 1.00 30.00  ? 150 TYR F C   1 
ATOM 8732  O O   . TYR F 1 150 ? 75.044  117.863 133.223 1.00 30.00  ? 150 TYR F O   1 
ATOM 8733  C CB  . TYR F 1 150 ? 74.427  118.671 135.775 1.00 30.00  ? 150 TYR F CB  1 
ATOM 8734  C CG  . TYR F 1 150 ? 74.122  119.205 137.151 1.00 30.00  ? 150 TYR F CG  1 
ATOM 8735  C CD1 . TYR F 1 150 ? 75.123  119.760 137.935 1.00 30.00  ? 150 TYR F CD1 1 
ATOM 8736  C CD2 . TYR F 1 150 ? 72.839  119.138 137.671 1.00 30.00  ? 150 TYR F CD2 1 
ATOM 8737  C CE1 . TYR F 1 150 ? 74.856  120.246 139.197 1.00 30.00  ? 150 TYR F CE1 1 
ATOM 8738  C CE2 . TYR F 1 150 ? 72.559  119.621 138.933 1.00 30.00  ? 150 TYR F CE2 1 
ATOM 8739  C CZ  . TYR F 1 150 ? 73.574  120.173 139.692 1.00 30.00  ? 150 TYR F CZ  1 
ATOM 8740  O OH  . TYR F 1 150 ? 73.307  120.656 140.952 1.00 30.00  ? 150 TYR F OH  1 
ATOM 8741  N N   . PRO F 1 151 ? 75.719  119.873 132.521 1.00 118.75 ? 151 PRO F N   1 
ATOM 8742  C CA  . PRO F 1 151 ? 76.485  119.257 131.436 1.00 118.46 ? 151 PRO F CA  1 
ATOM 8743  C C   . PRO F 1 151 ? 77.791  118.696 131.968 1.00 119.90 ? 151 PRO F C   1 
ATOM 8744  O O   . PRO F 1 151 ? 78.708  119.451 132.305 1.00 131.05 ? 151 PRO F O   1 
ATOM 8745  C CB  . PRO F 1 151 ? 76.717  120.415 130.461 1.00 30.00  ? 151 PRO F CB  1 
ATOM 8746  C CG  . PRO F 1 151 ? 75.695  121.428 130.814 1.00 30.00  ? 151 PRO F CG  1 
ATOM 8747  C CD  . PRO F 1 151 ? 75.552  121.316 132.294 1.00 30.00  ? 151 PRO F CD  1 
ATOM 8748  N N   . THR F 1 152 ? 77.879  117.373 132.059 1.00 103.12 ? 152 THR F N   1 
ATOM 8749  C CA  . THR F 1 152 ? 79.033  116.693 132.633 1.00 94.10  ? 152 THR F CA  1 
ATOM 8750  C C   . THR F 1 152 ? 79.691  115.841 131.560 1.00 104.71 ? 152 THR F C   1 
ATOM 8751  O O   . THR F 1 152 ? 79.040  114.978 130.964 1.00 113.36 ? 152 THR F O   1 
ATOM 8752  C CB  . THR F 1 152 ? 78.615  115.825 133.819 1.00 30.00  ? 152 THR F CB  1 
ATOM 8753  O OG1 . THR F 1 152 ? 77.727  114.800 133.363 1.00 30.00  ? 152 THR F OG1 1 
ATOM 8754  C CG2 . THR F 1 152 ? 77.898  116.661 134.862 1.00 30.00  ? 152 THR F CG2 1 
ATOM 8755  N N   . LEU F 1 153 ? 80.973  116.089 131.311 1.00 105.17 ? 153 LEU F N   1 
ATOM 8756  C CA  . LEU F 1 153 ? 81.726  115.298 130.347 1.00 86.31  ? 153 LEU F CA  1 
ATOM 8757  C C   . LEU F 1 153 ? 82.415  114.110 130.999 1.00 100.45 ? 153 LEU F C   1 
ATOM 8758  O O   . LEU F 1 153 ? 83.127  114.241 131.997 1.00 121.22 ? 153 LEU F O   1 
ATOM 8759  C CB  . LEU F 1 153 ? 82.770  116.152 129.631 1.00 85.43  ? 153 LEU F CB  1 
ATOM 8760  C CG  . LEU F 1 153 ? 82.413  116.670 128.246 1.00 104.80 ? 153 LEU F CG  1 
ATOM 8761  C CD1 . LEU F 1 153 ? 81.192  117.509 128.295 1.00 109.08 ? 153 LEU F CD1 1 
ATOM 8762  C CD2 . LEU F 1 153 ? 83.564  117.490 127.716 1.00 104.18 ? 153 LEU F CD2 1 
ATOM 8763  N N   . ASN F 1 154 ? 82.209  112.942 130.401 1.00 92.73  ? 154 ASN F N   1 
ATOM 8764  C CA  . ASN F 1 154 ? 82.964  111.745 130.737 1.00 102.94 ? 154 ASN F CA  1 
ATOM 8765  C C   . ASN F 1 154 ? 83.758  111.312 129.514 1.00 103.88 ? 154 ASN F C   1 
ATOM 8766  O O   . ASN F 1 154 ? 83.731  112.000 128.490 1.00 114.48 ? 154 ASN F O   1 
ATOM 8767  C CB  . ASN F 1 154 ? 82.023  110.652 131.259 1.00 108.28 ? 154 ASN F CB  1 
ATOM 8768  C CG  . ASN F 1 154 ? 80.800  110.447 130.375 1.00 136.92 ? 154 ASN F CG  1 
ATOM 8769  O OD1 . ASN F 1 154 ? 80.678  111.039 129.310 1.00 143.53 ? 154 ASN F OD1 1 
ATOM 8770  N ND2 . ASN F 1 154 ? 79.879  109.611 130.833 1.00 139.78 ? 154 ASN F ND2 1 
ATOM 8771  N N   . LYS F 1 155 ? 84.476  110.198 129.610 1.00 95.21  ? 155 LYS F N   1 
ATOM 8772  C CA  . LYS F 1 155 ? 85.360  109.775 128.533 1.00 95.36  ? 155 LYS F CA  1 
ATOM 8773  C C   . LYS F 1 155 ? 84.568  109.313 127.310 1.00 115.83 ? 155 LYS F C   1 
ATOM 8774  O O   . LYS F 1 155 ? 83.584  108.574 127.409 1.00 123.08 ? 155 LYS F O   1 
ATOM 8775  C CB  . LYS F 1 155 ? 86.311  108.680 129.033 1.00 30.00  ? 155 LYS F CB  1 
ATOM 8776  C CG  . LYS F 1 155 ? 85.646  107.419 129.571 1.00 30.00  ? 155 LYS F CG  1 
ATOM 8777  C CD  . LYS F 1 155 ? 86.663  106.462 130.151 1.00 30.00  ? 155 LYS F CD  1 
ATOM 8778  C CE  . LYS F 1 155 ? 87.202  106.997 131.464 1.00 30.00  ? 155 LYS F CE  1 
ATOM 8779  N NZ  . LYS F 1 155 ? 88.109  106.036 132.141 1.00 30.00  ? 155 LYS F NZ  1 
ATOM 8780  N N   . GLY F 1 156 ? 84.990  109.795 126.147 1.00 120.22 ? 156 GLY F N   1 
ATOM 8781  C CA  . GLY F 1 156 ? 84.271  109.528 124.916 1.00 108.72 ? 156 GLY F CA  1 
ATOM 8782  C C   . GLY F 1 156 ? 82.912  110.187 124.854 1.00 114.31 ? 156 GLY F C   1 
ATOM 8783  O O   . GLY F 1 156 ? 81.895  109.491 124.749 1.00 129.66 ? 156 GLY F O   1 
ATOM 8784  N N   . ASP F 1 157 ? 82.865  111.513 124.929 1.00 108.95 ? 157 ASP F N   1 
ATOM 8785  C CA  . ASP F 1 157 ? 81.607  112.251 124.943 1.00 110.20 ? 157 ASP F CA  1 
ATOM 8786  C C   . ASP F 1 157 ? 81.880  113.593 124.283 1.00 98.60  ? 157 ASP F C   1 
ATOM 8787  O O   . ASP F 1 157 ? 82.349  114.522 124.944 1.00 104.60 ? 157 ASP F O   1 
ATOM 8788  C CB  . ASP F 1 157 ? 81.099  112.414 126.375 1.00 30.00  ? 157 ASP F CB  1 
ATOM 8789  C CG  . ASP F 1 157 ? 79.654  112.874 126.452 1.00 30.00  ? 157 ASP F CG  1 
ATOM 8790  O OD1 . ASP F 1 157 ? 79.052  113.210 125.416 1.00 30.00  ? 157 ASP F OD1 1 
ATOM 8791  O OD2 . ASP F 1 157 ? 79.104  112.875 127.573 1.00 30.00  ? 157 ASP F OD2 1 
ATOM 8792  N N   . ILE F 1 158 ? 81.591  113.699 122.992 1.00 93.46  ? 158 ILE F N   1 
ATOM 8793  C CA  . ILE F 1 158 ? 82.017  114.839 122.191 1.00 94.83  ? 158 ILE F CA  1 
ATOM 8794  C C   . ILE F 1 158 ? 80.877  115.847 122.153 1.00 87.24  ? 158 ILE F C   1 
ATOM 8795  O O   . ILE F 1 158 ? 80.046  115.836 121.241 1.00 105.72 ? 158 ILE F O   1 
ATOM 8796  C CB  . ILE F 1 158 ? 82.431  114.412 120.779 1.00 30.00  ? 158 ILE F CB  1 
ATOM 8797  C CG1 . ILE F 1 158 ? 83.477  113.311 120.863 1.00 30.00  ? 158 ILE F CG1 1 
ATOM 8798  C CG2 . ILE F 1 158 ? 83.045  115.580 120.023 1.00 30.00  ? 158 ILE F CG2 1 
ATOM 8799  C CD1 . ILE F 1 158 ? 83.823  112.719 119.539 1.00 30.00  ? 158 ILE F CD1 1 
ATOM 8800  N N   . VAL F 1 159 ? 80.844  116.737 123.132 1.00 72.04  ? 159 VAL F N   1 
ATOM 8801  C CA  . VAL F 1 159 ? 79.882  117.821 123.143 1.00 85.77  ? 159 VAL F CA  1 
ATOM 8802  C C   . VAL F 1 159 ? 80.378  118.861 122.145 1.00 98.46  ? 159 VAL F C   1 
ATOM 8803  O O   . VAL F 1 159 ? 81.554  118.901 121.785 1.00 103.95 ? 159 VAL F O   1 
ATOM 8804  C CB  . VAL F 1 159 ? 79.712  118.401 124.565 1.00 96.17  ? 159 VAL F CB  1 
ATOM 8805  C CG1 . VAL F 1 159 ? 80.904  119.255 124.963 1.00 92.70  ? 159 VAL F CG1 1 
ATOM 8806  C CG2 . VAL F 1 159 ? 78.390  119.129 124.734 1.00 104.55 ? 159 VAL F CG2 1 
ATOM 8807  N N   . VAL F 1 160 ? 79.463  119.674 121.642 1.00 95.14  ? 160 VAL F N   1 
ATOM 8808  C CA  . VAL F 1 160 ? 79.796  120.708 120.673 1.00 101.45 ? 160 VAL F CA  1 
ATOM 8809  C C   . VAL F 1 160 ? 79.417  122.046 121.273 1.00 102.27 ? 160 VAL F C   1 
ATOM 8810  O O   . VAL F 1 160 ? 78.237  122.307 121.532 1.00 103.82 ? 160 VAL F O   1 
ATOM 8811  C CB  . VAL F 1 160 ? 79.088  120.491 119.336 1.00 30.00  ? 160 VAL F CB  1 
ATOM 8812  C CG1 . VAL F 1 160 ? 79.320  121.676 118.427 1.00 30.00  ? 160 VAL F CG1 1 
ATOM 8813  C CG2 . VAL F 1 160 ? 79.582  119.222 118.702 1.00 30.00  ? 160 VAL F CG2 1 
ATOM 8814  N N   . ILE F 1 161 ? 80.409  122.899 121.487 1.00 90.95  ? 161 ILE F N   1 
ATOM 8815  C CA  . ILE F 1 161 ? 80.147  124.232 122.010 1.00 81.94  ? 161 ILE F CA  1 
ATOM 8816  C C   . ILE F 1 161 ? 79.765  125.151 120.857 1.00 79.66  ? 161 ILE F C   1 
ATOM 8817  O O   . ILE F 1 161 ? 80.569  125.412 119.958 1.00 99.72  ? 161 ILE F O   1 
ATOM 8818  C CB  . ILE F 1 161 ? 81.343  124.770 122.804 1.00 30.00  ? 161 ILE F CB  1 
ATOM 8819  C CG1 . ILE F 1 161 ? 81.475  123.998 124.112 1.00 30.00  ? 161 ILE F CG1 1 
ATOM 8820  C CG2 . ILE F 1 161 ? 81.203  126.250 123.066 1.00 30.00  ? 161 ILE F CG2 1 
ATOM 8821  C CD1 . ILE F 1 161 ? 82.570  124.470 124.998 1.00 30.00  ? 161 ILE F CD1 1 
ATOM 8822  N N   . THR F 1 162 ? 78.513  125.596 120.859 1.00 81.25  ? 162 THR F N   1 
ATOM 8823  C CA  . THR F 1 162 ? 78.002  126.560 119.897 1.00 79.19  ? 162 THR F CA  1 
ATOM 8824  C C   . THR F 1 162 ? 78.193  127.965 120.436 1.00 81.11  ? 162 THR F C   1 
ATOM 8825  O O   . THR F 1 162 ? 77.675  128.289 121.502 1.00 116.53 ? 162 THR F O   1 
ATOM 8826  C CB  . THR F 1 162 ? 76.518  126.312 119.646 1.00 105.99 ? 162 THR F CB  1 
ATOM 8827  O OG1 . THR F 1 162 ? 76.343  125.065 118.968 1.00 101.14 ? 162 THR F OG1 1 
ATOM 8828  C CG2 . THR F 1 162 ? 75.919  127.420 118.840 1.00 102.00 ? 162 THR F CG2 1 
ATOM 8829  N N   . VAL F 1 163 ? 78.910  128.805 119.694 1.00 74.05  ? 163 VAL F N   1 
ATOM 8830  C CA  . VAL F 1 163 ? 79.172  130.183 120.098 1.00 59.01  ? 163 VAL F CA  1 
ATOM 8831  C C   . VAL F 1 163 ? 78.656  131.099 119.003 1.00 74.94  ? 163 VAL F C   1 
ATOM 8832  O O   . VAL F 1 163 ? 79.216  131.126 117.903 1.00 100.06 ? 163 VAL F O   1 
ATOM 8833  C CB  . VAL F 1 163 ? 80.668  130.447 120.341 1.00 30.00  ? 163 VAL F CB  1 
ATOM 8834  C CG1 . VAL F 1 163 ? 80.897  131.905 120.635 1.00 30.00  ? 163 VAL F CG1 1 
ATOM 8835  C CG2 . VAL F 1 163 ? 81.184  129.611 121.484 1.00 30.00  ? 163 VAL F CG2 1 
ATOM 8836  N N   . LYS F 1 164 ? 77.599  131.848 119.293 1.00 74.88  ? 164 LYS F N   1 
ATOM 8837  C CA  . LYS F 1 164 ? 77.143  132.842 118.335 1.00 83.69  ? 164 LYS F CA  1 
ATOM 8838  C C   . LYS F 1 164 ? 78.034  134.067 118.415 1.00 106.81 ? 164 LYS F C   1 
ATOM 8839  O O   . LYS F 1 164 ? 78.153  134.703 119.465 1.00 129.13 ? 164 LYS F O   1 
ATOM 8840  C CB  . LYS F 1 164 ? 75.693  133.239 118.578 1.00 30.00  ? 164 LYS F CB  1 
ATOM 8841  C CG  . LYS F 1 164 ? 75.180  134.214 117.544 1.00 30.00  ? 164 LYS F CG  1 
ATOM 8842  C CD  . LYS F 1 164 ? 73.734  134.538 117.776 1.00 30.00  ? 164 LYS F CD  1 
ATOM 8843  C CE  . LYS F 1 164 ? 73.245  135.525 116.751 1.00 30.00  ? 164 LYS F CE  1 
ATOM 8844  N NZ  . LYS F 1 164 ? 71.819  135.871 116.980 1.00 30.00  ? 164 LYS F NZ  1 
ATOM 8845  N N   . VAL F 1 165 ? 78.656  134.401 117.292 1.00 100.36 ? 165 VAL F N   1 
ATOM 8846  C CA  . VAL F 1 165 ? 79.736  135.372 117.294 1.00 103.79 ? 165 VAL F CA  1 
ATOM 8847  C C   . VAL F 1 165 ? 79.285  136.684 116.674 1.00 97.79  ? 165 VAL F C   1 
ATOM 8848  O O   . VAL F 1 165 ? 79.313  137.731 117.328 1.00 106.74 ? 165 VAL F O   1 
ATOM 8849  C CB  . VAL F 1 165 ? 80.960  134.806 116.554 1.00 30.00  ? 165 VAL F CB  1 
ATOM 8850  C CG1 . VAL F 1 165 ? 82.048  135.832 116.477 1.00 30.00  ? 165 VAL F CG1 1 
ATOM 8851  C CG2 . VAL F 1 165 ? 81.461  133.561 117.243 1.00 30.00  ? 165 VAL F CG2 1 
ATOM 8852  N N   . GLY F 1 166 ? 78.885  136.642 115.408 1.00 79.70  ? 166 GLY F N   1 
ATOM 8853  C CA  . GLY F 1 166 ? 78.895  137.848 114.604 1.00 92.16  ? 166 GLY F CA  1 
ATOM 8854  C C   . GLY F 1 166 ? 77.728  138.798 114.450 1.00 91.30  ? 166 GLY F C   1 
ATOM 8855  O O   . GLY F 1 166 ? 77.853  139.979 114.785 1.00 97.71  ? 166 GLY F O   1 
ATOM 8856  N N   . GLU F 1 167 ? 76.600  138.317 113.933 1.00 104.44 ? 167 GLU F N   1 
ATOM 8857  C CA  . GLU F 1 167 ? 75.630  139.214 113.319 1.00 121.81 ? 167 GLU F CA  1 
ATOM 8858  C C   . GLU F 1 167 ? 74.793  139.930 114.374 1.00 118.30 ? 167 GLU F C   1 
ATOM 8859  O O   . GLU F 1 167 ? 74.328  139.316 115.339 1.00 118.15 ? 167 GLU F O   1 
ATOM 8860  C CB  . GLU F 1 167 ? 74.756  138.447 112.320 1.00 30.00  ? 167 GLU F CB  1 
ATOM 8861  C CG  . GLU F 1 167 ? 73.945  137.273 112.853 1.00 30.00  ? 167 GLU F CG  1 
ATOM 8862  C CD  . GLU F 1 167 ? 72.551  137.673 113.289 1.00 30.00  ? 167 GLU F CD  1 
ATOM 8863  O OE1 . GLU F 1 167 ? 72.089  138.756 112.878 1.00 30.00  ? 167 GLU F OE1 1 
ATOM 8864  O OE2 . GLU F 1 167 ? 71.910  136.901 114.029 1.00 30.00  ? 167 GLU F OE2 1 
ATOM 8865  N N   . GLY F 1 168 ? 74.638  141.243 114.200 1.00 30.00  ? 168 GLY F N   1 
ATOM 8866  C CA  . GLY F 1 168 ? 73.933  142.068 115.160 1.00 30.00  ? 168 GLY F CA  1 
ATOM 8867  C C   . GLY F 1 168 ? 74.701  142.172 116.457 1.00 30.00  ? 168 GLY F C   1 
ATOM 8868  O O   . GLY F 1 168 ? 75.735  142.839 116.532 1.00 30.00  ? 168 GLY F O   1 
ATOM 8869  N N   . ASN F 1 169 ? 74.198  141.500 117.486 1.00 30.00  ? 169 ASN F N   1 
ATOM 8870  C CA  . ASN F 1 169 ? 74.937  141.329 118.724 1.00 30.00  ? 169 ASN F CA  1 
ATOM 8871  C C   . ASN F 1 169 ? 75.951  140.201 118.596 1.00 30.00  ? 169 ASN F C   1 
ATOM 8872  O O   . ASN F 1 169 ? 76.275  139.745 117.497 1.00 30.00  ? 169 ASN F O   1 
ATOM 8873  C CB  . ASN F 1 169 ? 73.985  141.053 119.894 1.00 30.00  ? 169 ASN F CB  1 
ATOM 8874  C CG  . ASN F 1 169 ? 73.060  139.852 119.659 1.00 30.00  ? 169 ASN F CG  1 
ATOM 8875  O OD1 . ASN F 1 169 ? 73.108  139.184 118.627 1.00 30.00  ? 169 ASN F OD1 1 
ATOM 8876  N ND2 . ASN F 1 169 ? 72.218  139.572 120.646 1.00 30.00  ? 169 ASN F ND2 1 
ATOM 8877  N N   . GLY F 1 170 ? 76.455  139.755 119.735 1.00 30.00  ? 170 GLY F N   1 
ATOM 8878  C CA  . GLY F 1 170 ? 77.270  138.561 119.736 1.00 30.00  ? 170 GLY F CA  1 
ATOM 8879  C C   . GLY F 1 170 ? 78.552  138.788 120.497 1.00 30.00  ? 170 GLY F C   1 
ATOM 8880  O O   . GLY F 1 170 ? 78.705  139.774 121.220 1.00 30.00  ? 170 GLY F O   1 
ATOM 8881  N N   . VAL F 1 171 ? 79.472  137.839 120.323 1.00 30.00  ? 171 VAL F N   1 
ATOM 8882  C CA  . VAL F 1 171 ? 80.782  137.943 120.953 1.00 30.00  ? 171 VAL F CA  1 
ATOM 8883  C C   . VAL F 1 171 ? 81.558  139.109 120.365 1.00 30.00  ? 171 VAL F C   1 
ATOM 8884  O O   . VAL F 1 171 ? 82.166  139.905 121.091 1.00 30.00  ? 171 VAL F O   1 
ATOM 8885  C CB  . VAL F 1 171 ? 81.541  136.614 120.798 1.00 30.00  ? 171 VAL F CB  1 
ATOM 8886  C CG1 . VAL F 1 171 ? 82.923  136.733 121.340 1.00 30.00  ? 171 VAL F CG1 1 
ATOM 8887  C CG2 . VAL F 1 171 ? 80.809  135.519 121.528 1.00 30.00  ? 171 VAL F CG2 1 
ATOM 8888  N N   . PHE F 1 172 ? 81.520  139.248 119.049 1.00 30.00  ? 172 PHE F N   1 
ATOM 8889  C CA  . PHE F 1 172 ? 82.237  140.298 118.350 1.00 30.00  ? 172 PHE F CA  1 
ATOM 8890  C C   . PHE F 1 172 ? 81.233  141.197 117.650 1.00 30.00  ? 172 PHE F C   1 
ATOM 8891  O O   . PHE F 1 172 ? 80.225  140.722 117.119 1.00 30.00  ? 172 PHE F O   1 
ATOM 8892  C CB  . PHE F 1 172 ? 83.196  139.713 117.317 1.00 30.00  ? 172 PHE F CB  1 
ATOM 8893  C CG  . PHE F 1 172 ? 84.306  138.891 117.903 1.00 30.00  ? 172 PHE F CG  1 
ATOM 8894  C CD1 . PHE F 1 172 ? 84.719  139.064 119.209 1.00 30.00  ? 172 PHE F CD1 1 
ATOM 8895  C CD2 . PHE F 1 172 ? 84.916  137.920 117.142 1.00 30.00  ? 172 PHE F CD2 1 
ATOM 8896  C CE1 . PHE F 1 172 ? 85.721  138.299 119.729 1.00 30.00  ? 172 PHE F CE1 1 
ATOM 8897  C CE2 . PHE F 1 172 ? 85.917  137.157 117.665 1.00 30.00  ? 172 PHE F CE2 1 
ATOM 8898  C CZ  . PHE F 1 172 ? 86.313  137.344 118.963 1.00 30.00  ? 172 PHE F CZ  1 
ATOM 8899  N N   . GLY F 1 173 ? 81.510  142.498 117.659 1.00 90.87  ? 173 GLY F N   1 
ATOM 8900  C CA  . GLY F 1 173 ? 80.712  143.432 116.888 1.00 106.12 ? 173 GLY F CA  1 
ATOM 8901  C C   . GLY F 1 173 ? 80.894  143.156 115.410 1.00 110.53 ? 173 GLY F C   1 
ATOM 8902  O O   . GLY F 1 173 ? 82.013  143.282 114.886 1.00 115.60 ? 173 GLY F O   1 
ATOM 8903  N N   . LYS F 1 174 ? 79.826  142.695 114.745 1.00 97.87  ? 174 LYS F N   1 
ATOM 8904  C CA  . LYS F 1 174 ? 79.737  142.293 113.337 1.00 80.02  ? 174 LYS F CA  1 
ATOM 8905  C C   . LYS F 1 174 ? 80.554  141.042 113.005 1.00 94.77  ? 174 LYS F C   1 
ATOM 8906  O O   . LYS F 1 174 ? 80.556  140.608 111.851 1.00 96.54  ? 174 LYS F O   1 
ATOM 8907  C CB  . LYS F 1 174 ? 80.125  143.432 112.375 1.00 30.00  ? 174 LYS F CB  1 
ATOM 8908  C CG  . LYS F 1 174 ? 79.318  144.704 112.544 1.00 30.00  ? 174 LYS F CG  1 
ATOM 8909  C CD  . LYS F 1 174 ? 77.852  144.478 112.243 1.00 30.00  ? 174 LYS F CD  1 
ATOM 8910  C CE  . LYS F 1 174 ? 77.635  144.173 110.771 1.00 30.00  ? 174 LYS F CE  1 
ATOM 8911  N NZ  . LYS F 1 174 ? 77.994  145.329 109.904 1.00 30.00  ? 174 LYS F NZ  1 
ATOM 8912  N N   . GLY F 1 175 ? 81.239  140.440 113.975 1.00 111.68 ? 175 GLY F N   1 
ATOM 8913  C CA  . GLY F 1 175 ? 82.034  139.258 113.717 1.00 81.48  ? 175 GLY F CA  1 
ATOM 8914  C C   . GLY F 1 175 ? 83.330  139.519 112.979 1.00 95.21  ? 175 GLY F C   1 
ATOM 8915  O O   . GLY F 1 175 ? 83.662  140.639 112.598 1.00 97.91  ? 175 GLY F O   1 
ATOM 8916  N N   . ILE F 1 176 ? 84.065  138.431 112.773 1.00 83.15  ? 176 ILE F N   1 
ATOM 8917  C CA  . ILE F 1 176 ? 85.397  138.502 112.182 1.00 78.96  ? 176 ILE F CA  1 
ATOM 8918  C C   . ILE F 1 176 ? 85.330  138.564 110.660 1.00 94.93  ? 176 ILE F C   1 
ATOM 8919  O O   . ILE F 1 176 ? 84.698  137.714 110.017 1.00 88.90  ? 176 ILE F O   1 
ATOM 8920  C CB  . ILE F 1 176 ? 86.276  137.340 112.671 1.00 30.00  ? 176 ILE F CB  1 
ATOM 8921  C CG1 . ILE F 1 176 ? 85.517  136.022 112.623 1.00 30.00  ? 176 ILE F CG1 1 
ATOM 8922  C CG2 . ILE F 1 176 ? 86.757  137.588 114.069 1.00 30.00  ? 176 ILE F CG2 1 
ATOM 8923  C CD1 . ILE F 1 176 ? 86.367  134.821 112.900 1.00 30.00  ? 176 ILE F CD1 1 
ATOM 8924  N N   . PRO F 1 177 ? 85.929  139.582 110.053 1.00 104.13 ? 177 PRO F N   1 
ATOM 8925  C CA  . PRO F 1 177 ? 86.161  139.567 108.613 1.00 102.32 ? 177 PRO F CA  1 
ATOM 8926  C C   . PRO F 1 177 ? 87.297  138.616 108.279 1.00 111.82 ? 177 PRO F C   1 
ATOM 8927  O O   . PRO F 1 177 ? 87.981  138.136 109.194 1.00 109.13 ? 177 PRO F O   1 
ATOM 8928  C CB  . PRO F 1 177 ? 86.525  141.033 108.314 1.00 30.00  ? 177 PRO F CB  1 
ATOM 8929  C CG  . PRO F 1 177 ? 87.065  141.548 109.568 1.00 30.00  ? 177 PRO F CG  1 
ATOM 8930  C CD  . PRO F 1 177 ? 86.307  140.870 110.656 1.00 30.00  ? 177 PRO F CD  1 
ATOM 8931  N N   . PRO F 1 178 ? 87.518  138.283 107.003 1.00 116.59 ? 178 PRO F N   1 
ATOM 8932  C CA  . PRO F 1 178 ? 88.659  137.428 106.657 1.00 103.53 ? 178 PRO F CA  1 
ATOM 8933  C C   . PRO F 1 178 ? 89.992  138.102 106.931 1.00 98.48  ? 178 PRO F C   1 
ATOM 8934  O O   . PRO F 1 178 ? 90.082  139.316 107.129 1.00 99.69  ? 178 PRO F O   1 
ATOM 8935  C CB  . PRO F 1 178 ? 88.482  137.178 105.159 1.00 30.00  ? 178 PRO F CB  1 
ATOM 8936  C CG  . PRO F 1 178 ? 87.607  138.263 104.687 1.00 30.00  ? 178 PRO F CG  1 
ATOM 8937  C CD  . PRO F 1 178 ? 86.674  138.524 105.819 1.00 30.00  ? 178 PRO F CD  1 
ATOM 8938  N N   . ARG F 1 179 ? 91.028  137.255 106.953 1.00 103.48 ? 179 ARG F N   1 
ATOM 8939  C CA  . ARG F 1 179 ? 92.434  137.646 107.065 1.00 103.58 ? 179 ARG F CA  1 
ATOM 8940  C C   . ARG F 1 179 ? 92.675  138.408 108.374 1.00 107.40 ? 179 ARG F C   1 
ATOM 8941  O O   . ARG F 1 179 ? 93.132  139.552 108.407 1.00 119.87 ? 179 ARG F O   1 
ATOM 8942  C CB  . ARG F 1 179 ? 92.857  138.438 105.818 1.00 30.00  ? 179 ARG F CB  1 
ATOM 8943  C CG  . ARG F 1 179 ? 94.339  138.693 105.597 1.00 30.00  ? 179 ARG F CG  1 
ATOM 8944  C CD  . ARG F 1 179 ? 94.535  139.445 104.292 1.00 30.00  ? 179 ARG F CD  1 
ATOM 8945  N NE  . ARG F 1 179 ? 93.847  140.735 104.289 1.00 30.00  ? 179 ARG F NE  1 
ATOM 8946  C CZ  . ARG F 1 179 ? 92.808  141.030 103.510 1.00 30.00  ? 179 ARG F CZ  1 
ATOM 8947  N NH1 . ARG F 1 179 ? 92.337  140.125 102.662 1.00 30.00  ? 179 ARG F NH1 1 
ATOM 8948  N NH2 . ARG F 1 179 ? 92.244  142.229 103.574 1.00 30.00  ? 179 ARG F NH2 1 
ATOM 8949  N N   . THR F 1 180 ? 92.289  137.757 109.468 1.00 92.25  ? 180 THR F N   1 
ATOM 8950  C CA  . THR F 1 180 ? 92.533  138.274 110.804 1.00 103.08 ? 180 THR F CA  1 
ATOM 8951  C C   . THR F 1 180 ? 92.706  137.091 111.732 1.00 94.35  ? 180 THR F C   1 
ATOM 8952  O O   . THR F 1 180 ? 92.499  135.943 111.336 1.00 104.26 ? 180 THR F O   1 
ATOM 8953  C CB  . THR F 1 180 ? 91.400  139.161 111.327 1.00 30.00  ? 180 THR F CB  1 
ATOM 8954  O OG1 . THR F 1 180 ? 91.813  139.776 112.552 1.00 30.00  ? 180 THR F OG1 1 
ATOM 8955  C CG2 . THR F 1 180 ? 90.162  138.332 111.611 1.00 30.00  ? 180 THR F CG2 1 
ATOM 8956  N N   . LYS F 1 181 ? 93.078  137.374 112.971 1.00 87.17  ? 181 LYS F N   1 
ATOM 8957  C CA  . LYS F 1 181 ? 93.334  136.318 113.932 1.00 109.98 ? 181 LYS F CA  1 
ATOM 8958  C C   . LYS F 1 181 ? 92.299  136.363 115.046 1.00 103.75 ? 181 LYS F C   1 
ATOM 8959  O O   . LYS F 1 181 ? 91.928  137.438 115.524 1.00 108.59 ? 181 LYS F O   1 
ATOM 8960  C CB  . LYS F 1 181 ? 94.755  136.423 114.486 1.00 30.00  ? 181 LYS F CB  1 
ATOM 8961  C CG  . LYS F 1 181 ? 95.161  135.246 115.337 1.00 30.00  ? 181 LYS F CG  1 
ATOM 8962  C CD  . LYS F 1 181 ? 96.618  135.311 115.691 1.00 30.00  ? 181 LYS F CD  1 
ATOM 8963  C CE  . LYS F 1 181 ? 97.449  135.025 114.462 1.00 30.00  ? 181 LYS F CE  1 
ATOM 8964  N NZ  . LYS F 1 181 ? 97.221  133.631 113.999 1.00 30.00  ? 181 LYS F NZ  1 
ATOM 8965  N N   . ILE F 1 182 ? 91.816  135.183 115.414 1.00 87.71  ? 182 ILE F N   1 
ATOM 8966  C CA  . ILE F 1 182 ? 90.924  134.922 116.533 1.00 85.86  ? 182 ILE F CA  1 
ATOM 8967  C C   . ILE F 1 182 ? 91.562  133.821 117.367 1.00 85.66  ? 182 ILE F C   1 
ATOM 8968  O O   . ILE F 1 182 ? 91.677  132.670 116.932 1.00 101.40 ? 182 ILE F O   1 
ATOM 8969  C CB  . ILE F 1 182 ? 89.505  134.590 116.024 1.00 30.00  ? 182 ILE F CB  1 
ATOM 8970  C CG1 . ILE F 1 182 ? 88.651  133.791 117.021 1.00 30.00  ? 182 ILE F CG1 1 
ATOM 8971  C CG2 . ILE F 1 182 ? 89.546  134.029 114.630 1.00 30.00  ? 182 ILE F CG2 1 
ATOM 8972  C CD1 . ILE F 1 182 ? 88.263  134.472 118.243 1.00 30.00  ? 182 ILE F CD1 1 
ATOM 8973  N N   . THR F 1 183 ? 92.018  134.193 118.557 1.00 68.96  ? 183 THR F N   1 
ATOM 8974  C CA  . THR F 1 183 ? 92.841  133.361 119.418 1.00 83.69  ? 183 THR F CA  1 
ATOM 8975  C C   . THR F 1 183 ? 92.094  133.108 120.719 1.00 82.58  ? 183 THR F C   1 
ATOM 8976  O O   . THR F 1 183 ? 91.465  134.016 121.269 1.00 95.81  ? 183 THR F O   1 
ATOM 8977  C CB  . THR F 1 183 ? 94.185  134.058 119.704 1.00 30.00  ? 183 THR F CB  1 
ATOM 8978  O OG1 . THR F 1 183 ? 94.830  134.370 118.467 1.00 30.00  ? 183 THR F OG1 1 
ATOM 8979  C CG2 . THR F 1 183 ? 95.114  133.180 120.524 1.00 30.00  ? 183 THR F CG2 1 
ATOM 8980  N N   . GLY F 1 184 ? 92.148  131.882 121.211 1.00 79.97  ? 184 GLY F N   1 
ATOM 8981  C CA  . GLY F 1 184 ? 91.435  131.586 122.426 1.00 78.59  ? 184 GLY F CA  1 
ATOM 8982  C C   . GLY F 1 184 ? 91.953  130.401 123.197 1.00 88.15  ? 184 GLY F C   1 
ATOM 8983  O O   . GLY F 1 184 ? 92.888  129.723 122.776 1.00 103.22 ? 184 GLY F O   1 
ATOM 8984  N N   . LYS F 1 185 ? 91.311  130.144 124.334 1.00 86.13  ? 185 LYS F N   1 
ATOM 8985  C CA  . LYS F 1 185 ? 91.556  128.939 125.113 1.00 94.37  ? 185 LYS F CA  1 
ATOM 8986  C C   . LYS F 1 185 ? 90.280  128.568 125.853 1.00 83.41  ? 185 LYS F C   1 
ATOM 8987  O O   . LYS F 1 185 ? 89.487  129.437 126.224 1.00 95.27  ? 185 LYS F O   1 
ATOM 8988  C CB  . LYS F 1 185 ? 92.718  129.121 126.094 1.00 30.00  ? 185 LYS F CB  1 
ATOM 8989  C CG  . LYS F 1 185 ? 92.488  130.163 127.167 1.00 30.00  ? 185 LYS F CG  1 
ATOM 8990  C CD  . LYS F 1 185 ? 93.691  130.281 128.072 1.00 30.00  ? 185 LYS F CD  1 
ATOM 8991  C CE  . LYS F 1 185 ? 93.831  129.047 128.936 1.00 30.00  ? 185 LYS F CE  1 
ATOM 8992  N NZ  . LYS F 1 185 ? 94.959  129.132 129.897 1.00 30.00  ? 185 LYS F NZ  1 
ATOM 8993  N N   . VAL F 1 186 ? 90.077  127.269 126.040 1.00 72.23  ? 186 VAL F N   1 
ATOM 8994  C CA  . VAL F 1 186 ? 88.911  126.738 126.737 1.00 76.48  ? 186 VAL F CA  1 
ATOM 8995  C C   . VAL F 1 186 ? 89.416  126.063 128.002 1.00 91.96  ? 186 VAL F C   1 
ATOM 8996  O O   . VAL F 1 186 ? 90.057  125.009 127.931 1.00 98.46  ? 186 VAL F O   1 
ATOM 8997  C CB  . VAL F 1 186 ? 88.122  125.754 125.864 1.00 30.00  ? 186 VAL F CB  1 
ATOM 8998  C CG1 . VAL F 1 186 ? 86.956  125.184 126.634 1.00 30.00  ? 186 VAL F CG1 1 
ATOM 8999  C CG2 . VAL F 1 186 ? 87.641  126.436 124.608 1.00 30.00  ? 186 VAL F CG2 1 
ATOM 9000  N N   . ILE F 1 187 ? 89.141  126.651 129.156 1.00 77.25  ? 187 ILE F N   1 
ATOM 9001  C CA  . ILE F 1 187 ? 89.661  126.159 130.429 1.00 61.12  ? 187 ILE F CA  1 
ATOM 9002  C C   . ILE F 1 187 ? 88.529  125.518 131.224 1.00 80.93  ? 187 ILE F C   1 
ATOM 9003  O O   . ILE F 1 187 ? 87.417  126.061 131.247 1.00 97.89  ? 187 ILE F O   1 
ATOM 9004  C CB  . ILE F 1 187 ? 90.363  127.269 131.236 1.00 30.00  ? 187 ILE F CB  1 
ATOM 9005  C CG1 . ILE F 1 187 ? 90.952  126.696 132.530 1.00 30.00  ? 187 ILE F CG1 1 
ATOM 9006  C CG2 . ILE F 1 187 ? 89.471  128.493 131.452 1.00 30.00  ? 187 ILE F CG2 1 
ATOM 9007  C CD1 . ILE F 1 187 ? 91.989  127.576 133.188 1.00 30.00  ? 187 ILE F CD1 1 
ATOM 9008  N N   . PRO F 1 188 ? 88.739  124.349 131.805 1.00 79.27  ? 188 PRO F N   1 
ATOM 9009  C CA  . PRO F 1 188 ? 87.728  123.757 132.684 1.00 92.71  ? 188 PRO F CA  1 
ATOM 9010  C C   . PRO F 1 188 ? 87.763  124.344 134.081 1.00 106.31 ? 188 PRO F C   1 
ATOM 9011  O O   . PRO F 1 188 ? 88.458  125.330 134.343 1.00 120.75 ? 188 PRO F O   1 
ATOM 9012  C CB  . PRO F 1 188 ? 88.114  122.275 132.717 1.00 30.00  ? 188 PRO F CB  1 
ATOM 9013  C CG  . PRO F 1 188 ? 88.979  122.072 131.538 1.00 30.00  ? 188 PRO F CG  1 
ATOM 9014  C CD  . PRO F 1 188 ? 89.728  123.353 131.377 1.00 30.00  ? 188 PRO F CD  1 
ATOM 9015  N N   . GLU F 1 189 ? 86.989  123.727 134.975 1.00 104.74 ? 189 GLU F N   1 
ATOM 9016  C CA  . GLU F 1 189 ? 87.028  124.059 136.395 1.00 101.76 ? 189 GLU F CA  1 
ATOM 9017  C C   . GLU F 1 189 ? 88.410  123.809 136.980 1.00 111.14 ? 189 GLU F C   1 
ATOM 9018  O O   . GLU F 1 189 ? 89.096  124.737 137.422 1.00 104.62 ? 189 GLU F O   1 
ATOM 9019  C CB  . GLU F 1 189 ? 85.973  123.227 137.126 1.00 30.00  ? 189 GLU F CB  1 
ATOM 9020  C CG  . GLU F 1 189 ? 85.890  123.436 138.620 1.00 30.00  ? 189 GLU F CG  1 
ATOM 9021  C CD  . GLU F 1 189 ? 84.823  122.568 139.252 1.00 30.00  ? 189 GLU F CD  1 
ATOM 9022  O OE1 . GLU F 1 189 ? 84.178  121.799 138.513 1.00 30.00  ? 189 GLU F OE1 1 
ATOM 9023  O OE2 . GLU F 1 189 ? 84.630  122.650 140.481 1.00 30.00  ? 189 GLU F OE2 1 
ATOM 9024  N N   . PHE F 1 190 ? 88.838  122.553 136.975 1.00 129.13 ? 190 PHE F N   1 
ATOM 9025  C CA  . PHE F 1 190 ? 90.146  122.167 137.470 1.00 141.21 ? 190 PHE F CA  1 
ATOM 9026  C C   . PHE F 1 190 ? 90.996  121.469 136.419 1.00 124.26 ? 190 PHE F C   1 
ATOM 9027  O O   . PHE F 1 190 ? 92.120  121.064 136.727 1.00 113.63 ? 190 PHE F O   1 
ATOM 9028  C CB  . PHE F 1 190 ? 90.006  121.267 138.714 1.00 30.00  ? 190 PHE F CB  1 
ATOM 9029  C CG  . PHE F 1 190 ? 89.080  120.085 138.523 1.00 30.00  ? 190 PHE F CG  1 
ATOM 9030  C CD1 . PHE F 1 190 ? 89.534  118.896 137.966 1.00 30.00  ? 190 PHE F CD1 1 
ATOM 9031  C CD2 . PHE F 1 190 ? 87.747  120.168 138.904 1.00 30.00  ? 190 PHE F CD2 1 
ATOM 9032  C CE1 . PHE F 1 190 ? 88.679  117.819 137.788 1.00 30.00  ? 190 PHE F CE1 1 
ATOM 9033  C CE2 . PHE F 1 190 ? 86.888  119.091 138.733 1.00 30.00  ? 190 PHE F CE2 1 
ATOM 9034  C CZ  . PHE F 1 190 ? 87.356  117.917 138.176 1.00 30.00  ? 190 PHE F CZ  1 
ATOM 9035  N N   . GLY F 1 191 ? 90.500  121.324 135.196 1.00 111.32 ? 191 GLY F N   1 
ATOM 9036  C CA  . GLY F 1 191 ? 91.156  120.515 134.195 1.00 115.22 ? 191 GLY F CA  1 
ATOM 9037  C C   . GLY F 1 191 ? 92.340  121.196 133.539 1.00 110.01 ? 191 GLY F C   1 
ATOM 9038  O O   . GLY F 1 191 ? 92.891  122.186 134.021 1.00 109.59 ? 191 GLY F O   1 
ATOM 9039  N N   . ALA F 1 192 ? 92.735  120.634 132.420 1.00 108.77 ? 192 ALA F N   1 
ATOM 9040  C CA  . ALA F 1 192 ? 93.804  121.224 131.632 1.00 106.70 ? 192 ALA F CA  1 
ATOM 9041  C C   . ALA F 1 192 ? 93.207  122.001 130.472 1.00 76.53  ? 192 ALA F C   1 
ATOM 9042  O O   . ALA F 1 192 ? 92.276  121.512 129.827 1.00 78.88  ? 192 ALA F O   1 
ATOM 9043  C CB  . ALA F 1 192 ? 94.744  120.153 131.103 1.00 30.00  ? 192 ALA F CB  1 
ATOM 9044  N N   . PRO F 1 193 ? 93.695  123.203 130.183 1.00 77.98  ? 193 PRO F N   1 
ATOM 9045  C CA  . PRO F 1 193 ? 93.057  124.027 129.152 1.00 87.61  ? 193 PRO F CA  1 
ATOM 9046  C C   . PRO F 1 193 ? 93.432  123.568 127.752 1.00 84.24  ? 193 PRO F C   1 
ATOM 9047  O O   . PRO F 1 193 ? 94.585  123.234 127.478 1.00 100.83 ? 193 PRO F O   1 
ATOM 9048  C CB  . PRO F 1 193 ? 93.597  125.429 129.439 1.00 30.00  ? 193 PRO F CB  1 
ATOM 9049  C CG  . PRO F 1 193 ? 94.900  125.194 130.089 1.00 30.00  ? 193 PRO F CG  1 
ATOM 9050  C CD  . PRO F 1 193 ? 94.751  123.937 130.896 1.00 30.00  ? 193 PRO F CD  1 
ATOM 9051  N N   . GLY F 1 194 ? 92.442  123.553 126.866 1.00 86.21  ? 194 GLY F N   1 
ATOM 9052  C CA  . GLY F 1 194 ? 92.688  123.328 125.456 1.00 97.13  ? 194 GLY F CA  1 
ATOM 9053  C C   . GLY F 1 194 ? 92.663  124.646 124.704 1.00 91.83  ? 194 GLY F C   1 
ATOM 9054  O O   . GLY F 1 194 ? 91.822  125.505 124.956 1.00 103.47 ? 194 GLY F O   1 
ATOM 9055  N N   . VAL F 1 195 ? 93.590  124.791 123.781 1.00 73.79  ? 195 VAL F N   1 
ATOM 9056  C CA  . VAL F 1 195 ? 93.827  126.080 123.163 1.00 78.62  ? 195 VAL F CA  1 
ATOM 9057  C C   . VAL F 1 195 ? 93.201  126.072 121.774 1.00 87.46  ? 195 VAL F C   1 
ATOM 9058  O O   . VAL F 1 195 ? 92.889  125.021 121.213 1.00 109.43 ? 195 VAL F O   1 
ATOM 9059  C CB  . VAL F 1 195 ? 95.340  126.382 123.120 1.00 30.00  ? 195 VAL F CB  1 
ATOM 9060  C CG1 . VAL F 1 195 ? 96.007  125.639 121.985 1.00 30.00  ? 195 VAL F CG1 1 
ATOM 9061  C CG2 . VAL F 1 195 ? 95.637  127.878 123.113 1.00 30.00  ? 195 VAL F CG2 1 
ATOM 9062  N N   . ILE F 1 196 ? 92.979  127.262 121.226 1.00 80.94  ? 196 ILE F N   1 
ATOM 9063  C CA  . ILE F 1 196 ? 92.370  127.395 119.910 1.00 81.29  ? 196 ILE F CA  1 
ATOM 9064  C C   . ILE F 1 196 ? 92.867  128.664 119.224 1.00 89.24  ? 196 ILE F C   1 
ATOM 9065  O O   . ILE F 1 196 ? 92.818  129.762 119.792 1.00 98.54  ? 196 ILE F O   1 
ATOM 9066  C CB  . ILE F 1 196 ? 90.830  127.339 120.021 1.00 30.00  ? 196 ILE F CB  1 
ATOM 9067  C CG1 . ILE F 1 196 ? 90.155  127.551 118.674 1.00 30.00  ? 196 ILE F CG1 1 
ATOM 9068  C CG2 . ILE F 1 196 ? 90.269  128.261 121.089 1.00 30.00  ? 196 ILE F CG2 1 
ATOM 9069  C CD1 . ILE F 1 196 ? 88.694  127.273 118.747 1.00 30.00  ? 196 ILE F CD1 1 
ATOM 9070  N N   . GLU F 1 197 ? 93.383  128.514 118.007 1.00 100.52 ? 197 GLU F N   1 
ATOM 9071  C CA  . GLU F 1 197 ? 93.932  129.632 117.245 1.00 92.70  ? 197 GLU F CA  1 
ATOM 9072  C C   . GLU F 1 197 ? 93.592  129.436 115.779 1.00 91.79  ? 197 GLU F C   1 
ATOM 9073  O O   . GLU F 1 197 ? 94.140  128.544 115.127 1.00 115.82 ? 197 GLU F O   1 
ATOM 9074  C CB  . GLU F 1 197 ? 95.442  129.742 117.416 1.00 30.00  ? 197 GLU F CB  1 
ATOM 9075  C CG  . GLU F 1 197 ? 96.050  130.870 116.606 1.00 30.00  ? 197 GLU F CG  1 
ATOM 9076  C CD  . GLU F 1 197 ? 97.556  130.944 116.738 1.00 30.00  ? 197 GLU F CD  1 
ATOM 9077  O OE1 . GLU F 1 197 ? 98.137  130.090 117.437 1.00 30.00  ? 197 GLU F OE1 1 
ATOM 9078  O OE2 . GLU F 1 197 ? 98.161  131.859 116.138 1.00 30.00  ? 197 GLU F OE2 1 
ATOM 9079  N N   . PHE F 1 198 ? 92.734  130.291 115.251 1.00 80.89  ? 198 PHE F N   1 
ATOM 9080  C CA  . PHE F 1 198 ? 92.316  130.207 113.865 1.00 87.10  ? 198 PHE F CA  1 
ATOM 9081  C C   . PHE F 1 198 ? 93.291  130.944 112.969 1.00 99.66  ? 198 PHE F C   1 
ATOM 9082  O O   . PHE F 1 198 ? 94.287  131.503 113.433 1.00 107.35 ? 198 PHE F O   1 
ATOM 9083  C CB  . PHE F 1 198 ? 90.952  130.839 113.668 1.00 30.00  ? 198 PHE F CB  1 
ATOM 9084  C CG  . PHE F 1 198 ? 89.860  130.189 114.425 1.00 30.00  ? 198 PHE F CG  1 
ATOM 9085  C CD1 . PHE F 1 198 ? 89.169  129.131 113.889 1.00 30.00  ? 198 PHE F CD1 1 
ATOM 9086  C CD2 . PHE F 1 198 ? 89.516  130.643 115.675 1.00 30.00  ? 198 PHE F CD2 1 
ATOM 9087  C CE1 . PHE F 1 198 ? 88.143  128.548 114.574 1.00 30.00  ? 198 PHE F CE1 1 
ATOM 9088  C CE2 . PHE F 1 198 ? 88.495  130.067 116.373 1.00 30.00  ? 198 PHE F CE2 1 
ATOM 9089  C CZ  . PHE F 1 198 ? 87.809  129.023 115.817 1.00 30.00  ? 198 PHE F CZ  1 
ATOM 9090  N N   . THR F 1 199 ? 92.987  130.941 111.673 1.00 95.30  ? 199 THR F N   1 
ATOM 9091  C CA  . THR F 1 199 ? 93.545  131.931 110.765 1.00 87.27  ? 199 THR F CA  1 
ATOM 9092  C C   . THR F 1 199 ? 92.444  132.672 110.020 1.00 91.37  ? 199 THR F C   1 
ATOM 9093  O O   . THR F 1 199 ? 92.694  133.766 109.502 1.00 118.25 ? 199 THR F O   1 
ATOM 9094  C CB  . THR F 1 199 ? 94.492  131.280 109.754 1.00 30.00  ? 199 THR F CB  1 
ATOM 9095  O OG1 . THR F 1 199 ? 93.766  130.341 108.955 1.00 30.00  ? 199 THR F OG1 1 
ATOM 9096  C CG2 . THR F 1 199 ? 95.632  130.563 110.451 1.00 30.00  ? 199 THR F CG2 1 
ATOM 9097  N N   . THR F 1 200 ? 91.219  132.098 109.988 1.00 66.50  ? 200 THR F N   1 
ATOM 9098  C CA  . THR F 1 200 ? 90.060  132.519 109.199 1.00 93.24  ? 200 THR F CA  1 
ATOM 9099  C C   . THR F 1 200 ? 90.481  132.639 107.740 1.00 108.13 ? 200 THR F C   1 
ATOM 9100  O O   . THR F 1 200 ? 90.840  133.740 107.300 1.00 112.01 ? 200 THR F O   1 
ATOM 9101  C CB  . THR F 1 200 ? 89.452  133.823 109.715 1.00 30.00  ? 200 THR F CB  1 
ATOM 9102  O OG1 . THR F 1 200 ? 89.193  133.692 111.114 1.00 30.00  ? 200 THR F OG1 1 
ATOM 9103  C CG2 . THR F 1 200 ? 88.122  134.089 109.027 1.00 30.00  ? 200 THR F CG2 1 
ATOM 9104  N N   . PRO F 1 201 ? 90.544  131.513 107.013 1.00 98.08  ? 201 PRO F N   1 
ATOM 9105  C CA  . PRO F 1 201 ? 91.241  131.461 105.717 1.00 101.37 ? 201 PRO F CA  1 
ATOM 9106  C C   . PRO F 1 201 ? 90.707  132.453 104.696 1.00 96.67  ? 201 PRO F C   1 
ATOM 9107  O O   . PRO F 1 201 ? 89.504  132.542 104.456 1.00 97.22  ? 201 PRO F O   1 
ATOM 9108  C CB  . PRO F 1 201 ? 91.012  130.018 105.259 1.00 30.00  ? 201 PRO F CB  1 
ATOM 9109  C CG  . PRO F 1 201 ? 89.772  129.601 105.947 1.00 30.00  ? 201 PRO F CG  1 
ATOM 9110  C CD  . PRO F 1 201 ? 89.791  130.279 107.281 1.00 30.00  ? 201 PRO F CD  1 
ATOM 9111  N N   . SER F 1 202 ? 91.636  133.195 104.101 1.00 84.53  ? 202 SER F N   1 
ATOM 9112  C CA  . SER F 1 202 ? 91.345  134.527 103.592 1.00 96.04  ? 202 SER F CA  1 
ATOM 9113  C C   . SER F 1 202 ? 90.511  134.492 102.322 1.00 107.48 ? 202 SER F C   1 
ATOM 9114  O O   . SER F 1 202 ? 90.752  133.684 101.422 1.00 120.32 ? 202 SER F O   1 
ATOM 9115  C CB  . SER F 1 202 ? 92.643  135.281 103.329 1.00 30.00  ? 202 SER F CB  1 
ATOM 9116  O OG  . SER F 1 202 ? 93.361  134.670 102.276 1.00 30.00  ? 202 SER F OG  1 
ATOM 9117  N N   . THR F 1 203 ? 89.514  135.383 102.287 1.00 102.41 ? 203 THR F N   1 
ATOM 9118  C CA  . THR F 1 203 ? 88.688  135.721 101.127 1.00 89.41  ? 203 THR F CA  1 
ATOM 9119  C C   . THR F 1 203 ? 87.960  134.476 100.611 1.00 95.49  ? 203 THR F C   1 
ATOM 9120  O O   . THR F 1 203 ? 88.210  133.958 99.525  1.00 116.57 ? 203 THR F O   1 
ATOM 9121  C CB  . THR F 1 203 ? 89.543  136.396 100.053 1.00 30.00  ? 203 THR F CB  1 
ATOM 9122  O OG1 . THR F 1 203 ? 90.400  137.348 100.693 1.00 30.00  ? 203 THR F OG1 1 
ATOM 9123  C CG2 . THR F 1 203 ? 88.660  137.178 99.121  1.00 30.00  ? 203 THR F CG2 1 
ATOM 9124  N N   . TYR F 1 204 ? 87.065  134.001 101.464 1.00 87.34  ? 204 TYR F N   1 
ATOM 9125  C CA  . TYR F 1 204 ? 86.618  132.620 101.489 1.00 85.33  ? 204 TYR F CA  1 
ATOM 9126  C C   . TYR F 1 204 ? 85.238  132.435 100.877 1.00 90.64  ? 204 TYR F C   1 
ATOM 9127  O O   . TYR F 1 204 ? 84.585  133.378 100.429 1.00 110.75 ? 204 TYR F O   1 
ATOM 9128  C CB  . TYR F 1 204 ? 86.624  132.103 102.929 1.00 30.00  ? 204 TYR F CB  1 
ATOM 9129  C CG  . TYR F 1 204 ? 85.913  133.003 103.929 1.00 30.00  ? 204 TYR F CG  1 
ATOM 9130  C CD1 . TYR F 1 204 ? 84.547  132.915 104.134 1.00 30.00  ? 204 TYR F CD1 1 
ATOM 9131  C CD2 . TYR F 1 204 ? 86.619  133.943 104.671 1.00 30.00  ? 204 TYR F CD2 1 
ATOM 9132  C CE1 . TYR F 1 204 ? 83.913  133.726 105.046 1.00 30.00  ? 204 TYR F CE1 1 
ATOM 9133  C CE2 . TYR F 1 204 ? 85.987  134.752 105.583 1.00 30.00  ? 204 TYR F CE2 1 
ATOM 9134  C CZ  . TYR F 1 204 ? 84.640  134.644 105.762 1.00 30.00  ? 204 TYR F CZ  1 
ATOM 9135  O OH  . TYR F 1 204 ? 84.019  135.466 106.665 1.00 30.00  ? 204 TYR F OH  1 
ATOM 9136  N N   . THR F 1 205 ? 84.816  131.175 100.870 1.00 82.57  ? 205 THR F N   1 
ATOM 9137  C CA  . THR F 1 205 ? 83.483  130.728 100.502 1.00 83.12  ? 205 THR F CA  1 
ATOM 9138  C C   . THR F 1 205 ? 82.771  130.214 101.754 1.00 89.17  ? 205 THR F C   1 
ATOM 9139  O O   . THR F 1 205 ? 83.308  130.275 102.860 1.00 113.02 ? 205 THR F O   1 
ATOM 9140  C CB  . THR F 1 205 ? 83.570  129.661 99.414  1.00 30.00  ? 205 THR F CB  1 
ATOM 9141  O OG1 . THR F 1 205 ? 84.310  128.542 99.912  1.00 30.00  ? 205 THR F OG1 1 
ATOM 9142  C CG2 . THR F 1 205 ? 84.283  130.222 98.193  1.00 30.00  ? 205 THR F CG2 1 
ATOM 9143  N N   . SER F 1 206 ? 81.557  129.690 101.577 1.00 77.54  ? 206 SER F N   1 
ATOM 9144  C CA  . SER F 1 206 ? 80.701  129.405 102.722 1.00 75.49  ? 206 SER F CA  1 
ATOM 9145  C C   . SER F 1 206 ? 81.142  128.146 103.462 1.00 85.95  ? 206 SER F C   1 
ATOM 9146  O O   . SER F 1 206 ? 81.764  127.246 102.889 1.00 96.77  ? 206 SER F O   1 
ATOM 9147  C CB  . SER F 1 206 ? 79.245  129.261 102.291 1.00 30.00  ? 206 SER F CB  1 
ATOM 9148  O OG  . SER F 1 206 ? 78.750  130.473 101.760 1.00 30.00  ? 206 SER F OG  1 
ATOM 9149  N N   . GLU F 1 207 ? 80.799  128.103 104.759 1.00 92.70  ? 207 GLU F N   1 
ATOM 9150  C CA  . GLU F 1 207 ? 81.113  127.008 105.689 1.00 84.94  ? 207 GLU F CA  1 
ATOM 9151  C C   . GLU F 1 207 ? 82.629  126.787 105.773 1.00 75.08  ? 207 GLU F C   1 
ATOM 9152  O O   . GLU F 1 207 ? 83.214  125.932 105.114 1.00 99.39  ? 207 GLU F O   1 
ATOM 9153  C CB  . GLU F 1 207 ? 80.348  125.726 105.348 1.00 30.00  ? 207 GLU F CB  1 
ATOM 9154  C CG  . GLU F 1 207 ? 80.282  124.770 106.517 1.00 30.00  ? 207 GLU F CG  1 
ATOM 9155  C CD  . GLU F 1 207 ? 81.466  123.845 106.599 1.00 30.00  ? 207 GLU F CD  1 
ATOM 9156  O OE1 . GLU F 1 207 ? 81.979  123.432 105.540 1.00 30.00  ? 207 GLU F OE1 1 
ATOM 9157  O OE2 . GLU F 1 207 ? 81.906  123.556 107.725 1.00 30.00  ? 207 GLU F OE2 1 
ATOM 9158  N N   . VAL F 1 208 ? 83.257  127.645 106.567 1.00 54.53  ? 208 VAL F N   1 
ATOM 9159  C CA  . VAL F 1 208 ? 84.642  128.060 106.395 1.00 74.84  ? 208 VAL F CA  1 
ATOM 9160  C C   . VAL F 1 208 ? 85.555  127.219 107.292 1.00 90.59  ? 208 VAL F C   1 
ATOM 9161  O O   . VAL F 1 208 ? 86.510  127.741 107.870 1.00 111.15 ? 208 VAL F O   1 
ATOM 9162  C CB  . VAL F 1 208 ? 84.762  129.567 106.693 1.00 30.00  ? 208 VAL F CB  1 
ATOM 9163  C CG1 . VAL F 1 208 ? 85.975  130.195 106.017 1.00 30.00  ? 208 VAL F CG1 1 
ATOM 9164  C CG2 . VAL F 1 208 ? 83.495  130.284 106.316 1.00 30.00  ? 208 VAL F CG2 1 
ATOM 9165  N N   . ILE F 1 209 ? 85.214  125.932 107.473 1.00 82.05  ? 209 ILE F N   1 
ATOM 9166  C CA  . ILE F 1 209 ? 85.856  124.958 108.373 1.00 100.57 ? 209 ILE F CA  1 
ATOM 9167  C C   . ILE F 1 209 ? 87.382  124.997 108.386 1.00 110.18 ? 209 ILE F C   1 
ATOM 9168  O O   . ILE F 1 209 ? 88.036  124.937 107.340 1.00 121.76 ? 209 ILE F O   1 
ATOM 9169  C CB  . ILE F 1 209 ? 85.373  123.525 108.038 1.00 30.00  ? 209 ILE F CB  1 
ATOM 9170  C CG1 . ILE F 1 209 ? 86.105  122.481 108.894 1.00 30.00  ? 209 ILE F CG1 1 
ATOM 9171  C CG2 . ILE F 1 209 ? 85.451  123.215 106.537 1.00 30.00  ? 209 ILE F CG2 1 
ATOM 9172  C CD1 . ILE F 1 209 ? 85.557  121.083 108.770 1.00 30.00  ? 209 ILE F CD1 1 
ATOM 9173  N N   . GLU F 1 210 ? 87.955  125.130 109.581 1.00 30.00  ? 210 GLU F N   1 
ATOM 9174  C CA  . GLU F 1 210 ? 89.392  125.277 109.732 1.00 30.00  ? 210 GLU F CA  1 
ATOM 9175  C C   . GLU F 1 210 ? 89.779  124.749 111.104 1.00 30.00  ? 210 GLU F C   1 
ATOM 9176  O O   . GLU F 1 210 ? 89.088  124.984 112.098 1.00 30.00  ? 210 GLU F O   1 
ATOM 9177  C CB  . GLU F 1 210 ? 89.798  126.745 109.519 1.00 30.00  ? 210 GLU F CB  1 
ATOM 9178  C CG  . GLU F 1 210 ? 89.496  127.767 110.620 1.00 30.00  ? 210 GLU F CG  1 
ATOM 9179  C CD  . GLU F 1 210 ? 88.021  128.151 110.784 1.00 30.00  ? 210 GLU F CD  1 
ATOM 9180  O OE1 . GLU F 1 210 ? 87.118  127.327 110.563 1.00 30.00  ? 210 GLU F OE1 1 
ATOM 9181  O OE2 . GLU F 1 210 ? 87.760  129.322 111.106 1.00 30.00  ? 210 GLU F OE2 1 
ATOM 9182  N N   . LEU F 1 211 ? 90.867  123.998 111.142 1.00 30.00  ? 211 LEU F N   1 
ATOM 9183  C CA  . LEU F 1 211 ? 91.178  123.177 112.299 1.00 30.00  ? 211 LEU F CA  1 
ATOM 9184  C C   . LEU F 1 211 ? 91.724  124.017 113.444 1.00 30.00  ? 211 LEU F C   1 
ATOM 9185  O O   . LEU F 1 211 ? 92.379  125.042 113.235 1.00 30.00  ? 211 LEU F O   1 
ATOM 9186  C CB  . LEU F 1 211 ? 92.182  122.084 111.925 1.00 30.00  ? 211 LEU F CB  1 
ATOM 9187  C CG  . LEU F 1 211 ? 91.696  121.032 110.924 1.00 30.00  ? 211 LEU F CG  1 
ATOM 9188  C CD1 . LEU F 1 211 ? 92.833  120.101 110.532 1.00 30.00  ? 211 LEU F CD1 1 
ATOM 9189  C CD2 . LEU F 1 211 ? 90.525  120.247 111.493 1.00 30.00  ? 211 LEU F CD2 1 
ATOM 9190  N N   . GLN F 1 212 ? 91.426  123.553 114.656 1.00 30.00  ? 212 GLN F N   1 
ATOM 9191  C CA  . GLN F 1 212 ? 91.847  124.116 115.939 1.00 30.00  ? 212 GLN F CA  1 
ATOM 9192  C C   . GLN F 1 212 ? 91.504  125.592 116.094 1.00 30.00  ? 212 GLN F C   1 
ATOM 9193  O O   . GLN F 1 212 ? 92.296  126.465 115.752 1.00 30.00  ? 212 GLN F O   1 
ATOM 9194  C CB  . GLN F 1 212 ? 93.345  123.899 116.152 1.00 30.00  ? 212 GLN F CB  1 
ATOM 9195  C CG  . GLN F 1 212 ? 93.793  124.205 117.565 1.00 30.00  ? 212 GLN F CG  1 
ATOM 9196  C CD  . GLN F 1 212 ? 95.246  123.882 117.795 1.00 30.00  ? 212 GLN F CD  1 
ATOM 9197  O OE1 . GLN F 1 212 ? 95.964  123.511 116.874 1.00 30.00  ? 212 GLN F OE1 1 
ATOM 9198  N NE2 . GLN F 1 212 ? 95.684  124.003 119.037 1.00 30.00  ? 212 GLN F NE2 1 
ATOM 9199  N N   . ALA G 1 6   ? 116.685 112.194 176.475 1.00 30.00  ? 6   ALA G N   1 
ATOM 9200  C CA  . ALA G 1 6   ? 115.867 113.271 175.938 1.00 30.00  ? 6   ALA G CA  1 
ATOM 9201  C C   . ALA G 1 6   ? 115.818 113.190 174.418 1.00 30.00  ? 6   ALA G C   1 
ATOM 9202  O O   . ALA G 1 6   ? 116.756 112.712 173.785 1.00 30.00  ? 6   ALA G O   1 
ATOM 9203  C CB  . ALA G 1 6   ? 116.398 114.611 176.386 1.00 30.00  ? 6   ALA G CB  1 
ATOM 9204  N N   . VAL G 1 7   ? 114.755 113.701 173.806 1.00 176.07 ? 7   VAL G N   1 
ATOM 9205  C CA  . VAL G 1 7   ? 114.572 113.621 172.340 1.00 158.44 ? 7   VAL G CA  1 
ATOM 9206  C C   . VAL G 1 7   ? 115.549 114.321 171.371 1.00 137.52 ? 7   VAL G C   1 
ATOM 9207  O O   . VAL G 1 7   ? 115.836 113.796 170.285 1.00 139.74 ? 7   VAL G O   1 
ATOM 9208  C CB  . VAL G 1 7   ? 113.119 113.910 171.912 1.00 30.00  ? 7   VAL G CB  1 
ATOM 9209  C CG1 . VAL G 1 7   ? 112.944 113.579 170.437 1.00 30.00  ? 7   VAL G CG1 1 
ATOM 9210  C CG2 . VAL G 1 7   ? 112.154 113.081 172.747 1.00 30.00  ? 7   VAL G CG2 1 
ATOM 9211  N N   . GLY G 1 8   ? 116.069 115.484 171.745 1.00 131.64 ? 8   GLY G N   1 
ATOM 9212  C CA  . GLY G 1 8   ? 116.929 116.229 170.837 1.00 139.85 ? 8   GLY G CA  1 
ATOM 9213  C C   . GLY G 1 8   ? 118.160 115.473 170.373 1.00 132.89 ? 8   GLY G C   1 
ATOM 9214  O O   . GLY G 1 8   ? 118.544 115.524 169.190 1.00 133.27 ? 8   GLY G O   1 
ATOM 9215  N N   . ILE G 1 9   ? 118.771 114.729 171.283 1.00 131.26 ? 9   ILE G N   1 
ATOM 9216  C CA  . ILE G 1 9   ? 119.942 113.958 170.917 1.00 135.93 ? 9   ILE G CA  1 
ATOM 9217  C C   . ILE G 1 9   ? 119.568 112.938 169.846 1.00 126.64 ? 9   ILE G C   1 
ATOM 9218  O O   . ILE G 1 9   ? 120.257 112.813 168.834 1.00 121.41 ? 9   ILE G O   1 
ATOM 9219  C CB  . ILE G 1 9   ? 120.511 113.214 172.133 1.00 30.00  ? 9   ILE G CB  1 
ATOM 9220  C CG1 . ILE G 1 9   ? 121.091 114.209 173.139 1.00 30.00  ? 9   ILE G CG1 1 
ATOM 9221  C CG2 . ILE G 1 9   ? 121.568 112.212 171.697 1.00 30.00  ? 9   ILE G CG2 1 
ATOM 9222  C CD1 . ILE G 1 9   ? 120.103 115.254 173.606 1.00 30.00  ? 9   ILE G CD1 1 
ATOM 9223  N N   . GLY G 1 10  ? 118.432 112.268 170.026 1.00 116.23 ? 10  GLY G N   1 
ATOM 9224  C CA  . GLY G 1 10  ? 117.979 111.283 169.066 1.00 108.48 ? 10  GLY G CA  1 
ATOM 9225  C C   . GLY G 1 10  ? 117.731 111.922 167.714 1.00 119.42 ? 10  GLY G C   1 
ATOM 9226  O O   . GLY G 1 10  ? 118.089 111.356 166.684 1.00 124.33 ? 10  GLY G O   1 
ATOM 9227  N N   . THR G 1 11  ? 117.131 113.109 167.710 1.00 133.79 ? 11  THR G N   1 
ATOM 9228  C CA  . THR G 1 11  ? 116.867 113.802 166.451 1.00 134.97 ? 11  THR G CA  1 
ATOM 9229  C C   . THR G 1 11  ? 118.135 114.173 165.693 1.00 126.74 ? 11  THR G C   1 
ATOM 9230  O O   . THR G 1 11  ? 118.174 114.080 164.470 1.00 132.88 ? 11  THR G O   1 
ATOM 9231  C CB  . THR G 1 11  ? 116.048 115.082 166.656 1.00 30.00  ? 11  THR G CB  1 
ATOM 9232  O OG1 . THR G 1 11  ? 116.829 116.032 167.387 1.00 30.00  ? 11  THR G OG1 1 
ATOM 9233  C CG2 . THR G 1 11  ? 114.766 114.780 167.414 1.00 30.00  ? 11  THR G CG2 1 
ATOM 9234  N N   . LEU G 1 12  ? 119.162 114.615 166.415 1.00 118.09 ? 12  LEU G N   1 
ATOM 9235  C CA  . LEU G 1 12  ? 120.426 115.016 165.775 1.00 128.80 ? 12  LEU G CA  1 
ATOM 9236  C C   . LEU G 1 12  ? 121.192 113.910 165.039 1.00 127.81 ? 12  LEU G C   1 
ATOM 9237  O O   . LEU G 1 12  ? 121.784 114.121 163.982 1.00 112.49 ? 12  LEU G O   1 
ATOM 9238  C CB  . LEU G 1 12  ? 121.368 115.614 166.822 1.00 30.00  ? 12  LEU G CB  1 
ATOM 9239  C CG  . LEU G 1 12  ? 121.334 117.114 167.095 1.00 30.00  ? 12  LEU G CG  1 
ATOM 9240  C CD1 . LEU G 1 12  ? 122.129 117.413 168.355 1.00 30.00  ? 12  LEU G CD1 1 
ATOM 9241  C CD2 . LEU G 1 12  ? 121.908 117.872 165.910 1.00 30.00  ? 12  LEU G CD2 1 
ATOM 9242  N N   . ILE G 1 13  ? 121.171 112.739 165.650 1.00 134.37 ? 13  ILE G N   1 
ATOM 9243  C CA  . ILE G 1 13  ? 121.894 111.540 165.254 1.00 120.65 ? 13  ILE G CA  1 
ATOM 9244  C C   . ILE G 1 13  ? 121.295 110.951 163.980 1.00 125.25 ? 13  ILE G C   1 
ATOM 9245  O O   . ILE G 1 13  ? 122.022 110.465 163.104 1.00 127.06 ? 13  ILE G O   1 
ATOM 9246  C CB  . ILE G 1 13  ? 121.908 110.544 166.425 1.00 30.00  ? 13  ILE G CB  1 
ATOM 9247  C CG1 . ILE G 1 13  ? 122.591 111.199 167.622 1.00 30.00  ? 13  ILE G CG1 1 
ATOM 9248  C CG2 . ILE G 1 13  ? 122.660 109.286 166.065 1.00 30.00  ? 13  ILE G CG2 1 
ATOM 9249  C CD1 . ILE G 1 13  ? 122.518 110.398 168.880 1.00 30.00  ? 13  ILE G CD1 1 
ATOM 9250  N N   . VAL G 1 14  ? 119.968 111.016 163.838 1.00 120.61 ? 14  VAL G N   1 
ATOM 9251  C CA  . VAL G 1 14  ? 119.338 110.685 162.562 1.00 119.27 ? 14  VAL G CA  1 
ATOM 9252  C C   . VAL G 1 14  ? 119.711 111.719 161.503 1.00 125.86 ? 14  VAL G C   1 
ATOM 9253  O O   . VAL G 1 14  ? 119.903 111.378 160.327 1.00 127.57 ? 14  VAL G O   1 
ATOM 9254  C CB  . VAL G 1 14  ? 117.815 110.569 162.755 1.00 30.00  ? 14  VAL G CB  1 
ATOM 9255  C CG1 . VAL G 1 14  ? 117.102 110.288 161.442 1.00 30.00  ? 14  VAL G CG1 1 
ATOM 9256  C CG2 . VAL G 1 14  ? 117.509 109.482 163.766 1.00 30.00  ? 14  VAL G CG2 1 
ATOM 9257  N N   . PHE G 1 15  ? 119.859 112.986 161.908 1.00 120.93 ? 15  PHE G N   1 
ATOM 9258  C CA  . PHE G 1 15  ? 120.378 114.018 161.011 1.00 130.25 ? 15  PHE G CA  1 
ATOM 9259  C C   . PHE G 1 15  ? 121.807 113.726 160.574 1.00 137.12 ? 15  PHE G C   1 
ATOM 9260  O O   . PHE G 1 15  ? 122.165 113.975 159.421 1.00 136.10 ? 15  PHE G O   1 
ATOM 9261  C CB  . PHE G 1 15  ? 120.295 115.387 161.679 1.00 30.00  ? 15  PHE G CB  1 
ATOM 9262  C CG  . PHE G 1 15  ? 120.988 116.466 160.921 1.00 30.00  ? 15  PHE G CG  1 
ATOM 9263  C CD1 . PHE G 1 15  ? 120.482 116.918 159.717 1.00 30.00  ? 15  PHE G CD1 1 
ATOM 9264  C CD2 . PHE G 1 15  ? 122.139 117.049 161.429 1.00 30.00  ? 15  PHE G CD2 1 
ATOM 9265  C CE1 . PHE G 1 15  ? 121.124 117.920 159.019 1.00 30.00  ? 15  PHE G CE1 1 
ATOM 9266  C CE2 . PHE G 1 15  ? 122.786 118.053 160.739 1.00 30.00  ? 15  PHE G CE2 1 
ATOM 9267  C CZ  . PHE G 1 15  ? 122.280 118.490 159.532 1.00 30.00  ? 15  PHE G CZ  1 
ATOM 9268  N N   . ILE G 1 16  ? 122.644 113.208 161.478 1.00 132.37 ? 16  ILE G N   1 
ATOM 9269  C CA  . ILE G 1 16  ? 123.954 112.724 161.051 1.00 131.31 ? 16  ILE G CA  1 
ATOM 9270  C C   . ILE G 1 16  ? 123.795 111.497 160.162 1.00 126.36 ? 16  ILE G C   1 
ATOM 9271  O O   . ILE G 1 16  ? 124.515 111.342 159.167 1.00 114.96 ? 16  ILE G O   1 
ATOM 9272  C CB  . ILE G 1 16  ? 124.854 112.452 162.274 1.00 30.00  ? 16  ILE G CB  1 
ATOM 9273  C CG1 . ILE G 1 16  ? 125.172 113.754 162.994 1.00 30.00  ? 16  ILE G CG1 1 
ATOM 9274  C CG2 . ILE G 1 16  ? 126.166 111.822 161.876 1.00 30.00  ? 16  ILE G CG2 1 
ATOM 9275  C CD1 . ILE G 1 16  ? 125.898 113.561 164.296 1.00 30.00  ? 16  ILE G CD1 1 
ATOM 9276  N N   . ALA G 1 17  ? 122.807 110.652 160.456 1.00 123.07 ? 17  ALA G N   1 
ATOM 9277  C CA  . ALA G 1 17  ? 122.622 109.423 159.693 1.00 113.60 ? 17  ALA G CA  1 
ATOM 9278  C C   . ALA G 1 17  ? 122.099 109.703 158.289 1.00 122.78 ? 17  ALA G C   1 
ATOM 9279  O O   . ALA G 1 17  ? 122.690 109.259 157.299 1.00 135.51 ? 17  ALA G O   1 
ATOM 9280  C CB  . ALA G 1 17  ? 121.673 108.488 160.437 1.00 30.00  ? 17  ALA G CB  1 
ATOM 9281  N N   . MET G 1 18  ? 120.997 110.447 158.184 1.00 110.98 ? 18  MET G N   1 
ATOM 9282  C CA  . MET G 1 18  ? 120.296 110.589 156.913 1.00 128.27 ? 18  MET G CA  1 
ATOM 9283  C C   . MET G 1 18  ? 121.072 111.422 155.899 1.00 133.84 ? 18  MET G C   1 
ATOM 9284  O O   . MET G 1 18  ? 120.974 111.159 154.695 1.00 141.63 ? 18  MET G O   1 
ATOM 9285  C CB  . MET G 1 18  ? 118.910 111.190 157.165 1.00 30.00  ? 18  MET G CB  1 
ATOM 9286  C CG  . MET G 1 18  ? 118.025 111.335 155.941 1.00 30.00  ? 18  MET G CG  1 
ATOM 9287  S SD  . MET G 1 18  ? 116.393 111.953 156.347 1.00 30.00  ? 18  MET G SD  1 
ATOM 9288  C CE  . MET G 1 18  ? 115.740 112.222 154.710 1.00 30.00  ? 18  MET G CE  1 
ATOM 9289  N N   . VAL G 1 19  ? 121.861 112.394 156.357 1.00 128.57 ? 19  VAL G N   1 
ATOM 9290  C CA  . VAL G 1 19  ? 122.657 113.205 155.441 1.00 124.82 ? 19  VAL G CA  1 
ATOM 9291  C C   . VAL G 1 19  ? 123.750 112.366 154.784 1.00 121.88 ? 19  VAL G C   1 
ATOM 9292  O O   . VAL G 1 19  ? 124.000 112.484 153.577 1.00 114.40 ? 19  VAL G O   1 
ATOM 9293  C CB  . VAL G 1 19  ? 123.222 114.427 156.188 1.00 30.00  ? 19  VAL G CB  1 
ATOM 9294  C CG1 . VAL G 1 19  ? 124.202 115.165 155.344 1.00 30.00  ? 19  VAL G CG1 1 
ATOM 9295  C CG2 . VAL G 1 19  ? 122.102 115.370 156.531 1.00 30.00  ? 19  VAL G CG2 1 
ATOM 9296  N N   . LEU G 1 20  ? 124.392 111.480 155.556 1.00 123.94 ? 20  LEU G N   1 
ATOM 9297  C CA  . LEU G 1 20  ? 125.323 110.515 154.975 1.00 120.76 ? 20  LEU G CA  1 
ATOM 9298  C C   . LEU G 1 20  ? 124.613 109.560 154.026 1.00 118.82 ? 20  LEU G C   1 
ATOM 9299  O O   . LEU G 1 20  ? 125.189 109.144 153.015 1.00 128.24 ? 20  LEU G O   1 
ATOM 9300  C CB  . LEU G 1 20  ? 126.020 109.725 156.078 1.00 30.00  ? 20  LEU G CB  1 
ATOM 9301  C CG  . LEU G 1 20  ? 126.900 110.542 157.019 1.00 30.00  ? 20  LEU G CG  1 
ATOM 9302  C CD1 . LEU G 1 20  ? 127.457 109.656 158.121 1.00 30.00  ? 20  LEU G CD1 1 
ATOM 9303  C CD2 . LEU G 1 20  ? 128.010 111.233 156.253 1.00 30.00  ? 20  LEU G CD2 1 
ATOM 9304  N N   . VAL G 1 21  ? 123.364 109.215 154.337 1.00 118.89 ? 21  VAL G N   1 
ATOM 9305  C CA  . VAL G 1 21  ? 122.531 108.455 153.416 1.00 124.09 ? 21  VAL G CA  1 
ATOM 9306  C C   . VAL G 1 21  ? 122.112 109.315 152.231 1.00 132.71 ? 21  VAL G C   1 
ATOM 9307  O O   . VAL G 1 21  ? 122.054 108.829 151.094 1.00 133.89 ? 21  VAL G O   1 
ATOM 9308  C CB  . VAL G 1 21  ? 121.341 107.871 154.196 1.00 30.00  ? 21  VAL G CB  1 
ATOM 9309  C CG1 . VAL G 1 21  ? 120.285 107.293 153.278 1.00 30.00  ? 21  VAL G CG1 1 
ATOM 9310  C CG2 . VAL G 1 21  ? 121.864 106.796 155.114 1.00 30.00  ? 21  VAL G CG2 1 
ATOM 9311  N N   . ALA G 1 22  ? 121.850 110.604 152.464 1.00 119.64 ? 22  ALA G N   1 
ATOM 9312  C CA  . ALA G 1 22  ? 121.602 111.519 151.355 1.00 121.63 ? 22  ALA G CA  1 
ATOM 9313  C C   . ALA G 1 22  ? 122.834 111.662 150.472 1.00 121.50 ? 22  ALA G C   1 
ATOM 9314  O O   . ALA G 1 22  ? 122.718 111.703 149.242 1.00 124.27 ? 22  ALA G O   1 
ATOM 9315  C CB  . ALA G 1 22  ? 121.165 112.884 151.883 1.00 30.00  ? 22  ALA G CB  1 
ATOM 9316  N N   . ALA G 1 23  ? 124.022 111.707 151.081 1.00 123.64 ? 23  ALA G N   1 
ATOM 9317  C CA  . ALA G 1 23  ? 125.262 111.845 150.329 1.00 136.43 ? 23  ALA G CA  1 
ATOM 9318  C C   . ALA G 1 23  ? 125.598 110.607 149.511 1.00 124.63 ? 23  ALA G C   1 
ATOM 9319  O O   . ALA G 1 23  ? 126.068 110.745 148.378 1.00 135.97 ? 23  ALA G O   1 
ATOM 9320  C CB  . ALA G 1 23  ? 126.423 112.168 151.272 1.00 30.00  ? 23  ALA G CB  1 
ATOM 9321  N N   . VAL G 1 24  ? 125.362 109.406 150.041 1.00 119.23 ? 24  VAL G N   1 
ATOM 9322  C CA  . VAL G 1 24  ? 125.548 108.202 149.242 1.00 115.14 ? 24  VAL G CA  1 
ATOM 9323  C C   . VAL G 1 24  ? 124.377 107.974 148.295 1.00 115.95 ? 24  VAL G C   1 
ATOM 9324  O O   . VAL G 1 24  ? 124.502 107.173 147.357 1.00 121.87 ? 24  VAL G O   1 
ATOM 9325  C CB  . VAL G 1 24  ? 125.777 106.953 150.118 1.00 30.00  ? 24  VAL G CB  1 
ATOM 9326  C CG1 . VAL G 1 24  ? 126.981 107.149 151.020 1.00 30.00  ? 24  VAL G CG1 1 
ATOM 9327  C CG2 . VAL G 1 24  ? 124.548 106.616 150.912 1.00 30.00  ? 24  VAL G CG2 1 
ATOM 9328  N N   . ALA G 1 25  ? 123.248 108.650 148.507 1.00 113.08 ? 25  ALA G N   1 
ATOM 9329  C CA  . ALA G 1 25  ? 122.250 108.750 147.456 1.00 132.88 ? 25  ALA G CA  1 
ATOM 9330  C C   . ALA G 1 25  ? 122.538 109.915 146.529 1.00 125.56 ? 25  ALA G C   1 
ATOM 9331  O O   . ALA G 1 25  ? 121.779 110.145 145.584 1.00 130.11 ? 25  ALA G O   1 
ATOM 9332  C CB  . ALA G 1 25  ? 120.854 108.900 148.048 1.00 30.00  ? 25  ALA G CB  1 
ATOM 9333  N N   . ALA G 1 26  ? 123.602 110.669 146.797 1.00 112.05 ? 26  ALA G N   1 
ATOM 9334  C CA  . ALA G 1 26  ? 124.058 111.712 145.899 1.00 121.96 ? 26  ALA G CA  1 
ATOM 9335  C C   . ALA G 1 26  ? 125.361 111.374 145.200 1.00 122.57 ? 26  ALA G C   1 
ATOM 9336  O O   . ALA G 1 26  ? 125.433 111.505 143.978 1.00 124.18 ? 26  ALA G O   1 
ATOM 9337  C CB  . ALA G 1 26  ? 124.234 113.033 146.655 1.00 30.00  ? 26  ALA G CB  1 
ATOM 9338  N N   . ALA G 1 27  ? 126.371 110.898 145.930 1.00 120.74 ? 27  ALA G N   1 
ATOM 9339  C CA  . ALA G 1 27  ? 127.662 110.583 145.331 1.00 112.14 ? 27  ALA G CA  1 
ATOM 9340  C C   . ALA G 1 27  ? 127.647 109.305 144.502 1.00 126.27 ? 27  ALA G C   1 
ATOM 9341  O O   . ALA G 1 27  ? 128.693 108.932 143.959 1.00 129.46 ? 27  ALA G O   1 
ATOM 9342  C CB  . ALA G 1 27  ? 128.736 110.473 146.414 1.00 30.00  ? 27  ALA G CB  1 
ATOM 9343  N N   . VAL G 1 28  ? 126.510 108.621 144.415 1.00 128.89 ? 28  VAL G N   1 
ATOM 9344  C CA  . VAL G 1 28  ? 126.323 107.503 143.506 1.00 113.05 ? 28  VAL G CA  1 
ATOM 9345  C C   . VAL G 1 28  ? 125.377 107.864 142.372 1.00 121.90 ? 28  VAL G C   1 
ATOM 9346  O O   . VAL G 1 28  ? 125.633 107.535 141.214 1.00 122.20 ? 28  VAL G O   1 
ATOM 9347  C CB  . VAL G 1 28  ? 125.814 106.281 144.295 1.00 30.00  ? 28  VAL G CB  1 
ATOM 9348  C CG1 . VAL G 1 28  ? 125.525 105.117 143.375 1.00 30.00  ? 28  VAL G CG1 1 
ATOM 9349  C CG2 . VAL G 1 28  ? 126.840 105.896 145.328 1.00 30.00  ? 28  VAL G CG2 1 
ATOM 9350  N N   . LEU G 1 29  ? 124.307 108.593 142.691 1.00 114.96 ? 29  LEU G N   1 
ATOM 9351  C CA  . LEU G 1 29  ? 123.336 109.001 141.683 1.00 129.81 ? 29  LEU G CA  1 
ATOM 9352  C C   . LEU G 1 29  ? 123.921 110.064 140.757 1.00 140.90 ? 29  LEU G C   1 
ATOM 9353  O O   . LEU G 1 29  ? 123.436 110.250 139.636 1.00 135.21 ? 29  LEU G O   1 
ATOM 9354  C CB  . LEU G 1 29  ? 122.063 109.489 142.380 1.00 30.00  ? 29  LEU G CB  1 
ATOM 9355  C CG  . LEU G 1 29  ? 120.721 109.649 141.663 1.00 30.00  ? 29  LEU G CG  1 
ATOM 9356  C CD1 . LEU G 1 29  ? 119.619 109.389 142.665 1.00 30.00  ? 29  LEU G CD1 1 
ATOM 9357  C CD2 . LEU G 1 29  ? 120.540 111.024 141.101 1.00 30.00  ? 29  LEU G CD2 1 
ATOM 9358  N N   . ILE G 1 30  ? 124.964 110.766 141.206 1.00 133.11 ? 30  ILE G N   1 
ATOM 9359  C CA  . ILE G 1 30  ? 125.798 111.529 140.282 1.00 124.38 ? 30  ILE G CA  1 
ATOM 9360  C C   . ILE G 1 30  ? 126.749 110.596 139.541 1.00 127.80 ? 30  ILE G C   1 
ATOM 9361  O O   . ILE G 1 30  ? 126.915 110.697 138.321 1.00 124.15 ? 30  ILE G O   1 
ATOM 9362  C CB  . ILE G 1 30  ? 126.556 112.640 141.034 1.00 30.00  ? 30  ILE G CB  1 
ATOM 9363  C CG1 . ILE G 1 30  ? 125.585 113.681 141.586 1.00 30.00  ? 30  ILE G CG1 1 
ATOM 9364  C CG2 . ILE G 1 30  ? 127.573 113.325 140.138 1.00 30.00  ? 30  ILE G CG2 1 
ATOM 9365  C CD1 . ILE G 1 30  ? 126.237 114.674 142.521 1.00 30.00  ? 30  ILE G CD1 1 
ATOM 9366  N N   . GLN G 1 31  ? 127.371 109.660 140.264 1.00 132.79 ? 31  GLN G N   1 
ATOM 9367  C CA  . GLN G 1 31  ? 128.410 108.810 139.689 1.00 126.31 ? 31  GLN G CA  1 
ATOM 9368  C C   . GLN G 1 31  ? 127.840 107.777 138.721 1.00 126.39 ? 31  GLN G C   1 
ATOM 9369  O O   . GLN G 1 31  ? 128.485 107.443 137.721 1.00 134.06 ? 31  GLN G O   1 
ATOM 9370  C CB  . GLN G 1 31  ? 129.194 108.126 140.811 1.00 30.00  ? 31  GLN G CB  1 
ATOM 9371  C CG  . GLN G 1 31  ? 130.375 107.280 140.362 1.00 30.00  ? 31  GLN G CG  1 
ATOM 9372  C CD  . GLN G 1 31  ? 131.115 106.645 141.524 1.00 30.00  ? 31  GLN G CD  1 
ATOM 9373  O OE1 . GLN G 1 31  ? 130.752 106.835 142.684 1.00 30.00  ? 31  GLN G OE1 1 
ATOM 9374  N NE2 . GLN G 1 31  ? 132.149 105.872 141.216 1.00 30.00  ? 31  GLN G NE2 1 
ATOM 9375  N N   . THR G 1 32  ? 126.641 107.256 138.991 1.00 112.61 ? 32  THR G N   1 
ATOM 9376  C CA  . THR G 1 32  ? 125.987 106.420 137.990 1.00 127.34 ? 32  THR G CA  1 
ATOM 9377  C C   . THR G 1 32  ? 125.551 107.237 136.786 1.00 131.45 ? 32  THR G C   1 
ATOM 9378  O O   . THR G 1 32  ? 125.575 106.733 135.658 1.00 120.85 ? 32  THR G O   1 
ATOM 9379  C CB  . THR G 1 32  ? 124.789 105.687 138.590 1.00 30.00  ? 32  THR G CB  1 
ATOM 9380  O OG1 . THR G 1 32  ? 123.907 106.633 139.204 1.00 30.00  ? 32  THR G OG1 1 
ATOM 9381  C CG2 . THR G 1 32  ? 125.247 104.668 139.612 1.00 30.00  ? 32  THR G CG2 1 
ATOM 9382  N N   . SER G 1 33  ? 125.162 108.494 137.005 1.00 130.67 ? 33  SER G N   1 
ATOM 9383  C CA  . SER G 1 33  ? 125.029 109.424 135.892 1.00 132.42 ? 33  SER G CA  1 
ATOM 9384  C C   . SER G 1 33  ? 126.392 109.820 135.351 1.00 131.30 ? 33  SER G C   1 
ATOM 9385  O O   . SER G 1 33  ? 126.500 110.240 134.195 1.00 133.84 ? 33  SER G O   1 
ATOM 9386  C CB  . SER G 1 33  ? 124.256 110.665 136.324 1.00 30.00  ? 33  SER G CB  1 
ATOM 9387  O OG  . SER G 1 33  ? 122.938 110.331 136.703 1.00 30.00  ? 33  SER G OG  1 
ATOM 9388  N N   . GLY G 1 34  ? 127.432 109.713 136.182 1.00 129.56 ? 34  GLY G N   1 
ATOM 9389  C CA  . GLY G 1 34  ? 128.783 109.969 135.714 1.00 121.87 ? 34  GLY G CA  1 
ATOM 9390  C C   . GLY G 1 34  ? 129.234 108.970 134.669 1.00 127.99 ? 34  GLY G C   1 
ATOM 9391  O O   . GLY G 1 34  ? 129.976 109.315 133.750 1.00 136.74 ? 34  GLY G O   1 
ATOM 9392  N N   . TYR G 1 35  ? 128.776 107.724 134.782 1.00 111.57 ? 35  TYR G N   1 
ATOM 9393  C CA  . TYR G 1 35  ? 129.079 106.747 133.744 1.00 115.71 ? 35  TYR G CA  1 
ATOM 9394  C C   . TYR G 1 35  ? 128.318 107.053 132.459 1.00 122.18 ? 35  TYR G C   1 
ATOM 9395  O O   . TYR G 1 35  ? 128.765 106.685 131.366 1.00 127.53 ? 35  TYR G O   1 
ATOM 9396  C CB  . TYR G 1 35  ? 128.768 105.334 134.242 1.00 30.00  ? 35  TYR G CB  1 
ATOM 9397  C CG  . TYR G 1 35  ? 129.036 104.263 133.212 1.00 30.00  ? 35  TYR G CG  1 
ATOM 9398  C CD1 . TYR G 1 35  ? 130.330 103.884 132.897 1.00 30.00  ? 35  TYR G CD1 1 
ATOM 9399  C CD2 . TYR G 1 35  ? 127.995 103.643 132.544 1.00 30.00  ? 35  TYR G CD2 1 
ATOM 9400  C CE1 . TYR G 1 35  ? 130.577 102.916 131.945 1.00 30.00  ? 35  TYR G CE1 1 
ATOM 9401  C CE2 . TYR G 1 35  ? 128.234 102.677 131.599 1.00 30.00  ? 35  TYR G CE2 1 
ATOM 9402  C CZ  . TYR G 1 35  ? 129.521 102.316 131.302 1.00 30.00  ? 35  TYR G CZ  1 
ATOM 9403  O OH  . TYR G 1 35  ? 129.748 101.347 130.356 1.00 30.00  ? 35  TYR G OH  1 
ATOM 9404  N N   . LEU G 1 36  ? 127.187 107.754 132.565 1.00 116.21 ? 36  LEU G N   1 
ATOM 9405  C CA  . LEU G 1 36  ? 126.320 107.964 131.413 1.00 130.01 ? 36  LEU G CA  1 
ATOM 9406  C C   . LEU G 1 36  ? 126.901 108.905 130.374 1.00 123.78 ? 36  LEU G C   1 
ATOM 9407  O O   . LEU G 1 36  ? 126.598 108.737 129.191 1.00 118.51 ? 36  LEU G O   1 
ATOM 9408  C CB  . LEU G 1 36  ? 124.969 108.514 131.850 1.00 30.00  ? 36  LEU G CB  1 
ATOM 9409  C CG  . LEU G 1 36  ? 124.116 107.570 132.679 1.00 30.00  ? 36  LEU G CG  1 
ATOM 9410  C CD1 . LEU G 1 36  ? 122.852 108.288 133.096 1.00 30.00  ? 36  LEU G CD1 1 
ATOM 9411  C CD2 . LEU G 1 36  ? 123.800 106.338 131.865 1.00 30.00  ? 36  LEU G CD2 1 
ATOM 9412  N N   . GLN G 1 37  ? 127.716 109.885 130.774 1.00 123.38 ? 37  GLN G N   1 
ATOM 9413  C CA  . GLN G 1 37  ? 128.276 110.793 129.778 1.00 117.62 ? 37  GLN G CA  1 
ATOM 9414  C C   . GLN G 1 37  ? 129.327 110.098 128.933 1.00 110.58 ? 37  GLN G C   1 
ATOM 9415  O O   . GLN G 1 37  ? 129.343 110.259 127.707 1.00 111.88 ? 37  GLN G O   1 
ATOM 9416  C CB  . GLN G 1 37  ? 128.897 112.031 130.428 1.00 30.00  ? 37  GLN G CB  1 
ATOM 9417  C CG  . GLN G 1 37  ? 127.950 112.885 131.229 1.00 30.00  ? 37  GLN G CG  1 
ATOM 9418  C CD  . GLN G 1 37  ? 127.936 112.493 132.668 1.00 30.00  ? 37  GLN G CD  1 
ATOM 9419  O OE1 . GLN G 1 37  ? 128.894 111.913 133.158 1.00 30.00  ? 37  GLN G OE1 1 
ATOM 9420  N NE2 . GLN G 1 37  ? 126.840 112.774 133.355 1.00 30.00  ? 37  GLN G NE2 1 
ATOM 9421  N N   . GLN G 1 38  ? 130.194 109.304 129.565 1.00 110.77 ? 38  GLN G N   1 
ATOM 9422  C CA  . GLN G 1 38  ? 131.342 108.752 128.859 1.00 125.53 ? 38  GLN G CA  1 
ATOM 9423  C C   . GLN G 1 38  ? 130.926 107.641 127.909 1.00 131.29 ? 38  GLN G C   1 
ATOM 9424  O O   . GLN G 1 38  ? 131.624 107.351 126.932 1.00 143.08 ? 38  GLN G O   1 
ATOM 9425  C CB  . GLN G 1 38  ? 132.397 108.260 129.848 1.00 30.00  ? 38  GLN G CB  1 
ATOM 9426  C CG  . GLN G 1 38  ? 131.983 107.156 130.792 1.00 30.00  ? 38  GLN G CG  1 
ATOM 9427  C CD  . GLN G 1 38  ? 133.164 106.661 131.603 1.00 30.00  ? 38  GLN G CD  1 
ATOM 9428  O OE1 . GLN G 1 38  ? 134.303 107.021 131.323 1.00 30.00  ? 38  GLN G OE1 1 
ATOM 9429  N NE2 . GLN G 1 38  ? 132.900 105.860 132.624 1.00 30.00  ? 38  GLN G NE2 1 
ATOM 9430  N N   . LYS G 1 39  ? 129.785 107.010 128.169 1.00 115.39 ? 39  LYS G N   1 
ATOM 9431  C CA  . LYS G 1 39  ? 129.287 106.067 127.183 1.00 122.69 ? 39  LYS G CA  1 
ATOM 9432  C C   . LYS G 1 39  ? 128.501 106.784 126.096 1.00 122.92 ? 39  LYS G C   1 
ATOM 9433  O O   . LYS G 1 39  ? 128.535 106.368 124.934 1.00 119.94 ? 39  LYS G O   1 
ATOM 9434  C CB  . LYS G 1 39  ? 128.437 104.990 127.852 1.00 30.00  ? 39  LYS G CB  1 
ATOM 9435  C CG  . LYS G 1 39  ? 128.064 103.863 126.915 1.00 30.00  ? 39  LYS G CG  1 
ATOM 9436  C CD  . LYS G 1 39  ? 129.325 103.146 126.481 1.00 30.00  ? 39  LYS G CD  1 
ATOM 9437  C CE  . LYS G 1 39  ? 129.017 101.955 125.613 1.00 30.00  ? 39  LYS G CE  1 
ATOM 9438  N NZ  . LYS G 1 39  ? 128.434 102.384 124.324 1.00 30.00  ? 39  LYS G NZ  1 
ATOM 9439  N N   . SER G 1 40  ? 127.823 107.879 126.435 1.00 115.71 ? 40  SER G N   1 
ATOM 9440  C CA  . SER G 1 40  ? 127.026 108.578 125.434 1.00 125.17 ? 40  SER G CA  1 
ATOM 9441  C C   . SER G 1 40  ? 127.905 109.399 124.504 1.00 124.47 ? 40  SER G C   1 
ATOM 9442  O O   . SER G 1 40  ? 127.738 109.357 123.282 1.00 117.25 ? 40  SER G O   1 
ATOM 9443  C CB  . SER G 1 40  ? 125.994 109.474 126.107 1.00 30.00  ? 40  SER G CB  1 
ATOM 9444  O OG  . SER G 1 40  ? 126.641 110.482 126.862 1.00 30.00  ? 40  SER G OG  1 
ATOM 9445  N N   . GLN G 1 41  ? 128.851 110.151 125.068 1.00 124.77 ? 41  GLN G N   1 
ATOM 9446  C CA  . GLN G 1 41  ? 129.615 111.094 124.260 1.00 118.76 ? 41  GLN G CA  1 
ATOM 9447  C C   . GLN G 1 41  ? 130.679 110.379 123.437 1.00 112.40 ? 41  GLN G C   1 
ATOM 9448  O O   . GLN G 1 41  ? 131.158 110.920 122.433 1.00 107.21 ? 41  GLN G O   1 
ATOM 9449  C CB  . GLN G 1 41  ? 130.194 112.182 125.174 1.00 30.00  ? 41  GLN G CB  1 
ATOM 9450  C CG  . GLN G 1 41  ? 130.848 113.379 124.494 1.00 30.00  ? 41  GLN G CG  1 
ATOM 9451  C CD  . GLN G 1 41  ? 130.964 114.571 125.429 1.00 30.00  ? 41  GLN G CD  1 
ATOM 9452  O OE1 . GLN G 1 41  ? 130.601 114.490 126.600 1.00 30.00  ? 41  GLN G OE1 1 
ATOM 9453  N NE2 . GLN G 1 41  ? 131.428 115.697 124.902 1.00 30.00  ? 41  GLN G NE2 1 
ATOM 9454  N N   . ALA G 1 42  ? 131.026 109.147 123.814 1.00 117.08 ? 42  ALA G N   1 
ATOM 9455  C CA  . ALA G 1 42  ? 131.769 108.281 122.906 1.00 121.87 ? 42  ALA G CA  1 
ATOM 9456  C C   . ALA G 1 42  ? 130.890 107.843 121.738 1.00 124.60 ? 42  ALA G C   1 
ATOM 9457  O O   . ALA G 1 42  ? 131.301 107.912 120.576 1.00 129.32 ? 42  ALA G O   1 
ATOM 9458  C CB  . ALA G 1 42  ? 132.319 107.070 123.658 1.00 30.00  ? 42  ALA G CB  1 
ATOM 9459  N N   . THR G 1 43  ? 129.669 107.388 122.028 1.00 122.18 ? 43  THR G N   1 
ATOM 9460  C CA  . THR G 1 43  ? 128.739 107.015 120.967 1.00 129.90 ? 43  THR G CA  1 
ATOM 9461  C C   . THR G 1 43  ? 128.154 108.211 120.236 1.00 121.89 ? 43  THR G C   1 
ATOM 9462  O O   . THR G 1 43  ? 127.713 108.050 119.092 1.00 106.94 ? 43  THR G O   1 
ATOM 9463  C CB  . THR G 1 43  ? 127.590 106.181 121.523 1.00 30.00  ? 43  THR G CB  1 
ATOM 9464  O OG1 . THR G 1 43  ? 126.935 106.912 122.564 1.00 30.00  ? 43  THR G OG1 1 
ATOM 9465  C CG2 . THR G 1 43  ? 128.092 104.873 122.059 1.00 30.00  ? 43  THR G CG2 1 
ATOM 9466  N N   . GLY G 1 44  ? 128.125 109.385 120.866 1.00 116.35 ? 44  GLY G N   1 
ATOM 9467  C CA  . GLY G 1 44  ? 127.559 110.577 120.264 1.00 102.42 ? 44  GLY G CA  1 
ATOM 9468  C C   . GLY G 1 44  ? 128.312 111.037 119.036 1.00 107.16 ? 44  GLY G C   1 
ATOM 9469  O O   . GLY G 1 44  ? 127.737 111.651 118.133 1.00 105.71 ? 44  GLY G O   1 
ATOM 9470  N N   . ARG G 1 45  ? 129.608 110.736 118.992 1.00 121.34 ? 45  ARG G N   1 
ATOM 9471  C CA  . ARG G 1 45  ? 130.411 111.118 117.839 1.00 118.64 ? 45  ARG G CA  1 
ATOM 9472  C C   . ARG G 1 45  ? 130.544 109.966 116.852 1.00 114.49 ? 45  ARG G C   1 
ATOM 9473  O O   . ARG G 1 45  ? 130.530 110.181 115.635 1.00 119.78 ? 45  ARG G O   1 
ATOM 9474  C CB  . ARG G 1 45  ? 131.789 111.577 118.303 1.00 30.00  ? 45  ARG G CB  1 
ATOM 9475  C CG  . ARG G 1 45  ? 131.780 112.806 119.191 1.00 30.00  ? 45  ARG G CG  1 
ATOM 9476  C CD  . ARG G 1 45  ? 133.192 113.178 119.580 1.00 30.00  ? 45  ARG G CD  1 
ATOM 9477  N NE  . ARG G 1 45  ? 133.785 112.166 120.446 1.00 30.00  ? 45  ARG G NE  1 
ATOM 9478  C CZ  . ARG G 1 45  ? 134.748 111.332 120.067 1.00 30.00  ? 45  ARG G CZ  1 
ATOM 9479  N NH1 . ARG G 1 45  ? 135.216 111.382 118.828 1.00 30.00  ? 45  ARG G NH1 1 
ATOM 9480  N NH2 . ARG G 1 45  ? 135.229 110.439 120.918 1.00 30.00  ? 45  ARG G NH2 1 
ATOM 9481  N N   . GLU G 1 46  ? 130.675 108.736 117.363 1.00 110.36 ? 46  GLU G N   1 
ATOM 9482  C CA  . GLU G 1 46  ? 131.017 107.584 116.532 1.00 120.39 ? 46  GLU G CA  1 
ATOM 9483  C C   . GLU G 1 46  ? 129.924 107.219 115.542 1.00 123.08 ? 46  GLU G C   1 
ATOM 9484  O O   . GLU G 1 46  ? 130.220 106.724 114.450 1.00 126.45 ? 46  GLU G O   1 
ATOM 9485  C CB  . GLU G 1 46  ? 131.317 106.372 117.407 1.00 30.00  ? 46  GLU G CB  1 
ATOM 9486  C CG  . GLU G 1 46  ? 132.660 106.387 118.080 1.00 30.00  ? 46  GLU G CG  1 
ATOM 9487  C CD  . GLU G 1 46  ? 132.817 105.210 119.006 1.00 30.00  ? 46  GLU G CD  1 
ATOM 9488  O OE1 . GLU G 1 46  ? 131.804 104.541 119.280 1.00 30.00  ? 46  GLU G OE1 1 
ATOM 9489  O OE2 . GLU G 1 46  ? 133.950 104.928 119.432 1.00 30.00  ? 46  GLU G OE2 1 
ATOM 9490  N N   . THR G 1 47  ? 128.669 107.435 115.894 1.00 109.60 ? 47  THR G N   1 
ATOM 9491  C CA  . THR G 1 47  ? 127.612 106.987 115.008 1.00 114.97 ? 47  THR G CA  1 
ATOM 9492  C C   . THR G 1 47  ? 127.324 107.977 113.896 1.00 122.24 ? 47  THR G C   1 
ATOM 9493  O O   . THR G 1 47  ? 126.614 107.632 112.947 1.00 126.78 ? 47  THR G O   1 
ATOM 9494  C CB  . THR G 1 47  ? 126.374 106.699 115.825 1.00 30.00  ? 47  THR G CB  1 
ATOM 9495  O OG1 . THR G 1 47  ? 126.036 107.873 116.570 1.00 30.00  ? 47  THR G OG1 1 
ATOM 9496  C CG2 . THR G 1 47  ? 126.684 105.558 116.768 1.00 30.00  ? 47  THR G CG2 1 
ATOM 9497  N N   . THR G 1 48  ? 127.853 109.193 113.989 1.00 106.63 ? 48  THR G N   1 
ATOM 9498  C CA  . THR G 1 48  ? 127.992 110.007 112.792 1.00 106.27 ? 48  THR G CA  1 
ATOM 9499  C C   . THR G 1 48  ? 129.105 109.465 111.909 1.00 112.60 ? 48  THR G C   1 
ATOM 9500  O O   . THR G 1 48  ? 129.017 109.529 110.681 1.00 117.23 ? 48  THR G O   1 
ATOM 9501  C CB  . THR G 1 48  ? 128.275 111.459 113.163 1.00 30.00  ? 48  THR G CB  1 
ATOM 9502  O OG1 . THR G 1 48  ? 129.465 111.521 113.957 1.00 30.00  ? 48  THR G OG1 1 
ATOM 9503  C CG2 . THR G 1 48  ? 127.122 112.042 113.946 1.00 30.00  ? 48  THR G CG2 1 
ATOM 9504  N N   . GLN G 1 49  ? 130.141 108.896 112.525 1.00 120.76 ? 49  GLN G N   1 
ATOM 9505  C CA  . GLN G 1 49  ? 131.301 108.434 111.774 1.00 129.15 ? 49  GLN G CA  1 
ATOM 9506  C C   . GLN G 1 49  ? 131.027 107.111 111.076 1.00 124.57 ? 49  GLN G C   1 
ATOM 9507  O O   . GLN G 1 49  ? 131.778 106.718 110.178 1.00 134.69 ? 49  GLN G O   1 
ATOM 9508  C CB  . GLN G 1 49  ? 132.490 108.311 112.719 1.00 30.00  ? 49  GLN G CB  1 
ATOM 9509  C CG  . GLN G 1 49  ? 132.826 109.618 113.386 1.00 30.00  ? 49  GLN G CG  1 
ATOM 9510  C CD  . GLN G 1 49  ? 133.921 109.496 114.415 1.00 30.00  ? 49  GLN G CD  1 
ATOM 9511  O OE1 . GLN G 1 49  ? 134.413 108.405 114.692 1.00 30.00  ? 49  GLN G OE1 1 
ATOM 9512  N NE2 . GLN G 1 49  ? 134.306 110.622 114.996 1.00 30.00  ? 49  GLN G NE2 1 
ATOM 9513  N N   . GLU G 1 50  ? 129.974 106.405 111.485 1.00 118.17 ? 50  GLU G N   1 
ATOM 9514  C CA  . GLU G 1 50  ? 129.579 105.187 110.793 1.00 122.89 ? 50  GLU G CA  1 
ATOM 9515  C C   . GLU G 1 50  ? 128.708 105.477 109.577 1.00 108.02 ? 50  GLU G C   1 
ATOM 9516  O O   . GLU G 1 50  ? 128.820 104.776 108.566 1.00 108.64 ? 50  GLU G O   1 
ATOM 9517  C CB  . GLU G 1 50  ? 128.843 104.259 111.762 1.00 30.00  ? 50  GLU G CB  1 
ATOM 9518  C CG  . GLU G 1 50  ? 128.434 102.909 111.188 1.00 30.00  ? 50  GLU G CG  1 
ATOM 9519  C CD  . GLU G 1 50  ? 129.617 102.014 110.884 1.00 30.00  ? 50  GLU G CD  1 
ATOM 9520  O OE1 . GLU G 1 50  ? 130.658 102.149 111.560 1.00 30.00  ? 50  GLU G OE1 1 
ATOM 9521  O OE2 . GLU G 1 50  ? 129.509 101.178 109.963 1.00 30.00  ? 50  GLU G OE2 1 
ATOM 9522  N N   . VAL G 1 51  ? 127.861 106.500 109.639 1.00 112.66 ? 51  VAL G N   1 
ATOM 9523  C CA  . VAL G 1 51  ? 126.957 106.801 108.539 1.00 114.59 ? 51  VAL G CA  1 
ATOM 9524  C C   . VAL G 1 51  ? 127.539 107.795 107.544 1.00 112.54 ? 51  VAL G C   1 
ATOM 9525  O O   . VAL G 1 51  ? 127.148 107.762 106.368 1.00 128.80 ? 51  VAL G O   1 
ATOM 9526  C CB  . VAL G 1 51  ? 125.589 107.298 109.053 1.00 30.00  ? 51  VAL G CB  1 
ATOM 9527  C CG1 . VAL G 1 51  ? 124.925 106.223 109.883 1.00 30.00  ? 51  VAL G CG1 1 
ATOM 9528  C CG2 . VAL G 1 51  ? 125.734 108.566 109.868 1.00 30.00  ? 51  VAL G CG2 1 
ATOM 9529  N N   . ALA G 1 52  ? 128.459 108.668 107.956 1.00 30.00  ? 52  ALA G N   1 
ATOM 9530  C CA  . ALA G 1 52  ? 128.960 109.674 107.028 1.00 30.00  ? 52  ALA G CA  1 
ATOM 9531  C C   . ALA G 1 52  ? 130.088 109.117 106.176 1.00 30.00  ? 52  ALA G C   1 
ATOM 9532  O O   . ALA G 1 52  ? 129.989 109.093 104.945 1.00 30.00  ? 52  ALA G O   1 
ATOM 9533  C CB  . ALA G 1 52  ? 129.422 110.919 107.782 1.00 30.00  ? 52  ALA G CB  1 
ATOM 9534  N N   . SER G 1 53  ? 131.161 108.661 106.817 1.00 113.33 ? 53  SER G N   1 
ATOM 9535  C CA  . SER G 1 53  ? 132.356 108.237 106.107 1.00 119.89 ? 53  SER G CA  1 
ATOM 9536  C C   . SER G 1 53  ? 132.099 106.961 105.317 1.00 124.17 ? 53  SER G C   1 
ATOM 9537  O O   . SER G 1 53  ? 131.320 106.096 105.722 1.00 123.77 ? 53  SER G O   1 
ATOM 9538  C CB  . SER G 1 53  ? 133.505 108.024 107.087 1.00 135.93 ? 53  SER G CB  1 
ATOM 9539  O OG  . SER G 1 53  ? 133.219 106.960 107.976 1.00 150.89 ? 53  SER G OG  1 
ATOM 9540  N N   . GLY G 1 54  ? 132.744 106.866 104.163 1.00 126.56 ? 54  GLY G N   1 
ATOM 9541  C CA  . GLY G 1 54  ? 132.516 105.739 103.288 1.00 107.25 ? 54  GLY G CA  1 
ATOM 9542  C C   . GLY G 1 54  ? 133.261 105.831 101.976 1.00 106.60 ? 54  GLY G C   1 
ATOM 9543  O O   . GLY G 1 54  ? 133.619 106.919 101.518 1.00 103.76 ? 54  GLY G O   1 
ATOM 9544  N N   . ILE G 1 55  ? 133.470 104.677 101.358 1.00 100.38 ? 55  ILE G N   1 
ATOM 9545  C CA  . ILE G 1 55  ? 134.273 104.526 100.154 1.00 80.06  ? 55  ILE G CA  1 
ATOM 9546  C C   . ILE G 1 55  ? 133.339 104.380 98.961  1.00 98.77  ? 55  ILE G C   1 
ATOM 9547  O O   . ILE G 1 55  ? 132.331 103.678 99.048  1.00 111.05 ? 55  ILE G O   1 
ATOM 9548  C CB  . ILE G 1 55  ? 135.213 103.316 100.305 1.00 30.00  ? 55  ILE G CB  1 
ATOM 9549  C CG1 . ILE G 1 55  ? 136.374 103.656 101.241 1.00 30.00  ? 55  ILE G CG1 1 
ATOM 9550  C CG2 . ILE G 1 55  ? 135.654 102.740 98.980  1.00 30.00  ? 55  ILE G CG2 1 
ATOM 9551  C CD1 . ILE G 1 55  ? 137.295 102.496 101.492 1.00 30.00  ? 55  ILE G CD1 1 
ATOM 9552  N N   . LYS G 1 56  ? 133.641 105.074 97.862  1.00 98.92  ? 56  LYS G N   1 
ATOM 9553  C CA  . LYS G 1 56  ? 132.958 104.834 96.599  1.00 91.81  ? 56  LYS G CA  1 
ATOM 9554  C C   . LYS G 1 56  ? 133.968 104.441 95.530  1.00 85.75  ? 56  LYS G C   1 
ATOM 9555  O O   . LYS G 1 56  ? 135.130 104.853 95.574  1.00 101.89 ? 56  LYS G O   1 
ATOM 9556  C CB  . LYS G 1 56  ? 132.141 106.047 96.147  1.00 30.00  ? 56  LYS G CB  1 
ATOM 9557  C CG  . LYS G 1 56  ? 132.917 107.265 95.688  1.00 30.00  ? 56  LYS G CG  1 
ATOM 9558  C CD  . LYS G 1 56  ? 131.932 108.370 95.336  1.00 30.00  ? 56  LYS G CD  1 
ATOM 9559  C CE  . LYS G 1 56  ? 132.619 109.633 94.873  1.00 30.00  ? 56  LYS G CE  1 
ATOM 9560  N NZ  . LYS G 1 56  ? 133.290 109.424 93.570  1.00 30.00  ? 56  LYS G NZ  1 
ATOM 9561  N N   . VAL G 1 57  ? 133.512 103.635 94.578  1.00 72.52  ? 57  VAL G N   1 
ATOM 9562  C CA  . VAL G 1 57  ? 134.364 102.961 93.606  1.00 81.55  ? 57  VAL G CA  1 
ATOM 9563  C C   . VAL G 1 57  ? 134.059 103.516 92.226  1.00 102.46 ? 57  VAL G C   1 
ATOM 9564  O O   . VAL G 1 57  ? 132.910 103.471 91.775  1.00 103.19 ? 57  VAL G O   1 
ATOM 9565  C CB  . VAL G 1 57  ? 134.143 101.445 93.639  1.00 30.00  ? 57  VAL G CB  1 
ATOM 9566  C CG1 . VAL G 1 57  ? 134.848 100.790 92.496  1.00 30.00  ? 57  VAL G CG1 1 
ATOM 9567  C CG2 . VAL G 1 57  ? 134.625 100.881 94.949  1.00 30.00  ? 57  VAL G CG2 1 
ATOM 9568  N N   . LEU G 1 58  ? 135.080 104.019 91.545  1.00 92.19  ? 58  LEU G N   1 
ATOM 9569  C CA  . LEU G 1 58  ? 134.899 104.603 90.226  1.00 86.93  ? 58  LEU G CA  1 
ATOM 9570  C C   . LEU G 1 58  ? 135.910 104.013 89.253  1.00 105.85 ? 58  LEU G C   1 
ATOM 9571  O O   . LEU G 1 58  ? 137.104 103.974 89.552  1.00 120.09 ? 58  LEU G O   1 
ATOM 9572  C CB  . LEU G 1 58  ? 135.004 106.137 90.308  1.00 30.00  ? 58  LEU G CB  1 
ATOM 9573  C CG  . LEU G 1 58  ? 136.230 106.877 90.867  1.00 30.00  ? 58  LEU G CG  1 
ATOM 9574  C CD1 . LEU G 1 58  ? 137.266 107.231 89.812  1.00 30.00  ? 58  LEU G CD1 1 
ATOM 9575  C CD2 . LEU G 1 58  ? 135.796 108.117 91.611  1.00 30.00  ? 58  LEU G CD2 1 
ATOM 9576  N N   . SER G 1 59  ? 135.409 103.504 88.120  1.00 102.02 ? 59  SER G N   1 
ATOM 9577  C CA  . SER G 1 59  ? 136.184 103.201 86.909  1.00 101.26 ? 59  SER G CA  1 
ATOM 9578  C C   . SER G 1 59  ? 137.315 102.201 87.173  1.00 100.91 ? 59  SER G C   1 
ATOM 9579  O O   . SER G 1 59  ? 138.499 102.522 87.108  1.00 93.78  ? 59  SER G O   1 
ATOM 9580  C CB  . SER G 1 59  ? 136.732 104.486 86.278  1.00 30.00  ? 59  SER G CB  1 
ATOM 9581  O OG  . SER G 1 59  ? 135.681 105.308 85.805  1.00 30.00  ? 59  SER G OG  1 
ATOM 9582  N N   . VAL G 1 60  ? 136.914 100.987 87.502  1.00 114.53 ? 60  VAL G N   1 
ATOM 9583  C CA  . VAL G 1 60  ? 137.866 99.893  87.638  1.00 106.73 ? 60  VAL G CA  1 
ATOM 9584  C C   . VAL G 1 60  ? 138.368 99.526  86.244  1.00 97.61  ? 60  VAL G C   1 
ATOM 9585  O O   . VAL G 1 60  ? 137.673 99.740  85.247  1.00 91.29  ? 60  VAL G O   1 
ATOM 9586  C CB  . VAL G 1 60  ? 137.195 98.704  88.349  1.00 30.00  ? 60  VAL G CB  1 
ATOM 9587  C CG1 . VAL G 1 60  ? 138.215 97.678  88.805  1.00 30.00  ? 60  VAL G CG1 1 
ATOM 9588  C CG2 . VAL G 1 60  ? 136.367 99.194  89.501  1.00 30.00  ? 60  VAL G CG2 1 
ATOM 9589  N N   . VAL G 1 61  ? 139.593 99.016  86.149  1.00 91.21  ? 61  VAL G N   1 
ATOM 9590  C CA  . VAL G 1 61  ? 140.200 98.696  84.865  1.00 75.96  ? 61  VAL G CA  1 
ATOM 9591  C C   . VAL G 1 61  ? 140.683 97.252  84.877  1.00 85.19  ? 61  VAL G C   1 
ATOM 9592  O O   . VAL G 1 61  ? 140.874 96.646  85.933  1.00 107.80 ? 61  VAL G O   1 
ATOM 9593  C CB  . VAL G 1 61  ? 141.350 99.653  84.545  1.00 30.00  ? 61  VAL G CB  1 
ATOM 9594  C CG1 . VAL G 1 61  ? 140.812 101.027 84.294  1.00 30.00  ? 61  VAL G CG1 1 
ATOM 9595  C CG2 . VAL G 1 61  ? 142.260 99.717  85.725  1.00 30.00  ? 61  VAL G CG2 1 
ATOM 9596  N N   . GLY G 1 62  ? 140.863 96.692  83.679  1.00 70.41  ? 62  GLY G N   1 
ATOM 9597  C CA  . GLY G 1 62  ? 141.143 95.272  83.564  1.00 74.08  ? 62  GLY G CA  1 
ATOM 9598  C C   . GLY G 1 62  ? 142.577 94.791  83.438  1.00 71.97  ? 62  GLY G C   1 
ATOM 9599  O O   . GLY G 1 62  ? 143.038 94.037  84.299  1.00 101.24 ? 62  GLY G O   1 
ATOM 9600  N N   . LYS G 1 63  ? 143.295 95.254  82.406  1.00 30.00  ? 63  LYS G N   1 
ATOM 9601  C CA  . LYS G 1 63  ? 144.596 94.721  81.983  1.00 30.00  ? 63  LYS G CA  1 
ATOM 9602  C C   . LYS G 1 63  ? 144.570 93.215  81.747  1.00 30.00  ? 63  LYS G C   1 
ATOM 9603  O O   . LYS G 1 63  ? 144.915 92.432  82.639  1.00 30.00  ? 63  LYS G O   1 
ATOM 9604  C CB  . LYS G 1 63  ? 145.731 95.072  82.948  1.00 30.00  ? 63  LYS G CB  1 
ATOM 9605  C CG  . LYS G 1 63  ? 147.117 94.683  82.420  1.00 30.00  ? 63  LYS G CG  1 
ATOM 9606  C CD  . LYS G 1 63  ? 147.415 95.361  81.106  1.00 30.00  ? 63  LYS G CD  1 
ATOM 9607  C CE  . LYS G 1 63  ? 148.732 94.883  80.558  1.00 30.00  ? 63  LYS G CE  1 
ATOM 9608  N NZ  . LYS G 1 63  ? 149.847 95.276  81.450  1.00 30.00  ? 63  LYS G NZ  1 
ATOM 9609  N N   . THR G 1 64  ? 144.038 92.781  80.612  1.00 74.75  ? 64  THR G N   1 
ATOM 9610  C CA  . THR G 1 64  ? 144.190 91.375  80.294  1.00 85.42  ? 64  THR G CA  1 
ATOM 9611  C C   . THR G 1 64  ? 145.618 91.055  79.876  1.00 94.58  ? 64  THR G C   1 
ATOM 9612  O O   . THR G 1 64  ? 146.466 91.933  79.694  1.00 107.53 ? 64  THR G O   1 
ATOM 9613  C CB  . THR G 1 64  ? 143.233 90.944  79.194  1.00 30.00  ? 64  THR G CB  1 
ATOM 9614  O OG1 . THR G 1 64  ? 143.293 89.522  79.050  1.00 30.00  ? 64  THR G OG1 1 
ATOM 9615  C CG2 . THR G 1 64  ? 143.624 91.558  77.896  1.00 30.00  ? 64  THR G CG2 1 
ATOM 9616  N N   . ASP G 1 65  ? 145.868 89.760  79.723  1.00 92.95  ? 65  ASP G N   1 
ATOM 9617  C CA  . ASP G 1 65  ? 147.154 89.247  79.282  1.00 78.92  ? 65  ASP G CA  1 
ATOM 9618  C C   . ASP G 1 65  ? 147.341 89.617  77.811  1.00 87.53  ? 65  ASP G C   1 
ATOM 9619  O O   . ASP G 1 65  ? 146.372 89.850  77.085  1.00 108.21 ? 65  ASP G O   1 
ATOM 9620  C CB  . ASP G 1 65  ? 147.209 87.743  79.526  1.00 30.00  ? 65  ASP G CB  1 
ATOM 9621  C CG  . ASP G 1 65  ? 148.600 87.179  79.405  1.00 30.00  ? 65  ASP G CG  1 
ATOM 9622  O OD1 . ASP G 1 65  ? 149.554 87.962  79.205  1.00 30.00  ? 65  ASP G OD1 1 
ATOM 9623  O OD2 . ASP G 1 65  ? 148.739 85.942  79.507  1.00 30.00  ? 65  ASP G OD2 1 
ATOM 9624  N N   . SER G 1 66  ? 148.594 89.664  77.348  1.00 82.88  ? 66  SER G N   1 
ATOM 9625  C CA  . SER G 1 66  ? 148.890 90.051  75.972  1.00 100.10 ? 66  SER G CA  1 
ATOM 9626  C C   . SER G 1 66  ? 148.376 89.045  74.950  1.00 99.91  ? 66  SER G C   1 
ATOM 9627  O O   . SER G 1 66  ? 148.218 89.399  73.778  1.00 105.10 ? 66  SER G O   1 
ATOM 9628  C CB  . SER G 1 66  ? 150.393 90.252  75.798  1.00 30.00  ? 66  SER G CB  1 
ATOM 9629  O OG  . SER G 1 66  ? 150.852 91.315  76.614  1.00 30.00  ? 66  SER G OG  1 
ATOM 9630  N N   . ASN G 1 67  ? 148.108 87.814  75.365  1.00 97.83  ? 67  ASN G N   1 
ATOM 9631  C CA  . ASN G 1 67  ? 147.173 86.930  74.683  1.00 107.23 ? 67  ASN G CA  1 
ATOM 9632  C C   . ASN G 1 67  ? 145.881 87.114  75.471  1.00 118.78 ? 67  ASN G C   1 
ATOM 9633  O O   . ASN G 1 67  ? 145.815 86.733  76.643  1.00 119.03 ? 67  ASN G O   1 
ATOM 9634  C CB  . ASN G 1 67  ? 147.663 85.488  74.680  1.00 30.00  ? 67  ASN G CB  1 
ATOM 9635  C CG  . ASN G 1 67  ? 146.880 84.607  73.734  1.00 30.00  ? 67  ASN G CG  1 
ATOM 9636  O OD1 . ASN G 1 67  ? 145.947 85.059  73.076  1.00 30.00  ? 67  ASN G OD1 1 
ATOM 9637  N ND2 . ASN G 1 67  ? 147.271 83.342  73.646  1.00 30.00  ? 67  ASN G ND2 1 
ATOM 9638  N N   . LYS G 1 68  ? 144.864 87.696  74.822  1.00 119.07 ? 68  LYS G N   1 
ATOM 9639  C CA  . LYS G 1 68  ? 143.721 88.380  75.437  1.00 123.65 ? 68  LYS G CA  1 
ATOM 9640  C C   . LYS G 1 68  ? 142.921 87.596  76.480  1.00 120.01 ? 68  LYS G C   1 
ATOM 9641  O O   . LYS G 1 68  ? 142.160 88.188  77.250  1.00 120.34 ? 68  LYS G O   1 
ATOM 9642  C CB  . LYS G 1 68  ? 142.754 88.819  74.340  1.00 30.00  ? 68  LYS G CB  1 
ATOM 9643  C CG  . LYS G 1 68  ? 143.385 89.600  73.195  1.00 30.00  ? 68  LYS G CG  1 
ATOM 9644  C CD  . LYS G 1 68  ? 144.016 90.899  73.638  1.00 30.00  ? 68  LYS G CD  1 
ATOM 9645  C CE  . LYS G 1 68  ? 144.365 91.753  72.431  1.00 30.00  ? 68  LYS G CE  1 
ATOM 9646  N NZ  . LYS G 1 68  ? 145.406 91.128  71.581  1.00 30.00  ? 68  LYS G NZ  1 
ATOM 9647  N N   . THR G 1 69  ? 143.061 86.274  76.488  1.00 104.67 ? 69  THR G N   1 
ATOM 9648  C CA  . THR G 1 69  ? 142.394 85.386  77.428  1.00 117.77 ? 69  THR G CA  1 
ATOM 9649  C C   . THR G 1 69  ? 142.873 85.645  78.863  1.00 114.76 ? 69  THR G C   1 
ATOM 9650  O O   . THR G 1 69  ? 144.043 85.963  79.096  1.00 113.10 ? 69  THR G O   1 
ATOM 9651  C CB  . THR G 1 69  ? 142.679 83.936  77.009  1.00 30.00  ? 69  THR G CB  1 
ATOM 9652  O OG1 . THR G 1 69  ? 142.297 83.761  75.640  1.00 30.00  ? 69  THR G OG1 1 
ATOM 9653  C CG2 . THR G 1 69  ? 141.924 82.917  77.845  1.00 30.00  ? 69  THR G CG2 1 
ATOM 9654  N N   . TYR G 1 70  ? 141.941 85.518  79.821  1.00 95.58  ? 70  TYR G N   1 
ATOM 9655  C CA  . TYR G 1 70  ? 142.223 85.379  81.256  1.00 91.75  ? 70  TYR G CA  1 
ATOM 9656  C C   . TYR G 1 70  ? 142.914 86.615  81.844  1.00 97.36  ? 70  TYR G C   1 
ATOM 9657  O O   . TYR G 1 70  ? 144.096 86.589  82.185  1.00 106.50 ? 70  TYR G O   1 
ATOM 9658  C CB  . TYR G 1 70  ? 143.068 84.128  81.523  1.00 30.00  ? 70  TYR G CB  1 
ATOM 9659  C CG  . TYR G 1 70  ? 142.355 82.811  81.347  1.00 30.00  ? 70  TYR G CG  1 
ATOM 9660  C CD1 . TYR G 1 70  ? 140.967 82.738  81.328  1.00 30.00  ? 70  TYR G CD1 1 
ATOM 9661  C CD2 . TYR G 1 70  ? 143.075 81.633  81.197  1.00 30.00  ? 70  TYR G CD2 1 
ATOM 9662  C CE1 . TYR G 1 70  ? 140.318 81.520  81.165  1.00 30.00  ? 70  TYR G CE1 1 
ATOM 9663  C CE2 . TYR G 1 70  ? 142.438 80.417  81.033  1.00 30.00  ? 70  TYR G CE2 1 
ATOM 9664  C CZ  . TYR G 1 70  ? 141.061 80.367  81.018  1.00 30.00  ? 70  TYR G CZ  1 
ATOM 9665  O OH  . TYR G 1 70  ? 140.426 79.159  80.855  1.00 30.00  ? 70  TYR G OH  1 
ATOM 9666  N N   . VAL G 1 71  ? 142.144 87.707  81.921  1.00 94.49  ? 71  VAL G N   1 
ATOM 9667  C CA  . VAL G 1 71  ? 142.569 88.981  82.512  1.00 80.78  ? 71  VAL G CA  1 
ATOM 9668  C C   . VAL G 1 71  ? 143.070 88.831  83.950  1.00 87.45  ? 71  VAL G C   1 
ATOM 9669  O O   . VAL G 1 71  ? 142.445 88.152  84.771  1.00 96.24  ? 71  VAL G O   1 
ATOM 9670  C CB  . VAL G 1 71  ? 141.427 90.018  82.398  1.00 30.00  ? 71  VAL G CB  1 
ATOM 9671  C CG1 . VAL G 1 71  ? 140.143 89.491  82.938  1.00 30.00  ? 71  VAL G CG1 1 
ATOM 9672  C CG2 . VAL G 1 71  ? 141.761 91.289  83.128  1.00 30.00  ? 71  VAL G CG2 1 
ATOM 9673  N N   . GLU G 1 72  ? 144.231 89.421  84.257  1.00 85.64  ? 72  GLU G N   1 
ATOM 9674  C CA  . GLU G 1 72  ? 144.875 89.197  85.544  1.00 94.43  ? 72  GLU G CA  1 
ATOM 9675  C C   . GLU G 1 72  ? 145.088 90.452  86.384  1.00 97.09  ? 72  GLU G C   1 
ATOM 9676  O O   . GLU G 1 72  ? 144.783 90.434  87.577  1.00 121.72 ? 72  GLU G O   1 
ATOM 9677  C CB  . GLU G 1 72  ? 146.206 88.442  85.342  1.00 30.00  ? 72  GLU G CB  1 
ATOM 9678  C CG  . GLU G 1 72  ? 147.334 89.118  84.574  1.00 30.00  ? 72  GLU G CG  1 
ATOM 9679  C CD  . GLU G 1 72  ? 147.250 88.919  83.079  1.00 30.00  ? 72  GLU G CD  1 
ATOM 9680  O OE1 . GLU G 1 72  ? 146.176 88.533  82.580  1.00 30.00  ? 72  GLU G OE1 1 
ATOM 9681  O OE2 . GLU G 1 72  ? 148.275 89.145  82.402  1.00 30.00  ? 72  GLU G OE2 1 
ATOM 9682  N N   . LYS G 1 73  ? 145.585 91.552  85.820  1.00 88.72  ? 73  LYS G N   1 
ATOM 9683  C CA  . LYS G 1 73  ? 146.117 92.658  86.618  1.00 76.19  ? 73  LYS G CA  1 
ATOM 9684  C C   . LYS G 1 73  ? 145.056 93.735  86.809  1.00 76.39  ? 73  LYS G C   1 
ATOM 9685  O O   . LYS G 1 73  ? 145.105 94.786  86.168  1.00 99.03  ? 73  LYS G O   1 
ATOM 9686  C CB  . LYS G 1 73  ? 147.372 93.231  85.973  1.00 30.00  ? 73  LYS G CB  1 
ATOM 9687  C CG  . LYS G 1 73  ? 148.555 92.286  86.037  1.00 30.00  ? 73  LYS G CG  1 
ATOM 9688  C CD  . LYS G 1 73  ? 149.870 92.960  85.667  1.00 30.00  ? 73  LYS G CD  1 
ATOM 9689  C CE  . LYS G 1 73  ? 150.006 93.200  84.178  1.00 30.00  ? 73  LYS G CE  1 
ATOM 9690  N NZ  . LYS G 1 73  ? 151.346 93.769  83.862  1.00 30.00  ? 73  LYS G NZ  1 
ATOM 9691  N N   . LEU G 1 74  ? 144.131 93.490  87.727  1.00 86.10  ? 74  LEU G N   1 
ATOM 9692  C CA  . LEU G 1 74  ? 143.019 94.390  87.991  1.00 69.89  ? 74  LEU G CA  1 
ATOM 9693  C C   . LEU G 1 74  ? 143.467 95.554  88.869  1.00 74.51  ? 74  LEU G C   1 
ATOM 9694  O O   . LEU G 1 74  ? 144.425 95.448  89.636  1.00 105.24 ? 74  LEU G O   1 
ATOM 9695  C CB  . LEU G 1 74  ? 141.877 93.611  88.650  1.00 30.00  ? 74  LEU G CB  1 
ATOM 9696  C CG  . LEU G 1 74  ? 140.481 94.163  88.911  1.00 30.00  ? 74  LEU G CG  1 
ATOM 9697  C CD1 . LEU G 1 74  ? 139.512 93.012  88.810  1.00 30.00  ? 74  LEU G CD1 1 
ATOM 9698  C CD2 . LEU G 1 74  ? 140.392 94.758  90.294  1.00 30.00  ? 74  LEU G CD2 1 
ATOM 9699  N N   . ALA G 1 75  ? 142.770 96.679  88.739  1.00 74.85  ? 75  ALA G N   1 
ATOM 9700  C CA  . ALA G 1 75  ? 143.081 97.864  89.525  1.00 71.52  ? 75  ALA G CA  1 
ATOM 9701  C C   . ALA G 1 75  ? 141.804 98.652  89.763  1.00 78.01  ? 75  ALA G C   1 
ATOM 9702  O O   . ALA G 1 75  ? 141.190 99.139  88.813  1.00 114.52 ? 75  ALA G O   1 
ATOM 9703  C CB  . ALA G 1 75  ? 144.121 98.741  88.823  1.00 30.00  ? 75  ALA G CB  1 
ATOM 9704  N N   . ILE G 1 76  ? 141.418 98.783  91.028  1.00 65.73  ? 76  ILE G N   1 
ATOM 9705  C CA  . ILE G 1 76  ? 140.196 99.469  91.435  1.00 91.48  ? 76  ILE G CA  1 
ATOM 9706  C C   . ILE G 1 76  ? 140.563 100.821 92.035  1.00 89.44  ? 76  ILE G C   1 
ATOM 9707  O O   . ILE G 1 76  ? 141.419 100.900 92.924  1.00 103.39 ? 76  ILE G O   1 
ATOM 9708  C CB  . ILE G 1 76  ? 139.383 98.604  92.411  1.00 30.00  ? 76  ILE G CB  1 
ATOM 9709  C CG1 . ILE G 1 76  ? 138.265 99.397  93.076  1.00 30.00  ? 76  ILE G CG1 1 
ATOM 9710  C CG2 . ILE G 1 76  ? 140.265 97.866  93.377  1.00 30.00  ? 76  ILE G CG2 1 
ATOM 9711  C CD1 . ILE G 1 76  ? 137.415 98.551  93.995  1.00 30.00  ? 76  ILE G CD1 1 
ATOM 9712  N N   . TYR G 1 77  ? 139.936 101.887 91.533  1.00 92.49  ? 77  TYR G N   1 
ATOM 9713  C CA  . TYR G 1 77  ? 140.198 103.239 92.013  1.00 95.04  ? 77  TYR G CA  1 
ATOM 9714  C C   . TYR G 1 77  ? 139.247 103.551 93.161  1.00 90.68  ? 77  TYR G C   1 
ATOM 9715  O O   . TYR G 1 77  ? 138.051 103.273 93.075  1.00 88.28  ? 77  TYR G O   1 
ATOM 9716  C CB  . TYR G 1 77  ? 139.990 104.293 90.921  1.00 30.00  ? 77  TYR G CB  1 
ATOM 9717  C CG  . TYR G 1 77  ? 140.848 104.234 89.671  1.00 30.00  ? 77  TYR G CG  1 
ATOM 9718  C CD1 . TYR G 1 77  ? 141.924 103.376 89.563  1.00 30.00  ? 77  TYR G CD1 1 
ATOM 9719  C CD2 . TYR G 1 77  ? 140.589 105.084 88.603  1.00 30.00  ? 77  TYR G CD2 1 
ATOM 9720  C CE1 . TYR G 1 77  ? 142.705 103.340 88.427  1.00 30.00  ? 77  TYR G CE1 1 
ATOM 9721  C CE2 . TYR G 1 77  ? 141.367 105.060 87.460  1.00 30.00  ? 77  TYR G CE2 1 
ATOM 9722  C CZ  . TYR G 1 77  ? 142.423 104.184 87.380  1.00 30.00  ? 77  TYR G CZ  1 
ATOM 9723  O OH  . TYR G 1 77  ? 143.200 104.148 86.247  1.00 30.00  ? 77  TYR G OH  1 
ATOM 9724  N N   . ILE G 1 78  ? 139.769 104.150 94.225  1.00 100.82 ? 78  ILE G N   1 
ATOM 9725  C CA  . ILE G 1 78  ? 138.961 104.496 95.389  1.00 80.56  ? 78  ILE G CA  1 
ATOM 9726  C C   . ILE G 1 78  ? 139.234 105.932 95.801  1.00 87.00  ? 78  ILE G C   1 
ATOM 9727  O O   . ILE G 1 78  ? 140.392 106.327 95.972  1.00 104.52 ? 78  ILE G O   1 
ATOM 9728  C CB  . ILE G 1 78  ? 139.202 103.528 96.564  1.00 30.00  ? 78  ILE G CB  1 
ATOM 9729  C CG1 . ILE G 1 78  ? 138.413 102.247 96.341  1.00 30.00  ? 78  ILE G CG1 1 
ATOM 9730  C CG2 . ILE G 1 78  ? 138.877 104.145 97.916  1.00 30.00  ? 78  ILE G CG2 1 
ATOM 9731  C CD1 . ILE G 1 78  ? 138.634 101.221 97.397  1.00 30.00  ? 78  ILE G CD1 1 
ATOM 9732  N N   . SER G 1 79  ? 138.164 106.711 95.937  1.00 77.59  ? 79  SER G N   1 
ATOM 9733  C CA  . SER G 1 79  ? 138.114 107.995 96.614  1.00 81.74  ? 79  SER G CA  1 
ATOM 9734  C C   . SER G 1 79  ? 136.952 107.974 97.593  1.00 98.36  ? 79  SER G C   1 
ATOM 9735  O O   . SER G 1 79  ? 135.876 107.467 97.265  1.00 117.87 ? 79  SER G O   1 
ATOM 9736  C CB  . SER G 1 79  ? 137.932 109.153 95.624  1.00 30.00  ? 79  SER G CB  1 
ATOM 9737  O OG  . SER G 1 79  ? 137.820 110.390 96.303  1.00 30.00  ? 79  SER G OG  1 
ATOM 9738  N N   . PRO G 1 80  ? 137.135 108.502 98.793  1.00 92.20  ? 80  PRO G N   1 
ATOM 9739  C CA  . PRO G 1 80  ? 136.080 108.442 99.806  1.00 88.75  ? 80  PRO G CA  1 
ATOM 9740  C C   . PRO G 1 80  ? 134.965 109.436 99.502  1.00 95.71  ? 80  PRO G C   1 
ATOM 9741  O O   . PRO G 1 80  ? 135.051 110.248 98.586  1.00 117.12 ? 80  PRO G O   1 
ATOM 9742  C CB  . PRO G 1 80  ? 136.814 108.803 101.094 1.00 30.00  ? 80  PRO G CB  1 
ATOM 9743  C CG  . PRO G 1 80  ? 137.918 109.653 100.653 1.00 30.00  ? 80  PRO G CG  1 
ATOM 9744  C CD  . PRO G 1 80  ? 138.358 109.118 99.325  1.00 30.00  ? 80  PRO G CD  1 
ATOM 9745  N N   . ASN G 1 81  ? 133.911 109.366 100.311 1.00 89.04  ? 81  ASN G N   1 
ATOM 9746  C CA  . ASN G 1 81  ? 132.712 110.163 100.091 1.00 119.16 ? 81  ASN G CA  1 
ATOM 9747  C C   . ASN G 1 81  ? 132.952 111.620 100.481 1.00 129.92 ? 81  ASN G C   1 
ATOM 9748  O O   . ASN G 1 81  ? 134.056 112.022 100.856 1.00 123.56 ? 81  ASN G O   1 
ATOM 9749  C CB  . ASN G 1 81  ? 131.530 109.581 100.861 1.00 30.00  ? 81  ASN G CB  1 
ATOM 9750  C CG  . ASN G 1 81  ? 130.976 108.330 100.226 1.00 30.00  ? 81  ASN G CG  1 
ATOM 9751  O OD1 . ASN G 1 81  ? 130.875 108.234 99.008  1.00 30.00  ? 81  ASN G OD1 1 
ATOM 9752  N ND2 . ASN G 1 81  ? 130.582 107.375 101.051 1.00 30.00  ? 81  ASN G ND2 1 
ATOM 9753  N N   . ALA G 1 82  ? 131.896 112.429 100.383 1.00 129.27 ? 82  ALA G N   1 
ATOM 9754  C CA  . ALA G 1 82  ? 131.978 113.829 100.786 1.00 116.73 ? 82  ALA G CA  1 
ATOM 9755  C C   . ALA G 1 82  ? 132.154 113.945 102.292 1.00 106.52 ? 82  ALA G C   1 
ATOM 9756  O O   . ALA G 1 82  ? 133.166 114.467 102.774 1.00 96.85  ? 82  ALA G O   1 
ATOM 9757  C CB  . ALA G 1 82  ? 130.728 114.580 100.326 1.00 30.00  ? 82  ALA G CB  1 
ATOM 9758  N N   . GLY G 1 83  ? 131.188 113.447 103.052 1.00 114.15 ? 83  GLY G N   1 
ATOM 9759  C CA  . GLY G 1 83  ? 131.367 113.369 104.483 1.00 114.95 ? 83  GLY G CA  1 
ATOM 9760  C C   . GLY G 1 83  ? 132.307 112.237 104.817 1.00 115.25 ? 83  GLY G C   1 
ATOM 9761  O O   . GLY G 1 83  ? 132.015 111.085 104.495 1.00 115.65 ? 83  GLY G O   1 
ATOM 9762  N N   . SER G 1 84  ? 133.446 112.543 105.434 1.00 112.07 ? 84  SER G N   1 
ATOM 9763  C CA  . SER G 1 84  ? 134.441 111.523 105.721 1.00 124.31 ? 84  SER G CA  1 
ATOM 9764  C C   . SER G 1 84  ? 135.354 111.973 106.846 1.00 115.58 ? 84  SER G C   1 
ATOM 9765  O O   . SER G 1 84  ? 136.065 112.970 106.707 1.00 106.26 ? 84  SER G O   1 
ATOM 9766  C CB  . SER G 1 84  ? 135.287 111.223 104.485 1.00 30.00  ? 84  SER G CB  1 
ATOM 9767  O OG  . SER G 1 84  ? 136.366 110.380 104.827 1.00 30.00  ? 84  SER G OG  1 
ATOM 9768  N N   . GLU G 1 85  ? 135.328 111.243 107.959 1.00 118.56 ? 85  GLU G N   1 
ATOM 9769  C CA  . GLU G 1 85  ? 136.355 111.400 108.987 1.00 105.86 ? 85  GLU G CA  1 
ATOM 9770  C C   . GLU G 1 85  ? 137.350 110.241 108.926 1.00 107.85 ? 85  GLU G C   1 
ATOM 9771  O O   . GLU G 1 85  ? 137.356 109.345 109.767 1.00 104.84 ? 85  GLU G O   1 
ATOM 9772  C CB  . GLU G 1 85  ? 135.722 111.524 110.369 1.00 30.00  ? 85  GLU G CB  1 
ATOM 9773  C CG  . GLU G 1 85  ? 134.889 112.775 110.549 1.00 30.00  ? 85  GLU G CG  1 
ATOM 9774  C CD  . GLU G 1 85  ? 134.432 112.979 111.982 1.00 30.00  ? 85  GLU G CD  1 
ATOM 9775  O OE1 . GLU G 1 85  ? 134.764 112.135 112.834 1.00 30.00  ? 85  GLU G OE1 1 
ATOM 9776  O OE2 . GLU G 1 85  ? 133.737 113.982 112.252 1.00 30.00  ? 85  GLU G OE2 1 
ATOM 9777  N N   . GLY G 1 86  ? 138.208 110.282 107.909 1.00 113.31 ? 86  GLY G N   1 
ATOM 9778  C CA  . GLY G 1 86  ? 139.402 109.457 107.900 1.00 111.17 ? 86  GLY G CA  1 
ATOM 9779  C C   . GLY G 1 86  ? 139.227 107.957 107.767 1.00 101.55 ? 86  GLY G C   1 
ATOM 9780  O O   . GLY G 1 86  ? 139.410 107.236 108.752 1.00 106.00 ? 86  GLY G O   1 
ATOM 9781  N N   . ILE G 1 87  ? 138.830 107.474 106.592 1.00 75.80  ? 87  ILE G N   1 
ATOM 9782  C CA  . ILE G 1 87  ? 138.852 106.039 106.325 1.00 73.31  ? 87  ILE G CA  1 
ATOM 9783  C C   . ILE G 1 87  ? 140.291 105.542 106.377 1.00 100.35 ? 87  ILE G C   1 
ATOM 9784  O O   . ILE G 1 87  ? 141.173 106.081 105.698 1.00 117.40 ? 87  ILE G O   1 
ATOM 9785  C CB  . ILE G 1 87  ? 138.203 105.712 104.971 1.00 30.00  ? 87  ILE G CB  1 
ATOM 9786  C CG1 . ILE G 1 87  ? 136.682 105.840 105.027 1.00 30.00  ? 87  ILE G CG1 1 
ATOM 9787  C CG2 . ILE G 1 87  ? 138.571 104.328 104.499 1.00 30.00  ? 87  ILE G CG2 1 
ATOM 9788  C CD1 . ILE G 1 87  ? 136.149 107.153 104.584 1.00 30.00  ? 87  ILE G CD1 1 
ATOM 9789  N N   . ASP G 1 88  ? 140.538 104.527 107.198 1.00 103.88 ? 88  ASP G N   1 
ATOM 9790  C CA  . ASP G 1 88  ? 141.812 103.827 107.200 1.00 95.71  ? 88  ASP G CA  1 
ATOM 9791  C C   . ASP G 1 88  ? 141.809 102.759 106.116 1.00 94.42  ? 88  ASP G C   1 
ATOM 9792  O O   . ASP G 1 88  ? 140.767 102.202 105.772 1.00 101.39 ? 88  ASP G O   1 
ATOM 9793  C CB  . ASP G 1 88  ? 142.067 103.178 108.561 1.00 30.00  ? 88  ASP G CB  1 
ATOM 9794  C CG  . ASP G 1 88  ? 143.483 102.629 108.705 1.00 30.00  ? 88  ASP G CG  1 
ATOM 9795  O OD1 . ASP G 1 88  ? 144.324 102.844 107.807 1.00 30.00  ? 88  ASP G OD1 1 
ATOM 9796  O OD2 . ASP G 1 88  ? 143.756 101.967 109.729 1.00 30.00  ? 88  ASP G OD2 1 
ATOM 9797  N N   . LEU G 1 89  ? 142.992 102.471 105.579 1.00 99.19  ? 89  LEU G N   1 
ATOM 9798  C CA  . LEU G 1 89  ? 143.138 101.333 104.687 1.00 104.74 ? 89  LEU G CA  1 
ATOM 9799  C C   . LEU G 1 89  ? 144.031 100.230 105.240 1.00 110.40 ? 89  LEU G C   1 
ATOM 9800  O O   . LEU G 1 89  ? 144.127 99.168  104.619 1.00 132.98 ? 89  LEU G O   1 
ATOM 9801  C CB  . LEU G 1 89  ? 143.649 101.768 103.318 1.00 30.00  ? 89  LEU G CB  1 
ATOM 9802  C CG  . LEU G 1 89  ? 142.671 102.637 102.540 1.00 30.00  ? 89  LEU G CG  1 
ATOM 9803  C CD1 . LEU G 1 89  ? 143.248 102.904 101.189 1.00 30.00  ? 89  LEU G CD1 1 
ATOM 9804  C CD2 . LEU G 1 89  ? 141.315 101.983 102.424 1.00 30.00  ? 89  LEU G CD2 1 
ATOM 9805  N N   . ASN G 1 90  ? 144.684 100.441 106.382 1.00 101.49 ? 90  ASN G N   1 
ATOM 9806  C CA  . ASN G 1 90  ? 145.362 99.316  107.009 1.00 104.71 ? 90  ASN G CA  1 
ATOM 9807  C C   . ASN G 1 90  ? 144.347 98.385  107.652 1.00 105.99 ? 90  ASN G C   1 
ATOM 9808  O O   . ASN G 1 90  ? 144.535 97.166  107.640 1.00 109.37 ? 90  ASN G O   1 
ATOM 9809  C CB  . ASN G 1 90  ? 146.378 99.805  108.040 1.00 30.00  ? 90  ASN G CB  1 
ATOM 9810  C CG  . ASN G 1 90  ? 147.527 98.819  108.261 1.00 30.00  ? 90  ASN G CG  1 
ATOM 9811  O OD1 . ASN G 1 90  ? 148.557 99.181  108.827 1.00 30.00  ? 90  ASN G OD1 1 
ATOM 9812  N ND2 . ASN G 1 90  ? 147.368 97.588  107.788 1.00 30.00  ? 90  ASN G ND2 1 
ATOM 9813  N N   . ASN G 1 91  ? 143.272 98.936  108.213 1.00 96.80  ? 91  ASN G N   1 
ATOM 9814  C CA  . ASN G 1 91  ? 142.144 98.138  108.687 1.00 97.18  ? 91  ASN G CA  1 
ATOM 9815  C C   . ASN G 1 91  ? 141.033 98.227  107.645 1.00 103.39 ? 91  ASN G C   1 
ATOM 9816  O O   . ASN G 1 91  ? 139.997 98.855  107.851 1.00 107.67 ? 91  ASN G O   1 
ATOM 9817  C CB  . ASN G 1 91  ? 141.673 98.628  110.050 1.00 30.00  ? 91  ASN G CB  1 
ATOM 9818  C CG  . ASN G 1 91  ? 142.752 98.561  111.095 1.00 30.00  ? 91  ASN G CG  1 
ATOM 9819  O OD1 . ASN G 1 91  ? 143.178 99.584  111.624 1.00 30.00  ? 91  ASN G OD1 1 
ATOM 9820  N ND2 . ASN G 1 91  ? 143.208 97.356  111.400 1.00 30.00  ? 91  ASN G ND2 1 
ATOM 9821  N N   . THR G 1 92  ? 141.250 97.565  106.511 1.00 101.15 ? 92  THR G N   1 
ATOM 9822  C CA  . THR G 1 92  ? 140.289 97.590  105.416 1.00 84.54  ? 92  THR G CA  1 
ATOM 9823  C C   . THR G 1 92  ? 140.442 96.327  104.596 1.00 86.65  ? 92  THR G C   1 
ATOM 9824  O O   . THR G 1 92  ? 141.545 96.021  104.139 1.00 106.48 ? 92  THR G O   1 
ATOM 9825  C CB  . THR G 1 92  ? 140.496 98.809  104.522 1.00 30.00  ? 92  THR G CB  1 
ATOM 9826  O OG1 . THR G 1 92  ? 140.167 100.000 105.244 1.00 30.00  ? 92  THR G OG1 1 
ATOM 9827  C CG2 . THR G 1 92  ? 139.669 98.720  103.254 1.00 30.00  ? 92  THR G CG2 1 
ATOM 9828  N N   . ARG G 1 93  ? 139.347 95.608  104.398 1.00 78.31  ? 93  ARG G N   1 
ATOM 9829  C CA  . ARG G 1 93  ? 139.374 94.392  103.611 1.00 89.86  ? 93  ARG G CA  1 
ATOM 9830  C C   . ARG G 1 93  ? 138.577 94.595  102.332 1.00 89.07  ? 93  ARG G C   1 
ATOM 9831  O O   . ARG G 1 93  ? 137.392 94.938  102.376 1.00 106.87 ? 93  ARG G O   1 
ATOM 9832  C CB  . ARG G 1 93  ? 138.824 93.220  104.414 1.00 30.00  ? 93  ARG G CB  1 
ATOM 9833  C CG  . ARG G 1 93  ? 139.568 93.027  105.719 1.00 30.00  ? 93  ARG G CG  1 
ATOM 9834  C CD  . ARG G 1 93  ? 141.037 92.750  105.476 1.00 30.00  ? 93  ARG G CD  1 
ATOM 9835  N NE  . ARG G 1 93  ? 141.775 92.519  106.713 1.00 30.00  ? 93  ARG G NE  1 
ATOM 9836  C CZ  . ARG G 1 93  ? 142.337 93.480  107.436 1.00 30.00  ? 93  ARG G CZ  1 
ATOM 9837  N NH1 . ARG G 1 93  ? 142.231 94.741  107.058 1.00 30.00  ? 93  ARG G NH1 1 
ATOM 9838  N NH2 . ARG G 1 93  ? 143.001 93.184  108.541 1.00 30.00  ? 93  ARG G NH2 1 
ATOM 9839  N N   . VAL G 1 94  ? 139.243 94.399  101.196 1.00 84.22  ? 94  VAL G N   1 
ATOM 9840  C CA  . VAL G 1 94  ? 138.580 94.379  99.899  1.00 73.51  ? 94  VAL G CA  1 
ATOM 9841  C C   . VAL G 1 94  ? 138.088 92.967  99.656  1.00 86.10  ? 94  VAL G C   1 
ATOM 9842  O O   . VAL G 1 94  ? 138.885 92.034  99.547  1.00 102.58 ? 94  VAL G O   1 
ATOM 9843  C CB  . VAL G 1 94  ? 139.516 94.828  98.771  1.00 30.00  ? 94  VAL G CB  1 
ATOM 9844  C CG1 . VAL G 1 94  ? 138.852 94.616  97.435  1.00 30.00  ? 94  VAL G CG1 1 
ATOM 9845  C CG2 . VAL G 1 94  ? 139.861 96.276  98.956  1.00 30.00  ? 94  VAL G CG2 1 
ATOM 9846  N N   . VAL G 1 95  ? 136.774 92.799  99.588  1.00 80.17  ? 95  VAL G N   1 
ATOM 9847  C CA  . VAL G 1 95  ? 136.170 91.479  99.514  1.00 77.28  ? 95  VAL G CA  1 
ATOM 9848  C C   . VAL G 1 95  ? 135.487 91.385  98.159  1.00 86.14  ? 95  VAL G C   1 
ATOM 9849  O O   . VAL G 1 95  ? 134.420 91.953  97.958  1.00 98.38  ? 95  VAL G O   1 
ATOM 9850  C CB  . VAL G 1 95  ? 135.176 91.253  100.650 1.00 30.00  ? 95  VAL G CB  1 
ATOM 9851  C CG1 . VAL G 1 95  ? 134.583 89.866  100.557 1.00 30.00  ? 95  VAL G CG1 1 
ATOM 9852  C CG2 . VAL G 1 95  ? 135.829 91.498  101.988 1.00 30.00  ? 95  VAL G CG2 1 
ATOM 9853  N N   . LEU G 1 96  ? 136.098 90.668  97.226  1.00 91.86  ? 96  LEU G N   1 
ATOM 9854  C CA  . LEU G 1 96  ? 135.468 90.404  95.943  1.00 76.62  ? 96  LEU G CA  1 
ATOM 9855  C C   . LEU G 1 96  ? 135.200 88.913  95.814  1.00 90.23  ? 96  LEU G C   1 
ATOM 9856  O O   . LEU G 1 96  ? 136.067 88.090  96.117  1.00 122.98 ? 96  LEU G O   1 
ATOM 9857  C CB  . LEU G 1 96  ? 136.314 90.936  94.781  1.00 30.00  ? 96  LEU G CB  1 
ATOM 9858  C CG  . LEU G 1 96  ? 137.763 90.549  94.487  1.00 30.00  ? 96  LEU G CG  1 
ATOM 9859  C CD1 . LEU G 1 96  ? 137.882 89.310  93.627  1.00 30.00  ? 96  LEU G CD1 1 
ATOM 9860  C CD2 . LEU G 1 96  ? 138.462 91.718  93.816  1.00 30.00  ? 96  LEU G CD2 1 
ATOM 9861  N N   . SER G 1 97  ? 133.987 88.578  95.379  1.00 77.79  ? 97  SER G N   1 
ATOM 9862  C CA  . SER G 1 97  ? 133.540 87.203  95.197  1.00 80.19  ? 97  SER G CA  1 
ATOM 9863  C C   . SER G 1 97  ? 134.043 86.647  93.877  1.00 99.22  ? 97  SER G C   1 
ATOM 9864  O O   . SER G 1 97  ? 135.001 87.169  93.314  1.00 107.37 ? 97  SER G O   1 
ATOM 9865  C CB  . SER G 1 97  ? 132.020 87.128  95.238  1.00 30.00  ? 97  SER G CB  1 
ATOM 9866  O OG  . SER G 1 97  ? 131.455 87.826  94.148  1.00 30.00  ? 97  SER G OG  1 
ATOM 9867  N N   . ASN G 1 98  ? 133.458 85.552  93.409  1.00 30.00  ? 98  ASN G N   1 
ATOM 9868  C CA  . ASN G 1 98  ? 133.641 85.149  92.022  1.00 30.00  ? 98  ASN G CA  1 
ATOM 9869  C C   . ASN G 1 98  ? 132.300 84.596  91.579  1.00 30.00  ? 98  ASN G C   1 
ATOM 9870  O O   . ASN G 1 98  ? 131.299 84.768  92.279  1.00 30.00  ? 98  ASN G O   1 
ATOM 9871  C CB  . ASN G 1 98  ? 134.758 84.105  91.883  1.00 30.00  ? 98  ASN G CB  1 
ATOM 9872  C CG  . ASN G 1 98  ? 135.334 84.021  90.469  1.00 30.00  ? 98  ASN G CG  1 
ATOM 9873  O OD1 . ASN G 1 98  ? 134.896 84.730  89.568  1.00 30.00  ? 98  ASN G OD1 1 
ATOM 9874  N ND2 . ASN G 1 98  ? 136.326 83.159  90.282  1.00 30.00  ? 98  ASN G ND2 1 
ATOM 9875  N N   . GLY G 1 99  ? 132.256 83.938  90.425  1.00 30.00  ? 99  GLY G N   1 
ATOM 9876  C CA  . GLY G 1 99  ? 131.173 83.016  90.192  1.00 30.00  ? 99  GLY G CA  1 
ATOM 9877  C C   . GLY G 1 99  ? 131.191 81.839  91.140  1.00 30.00  ? 99  GLY G C   1 
ATOM 9878  O O   . GLY G 1 99  ? 130.130 81.291  91.445  1.00 30.00  ? 99  GLY G O   1 
ATOM 9879  N N   . THR G 1 100 ? 132.367 81.445  91.628  1.00 85.87  ? 100 THR G N   1 
ATOM 9880  C CA  . THR G 1 100 ? 132.483 80.283  92.497  1.00 102.79 ? 100 THR G CA  1 
ATOM 9881  C C   . THR G 1 100 ? 133.109 80.585  93.851  1.00 104.11 ? 100 THR G C   1 
ATOM 9882  O O   . THR G 1 100 ? 132.546 80.204  94.883  1.00 96.07  ? 100 THR G O   1 
ATOM 9883  C CB  . THR G 1 100 ? 133.288 79.199  91.774  1.00 30.00  ? 100 THR G CB  1 
ATOM 9884  O OG1 . THR G 1 100 ? 132.652 78.892  90.529  1.00 30.00  ? 100 THR G OG1 1 
ATOM 9885  C CG2 . THR G 1 100 ? 133.348 77.946  92.611  1.00 30.00  ? 100 THR G CG2 1 
ATOM 9886  N N   . VAL G 1 101 ? 134.249 81.274  93.888  1.00 97.64  ? 101 VAL G N   1 
ATOM 9887  C CA  . VAL G 1 101 ? 135.127 81.294  95.056  1.00 100.35 ? 101 VAL G CA  1 
ATOM 9888  C C   . VAL G 1 101 ? 135.211 82.707  95.616  1.00 117.38 ? 101 VAL G C   1 
ATOM 9889  O O   . VAL G 1 101 ? 135.669 83.623  94.928  1.00 123.46 ? 101 VAL G O   1 
ATOM 9890  C CB  . VAL G 1 101 ? 136.535 80.783  94.702  1.00 30.00  ? 101 VAL G CB  1 
ATOM 9891  C CG1 . VAL G 1 101 ? 137.441 80.845  95.913  1.00 30.00  ? 101 VAL G CG1 1 
ATOM 9892  C CG2 . VAL G 1 101 ? 136.473 79.373  94.146  1.00 30.00  ? 101 VAL G CG2 1 
ATOM 9893  N N   . GLN G 1 102 ? 134.797 82.873  96.873  1.00 107.35 ? 102 GLN G N   1 
ATOM 9894  C CA  . GLN G 1 102 ? 134.980 84.127  97.596  1.00 99.10  ? 102 GLN G CA  1 
ATOM 9895  C C   . GLN G 1 102 ? 136.455 84.479  97.745  1.00 93.31  ? 102 GLN G C   1 
ATOM 9896  O O   . GLN G 1 102 ? 137.342 83.625  97.702  1.00 114.39 ? 102 GLN G O   1 
ATOM 9897  C CB  . GLN G 1 102 ? 134.365 84.055  98.992  1.00 30.00  ? 102 GLN G CB  1 
ATOM 9898  C CG  . GLN G 1 102 ? 132.876 84.238  99.069  1.00 30.00  ? 102 GLN G CG  1 
ATOM 9899  C CD  . GLN G 1 102 ? 132.470 85.679  98.892  1.00 30.00  ? 102 GLN G CD  1 
ATOM 9900  O OE1 . GLN G 1 102 ? 133.140 86.591  99.372  1.00 30.00  ? 102 GLN G OE1 1 
ATOM 9901  N NE2 . GLN G 1 102 ? 131.362 85.892  98.214  1.00 30.00  ? 102 GLN G NE2 1 
ATOM 9902  N N   . ALA G 1 103 ? 136.705 85.766  97.947  1.00 90.25  ? 103 ALA G N   1 
ATOM 9903  C CA  . ALA G 1 103 ? 138.043 86.224  98.269  1.00 88.34  ? 103 ALA G CA  1 
ATOM 9904  C C   . ALA G 1 103 ? 137.937 87.454  99.148  1.00 104.79 ? 103 ALA G C   1 
ATOM 9905  O O   . ALA G 1 103 ? 137.141 88.351  98.870  1.00 117.96 ? 103 ALA G O   1 
ATOM 9906  C CB  . ALA G 1 103 ? 138.848 86.542  97.008  1.00 30.00  ? 103 ALA G CB  1 
ATOM 9907  N N   . VAL G 1 104 ? 138.722 87.474  100.216 1.00 94.80  ? 104 VAL G N   1 
ATOM 9908  C CA  . VAL G 1 104 ? 138.959 88.686  100.981 1.00 109.96 ? 104 VAL G CA  1 
ATOM 9909  C C   . VAL G 1 104 ? 140.422 89.042  100.782 1.00 89.25  ? 104 VAL G C   1 
ATOM 9910  O O   . VAL G 1 104 ? 141.239 88.185  100.432 1.00 75.68  ? 104 VAL G O   1 
ATOM 9911  C CB  . VAL G 1 104 ? 138.615 88.520  102.474 1.00 30.00  ? 104 VAL G CB  1 
ATOM 9912  C CG1 . VAL G 1 104 ? 137.175 88.120  102.633 1.00 30.00  ? 104 VAL G CG1 1 
ATOM 9913  C CG2 . VAL G 1 104 ? 139.486 87.486  103.097 1.00 30.00  ? 104 VAL G CG2 1 
ATOM 9914  N N   . LEU G 1 105 ? 140.751 90.319  100.952 1.00 88.49  ? 105 LEU G N   1 
ATOM 9915  C CA  . LEU G 1 105 ? 142.094 90.802  100.649 1.00 98.24  ? 105 LEU G CA  1 
ATOM 9916  C C   . LEU G 1 105 ? 142.595 91.658  101.805 1.00 91.87  ? 105 LEU G C   1 
ATOM 9917  O O   . LEU G 1 105 ? 142.053 92.735  102.067 1.00 103.67 ? 105 LEU G O   1 
ATOM 9918  C CB  . LEU G 1 105 ? 142.124 91.588  99.335  1.00 30.00  ? 105 LEU G CB  1 
ATOM 9919  C CG  . LEU G 1 105 ? 142.128 90.866  97.973  1.00 30.00  ? 105 LEU G CG  1 
ATOM 9920  C CD1 . LEU G 1 105 ? 143.228 89.833  97.899  1.00 30.00  ? 105 LEU G CD1 1 
ATOM 9921  C CD2 . LEU G 1 105 ? 140.804 90.268  97.538  1.00 30.00  ? 105 LEU G CD2 1 
ATOM 9922  N N   . LYS G 1 106 ? 143.623 91.171  102.493 1.00 80.59  ? 106 LYS G N   1 
ATOM 9923  C CA  . LYS G 1 106 ? 144.324 91.913  103.529 1.00 95.20  ? 106 LYS G CA  1 
ATOM 9924  C C   . LYS G 1 106 ? 145.238 92.945  102.877 1.00 109.74 ? 106 LYS G C   1 
ATOM 9925  O O   . LYS G 1 106 ? 145.683 92.764  101.743 1.00 125.41 ? 106 LYS G O   1 
ATOM 9926  C CB  . LYS G 1 106 ? 145.132 90.942  104.404 1.00 30.00  ? 106 LYS G CB  1 
ATOM 9927  C CG  . LYS G 1 106 ? 145.867 91.530  105.612 1.00 30.00  ? 106 LYS G CG  1 
ATOM 9928  C CD  . LYS G 1 106 ? 146.483 90.439  106.474 1.00 30.00  ? 106 LYS G CD  1 
ATOM 9929  C CE  . LYS G 1 106 ? 147.667 89.782  105.794 1.00 30.00  ? 106 LYS G CE  1 
ATOM 9930  N NZ  . LYS G 1 106 ? 148.824 90.705  105.693 1.00 30.00  ? 106 LYS G NZ  1 
ATOM 9931  N N   . TYR G 1 107 ? 145.474 94.051  103.582 1.00 113.92 ? 107 TYR G N   1 
ATOM 9932  C CA  . TYR G 1 107 ? 146.466 95.024  103.145 1.00 120.86 ? 107 TYR G CA  1 
ATOM 9933  C C   . TYR G 1 107 ? 147.854 94.403  103.126 1.00 104.10 ? 107 TYR G C   1 
ATOM 9934  O O   . TYR G 1 107 ? 148.185 93.557  103.959 1.00 105.66 ? 107 TYR G O   1 
ATOM 9935  C CB  . TYR G 1 107 ? 146.459 96.245  104.063 1.00 30.00  ? 107 TYR G CB  1 
ATOM 9936  C CG  . TYR G 1 107 ? 147.451 97.319  103.666 1.00 30.00  ? 107 TYR G CG  1 
ATOM 9937  C CD1 . TYR G 1 107 ? 147.169 98.202  102.640 1.00 30.00  ? 107 TYR G CD1 1 
ATOM 9938  C CD2 . TYR G 1 107 ? 148.682 97.433  104.308 1.00 30.00  ? 107 TYR G CD2 1 
ATOM 9939  C CE1 . TYR G 1 107 ? 148.072 99.178  102.281 1.00 30.00  ? 107 TYR G CE1 1 
ATOM 9940  C CE2 . TYR G 1 107 ? 149.594 98.404  103.944 1.00 30.00  ? 107 TYR G CE2 1 
ATOM 9941  C CZ  . TYR G 1 107 ? 149.284 99.270  102.930 1.00 30.00  ? 107 TYR G CZ  1 
ATOM 9942  O OH  . TYR G 1 107 ? 150.193 100.234 102.577 1.00 30.00  ? 107 TYR G OH  1 
ATOM 9943  N N   . GLU G 1 108 ? 148.667 94.826  102.166 1.00 101.18 ? 108 GLU G N   1 
ATOM 9944  C CA  . GLU G 1 108 ? 150.053 94.405  102.078 1.00 107.42 ? 108 GLU G CA  1 
ATOM 9945  C C   . GLU G 1 108 ? 150.958 95.621  102.172 1.00 97.36  ? 108 GLU G C   1 
ATOM 9946  O O   . GLU G 1 108 ? 150.716 96.639  101.516 1.00 99.71  ? 108 GLU G O   1 
ATOM 9947  C CB  . GLU G 1 108 ? 150.316 93.649  100.778 1.00 30.00  ? 108 GLU G CB  1 
ATOM 9948  C CG  . GLU G 1 108 ? 151.744 93.150  100.598 1.00 30.00  ? 108 GLU G CG  1 
ATOM 9949  C CD  . GLU G 1 108 ? 152.158 92.093  101.608 1.00 30.00  ? 108 GLU G CD  1 
ATOM 9950  O OE1 . GLU G 1 108 ? 151.286 91.364  102.119 1.00 30.00  ? 108 GLU G OE1 1 
ATOM 9951  O OE2 . GLU G 1 108 ? 153.369 91.988  101.892 1.00 30.00  ? 108 GLU G OE2 1 
ATOM 9952  N N   . LYS G 1 109 ? 151.994 95.512  103.003 1.00 87.60  ? 109 LYS G N   1 
ATOM 9953  C CA  . LYS G 1 109 ? 153.008 96.547  103.124 1.00 83.82  ? 109 LYS G CA  1 
ATOM 9954  C C   . LYS G 1 109 ? 153.945 96.512  101.920 1.00 93.03  ? 109 LYS G C   1 
ATOM 9955  O O   . LYS G 1 109 ? 153.970 95.550  101.147 1.00 117.66 ? 109 LYS G O   1 
ATOM 9956  C CB  . LYS G 1 109 ? 153.795 96.372  104.420 1.00 30.00  ? 109 LYS G CB  1 
ATOM 9957  C CG  . LYS G 1 109 ? 152.982 96.577  105.682 1.00 30.00  ? 109 LYS G CG  1 
ATOM 9958  C CD  . LYS G 1 109 ? 153.846 96.417  106.924 1.00 30.00  ? 109 LYS G CD  1 
ATOM 9959  C CE  . LYS G 1 109 ? 153.035 96.606  108.198 1.00 30.00  ? 109 LYS G CE  1 
ATOM 9960  N NZ  . LYS G 1 109 ? 153.870 96.450  109.425 1.00 30.00  ? 109 LYS G NZ  1 
ATOM 9961  N N   . THR G 1 110 ? 154.730 97.583  101.785 1.00 94.95  ? 110 THR G N   1 
ATOM 9962  C CA  . THR G 1 110 ? 155.799 97.742  100.788 1.00 121.68 ? 110 THR G CA  1 
ATOM 9963  C C   . THR G 1 110 ? 155.291 97.562  99.360  1.00 133.18 ? 110 THR G C   1 
ATOM 9964  O O   . THR G 1 110 ? 155.759 96.697  98.616  1.00 143.94 ? 110 THR G O   1 
ATOM 9965  C CB  . THR G 1 110 ? 156.977 96.798  101.058 1.00 30.00  ? 110 THR G CB  1 
ATOM 9966  O OG1 . THR G 1 110 ? 156.584 95.440  100.824 1.00 30.00  ? 110 THR G OG1 1 
ATOM 9967  C CG2 . THR G 1 110 ? 157.453 96.938  102.493 1.00 30.00  ? 110 THR G CG2 1 
ATOM 9968  N N   . ALA G 1 111 ? 154.301 98.378  98.984  1.00 106.50 ? 111 ALA G N   1 
ATOM 9969  C CA  . ALA G 1 111 ? 153.884 98.473  97.582  1.00 107.45 ? 111 ALA G CA  1 
ATOM 9970  C C   . ALA G 1 111 ? 153.290 99.864  97.340  1.00 124.52 ? 111 ALA G C   1 
ATOM 9971  O O   . ALA G 1 111 ? 152.084 100.049 97.477  1.00 140.43 ? 111 ALA G O   1 
ATOM 9972  C CB  . ALA G 1 111 ? 152.881 97.378  97.244  1.00 30.00  ? 111 ALA G CB  1 
ATOM 9973  N N   . TYR G 1 112 ? 154.119 100.823 96.918  1.00 30.00  ? 112 TYR G N   1 
ATOM 9974  C CA  . TYR G 1 112 ? 153.561 102.121 96.543  1.00 30.00  ? 112 TYR G CA  1 
ATOM 9975  C C   . TYR G 1 112 ? 153.718 102.472 95.070  1.00 30.00  ? 112 TYR G C   1 
ATOM 9976  O O   . TYR G 1 112 ? 152.699 102.558 94.382  1.00 30.00  ? 112 TYR G O   1 
ATOM 9977  C CB  . TYR G 1 112 ? 154.143 103.257 97.388  1.00 30.00  ? 112 TYR G CB  1 
ATOM 9978  C CG  . TYR G 1 112 ? 153.402 103.513 98.672  1.00 30.00  ? 112 TYR G CG  1 
ATOM 9979  C CD1 . TYR G 1 112 ? 152.229 102.847 98.954  1.00 30.00  ? 112 TYR G CD1 1 
ATOM 9980  C CD2 . TYR G 1 112 ? 153.821 104.501 99.549  1.00 30.00  ? 112 TYR G CD2 1 
ATOM 9981  C CE1 . TYR G 1 112 ? 151.534 103.099 100.101 1.00 30.00  ? 112 TYR G CE1 1 
ATOM 9982  C CE2 . TYR G 1 112 ? 153.126 104.763 100.706 1.00 30.00  ? 112 TYR G CE2 1 
ATOM 9983  C CZ  . TYR G 1 112 ? 151.981 104.054 100.970 1.00 30.00  ? 112 TYR G CZ  1 
ATOM 9984  O OH  . TYR G 1 112 ? 151.259 104.287 102.106 1.00 30.00  ? 112 TYR G OH  1 
ATOM 9985  N N   . HIS G 1 113 ? 154.946 102.614 94.559  1.00 30.00  ? 113 HIS G N   1 
ATOM 9986  C CA  . HIS G 1 113 ? 155.227 103.148 93.215  1.00 30.00  ? 113 HIS G CA  1 
ATOM 9987  C C   . HIS G 1 113 ? 154.463 104.455 92.967  1.00 30.00  ? 113 HIS G C   1 
ATOM 9988  O O   . HIS G 1 113 ? 153.506 104.525 92.194  1.00 30.00  ? 113 HIS G O   1 
ATOM 9989  C CB  . HIS G 1 113 ? 154.943 102.088 92.146  1.00 30.00  ? 113 HIS G CB  1 
ATOM 9990  C CG  . HIS G 1 113 ? 155.237 102.527 90.749  1.00 30.00  ? 113 HIS G CG  1 
ATOM 9991  N ND1 . HIS G 1 113 ? 156.512 102.804 90.309  1.00 30.00  ? 113 HIS G ND1 1 
ATOM 9992  C CD2 . HIS G 1 113 ? 154.424 102.689 89.680  1.00 30.00  ? 113 HIS G CD2 1 
ATOM 9993  C CE1 . HIS G 1 113 ? 156.469 103.148 89.035  1.00 30.00  ? 113 HIS G CE1 1 
ATOM 9994  N NE2 . HIS G 1 113 ? 155.213 103.082 88.628  1.00 30.00  ? 113 HIS G NE2 1 
ATOM 9995  N N   . LYS G 1 114 ? 154.862 105.483 93.709  1.00 30.00  ? 114 LYS G N   1 
ATOM 9996  C CA  . LYS G 1 114 ? 154.091 106.711 93.833  1.00 30.00  ? 114 LYS G CA  1 
ATOM 9997  C C   . LYS G 1 114 ? 154.700 107.907 93.115  1.00 30.00  ? 114 LYS G C   1 
ATOM 9998  O O   . LYS G 1 114 ? 154.188 109.021 93.264  1.00 30.00  ? 114 LYS G O   1 
ATOM 9999  C CB  . LYS G 1 114 ? 153.907 107.035 95.318  1.00 30.00  ? 114 LYS G CB  1 
ATOM 10000 C CG  . LYS G 1 114 ? 155.220 107.223 96.050  1.00 30.00  ? 114 LYS G CG  1 
ATOM 10001 C CD  . LYS G 1 114 ? 155.026 107.382 97.544  1.00 30.00  ? 114 LYS G CD  1 
ATOM 10002 C CE  . LYS G 1 114 ? 156.367 107.523 98.243  1.00 30.00  ? 114 LYS G CE  1 
ATOM 10003 N NZ  . LYS G 1 114 ? 156.225 107.649 99.715  1.00 30.00  ? 114 LYS G NZ  1 
ATOM 10004 N N   . GLY G 1 115 ? 155.769 107.719 92.344  1.00 30.00  ? 115 GLY G N   1 
ATOM 10005 C CA  . GLY G 1 115 ? 156.402 108.836 91.666  1.00 30.00  ? 115 GLY G CA  1 
ATOM 10006 C C   . GLY G 1 115 ? 156.388 108.769 90.152  1.00 30.00  ? 115 GLY G C   1 
ATOM 10007 O O   . GLY G 1 115 ? 156.323 109.802 89.482  1.00 30.00  ? 115 GLY G O   1 
ATOM 10008 N N   . ALA G 1 116 ? 156.456 107.560 89.600  1.00 30.00  ? 116 ALA G N   1 
ATOM 10009 C CA  . ALA G 1 116 ? 156.364 107.325 88.160  1.00 30.00  ? 116 ALA G CA  1 
ATOM 10010 C C   . ALA G 1 116 ? 155.006 106.752 87.789  1.00 30.00  ? 116 ALA G C   1 
ATOM 10011 O O   . ALA G 1 116 ? 154.895 105.861 86.942  1.00 30.00  ? 116 ALA G O   1 
ATOM 10012 C CB  . ALA G 1 116 ? 157.485 106.404 87.693  1.00 30.00  ? 116 ALA G CB  1 
ATOM 10013 N N   . VAL G 1 117 ? 153.960 107.277 88.431  1.00 30.00  ? 117 VAL G N   1 
ATOM 10014 C CA  . VAL G 1 117 ? 152.615 106.711 88.487  1.00 30.00  ? 117 VAL G CA  1 
ATOM 10015 C C   . VAL G 1 117 ? 151.949 106.655 87.113  1.00 30.00  ? 117 VAL G C   1 
ATOM 10016 O O   . VAL G 1 117 ? 151.080 105.810 86.868  1.00 30.00  ? 117 VAL G O   1 
ATOM 10017 C CB  . VAL G 1 117 ? 151.785 107.515 89.514  1.00 30.00  ? 117 VAL G CB  1 
ATOM 10018 C CG1 . VAL G 1 117 ? 151.628 108.977 89.087  1.00 30.00  ? 117 VAL G CG1 1 
ATOM 10019 C CG2 . VAL G 1 117 ? 150.439 106.850 89.831  1.00 30.00  ? 117 VAL G CG2 1 
ATOM 10020 N N   . GLY G 1 118 ? 152.415 107.481 86.171  1.00 30.00  ? 118 GLY G N   1 
ATOM 10021 C CA  . GLY G 1 118 ? 151.780 107.585 84.864  1.00 30.00  ? 118 GLY G CA  1 
ATOM 10022 C C   . GLY G 1 118 ? 151.971 106.392 83.946  1.00 30.00  ? 118 GLY G C   1 
ATOM 10023 O O   . GLY G 1 118 ? 151.526 106.439 82.796  1.00 30.00  ? 118 GLY G O   1 
ATOM 10024 N N   . ASP G 1 119 ? 152.634 105.342 84.411  1.00 30.00  ? 119 ASP G N   1 
ATOM 10025 C CA  . ASP G 1 119 ? 152.595 104.030 83.780  1.00 30.00  ? 119 ASP G CA  1 
ATOM 10026 C C   . ASP G 1 119 ? 152.092 103.060 84.839  1.00 30.00  ? 119 ASP G C   1 
ATOM 10027 O O   . ASP G 1 119 ? 152.869 102.600 85.683  1.00 30.00  ? 119 ASP G O   1 
ATOM 10028 C CB  . ASP G 1 119 ? 153.967 103.626 83.250  1.00 30.00  ? 119 ASP G CB  1 
ATOM 10029 C CG  . ASP G 1 119 ? 154.401 104.463 82.065  1.00 30.00  ? 119 ASP G CG  1 
ATOM 10030 O OD1 . ASP G 1 119 ? 153.522 104.937 81.317  1.00 30.00  ? 119 ASP G OD1 1 
ATOM 10031 O OD2 . ASP G 1 119 ? 155.622 104.644 81.877  1.00 30.00  ? 119 ASP G OD2 1 
ATOM 10032 N N   . VAL G 1 120 ? 150.791 102.759 84.798  1.00 30.00  ? 120 VAL G N   1 
ATOM 10033 C CA  . VAL G 1 120 ? 150.144 102.084 85.920  1.00 30.00  ? 120 VAL G CA  1 
ATOM 10034 C C   . VAL G 1 120 ? 150.512 100.607 85.955  1.00 30.00  ? 120 VAL G C   1 
ATOM 10035 O O   . VAL G 1 120 ? 150.908 100.073 86.998  1.00 30.00  ? 120 VAL G O   1 
ATOM 10036 C CB  . VAL G 1 120 ? 148.620 102.281 85.851  1.00 30.00  ? 120 VAL G CB  1 
ATOM 10037 C CG1 . VAL G 1 120 ? 147.949 101.559 86.995  1.00 30.00  ? 120 VAL G CG1 1 
ATOM 10038 C CG2 . VAL G 1 120 ? 148.278 103.749 85.877  1.00 30.00  ? 120 VAL G CG2 1 
ATOM 10039 N N   . PHE G 1 121 ? 150.406 99.928  84.818  1.00 30.00  ? 121 PHE G N   1 
ATOM 10040 C CA  . PHE G 1 121 ? 150.507 98.477  84.762  1.00 30.00  ? 121 PHE G CA  1 
ATOM 10041 C C   . PHE G 1 121 ? 151.920 98.002  84.463  1.00 30.00  ? 121 PHE G C   1 
ATOM 10042 O O   . PHE G 1 121 ? 152.131 96.818  84.179  1.00 30.00  ? 121 PHE G O   1 
ATOM 10043 C CB  . PHE G 1 121 ? 149.521 97.949  83.727  1.00 30.00  ? 121 PHE G CB  1 
ATOM 10044 C CG  . PHE G 1 121 ? 148.094 98.142  84.120  1.00 30.00  ? 121 PHE G CG  1 
ATOM 10045 C CD1 . PHE G 1 121 ? 147.733 98.221  85.453  1.00 30.00  ? 121 PHE G CD1 1 
ATOM 10046 C CD2 . PHE G 1 121 ? 147.124 98.323  83.159  1.00 30.00  ? 121 PHE G CD2 1 
ATOM 10047 C CE1 . PHE G 1 121 ? 146.426 98.414  85.811  1.00 30.00  ? 121 PHE G CE1 1 
ATOM 10048 C CE2 . PHE G 1 121 ? 145.815 98.524  83.518  1.00 30.00  ? 121 PHE G CE2 1 
ATOM 10049 C CZ  . PHE G 1 121 ? 145.472 98.561  84.841  1.00 30.00  ? 121 PHE G CZ  1 
ATOM 10050 N N   . ASN G 1 122 ? 152.889 98.909  84.515  1.00 30.00  ? 122 ASN G N   1 
ATOM 10051 C CA  . ASN G 1 122 ? 154.281 98.529  84.341  1.00 30.00  ? 122 ASN G CA  1 
ATOM 10052 C C   . ASN G 1 122 ? 154.738 97.726  85.553  1.00 30.00  ? 122 ASN G C   1 
ATOM 10053 O O   . ASN G 1 122 ? 154.273 97.950  86.675  1.00 30.00  ? 122 ASN G O   1 
ATOM 10054 C CB  . ASN G 1 122 ? 155.145 99.779  84.154  1.00 30.00  ? 122 ASN G CB  1 
ATOM 10055 C CG  . ASN G 1 122 ? 156.541 99.466  83.642  1.00 30.00  ? 122 ASN G CG  1 
ATOM 10056 O OD1 . ASN G 1 122 ? 156.884 98.313  83.380  1.00 30.00  ? 122 ASN G OD1 1 
ATOM 10057 N ND2 . ASN G 1 122 ? 157.355 100.503 83.496  1.00 30.00  ? 122 ASN G ND2 1 
ATOM 10058 N N   . ALA G 1 123 ? 155.649 96.780  85.322  1.00 30.00  ? 123 ALA G N   1 
ATOM 10059 C CA  . ALA G 1 123 ? 156.097 95.868  86.370  1.00 30.00  ? 123 ALA G CA  1 
ATOM 10060 C C   . ALA G 1 123 ? 157.020 96.570  87.357  1.00 30.00  ? 123 ALA G C   1 
ATOM 10061 O O   . ALA G 1 123 ? 158.229 96.322  87.372  1.00 30.00  ? 123 ALA G O   1 
ATOM 10062 C CB  . ALA G 1 123 ? 156.803 94.658  85.756  1.00 30.00  ? 123 ALA G CB  1 
ATOM 10063 N N   . SER G 1 124 ? 156.457 97.448  88.181  1.00 30.00  ? 124 SER G N   1 
ATOM 10064 C CA  . SER G 1 124 ? 157.228 98.244  89.121  1.00 30.00  ? 124 SER G CA  1 
ATOM 10065 C C   . SER G 1 124 ? 157.286 97.563  90.484  1.00 30.00  ? 124 SER G C   1 
ATOM 10066 O O   . SER G 1 124 ? 156.937 96.390  90.641  1.00 30.00  ? 124 SER G O   1 
ATOM 10067 C CB  . SER G 1 124 ? 156.645 99.644  89.246  1.00 30.00  ? 124 SER G CB  1 
ATOM 10068 O OG  . SER G 1 124 ? 157.383 100.390 90.198  1.00 30.00  ? 124 SER G OG  1 
ATOM 10069 N N   . THR G 1 125 ? 157.732 98.317  91.491  1.00 30.00  ? 125 THR G N   1 
ATOM 10070 C CA  . THR G 1 125 ? 157.933 97.770  92.825  1.00 30.00  ? 125 THR G CA  1 
ATOM 10071 C C   . THR G 1 125 ? 156.627 97.483  93.552  1.00 30.00  ? 125 THR G C   1 
ATOM 10072 O O   . THR G 1 125 ? 156.638 96.742  94.539  1.00 30.00  ? 125 THR G O   1 
ATOM 10073 C CB  . THR G 1 125 ? 158.775 98.732  93.658  1.00 30.00  ? 125 THR G CB  1 
ATOM 10074 O OG1 . THR G 1 125 ? 158.073 99.972  93.801  1.00 30.00  ? 125 THR G OG1 1 
ATOM 10075 C CG2 . THR G 1 125 ? 160.105 98.990  92.972  1.00 30.00  ? 125 THR G CG2 1 
ATOM 10076 N N   . ALA G 1 126 ? 155.512 98.047  93.100  1.00 30.00  ? 126 ALA G N   1 
ATOM 10077 C CA  . ALA G 1 126 ? 154.251 97.874  93.804  1.00 30.00  ? 126 ALA G CA  1 
ATOM 10078 C C   . ALA G 1 126 ? 153.382 96.779  93.219  1.00 30.00  ? 126 ALA G C   1 
ATOM 10079 O O   . ALA G 1 126 ? 152.157 96.929  93.192  1.00 30.00  ? 126 ALA G O   1 
ATOM 10080 C CB  . ALA G 1 126 ? 153.475 99.182  93.827  1.00 30.00  ? 126 ALA G CB  1 
ATOM 10081 N N   . TRP G 1 127 ? 153.980 95.698  92.727  1.00 30.00  ? 127 TRP G N   1 
ATOM 10082 C CA  . TRP G 1 127 ? 153.233 94.557  92.216  1.00 30.00  ? 127 TRP G CA  1 
ATOM 10083 C C   . TRP G 1 127 ? 153.783 93.231  92.719  1.00 30.00  ? 127 TRP G C   1 
ATOM 10084 O O   . TRP G 1 127 ? 153.243 92.177  92.368  1.00 30.00  ? 127 TRP G O   1 
ATOM 10085 C CB  . TRP G 1 127 ? 153.219 94.590  90.691  1.00 30.00  ? 127 TRP G CB  1 
ATOM 10086 C CG  . TRP G 1 127 ? 152.318 95.642  90.147  1.00 30.00  ? 127 TRP G CG  1 
ATOM 10087 C CD1 . TRP G 1 127 ? 152.595 96.969  90.006  1.00 30.00  ? 127 TRP G CD1 1 
ATOM 10088 C CD2 . TRP G 1 127 ? 151.022 95.442  89.582  1.00 30.00  ? 127 TRP G CD2 1 
ATOM 10089 N NE1 . TRP G 1 127 ? 151.525 97.619  89.439  1.00 30.00  ? 127 TRP G NE1 1 
ATOM 10090 C CE2 . TRP G 1 127 ? 150.549 96.700  89.162  1.00 30.00  ? 127 TRP G CE2 1 
ATOM 10091 C CE3 . TRP G 1 127 ? 150.210 94.325  89.406  1.00 30.00  ? 127 TRP G CE3 1 
ATOM 10092 C CZ2 . TRP G 1 127 ? 149.306 96.867  88.569  1.00 30.00  ? 127 TRP G CZ2 1 
ATOM 10093 C CZ3 . TRP G 1 127 ? 148.976 94.495  88.832  1.00 30.00  ? 127 TRP G CZ3 1 
ATOM 10094 C CH2 . TRP G 1 127 ? 148.534 95.753  88.411  1.00 30.00  ? 127 TRP G CH2 1 
ATOM 10095 N N   . ASN G 1 128 ? 154.830 93.253  93.539  1.00 30.00  ? 128 ASN G N   1 
ATOM 10096 C CA  . ASN G 1 128 ? 155.327 92.047  94.196  1.00 30.00  ? 128 ASN G CA  1 
ATOM 10097 C C   . ASN G 1 128 ? 154.343 91.721  95.307  1.00 30.00  ? 128 ASN G C   1 
ATOM 10098 O O   . ASN G 1 128 ? 154.520 92.111  96.461  1.00 30.00  ? 128 ASN G O   1 
ATOM 10099 C CB  . ASN G 1 128 ? 156.739 92.260  94.731  1.00 30.00  ? 128 ASN G CB  1 
ATOM 10100 C CG  . ASN G 1 128 ? 157.393 90.970  95.223  1.00 30.00  ? 128 ASN G CG  1 
ATOM 10101 O OD1 . ASN G 1 128 ? 156.811 89.888  95.148  1.00 30.00  ? 128 ASN G OD1 1 
ATOM 10102 N ND2 . ASN G 1 128 ? 158.615 91.089  95.729  1.00 30.00  ? 128 ASN G ND2 1 
ATOM 10103 N N   . LEU G 1 129 ? 153.285 90.997  94.953  1.00 30.00  ? 129 LEU G N   1 
ATOM 10104 C CA  . LEU G 1 129 ? 152.214 90.718  95.893  1.00 30.00  ? 129 LEU G CA  1 
ATOM 10105 C C   . LEU G 1 129 ? 151.655 89.331  95.610  1.00 30.00  ? 129 LEU G C   1 
ATOM 10106 O O   . LEU G 1 129 ? 151.971 88.704  94.597  1.00 30.00  ? 129 LEU G O   1 
ATOM 10107 C CB  . LEU G 1 129 ? 151.150 91.820  95.835  1.00 30.00  ? 129 LEU G CB  1 
ATOM 10108 C CG  . LEU G 1 129 ? 150.409 92.140  94.539  1.00 30.00  ? 129 LEU G CG  1 
ATOM 10109 C CD1 . LEU G 1 129 ? 149.107 91.381  94.451  1.00 30.00  ? 129 LEU G CD1 1 
ATOM 10110 C CD2 . LEU G 1 129 ? 150.180 93.631  94.422  1.00 30.00  ? 129 LEU G CD2 1 
ATOM 10111 N N   . SER G 1 130 ? 150.813 88.859  96.526  1.00 30.00  ? 130 SER G N   1 
ATOM 10112 C CA  . SER G 1 130 ? 150.419 87.456  96.562  1.00 30.00  ? 130 SER G CA  1 
ATOM 10113 C C   . SER G 1 130 ? 148.903 87.298  96.570  1.00 30.00  ? 130 SER G C   1 
ATOM 10114 O O   . SER G 1 130 ? 148.184 88.215  96.157  1.00 30.00  ? 130 SER G O   1 
ATOM 10115 C CB  . SER G 1 130 ? 151.051 86.753  97.766  1.00 30.00  ? 130 SER G CB  1 
ATOM 10116 O OG  . SER G 1 130 ? 150.577 87.286  98.984  1.00 30.00  ? 130 SER G OG  1 
ATOM 10117 N N   . ASN G 1 131 ? 148.441 86.101  96.957  1.00 30.00  ? 131 ASN G N   1 
ATOM 10118 C CA  . ASN G 1 131 ? 147.024 85.735  96.932  1.00 30.00  ? 131 ASN G CA  1 
ATOM 10119 C C   . ASN G 1 131 ? 146.158 86.702  97.734  1.00 30.00  ? 131 ASN G C   1 
ATOM 10120 O O   . ASN G 1 131 ? 145.265 87.356  97.186  1.00 30.00  ? 131 ASN G O   1 
ATOM 10121 C CB  . ASN G 1 131 ? 146.849 84.326  97.494  1.00 30.00  ? 131 ASN G CB  1 
ATOM 10122 C CG  . ASN G 1 131 ? 147.577 83.285  96.691  1.00 30.00  ? 131 ASN G CG  1 
ATOM 10123 O OD1 . ASN G 1 131 ? 147.609 83.337  95.465  1.00 30.00  ? 131 ASN G OD1 1 
ATOM 10124 N ND2 . ASN G 1 131 ? 148.173 82.321  97.382  1.00 30.00  ? 131 ASN G ND2 1 
ATOM 10125 N N   . THR G 1 132 ? 146.416 86.812  99.035  1.00 30.00  ? 132 THR G N   1 
ATOM 10126 C CA  . THR G 1 132 ? 145.511 87.464  99.980  1.00 30.00  ? 132 THR G CA  1 
ATOM 10127 C C   . THR G 1 132 ? 145.816 88.944  100.145 1.00 30.00  ? 132 THR G C   1 
ATOM 10128 O O   . THR G 1 132 ? 145.509 89.529  101.185 1.00 30.00  ? 132 THR G O   1 
ATOM 10129 C CB  . THR G 1 132 ? 145.598 86.776  101.333 1.00 30.00  ? 132 THR G CB  1 
ATOM 10130 O OG1 . THR G 1 132 ? 146.835 87.141  101.954 1.00 30.00  ? 132 THR G OG1 1 
ATOM 10131 C CG2 . THR G 1 132 ? 145.620 85.282  101.144 1.00 30.00  ? 132 THR G CG2 1 
ATOM 10132 N N   . ASN G 1 133 ? 146.418 89.579  99.147  1.00 30.00  ? 133 ASN G N   1 
ATOM 10133 C CA  . ASN G 1 133 ? 146.973 90.911  99.312  1.00 30.00  ? 133 ASN G CA  1 
ATOM 10134 C C   . ASN G 1 133 ? 146.489 91.829  98.200  1.00 30.00  ? 133 ASN G C   1 
ATOM 10135 O O   . ASN G 1 133 ? 146.065 91.375  97.137  1.00 30.00  ? 133 ASN G O   1 
ATOM 10136 C CB  . ASN G 1 133 ? 148.500 90.854  99.314  1.00 30.00  ? 133 ASN G CB  1 
ATOM 10137 C CG  . ASN G 1 133 ? 149.044 90.001  100.436 1.00 30.00  ? 133 ASN G CG  1 
ATOM 10138 O OD1 . ASN G 1 133 ? 149.684 88.982  100.200 1.00 30.00  ? 133 ASN G OD1 1 
ATOM 10139 N ND2 . ASN G 1 133 ? 148.783 90.410  101.667 1.00 30.00  ? 133 ASN G ND2 1 
ATOM 10140 N N   . PHE G 1 134 ? 146.564 93.136  98.449  1.00 30.00  ? 134 PHE G N   1 
ATOM 10141 C CA  . PHE G 1 134 ? 146.299 94.113  97.405  1.00 30.00  ? 134 PHE G CA  1 
ATOM 10142 C C   . PHE G 1 134 ? 147.323 95.236  97.454  1.00 30.00  ? 134 PHE G C   1 
ATOM 10143 O O   . PHE G 1 134 ? 147.729 95.682  98.528  1.00 30.00  ? 134 PHE G O   1 
ATOM 10144 C CB  . PHE G 1 134 ? 144.875 94.690  97.478  1.00 30.00  ? 134 PHE G CB  1 
ATOM 10145 C CG  . PHE G 1 134 ? 144.538 95.387  98.769  1.00 30.00  ? 134 PHE G CG  1 
ATOM 10146 C CD1 . PHE G 1 134 ? 143.978 94.682  99.814  1.00 30.00  ? 134 PHE G CD1 1 
ATOM 10147 C CD2 . PHE G 1 134 ? 144.717 96.754  98.917  1.00 30.00  ? 134 PHE G CD2 1 
ATOM 10148 C CE1 . PHE G 1 134 ? 143.634 95.316  100.990 1.00 30.00  ? 134 PHE G CE1 1 
ATOM 10149 C CE2 . PHE G 1 134 ? 144.382 97.391  100.095 1.00 30.00  ? 134 PHE G CE2 1 
ATOM 10150 C CZ  . PHE G 1 134 ? 143.844 96.671  101.132 1.00 30.00  ? 134 PHE G CZ  1 
ATOM 10151 N N   . GLY G 1 135 ? 147.733 95.690  96.266  1.00 30.00  ? 135 GLY G N   1 
ATOM 10152 C CA  . GLY G 1 135 ? 148.633 96.814  96.132  1.00 30.00  ? 135 GLY G CA  1 
ATOM 10153 C C   . GLY G 1 135 ? 147.877 98.124  96.226  1.00 30.00  ? 135 GLY G C   1 
ATOM 10154 O O   . GLY G 1 135 ? 146.700 98.201  95.902  1.00 30.00  ? 135 GLY G O   1 
ATOM 10155 N N   . ILE G 1 136 ? 148.571 99.156  96.696  1.00 30.00  ? 136 ILE G N   1 
ATOM 10156 C CA  . ILE G 1 136 ? 147.916 100.355 97.201  1.00 30.00  ? 136 ILE G CA  1 
ATOM 10157 C C   . ILE G 1 136 ? 148.473 101.612 96.517  1.00 30.00  ? 136 ILE G C   1 
ATOM 10158 O O   . ILE G 1 136 ? 148.723 102.636 97.166  1.00 30.00  ? 136 ILE G O   1 
ATOM 10159 C CB  . ILE G 1 136 ? 148.001 100.338 98.747  1.00 30.00  ? 136 ILE G CB  1 
ATOM 10160 C CG1 . ILE G 1 136 ? 147.039 101.327 99.421  1.00 30.00  ? 136 ILE G CG1 1 
ATOM 10161 C CG2 . ILE G 1 136 ? 149.429 100.363 99.253  1.00 30.00  ? 136 ILE G CG2 1 
ATOM 10162 C CD1 . ILE G 1 136 ? 145.624 101.017 99.127  1.00 30.00  ? 136 ILE G CD1 1 
ATOM 10163 N N   . ILE G 1 137 ? 148.726 101.523 95.201  1.00 30.00  ? 137 ILE G N   1 
ATOM 10164 C CA  . ILE G 1 137 ? 149.403 102.603 94.474  1.00 30.00  ? 137 ILE G CA  1 
ATOM 10165 C C   . ILE G 1 137 ? 148.559 103.871 94.526  1.00 30.00  ? 137 ILE G C   1 
ATOM 10166 O O   . ILE G 1 137 ? 147.324 103.823 94.486  1.00 30.00  ? 137 ILE G O   1 
ATOM 10167 C CB  . ILE G 1 137 ? 149.741 102.159 93.037  1.00 30.00  ? 137 ILE G CB  1 
ATOM 10168 C CG1 . ILE G 1 137 ? 148.567 102.167 92.056  1.00 30.00  ? 137 ILE G CG1 1 
ATOM 10169 C CG2 . ILE G 1 137 ? 150.240 100.747 93.051  1.00 30.00  ? 137 ILE G CG2 1 
ATOM 10170 C CD1 . ILE G 1 137 ? 148.568 103.382 91.119  1.00 30.00  ? 137 ILE G CD1 1 
ATOM 10171 N N   . VAL G 1 138 ? 149.216 105.007 94.722  1.00 30.00  ? 138 VAL G N   1 
ATOM 10172 C CA  . VAL G 1 138 ? 148.544 106.190 95.239  1.00 30.00  ? 138 VAL G CA  1 
ATOM 10173 C C   . VAL G 1 138 ? 148.777 107.357 94.291  1.00 30.00  ? 138 VAL G C   1 
ATOM 10174 O O   . VAL G 1 138 ? 149.808 107.430 93.614  1.00 30.00  ? 138 VAL G O   1 
ATOM 10175 C CB  . VAL G 1 138 ? 149.019 106.496 96.679  1.00 30.00  ? 138 VAL G CB  1 
ATOM 10176 C CG1 . VAL G 1 138 ? 150.482 106.915 96.721  1.00 30.00  ? 138 VAL G CG1 1 
ATOM 10177 C CG2 . VAL G 1 138 ? 148.121 107.502 97.375  1.00 30.00  ? 138 VAL G CG2 1 
ATOM 10178 N N   . LEU G 1 139 ? 147.779 108.226 94.188  1.00 30.00  ? 139 LEU G N   1 
ATOM 10179 C CA  . LEU G 1 139 ? 147.854 109.443 93.402  1.00 30.00  ? 139 LEU G CA  1 
ATOM 10180 C C   . LEU G 1 139 ? 146.912 110.466 94.015  1.00 30.00  ? 139 LEU G C   1 
ATOM 10181 O O   . LEU G 1 139 ? 145.927 110.106 94.662  1.00 30.00  ? 139 LEU G O   1 
ATOM 10182 C CB  . LEU G 1 139 ? 147.533 109.164 91.921  1.00 30.00  ? 139 LEU G CB  1 
ATOM 10183 C CG  . LEU G 1 139 ? 146.254 108.438 91.478  1.00 30.00  ? 139 LEU G CG  1 
ATOM 10184 C CD1 . LEU G 1 139 ? 145.060 109.358 91.280  1.00 30.00  ? 139 LEU G CD1 1 
ATOM 10185 C CD2 . LEU G 1 139 ? 146.520 107.649 90.210  1.00 30.00  ? 139 LEU G CD2 1 
ATOM 10186 N N   . GLN G 1 140 ? 147.245 111.742 93.810  1.00 30.00  ? 140 GLN G N   1 
ATOM 10187 C CA  . GLN G 1 140 ? 146.515 112.901 94.337  1.00 30.00  ? 140 GLN G CA  1 
ATOM 10188 C C   . GLN G 1 140 ? 146.380 112.815 95.863  1.00 30.00  ? 140 GLN G C   1 
ATOM 10189 O O   . GLN G 1 140 ? 145.306 112.618 96.422  1.00 30.00  ? 140 GLN G O   1 
ATOM 10190 C CB  . GLN G 1 140 ? 145.149 113.059 93.651  1.00 30.00  ? 140 GLN G CB  1 
ATOM 10191 C CG  . GLN G 1 140 ? 144.406 114.367 93.960  1.00 30.00  ? 140 GLN G CG  1 
ATOM 10192 C CD  . GLN G 1 140 ? 143.021 114.399 93.365  1.00 30.00  ? 140 GLN G CD  1 
ATOM 10193 O OE1 . GLN G 1 140 ? 142.612 113.471 92.682  1.00 30.00  ? 140 GLN G OE1 1 
ATOM 10194 N NE2 . GLN G 1 140 ? 142.279 115.455 93.652  1.00 30.00  ? 140 GLN G NE2 1 
ATOM 10195 N N   . ASP G 1 141 ? 147.522 112.895 96.530  1.00 30.00  ? 141 ASP G N   1 
ATOM 10196 C CA  . ASP G 1 141 ? 147.550 113.076 97.973  1.00 30.00  ? 141 ASP G CA  1 
ATOM 10197 C C   . ASP G 1 141 ? 147.803 114.546 98.271  1.00 30.00  ? 141 ASP G C   1 
ATOM 10198 O O   . ASP G 1 141 ? 148.738 115.145 97.734  1.00 30.00  ? 141 ASP G O   1 
ATOM 10199 C CB  . ASP G 1 141 ? 148.587 112.164 98.647  1.00 30.00  ? 141 ASP G CB  1 
ATOM 10200 C CG  . ASP G 1 141 ? 149.961 112.223 97.994  1.00 30.00  ? 141 ASP G CG  1 
ATOM 10201 O OD1 . ASP G 1 141 ? 150.093 112.803 96.898  1.00 30.00  ? 141 ASP G OD1 1 
ATOM 10202 O OD2 . ASP G 1 141 ? 150.920 111.678 98.584  1.00 30.00  ? 141 ASP G OD2 1 
ATOM 10203 N N   . ALA G 1 142 ? 146.942 115.135 99.094  1.00 30.00  ? 142 ALA G N   1 
ATOM 10204 C CA  . ALA G 1 142 ? 147.020 116.570 99.328  1.00 30.00  ? 142 ALA G CA  1 
ATOM 10205 C C   . ALA G 1 142 ? 148.160 116.914 100.277 1.00 30.00  ? 142 ALA G C   1 
ATOM 10206 O O   . ALA G 1 142 ? 149.108 117.611 99.903  1.00 30.00  ? 142 ALA G O   1 
ATOM 10207 C CB  . ALA G 1 142 ? 145.688 117.084 99.875  1.00 30.00  ? 142 ALA G CB  1 
ATOM 10208 N N   . ASP G 1 143 ? 148.089 116.419 101.506 1.00 30.00  ? 143 ASP G N   1 
ATOM 10209 C CA  . ASP G 1 143 ? 149.048 116.748 102.552 1.00 30.00  ? 143 ASP G CA  1 
ATOM 10210 C C   . ASP G 1 143 ? 150.067 115.631 102.736 1.00 30.00  ? 143 ASP G C   1 
ATOM 10211 O O   . ASP G 1 143 ? 150.619 115.458 103.825 1.00 30.00  ? 143 ASP G O   1 
ATOM 10212 C CB  . ASP G 1 143 ? 148.325 117.025 103.864 1.00 30.00  ? 143 ASP G CB  1 
ATOM 10213 C CG  . ASP G 1 143 ? 147.435 118.239 103.786 1.00 30.00  ? 143 ASP G CG  1 
ATOM 10214 O OD1 . ASP G 1 143 ? 147.762 119.166 103.019 1.00 30.00  ? 143 ASP G OD1 1 
ATOM 10215 O OD2 . ASP G 1 143 ? 146.400 118.261 104.483 1.00 30.00  ? 143 ASP G OD2 1 
ATOM 10216 N N   . ASN G 1 144 ? 150.339 114.900 101.646 1.00 30.00  ? 144 ASN G N   1 
ATOM 10217 C CA  . ASN G 1 144 ? 151.008 113.596 101.672 1.00 30.00  ? 144 ASN G CA  1 
ATOM 10218 C C   . ASN G 1 144 ? 150.348 112.688 102.704 1.00 30.00  ? 144 ASN G C   1 
ATOM 10219 O O   . ASN G 1 144 ? 150.996 112.134 103.592 1.00 30.00  ? 144 ASN G O   1 
ATOM 10220 C CB  . ASN G 1 144 ? 152.513 113.730 101.921 1.00 30.00  ? 144 ASN G CB  1 
ATOM 10221 C CG  . ASN G 1 144 ? 153.236 114.373 100.758 1.00 30.00  ? 144 ASN G CG  1 
ATOM 10222 O OD1 . ASN G 1 144 ? 152.945 114.085 99.598  1.00 30.00  ? 144 ASN G OD1 1 
ATOM 10223 N ND2 . ASN G 1 144 ? 154.183 115.251 101.061 1.00 30.00  ? 144 ASN G ND2 1 
ATOM 10224 N N   . SER G 1 145 ? 149.027 112.571 102.592 1.00 30.00  ? 145 SER G N   1 
ATOM 10225 C CA  . SER G 1 145 ? 148.217 111.915 103.604 1.00 30.00  ? 145 SER G CA  1 
ATOM 10226 C C   . SER G 1 145 ? 148.402 110.407 103.635 1.00 30.00  ? 145 SER G C   1 
ATOM 10227 O O   . SER G 1 145 ? 148.232 109.805 104.699 1.00 30.00  ? 145 SER G O   1 
ATOM 10228 C CB  . SER G 1 145 ? 146.741 112.251 103.380 1.00 30.00  ? 145 SER G CB  1 
ATOM 10229 O OG  . SER G 1 145 ? 146.273 111.724 102.151 1.00 30.00  ? 145 SER G OG  1 
ATOM 10230 N N   . VAL G 1 146 ? 148.751 109.784 102.515 1.00 30.00  ? 146 VAL G N   1 
ATOM 10231 C CA  . VAL G 1 146 ? 148.933 108.339 102.494 1.00 30.00  ? 146 VAL G CA  1 
ATOM 10232 C C   . VAL G 1 146 ? 150.412 108.045 102.708 1.00 30.00  ? 146 VAL G C   1 
ATOM 10233 O O   . VAL G 1 146 ? 151.187 107.947 101.750 1.00 30.00  ? 146 VAL G O   1 
ATOM 10234 C CB  . VAL G 1 146 ? 148.416 107.730 101.178 1.00 30.00  ? 146 VAL G CB  1 
ATOM 10235 C CG1 . VAL G 1 146 ? 148.497 106.210 101.211 1.00 30.00  ? 146 VAL G CG1 1 
ATOM 10236 C CG2 . VAL G 1 146 ? 147.004 108.189 100.910 1.00 30.00  ? 146 VAL G CG2 1 
ATOM 10237 N N   . ASP G 1 147 ? 150.818 107.927 103.966 1.00 30.00  ? 147 ASP G N   1 
ATOM 10238 C CA  . ASP G 1 147 ? 152.193 107.605 104.310 1.00 30.00  ? 147 ASP G CA  1 
ATOM 10239 C C   . ASP G 1 147 ? 152.402 106.101 104.257 1.00 30.00  ? 147 ASP G C   1 
ATOM 10240 O O   . ASP G 1 147 ? 151.451 105.317 104.276 1.00 30.00  ? 147 ASP G O   1 
ATOM 10241 C CB  . ASP G 1 147 ? 152.545 108.142 105.697 1.00 30.00  ? 147 ASP G CB  1 
ATOM 10242 C CG  . ASP G 1 147 ? 152.637 109.646 105.729 1.00 30.00  ? 147 ASP G CG  1 
ATOM 10243 O OD1 . ASP G 1 147 ? 152.994 110.237 104.690 1.00 30.00  ? 147 ASP G OD1 1 
ATOM 10244 O OD2 . ASP G 1 147 ? 152.353 110.237 106.792 1.00 30.00  ? 147 ASP G OD2 1 
ATOM 10245 N N   . GLN G 1 148 ? 153.667 105.704 104.140 1.00 30.00  ? 148 GLN G N   1 
ATOM 10246 C CA  . GLN G 1 148 ? 154.017 104.295 104.246 1.00 30.00  ? 148 GLN G CA  1 
ATOM 10247 C C   . GLN G 1 148 ? 153.713 103.818 105.659 1.00 30.00  ? 148 GLN G C   1 
ATOM 10248 O O   . GLN G 1 148 ? 153.885 104.570 106.622 1.00 30.00  ? 148 GLN G O   1 
ATOM 10249 C CB  . GLN G 1 148 ? 155.494 104.089 103.913 1.00 30.00  ? 148 GLN G CB  1 
ATOM 10250 C CG  . GLN G 1 148 ? 155.915 102.642 103.827 1.00 30.00  ? 148 GLN G CG  1 
ATOM 10251 C CD  . GLN G 1 148 ? 155.318 101.952 102.632 1.00 30.00  ? 148 GLN G CD  1 
ATOM 10252 O OE1 . GLN G 1 148 ? 155.305 102.498 101.534 1.00 30.00  ? 148 GLN G OE1 1 
ATOM 10253 N NE2 . GLN G 1 148 ? 154.799 100.754 102.838 1.00 30.00  ? 148 GLN G NE2 1 
ATOM 10254 N N   . ASN G 1 149 ? 153.160 102.600 105.755 1.00 30.00  ? 149 ASN G N   1 
ATOM 10255 C CA  . ASN G 1 149 ? 152.660 101.938 106.965 1.00 30.00  ? 149 ASN G CA  1 
ATOM 10256 C C   . ASN G 1 149 ? 151.439 102.630 107.575 1.00 30.00  ? 149 ASN G C   1 
ATOM 10257 O O   . ASN G 1 149 ? 150.924 102.174 108.600 1.00 30.00  ? 149 ASN G O   1 
ATOM 10258 C CB  . ASN G 1 149 ? 153.752 101.798 108.039 1.00 30.00  ? 149 ASN G CB  1 
ATOM 10259 C CG  . ASN G 1 149 ? 154.948 101.012 107.558 1.00 30.00  ? 149 ASN G CG  1 
ATOM 10260 O OD1 . ASN G 1 149 ? 156.044 101.553 107.434 1.00 30.00  ? 149 ASN G OD1 1 
ATOM 10261 N ND2 . ASN G 1 149 ? 154.751 99.728  107.298 1.00 30.00  ? 149 ASN G ND2 1 
ATOM 10262 N N   . TYR G 1 150 ? 150.958 103.715 106.972 1.00 30.00  ? 150 TYR G N   1 
ATOM 10263 C CA  . TYR G 1 150 ? 149.813 104.469 107.488 1.00 30.00  ? 150 TYR G CA  1 
ATOM 10264 C C   . TYR G 1 150 ? 149.020 105.053 106.329 1.00 30.00  ? 150 TYR G C   1 
ATOM 10265 O O   . TYR G 1 150 ? 149.235 106.200 105.924 1.00 30.00  ? 150 TYR G O   1 
ATOM 10266 C CB  . TYR G 1 150 ? 150.273 105.586 108.429 1.00 30.00  ? 150 TYR G CB  1 
ATOM 10267 C CG  . TYR G 1 150 ? 150.918 105.115 109.703 1.00 30.00  ? 150 TYR G CG  1 
ATOM 10268 C CD1 . TYR G 1 150 ? 150.149 104.717 110.783 1.00 30.00  ? 150 TYR G CD1 1 
ATOM 10269 C CD2 . TYR G 1 150 ? 152.297 105.069 109.824 1.00 30.00  ? 150 TYR G CD2 1 
ATOM 10270 C CE1 . TYR G 1 150 ? 150.733 104.286 111.951 1.00 30.00  ? 150 TYR G CE1 1 
ATOM 10271 C CE2 . TYR G 1 150 ? 152.894 104.638 110.983 1.00 30.00  ? 150 TYR G CE2 1 
ATOM 10272 C CZ  . TYR G 1 150 ? 152.107 104.248 112.045 1.00 30.00  ? 150 TYR G CZ  1 
ATOM 10273 O OH  . TYR G 1 150 ? 152.702 103.817 113.207 1.00 30.00  ? 150 TYR G OH  1 
ATOM 10274 N N   . PRO G 1 151 ? 148.087 104.294 105.768 1.00 118.75 ? 151 PRO G N   1 
ATOM 10275 C CA  . PRO G 1 151 ? 147.204 104.882 104.758 1.00 118.46 ? 151 PRO G CA  1 
ATOM 10276 C C   . PRO G 1 151 ? 146.055 105.640 105.396 1.00 119.90 ? 151 PRO G C   1 
ATOM 10277 O O   . PRO G 1 151 ? 145.252 105.052 106.123 1.00 131.05 ? 151 PRO G O   1 
ATOM 10278 C CB  . PRO G 1 151 ? 146.699 103.665 103.979 1.00 30.00  ? 151 PRO G CB  1 
ATOM 10279 C CG  . PRO G 1 151 ? 147.651 102.574 104.302 1.00 30.00  ? 151 PRO G CG  1 
ATOM 10280 C CD  . PRO G 1 151 ? 148.045 102.827 105.716 1.00 30.00  ? 151 PRO G CD  1 
ATOM 10281 N N   . THR G 1 152 ? 145.966 106.941 105.132 1.00 103.12 ? 152 THR G N   1 
ATOM 10282 C CA  . THR G 1 152 ? 144.865 107.775 105.597 1.00 94.10  ? 152 THR G CA  1 
ATOM 10283 C C   . THR G 1 152 ? 144.120 108.279 104.374 1.00 104.71 ? 152 THR G C   1 
ATOM 10284 O O   . THR G 1 152 ? 144.747 108.657 103.380 1.00 113.36 ? 152 THR G O   1 
ATOM 10285 C CB  . THR G 1 152 ? 145.360 108.969 106.416 1.00 30.00  ? 152 THR G CB  1 
ATOM 10286 O OG1 . THR G 1 152 ? 146.029 109.887 105.549 1.00 30.00  ? 152 THR G OG1 1 
ATOM 10287 C CG2 . THR G 1 152 ? 146.350 108.531 107.466 1.00 30.00  ? 152 THR G CG2 1 
ATOM 10288 N N   . LEU G 1 153 ? 142.796 108.281 104.435 1.00 105.17 ? 153 LEU G N   1 
ATOM 10289 C CA  . LEU G 1 153 ? 142.031 108.913 103.374 1.00 86.31  ? 153 LEU G CA  1 
ATOM 10290 C C   . LEU G 1 153 ? 141.268 110.126 103.884 1.00 100.45 ? 153 LEU G C   1 
ATOM 10291 O O   . LEU G 1 153 ? 140.368 110.028 104.721 1.00 121.22 ? 153 LEU G O   1 
ATOM 10292 C CB  . LEU G 1 153 ? 141.073 107.927 102.707 1.00 85.43  ? 153 LEU G CB  1 
ATOM 10293 C CG  . LEU G 1 153 ? 141.594 107.327 101.401 1.00 104.80 ? 153 LEU G CG  1 
ATOM 10294 C CD1 . LEU G 1 153 ? 142.825 106.506 101.606 1.00 109.08 ? 153 LEU G CD1 1 
ATOM 10295 C CD2 . LEU G 1 153 ? 140.526 106.484 100.744 1.00 104.18 ? 153 LEU G CD2 1 
ATOM 10296 N N   . ASN G 1 154 ? 141.650 111.281 103.354 1.00 92.73  ? 154 ASN G N   1 
ATOM 10297 C CA  . ASN G 1 154 ? 140.944 112.534 103.556 1.00 102.94 ? 154 ASN G CA  1 
ATOM 10298 C C   . ASN G 1 154 ? 140.155 112.843 102.292 1.00 103.88 ? 154 ASN G C   1 
ATOM 10299 O O   . ASN G 1 154 ? 140.094 111.999 101.394 1.00 114.48 ? 154 ASN G O   1 
ATOM 10300 C CB  . ASN G 1 154 ? 141.939 113.637 103.925 1.00 108.28 ? 154 ASN G CB  1 
ATOM 10301 C CG  . ASN G 1 154 ? 143.155 113.671 103.005 1.00 136.92 ? 154 ASN G CG  1 
ATOM 10302 O OD1 . ASN G 1 154 ? 143.230 112.947 102.016 1.00 143.53 ? 154 ASN G OD1 1 
ATOM 10303 N ND2 . ASN G 1 154 ? 144.125 114.506 103.351 1.00 139.78 ? 154 ASN G ND2 1 
ATOM 10304 N N   . LYS G 1 155 ? 139.535 114.016 102.213 1.00 95.21  ? 155 LYS G N   1 
ATOM 10305 C CA  . LYS G 1 155 ? 138.738 114.352 101.041 1.00 95.36  ? 155 LYS G CA  1 
ATOM 10306 C C   . LYS G 1 155 ? 139.625 114.569 99.816  1.00 115.83 ? 155 LYS G C   1 
ATOM 10307 O O   . LYS G 1 155 ? 140.704 115.165 99.890  1.00 123.08 ? 155 LYS G O   1 
ATOM 10308 C CB  . LYS G 1 155 ? 137.872 115.586 101.318 1.00 30.00  ? 155 LYS G CB  1 
ATOM 10309 C CG  . LYS G 1 155 ? 138.642 116.851 101.675 1.00 30.00  ? 155 LYS G CG  1 
ATOM 10310 C CD  . LYS G 1 155 ? 137.722 118.029 101.918 1.00 30.00  ? 155 LYS G CD  1 
ATOM 10311 C CE  . LYS G 1 155 ? 136.975 117.886 103.229 1.00 30.00  ? 155 LYS G CE  1 
ATOM 10312 N NZ  . LYS G 1 155 ? 136.174 119.102 103.531 1.00 30.00  ? 155 LYS G NZ  1 
ATOM 10313 N N   . GLY G 1 156 ? 139.177 114.026 98.690  1.00 120.22 ? 156 GLY G N   1 
ATOM 10314 C CA  . GLY G 1 156 ? 139.892 114.164 97.433  1.00 108.72 ? 156 GLY G CA  1 
ATOM 10315 C C   . GLY G 1 156 ? 141.233 113.469 97.387  1.00 114.31 ? 156 GLY G C   1 
ATOM 10316 O O   . GLY G 1 156 ? 142.253 114.118 97.133  1.00 129.66 ? 156 GLY G O   1 
ATOM 10317 N N   . ASP G 1 157 ? 141.260 112.164 97.633  1.00 108.95 ? 157 ASP G N   1 
ATOM 10318 C CA  . ASP G 1 157 ? 142.510 111.414 97.685  1.00 110.20 ? 157 ASP G CA  1 
ATOM 10319 C C   . ASP G 1 157 ? 142.270 110.082 96.989  1.00 98.60  ? 157 ASP G C   1 
ATOM 10320 O O   . ASP G 1 157 ? 141.894 109.102 97.636  1.00 104.60 ? 157 ASP G O   1 
ATOM 10321 C CB  . ASP G 1 157 ? 142.958 111.233 99.136  1.00 30.00  ? 157 ASP G CB  1 
ATOM 10322 C CG  . ASP G 1 157 ? 144.399 110.778 99.268  1.00 30.00  ? 157 ASP G CG  1 
ATOM 10323 O OD1 . ASP G 1 157 ? 145.042 110.454 98.252  1.00 30.00  ? 157 ASP G OD1 1 
ATOM 10324 O OD2 . ASP G 1 157 ? 144.905 110.776 100.409 1.00 30.00  ? 157 ASP G OD2 1 
ATOM 10325 N N   . ILE G 1 158 ? 142.505 110.040 95.682  1.00 93.46  ? 158 ILE G N   1 
ATOM 10326 C CA  . ILE G 1 158 ? 142.140 108.901 94.851  1.00 94.83  ? 158 ILE G CA  1 
ATOM 10327 C C   . ILE G 1 158 ? 143.257 107.872 94.937  1.00 87.24  ? 158 ILE G C   1 
ATOM 10328 O O   . ILE G 1 158 ? 144.206 107.898 94.148  1.00 105.72 ? 158 ILE G O   1 
ATOM 10329 C CB  . ILE G 1 158 ? 141.890 109.313 93.397  1.00 30.00  ? 158 ILE G CB  1 
ATOM 10330 C CG1 . ILE G 1 158 ? 140.838 110.402 93.320  1.00 30.00  ? 158 ILE G CG1 1 
ATOM 10331 C CG2 . ILE G 1 158 ? 141.363 108.144 92.596  1.00 30.00  ? 158 ILE G CG2 1 
ATOM 10332 C CD1 . ILE G 1 158 ? 140.699 110.952 91.938  1.00 30.00  ? 158 ILE G CD1 1 
ATOM 10333 N N   . VAL G 1 159 ? 143.153 106.954 95.883  1.00 72.04  ? 159 VAL G N   1 
ATOM 10334 C CA  . VAL G 1 159 ? 144.090 105.850 95.953  1.00 85.77  ? 159 VAL G CA  1 
ATOM 10335 C C   . VAL G 1 159 ? 143.591 104.775 94.996  1.00 98.46  ? 159 VAL G C   1 
ATOM 10336 O O   . VAL G 1 159 ? 142.393 104.630 94.740  1.00 103.95 ? 159 VAL G O   1 
ATOM 10337 C CB  . VAL G 1 159 ? 144.269 105.329 97.400  1.00 96.17  ? 159 VAL G CB  1 
ATOM 10338 C CG1 . VAL G 1 159 ? 143.015 104.648 97.912  1.00 92.70  ? 159 VAL G CG1 1 
ATOM 10339 C CG2 . VAL G 1 159 ? 145.503 104.438 97.538  1.00 104.55 ? 159 VAL G CG2 1 
ATOM 10340 N N   . VAL G 1 160 ? 144.535 104.067 94.399  1.00 95.14  ? 160 VAL G N   1 
ATOM 10341 C CA  . VAL G 1 160 ? 144.262 103.068 93.381  1.00 101.45 ? 160 VAL G CA  1 
ATOM 10342 C C   . VAL G 1 160 ? 144.646 101.720 93.959  1.00 102.27 ? 160 VAL G C   1 
ATOM 10343 O O   . VAL G 1 160 ? 145.835 101.405 94.087  1.00 103.82 ? 160 VAL G O   1 
ATOM 10344 C CB  . VAL G 1 160 ? 145.038 103.361 92.096  1.00 30.00  ? 160 VAL G CB  1 
ATOM 10345 C CG1 . VAL G 1 160 ? 144.888 102.232 91.095  1.00 30.00  ? 160 VAL G CG1 1 
ATOM 10346 C CG2 . VAL G 1 160 ? 144.599 104.681 91.516  1.00 30.00  ? 160 VAL G CG2 1 
ATOM 10347 N N   . ILE G 1 161 ? 143.656 100.924 94.333  1.00 90.95  ? 161 ILE G N   1 
ATOM 10348 C CA  . ILE G 1 161 ? 143.953 99.606  94.869  1.00 81.94  ? 161 ILE G CA  1 
ATOM 10349 C C   . ILE G 1 161 ? 144.304 98.672  93.721  1.00 79.66  ? 161 ILE G C   1 
ATOM 10350 O O   . ILE G 1 161 ? 143.507 98.467  92.802  1.00 99.72  ? 161 ILE G O   1 
ATOM 10351 C CB  . ILE G 1 161 ? 142.801 99.064  95.723  1.00 30.00  ? 161 ILE G CB  1 
ATOM 10352 C CG1 . ILE G 1 161 ? 142.767 99.813  97.048  1.00 30.00  ? 161 ILE G CG1 1 
ATOM 10353 C CG2 . ILE G 1 161 ? 142.940 97.576  95.942  1.00 30.00  ? 161 ILE G CG2 1 
ATOM 10354 C CD1 . ILE G 1 161 ? 141.712 99.362  97.980  1.00 30.00  ? 161 ILE G CD1 1 
ATOM 10355 N N   . THR G 1 162 ? 145.527 98.152  93.754  1.00 81.25  ? 162 THR G N   1 
ATOM 10356 C CA  . THR G 1 162 ? 146.038 97.194  92.787  1.00 79.19  ? 162 THR G CA  1 
ATOM 10357 C C   . THR G 1 162 ? 145.825 95.778  93.300  1.00 81.11  ? 162 THR G C   1 
ATOM 10358 O O   . THR G 1 162 ? 146.192 95.470  94.434  1.00 116.53 ? 162 THR G O   1 
ATOM 10359 C CB  . THR G 1 162 ? 147.526 97.458  92.552  1.00 105.99 ? 162 THR G CB  1 
ATOM 10360 O OG1 . THR G 1 162 ? 147.697 98.645  91.770  1.00 101.14 ? 162 THR G OG1 1 
ATOM 10361 C CG2 . THR G 1 162 ? 148.215 96.293  91.900  1.00 102.00 ? 162 THR G CG2 1 
ATOM 10362 N N   . VAL G 1 163 ? 145.225 94.922  92.476  1.00 74.05  ? 163 VAL G N   1 
ATOM 10363 C CA  . VAL G 1 163 ? 145.039 93.514  92.815  1.00 59.01  ? 163 VAL G CA  1 
ATOM 10364 C C   . VAL G 1 163 ? 145.525 92.674  91.647  1.00 74.94  ? 163 VAL G C   1 
ATOM 10365 O O   . VAL G 1 163 ? 144.990 92.782  90.539  1.00 100.06 ? 163 VAL G O   1 
ATOM 10366 C CB  . VAL G 1 163 ? 143.571 93.168  93.121  1.00 30.00  ? 163 VAL G CB  1 
ATOM 10367 C CG1 . VAL G 1 163 ? 143.442 91.688  93.375  1.00 30.00  ? 163 VAL G CG1 1 
ATOM 10368 C CG2 . VAL G 1 163 ? 143.047 93.931  94.311  1.00 30.00  ? 163 VAL G CG2 1 
ATOM 10369 N N   . LYS G 1 164 ? 146.524 91.833  91.883  1.00 74.88  ? 164 LYS G N   1 
ATOM 10370 C CA  . LYS G 1 164 ? 146.843 90.800  90.913  1.00 83.69  ? 164 LYS G CA  1 
ATOM 10371 C C   . LYS G 1 164 ? 145.927 89.613  91.155  1.00 106.81 ? 164 LYS G C   1 
ATOM 10372 O O   . LYS G 1 164 ? 145.681 89.228  92.300  1.00 129.13 ? 164 LYS G O   1 
ATOM 10373 C CB  . LYS G 1 164 ? 148.302 90.366  91.012  1.00 30.00  ? 164 LYS G CB  1 
ATOM 10374 C CG  . LYS G 1 164 ? 148.690 89.354  89.954  1.00 30.00  ? 164 LYS G CG  1 
ATOM 10375 C CD  . LYS G 1 164 ? 150.119 88.915  90.070  1.00 30.00  ? 164 LYS G CD  1 
ATOM 10376 C CE  . LYS G 1 164 ? 150.420 87.888  89.008  1.00 30.00  ? 164 LYS G CE  1 
ATOM 10377 N NZ  . LYS G 1 164 ? 151.818 87.401  89.099  1.00 30.00  ? 164 LYS G NZ  1 
ATOM 10378 N N   . VAL G 1 165 ? 145.401 89.044  90.074  1.00 100.36 ? 165 VAL G N   1 
ATOM 10379 C CA  . VAL G 1 165 ? 144.398 87.993  90.151  1.00 103.79 ? 165 VAL G CA  1 
ATOM 10380 C C   . VAL G 1 165 ? 144.872 86.706  89.481  1.00 97.79  ? 165 VAL G C   1 
ATOM 10381 O O   . VAL G 1 165 ? 144.878 85.638  90.097  1.00 106.74 ? 165 VAL G O   1 
ATOM 10382 C CB  . VAL G 1 165 ? 143.056 88.458  89.546  1.00 30.00  ? 165 VAL G CB  1 
ATOM 10383 C CG1 . VAL G 1 165 ? 142.069 87.339  89.572  1.00 30.00  ? 165 VAL G CG1 1 
ATOM 10384 C CG2 . VAL G 1 165 ? 142.511 89.651  90.294  1.00 30.00  ? 165 VAL G CG2 1 
ATOM 10385 N N   . GLY G 1 166 ? 145.263 86.788  88.213  1.00 79.70  ? 166 GLY G N   1 
ATOM 10386 C CA  . GLY G 1 166 ? 145.238 85.611  87.365  1.00 92.16  ? 166 GLY G CA  1 
ATOM 10387 C C   . GLY G 1 166 ? 146.319 84.552  87.346  1.00 91.30  ? 166 GLY G C   1 
ATOM 10388 O O   . GLY G 1 166 ? 146.071 83.426  87.782  1.00 97.71  ? 166 GLY G O   1 
ATOM 10389 N N   . GLU G 1 167 ? 147.516 84.886  86.863  1.00 104.44 ? 167 GLU G N   1 
ATOM 10390 C CA  . GLU G 1 167 ? 148.418 83.871  86.328  1.00 121.81 ? 167 GLU G CA  1 
ATOM 10391 C C   . GLU G 1 167 ? 149.087 83.070  87.441  1.00 118.30 ? 167 GLU G C   1 
ATOM 10392 O O   . GLU G 1 167 ? 149.573 83.636  88.425  1.00 118.15 ? 167 GLU G O   1 
ATOM 10393 C CB  . GLU G 1 167 ? 149.455 84.514  85.397  1.00 30.00  ? 167 GLU G CB  1 
ATOM 10394 C CG  . GLU G 1 167 ? 150.372 85.595  85.988  1.00 30.00  ? 167 GLU G CG  1 
ATOM 10395 C CD  . GLU G 1 167 ? 151.654 85.033  86.587  1.00 30.00  ? 167 GLU G CD  1 
ATOM 10396 O OE1 . GLU G 1 167 ? 152.003 83.876  86.274  1.00 30.00  ? 167 GLU G OE1 1 
ATOM 10397 O OE2 . GLU G 1 167 ? 152.320 85.746  87.364  1.00 30.00  ? 167 GLU G OE2 1 
ATOM 10398 N N   . GLY G 1 168 ? 149.073 81.744  87.293  1.00 30.00  ? 168 GLY G N   1 
ATOM 10399 C CA  . GLY G 1 168 ? 149.628 80.858  88.295  1.00 30.00  ? 168 GLY G CA  1 
ATOM 10400 C C   . GLY G 1 168 ? 148.835 80.914  89.580  1.00 30.00  ? 168 GLY G C   1 
ATOM 10401 O O   . GLY G 1 168 ? 147.724 80.386  89.671  1.00 30.00  ? 168 GLY G O   1 
ATOM 10402 N N   . ASN G 1 169 ? 149.415 81.562  90.583  1.00 30.00  ? 169 ASN G N   1 
ATOM 10403 C CA  . ASN G 1 169 ? 148.709 81.871  91.813  1.00 30.00  ? 169 ASN G CA  1 
ATOM 10404 C C   . ASN G 1 169 ? 147.806 83.085  91.641  1.00 30.00  ? 169 ASN G C   1 
ATOM 10405 O O   . ASN G 1 169 ? 147.526 83.533  90.527  1.00 30.00  ? 169 ASN G O   1 
ATOM 10406 C CB  . ASN G 1 169 ? 149.703 82.114  92.953  1.00 30.00  ? 169 ASN G CB  1 
ATOM 10407 C CG  . ASN G 1 169 ? 150.742 83.193  92.633  1.00 30.00  ? 169 ASN G CG  1 
ATOM 10408 O OD1 . ASN G 1 169 ? 150.727 83.818  91.573  1.00 30.00  ? 169 ASN G OD1 1 
ATOM 10409 N ND2 . ASN G 1 169 ? 151.652 83.415  93.574  1.00 30.00  ? 169 ASN G ND2 1 
ATOM 10410 N N   . GLY G 1 170 ? 147.353 83.619  92.765  1.00 30.00  ? 170 GLY G N   1 
ATOM 10411 C CA  . GLY G 1 170 ? 146.626 84.868  92.730  1.00 30.00  ? 170 GLY G CA  1 
ATOM 10412 C C   . GLY G 1 170 ? 145.288 84.721  93.411  1.00 30.00  ? 170 GLY G C   1 
ATOM 10413 O O   . GLY G 1 170 ? 145.061 83.791  94.186  1.00 30.00  ? 170 GLY G O   1 
ATOM 10414 N N   . VAL G 1 171 ? 144.399 85.664  93.105  1.00 30.00  ? 171 VAL G N   1 
ATOM 10415 C CA  . VAL G 1 171 ? 143.057 85.627  93.672  1.00 30.00  ? 171 VAL G CA  1 
ATOM 10416 C C   . VAL G 1 171 ? 142.262 84.480  93.074  1.00 30.00  ? 171 VAL G C   1 
ATOM 10417 O O   . VAL G 1 171 ? 141.619 83.706  93.793  1.00 30.00  ? 171 VAL G O   1 
ATOM 10418 C CB  . VAL G 1 171 ? 142.361 86.979  93.455  1.00 30.00  ? 171 VAL G CB  1 
ATOM 10419 C CG1 . VAL G 1 171 ? 140.936 86.922  93.925  1.00 30.00  ? 171 VAL G CG1 1 
ATOM 10420 C CG2 . VAL G 1 171 ? 143.109 88.059  94.198  1.00 30.00  ? 171 VAL G CG2 1 
ATOM 10421 N N   . PHE G 1 172 ? 142.302 84.343  91.756  1.00 30.00  ? 172 PHE G N   1 
ATOM 10422 C CA  . PHE G 1 172 ? 141.599 83.284  91.053  1.00 30.00  ? 172 PHE G CA  1 
ATOM 10423 C C   . PHE G 1 172 ? 142.615 82.423  90.324  1.00 30.00  ? 172 PHE G C   1 
ATOM 10424 O O   . PHE G 1 172 ? 143.652 82.917  89.872  1.00 30.00  ? 172 PHE G O   1 
ATOM 10425 C CB  . PHE G 1 172 ? 140.606 83.852  90.040  1.00 30.00  ? 172 PHE G CB  1 
ATOM 10426 C CG  . PHE G 1 172 ? 139.509 84.669  90.650  1.00 30.00  ? 172 PHE G CG  1 
ATOM 10427 C CD1 . PHE G 1 172 ? 139.090 84.461  91.950  1.00 30.00  ? 172 PHE G CD1 1 
ATOM 10428 C CD2 . PHE G 1 172 ? 138.932 85.693  89.929  1.00 30.00  ? 172 PHE G CD2 1 
ATOM 10429 C CE1 . PHE G 1 172 ? 138.102 85.241  92.495  1.00 30.00  ? 172 PHE G CE1 1 
ATOM 10430 C CE2 . PHE G 1 172 ? 137.954 86.471  90.478  1.00 30.00  ? 172 PHE G CE2 1 
ATOM 10431 C CZ  . PHE G 1 172 ? 137.547 86.250  91.754  1.00 30.00  ? 172 PHE G CZ  1 
ATOM 10432 N N   . GLY G 1 173 ? 142.324 81.129  90.224  1.00 90.87  ? 173 GLY G N   1 
ATOM 10433 C CA  . GLY G 1 173 ? 143.101 80.260  89.362  1.00 106.12 ? 173 GLY G CA  1 
ATOM 10434 C C   . GLY G 1 173 ? 142.897 80.669  87.918  1.00 110.53 ? 173 GLY G C   1 
ATOM 10435 O O   . GLY G 1 173 ? 141.760 80.637  87.417  1.00 115.60 ? 173 GLY G O   1 
ATOM 10436 N N   . LYS G 1 174 ? 143.967 81.142  87.265  1.00 97.87  ? 174 LYS G N   1 
ATOM 10437 C CA  . LYS G 1 174 ? 144.042 81.680  85.903  1.00 80.02  ? 174 LYS G CA  1 
ATOM 10438 C C   . LYS G 1 174 ? 143.310 83.014  85.732  1.00 94.77  ? 174 LYS G C   1 
ATOM 10439 O O   . LYS G 1 174 ? 143.411 83.625  84.669  1.00 96.54  ? 174 LYS G O   1 
ATOM 10440 C CB  . LYS G 1 174 ? 143.546 80.680  84.840  1.00 30.00  ? 174 LYS G CB  1 
ATOM 10441 C CG  . LYS G 1 174 ? 144.302 79.361  84.789  1.00 30.00  ? 174 LYS G CG  1 
ATOM 10442 C CD  . LYS G 1 174 ? 145.733 79.531  84.316  1.00 30.00  ? 174 LYS G CD  1 
ATOM 10443 C CE  . LYS G 1 174 ? 145.794 79.905  82.844  1.00 30.00  ? 174 LYS G CE  1 
ATOM 10444 N NZ  . LYS G 1 174 ? 145.278 78.820  81.967  1.00 30.00  ? 174 LYS G NZ  1 
ATOM 10445 N N   . GLY G 1 175 ? 142.609 83.509  86.753  1.00 111.68 ? 175 GLY G N   1 
ATOM 10446 C CA  . GLY G 1 175 ? 141.842 84.736  86.625  1.00 81.48  ? 175 GLY G CA  1 
ATOM 10447 C C   . GLY G 1 175 ? 140.522 84.552  85.896  1.00 95.21  ? 175 GLY G C   1 
ATOM 10448 O O   . GLY G 1 175 ? 140.197 83.485  85.376  1.00 97.91  ? 175 GLY G O   1 
ATOM 10449 N N   . ILE G 1 176 ? 139.754 85.635  85.870  1.00 83.15  ? 176 ILE G N   1 
ATOM 10450 C CA  . ILE G 1 176 ? 138.429 85.608  85.261  1.00 78.96  ? 176 ILE G CA  1 
ATOM 10451 C C   . ILE G 1 176 ? 138.506 85.552  83.742  1.00 94.93  ? 176 ILE G C   1 
ATOM 10452 O O   . ILE G 1 176 ? 139.267 86.304  83.121  1.00 88.90  ? 176 ILE G O   1 
ATOM 10453 C CB  . ILE G 1 176 ? 137.581 86.798  85.727  1.00 30.00  ? 176 ILE G CB  1 
ATOM 10454 C CG1 . ILE G 1 176 ? 138.420 88.065  85.774  1.00 30.00  ? 176 ILE G CG1 1 
ATOM 10455 C CG2 . ILE G 1 176 ? 136.931 86.509  87.044  1.00 30.00  ? 176 ILE G CG2 1 
ATOM 10456 C CD1 . ILE G 1 176 ? 137.622 89.307  86.046  1.00 30.00  ? 176 ILE G CD1 1 
ATOM 10457 N N   . PRO G 1 177 ? 137.758 84.651  83.117  1.00 104.13 ? 177 PRO G N   1 
ATOM 10458 C CA  . PRO G 1 177 ? 137.639 84.644  81.664  1.00 102.32 ? 177 PRO G CA  1 
ATOM 10459 C C   . PRO G 1 177 ? 136.670 85.720  81.214  1.00 111.82 ? 177 PRO G C   1 
ATOM 10460 O O   . PRO G 1 177 ? 136.030 86.363  82.059  1.00 109.13 ? 177 PRO G O   1 
ATOM 10461 C CB  . PRO G 1 177 ? 137.095 83.235  81.378  1.00 30.00  ? 177 PRO G CB  1 
ATOM 10462 C CG  . PRO G 1 177 ? 136.356 82.880  82.591  1.00 30.00  ? 177 PRO G CG  1 
ATOM 10463 C CD  . PRO G 1 177 ? 137.111 83.481  83.728  1.00 30.00  ? 177 PRO G CD  1 
ATOM 10464 N N   . PRO G 1 178 ? 136.556 85.984  79.911  1.00 116.59 ? 178 PRO G N   1 
ATOM 10465 C CA  . PRO G 1 178 ? 135.464 86.835  79.431  1.00 103.53 ? 178 PRO G CA  1 
ATOM 10466 C C   . PRO G 1 178 ? 134.108 86.212  79.702  1.00 98.48  ? 178 PRO G C   1 
ATOM 10467 O O   . PRO G 1 178 ? 133.974 84.995  79.854  1.00 99.69  ? 178 PRO G O   1 
ATOM 10468 C CB  . PRO G 1 178 ? 135.726 86.944  77.927  1.00 30.00  ? 178 PRO G CB  1 
ATOM 10469 C CG  . PRO G 1 178 ? 136.629 85.829  77.602  1.00 30.00  ? 178 PRO G CG  1 
ATOM 10470 C CD  . PRO G 1 178 ? 137.485 85.664  78.813  1.00 30.00  ? 178 PRO G CD  1 
ATOM 10471 N N   . ARG G 1 179 ? 133.105 87.094  79.778  1.00 103.48 ? 179 ARG G N   1 
ATOM 10472 C CA  . ARG G 1 179 ? 131.688 86.741  79.867  1.00 103.58 ? 179 ARG G CA  1 
ATOM 10473 C C   . ARG G 1 179 ? 131.411 85.909  81.125  1.00 107.40 ? 179 ARG G C   1 
ATOM 10474 O O   . ARG G 1 179 ? 131.072 84.725  81.075  1.00 119.87 ? 179 ARG G O   1 
ATOM 10475 C CB  . ARG G 1 179 ? 131.257 86.035  78.575  1.00 30.00  ? 179 ARG G CB  1 
ATOM 10476 C CG  . ARG G 1 179 ? 129.783 85.780  78.347  1.00 30.00  ? 179 ARG G CG  1 
ATOM 10477 C CD  . ARG G 1 179 ? 129.609 85.051  77.019  1.00 30.00  ? 179 ARG G CD  1 
ATOM 10478 N NE  . ARG G 1 179 ? 130.276 83.748  77.019  1.00 30.00  ? 179 ARG G NE  1 
ATOM 10479 C CZ  . ARG G 1 179 ? 131.353 83.450  76.296  1.00 30.00  ? 179 ARG G CZ  1 
ATOM 10480 N NH1 . ARG G 1 179 ? 131.899 84.364  75.505  1.00 30.00  ? 179 ARG G NH1 1 
ATOM 10481 N NH2 . ARG G 1 179 ? 131.887 82.239  76.367  1.00 30.00  ? 179 ARG G NH2 1 
ATOM 10482 N N   . THR G 1 180 ? 131.635 86.546  82.273  1.00 92.25  ? 180 THR G N   1 
ATOM 10483 C CA  . THR G 1 180 ? 131.345 85.947  83.567  1.00 103.08 ? 180 THR G CA  1 
ATOM 10484 C C   . THR G 1 180 ? 131.106 87.061  84.569  1.00 94.35  ? 180 THR G C   1 
ATOM 10485 O O   . THR G 1 180 ? 131.452 88.218  84.324  1.00 104.26 ? 180 THR G O   1 
ATOM 10486 C CB  . THR G 1 180 ? 132.472 85.036  84.072  1.00 30.00  ? 180 THR G CB  1 
ATOM 10487 O OG1 . THR G 1 180 ? 132.045 84.371  85.266  1.00 30.00  ? 180 THR G OG1 1 
ATOM 10488 C CG2 . THR G 1 180 ? 133.714 85.842  84.391  1.00 30.00  ? 180 THR G CG2 1 
ATOM 10489 N N   . LYS G 1 181 ? 130.501 86.707  85.696  1.00 87.17  ? 181 LYS G N   1 
ATOM 10490 C CA  . LYS G 1 181 ? 130.199 87.679  86.734  1.00 109.98 ? 181 LYS G CA  1 
ATOM 10491 C C   . LYS G 1 181 ? 131.276 87.628  87.805  1.00 103.75 ? 181 LYS G C   1 
ATOM 10492 O O   . LYS G 1 181 ? 131.742 86.550  88.184  1.00 108.59 ? 181 LYS G O   1 
ATOM 10493 C CB  . LYS G 1 181 ? 128.815 87.442  87.344  1.00 30.00  ? 181 LYS G CB  1 
ATOM 10494 C CG  . LYS G 1 181 ? 128.384 88.530  88.323  1.00 30.00  ? 181 LYS G CG  1 
ATOM 10495 C CD  . LYS G 1 181 ? 126.971 88.330  88.823  1.00 30.00  ? 181 LYS G CD  1 
ATOM 10496 C CE  . LYS G 1 181 ? 125.964 88.656  87.739  1.00 30.00  ? 181 LYS G CE  1 
ATOM 10497 N NZ  . LYS G 1 181 ? 125.995 90.104  87.398  1.00 30.00  ? 181 LYS G NZ  1 
ATOM 10498 N N   . ILE G 1 182 ? 131.680 88.805  88.261  1.00 87.71  ? 182 ILE G N   1 
ATOM 10499 C CA  . ILE G 1 182 ? 132.691 89.023  89.283  1.00 85.86  ? 182 ILE G CA  1 
ATOM 10500 C C   . ILE G 1 182 ? 132.270 90.261  90.062  1.00 85.66  ? 182 ILE G C   1 
ATOM 10501 O O   . ILE G 1 182 ? 132.117 91.346  89.498  1.00 101.40 ? 182 ILE G O   1 
ATOM 10502 C CB  . ILE G 1 182 ? 134.092 89.126  88.644  1.00 30.00  ? 182 ILE G CB  1 
ATOM 10503 C CG1 . ILE G 1 182 ? 135.121 89.757  89.577  1.00 30.00  ? 182 ILE G CG1 1 
ATOM 10504 C CG2 . ILE G 1 182 ? 134.045 89.752  87.273  1.00 30.00  ? 182 ILE G CG2 1 
ATOM 10505 C CD1 . ILE G 1 182 ? 135.449 88.984  90.739  1.00 30.00  ? 182 ILE G CD1 1 
ATOM 10506 N N   . THR G 1 183 ? 132.035 90.091  91.356  1.00 68.96  ? 183 THR G N   1 
ATOM 10507 C CA  . THR G 1 183 ? 131.274 91.033  92.160  1.00 83.69  ? 183 THR G CA  1 
ATOM 10508 C C   . THR G 1 183 ? 131.908 91.116  93.539  1.00 82.58  ? 183 THR G C   1 
ATOM 10509 O O   . THR G 1 183 ? 132.445 90.127  94.038  1.00 95.81  ? 183 THR G O   1 
ATOM 10510 C CB  . THR G 1 183 ? 129.807 90.564  92.256  1.00 30.00  ? 183 THR G CB  1 
ATOM 10511 O OG1 . THR G 1 183 ? 129.273 90.413  90.937  1.00 30.00  ? 183 THR G OG1 1 
ATOM 10512 C CG2 . THR G 1 183 ? 128.920 91.536  93.022  1.00 30.00  ? 183 THR G CG2 1 
ATOM 10513 N N   . GLY G 1 184 ? 131.882 92.293  94.149  1.00 79.97  ? 184 GLY G N   1 
ATOM 10514 C CA  . GLY G 1 184 ? 132.376 92.398  95.499  1.00 78.59  ? 184 GLY G CA  1 
ATOM 10515 C C   . GLY G 1 184 ? 131.987 93.658  96.224  1.00 88.15  ? 184 GLY G C   1 
ATOM 10516 O O   . GLY G 1 184 ? 131.182 94.455  95.746  1.00 103.22 ? 184 GLY G O   1 
ATOM 10517 N N   . LYS G 1 185 ? 132.592 93.845  97.391  1.00 86.13  ? 185 LYS G N   1 
ATOM 10518 C CA  . LYS G 1 185 ? 132.382 95.051  98.172  1.00 94.37  ? 185 LYS G CA  1 
ATOM 10519 C C   . LYS G 1 185 ? 133.676 95.409  98.884  1.00 83.41  ? 185 LYS G C   1 
ATOM 10520 O O   . LYS G 1 185 ? 134.483 94.537  99.211  1.00 95.27  ? 185 LYS G O   1 
ATOM 10521 C CB  . LYS G 1 185 ? 131.240 94.875  99.174  1.00 30.00  ? 185 LYS G CB  1 
ATOM 10522 C CG  . LYS G 1 185 ? 131.483 93.814  100.225 1.00 30.00  ? 185 LYS G CG  1 
ATOM 10523 C CD  . LYS G 1 185 ? 130.299 93.690  101.153 1.00 30.00  ? 185 LYS G CD  1 
ATOM 10524 C CE  . LYS G 1 185 ? 130.193 94.906  102.046 1.00 30.00  ? 185 LYS G CE  1 
ATOM 10525 N NZ  . LYS G 1 185 ? 129.077 94.799  103.017 1.00 30.00  ? 185 LYS G NZ  1 
ATOM 10526 N N   . VAL G 1 186 ? 133.879 96.703  99.096  1.00 72.23  ? 186 VAL G N   1 
ATOM 10527 C CA  . VAL G 1 186 ? 135.057 97.212  99.787  1.00 76.48  ? 186 VAL G CA  1 
ATOM 10528 C C   . VAL G 1 186 ? 134.567 97.926  101.035 1.00 91.96  ? 186 VAL G C   1 
ATOM 10529 O O   . VAL G 1 186 ? 133.894 98.958  100.939 1.00 98.46  ? 186 VAL G O   1 
ATOM 10530 C CB  . VAL G 1 186 ? 135.880 98.154  98.901  1.00 30.00  ? 186 VAL G CB  1 
ATOM 10531 C CG1 . VAL G 1 186 ? 137.048 98.705  99.683  1.00 30.00  ? 186 VAL G CG1 1 
ATOM 10532 C CG2 . VAL G 1 186 ? 136.363 97.434  97.663  1.00 30.00  ? 186 VAL G CG2 1 
ATOM 10533 N N   . ILE G 1 187 ? 134.896 97.393  102.203 1.00 77.25  ? 187 ILE G N   1 
ATOM 10534 C CA  . ILE G 1 187 ? 134.399 97.916  103.474 1.00 61.12  ? 187 ILE G CA  1 
ATOM 10535 C C   . ILE G 1 187 ? 135.555 98.535  104.251 1.00 80.93  ? 187 ILE G C   1 
ATOM 10536 O O   . ILE G 1 187 ? 136.651 97.962  104.267 1.00 97.89  ? 187 ILE G O   1 
ATOM 10537 C CB  . ILE G 1 187 ? 133.677 96.829  104.299 1.00 30.00  ? 187 ILE G CB  1 
ATOM 10538 C CG1 . ILE G 1 187 ? 133.108 97.422  105.594 1.00 30.00  ? 187 ILE G CG1 1 
ATOM 10539 C CG2 . ILE G 1 187 ? 134.541 95.579  104.514 1.00 30.00  ? 187 ILE G CG2 1 
ATOM 10540 C CD1 . ILE G 1 187 ? 132.044 96.569  106.254 1.00 30.00  ? 187 ILE G CD1 1 
ATOM 10541 N N   . PRO G 1 188 ? 135.381 99.713  104.831 1.00 79.27  ? 188 PRO G N   1 
ATOM 10542 C CA  . PRO G 1 188 ? 136.439 100.311 105.652 1.00 92.71  ? 188 PRO G CA  1 
ATOM 10543 C C   . PRO G 1 188 ? 136.451 99.797  107.080 1.00 106.31 ? 188 PRO G C   1 
ATOM 10544 O O   . PRO G 1 188 ? 135.760 98.829  107.415 1.00 120.75 ? 188 PRO G O   1 
ATOM 10545 C CB  . PRO G 1 188 ? 136.100 101.804 105.626 1.00 30.00  ? 188 PRO G CB  1 
ATOM 10546 C CG  . PRO G 1 188 ? 135.200 101.974 104.467 1.00 30.00  ? 188 PRO G CG  1 
ATOM 10547 C CD  . PRO G 1 188 ? 134.403 100.718 104.403 1.00 30.00  ? 188 PRO G CD  1 
ATOM 10548 N N   . GLU G 1 189 ? 137.273 100.438 107.915 1.00 104.74 ? 189 GLU G N   1 
ATOM 10549 C CA  . GLU G 1 189 ? 137.269 100.174 109.350 1.00 101.76 ? 189 GLU G CA  1 
ATOM 10550 C C   . GLU G 1 189 ? 135.920 100.515 109.964 1.00 111.14 ? 189 GLU G C   1 
ATOM 10551 O O   . GLU G 1 189 ? 135.211 99.639  110.471 1.00 104.62 ? 189 GLU G O   1 
ATOM 10552 C CB  . GLU G 1 189 ? 138.381 100.979 110.021 1.00 30.00  ? 189 GLU G CB  1 
ATOM 10553 C CG  . GLU G 1 189 ? 138.472 100.802 111.522 1.00 30.00  ? 189 GLU G CG  1 
ATOM 10554 C CD  . GLU G 1 189 ? 139.613 101.596 112.127 1.00 30.00  ? 189 GLU G CD  1 
ATOM 10555 O OE1 . GLU G 1 189 ? 140.315 102.297 111.371 1.00 30.00  ? 189 GLU G OE1 1 
ATOM 10556 O OE2 . GLU G 1 189 ? 139.811 101.524 113.357 1.00 30.00  ? 189 GLU G OE2 1 
ATOM 10557 N N   . PHE G 1 190 ? 135.547 101.790 109.920 1.00 129.13 ? 190 PHE G N   1 
ATOM 10558 C CA  . PHE G 1 190 ? 134.247 102.222 110.398 1.00 141.21 ? 190 PHE G CA  1 
ATOM 10559 C C   . PHE G 1 190 ? 133.454 102.996 109.357 1.00 124.26 ? 190 PHE G C   1 
ATOM 10560 O O   . PHE G 1 190 ? 132.437 103.603 109.705 1.00 113.63 ? 190 PHE G O   1 
ATOM 10561 C CB  . PHE G 1 190 ? 134.386 103.062 111.684 1.00 30.00  ? 190 PHE G CB  1 
ATOM 10562 C CG  . PHE G 1 190 ? 135.240 104.301 111.535 1.00 30.00  ? 190 PHE G CG  1 
ATOM 10563 C CD1 . PHE G 1 190 ? 136.601 104.252 111.800 1.00 30.00  ? 190 PHE G CD1 1 
ATOM 10564 C CD2 . PHE G 1 190 ? 134.681 105.519 111.171 1.00 30.00  ? 190 PHE G CD2 1 
ATOM 10565 C CE1 . PHE G 1 190 ? 137.390 105.386 111.681 1.00 30.00  ? 190 PHE G CE1 1 
ATOM 10566 C CE2 . PHE G 1 190 ? 135.466 106.648 111.047 1.00 30.00  ? 190 PHE G CE2 1 
ATOM 10567 C CZ  . PHE G 1 190 ? 136.820 106.581 111.307 1.00 30.00  ? 190 PHE G CZ  1 
ATOM 10568 N N   . GLY G 1 191 ? 133.887 103.003 108.103 1.00 111.32 ? 191 GLY G N   1 
ATOM 10569 C CA  . GLY G 1 191 ? 133.169 103.699 107.061 1.00 115.22 ? 191 GLY G CA  1 
ATOM 10570 C C   . GLY G 1 191 ? 131.973 102.914 106.552 1.00 110.01 ? 191 GLY G C   1 
ATOM 10571 O O   . GLY G 1 191 ? 131.623 101.842 107.047 1.00 109.59 ? 191 GLY G O   1 
ATOM 10572 N N   . ALA G 1 192 ? 131.335 103.480 105.546 1.00 108.77 ? 192 ALA G N   1 
ATOM 10573 C CA  . ALA G 1 192 ? 130.244 102.791 104.873 1.00 106.70 ? 192 ALA G CA  1 
ATOM 10574 C C   . ALA G 1 192 ? 130.795 101.996 103.701 1.00 76.53  ? 192 ALA G C   1 
ATOM 10575 O O   . ALA G 1 192 ? 131.635 102.512 102.960 1.00 78.88  ? 192 ALA G O   1 
ATOM 10576 C CB  . ALA G 1 192 ? 129.202 103.780 104.380 1.00 30.00  ? 192 ALA G CB  1 
ATOM 10577 N N   . PRO G 1 193 ? 130.364 100.750 103.507 1.00 77.98  ? 193 PRO G N   1 
ATOM 10578 C CA  . PRO G 1 193 ? 130.989 99.901  102.487 1.00 87.61  ? 193 PRO G CA  1 
ATOM 10579 C C   . PRO G 1 193 ? 130.604 100.318 101.076 1.00 84.24  ? 193 PRO G C   1 
ATOM 10580 O O   . PRO G 1 193 ? 129.433 100.561 100.780 1.00 100.83 ? 193 PRO G O   1 
ATOM 10581 C CB  . PRO G 1 193 ? 130.458 98.504  102.818 1.00 30.00  ? 193 PRO G CB  1 
ATOM 10582 C CG  . PRO G 1 193 ? 129.189 98.743  103.517 1.00 30.00  ? 193 PRO G CG  1 
ATOM 10583 C CD  . PRO G 1 193 ? 129.368 100.011 104.297 1.00 30.00  ? 193 PRO G CD  1 
ATOM 10584 N N   . GLY G 1 194 ? 131.609 100.405 100.210 1.00 86.21  ? 194 GLY G N   1 
ATOM 10585 C CA  . GLY G 1 194 ? 131.384 100.655 98.801  1.00 97.13  ? 194 GLY G CA  1 
ATOM 10586 C C   . GLY G 1 194 ? 131.444 99.360  98.014  1.00 91.83  ? 194 GLY G C   1 
ATOM 10587 O O   . GLY G 1 194 ? 132.091 98.399  98.424  1.00 103.47 ? 194 GLY G O   1 
ATOM 10588 N N   . VAL G 1 195 ? 130.773 99.352  96.875  1.00 73.79  ? 195 VAL G N   1 
ATOM 10589 C CA  . VAL G 1 195 ? 130.443 98.100  96.224  1.00 78.62  ? 195 VAL G CA  1 
ATOM 10590 C C   . VAL G 1 195 ? 131.042 98.078  94.822  1.00 87.46  ? 195 VAL G C   1 
ATOM 10591 O O   . VAL G 1 195 ? 131.398 99.111  94.251  1.00 109.43 ? 195 VAL G O   1 
ATOM 10592 C CB  . VAL G 1 195 ? 128.912 97.913  96.212  1.00 30.00  ? 195 VAL G CB  1 
ATOM 10593 C CG1 . VAL G 1 195 ? 128.274 98.736  95.114  1.00 30.00  ? 195 VAL G CG1 1 
ATOM 10594 C CG2 . VAL G 1 195 ? 128.509 96.449  96.194  1.00 30.00  ? 195 VAL G CG2 1 
ATOM 10595 N N   . ILE G 1 196 ? 131.190 96.873  94.273  1.00 80.94  ? 196 ILE G N   1 
ATOM 10596 C CA  . ILE G 1 196 ? 131.779 96.673  92.955  1.00 81.29  ? 196 ILE G CA  1 
ATOM 10597 C C   . ILE G 1 196 ? 131.211 95.420  92.293  1.00 89.24  ? 196 ILE G C   1 
ATOM 10598 O O   . ILE G 1 196 ? 131.233 94.328  92.870  1.00 98.54  ? 196 ILE G O   1 
ATOM 10599 C CB  . ILE G 1 196 ? 133.319 96.632  93.057  1.00 30.00  ? 196 ILE G CB  1 
ATOM 10600 C CG1 . ILE G 1 196 ? 133.960 96.285  91.721  1.00 30.00  ? 196 ILE G CG1 1 
ATOM 10601 C CG2 . ILE G 1 196 ? 133.820 95.740  94.179  1.00 30.00  ? 196 ILE G CG2 1 
ATOM 10602 C CD1 . ILE G 1 196 ? 135.446 96.393  91.770  1.00 30.00  ? 196 ILE G CD1 1 
ATOM 10603 N N   . GLU G 1 197 ? 130.685 95.569  91.078  1.00 100.52 ? 197 GLU G N   1 
ATOM 10604 C CA  . GLU G 1 197 ? 130.078 94.454  90.354  1.00 92.70  ? 197 GLU G CA  1 
ATOM 10605 C C   . GLU G 1 197 ? 130.356 94.612  88.869  1.00 91.79  ? 197 GLU G C   1 
ATOM 10606 O O   . GLU G 1 197 ? 129.750 95.462  88.212  1.00 115.82 ? 197 GLU G O   1 
ATOM 10607 C CB  . GLU G 1 197 ? 128.575 94.382  90.600  1.00 30.00  ? 197 GLU G CB  1 
ATOM 10608 C CG  . GLU G 1 197 ? 127.907 93.242  89.857  1.00 30.00  ? 197 GLU G CG  1 
ATOM 10609 C CD  . GLU G 1 197 ? 126.425 93.144  90.144  1.00 30.00  ? 197 GLU G CD  1 
ATOM 10610 O OE1 . GLU G 1 197 ? 125.913 93.986  90.908  1.00 30.00  ? 197 GLU G OE1 1 
ATOM 10611 O OE2 . GLU G 1 197 ? 125.771 92.223  89.607  1.00 30.00  ? 197 GLU G OE2 1 
ATOM 10612 N N   . PHE G 1 198 ? 131.232 93.774  88.332  1.00 80.89  ? 198 PHE G N   1 
ATOM 10613 C CA  . PHE G 1 198 ? 131.621 93.855  86.935  1.00 87.10  ? 198 PHE G CA  1 
ATOM 10614 C C   . PHE G 1 198 ? 130.586 93.191  86.046  1.00 99.66  ? 198 PHE G C   1 
ATOM 10615 O O   . PHE G 1 198 ? 129.569 92.678  86.520  1.00 107.35 ? 198 PHE G O   1 
ATOM 10616 C CB  . PHE G 1 198 ? 132.946 93.153  86.682  1.00 30.00  ? 198 PHE G CB  1 
ATOM 10617 C CG  . PHE G 1 198 ? 134.095 93.702  87.441  1.00 30.00  ? 198 PHE G CG  1 
ATOM 10618 C CD1 . PHE G 1 198 ? 134.740 94.828  87.012  1.00 30.00  ? 198 PHE G CD1 1 
ATOM 10619 C CD2 . PHE G 1 198 ? 134.565 93.057  88.559  1.00 30.00  ? 198 PHE G CD2 1 
ATOM 10620 C CE1 . PHE G 1 198 ? 135.818 95.316  87.688  1.00 30.00  ? 198 PHE G CE1 1 
ATOM 10621 C CE2 . PHE G 1 198 ? 135.643 93.533  89.249  1.00 30.00  ? 198 PHE G CE2 1 
ATOM 10622 C CZ  . PHE G 1 198 ? 136.273 94.664  88.808  1.00 30.00  ? 198 PHE G CZ  1 
ATOM 10623 N N   . THR G 1 199 ? 130.864 93.204  84.745  1.00 95.30  ? 199 THR G N   1 
ATOM 10624 C CA  . THR G 1 199 ? 130.243 92.270  83.819  1.00 87.27  ? 199 THR G CA  1 
ATOM 10625 C C   . THR G 1 199 ? 131.287 91.504  83.021  1.00 91.37  ? 199 THR G C   1 
ATOM 10626 O O   . THR G 1 199 ? 130.989 90.414  82.521  1.00 118.25 ? 199 THR G O   1 
ATOM 10627 C CB  . THR G 1 199 ? 129.308 92.995  82.851  1.00 30.00  ? 199 THR G CB  1 
ATOM 10628 O OG1 . THR G 1 199 ? 130.050 93.966  82.105  1.00 30.00  ? 199 THR G OG1 1 
ATOM 10629 C CG2 . THR G 1 199 ? 128.183 93.677  83.593  1.00 30.00  ? 199 THR G CG2 1 
ATOM 10630 N N   . THR G 1 200 ? 132.516 92.055  82.920  1.00 66.50  ? 200 THR G N   1 
ATOM 10631 C CA  . THR G 1 200 ? 133.640 91.596  82.105  1.00 93.24  ? 200 THR G CA  1 
ATOM 10632 C C   . THR G 1 200 ? 133.169 91.435  80.666  1.00 108.13 ? 200 THR G C   1 
ATOM 10633 O O   . THR G 1 200 ? 132.824 90.318  80.258  1.00 112.01 ? 200 THR G O   1 
ATOM 10634 C CB  . THR G 1 200 ? 134.238 90.296  82.640  1.00 30.00  ? 200 THR G CB  1 
ATOM 10635 O OG1 . THR G 1 200 ? 134.494 90.442  84.037  1.00 30.00  ? 200 THR G OG1 1 
ATOM 10636 C CG2 . THR G 1 200 ? 135.567 90.017  81.961  1.00 30.00  ? 200 THR G CG2 1 
ATOM 10637 N N   . PRO G 1 201 ? 133.041 92.536  79.921  1.00 98.08  ? 201 PRO G N   1 
ATOM 10638 C CA  . PRO G 1 201 ? 132.349 92.501  78.624  1.00 101.37 ? 201 PRO G CA  1 
ATOM 10639 C C   . PRO G 1 201 ? 133.042 91.607  77.609  1.00 96.67  ? 201 PRO G C   1 
ATOM 10640 O O   . PRO G 1 201 ? 134.261 91.648  77.446  1.00 97.22  ? 201 PRO G O   1 
ATOM 10641 C CB  . PRO G 1 201 ? 132.360 93.967  78.183  1.00 30.00  ? 201 PRO G CB  1 
ATOM 10642 C CG  . PRO G 1 201 ? 133.512 94.556  78.884  1.00 30.00  ? 201 PRO G CG  1 
ATOM 10643 C CD  . PRO G 1 201 ? 133.593 93.865  80.209  1.00 30.00  ? 201 PRO G CD  1 
ATOM 10644 N N   . SER G 1 202 ? 132.229 90.814  76.915  1.00 84.53  ? 202 SER G N   1 
ATOM 10645 C CA  . SER G 1 202 ? 132.676 89.548  76.353  1.00 96.04  ? 202 SER G CA  1 
ATOM 10646 C C   . SER G 1 202 ? 133.585 89.736  75.150  1.00 107.48 ? 202 SER G C   1 
ATOM 10647 O O   . SER G 1 202 ? 133.367 90.621  74.319  1.00 120.32 ? 202 SER G O   1 
ATOM 10648 C CB  . SER G 1 202 ? 131.473 88.703  75.949  1.00 30.00  ? 202 SER G CB  1 
ATOM 10649 O OG  . SER G 1 202 ? 130.778 89.312  74.879  1.00 30.00  ? 202 SER G OG  1 
ATOM 10650 N N   . THR G 1 203 ? 134.624 88.896  75.097  1.00 102.41 ? 203 THR G N   1 
ATOM 10651 C CA  . THR G 1 203 ? 135.453 88.622  73.923  1.00 89.41  ? 203 THR G CA  1 
ATOM 10652 C C   . THR G 1 203 ? 136.180 89.893  73.470  1.00 95.49  ? 203 THR G C   1 
ATOM 10653 O O   . THR G 1 203 ? 135.972 90.429  72.382  1.00 116.57 ? 203 THR G O   1 
ATOM 10654 C CB  . THR G 1 203 ? 134.586 88.000  72.824  1.00 30.00  ? 203 THR G CB  1 
ATOM 10655 O OG1 . THR G 1 203 ? 133.727 87.031  73.431  1.00 30.00  ? 203 THR G OG1 1 
ATOM 10656 C CG2 . THR G 1 203 ? 135.438 87.243  71.849  1.00 30.00  ? 203 THR G CG2 1 
ATOM 10657 N N   . TYR G 1 204 ? 137.034 90.366  74.370  1.00 87.34  ? 204 TYR G N   1 
ATOM 10658 C CA  . TYR G 1 204 ? 137.555 91.723  74.373  1.00 85.33  ? 204 TYR G CA  1 
ATOM 10659 C C   . TYR G 1 204 ? 138.974 91.812  73.825  1.00 90.64  ? 204 TYR G C   1 
ATOM 10660 O O   . TYR G 1 204 ? 139.605 90.814  73.472  1.00 110.75 ? 204 TYR G O   1 
ATOM 10661 C CB  . TYR G 1 204 ? 137.508 92.290  75.795  1.00 30.00  ? 204 TYR G CB  1 
ATOM 10662 C CG  . TYR G 1 204 ? 138.057 91.361  76.866  1.00 30.00  ? 204 TYR G CG  1 
ATOM 10663 C CD1 . TYR G 1 204 ? 139.417 91.242  77.102  1.00 30.00  ? 204 TYR G CD1 1 
ATOM 10664 C CD2 . TYR G 1 204 ? 137.201 90.586  77.633  1.00 30.00  ? 204 TYR G CD2 1 
ATOM 10665 C CE1 . TYR G 1 204 ? 139.895 90.394  78.075  1.00 30.00  ? 204 TYR G CE1 1 
ATOM 10666 C CE2 . TYR G 1 204 ? 137.674 89.754  78.615  1.00 30.00  ? 204 TYR G CE2 1 
ATOM 10667 C CZ  . TYR G 1 204 ? 139.018 89.651  78.824  1.00 30.00  ? 204 TYR G CZ  1 
ATOM 10668 O OH  . TYR G 1 204 ? 139.481 88.802  79.795  1.00 30.00  ? 204 TYR G OH  1 
ATOM 10669 N N   . THR G 1 205 ? 139.457 93.053  73.767  1.00 82.57  ? 205 THR G N   1 
ATOM 10670 C CA  . THR G 1 205 ? 140.837 93.424  73.483  1.00 83.12  ? 205 THR G CA  1 
ATOM 10671 C C   . THR G 1 205 ? 141.529 93.814  74.787  1.00 89.17  ? 205 THR G C   1 
ATOM 10672 O O   . THR G 1 205 ? 140.959 93.697  75.871  1.00 113.02 ? 205 THR G O   1 
ATOM 10673 C CB  . THR G 1 205 ? 140.891 94.574  72.480  1.00 30.00  ? 205 THR G CB  1 
ATOM 10674 O OG1 . THR G 1 205 ? 140.268 95.728  73.056  1.00 30.00  ? 205 THR G OG1 1 
ATOM 10675 C CG2 . THR G 1 205 ? 140.156 94.194  71.208  1.00 30.00  ? 205 THR G CG2 1 
ATOM 10676 N N   . SER G 1 206 ? 142.763 94.301  74.681  1.00 77.54  ? 206 SER G N   1 
ATOM 10677 C CA  . SER G 1 206 ? 143.527 94.592  75.886  1.00 75.49  ? 206 SER G CA  1 
ATOM 10678 C C   . SER G 1 206 ? 143.038 95.876  76.545  1.00 85.95  ? 206 SER G C   1 
ATOM 10679 O O   . SER G 1 206 ? 142.406 96.722  75.908  1.00 96.77  ? 206 SER G O   1 
ATOM 10680 C CB  . SER G 1 206 ? 145.018 94.691  75.576  1.00 30.00  ? 206 SER G CB  1 
ATOM 10681 O OG  . SER G 1 206 ? 145.535 93.450  75.134  1.00 30.00  ? 206 SER G OG  1 
ATOM 10682 N N   . GLU G 1 207 ? 143.339 95.998  77.846  1.00 92.70  ? 207 GLU G N   1 
ATOM 10683 C CA  . GLU G 1 207 ? 142.913 97.104  78.716  1.00 84.94  ? 207 GLU G CA  1 
ATOM 10684 C C   . GLU G 1 207 ? 141.383 97.205  78.734  1.00 75.08  ? 207 GLU G C   1 
ATOM 10685 O O   . GLU G 1 207 ? 140.762 98.035  78.076  1.00 99.39  ? 207 GLU G O   1 
ATOM 10686 C CB  . GLU G 1 207 ? 143.593 98.426  78.341  1.00 30.00  ? 207 GLU G CB  1 
ATOM 10687 C CG  . GLU G 1 207 ? 143.553 99.461  79.447  1.00 30.00  ? 207 GLU G CG  1 
ATOM 10688 C CD  . GLU G 1 207 ? 142.334 100.341 79.404  1.00 30.00  ? 207 GLU G CD  1 
ATOM 10689 O OE1 . GLU G 1 207 ? 141.847 100.635 78.294  1.00 30.00  ? 207 GLU G OE1 1 
ATOM 10690 O OE2 . GLU G 1 207 ? 141.860 100.739 80.483  1.00 30.00  ? 207 GLU G OE2 1 
ATOM 10691 N N   . VAL G 1 208 ? 140.793 96.277  79.482  1.00 54.53  ? 208 VAL G N   1 
ATOM 10692 C CA  . VAL G 1 208 ? 139.449 95.744  79.276  1.00 74.84  ? 208 VAL G CA  1 
ATOM 10693 C C   . VAL G 1 208 ? 138.356 96.706  79.764  1.00 90.59  ? 208 VAL G C   1 
ATOM 10694 O O   . VAL G 1 208 ? 137.166 96.424  79.590  1.00 111.15 ? 208 VAL G O   1 
ATOM 10695 C CB  . VAL G 1 208 ? 139.395 94.370  79.983  1.00 30.00  ? 208 VAL G CB  1 
ATOM 10696 C CG1 . VAL G 1 208 ? 138.196 93.502  79.608  1.00 30.00  ? 208 VAL G CG1 1 
ATOM 10697 C CG2 . VAL G 1 208 ? 140.668 93.613  79.713  1.00 30.00  ? 208 VAL G CG2 1 
ATOM 10698 N N   . ILE G 1 209 ? 138.747 97.924  80.173  1.00 82.05  ? 209 ILE G N   1 
ATOM 10699 C CA  . ILE G 1 209 ? 138.131 98.763  81.213  1.00 100.57 ? 209 ILE G CA  1 
ATOM 10700 C C   . ILE G 1 209 ? 136.609 98.716  81.291  1.00 110.18 ? 209 ILE G C   1 
ATOM 10701 O O   . ILE G 1 209 ? 135.901 98.939  80.304  1.00 121.76 ? 209 ILE G O   1 
ATOM 10702 C CB  . ILE G 1 209 ? 138.594 100.226 81.031  1.00 30.00  ? 209 ILE G CB  1 
ATOM 10703 C CG1 . ILE G 1 209 ? 137.863 101.165 81.994  1.00 30.00  ? 209 ILE G CG1 1 
ATOM 10704 C CG2 . ILE G 1 209 ? 138.508 100.684 79.570  1.00 30.00  ? 209 ILE G CG2 1 
ATOM 10705 C CD1 . ILE G 1 209 ? 138.372 102.587 81.961  1.00 30.00  ? 209 ILE G CD1 1 
ATOM 10706 N N   . GLU G 1 210 ? 136.107 98.392  82.477  1.00 30.00  ? 210 GLU G N   1 
ATOM 10707 C CA  . GLU G 1 210 ? 134.693 98.146  82.674  1.00 30.00  ? 210 GLU G CA  1 
ATOM 10708 C C   . GLU G 1 210 ? 134.297 98.756  84.007  1.00 30.00  ? 210 GLU G C   1 
ATOM 10709 O O   . GLU G 1 210 ? 135.017 98.653  85.002  1.00 30.00  ? 210 GLU G O   1 
ATOM 10710 C CB  . GLU G 1 210 ? 134.379 96.644  82.586  1.00 30.00  ? 210 GLU G CB  1 
ATOM 10711 C CG  . GLU G 1 210 ? 134.946 95.776  83.684  1.00 30.00  ? 210 GLU G CG  1 
ATOM 10712 C CD  . GLU G 1 210 ? 136.388 95.360  83.480  1.00 30.00  ? 210 GLU G CD  1 
ATOM 10713 O OE1 . GLU G 1 210 ? 137.048 95.872  82.556  1.00 30.00  ? 210 GLU G OE1 1 
ATOM 10714 O OE2 . GLU G 1 210 ? 136.878 94.531  84.273  1.00 30.00  ? 210 GLU G OE2 1 
ATOM 10715 N N   . LEU G 1 211 ? 133.168 99.438  84.004  1.00 30.00  ? 211 LEU G N   1 
ATOM 10716 C CA  . LEU G 1 211 ? 132.841 100.360 85.075  1.00 30.00  ? 211 LEU G CA  1 
ATOM 10717 C C   . LEU G 1 211 ? 132.381 99.606  86.315  1.00 30.00  ? 211 LEU G C   1 
ATOM 10718 O O   . LEU G 1 211 ? 131.711 98.575  86.224  1.00 30.00  ? 211 LEU G O   1 
ATOM 10719 C CB  . LEU G 1 211 ? 131.761 101.347 84.625  1.00 30.00  ? 211 LEU G CB  1 
ATOM 10720 C CG  . LEU G 1 211 ? 132.152 102.315 83.506  1.00 30.00  ? 211 LEU G CG  1 
ATOM 10721 C CD1 . LEU G 1 211 ? 130.949 103.132 83.059  1.00 30.00  ? 211 LEU G CD1 1 
ATOM 10722 C CD2 . LEU G 1 211 ? 133.288 103.224 83.951  1.00 30.00  ? 211 LEU G CD2 1 
ATOM 10723 N N   . GLN G 1 212 ? 132.802 100.125 87.467  1.00 30.00  ? 212 GLN G N   1 
ATOM 10724 C CA  . GLN G 1 212 ? 132.345 99.738  88.802  1.00 30.00  ? 212 GLN G CA  1 
ATOM 10725 C C   . GLN G 1 212 ? 132.590 98.271  89.127  1.00 30.00  ? 212 GLN G C   1 
ATOM 10726 O O   . GLN G 1 212 ? 131.740 97.419  88.887  1.00 30.00  ? 212 GLN G O   1 
ATOM 10727 C CB  . GLN G 1 212 ? 130.863 100.078 88.969  1.00 30.00  ? 212 GLN G CB  1 
ATOM 10728 C CG  . GLN G 1 212 ? 130.341 99.930  90.380  1.00 30.00  ? 212 GLN G CG  1 
ATOM 10729 C CD  . GLN G 1 212 ? 128.922 100.414 90.507  1.00 30.00  ? 212 GLN G CD  1 
ATOM 10730 O OE1 . GLN G 1 212 ? 128.312 100.825 89.525  1.00 30.00  ? 212 GLN G OE1 1 
ATOM 10731 N NE2 . GLN G 1 212 ? 128.389 100.380 91.720  1.00 30.00  ? 212 GLN G NE2 1 
ATOM 10732 N N   . ALA H 1 6   ? 114.217 116.831 215.089 1.00 30.00  ? 6   ALA H N   1 
ATOM 10733 C CA  . ALA H 1 6   ? 113.273 116.194 214.178 1.00 30.00  ? 6   ALA H CA  1 
ATOM 10734 C C   . ALA H 1 6   ? 113.997 115.602 212.974 1.00 30.00  ? 6   ALA H C   1 
ATOM 10735 O O   . ALA H 1 6   ? 115.219 115.460 212.983 1.00 30.00  ? 6   ALA H O   1 
ATOM 10736 C CB  . ALA H 1 6   ? 112.217 117.190 213.727 1.00 30.00  ? 6   ALA H CB  1 
ATOM 10737 N N   . VAL H 1 7   ? 113.236 115.259 211.934 1.00 176.07 ? 7   VAL H N   1 
ATOM 10738 C CA  . VAL H 1 7   ? 113.807 114.671 210.727 1.00 158.44 ? 7   VAL H CA  1 
ATOM 10739 C C   . VAL H 1 7   ? 113.698 115.756 209.653 1.00 137.52 ? 7   VAL H C   1 
ATOM 10740 O O   . VAL H 1 7   ? 113.623 115.482 208.450 1.00 139.74 ? 7   VAL H O   1 
ATOM 10741 C CB  . VAL H 1 7   ? 113.080 113.358 210.356 1.00 30.00  ? 7   VAL H CB  1 
ATOM 10742 C CG1 . VAL H 1 7   ? 113.900 112.478 209.386 1.00 30.00  ? 7   VAL H CG1 1 
ATOM 10743 C CG2 . VAL H 1 7   ? 112.710 112.573 211.609 1.00 30.00  ? 7   VAL H CG2 1 
ATOM 10744 N N   . GLY H 1 8   ? 113.677 117.015 210.092 1.00 131.64 ? 8   GLY H N   1 
ATOM 10745 C CA  . GLY H 1 8   ? 113.664 118.132 209.166 1.00 139.85 ? 8   GLY H CA  1 
ATOM 10746 C C   . GLY H 1 8   ? 115.009 118.481 208.570 1.00 132.89 ? 8   GLY H C   1 
ATOM 10747 O O   . GLY H 1 8   ? 115.073 119.301 207.650 1.00 133.27 ? 8   GLY H O   1 
ATOM 10748 N N   . ILE H 1 9   ? 116.084 117.875 209.075 1.00 131.26 ? 9   ILE H N   1 
ATOM 10749 C CA  . ILE H 1 9   ? 117.417 118.134 208.544 1.00 135.93 ? 9   ILE H CA  1 
ATOM 10750 C C   . ILE H 1 9   ? 117.706 117.212 207.363 1.00 126.64 ? 9   ILE H C   1 
ATOM 10751 O O   . ILE H 1 9   ? 118.263 117.642 206.345 1.00 121.41 ? 9   ILE H O   1 
ATOM 10752 C CB  . ILE H 1 9   ? 118.478 117.995 209.661 1.00 30.00  ? 9   ILE H CB  1 
ATOM 10753 C CG1 . ILE H 1 9   ? 118.295 119.058 210.757 1.00 30.00  ? 9   ILE H CG1 1 
ATOM 10754 C CG2 . ILE H 1 9   ? 119.896 118.087 209.108 1.00 30.00  ? 9   ILE H CG2 1 
ATOM 10755 C CD1 . ILE H 1 9   ? 117.488 118.617 211.978 1.00 30.00  ? 9   ILE H CD1 1 
ATOM 10756 N N   . GLY H 1 10  ? 117.294 115.943 207.466 1.00 116.23 ? 10  GLY H N   1 
ATOM 10757 C CA  . GLY H 1 10  ? 117.586 114.972 206.423 1.00 108.48 ? 10  GLY H CA  1 
ATOM 10758 C C   . GLY H 1 10  ? 116.845 115.217 205.124 1.00 119.42 ? 10  GLY H C   1 
ATOM 10759 O O   . GLY H 1 10  ? 117.330 114.845 204.051 1.00 124.33 ? 10  GLY H O   1 
ATOM 10760 N N   . THR H 1 11  ? 115.669 115.846 205.194 1.00 133.79 ? 11  THR H N   1 
ATOM 10761 C CA  . THR H 1 11  ? 114.952 116.201 203.973 1.00 134.97 ? 11  THR H CA  1 
ATOM 10762 C C   . THR H 1 11  ? 115.603 117.382 203.265 1.00 126.74 ? 11  THR H C   1 
ATOM 10763 O O   . THR H 1 11  ? 115.382 117.583 202.065 1.00 132.88 ? 11  THR H O   1 
ATOM 10764 C CB  . THR H 1 11  ? 113.492 116.514 204.293 1.00 30.00  ? 11  THR H CB  1 
ATOM 10765 O OG1 . THR H 1 11  ? 113.427 117.624 205.197 1.00 30.00  ? 11  THR H OG1 1 
ATOM 10766 C CG2 . THR H 1 11  ? 112.820 115.310 204.934 1.00 30.00  ? 11  THR H CG2 1 
ATOM 10767 N N   . LEU H 1 12  ? 116.401 118.171 203.987 1.00 118.09 ? 12  LEU H N   1 
ATOM 10768 C CA  . LEU H 1 12  ? 117.129 119.271 203.364 1.00 128.80 ? 12  LEU H CA  1 
ATOM 10769 C C   . LEU H 1 12  ? 118.417 118.779 202.715 1.00 127.81 ? 12  LEU H C   1 
ATOM 10770 O O   . LEU H 1 12  ? 119.036 119.494 201.920 1.00 112.49 ? 12  LEU H O   1 
ATOM 10771 C CB  . LEU H 1 12  ? 117.427 120.353 204.401 1.00 30.00  ? 12  LEU H CB  1 
ATOM 10772 C CG  . LEU H 1 12  ? 116.212 121.069 204.994 1.00 30.00  ? 12  LEU H CG  1 
ATOM 10773 C CD1 . LEU H 1 12  ? 116.635 122.031 206.094 1.00 30.00  ? 12  LEU H CD1 1 
ATOM 10774 C CD2 . LEU H 1 12  ? 115.441 121.796 203.905 1.00 30.00  ? 12  LEU H CD2 1 
ATOM 10775 N N   . ILE H 1 13  ? 118.843 117.561 203.054 1.00 134.37 ? 13  ILE H N   1 
ATOM 10776 C CA  . ILE H 1 13  ? 120.062 117.012 202.472 1.00 120.65 ? 13  ILE H CA  1 
ATOM 10777 C C   . ILE H 1 13  ? 119.828 116.616 201.019 1.00 125.25 ? 13  ILE H C   1 
ATOM 10778 O O   . ILE H 1 13  ? 120.662 116.891 200.146 1.00 127.06 ? 13  ILE H O   1 
ATOM 10779 C CB  . ILE H 1 13  ? 120.560 115.830 203.323 1.00 30.00  ? 13  ILE H CB  1 
ATOM 10780 C CG1 . ILE H 1 13  ? 120.914 116.311 204.729 1.00 30.00  ? 13  ILE H CG1 1 
ATOM 10781 C CG2 . ILE H 1 13  ? 121.768 115.168 202.692 1.00 30.00  ? 13  ILE H CG2 1 
ATOM 10782 C CD1 . ILE H 1 13  ? 121.250 115.192 205.691 1.00 30.00  ? 13  ILE H CD1 1 
ATOM 10783 N N   . VAL H 1 14  ? 118.684 115.984 200.735 1.00 120.61 ? 14  VAL H N   1 
ATOM 10784 C CA  . VAL H 1 14  ? 118.326 115.613 199.367 1.00 119.27 ? 14  VAL H CA  1 
ATOM 10785 C C   . VAL H 1 14  ? 118.102 116.858 198.515 1.00 125.86 ? 14  VAL H C   1 
ATOM 10786 O O   . VAL H 1 14  ? 118.448 116.877 197.327 1.00 127.57 ? 14  VAL H O   1 
ATOM 10787 C CB  . VAL H 1 14  ? 117.091 114.688 199.390 1.00 30.00  ? 14  VAL H CB  1 
ATOM 10788 C CG1 . VAL H 1 14  ? 116.647 114.294 197.985 1.00 30.00  ? 14  VAL H CG1 1 
ATOM 10789 C CG2 . VAL H 1 14  ? 117.383 113.445 200.216 1.00 30.00  ? 14  VAL H CG2 1 
ATOM 10790 N N   . PHE H 1 15  ? 117.573 117.928 199.119 1.00 120.93 ? 15  PHE H N   1 
ATOM 10791 C CA  . PHE H 1 15  ? 117.459 119.214 198.433 1.00 130.25 ? 15  PHE H CA  1 
ATOM 10792 C C   . PHE H 1 15  ? 118.825 119.772 198.050 1.00 137.12 ? 15  PHE H C   1 
ATOM 10793 O O   . PHE H 1 15  ? 118.957 120.468 197.040 1.00 136.10 ? 15  PHE H O   1 
ATOM 10794 C CB  . PHE H 1 15  ? 116.700 120.207 199.314 1.00 30.00  ? 15  PHE H CB  1 
ATOM 10795 C CG  . PHE H 1 15  ? 116.592 121.582 198.725 1.00 30.00  ? 15  PHE H CG  1 
ATOM 10796 C CD1 . PHE H 1 15  ? 115.746 121.828 197.658 1.00 30.00  ? 15  PHE H CD1 1 
ATOM 10797 C CD2 . PHE H 1 15  ? 117.328 122.633 199.250 1.00 30.00  ? 15  PHE H CD2 1 
ATOM 10798 C CE1 . PHE H 1 15  ? 115.643 123.099 197.113 1.00 30.00  ? 15  PHE H CE1 1 
ATOM 10799 C CE2 . PHE H 1 15  ? 117.230 123.905 198.711 1.00 30.00  ? 15  PHE H CE2 1 
ATOM 10800 C CZ  . PHE H 1 15  ? 116.386 124.138 197.642 1.00 30.00  ? 15  PHE H CZ  1 
ATOM 10801 N N   . ILE H 1 16  ? 119.856 119.478 198.844 1.00 132.37 ? 16  ILE H N   1 
ATOM 10802 C CA  . ILE H 1 16  ? 121.212 119.822 198.432 1.00 131.31 ? 16  ILE H CA  1 
ATOM 10803 C C   . ILE H 1 16  ? 121.744 118.789 197.449 1.00 126.36 ? 16  ILE H C   1 
ATOM 10804 O O   . ILE H 1 16  ? 122.421 119.137 196.473 1.00 114.96 ? 16  ILE H O   1 
ATOM 10805 C CB  . ILE H 1 16  ? 122.112 119.965 199.675 1.00 30.00  ? 16  ILE H CB  1 
ATOM 10806 C CG1 . ILE H 1 16  ? 121.583 121.088 200.566 1.00 30.00  ? 16  ILE H CG1 1 
ATOM 10807 C CG2 . ILE H 1 16  ? 123.550 120.264 199.286 1.00 30.00  ? 16  ILE H CG2 1 
ATOM 10808 C CD1 . ILE H 1 16  ? 122.251 121.168 201.915 1.00 30.00  ? 16  ILE H CD1 1 
ATOM 10809 N N   . ALA H 1 17  ? 121.407 117.515 197.654 1.00 123.07 ? 17  ALA H N   1 
ATOM 10810 C CA  . ALA H 1 17  ? 122.007 116.447 196.860 1.00 113.60 ? 17  ALA H CA  1 
ATOM 10811 C C   . ALA H 1 17  ? 121.390 116.361 195.469 1.00 122.78 ? 17  ALA H C   1 
ATOM 10812 O O   . ALA H 1 17  ? 122.109 116.363 194.464 1.00 135.51 ? 17  ALA H O   1 
ATOM 10813 C CB  . ALA H 1 17  ? 121.869 115.113 197.591 1.00 30.00  ? 17  ALA H CB  1 
ATOM 10814 N N   . MET H 1 18  ? 120.056 116.281 195.391 1.00 110.98 ? 18  MET H N   1 
ATOM 10815 C CA  . MET H 1 18  ? 119.381 116.003 194.125 1.00 128.27 ? 18  MET H CA  1 
ATOM 10816 C C   . MET H 1 18  ? 119.475 117.165 193.143 1.00 133.84 ? 18  MET H C   1 
ATOM 10817 O O   . MET H 1 18  ? 119.490 116.930 191.931 1.00 141.63 ? 18  MET H O   1 
ATOM 10818 C CB  . MET H 1 18  ? 117.914 115.635 194.389 1.00 30.00  ? 18  MET H CB  1 
ATOM 10819 C CG  . MET H 1 18  ? 117.113 115.182 193.174 1.00 30.00  ? 18  MET H CG  1 
ATOM 10820 S SD  . MET H 1 18  ? 115.422 114.708 193.566 1.00 30.00  ? 18  MET H SD  1 
ATOM 10821 C CE  . MET H 1 18  ? 114.788 114.406 191.923 1.00 30.00  ? 18  MET H CE  1 
ATOM 10822 N N   . VAL H 1 19  ? 119.551 118.404 193.635 1.00 128.57 ? 19  VAL H N   1 
ATOM 10823 C CA  . VAL H 1 19  ? 119.820 119.546 192.764 1.00 124.82 ? 19  VAL H CA  1 
ATOM 10824 C C   . VAL H 1 19  ? 121.196 119.414 192.119 1.00 121.88 ? 19  VAL H C   1 
ATOM 10825 O O   . VAL H 1 19  ? 121.362 119.675 190.921 1.00 114.40 ? 19  VAL H O   1 
ATOM 10826 C CB  . VAL H 1 19  ? 119.669 120.857 193.559 1.00 30.00  ? 19  VAL H CB  1 
ATOM 10827 C CG1 . VAL H 1 19  ? 120.157 122.054 192.759 1.00 30.00  ? 19  VAL H CG1 1 
ATOM 10828 C CG2 . VAL H 1 19  ? 118.216 121.062 193.931 1.00 30.00  ? 19  VAL H CG2 1 
ATOM 10829 N N   . LEU H 1 20  ? 122.191 118.964 192.888 1.00 123.94 ? 20  LEU H N   1 
ATOM 10830 C CA  . LEU H 1 20  ? 123.491 118.654 192.305 1.00 120.76 ? 20  LEU H CA  1 
ATOM 10831 C C   . LEU H 1 20  ? 123.417 117.446 191.381 1.00 118.82 ? 20  LEU H C   1 
ATOM 10832 O O   . LEU H 1 20  ? 124.181 117.363 190.412 1.00 128.24 ? 20  LEU H O   1 
ATOM 10833 C CB  . LEU H 1 20  ? 124.517 118.421 193.410 1.00 30.00  ? 20  LEU H CB  1 
ATOM 10834 C CG  . LEU H 1 20  ? 124.838 119.659 194.247 1.00 30.00  ? 20  LEU H CG  1 
ATOM 10835 C CD1 . LEU H 1 20  ? 125.755 119.312 195.408 1.00 30.00  ? 20  LEU H CD1 1 
ATOM 10836 C CD2 . LEU H 1 20  ? 125.458 120.739 193.375 1.00 30.00  ? 20  LEU H CD2 1 
ATOM 10837 N N   . VAL H 1 21  ? 122.510 116.505 191.662 1.00 118.89 ? 21  VAL H N   1 
ATOM 10838 C CA  . VAL H 1 21  ? 122.229 115.444 190.699 1.00 124.09 ? 21  VAL H CA  1 
ATOM 10839 C C   . VAL H 1 21  ? 121.471 116.013 189.507 1.00 132.71 ? 21  VAL H C   1 
ATOM 10840 O O   . VAL H 1 21  ? 121.728 115.632 188.359 1.00 133.89 ? 21  VAL H O   1 
ATOM 10841 C CB  . VAL H 1 21  ? 121.466 114.290 191.379 1.00 30.00  ? 21  VAL H CB  1 
ATOM 10842 C CG1 . VAL H 1 21  ? 121.109 113.201 190.380 1.00 30.00  ? 21  VAL H CG1 1 
ATOM 10843 C CG2 . VAL H 1 21  ? 122.295 113.703 192.507 1.00 30.00  ? 21  VAL H CG2 1 
ATOM 10844 N N   . ALA H 1 22  ? 120.558 116.960 189.748 1.00 119.64 ? 22  ALA H N   1 
ATOM 10845 C CA  . ALA H 1 22  ? 119.898 117.655 188.646 1.00 121.63 ? 22  ALA H CA  1 
ATOM 10846 C C   . ALA H 1 22  ? 120.879 118.530 187.881 1.00 121.50 ? 22  ALA H C   1 
ATOM 10847 O O   . ALA H 1 22  ? 120.706 118.758 186.679 1.00 124.27 ? 22  ALA H O   1 
ATOM 10848 C CB  . ALA H 1 22  ? 118.736 118.497 189.167 1.00 30.00  ? 22  ALA H CB  1 
ATOM 10849 N N   . ALA H 1 23  ? 121.908 119.035 188.565 1.00 123.64 ? 23  ALA H N   1 
ATOM 10850 C CA  . ALA H 1 23  ? 122.999 119.721 187.890 1.00 136.43 ? 23  ALA H CA  1 
ATOM 10851 C C   . ALA H 1 23  ? 123.772 118.799 186.962 1.00 124.63 ? 23  ALA H C   1 
ATOM 10852 O O   . ALA H 1 23  ? 124.026 119.173 185.814 1.00 135.97 ? 23  ALA H O   1 
ATOM 10853 C CB  . ALA H 1 23  ? 123.957 120.338 188.910 1.00 30.00  ? 23  ALA H CB  1 
ATOM 10854 N N   . VAL H 1 24  ? 124.128 117.598 187.415 1.00 119.23 ? 24  VAL H N   1 
ATOM 10855 C CA  . VAL H 1 24  ? 124.790 116.647 186.535 1.00 115.14 ? 24  VAL H CA  1 
ATOM 10856 C C   . VAL H 1 24  ? 123.791 115.883 185.675 1.00 115.95 ? 24  VAL H C   1 
ATOM 10857 O O   . VAL H 1 24  ? 124.210 115.135 184.781 1.00 121.87 ? 24  VAL H O   1 
ATOM 10858 C CB  . VAL H 1 24  ? 125.682 115.668 187.325 1.00 30.00  ? 24  VAL H CB  1 
ATOM 10859 C CG1 . VAL H 1 24  ? 126.675 116.440 188.186 1.00 30.00  ? 24  VAL H CG1 1 
ATOM 10860 C CG2 . VAL H 1 24  ? 124.856 114.718 188.151 1.00 30.00  ? 24  VAL H CG2 1 
ATOM 10861 N N   . ALA H 1 25  ? 122.488 116.046 185.913 1.00 113.08 ? 25  ALA H N   1 
ATOM 10862 C CA  . ALA H 1 25  ? 121.509 115.682 184.897 1.00 132.88 ? 25  ALA H CA  1 
ATOM 10863 C C   . ALA H 1 25  ? 121.411 116.745 183.818 1.00 125.56 ? 25  ALA H C   1 
ATOM 10864 O O   . ALA H 1 25  ? 120.763 116.516 182.793 1.00 130.11 ? 25  ALA H O   1 
ATOM 10865 C CB  . ALA H 1 25  ? 120.131 115.460 185.515 1.00 30.00  ? 25  ALA H CB  1 
ATOM 10866 N N   . ALA H 1 26  ? 122.009 117.911 184.048 1.00 112.05 ? 26  ALA H N   1 
ATOM 10867 C CA  . ALA H 1 26  ? 122.169 118.926 183.022 1.00 121.96 ? 26  ALA H CA  1 
ATOM 10868 C C   . ALA H 1 26  ? 123.592 119.014 182.500 1.00 122.57 ? 26  ALA H C   1 
ATOM 10869 O O   . ALA H 1 26  ? 123.794 118.899 181.289 1.00 124.18 ? 26  ALA H O   1 
ATOM 10870 C CB  . ALA H 1 26  ? 121.751 120.298 183.560 1.00 30.00  ? 26  ALA H CB  1 
ATOM 10871 N N   . ALA H 1 27  ? 124.584 119.148 183.386 1.00 120.74 ? 27  ALA H N   1 
ATOM 10872 C CA  . ALA H 1 27  ? 125.972 119.348 182.985 1.00 112.14 ? 27  ALA H CA  1 
ATOM 10873 C C   . ALA H 1 27  ? 126.600 118.129 182.322 1.00 126.27 ? 27  ALA H C   1 
ATOM 10874 O O   . ALA H 1 27  ? 127.736 118.227 181.854 1.00 129.46 ? 27  ALA H O   1 
ATOM 10875 C CB  . ALA H 1 27  ? 126.824 119.756 184.187 1.00 30.00  ? 27  ALA H CB  1 
ATOM 10876 N N   . VAL H 1 28  ? 125.921 116.987 182.301 1.00 128.89 ? 28  VAL H N   1 
ATOM 10877 C CA  . VAL H 1 28  ? 126.281 115.886 181.421 1.00 113.05 ? 28  VAL H CA  1 
ATOM 10878 C C   . VAL H 1 28  ? 125.384 115.848 180.191 1.00 121.90 ? 28  VAL H C   1 
ATOM 10879 O O   . VAL H 1 28  ? 125.861 115.644 179.076 1.00 122.20 ? 28  VAL H O   1 
ATOM 10880 C CB  . VAL H 1 28  ? 126.236 114.549 182.194 1.00 30.00  ? 28  VAL H CB  1 
ATOM 10881 C CG1 . VAL H 1 28  ? 126.537 113.370 181.281 1.00 30.00  ? 28  VAL H CG1 1 
ATOM 10882 C CG2 . VAL H 1 28  ? 127.217 114.583 183.352 1.00 30.00  ? 28  VAL H CG2 1 
ATOM 10883 N N   . LEU H 1 29  ? 124.088 116.103 180.365 1.00 114.96 ? 29  LEU H N   1 
ATOM 10884 C CA  . LEU H 1 29  ? 123.162 115.962 179.248 1.00 129.81 ? 29  LEU H CA  1 
ATOM 10885 C C   . LEU H 1 29  ? 123.262 117.149 178.291 1.00 140.90 ? 29  LEU H C   1 
ATOM 10886 O O   . LEU H 1 29  ? 123.123 116.975 177.076 1.00 135.21 ? 29  LEU H O   1 
ATOM 10887 C CB  . LEU H 1 29  ? 121.737 115.783 179.780 1.00 30.00  ? 29  LEU H CB  1 
ATOM 10888 C CG  . LEU H 1 29  ? 120.612 115.173 178.932 1.00 30.00  ? 29  LEU H CG  1 
ATOM 10889 C CD1 . LEU H 1 29  ? 119.595 114.527 179.852 1.00 30.00  ? 29  LEU H CD1 1 
ATOM 10890 C CD2 . LEU H 1 29  ? 119.917 116.167 178.041 1.00 30.00  ? 29  LEU H CD2 1 
ATOM 10891 N N   . ILE H 1 30  ? 123.509 118.356 178.808 1.00 133.11 ? 30  ILE H N   1 
ATOM 10892 C CA  . ILE H 1 30  ? 123.722 119.496 177.919 1.00 124.38 ? 30  ILE H CA  1 
ATOM 10893 C C   . ILE H 1 30  ? 125.093 119.403 177.268 1.00 127.80 ? 30  ILE H C   1 
ATOM 10894 O O   . ILE H 1 30  ? 125.233 119.566 176.050 1.00 124.15 ? 30  ILE H O   1 
ATOM 10895 C CB  . ILE H 1 30  ? 123.566 120.828 178.677 1.00 30.00  ? 30  ILE H CB  1 
ATOM 10896 C CG1 . ILE H 1 30  ? 122.171 120.963 179.278 1.00 30.00  ? 30  ILE H CG1 1 
ATOM 10897 C CG2 . ILE H 1 30  ? 123.832 122.007 177.757 1.00 30.00  ? 30  ILE H CG2 1 
ATOM 10898 C CD1 . ILE H 1 30  ? 122.040 122.148 180.218 1.00 30.00  ? 30  ILE H CD1 1 
ATOM 10899 N N   . GLN H 1 31  ? 126.122 119.128 178.070 1.00 132.79 ? 31  GLN H N   1 
ATOM 10900 C CA  . GLN H 1 31  ? 127.504 119.227 177.615 1.00 126.31 ? 31  GLN H CA  1 
ATOM 10901 C C   . GLN H 1 31  ? 127.868 118.113 176.636 1.00 126.39 ? 31  GLN H C   1 
ATOM 10902 O O   . GLN H 1 31  ? 128.695 118.319 175.741 1.00 134.06 ? 31  GLN H O   1 
ATOM 10903 C CB  . GLN H 1 31  ? 128.432 119.226 178.831 1.00 30.00  ? 31  GLN H CB  1 
ATOM 10904 C CG  . GLN H 1 31  ? 129.904 119.408 178.539 1.00 30.00  ? 31  GLN H CG  1 
ATOM 10905 C CD  . GLN H 1 31  ? 130.740 119.434 179.800 1.00 30.00  ? 31  GLN H CD  1 
ATOM 10906 O OE1 . GLN H 1 31  ? 130.216 119.332 180.906 1.00 30.00  ? 31  GLN H OE1 1 
ATOM 10907 N NE2 . GLN H 1 31  ? 132.051 119.558 179.638 1.00 30.00  ? 31  GLN H NE2 1 
ATOM 10908 N N   . THR H 1 32  ? 127.256 116.933 176.765 1.00 112.61 ? 32  THR H N   1 
ATOM 10909 C CA  . THR H 1 32  ? 127.469 115.913 175.742 1.00 127.34 ? 32  THR H CA  1 
ATOM 10910 C C   . THR H 1 32  ? 126.616 116.171 174.511 1.00 131.45 ? 32  THR H C   1 
ATOM 10911 O O   . THR H 1 32  ? 127.001 115.784 173.404 1.00 120.85 ? 32  THR H O   1 
ATOM 10912 C CB  . THR H 1 32  ? 127.196 114.516 176.294 1.00 30.00  ? 32  THR H CB  1 
ATOM 10913 O OG1 . THR H 1 32  ? 125.873 114.466 176.843 1.00 30.00  ? 32  THR H OG1 1 
ATOM 10914 C CG2 . THR H 1 32  ? 128.230 114.150 177.355 1.00 30.00  ? 32  THR H CG2 1 
ATOM 10915 N N   . SER H 1 33  ? 125.458 116.784 174.708 1.00 130.67 ? 33  SER H N   1 
ATOM 10916 C CA  . SER H 1 33  ? 124.602 117.149 173.589 1.00 132.42 ? 33  SER H CA  1 
ATOM 10917 C C   . SER H 1 33  ? 125.347 118.167 172.730 1.00 131.30 ? 33  SER H C   1 
ATOM 10918 O O   . SER H 1 33  ? 125.253 118.153 171.503 1.00 133.84 ? 33  SER H O   1 
ATOM 10919 C CB  . SER H 1 33  ? 123.278 117.712 174.078 1.00 30.00  ? 33  SER H CB  1 
ATOM 10920 O OG  . SER H 1 33  ? 122.538 116.709 174.748 1.00 30.00  ? 33  SER H OG  1 
ATOM 10921 N N   . GLY H 1 34  ? 126.102 119.037 173.397 1.00 129.56 ? 34  GLY H N   1 
ATOM 10922 C CA  . GLY H 1 34  ? 126.882 120.077 172.757 1.00 121.87 ? 34  GLY H CA  1 
ATOM 10923 C C   . GLY H 1 34  ? 127.911 119.510 171.802 1.00 127.99 ? 34  GLY H C   1 
ATOM 10924 O O   . GLY H 1 34  ? 128.152 120.090 170.750 1.00 136.74 ? 34  GLY H O   1 
ATOM 10925 N N   . TYR H 1 35  ? 128.534 118.388 172.162 1.00 111.57 ? 35  TYR H N   1 
ATOM 10926 C CA  . TYR H 1 35  ? 129.508 117.759 171.276 1.00 115.71 ? 35  TYR H CA  1 
ATOM 10927 C C   . TYR H 1 35  ? 128.820 117.339 169.978 1.00 122.18 ? 35  TYR H C   1 
ATOM 10928 O O   . TYR H 1 35  ? 129.345 117.559 168.883 1.00 127.53 ? 35  TYR H O   1 
ATOM 10929 C CB  . TYR H 1 35  ? 130.140 116.544 171.950 1.00 30.00  ? 35  TYR H CB  1 
ATOM 10930 C CG  . TYR H 1 35  ? 130.648 115.503 170.981 1.00 30.00  ? 35  TYR H CG  1 
ATOM 10931 C CD1 . TYR H 1 35  ? 131.263 115.873 169.795 1.00 30.00  ? 35  TYR H CD1 1 
ATOM 10932 C CD2 . TYR H 1 35  ? 130.526 114.149 171.259 1.00 30.00  ? 35  TYR H CD2 1 
ATOM 10933 C CE1 . TYR H 1 35  ? 131.732 114.925 168.907 1.00 30.00  ? 35  TYR H CE1 1 
ATOM 10934 C CE2 . TYR H 1 35  ? 130.993 113.192 170.378 1.00 30.00  ? 35  TYR H CE2 1 
ATOM 10935 C CZ  . TYR H 1 35  ? 131.596 113.587 169.204 1.00 30.00  ? 35  TYR H CZ  1 
ATOM 10936 O OH  . TYR H 1 35  ? 132.064 112.640 168.324 1.00 30.00  ? 35  TYR H OH  1 
ATOM 10937 N N   . LEU H 1 36  ? 127.621 116.770 170.098 1.00 116.21 ? 36  LEU H N   1 
ATOM 10938 C CA  . LEU H 1 36  ? 126.846 116.364 168.932 1.00 130.01 ? 36  LEU H CA  1 
ATOM 10939 C C   . LEU H 1 36  ? 126.487 117.584 168.097 1.00 123.78 ? 36  LEU H C   1 
ATOM 10940 O O   . LEU H 1 36  ? 126.545 117.541 166.872 1.00 118.51 ? 36  LEU H O   1 
ATOM 10941 C CB  . LEU H 1 36  ? 125.595 115.596 169.345 1.00 30.00  ? 36  LEU H CB  1 
ATOM 10942 C CG  . LEU H 1 36  ? 125.911 114.174 169.808 1.00 30.00  ? 36  LEU H CG  1 
ATOM 10943 C CD1 . LEU H 1 36  ? 124.665 113.424 170.247 1.00 30.00  ? 36  LEU H CD1 1 
ATOM 10944 C CD2 . LEU H 1 36  ? 126.627 113.417 168.704 1.00 30.00  ? 36  LEU H CD2 1 
ATOM 10945 N N   . GLN H 1 37  ? 126.134 118.680 168.761 1.00 123.38 ? 37  GLN H N   1 
ATOM 10946 C CA  . GLN H 1 37  ? 125.798 119.900 168.051 1.00 117.62 ? 37  GLN H CA  1 
ATOM 10947 C C   . GLN H 1 37  ? 127.000 120.376 167.256 1.00 110.58 ? 37  GLN H C   1 
ATOM 10948 O O   . GLN H 1 37  ? 126.878 120.712 166.079 1.00 111.88 ? 37  GLN H O   1 
ATOM 10949 C CB  . GLN H 1 37  ? 125.408 120.992 169.044 1.00 30.00  ? 37  GLN H CB  1 
ATOM 10950 C CG  . GLN H 1 37  ? 124.156 120.679 169.840 1.00 30.00  ? 37  GLN H CG  1 
ATOM 10951 C CD  . GLN H 1 37  ? 124.150 121.354 171.190 1.00 30.00  ? 37  GLN H CD  1 
ATOM 10952 O OE1 . GLN H 1 37  ? 124.930 122.271 171.435 1.00 30.00  ? 37  GLN H OE1 1 
ATOM 10953 N NE2 . GLN H 1 37  ? 123.275 120.900 172.079 1.00 30.00  ? 37  GLN H NE2 1 
ATOM 10954 N N   . GLN H 1 38  ? 128.177 120.350 167.870 1.00 110.77 ? 38  GLN H N   1 
ATOM 10955 C CA  . GLN H 1 38  ? 129.367 120.803 167.162 1.00 125.53 ? 38  GLN H CA  1 
ATOM 10956 C C   . GLN H 1 38  ? 129.655 119.901 165.961 1.00 131.29 ? 38  GLN H C   1 
ATOM 10957 O O   . GLN H 1 38  ? 130.015 120.385 164.889 1.00 143.08 ? 38  GLN H O   1 
ATOM 10958 C CB  . GLN H 1 38  ? 130.575 121.010 168.105 1.00 30.00  ? 38  GLN H CB  1 
ATOM 10959 C CG  . GLN H 1 38  ? 131.532 119.843 168.303 1.00 30.00  ? 38  GLN H CG  1 
ATOM 10960 C CD  . GLN H 1 38  ? 132.464 120.050 169.481 1.00 30.00  ? 38  GLN H CD  1 
ATOM 10961 O OE1 . GLN H 1 38  ? 132.275 120.965 170.281 1.00 30.00  ? 38  GLN H OE1 1 
ATOM 10962 N NE2 . GLN H 1 38  ? 133.476 119.200 169.594 1.00 30.00  ? 38  GLN H NE2 1 
ATOM 10963 N N   . LYS H 1 39  ? 129.474 118.596 166.134 1.00 115.39 ? 39  LYS H N   1 
ATOM 10964 C CA  . LYS H 1 39  ? 129.708 117.661 165.045 1.00 122.69 ? 39  LYS H CA  1 
ATOM 10965 C C   . LYS H 1 39  ? 128.732 117.877 163.886 1.00 122.92 ? 39  LYS H C   1 
ATOM 10966 O O   . LYS H 1 39  ? 129.091 117.742 162.719 1.00 119.94 ? 39  LYS H O   1 
ATOM 10967 C CB  . LYS H 1 39  ? 129.653 116.220 165.545 1.00 30.00  ? 39  LYS H CB  1 
ATOM 10968 C CG  . LYS H 1 39  ? 130.333 115.228 164.619 1.00 30.00  ? 39  LYS H CG  1 
ATOM 10969 C CD  . LYS H 1 39  ? 131.726 115.700 164.247 1.00 30.00  ? 39  LYS H CD  1 
ATOM 10970 C CE  . LYS H 1 39  ? 132.415 114.701 163.333 1.00 30.00  ? 39  LYS H CE  1 
ATOM 10971 N NZ  . LYS H 1 39  ? 131.611 114.414 162.114 1.00 30.00  ? 39  LYS H NZ  1 
ATOM 10972 N N   . SER H 1 40  ? 127.485 118.184 164.214 1.00 115.71 ? 40  SER H N   1 
ATOM 10973 C CA  . SER H 1 40  ? 126.466 118.373 163.192 1.00 125.17 ? 40  SER H CA  1 
ATOM 10974 C C   . SER H 1 40  ? 126.657 119.533 162.217 1.00 124.47 ? 40  SER H C   1 
ATOM 10975 O O   . SER H 1 40  ? 126.410 119.370 161.026 1.00 117.25 ? 40  SER H O   1 
ATOM 10976 C CB  . SER H 1 40  ? 125.081 118.457 163.830 1.00 30.00  ? 40  SER H CB  1 
ATOM 10977 O OG  . SER H 1 40  ? 125.065 119.398 164.881 1.00 30.00  ? 40  SER H OG  1 
ATOM 10978 N N   . GLN H 1 41  ? 127.103 120.691 162.700 1.00 124.77 ? 41  GLN H N   1 
ATOM 10979 C CA  . GLN H 1 41  ? 127.240 121.846 161.816 1.00 118.76 ? 41  GLN H CA  1 
ATOM 10980 C C   . GLN H 1 41  ? 128.414 121.696 160.859 1.00 112.40 ? 41  GLN H C   1 
ATOM 10981 O O   . GLN H 1 41  ? 128.390 122.262 159.761 1.00 107.21 ? 41  GLN H O   1 
ATOM 10982 C CB  . GLN H 1 41  ? 127.391 123.125 162.635 1.00 30.00  ? 41  GLN H CB  1 
ATOM 10983 C CG  . GLN H 1 41  ? 126.135 123.534 163.375 1.00 30.00  ? 41  GLN H CG  1 
ATOM 10984 C CD  . GLN H 1 41  ? 126.341 124.750 164.258 1.00 30.00  ? 41  GLN H CD  1 
ATOM 10985 O OE1 . GLN H 1 41  ? 127.464 125.225 164.430 1.00 30.00  ? 41  GLN H OE1 1 
ATOM 10986 N NE2 . GLN H 1 41  ? 125.251 125.269 164.813 1.00 30.00  ? 41  GLN H NE2 1 
ATOM 10987 N N   . ALA H 1 42  ? 129.447 120.953 161.256 1.00 117.08 ? 42  ALA H N   1 
ATOM 10988 C CA  . ALA H 1 42  ? 130.534 120.648 160.332 1.00 121.87 ? 42  ALA H CA  1 
ATOM 10989 C C   . ALA H 1 42  ? 130.129 119.536 159.372 1.00 124.60 ? 42  ALA H C   1 
ATOM 10990 O O   . ALA H 1 42  ? 130.332 119.641 158.159 1.00 129.32 ? 42  ALA H O   1 
ATOM 10991 C CB  . ALA H 1 42  ? 131.798 120.274 161.106 1.00 30.00  ? 42  ALA H CB  1 
ATOM 10992 N N   . THR H 1 43  ? 129.532 118.463 159.898 1.00 122.18 ? 43  THR H N   1 
ATOM 10993 C CA  . THR H 1 43  ? 129.076 117.368 159.049 1.00 129.90 ? 43  THR H CA  1 
ATOM 10994 C C   . THR H 1 43  ? 127.739 117.644 158.381 1.00 121.89 ? 43  THR H C   1 
ATOM 10995 O O   . THR H 1 43  ? 127.211 116.755 157.707 1.00 106.94 ? 43  THR H O   1 
ATOM 10996 C CB  . THR H 1 43  ? 128.965 116.079 159.846 1.00 30.00  ? 43  THR H CB  1 
ATOM 10997 O OG1 . THR H 1 43  ? 128.025 116.267 160.909 1.00 30.00  ? 43  THR H OG1 1 
ATOM 10998 C CG2 . THR H 1 43  ? 130.313 115.696 160.415 1.00 30.00  ? 43  THR H CG2 1 
ATOM 10999 N N   . GLY H 1 44  ? 127.156 118.816 158.585 1.00 116.35 ? 44  GLY H N   1 
ATOM 11000 C CA  . GLY H 1 44  ? 126.051 119.232 157.755 1.00 102.42 ? 44  GLY H CA  1 
ATOM 11001 C C   . GLY H 1 44  ? 126.564 119.948 156.526 1.00 107.16 ? 44  GLY H C   1 
ATOM 11002 O O   . GLY H 1 44  ? 126.224 119.592 155.395 1.00 105.71 ? 44  GLY H O   1 
ATOM 11003 N N   . ARG H 1 45  ? 127.412 120.953 156.751 1.00 121.34 ? 45  ARG H N   1 
ATOM 11004 C CA  . ARG H 1 45  ? 127.860 121.812 155.661 1.00 118.64 ? 45  ARG H CA  1 
ATOM 11005 C C   . ARG H 1 45  ? 128.814 121.083 154.727 1.00 114.49 ? 45  ARG H C   1 
ATOM 11006 O O   . ARG H 1 45  ? 128.648 121.136 153.503 1.00 119.78 ? 45  ARG H O   1 
ATOM 11007 C CB  . ARG H 1 45  ? 128.533 123.062 156.220 1.00 30.00  ? 45  ARG H CB  1 
ATOM 11008 C CG  . ARG H 1 45  ? 127.624 123.997 156.994 1.00 30.00  ? 45  ARG H CG  1 
ATOM 11009 C CD  . ARG H 1 45  ? 128.387 125.236 157.418 1.00 30.00  ? 45  ARG H CD  1 
ATOM 11010 N NE  . ARG H 1 45  ? 129.440 124.918 158.378 1.00 30.00  ? 45  ARG H NE  1 
ATOM 11011 C CZ  . ARG H 1 45  ? 130.741 124.972 158.106 1.00 30.00  ? 45  ARG H CZ  1 
ATOM 11012 N NH1 . ARG H 1 45  ? 131.152 125.325 156.896 1.00 30.00  ? 45  ARG H NH1 1 
ATOM 11013 N NH2 . ARG H 1 45  ? 131.630 124.665 159.039 1.00 30.00  ? 45  ARG H NH2 1 
ATOM 11014 N N   . GLU H 1 46  ? 129.828 120.411 155.286 1.00 110.36 ? 46  GLU H N   1 
ATOM 11015 C CA  . GLU H 1 46  ? 130.821 119.714 154.472 1.00 120.39 ? 46  GLU H CA  1 
ATOM 11016 C C   . GLU H 1 46  ? 130.201 118.578 153.673 1.00 123.08 ? 46  GLU H C   1 
ATOM 11017 O O   . GLU H 1 46  ? 130.632 118.302 152.549 1.00 126.45 ? 46  GLU H O   1 
ATOM 11018 C CB  . GLU H 1 46  ? 131.936 119.176 155.363 1.00 30.00  ? 46  GLU H CB  1 
ATOM 11019 C CG  . GLU H 1 46  ? 132.773 120.245 156.029 1.00 30.00  ? 46  GLU H CG  1 
ATOM 11020 C CD  . GLU H 1 46  ? 133.769 119.660 157.007 1.00 30.00  ? 46  GLU H CD  1 
ATOM 11021 O OE1 . GLU H 1 46  ? 133.675 118.447 157.285 1.00 30.00  ? 46  GLU H OE1 1 
ATOM 11022 O OE2 . GLU H 1 46  ? 134.649 120.405 157.491 1.00 30.00  ? 46  GLU H OE2 1 
ATOM 11023 N N   . THR H 1 47  ? 129.179 117.931 154.224 1.00 109.60 ? 47  THR H N   1 
ATOM 11024 C CA  . THR H 1 47  ? 128.450 116.910 153.491 1.00 114.97 ? 47  THR H CA  1 
ATOM 11025 C C   . THR H 1 47  ? 127.478 117.490 152.478 1.00 122.24 ? 47  THR H C   1 
ATOM 11026 O O   . THR H 1 47  ? 126.966 116.745 151.637 1.00 126.78 ? 47  THR H O   1 
ATOM 11027 C CB  . THR H 1 47  ? 127.719 116.009 154.473 1.00 30.00  ? 47  THR H CB  1 
ATOM 11028 O OG1 . THR H 1 47  ? 126.986 116.830 155.389 1.00 30.00  ? 47  THR H OG1 1 
ATOM 11029 C CG2 . THR H 1 47  ? 128.709 115.135 155.227 1.00 30.00  ? 47  THR H CG2 1 
ATOM 11030 N N   . THR H 1 48  ? 127.198 118.789 152.541 1.00 106.63 ? 48  THR H N   1 
ATOM 11031 C CA  . THR H 1 48  ? 126.623 119.445 151.375 1.00 106.27 ? 48  THR H CA  1 
ATOM 11032 C C   . THR H 1 48  ? 127.719 119.890 150.418 1.00 112.60 ? 48  THR H C   1 
ATOM 11033 O O   . THR H 1 48  ? 127.514 119.909 149.202 1.00 117.23 ? 48  THR H O   1 
ATOM 11034 C CB  . THR H 1 48  ? 125.758 120.633 151.788 1.00 30.00  ? 48  THR H CB  1 
ATOM 11035 O OG1 . THR H 1 48  ? 126.539 121.544 152.567 1.00 30.00  ? 48  THR H OG1 1 
ATOM 11036 C CG2 . THR H 1 48  ? 124.562 120.172 152.591 1.00 30.00  ? 48  THR H CG2 1 
ATOM 11037 N N   . GLN H 1 49  ? 128.892 120.239 150.948 1.00 120.76 ? 49  GLN H N   1 
ATOM 11038 C CA  . GLN H 1 49  ? 130.027 120.537 150.084 1.00 129.15 ? 49  GLN H CA  1 
ATOM 11039 C C   . GLN H 1 49  ? 130.576 119.272 149.442 1.00 124.57 ? 49  GLN H C   1 
ATOM 11040 O O   . GLN H 1 49  ? 131.219 119.339 148.390 1.00 134.69 ? 49  GLN H O   1 
ATOM 11041 C CB  . GLN H 1 49  ? 131.110 121.254 150.882 1.00 30.00  ? 49  GLN H CB  1 
ATOM 11042 C CG  . GLN H 1 49  ? 130.684 122.619 151.378 1.00 30.00  ? 49  GLN H CG  1 
ATOM 11043 C CD  . GLN H 1 49  ? 131.735 123.271 152.243 1.00 30.00  ? 49  GLN H CD  1 
ATOM 11044 O OE1 . GLN H 1 49  ? 132.777 122.681 152.522 1.00 30.00  ? 49  GLN H OE1 1 
ATOM 11045 N NE2 . GLN H 1 49  ? 131.463 124.492 152.682 1.00 30.00  ? 49  GLN H NE2 1 
ATOM 11046 N N   . GLU H 1 50  ? 130.345 118.119 150.074 1.00 118.17 ? 50  GLU H N   1 
ATOM 11047 C CA  . GLU H 1 50  ? 130.585 116.820 149.457 1.00 122.89 ? 50  GLU H CA  1 
ATOM 11048 C C   . GLU H 1 50  ? 129.767 116.621 148.188 1.00 108.02 ? 50  GLU H C   1 
ATOM 11049 O O   . GLU H 1 50  ? 130.256 116.000 147.239 1.00 108.64 ? 50  GLU H O   1 
ATOM 11050 C CB  . GLU H 1 50  ? 130.254 115.714 150.467 1.00 30.00  ? 50  GLU H CB  1 
ATOM 11051 C CG  . GLU H 1 50  ? 130.396 114.269 149.989 1.00 30.00  ? 50  GLU H CG  1 
ATOM 11052 C CD  . GLU H 1 50  ? 131.828 113.845 149.790 1.00 30.00  ? 50  GLU H CD  1 
ATOM 11053 O OE1 . GLU H 1 50  ? 132.713 114.425 150.452 1.00 30.00  ? 50  GLU H OE1 1 
ATOM 11054 O OE2 . GLU H 1 50  ? 132.068 112.927 148.978 1.00 30.00  ? 50  GLU H OE2 1 
ATOM 11055 N N   . VAL H 1 51  ? 128.549 117.150 148.139 1.00 112.66 ? 51  VAL H N   1 
ATOM 11056 C CA  . VAL H 1 51  ? 127.625 116.822 147.067 1.00 114.59 ? 51  VAL H CA  1 
ATOM 11057 C C   . VAL H 1 51  ? 127.423 117.963 146.079 1.00 112.54 ? 51  VAL H C   1 
ATOM 11058 O O   . VAL H 1 51  ? 126.979 117.703 144.951 1.00 128.80 ? 51  VAL H O   1 
ATOM 11059 C CB  . VAL H 1 51  ? 126.267 116.358 147.631 1.00 30.00  ? 51  VAL H CB  1 
ATOM 11060 C CG1 . VAL H 1 51  ? 126.475 115.227 148.622 1.00 30.00  ? 51  VAL H CG1 1 
ATOM 11061 C CG2 . VAL H 1 51  ? 125.514 117.497 148.277 1.00 30.00  ? 51  VAL H CG2 1 
ATOM 11062 N N   . ALA H 1 52  ? 127.743 119.208 146.446 1.00 30.00  ? 52  ALA H N   1 
ATOM 11063 C CA  . ALA H 1 52  ? 127.400 120.340 145.589 1.00 30.00  ? 52  ALA H CA  1 
ATOM 11064 C C   . ALA H 1 52  ? 128.501 120.639 144.581 1.00 30.00  ? 52  ALA H C   1 
ATOM 11065 O O   . ALA H 1 52  ? 128.235 120.757 143.380 1.00 30.00  ? 52  ALA H O   1 
ATOM 11066 C CB  . ALA H 1 52  ? 127.112 121.577 146.435 1.00 30.00  ? 52  ALA H CB  1 
ATOM 11067 N N   . SER H 1 53  ? 129.731 120.808 145.052 1.00 113.33 ? 53  SER H N   1 
ATOM 11068 C CA  . SER H 1 53  ? 130.828 121.163 144.164 1.00 119.89 ? 53  SER H CA  1 
ATOM 11069 C C   . SER H 1 53  ? 131.175 119.997 143.247 1.00 124.17 ? 53  SER H C   1 
ATOM 11070 O O   . SER H 1 53  ? 131.001 118.829 143.597 1.00 123.77 ? 53  SER H O   1 
ATOM 11071 C CB  . SER H 1 53  ? 132.049 121.587 144.974 1.00 135.93 ? 53  SER H CB  1 
ATOM 11072 O OG  . SER H 1 53  ? 132.530 120.519 145.767 1.00 150.89 ? 53  SER H OG  1 
ATOM 11073 N N   . GLY H 1 54  ? 131.634 120.324 142.045 1.00 126.56 ? 54  GLY H N   1 
ATOM 11074 C CA  . GLY H 1 54  ? 131.917 119.282 141.082 1.00 107.25 ? 54  GLY H CA  1 
ATOM 11075 C C   . GLY H 1 54  ? 132.678 119.736 139.857 1.00 106.60 ? 54  GLY H C   1 
ATOM 11076 O O   . GLY H 1 54  ? 132.508 120.862 139.386 1.00 103.76 ? 54  GLY H O   1 
ATOM 11077 N N   . ILE H 1 55  ? 133.515 118.850 139.330 1.00 100.38 ? 55  ILE H N   1 
ATOM 11078 C CA  . ILE H 1 55  ? 134.360 119.115 138.174 1.00 80.06  ? 55  ILE H CA  1 
ATOM 11079 C C   . ILE H 1 55  ? 133.784 118.378 136.978 1.00 98.77  ? 55  ILE H C   1 
ATOM 11080 O O   . ILE H 1 55  ? 133.496 117.182 137.069 1.00 111.05 ? 55  ILE H O   1 
ATOM 11081 C CB  . ILE H 1 55  ? 135.810 118.683 138.455 1.00 30.00  ? 55  ILE H CB  1 
ATOM 11082 C CG1 . ILE H 1 55  ? 136.486 119.689 139.387 1.00 30.00  ? 55  ILE H CG1 1 
ATOM 11083 C CG2 . ILE H 1 55  ? 136.590 118.430 137.186 1.00 30.00  ? 55  ILE H CG2 1 
ATOM 11084 C CD1 . ILE H 1 55  ? 137.885 119.309 139.785 1.00 30.00  ? 55  ILE H CD1 1 
ATOM 11085 N N   . LYS H 1 56  ? 133.596 119.085 135.866 1.00 98.92  ? 56  LYS H N   1 
ATOM 11086 C CA  . LYS H 1 56  ? 133.162 118.457 134.626 1.00 91.81  ? 56  LYS H CA  1 
ATOM 11087 C C   . LYS H 1 56  ? 134.175 118.716 133.519 1.00 85.75  ? 56  LYS H C   1 
ATOM 11088 O O   . LYS H 1 56  ? 134.803 119.778 133.468 1.00 101.89 ? 56  LYS H O   1 
ATOM 11089 C CB  . LYS H 1 56  ? 131.760 118.929 134.211 1.00 30.00  ? 56  LYS H CB  1 
ATOM 11090 C CG  . LYS H 1 56  ? 131.607 120.390 133.834 1.00 30.00  ? 56  LYS H CG  1 
ATOM 11091 C CD  . LYS H 1 56  ? 130.145 120.670 133.520 1.00 30.00  ? 56  LYS H CD  1 
ATOM 11092 C CE  . LYS H 1 56  ? 129.891 122.124 133.196 1.00 30.00  ? 56  LYS H CE  1 
ATOM 11093 N NZ  . LYS H 1 56  ? 130.529 122.508 131.918 1.00 30.00  ? 56  LYS H NZ  1 
ATOM 11094 N N   . VAL H 1 57  ? 134.331 117.727 132.644 1.00 72.52  ? 57  VAL H N   1 
ATOM 11095 C CA  . VAL H 1 57  ? 135.362 117.704 131.614 1.00 81.55  ? 57  VAL H CA  1 
ATOM 11096 C C   . VAL H 1 57  ? 134.716 118.034 130.280 1.00 102.46 ? 57  VAL H C   1 
ATOM 11097 O O   . VAL H 1 57  ? 133.748 117.382 129.875 1.00 103.19 ? 57  VAL H O   1 
ATOM 11098 C CB  . VAL H 1 57  ? 136.057 116.338 131.558 1.00 30.00  ? 57  VAL H CB  1 
ATOM 11099 C CG1 . VAL H 1 57  ? 136.977 116.258 130.366 1.00 30.00  ? 57  VAL H CG1 1 
ATOM 11100 C CG2 . VAL H 1 57  ? 136.824 116.097 132.834 1.00 30.00  ? 57  VAL H CG2 1 
ATOM 11101 N N   . LEU H 1 58  ? 135.255 119.032 129.588 1.00 92.19  ? 58  LEU H N   1 
ATOM 11102 C CA  . LEU H 1 58  ? 134.759 119.402 128.273 1.00 86.93  ? 58  LEU H CA  1 
ATOM 11103 C C   . LEU H 1 58  ? 135.924 119.633 127.322 1.00 105.85 ? 58  LEU H C   1 
ATOM 11104 O O   . LEU H 1 58  ? 136.870 120.351 127.660 1.00 120.09 ? 58  LEU H O   1 
ATOM 11105 C CB  . LEU H 1 58  ? 133.846 120.634 128.373 1.00 30.00  ? 58  LEU H CB  1 
ATOM 11106 C CG  . LEU H 1 58  ? 134.281 121.973 128.986 1.00 30.00  ? 58  LEU H CG  1 
ATOM 11107 C CD1 . LEU H 1 58  ? 134.897 122.932 127.980 1.00 30.00  ? 58  LEU H CD1 1 
ATOM 11108 C CD2 . LEU H 1 58  ? 133.107 122.636 129.674 1.00 30.00  ? 58  LEU H CD2 1 
ATOM 11109 N N   . SER H 1 59  ? 135.864 118.976 126.158 1.00 102.02 ? 59  SER H N   1 
ATOM 11110 C CA  . SER H 1 59  ? 136.657 119.287 124.963 1.00 101.26 ? 59  SER H CA  1 
ATOM 11111 C C   . SER H 1 59  ? 138.165 119.185 125.219 1.00 100.91 ? 59  SER H C   1 
ATOM 11112 O O   . SER H 1 59  ? 138.895 120.170 125.258 1.00 93.78  ? 59  SER H O   1 
ATOM 11113 C CB  . SER H 1 59  ? 136.276 120.661 124.408 1.00 30.00  ? 59  SER H CB  1 
ATOM 11114 O OG  . SER H 1 59  ? 134.936 120.649 123.951 1.00 30.00  ? 59  SER H OG  1 
ATOM 11115 N N   . VAL H 1 60  ? 138.598 117.962 125.424 1.00 114.53 ? 60  VAL H N   1 
ATOM 11116 C CA  . VAL H 1 60  ? 140.020 117.670 125.523 1.00 106.73 ? 60  VAL H CA  1 
ATOM 11117 C C   . VAL H 1 60  ? 140.636 117.698 124.128 1.00 97.61  ? 60  VAL H C   1 
ATOM 11118 O O   . VAL H 1 60  ? 140.015 117.271 123.152 1.00 91.29  ? 60  VAL H O   1 
ATOM 11119 C CB  . VAL H 1 60  ? 140.214 116.312 126.208 1.00 30.00  ? 60  VAL H CB  1 
ATOM 11120 C CG1 . VAL H 1 60  ? 141.677 116.048 126.470 1.00 30.00  ? 60  VAL H CG1 1 
ATOM 11121 C CG2 . VAL H 1 60  ? 139.396 116.260 127.475 1.00 30.00  ? 60  VAL H CG2 1 
ATOM 11122 N N   . VAL H 1 61  ? 141.855 118.219 124.017 1.00 91.21  ? 61  VAL H N   1 
ATOM 11123 C CA  . VAL H 1 61  ? 142.523 118.380 122.734 1.00 75.96  ? 61  VAL H CA  1 
ATOM 11124 C C   . VAL H 1 61  ? 143.751 117.474 122.691 1.00 85.19  ? 61  VAL H C   1 
ATOM 11125 O O   . VAL H 1 61  ? 144.279 117.059 123.724 1.00 107.80 ? 61  VAL H O   1 
ATOM 11126 C CB  . VAL H 1 61  ? 142.900 119.849 122.504 1.00 30.00  ? 61  VAL H CB  1 
ATOM 11127 C CG1 . VAL H 1 61  ? 141.648 120.690 122.480 1.00 30.00  ? 61  VAL H CG1 1 
ATOM 11128 C CG2 . VAL H 1 61  ? 143.763 120.325 123.627 1.00 30.00  ? 61  VAL H CG2 1 
ATOM 11129 N N   . GLY H 1 62  ? 144.193 117.145 121.474 1.00 70.41  ? 62  GLY H N   1 
ATOM 11130 C CA  . GLY H 1 62  ? 145.170 116.076 121.315 1.00 74.08  ? 62  GLY H CA  1 
ATOM 11131 C C   . GLY H 1 62  ? 146.660 116.355 121.205 1.00 71.97  ? 62  GLY H C   1 
ATOM 11132 O O   . GLY H 1 62  ? 147.424 115.855 122.035 1.00 101.24 ? 62  GLY H O   1 
ATOM 11133 N N   . LYS H 1 63  ? 147.081 117.140 120.202 1.00 30.00  ? 63  LYS H N   1 
ATOM 11134 C CA  . LYS H 1 63  ? 148.487 117.421 119.875 1.00 30.00  ? 63  LYS H CA  1 
ATOM 11135 C C   . LYS H 1 63  ? 149.317 116.162 119.615 1.00 30.00  ? 63  LYS H C   1 
ATOM 11136 O O   . LYS H 1 63  ? 150.012 115.669 120.510 1.00 30.00  ? 63  LYS H O   1 
ATOM 11137 C CB  . LYS H 1 63  ? 149.161 118.301 120.935 1.00 30.00  ? 63  LYS H CB  1 
ATOM 11138 C CG  . LYS H 1 63  ? 150.582 118.753 120.570 1.00 30.00  ? 63  LYS H CG  1 
ATOM 11139 C CD  . LYS H 1 63  ? 150.604 119.561 119.303 1.00 30.00  ? 63  LYS H CD  1 
ATOM 11140 C CE  . LYS H 1 63  ? 152.027 119.833 118.889 1.00 30.00  ? 63  LYS H CE  1 
ATOM 11141 N NZ  . LYS H 1 63  ? 152.727 120.648 119.906 1.00 30.00  ? 63  LYS H NZ  1 
ATOM 11142 N N   . THR H 1 64  ? 149.162 115.551 118.447 1.00 74.75  ? 64  THR H N   1 
ATOM 11143 C CA  . THR H 1 64  ? 150.080 114.477 118.112 1.00 85.42  ? 64  THR H CA  1 
ATOM 11144 C C   . THR H 1 64  ? 151.421 115.029 117.639 1.00 94.58  ? 64  THR H C   1 
ATOM 11145 O O   . THR H 1 64  ? 151.631 116.239 117.536 1.00 107.53 ? 64  THR H O   1 
ATOM 11146 C CB  . THR H 1 64  ? 149.502 113.570 117.035 1.00 30.00  ? 64  THR H CB  1 
ATOM 11147 O OG1 . THR H 1 64  ? 150.372 112.448 116.854 1.00 30.00  ? 64  THR H OG1 1 
ATOM 11148 C CG2 . THR H 1 64  ? 149.417 114.300 115.747 1.00 30.00  ? 64  THR H CG2 1 
ATOM 11149 N N   . ASP H 1 65  ? 152.334 114.108 117.343 1.00 92.95  ? 65  ASP H N   1 
ATOM 11150 C CA  . ASP H 1 65  ? 153.660 114.437 116.841 1.00 78.92  ? 65  ASP H CA  1 
ATOM 11151 C C   . ASP H 1 65  ? 153.555 114.857 115.376 1.00 87.53  ? 65  ASP H C   1 
ATOM 11152 O O   . ASP H 1 65  ? 152.626 114.475 114.660 1.00 108.21 ? 65  ASP H O   1 
ATOM 11153 C CB  . ASP H 1 65  ? 154.590 113.242 117.029 1.00 30.00  ? 65  ASP H CB  1 
ATOM 11154 C CG  . ASP H 1 65  ? 156.047 113.586 116.812 1.00 30.00  ? 65  ASP H CG  1 
ATOM 11155 O OD1 . ASP H 1 65  ? 156.368 114.775 116.602 1.00 30.00  ? 65  ASP H OD1 1 
ATOM 11156 O OD2 . ASP H 1 65  ? 156.878 112.655 116.840 1.00 30.00  ? 65  ASP H OD2 1 
ATOM 11157 N N   . SER H 1 66  ? 154.531 115.639 114.904 1.00 82.88  ? 66  SER H N   1 
ATOM 11158 C CA  . SER H 1 66  ? 154.593 116.042 113.504 1.00 100.10 ? 66  SER H CA  1 
ATOM 11159 C C   . SER H 1 66  ? 154.936 114.886 112.577 1.00 99.91  ? 66  SER H C   1 
ATOM 11160 O O   . SER H 1 66  ? 154.759 115.008 111.362 1.00 105.10 ? 66  SER H O   1 
ATOM 11161 C CB  . SER H 1 66  ? 155.615 117.162 113.329 1.00 30.00  ? 66  SER H CB  1 
ATOM 11162 O OG  . SER H 1 66  ? 155.238 118.304 114.074 1.00 30.00  ? 66  SER H OG  1 
ATOM 11163 N N   . ASN H 1 67  ? 155.438 113.786 113.119 1.00 97.83  ? 67  ASN H N   1 
ATOM 11164 C CA  . ASN H 1 67  ? 155.406 112.483 112.471 1.00 107.23 ? 67  ASN H CA  1 
ATOM 11165 C C   . ASN H 1 67  ? 154.258 111.771 113.178 1.00 118.78 ? 67  ASN H C   1 
ATOM 11166 O O   . ASN H 1 67  ? 154.434 111.281 114.298 1.00 119.03 ? 67  ASN H O   1 
ATOM 11167 C CB  . ASN H 1 67  ? 156.738 111.755 112.620 1.00 30.00  ? 67  ASN H CB  1 
ATOM 11168 C CG  . ASN H 1 67  ? 156.844 110.539 111.731 1.00 30.00  ? 67  ASN H CG  1 
ATOM 11169 O OD1 . ASN H 1 67  ? 155.914 110.206 111.000 1.00 30.00  ? 67  ASN H OD1 1 
ATOM 11170 N ND2 . ASN H 1 67  ? 157.993 109.877 111.774 1.00 30.00  ? 67  ASN H ND2 1 
ATOM 11171 N N   . LYS H 1 68  ? 153.103 111.690 112.498 1.00 119.07 ? 68  LYS H N   1 
ATOM 11172 C CA  . LYS H 1 68  ? 151.747 111.541 113.045 1.00 123.65 ? 68  LYS H CA  1 
ATOM 11173 C C   . LYS H 1 68  ? 151.537 110.498 114.143 1.00 120.01 ? 68  LYS H C   1 
ATOM 11174 O O   . LYS H 1 68  ? 150.557 110.572 114.888 1.00 120.34 ? 68  LYS H O   1 
ATOM 11175 C CB  . LYS H 1 68  ? 150.781 111.213 111.907 1.00 30.00  ? 68  LYS H CB  1 
ATOM 11176 C CG  . LYS H 1 68  ? 150.785 112.186 110.742 1.00 30.00  ? 68  LYS H CG  1 
ATOM 11177 C CD  . LYS H 1 68  ? 150.345 113.573 111.141 1.00 30.00  ? 68  LYS H CD  1 
ATOM 11178 C CE  . LYS H 1 68  ? 150.082 114.410 109.902 1.00 30.00  ? 68  LYS H CE  1 
ATOM 11179 N NZ  . LYS H 1 68  ? 151.306 114.626 109.095 1.00 30.00  ? 68  LYS H NZ  1 
ATOM 11180 N N   . THR H 1 69  ? 152.422 109.509 114.214 1.00 104.67 ? 69  THR H N   1 
ATOM 11181 C CA  . THR H 1 69  ? 152.365 108.419 115.173 1.00 117.77 ? 69  THR H CA  1 
ATOM 11182 C C   . THR H 1 69  ? 152.486 108.938 116.611 1.00 114.76 ? 69  THR H C   1 
ATOM 11183 O O   . THR H 1 69  ? 153.197 109.908 116.882 1.00 113.10 ? 69  THR H O   1 
ATOM 11184 C CB  . THR H 1 69  ? 153.502 107.440 114.860 1.00 30.00  ? 69  THR H CB  1 
ATOM 11185 O OG1 . THR H 1 69  ? 153.498 107.155 113.457 1.00 30.00  ? 69  THR H OG1 1 
ATOM 11186 C CG2 . THR H 1 69  ? 153.337 106.122 115.597 1.00 30.00  ? 69  THR H CG2 1 
ATOM 11187 N N   . TYR H 1 70  ? 151.765 108.276 117.529 1.00 95.58  ? 70  TYR H N   1 
ATOM 11188 C CA  . TYR H 1 70  ? 151.985 108.343 118.980 1.00 91.75  ? 70  TYR H CA  1 
ATOM 11189 C C   . TYR H 1 70  ? 151.762 109.751 119.543 1.00 97.36  ? 70  TYR H C   1 
ATOM 11190 O O   . TYR H 1 70  ? 152.708 110.465 119.877 1.00 106.50 ? 70  TYR H O   1 
ATOM 11191 C CB  . TYR H 1 70  ? 153.387 107.843 119.345 1.00 30.00  ? 70  TYR H CB  1 
ATOM 11192 C CG  . TYR H 1 70  ? 153.614 106.358 119.168 1.00 30.00  ? 70  TYR H CG  1 
ATOM 11193 C CD1 . TYR H 1 70  ? 152.548 105.469 119.067 1.00 30.00  ? 70  TYR H CD1 1 
ATOM 11194 C CD2 . TYR H 1 70  ? 154.904 105.844 119.101 1.00 30.00  ? 70  TYR H CD2 1 
ATOM 11195 C CE1 . TYR H 1 70  ? 152.765 104.110 118.906 1.00 30.00  ? 70  TYR H CE1 1 
ATOM 11196 C CE2 . TYR H 1 70  ? 155.130 104.492 118.939 1.00 30.00  ? 70  TYR H CE2 1 
ATOM 11197 C CZ  . TYR H 1 70  ? 154.058 103.630 118.842 1.00 30.00  ? 70  TYR H CZ  1 
ATOM 11198 O OH  . TYR H 1 70  ? 154.282 102.284 118.681 1.00 30.00  ? 70  TYR H OH  1 
ATOM 11199 N N   . VAL H 1 71  ? 150.484 110.150 119.580 1.00 94.49  ? 71  VAL H N   1 
ATOM 11200 C CA  . VAL H 1 71  ? 150.047 111.431 120.150 1.00 80.78  ? 71  VAL H CA  1 
ATOM 11201 C C   . VAL H 1 71  ? 150.516 111.643 121.589 1.00 87.45  ? 71  VAL H C   1 
ATOM 11202 O O   . VAL H 1 71  ? 150.218 110.847 122.484 1.00 96.24  ? 71  VAL H O   1 
ATOM 11203 C CB  . VAL H 1 71  ? 148.514 111.589 120.020 1.00 30.00  ? 71  VAL H CB  1 
ATOM 11204 C CG1 . VAL H 1 71  ? 147.770 110.361 120.467 1.00 30.00  ? 71  VAL H CG1 1 
ATOM 11205 C CG2 . VAL H 1 71  ? 148.039 112.780 120.831 1.00 30.00  ? 71  VAL H CG2 1 
ATOM 11206 N N   . GLU H 1 72  ? 151.278 112.716 121.819 1.00 85.64  ? 72  GLU H N   1 
ATOM 11207 C CA  . GLU H 1 72  ? 152.035 112.838 123.057 1.00 94.43  ? 72  GLU H CA  1 
ATOM 11208 C C   . GLU H 1 72  ? 151.507 113.881 124.036 1.00 97.09  ? 72  GLU H C   1 
ATOM 11209 O O   . GLU H 1 72  ? 151.300 113.550 125.203 1.00 121.72 ? 72  GLU H O   1 
ATOM 11210 C CB  . GLU H 1 72  ? 153.535 113.074 122.752 1.00 30.00  ? 72  GLU H CB  1 
ATOM 11211 C CG  . GLU H 1 72  ? 153.994 114.351 122.064 1.00 30.00  ? 72  GLU H CG  1 
ATOM 11212 C CD  . GLU H 1 72  ? 153.972 114.255 120.563 1.00 30.00  ? 72  GLU H CD  1 
ATOM 11213 O OE1 . GLU H 1 72  ? 153.258 113.384 120.030 1.00 30.00  ? 72  GLU H OE1 1 
ATOM 11214 O OE2 . GLU H 1 72  ? 154.701 115.036 119.918 1.00 30.00  ? 72  GLU H OE2 1 
ATOM 11215 N N   . LYS H 1 73  ? 151.271 115.126 123.635 1.00 88.72  ? 73  LYS H N   1 
ATOM 11216 C CA  . LYS H 1 73  ? 151.021 116.199 124.599 1.00 76.19  ? 73  LYS H CA  1 
ATOM 11217 C C   . LYS H 1 73  ? 149.524 116.459 124.703 1.00 76.39  ? 73  LYS H C   1 
ATOM 11218 O O   . LYS H 1 73  ? 148.996 117.362 124.053 1.00 99.03  ? 73  LYS H O   1 
ATOM 11219 C CB  . LYS H 1 73  ? 151.779 117.464 124.217 1.00 30.00  ? 73  LYS H CB  1 
ATOM 11220 C CG  . LYS H 1 73  ? 153.283 117.337 124.359 1.00 30.00  ? 73  LYS H CG  1 
ATOM 11221 C CD  . LYS H 1 73  ? 154.000 118.673 124.197 1.00 30.00  ? 73  LYS H CD  1 
ATOM 11222 C CE  . LYS H 1 73  ? 154.015 119.155 122.760 1.00 30.00  ? 73  LYS H CE  1 
ATOM 11223 N NZ  . LYS H 1 73  ? 154.813 120.403 122.615 1.00 30.00  ? 73  LYS H NZ  1 
ATOM 11224 N N   . LEU H 1 74  ? 148.849 115.685 125.542 1.00 86.10  ? 74  LEU H N   1 
ATOM 11225 C CA  . LEU H 1 74  ? 147.423 115.851 125.774 1.00 69.89  ? 74  LEU H CA  1 
ATOM 11226 C C   . LEU H 1 74  ? 147.180 117.079 126.643 1.00 74.51  ? 74  LEU H C   1 
ATOM 11227 O O   . LEU H 1 74  ? 148.058 117.518 127.388 1.00 105.24 ? 74  LEU H O   1 
ATOM 11228 C CB  . LEU H 1 74  ? 146.850 114.591 126.429 1.00 30.00  ? 74  LEU H CB  1 
ATOM 11229 C CG  . LEU H 1 74  ? 145.357 114.336 126.623 1.00 30.00  ? 74  LEU H CG  1 
ATOM 11230 C CD1 . LEU H 1 74  ? 145.117 112.853 126.541 1.00 30.00  ? 74  LEU H CD1 1 
ATOM 11231 C CD2 . LEU H 1 74  ? 144.889 114.822 127.971 1.00 30.00  ? 74  LEU H CD2 1 
ATOM 11232 N N   . ALA H 1 75  ? 145.983 117.650 126.524 1.00 74.85  ? 75  ALA H N   1 
ATOM 11233 C CA  . ALA H 1 75  ? 145.586 118.788 127.341 1.00 71.52  ? 75  ALA H CA  1 
ATOM 11234 C C   . ALA H 1 75  ? 144.089 118.732 127.581 1.00 78.01  ? 75  ALA H C   1 
ATOM 11235 O O   . ALA H 1 75  ? 143.306 118.894 126.644 1.00 114.52 ? 75  ALA H O   1 
ATOM 11236 C CB  . ALA H 1 75  ? 145.959 120.116 126.673 1.00 30.00  ? 75  ALA H CB  1 
ATOM 11237 N N   . ILE H 1 76  ? 143.696 118.527 128.833 1.00 65.73  ? 76  ILE H N   1 
ATOM 11238 C CA  . ILE H 1 76  ? 142.296 118.420 129.225 1.00 91.48  ? 76  ILE H CA  1 
ATOM 11239 C C   . ILE H 1 76  ? 141.808 119.773 129.729 1.00 89.44  ? 76  ILE H C   1 
ATOM 11240 O O   . ILE H 1 76  ? 142.420 120.369 130.622 1.00 103.39 ? 76  ILE H O   1 
ATOM 11241 C CB  . ILE H 1 76  ? 142.099 117.307 130.266 1.00 30.00  ? 76  ILE H CB  1 
ATOM 11242 C CG1 . ILE H 1 76  ? 140.690 117.333 130.840 1.00 30.00  ? 76  ILE H CG1 1 
ATOM 11243 C CG2 . ILE H 1 76  ? 143.178 117.298 131.323 1.00 30.00  ? 76  ILE H CG2 1 
ATOM 11244 C CD1 . ILE H 1 76  ? 140.432 116.195 131.783 1.00 30.00  ? 76  ILE H CD1 1 
ATOM 11245 N N   . TYR H 1 77  ? 140.719 120.274 129.140 1.00 92.49  ? 77  TYR H N   1 
ATOM 11246 C CA  . TYR H 1 77  ? 140.112 121.526 129.583 1.00 95.04  ? 77  TYR H CA  1 
ATOM 11247 C C   . TYR H 1 77  ? 139.089 121.189 130.654 1.00 90.68  ? 77  TYR H C   1 
ATOM 11248 O O   . TYR H 1 77  ? 138.249 120.309 130.461 1.00 88.28  ? 77  TYR H O   1 
ATOM 11249 C CB  . TYR H 1 77  ? 139.388 122.277 128.458 1.00 30.00  ? 77  TYR H CB  1 
ATOM 11250 C CG  . TYR H 1 77  ? 140.154 122.688 127.211 1.00 30.00  ? 77  TYR H CG  1 
ATOM 11251 C CD1 . TYR H 1 77  ? 141.531 122.581 127.118 1.00 30.00  ? 77  TYR H CD1 1 
ATOM 11252 C CD2 . TYR H 1 77  ? 139.471 123.211 126.120 1.00 30.00  ? 77  TYR H CD2 1 
ATOM 11253 C CE1 . TYR H 1 77  ? 142.207 122.961 125.970 1.00 30.00  ? 77  TYR H CE1 1 
ATOM 11254 C CE2 . TYR H 1 77  ? 140.134 123.592 124.969 1.00 30.00  ? 77  TYR H CE2 1 
ATOM 11255 C CZ  . TYR H 1 77  ? 141.499 123.466 124.900 1.00 30.00  ? 77  TYR H CZ  1 
ATOM 11256 O OH  . TYR H 1 77  ? 142.159 123.846 123.756 1.00 30.00  ? 77  TYR H OH  1 
ATOM 11257 N N   . ILE H 1 78  ? 139.142 121.890 131.778 1.00 100.82 ? 78  ILE H N   1 
ATOM 11258 C CA  . ILE H 1 78  ? 138.264 121.587 132.902 1.00 80.56  ? 78  ILE H CA  1 
ATOM 11259 C C   . ILE H 1 78  ? 137.617 122.858 133.428 1.00 87.00  ? 78  ILE H C   1 
ATOM 11260 O O   . ILE H 1 78  ? 138.300 123.854 133.688 1.00 104.52 ? 78  ILE H O   1 
ATOM 11261 C CB  . ILE H 1 78  ? 139.014 120.828 134.014 1.00 30.00  ? 78  ILE H CB  1 
ATOM 11262 C CG1 . ILE H 1 78  ? 139.096 119.350 133.647 1.00 30.00  ? 78  ILE H CG1 1 
ATOM 11263 C CG2 . ILE H 1 78  ? 138.420 121.053 135.395 1.00 30.00  ? 78  ILE H CG2 1 
ATOM 11264 C CD1 . ILE H 1 78  ? 139.808 118.520 134.649 1.00 30.00  ? 78  ILE H CD1 1 
ATOM 11265 N N   . SER H 1 79  ? 136.296 122.822 133.568 1.00 77.59  ? 79  SER H N   1 
ATOM 11266 C CA  . SER H 1 79  ? 135.517 123.839 134.247 1.00 81.74  ? 79  SER H CA  1 
ATOM 11267 C C   . SER H 1 79  ? 134.728 123.197 135.375 1.00 98.36  ? 79  SER H C   1 
ATOM 11268 O O   . SER H 1 79  ? 134.147 122.123 135.198 1.00 117.87 ? 79  SER H O   1 
ATOM 11269 C CB  . SER H 1 79  ? 134.552 124.543 133.285 1.00 30.00  ? 79  SER H CB  1 
ATOM 11270 O OG  . SER H 1 79  ? 133.745 125.482 133.976 1.00 30.00  ? 79  SER H OG  1 
ATOM 11271 N N   . PRO H 1 80  ? 134.703 123.819 136.543 1.00 92.20  ? 80  PRO H N   1 
ATOM 11272 C CA  . PRO H 1 80  ? 133.915 123.294 137.657 1.00 88.75  ? 80  PRO H CA  1 
ATOM 11273 C C   . PRO H 1 80  ? 132.437 123.606 137.458 1.00 95.71  ? 80  PRO H C   1 
ATOM 11274 O O   . PRO H 1 80  ? 132.054 124.431 136.632 1.00 117.12 ? 80  PRO H O   1 
ATOM 11275 C CB  . PRO H 1 80  ? 134.492 124.027 138.867 1.00 30.00  ? 80  PRO H CB  1 
ATOM 11276 C CG  . PRO H 1 80  ? 134.990 125.295 138.320 1.00 30.00  ? 80  PRO H CG  1 
ATOM 11277 C CD  . PRO H 1 80  ? 135.502 124.985 136.945 1.00 30.00  ? 80  PRO H CD  1 
ATOM 11278 N N   . ASN H 1 81  ? 131.604 122.931 138.247 1.00 89.04  ? 81  ASN H N   1 
ATOM 11279 C CA  . ASN H 1 81  ? 130.159 123.076 138.135 1.00 119.16 ? 81  ASN H CA  1 
ATOM 11280 C C   . ASN H 1 81  ? 129.711 124.410 138.726 1.00 129.92 ? 81  ASN H C   1 
ATOM 11281 O O   . ASN H 1 81  ? 130.513 125.212 139.213 1.00 123.56 ? 81  ASN H O   1 
ATOM 11282 C CB  . ASN H 1 81  ? 129.443 121.901 138.796 1.00 30.00  ? 81  ASN H CB  1 
ATOM 11283 C CG  . ASN H 1 81  ? 129.502 120.641 137.965 1.00 30.00  ? 81  ASN H CG  1 
ATOM 11284 O OD1 . ASN H 1 81  ? 129.385 120.689 136.745 1.00 30.00  ? 81  ASN H OD1 1 
ATOM 11285 N ND2 . ASN H 1 81  ? 129.657 119.503 138.622 1.00 30.00  ? 81  ASN H ND2 1 
ATOM 11286 N N   . ALA H 1 82  ? 128.400 124.648 138.686 1.00 129.27 ? 82  ALA H N   1 
ATOM 11287 C CA  . ALA H 1 82  ? 127.855 125.946 139.062 1.00 116.73 ? 82  ALA H CA  1 
ATOM 11288 C C   . ALA H 1 82  ? 127.961 126.172 140.563 1.00 106.52 ? 82  ALA H C   1 
ATOM 11289 O O   . ALA H 1 82  ? 128.621 127.111 141.018 1.00 96.85  ? 82  ALA H O   1 
ATOM 11290 C CB  . ALA H 1 82  ? 126.401 126.051 138.598 1.00 30.00  ? 82  ALA H CB  1 
ATOM 11291 N N   . GLY H 1 83  ? 127.336 125.308 141.348 1.00 114.15 ? 83  GLY H N   1 
ATOM 11292 C CA  . GLY H 1 83  ? 127.398 125.474 142.780 1.00 114.95 ? 83  GLY H CA  1 
ATOM 11293 C C   . GLY H 1 83  ? 128.650 124.852 143.349 1.00 115.25 ? 83  GLY H C   1 
ATOM 11294 O O   . GLY H 1 83  ? 128.712 123.635 143.533 1.00 115.65 ? 83  GLY H O   1 
ATOM 11295 N N   . SER H 1 84  ? 129.656 125.673 143.631 1.00 112.07 ? 84  SER H N   1 
ATOM 11296 C CA  . SER H 1 84  ? 130.903 125.169 144.182 1.00 124.31 ? 84  SER H CA  1 
ATOM 11297 C C   . SER H 1 84  ? 131.525 126.172 145.133 1.00 115.58 ? 84  SER H C   1 
ATOM 11298 O O   . SER H 1 84  ? 131.588 127.366 144.837 1.00 106.26 ? 84  SER H O   1 
ATOM 11299 C CB  . SER H 1 84  ? 131.920 124.849 143.097 1.00 30.00  ? 84  SER H CB  1 
ATOM 11300 O OG  . SER H 1 84  ? 133.150 124.575 143.727 1.00 30.00  ? 84  SER H OG  1 
ATOM 11301 N N   . GLU H 1 85  ? 131.975 125.673 146.277 1.00 118.56 ? 85  GLU H N   1 
ATOM 11302 C CA  . GLU H 1 85  ? 132.801 126.459 147.182 1.00 105.86 ? 85  GLU H CA  1 
ATOM 11303 C C   . GLU H 1 85  ? 134.260 126.008 147.083 1.00 107.85 ? 85  GLU H C   1 
ATOM 11304 O O   . GLU H 1 85  ? 134.803 125.349 147.970 1.00 104.84 ? 85  GLU H O   1 
ATOM 11305 C CB  . GLU H 1 85  ? 132.262 126.353 148.604 1.00 30.00  ? 85  GLU H CB  1 
ATOM 11306 C CG  . GLU H 1 85  ? 130.893 126.993 148.770 1.00 30.00  ? 85  GLU H CG  1 
ATOM 11307 C CD  . GLU H 1 85  ? 130.329 126.827 150.165 1.00 30.00  ? 85  GLU H CD  1 
ATOM 11308 O OE1 . GLU H 1 85  ? 130.930 126.086 150.967 1.00 30.00  ? 85  GLU H OE1 1 
ATOM 11309 O OE2 . GLU H 1 85  ? 129.285 127.444 150.459 1.00 30.00  ? 85  GLU H OE2 1 
ATOM 11310 N N   . GLY H 1 86  ? 134.896 126.385 145.973 1.00 113.31 ? 86  GLY H N   1 
ATOM 11311 C CA  . GLY H 1 86  ? 136.344 126.309 145.879 1.00 111.17 ? 86  GLY H CA  1 
ATOM 11312 C C   . GLY H 1 86  ? 137.031 124.955 145.794 1.00 101.55 ? 86  GLY H C   1 
ATOM 11313 O O   . GLY H 1 86  ? 137.601 124.513 146.796 1.00 106.00 ? 86  GLY H O   1 
ATOM 11314 N N   . ILE H 1 87  ? 136.963 124.262 144.656 1.00 75.80  ? 87  ILE H N   1 
ATOM 11315 C CA  . ILE H 1 87  ? 137.808 123.082 144.489 1.00 73.31  ? 87  ILE H CA  1 
ATOM 11316 C C   . ILE H 1 87  ? 139.261 123.525 144.412 1.00 100.35 ? 87  ILE H C   1 
ATOM 11317 O O   . ILE H 1 87  ? 139.684 124.139 143.426 1.00 117.40 ? 87  ILE H O   1 
ATOM 11318 C CB  . ILE H 1 87  ? 137.450 122.280 143.233 1.00 30.00  ? 87  ILE H CB  1 
ATOM 11319 C CG1 . ILE H 1 87  ? 136.006 121.814 143.212 1.00 30.00  ? 87  ILE H CG1 1 
ATOM 11320 C CG2 . ILE H 1 87  ? 138.347 121.080 143.124 1.00 30.00  ? 87  ILE H CG2 1 
ATOM 11321 C CD1 . ILE H 1 87  ? 135.183 122.588 142.251 1.00 30.00  ? 87  ILE H CD1 1 
ATOM 11322 N N   . ASP H 1 88  ? 140.030 123.214 145.445 1.00 103.88 ? 88  ASP H N   1 
ATOM 11323 C CA  . ASP H 1 88  ? 141.473 123.386 145.401 1.00 95.71  ? 88  ASP H CA  1 
ATOM 11324 C C   . ASP H 1 88  ? 142.050 122.363 144.433 1.00 94.42  ? 88  ASP H C   1 
ATOM 11325 O O   . ASP H 1 88  ? 141.476 121.294 144.226 1.00 101.39 ? 88  ASP H O   1 
ATOM 11326 C CB  . ASP H 1 88  ? 142.073 123.206 146.798 1.00 30.00  ? 88  ASP H CB  1 
ATOM 11327 C CG  . ASP H 1 88  ? 143.511 123.678 146.898 1.00 30.00  ? 88  ASP H CG  1 
ATOM 11328 O OD1 . ASP H 1 88  ? 144.082 124.128 145.886 1.00 30.00  ? 88  ASP H OD1 1 
ATOM 11329 O OD2 . ASP H 1 88  ? 144.075 123.600 148.009 1.00 30.00  ? 88  ASP H OD2 1 
ATOM 11330 N N   . LEU H 1 89  ? 143.189 122.689 143.836 1.00 99.19  ? 89  LEU H N   1 
ATOM 11331 C CA  . LEU H 1 89  ? 143.779 121.783 142.862 1.00 104.74 ? 89  LEU H CA  1 
ATOM 11332 C C   . LEU H 1 89  ? 145.148 121.247 143.267 1.00 110.40 ? 89  LEU H C   1 
ATOM 11333 O O   . LEU H 1 89  ? 145.695 120.400 142.555 1.00 132.98 ? 89  LEU H O   1 
ATOM 11334 C CB  . LEU H 1 89  ? 143.861 122.451 141.492 1.00 30.00  ? 89  LEU H CB  1 
ATOM 11335 C CG  . LEU H 1 89  ? 142.510 122.715 140.839 1.00 30.00  ? 89  LEU H CG  1 
ATOM 11336 C CD1 . LEU H 1 89  ? 142.738 123.376 139.519 1.00 30.00  ? 89  LEU H CD1 1 
ATOM 11337 C CD2 . LEU H 1 89  ? 141.731 121.442 140.647 1.00 30.00  ? 89  LEU H CD2 1 
ATOM 11338 N N   . ASN H 1 90  ?