CNRS Nantes University UFIP UFIP
home |  start a new run |  job status |  references&downloads |  examples |  help  

Elnemo is running on a new server.
Should you encounter any unexpected behaviour,
please let us know.


***    ***

elNémo ID: 191014051402126840

Job options:

ID        	=	 191014051402126840
JOBID     	=	 
USERID    	=	 unknown
PRIVAT    	=	 0

NMODES    	=	 10
DQMIN     	=	 -100
DQMAX     	=	 100
DQSTEP    	=	 20
DOGRAPHS  	=	 on

DOPROJMODS	=	 0
DORMSD    	=	 0

NRBL      	=	 0
CUTOFF    	=	 0
CAONLY    	=	 0


Input data for this run:


TITLE     SWISS-MODEL SERVER (https://swissmodel.expasy.org)
TITLE    2 Untitled Project
EXPDTA    THEORETICAL MODEL (SWISS-MODEL SERVER)
AUTHOR    SWISS-MODEL SERVER (SEE REFERENCE IN JRNL Records)
REVDAT   1   14-OCT-19 1MOD    1       05:05
JRNL        AUTH   A.WATERHOUSE,M.BERTONI,S.BIENERT,G.STUDER,G.TAURIELLO,
JRNL        AUTH 2 R.GUMIENNY,F.T.HEER,T.A.P.DE BEER,C.REMPFER,L.BORDOLI,
JRNL        AUTH 3 R.LEPORE,T.SCHWEDE
JRNL        TITL   SWISS-MODEL: HOMOLOGY MODELLING OF PROTEIN STRUCTURES AND
JRNL        TITL 2 COMPLEXES
JRNL        REF    NUCLEIC.ACIDS.RES..           V.  46 W296  2018
JRNL        PMID   29788355
JRNL        DOI    10.1093/nar/gky427
REMARK   1
REMARK   1 REFERENCE 1
REMARK   1  AUTH   S.BIENERT,A.WATERHOUSE,T.A.P.DE BEER,G.TAURIELLO,G.STUDER,
REMARK   1  AUTH 2 L.BORDOLI,T.SCHWEDE
REMARK   1  TITL   THE SWISS-MODEL REPOSITORY - NEW FEATURES AND FUNCTIONALITY
REMARK   1  REF    NUCLEIC.ACIDS.RES..           V.  22       2017
REMARK   1  REFN                   ISSN 0305-1048
REMARK   1  PMID   27899672
REMARK   1  DOI    10.1093/nar/gkw1132
REMARK   1
REMARK   1 REFERENCE 2
REMARK   1  AUTH   N.GUEX,M.C.PEITSCH,T.SCHWEDE
REMARK   1  TITL   AUTOMATED COMPARATIVE PROTEIN STRUCTURE MODELING WITH
REMARK   1  TITL 2 SWISS-MODEL AND SWISS-PDBVIEWER: A HISTORICAL PERSPECTIVE
REMARK   1  REF    ELECTROPHORESIS               V.  30       2009
REMARK   1  REFN                   ISSN 0173-0835
REMARK   1  PMID   19517507
REMARK   1  DOI    10.1002/elps.200900140
REMARK   1
REMARK   1 REFERENCE 3
REMARK   1  AUTH   P.BENKERT,M.BIASINI,T.SCHWEDE
REMARK   1  TITL   TOWARD THE ESTIMATION OF THE ABSOLUTE QUALITY OF INDIVIDUAL
REMARK   1  TITL 2 PROTEIN STRUCTURE MODELS
REMARK   1  REF    BIOINFORMATICS                V.  27       2011
REMARK   1  REFN                   ISSN 1367-4803
REMARK   1  PMID   21134891
REMARK   1  DOI    10.1093/bioinformatics/btq662
REMARK   1
REMARK   1 REFERENCE 4
REMARK   1  AUTH   M.BERTONI,F.KIEFER,M.BIASINI,L.BORDOLI,T.SCHWEDE
REMARK   1  TITL   MODELING PROTEIN QUATERNARY STRUCTURE OF HOMO- AND
REMARK   1  TITL 2 HETERO-OLIGOMERS BEYOND BINARY INTERACTIONS BY HOMOLOGY
REMARK   1  REF    SCI.REP.                      V.   7       2017
REMARK   1  REFN                   ISSN
REMARK   1  PMID   28874689
REMARK   1  DOI    10.1038/s41598-017-09654-8
REMARK   1
REMARK   1 DISCLAIMER
REMARK   1 The SWISS-MODEL SERVER produces theoretical models for proteins.
REMARK   1 The results of any theoretical modelling procedure is
REMARK   1 NON-EXPERIMENTAL and MUST be considered with care. These models may
REMARK   1 contain significant errors. This is especially true for automated
REMARK   1 modeling since there is no human intervention during model
REMARK   1 building. Please read the header section and the logfile carefully
REMARK   1 to know what templates and alignments were used during the model
REMARK   1 building process. All information by the SWISS-MODEL SERVER is
REMARK   1 provided "AS-IS", without any warranty, expressed or implied.
REMARK   2
REMARK   2 COPYRIGHT NOTICE
REMARK   2 This SWISS-MODEL protein model is copyright. It is produced by the
REMARK   2 SWISS-MODEL server, developed by the Computational Structural
REMARK   2 Biology Group at the SIB Swiss Institute of Bioinformatics at the
REMARK   2 Biozentrum, University of Basel (https://swissmodel.expasy.org). This
REMARK   2 model is licensed under the CC BY-SA 4.0 Creative Commons
REMARK   2 Attribution-ShareAlike 4.0 International License
REMARK   2 (https://creativecommons.org/licenses/by-sa/4.0/legalcode), i.e. you
REMARK   2 can copy and redistribute the model in any medium or format,
REMARK   2 transform and build upon the model for any purpose, even
REMARK   2 commercially, under the following terms:
REMARK   2 Attribution - You must give appropriate credit, provide a link to
REMARK   2 the license, and indicate if changes were made. You may do so in any
REMARK   2 reasonable manner, but not in any way that suggests the licensor
REMARK   2 endorses you or your use. When you publish, patent or distribute
REMARK   2 results that were fully or partially based on the model, please cite
REMARK   2 the corresponding papers mentioned under JRNL.
REMARK   2 ShareAlike - If you remix, transform, or build upon the material,
REMARK   2 you must distribute your contributions under the same license as the
REMARK   2 original.
REMARK   2 No additional restrictions - you may not apply legal terms or
REMARK   2 technological measures that legally restrict others from doing
REMARK   2 anything the license permits.
REMARK   2 Find a human-readable summary of (and not a substitute for) the
REMARK   2 CC BY-SA 4.0 license at this link:
REMARK   2 https://creativecommons.org/licenses/by-sa/4.0/
REMARK   3 
REMARK   3 MODEL INFORMATION
REMARK   3  ENGIN   PROMOD3
REMARK   3  VERSN   2.0.0
REMARK   3  OSTAT   monomer
REMARK   3  OSRSN   PREDICTION
REMARK   3  QSPRD   0.000
REMARK   3  QMN4    -2.50
REMARK   3  MODT    FALSE
REMARK   3 
REMARK   3 MODEL LIGAND 1
REMARK   3  NAME    NAG
REMARK   3  BIND    B.72
REMARK   3  BIND 2  B.74
REMARK   3  BIND 3  B.77
REMARK   3  BIND 4  _.1
REMARK   3 
REMARK   3 TEMPLATE 1
REMARK   3  PDBID   4kc3
REMARK   3  CHAIN   B
REMARK   3  MMCIF   B
REMARK   3  PDBV    2019-10-04
REMARK   3  SMTLE   4kc3.1.B
REMARK   3  SMTLV   2019-10-09
REMARK   3  MTHD    X-RAY DIFFRACTION 3.27 A
REMARK   3  FOUND   HHblits
REMARK   3  SIM     0.62
REMARK   3  SID     100.00
REMARK   3  OSTAT   monomer
REMARK   3  LIGND   NAG
REMARK   3  LIGND 2 NAG
REMARK   3  LIGND 3 NAG
REMARK   3  ALN B TRG KFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLP
REMARK   3  ALN B TRG AAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCP
REMARK   3  ALN B TRG TIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYTCKFIHNENGANY
REMARK   3  ALN B TRG SVTATRSFTVKDEQGFSLFPVIGAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAVL
REMARK   3  ALN B TRG WQLNGTKITDFGEPRIQQEEGQNQSFSNGLACLDMVLRIADVKEEDLLLQYDCLALNL
REMARK   3  ALN B TRG HGLRRHTVRLSRK
REMARK   3  ALN B TPL KFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLP
REMARK   3  ALN B TPL AAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCP
REMARK   3  ALN B TPL TIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYTCKFIHNENGANY
REMARK   3  ALN B TPL SVTATRSFTVKDEQGFSLFPVIGAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAVL
REMARK   3  ALN B TPL WQLNGTKITDFGEPRIQQEEGQNQSFSNGLACLDMVLRIADVKEEDLLLQYDCLALNL
REMARK   3  ALN B TPL HGLRRHTVRLSRK
REMARK   3  ALN B OFF 0
ATOM      1  N   SER B   3      54.973 -21.089  15.380  1.00  0.73           N  
ATOM      2  CA  SER B   3      55.034 -20.110  14.252  1.00  0.73           C  
ATOM      3  C   SER B   3      54.178 -20.636  13.135  1.00  0.73           C  
ATOM      4  O   SER B   3      54.499 -21.702  12.607  1.00  0.73           O  
ATOM      5  CB  SER B   3      56.490 -19.887  13.780  1.00  0.73           C  
ATOM      6  OG  SER B   3      56.505 -18.847  12.807  1.00  0.73           O  
ATOM      7  N   LYS B   4      53.036 -19.999  12.823  1.00  0.77           N  
ATOM      8  CA  LYS B   4      52.084 -20.533  11.853  1.00  0.77           C  
ATOM      9  C   LYS B   4      51.452 -19.417  11.033  1.00  0.77           C  
ATOM     10  O   LYS B   4      51.190 -18.322  11.531  1.00  0.77           O  
ATOM     11  CB  LYS B   4      50.980 -21.448  12.482  1.00  0.77           C  
ATOM     12  CG  LYS B   4      51.515 -22.826  12.925  1.00  0.77           C  
ATOM     13  CD  LYS B   4      50.458 -23.833  13.422  1.00  0.77           C  
ATOM     14  CE  LYS B   4      50.894 -25.299  13.260  1.00  0.77           C  
ATOM     15  NZ  LYS B   4      50.714 -25.735  11.854  1.00  0.77           N  
ATOM     16  N   GLN B   5      51.260 -19.641   9.720  1.00  0.75           N  
ATOM     17  CA  GLN B   5      50.795 -18.613   8.809  1.00  0.75           C  
ATOM     18  C   GLN B   5      49.271 -18.540   8.690  1.00  0.75           C  
ATOM     19  O   GLN B   5      48.593 -19.566   8.711  1.00  0.75           O  
ATOM     20  CB  GLN B   5      51.459 -18.843   7.428  1.00  0.75           C  
ATOM     21  CG  GLN B   5      51.660 -17.563   6.583  1.00  0.75           C  
ATOM     22  CD  GLN B   5      52.743 -17.730   5.512  1.00  0.75           C  
ATOM     23  OE1 GLN B   5      53.581 -16.858   5.296  1.00  0.75           O  
ATOM     24  NE2 GLN B   5      52.762 -18.895   4.828  1.00  0.75           N  
ATOM     25  N   SER B   6      48.703 -17.324   8.547  1.00  0.84           N  
ATOM     26  CA  SER B   6      47.265 -17.093   8.468  1.00  0.84           C  
ATOM     27  C   SER B   6      47.019 -15.977   7.474  1.00  0.84           C  
ATOM     28  O   SER B   6      47.906 -15.172   7.197  1.00  0.84           O  
ATOM     29  CB  SER B   6      46.636 -16.606   9.796  1.00  0.84           C  
ATOM     30  OG  SER B   6      46.820 -17.556  10.841  1.00  0.84           O  
ATOM     31  N   TRP B   7      45.813 -15.881   6.885  1.00  0.83           N  
ATOM     32  CA  TRP B   7      45.588 -14.948   5.796  1.00  0.83           C  
ATOM     33  C   TRP B   7      44.101 -14.643   5.613  1.00  0.83           C  
ATOM     34  O   TRP B   7      43.247 -15.347   6.148  1.00  0.83           O  
ATOM     35  CB  TRP B   7      46.206 -15.495   4.472  1.00  0.83           C  
ATOM     36  CG  TRP B   7      45.591 -16.787   3.959  1.00  0.83           C  
ATOM     37  CD1 TRP B   7      44.538 -16.902   3.102  1.00  0.83           C  
ATOM     38  CD2 TRP B   7      45.928 -18.134   4.360  1.00  0.83           C  
ATOM     39  NE1 TRP B   7      44.173 -18.221   2.963  1.00  0.83           N  
ATOM     40  CE2 TRP B   7      45.025 -18.991   3.712  1.00  0.83           C  
ATOM     41  CE3 TRP B   7      46.909 -18.641   5.213  1.00  0.83           C  
ATOM     42  CZ2 TRP B   7      45.081 -20.365   3.893  1.00  0.83           C  
ATOM     43  CZ3 TRP B   7      46.921 -20.026   5.450  1.00  0.83           C  
ATOM     44  CH2 TRP B   7      46.016 -20.876   4.804  1.00  0.83           C  
ATOM     45  N   GLY B   8      43.750 -13.581   4.851  1.00  0.87           N  
ATOM     46  CA  GLY B   8      42.354 -13.268   4.539  1.00  0.87           C  
ATOM     47  C   GLY B   8      42.239 -12.045   3.669  1.00  0.87           C  
ATOM     48  O   GLY B   8      43.244 -11.461   3.268  1.00  0.87           O  
ATOM     49  N   LEU B   9      41.016 -11.601   3.335  1.00  0.82           N  
ATOM     50  CA  LEU B   9      40.833 -10.413   2.511  1.00  0.82           C  
ATOM     51  C   LEU B   9      40.567  -9.154   3.338  1.00  0.82           C  
ATOM     52  O   LEU B   9      40.207  -9.199   4.513  1.00  0.82           O  
ATOM     53  CB  LEU B   9      39.656 -10.537   1.502  1.00  0.82           C  
ATOM     54  CG  LEU B   9      39.806 -11.530   0.330  1.00  0.82           C  
ATOM     55  CD1 LEU B   9      41.159 -11.401  -0.363  1.00  0.82           C  
ATOM     56  CD2 LEU B   9      39.549 -12.981   0.735  1.00  0.82           C  
ATOM     57  N   GLU B  10      40.733  -7.965   2.709  1.00  0.77           N  
ATOM     58  CA  GLU B  10      40.206  -6.691   3.180  1.00  0.77           C  
ATOM     59  C   GLU B  10      38.686  -6.716   3.346  1.00  0.77           C  
ATOM     60  O   GLU B  10      37.966  -7.347   2.572  1.00  0.77           O  
ATOM     61  CB  GLU B  10      40.588  -5.516   2.226  1.00  0.77           C  
ATOM     62  CG  GLU B  10      39.878  -5.549   0.839  1.00  0.77           C  
ATOM     63  CD  GLU B  10      40.310  -4.469  -0.153  1.00  0.77           C  
ATOM     64  OE1 GLU B  10      41.211  -3.659   0.166  1.00  0.77           O  
ATOM     65  OE2 GLU B  10      39.754  -4.447  -1.293  1.00  0.77           O  
ATOM     66  N   ASN B  11      38.168  -6.039   4.396  1.00  0.81           N  
ATOM     67  CA  ASN B  11      36.747  -5.904   4.717  1.00  0.81           C  
ATOM     68  C   ASN B  11      36.184  -7.122   5.434  1.00  0.81           C  
ATOM     69  O   ASN B  11      35.014  -7.137   5.815  1.00  0.81           O  
ATOM     70  CB  ASN B  11      35.781  -5.612   3.523  1.00  0.81           C  
ATOM     71  CG  ASN B  11      36.180  -4.488   2.574  1.00  0.81           C  
ATOM     72  OD1 ASN B  11      35.853  -4.574   1.383  1.00  0.81           O  
ATOM     73  ND2 ASN B  11      36.811  -3.409   3.083  1.00  0.81           N  
ATOM     74  N   GLU B  12      37.014  -8.145   5.675  1.00  0.83           N  
ATOM     75  CA  GLU B  12      36.577  -9.393   6.257  1.00  0.83           C  
ATOM     76  C   GLU B  12      37.087  -9.524   7.672  1.00  0.83           C  
ATOM     77  O   GLU B  12      38.180  -9.071   8.019  1.00  0.83           O  
ATOM     78  CB  GLU B  12      37.011 -10.602   5.393  1.00  0.83           C  
ATOM     79  CG  GLU B  12      36.132 -10.727   4.121  1.00  0.83           C  
ATOM     80  CD  GLU B  12      36.395 -11.965   3.267  1.00  0.83           C  
ATOM     81  OE1 GLU B  12      36.754 -13.026   3.834  1.00  0.83           O  
ATOM     82  OE2 GLU B  12      36.171 -11.881   2.029  1.00  0.83           O  
ATOM     83  N   ALA B  13      36.275 -10.105   8.578  1.00  0.91           N  
ATOM     84  CA  ALA B  13      36.758 -10.446   9.898  1.00  0.91           C  
ATOM     85  C   ALA B  13      37.770 -11.575   9.859  1.00  0.91           C  
ATOM     86  O   ALA B  13      37.614 -12.544   9.124  1.00  0.91           O  
ATOM     87  CB  ALA B  13      35.620 -10.827  10.856  1.00  0.91           C  
ATOM     88  N   LEU B  14      38.824 -11.495  10.677  1.00  0.89           N  
ATOM     89  CA  LEU B  14      39.775 -12.578  10.763  1.00  0.89           C  
ATOM     90  C   LEU B  14      40.055 -12.830  12.219  1.00  0.89           C  
ATOM     91  O   LEU B  14      40.315 -11.902  12.988  1.00  0.89           O  
ATOM     92  CB  LEU B  14      41.071 -12.252   9.981  1.00  0.89           C  
ATOM     93  CG  LEU B  14      42.150 -13.356   9.964  1.00  0.89           C  
ATOM     94  CD1 LEU B  14      41.791 -14.508   9.023  1.00  0.89           C  
ATOM     95  CD2 LEU B  14      43.510 -12.781   9.550  1.00  0.89           C  
ATOM     96  N   ILE B  15      39.988 -14.100  12.647  1.00  0.88           N  
ATOM     97  CA  ILE B  15      40.353 -14.495  13.993  1.00  0.88           C  
ATOM     98  C   ILE B  15      41.546 -15.418  13.840  1.00  0.88           C  
ATOM     99  O   ILE B  15      41.563 -16.292  12.975  1.00  0.88           O  
ATOM    100  CB  ILE B  15      39.256 -15.220  14.773  1.00  0.88           C  
ATOM    101  CG1 ILE B  15      37.861 -14.560  14.694  1.00  0.88           C  
ATOM    102  CG2 ILE B  15      39.698 -15.396  16.239  1.00  0.88           C  
ATOM    103  CD1 ILE B  15      37.754 -13.140  15.232  1.00  0.88           C  
ATOM    104  N   VAL B  16      42.601 -15.225  14.650  1.00  0.88           N  
ATOM    105  CA  VAL B  16      43.854 -15.953  14.554  1.00  0.88           C  
ATOM    106  C   VAL B  16      44.155 -16.593  15.896  1.00  0.88           C  
ATOM    107  O   VAL B  16      44.256 -15.916  16.917  1.00  0.88           O  
ATOM    108  CB  VAL B  16      44.997 -15.011  14.192  1.00  0.88           C  
ATOM    109  CG1 VAL B  16      46.367 -15.708  14.250  1.00  0.88           C  
ATOM    110  CG2 VAL B  16      44.747 -14.437  12.788  1.00  0.88           C  
ATOM    111  N   ARG B  17      44.327 -17.928  15.949  1.00  0.76           N  
ATOM    112  CA  ARG B  17      44.624 -18.618  17.192  1.00  0.76           C  
ATOM    113  C   ARG B  17      46.123 -18.592  17.498  1.00  0.76           C  
ATOM    114  O   ARG B  17      46.954 -18.833  16.626  1.00  0.76           O  
ATOM    115  CB  ARG B  17      44.077 -20.074  17.134  1.00  0.76           C  
ATOM    116  CG  ARG B  17      44.070 -20.837  18.478  1.00  0.76           C  
ATOM    117  CD  ARG B  17      43.393 -22.223  18.415  1.00  0.76           C  
ATOM    118  NE  ARG B  17      42.245 -22.252  19.392  1.00  0.76           N  
ATOM    119  CZ  ARG B  17      40.953 -22.462  19.085  1.00  0.76           C  
ATOM    120  NH1 ARG B  17      40.514 -22.608  17.841  1.00  0.76           N  
ATOM    121  NH2 ARG B  17      40.059 -22.524  20.069  1.00  0.76           N  
ATOM    122  N   CYS B  18      46.525 -18.283  18.754  1.00  0.80           N  
ATOM    123  CA  CYS B  18      47.925 -18.345  19.177  1.00  0.80           C  
ATOM    124  C   CYS B  18      48.512 -19.756  18.997  1.00  0.80           C  
ATOM    125  O   CYS B  18      47.872 -20.709  19.455  1.00  0.80           O  
ATOM    126  CB  CYS B  18      48.120 -17.901  20.652  1.00  0.80           C  
ATOM    127  SG  CYS B  18      49.833 -17.969  21.290  1.00  0.80           S  
ATOM    128  N   PRO B  19      49.695 -19.956  18.371  1.00  0.75           N  
ATOM    129  CA  PRO B  19      50.153 -21.288  17.981  1.00  0.75           C  
ATOM    130  C   PRO B  19      50.485 -22.201  19.120  1.00  0.75           C  
ATOM    131  O   PRO B  19      50.521 -23.415  18.942  1.00  0.75           O  
ATOM    132  CB  PRO B  19      51.453 -21.033  17.208  1.00  0.75           C  
ATOM    133  CG  PRO B  19      51.244 -19.674  16.564  1.00  0.75           C  
ATOM    134  CD  PRO B  19      50.367 -18.923  17.565  1.00  0.75           C  
ATOM    135  N   ARG B  20      50.847 -21.624  20.268  1.00  0.66           N  
ATOM    136  CA  ARG B  20      51.173 -22.387  21.438  1.00  0.66           C  
ATOM    137  C   ARG B  20      49.957 -22.382  22.317  1.00  0.66           C  
ATOM    138  O   ARG B  20      49.444 -21.334  22.698  1.00  0.66           O  
ATOM    139  CB  ARG B  20      52.407 -21.815  22.156  1.00  0.66           C  
ATOM    140  CG  ARG B  20      53.586 -21.674  21.176  1.00  0.66           C  
ATOM    141  CD  ARG B  20      54.965 -22.001  21.745  1.00  0.66           C  
ATOM    142  NE  ARG B  20      54.994 -23.443  22.135  1.00  0.66           N  
ATOM    143  CZ  ARG B  20      56.007 -23.995  22.814  1.00  0.66           C  
ATOM    144  NH1 ARG B  20      57.109 -23.307  23.105  1.00  0.66           N  
ATOM    145  NH2 ARG B  20      55.895 -25.252  23.239  1.00  0.66           N  
ATOM    146  N   GLN B  21      49.412 -23.572  22.600  1.00  0.78           N  
ATOM    147  CA  GLN B  21      48.125 -23.642  23.239  1.00  0.78           C  
ATOM    148  C   GLN B  21      48.163 -23.547  24.752  1.00  0.78           C  
ATOM    149  O   GLN B  21      49.167 -23.824  25.413  1.00  0.78           O  
ATOM    150  CB  GLN B  21      47.334 -24.894  22.798  1.00  0.78           C  
ATOM    151  CG  GLN B  21      47.824 -26.229  23.401  1.00  0.78           C  
ATOM    152  CD  GLN B  21      46.748 -27.295  23.225  1.00  0.78           C  
ATOM    153  OE1 GLN B  21      46.685 -28.005  22.226  1.00  0.78           O  
ATOM    154  NE2 GLN B  21      45.831 -27.389  24.217  1.00  0.78           N  
ATOM    155  N   GLY B  22      47.013 -23.183  25.343  1.00  0.82           N  
ATOM    156  CA  GLY B  22      46.832 -23.233  26.775  1.00  0.82           C  
ATOM    157  C   GLY B  22      45.382 -23.339  27.104  1.00  0.82           C  
ATOM    158  O   GLY B  22      44.631 -24.087  26.473  1.00  0.82           O  
ATOM    159  N   LYS B  23      44.937 -22.611  28.131  1.00  0.71           N  
ATOM    160  CA  LYS B  23      43.613 -22.710  28.694  1.00  0.71           C  
ATOM    161  C   LYS B  23      43.150 -21.304  29.016  1.00  0.71           C  
ATOM    162  O   LYS B  23      43.990 -20.418  29.159  1.00  0.71           O  
ATOM    163  CB  LYS B  23      43.659 -23.521  30.022  1.00  0.71           C  
ATOM    164  CG  LYS B  23      43.017 -24.920  30.027  1.00  0.71           C  
ATOM    165  CD  LYS B  23      43.428 -25.835  28.867  1.00  0.71           C  
ATOM    166  CE  LYS B  23      42.284 -26.064  27.871  1.00  0.71           C  
ATOM    167  NZ  LYS B  23      42.745 -25.984  26.471  1.00  0.71           N  
ATOM    168  N   PRO B  24      41.853 -21.056  29.168  1.00  0.73           N  
ATOM    169  CA  PRO B  24      41.326 -19.994  30.028  1.00  0.73           C  
ATOM    170  C   PRO B  24      41.983 -19.968  31.400  1.00  0.73           C  
ATOM    171  O   PRO B  24      42.174 -21.046  31.953  1.00  0.73           O  
ATOM    172  CB  PRO B  24      39.820 -20.309  30.115  1.00  0.73           C  
ATOM    173  CG  PRO B  24      39.522 -21.204  28.908  1.00  0.73           C  
ATOM    174  CD  PRO B  24      40.808 -21.993  28.762  1.00  0.73           C  
ATOM    175  N   SER B  25      42.346 -18.779  31.920  1.00  0.71           N  
ATOM    176  CA  SER B  25      43.031 -18.560  33.198  1.00  0.71           C  
ATOM    177  C   SER B  25      44.542 -18.626  33.084  1.00  0.71           C  
ATOM    178  O   SER B  25      45.248 -17.827  33.703  1.00  0.71           O  
ATOM    179  CB  SER B  25      42.468 -19.314  34.437  1.00  0.71           C  
ATOM    180  OG  SER B  25      43.039 -20.612  34.613  1.00  0.71           O  
ATOM    181  N   TYR B  26      45.094 -19.475  32.186  1.00  0.77           N  
ATOM    182  CA  TYR B  26      46.376 -19.162  31.577  1.00  0.77           C  
ATOM    183  C   TYR B  26      46.243 -17.906  30.725  1.00  0.77           C  
ATOM    184  O   TYR B  26      45.210 -17.644  30.106  1.00  0.77           O  
ATOM    185  CB  TYR B  26      46.998 -20.286  30.708  1.00  0.77           C  
ATOM    186  CG  TYR B  26      47.422 -21.500  31.500  1.00  0.77           C  
ATOM    187  CD1 TYR B  26      48.129 -21.380  32.709  1.00  0.77           C  
ATOM    188  CD2 TYR B  26      47.197 -22.790  30.988  1.00  0.77           C  
ATOM    189  CE1 TYR B  26      48.592 -22.516  33.385  1.00  0.77           C  
ATOM    190  CE2 TYR B  26      47.654 -23.932  31.663  1.00  0.77           C  
ATOM    191  CZ  TYR B  26      48.365 -23.788  32.859  1.00  0.77           C  
ATOM    192  OH  TYR B  26      48.870 -24.911  33.540  1.00  0.77           O  
ATOM    193  N   THR B  27      47.277 -17.059  30.722  1.00  0.78           N  
ATOM    194  CA  THR B  27      47.124 -15.674  30.293  1.00  0.78           C  
ATOM    195  C   THR B  27      48.030 -15.378  29.118  1.00  0.78           C  
ATOM    196  O   THR B  27      49.168 -15.871  29.044  1.00  0.78           O  
ATOM    197  CB  THR B  27      47.199 -14.699  31.469  1.00  0.78           C  
ATOM    198  OG1 THR B  27      47.226 -13.343  31.054  1.00  0.78           O  
ATOM    199  CG2 THR B  27      48.406 -14.968  32.379  1.00  0.78           C  
ATOM    200  N   VAL B  28      47.490 -14.673  28.105  1.00  0.84           N  
ATOM    201  CA  VAL B  28      48.059 -14.586  26.768  1.00  0.84           C  
ATOM    202  C   VAL B  28      48.185 -13.140  26.331  1.00  0.84           C  
ATOM    203  O   VAL B  28      47.194 -12.408  26.289  1.00  0.84           O  
ATOM    204  CB  VAL B  28      47.249 -15.327  25.690  1.00  0.84           C  
ATOM    205  CG1 VAL B  28      47.983 -15.308  24.331  1.00  0.84           C  
ATOM    206  CG2 VAL B  28      46.948 -16.777  26.110  1.00  0.84           C  
ATOM    207  N   ASP B  29      49.402 -12.716  25.943  1.00  0.82           N  
ATOM    208  CA  ASP B  29      49.666 -11.376  25.460  1.00  0.82           C  
ATOM    209  C   ASP B  29      50.148 -11.454  24.023  1.00  0.82           C  
ATOM    210  O   ASP B  29      50.640 -12.489  23.572  1.00  0.82           O  
ATOM    211  CB  ASP B  29      50.766 -10.662  26.275  1.00  0.82           C  
ATOM    212  CG  ASP B  29      50.475 -10.669  27.765  1.00  0.82           C  
ATOM    213  OD1 ASP B  29      51.300 -11.263  28.504  1.00  0.82           O  
ATOM    214  OD2 ASP B  29      49.484 -10.049  28.202  1.00  0.82           O  
ATOM    215  N   TRP B  30      50.018 -10.357  23.256  1.00  0.78           N  
ATOM    216  CA  TRP B  30      50.332 -10.356  21.841  1.00  0.78           C  
ATOM    217  C   TRP B  30      51.015  -9.049  21.453  1.00  0.78           C  
ATOM    218  O   TRP B  30      50.916  -8.046  22.161  1.00  0.78           O  
ATOM    219  CB  TRP B  30      49.053 -10.493  20.986  1.00  0.78           C  
ATOM    220  CG  TRP B  30      48.271 -11.789  21.054  1.00  0.78           C  
ATOM    221  CD1 TRP B  30      47.433 -12.237  22.040  1.00  0.78           C  
ATOM    222  CD2 TRP B  30      48.165 -12.725  19.971  1.00  0.78           C  
ATOM    223  NE1 TRP B  30      46.781 -13.380  21.628  1.00  0.78           N  
ATOM    224  CE2 TRP B  30      47.217 -13.697  20.361  1.00  0.78           C  
ATOM    225  CE3 TRP B  30      48.806 -12.796  18.734  1.00  0.78           C  
ATOM    226  CZ2 TRP B  30      46.887 -14.742  19.512  1.00  0.78           C  
ATOM    227  CZ3 TRP B  30      48.516 -13.891  17.907  1.00  0.78           C  
ATOM    228  CH2 TRP B  30      47.562 -14.847  18.286  1.00  0.78           C  
ATOM    229  N   TYR B  31      51.747  -9.033  20.316  1.00  0.81           N  
ATOM    230  CA  TYR B  31      52.638  -7.935  19.961  1.00  0.81           C  
ATOM    231  C   TYR B  31      52.690  -7.779  18.441  1.00  0.81           C  
ATOM    232  O   TYR B  31      52.390  -8.718  17.711  1.00  0.81           O  
ATOM    233  CB  TYR B  31      54.093  -8.171  20.471  1.00  0.81           C  
ATOM    234  CG  TYR B  31      54.120  -8.475  21.949  1.00  0.81           C  
ATOM    235  CD1 TYR B  31      53.992  -9.804  22.389  1.00  0.81           C  
ATOM    236  CD2 TYR B  31      54.208  -7.454  22.909  1.00  0.81           C  
ATOM    237  CE1 TYR B  31      53.914 -10.098  23.754  1.00  0.81           C  
ATOM    238  CE2 TYR B  31      54.168  -7.754  24.282  1.00  0.81           C  
ATOM    239  CZ  TYR B  31      54.017  -9.082  24.705  1.00  0.81           C  
ATOM    240  OH  TYR B  31      53.955  -9.406  26.081  1.00  0.81           O  
ATOM    241  N   TYR B  32      53.058  -6.583  17.917  1.00  0.79           N  
ATOM    242  CA  TYR B  32      53.120  -6.340  16.472  1.00  0.79           C  
ATOM    243  C   TYR B  32      54.495  -5.847  16.024  1.00  0.79           C  
ATOM    244  O   TYR B  32      55.272  -6.614  15.466  1.00  0.79           O  
ATOM    245  CB  TYR B  32      51.979  -5.351  16.053  1.00  0.79           C  
ATOM    246  CG  TYR B  32      51.784  -5.055  14.574  1.00  0.79           C  
ATOM    247  CD1 TYR B  32      50.864  -4.044  14.227  1.00  0.79           C  
ATOM    248  CD2 TYR B  32      52.456  -5.729  13.532  1.00  0.79           C  
ATOM    249  CE1 TYR B  32      50.649  -3.693  12.888  1.00  0.79           C  
ATOM    250  CE2 TYR B  32      52.239  -5.377  12.191  1.00  0.79           C  
ATOM    251  CZ  TYR B  32      51.335  -4.362  11.873  1.00  0.79           C  
ATOM    252  OH  TYR B  32      51.108  -3.978  10.541  1.00  0.79           O  
ATOM    253  N   SER B  33      54.809  -4.547  16.232  1.00  0.60           N  
ATOM    254  CA  SER B  33      55.996  -3.900  15.670  1.00  0.60           C  
ATOM    255  C   SER B  33      55.985  -2.416  15.960  1.00  0.60           C  
ATOM    256  O   SER B  33      56.996  -1.814  16.307  1.00  0.60           O  
ATOM    257  CB  SER B  33      56.154  -4.068  14.122  1.00  0.60           C  
ATOM    258  OG  SER B  33      55.067  -3.507  13.371  1.00  0.60           O  
ATOM    259  N   GLN B  34      54.815  -1.772  15.795  1.00  0.32           N  
ATOM    260  CA  GLN B  34      54.682  -0.337  15.976  1.00  0.32           C  
ATOM    261  C   GLN B  34      54.691   0.107  17.427  1.00  0.32           C  
ATOM    262  O   GLN B  34      55.415   1.007  17.839  1.00  0.32           O  
ATOM    263  CB  GLN B  34      53.353   0.150  15.345  1.00  0.32           C  
ATOM    264  CG  GLN B  34      53.139  -0.292  13.880  1.00  0.32           C  
ATOM    265  CD  GLN B  34      54.219   0.289  12.968  1.00  0.32           C  
ATOM    266  OE1 GLN B  34      54.230   1.481  12.666  1.00  0.32           O  
ATOM    267  NE2 GLN B  34      55.165  -0.569  12.524  1.00  0.32           N  
ATOM    268  N   THR B  35      53.857  -0.520  18.276  1.00  0.45           N  
ATOM    269  CA  THR B  35      53.771  -0.125  19.671  1.00  0.45           C  
ATOM    270  C   THR B  35      54.823  -0.740  20.553  1.00  0.45           C  
ATOM    271  O   THR B  35      55.333  -0.054  21.443  1.00  0.45           O  
ATOM    272  CB  THR B  35      52.417  -0.435  20.295  1.00  0.45           C  
ATOM    273  OG1 THR B  35      52.024  -1.781  20.052  1.00  0.45           O  
ATOM    274  CG2 THR B  35      51.357   0.491  19.685  1.00  0.45           C  
ATOM    275  N   ASN B  36      55.097  -2.041  20.353  1.00  0.43           N  
ATOM    276  CA  ASN B  36      55.916  -2.928  21.172  1.00  0.43           C  
ATOM    277  C   ASN B  36      55.489  -2.981  22.630  1.00  0.43           C  
ATOM    278  O   ASN B  36      56.291  -3.018  23.558  1.00  0.43           O  
ATOM    279  CB  ASN B  36      57.431  -2.647  21.053  1.00  0.43           C  
ATOM    280  CG  ASN B  36      57.858  -2.774  19.599  1.00  0.43           C  
ATOM    281  OD1 ASN B  36      57.408  -3.683  18.895  1.00  0.43           O  
ATOM    282  ND2 ASN B  36      58.731  -1.861  19.124  1.00  0.43           N  
ATOM    283  N   LYS B  37      54.171  -2.997  22.853  1.00  0.50           N  
ATOM    284  CA  LYS B  37      53.586  -2.940  24.171  1.00  0.50           C  
ATOM    285  C   LYS B  37      52.622  -4.084  24.285  1.00  0.50           C  
ATOM    286  O   LYS B  37      52.449  -4.860  23.347  1.00  0.50           O  
ATOM    287  CB  LYS B  37      52.798  -1.622  24.412  1.00  0.50           C  
ATOM    288  CG  LYS B  37      53.628  -0.364  24.146  1.00  0.50           C  
ATOM    289  CD  LYS B  37      52.880   0.956  24.362  1.00  0.50           C  
ATOM    290  CE  LYS B  37      53.730   2.191  24.033  1.00  0.50           C  
ATOM    291  NZ  LYS B  37      54.109   2.213  22.601  1.00  0.50           N  
ATOM    292  N   SER B  38      51.917  -4.191  25.423  1.00  0.72           N  
ATOM    293  CA  SER B  38      50.677  -4.959  25.471  1.00  0.72           C  
ATOM    294  C   SER B  38      49.667  -4.474  24.431  1.00  0.72           C  
ATOM    295  O   SER B  38      49.147  -3.356  24.512  1.00  0.72           O  
ATOM    296  CB  SER B  38      50.026  -4.929  26.876  1.00  0.72           C  
ATOM    297  OG  SER B  38      48.955  -5.865  26.973  1.00  0.72           O  
ATOM    298  N   ILE B  39      49.414  -5.285  23.379  1.00  0.80           N  
ATOM    299  CA  ILE B  39      48.397  -5.024  22.370  1.00  0.80           C  
ATOM    300  C   ILE B  39      47.027  -4.969  23.057  1.00  0.80           C  
ATOM    301  O   ILE B  39      46.871  -5.583  24.114  1.00  0.80           O  
ATOM    302  CB  ILE B  39      48.476  -6.030  21.219  1.00  0.80           C  
ATOM    303  CG1 ILE B  39      47.929  -5.578  19.841  1.00  0.80           C  
ATOM    304  CG2 ILE B  39      47.804  -7.334  21.652  1.00  0.80           C  
ATOM    305  CD1 ILE B  39      48.349  -6.495  18.685  1.00  0.80           C  
ATOM    306  N   PRO B  40      46.023  -4.242  22.597  1.00  0.80           N  
ATOM    307  CA  PRO B  40      44.770  -4.083  23.327  1.00  0.80           C  
ATOM    308  C   PRO B  40      44.083  -5.392  23.683  1.00  0.80           C  
ATOM    309  O   PRO B  40      43.780  -6.194  22.800  1.00  0.80           O  
ATOM    310  CB  PRO B  40      43.942  -3.184  22.410  1.00  0.80           C  
ATOM    311  CG  PRO B  40      45.013  -2.388  21.665  1.00  0.80           C  
ATOM    312  CD  PRO B  40      46.059  -3.432  21.389  1.00  0.80           C  
ATOM    313  N   THR B  41      43.844  -5.612  24.987  1.00  0.79           N  
ATOM    314  CA  THR B  41      43.379  -6.884  25.533  1.00  0.79           C  
ATOM    315  C   THR B  41      41.894  -7.092  25.306  1.00  0.79           C  
ATOM    316  O   THR B  41      41.372  -8.205  25.297  1.00  0.79           O  
ATOM    317  CB  THR B  41      43.692  -7.006  27.030  1.00  0.79           C  
ATOM    318  OG1 THR B  41      42.796  -6.246  27.845  1.00  0.79           O  
ATOM    319  CG2 THR B  41      45.096  -6.442  27.295  1.00  0.79           C  
ATOM    320  N   GLN B  42      41.169  -5.981  25.116  1.00  0.75           N  
ATOM    321  CA  GLN B  42      39.819  -5.974  24.623  1.00  0.75           C  
ATOM    322  C   GLN B  42      39.642  -4.669  23.855  1.00  0.75           C  
ATOM    323  O   GLN B  42      39.990  -3.603  24.359  1.00  0.75           O  
ATOM    324  CB  GLN B  42      38.795  -6.072  25.791  1.00  0.75           C  
ATOM    325  CG  GLN B  42      37.717  -7.171  25.627  1.00  0.75           C  
ATOM    326  CD  GLN B  42      38.230  -8.577  25.935  1.00  0.75           C  
ATOM    327  OE1 GLN B  42      38.304  -9.444  25.061  1.00  0.75           O  
ATOM    328  NE2 GLN B  42      38.567  -8.836  27.218  1.00  0.75           N  
ATOM    329  N   GLU B  43      39.096  -4.716  22.628  1.00  0.76           N  
ATOM    330  CA  GLU B  43      38.412  -3.603  21.982  1.00  0.76           C  
ATOM    331  C   GLU B  43      39.126  -2.250  21.757  1.00  0.76           C  
ATOM    332  O   GLU B  43      38.533  -1.178  21.874  1.00  0.76           O  
ATOM    333  CB  GLU B  43      37.005  -3.427  22.631  1.00  0.76           C  
ATOM    334  CG  GLU B  43      36.032  -4.601  22.338  1.00  0.76           C  
ATOM    335  CD  GLU B  43      35.329  -4.494  20.982  1.00  0.76           C  
ATOM    336  OE1 GLU B  43      35.828  -3.749  20.100  1.00  0.76           O  
ATOM    337  OE2 GLU B  43      34.266  -5.154  20.831  1.00  0.76           O  
ATOM    338  N   ARG B  44      40.397  -2.240  21.270  1.00  0.72           N  
ATOM    339  CA  ARG B  44      40.827  -1.202  20.322  1.00  0.72           C  
ATOM    340  C   ARG B  44      40.140  -1.573  19.040  1.00  0.72           C  
ATOM    341  O   ARG B  44      40.507  -2.575  18.428  1.00  0.72           O  
ATOM    342  CB  ARG B  44      42.346  -1.153  20.034  1.00  0.72           C  
ATOM    343  CG  ARG B  44      42.847  -0.333  18.806  1.00  0.72           C  
ATOM    344  CD  ARG B  44      44.047  -1.023  18.130  1.00  0.72           C  
ATOM    345  NE  ARG B  44      44.406  -0.361  16.829  1.00  0.72           N  
ATOM    346  CZ  ARG B  44      45.264  -0.908  15.951  1.00  0.72           C  
ATOM    347  NH1 ARG B  44      45.790  -2.115  16.146  1.00  0.72           N  
ATOM    348  NH2 ARG B  44      45.601  -0.237  14.850  1.00  0.72           N  
ATOM    349  N   ASN B  45      39.135  -0.798  18.627  1.00  0.81           N  
ATOM    350  CA  ASN B  45      37.888  -1.265  18.029  1.00  0.81           C  
ATOM    351  C   ASN B  45      37.989  -2.040  16.718  1.00  0.81           C  
ATOM    352  O   ASN B  45      37.010  -2.581  16.223  1.00  0.81           O  
ATOM    353  CB  ASN B  45      36.943  -0.047  17.824  1.00  0.81           C  
ATOM    354  CG  ASN B  45      36.961   0.893  19.033  1.00  0.81           C  
ATOM    355  OD1 ASN B  45      37.966   1.553  19.317  1.00  0.81           O  
ATOM    356  ND2 ASN B  45      35.830   0.999  19.753  1.00  0.81           N  
ATOM    357  N   ARG B  46      39.191  -2.113  16.124  1.00  0.73           N  
ATOM    358  CA  ARG B  46      39.443  -2.926  14.963  1.00  0.73           C  
ATOM    359  C   ARG B  46      40.333  -4.137  15.229  1.00  0.73           C  
ATOM    360  O   ARG B  46      39.954  -5.263  14.938  1.00  0.73           O  
ATOM    361  CB  ARG B  46      40.065  -2.041  13.865  1.00  0.73           C  
ATOM    362  CG  ARG B  46      39.949  -2.697  12.485  1.00  0.73           C  
ATOM    363  CD  ARG B  46      40.178  -1.761  11.302  1.00  0.73           C  
ATOM    364  NE  ARG B  46      41.348  -2.283  10.561  1.00  0.73           N  
ATOM    365  CZ  ARG B  46      42.601  -1.848  10.713  1.00  0.73           C  
ATOM    366  NH1 ARG B  46      42.960  -0.992  11.663  1.00  0.73           N  
ATOM    367  NH2 ARG B  46      43.534  -2.292   9.898  1.00  0.73           N  
ATOM    368  N   VAL B  47      41.558  -3.956  15.774  1.00  0.85           N  
ATOM    369  CA  VAL B  47      42.516  -5.057  15.915  1.00  0.85           C  
ATOM    370  C   VAL B  47      42.937  -5.195  17.366  1.00  0.85           C  
ATOM    371  O   VAL B  47      43.604  -4.316  17.920  1.00  0.85           O  
ATOM    372  CB  VAL B  47      43.786  -4.910  15.070  1.00  0.85           C  
ATOM    373  CG1 VAL B  47      44.613  -6.211  15.109  1.00  0.85           C  
ATOM    374  CG2 VAL B  47      43.450  -4.541  13.615  1.00  0.85           C  
ATOM    375  N   PHE B  48      42.579  -6.316  18.010  1.00  0.78           N  
ATOM    376  CA  PHE B  48      42.758  -6.518  19.437  1.00  0.78           C  
ATOM    377  C   PHE B  48      42.810  -8.006  19.740  1.00  0.78           C  
ATOM    378  O   PHE B  48      42.442  -8.818  18.897  1.00  0.78           O  
ATOM    379  CB  PHE B  48      41.631  -5.830  20.252  1.00  0.78           C  
ATOM    380  CG  PHE B  48      40.252  -6.344  19.955  1.00  0.78           C  
ATOM    381  CD1 PHE B  48      39.443  -5.708  19.003  1.00  0.78           C  
ATOM    382  CD2 PHE B  48      39.728  -7.418  20.693  1.00  0.78           C  
ATOM    383  CE1 PHE B  48      38.146  -6.162  18.753  1.00  0.78           C  
ATOM    384  CE2 PHE B  48      38.421  -7.862  20.465  1.00  0.78           C  
ATOM    385  CZ  PHE B  48      37.635  -7.242  19.485  1.00  0.78           C  
ATOM    386  N   ALA B  49      43.266  -8.439  20.929  1.00  0.83           N  
ATOM    387  CA  ALA B  49      43.432  -9.861  21.180  1.00  0.83           C  
ATOM    388  C   ALA B  49      42.653 -10.313  22.405  1.00  0.83           C  
ATOM    389  O   ALA B  49      42.895  -9.839  23.509  1.00  0.83           O  
ATOM    390  CB  ALA B  49      44.926 -10.189  21.332  1.00  0.83           C  
ATOM    391  N   SER B  50      41.700 -11.264  22.265  1.00  0.83           N  
ATOM    392  CA  SER B  50      41.000 -11.804  23.428  1.00  0.83           C  
ATOM    393  C   SER B  50      41.583 -13.167  23.736  1.00  0.83           C  
ATOM    394  O   SER B  50      41.261 -14.158  23.081  1.00  0.83           O  
ATOM    395  CB  SER B  50      39.469 -12.001  23.276  1.00  0.83           C  
ATOM    396  OG  SER B  50      38.846 -10.798  22.798  1.00  0.83           O  
ATOM    397  N   GLY B  51      42.455 -13.287  24.762  1.00  0.79           N  
ATOM    398  CA  GLY B  51      43.092 -14.567  25.084  1.00  0.79           C  
ATOM    399  C   GLY B  51      43.897 -15.185  23.960  1.00  0.79           C  
ATOM    400  O   GLY B  51      44.701 -14.540  23.293  1.00  0.79           O  
ATOM    401  N   GLN B  52      43.674 -16.488  23.700  1.00  0.78           N  
ATOM    402  CA  GLN B  52      44.315 -17.225  22.619  1.00  0.78           C  
ATOM    403  C   GLN B  52      43.908 -16.748  21.228  1.00  0.78           C  
ATOM    404  O   GLN B  52      44.434 -17.251  20.234  1.00  0.78           O  
ATOM    405  CB  GLN B  52      44.069 -18.766  22.754  1.00  0.78           C  
ATOM    406  CG  GLN B  52      45.377 -19.596  22.808  1.00  0.78           C  
ATOM    407  CD  GLN B  52      45.145 -21.105  22.896  1.00  0.78           C  
ATOM    408  OE1 GLN B  52      44.751 -21.655  23.929  1.00  0.78           O  
ATOM    409  NE2 GLN B  52      45.383 -21.834  21.779  1.00  0.78           N  
ATOM    410  N   LEU B  53      42.967 -15.798  21.103  1.00  0.85           N  
ATOM    411  CA  LEU B  53      42.434 -15.370  19.825  1.00  0.85           C  
ATOM    412  C   LEU B  53      42.822 -13.924  19.520  1.00  0.85           C  
ATOM    413  O   LEU B  53      42.293 -12.979  20.107  1.00  0.85           O  
ATOM    414  CB  LEU B  53      40.876 -15.424  19.811  1.00  0.85           C  
ATOM    415  CG  LEU B  53      40.172 -16.787  19.600  1.00  0.85           C  
ATOM    416  CD1 LEU B  53      40.537 -17.851  20.635  1.00  0.85           C  
ATOM    417  CD2 LEU B  53      38.647 -16.586  19.606  1.00  0.85           C  
ATOM    418  N   LEU B  54      43.700 -13.691  18.525  1.00  0.88           N  
ATOM    419  CA  LEU B  54      43.876 -12.369  17.951  1.00  0.88           C  
ATOM    420  C   LEU B  54      42.697 -12.074  17.036  1.00  0.88           C  
ATOM    421  O   LEU B  54      42.308 -12.926  16.239  1.00  0.88           O  
ATOM    422  CB  LEU B  54      45.186 -12.270  17.132  1.00  0.88           C  
ATOM    423  CG  LEU B  54      46.049 -11.008  17.321  1.00  0.88           C  
ATOM    424  CD1 LEU B  54      46.986 -10.863  16.128  1.00  0.88           C  
ATOM    425  CD2 LEU B  54      45.266  -9.709  17.493  1.00  0.88           C  
ATOM    426  N   LYS B  55      42.081 -10.889  17.126  1.00  0.85           N  
ATOM    427  CA  LYS B  55      40.928 -10.559  16.318  1.00  0.85           C  
ATOM    428  C   LYS B  55      41.171  -9.326  15.470  1.00  0.85           C  
ATOM    429  O   LYS B  55      41.709  -8.321  15.932  1.00  0.85           O  
ATOM    430  CB  LYS B  55      39.673 -10.292  17.176  1.00  0.85           C  
ATOM    431  CG  LYS B  55      39.245 -11.428  18.117  1.00  0.85           C  
ATOM    432  CD  LYS B  55      37.749 -11.277  18.416  1.00  0.85           C  
ATOM    433  CE  LYS B  55      37.113 -12.412  19.217  1.00  0.85           C  
ATOM    434  NZ  LYS B  55      37.080 -12.084  20.658  1.00  0.85           N  
ATOM    435  N   PHE B  56      40.761  -9.379  14.191  1.00  0.88           N  
ATOM    436  CA  PHE B  56      40.842  -8.257  13.278  1.00  0.88           C  
ATOM    437  C   PHE B  56      39.441  -8.016  12.746  1.00  0.88           C  
ATOM    438  O   PHE B  56      38.916  -8.830  11.983  1.00  0.88           O  
ATOM    439  CB  PHE B  56      41.739  -8.545  12.042  1.00  0.88           C  
ATOM    440  CG  PHE B  56      43.159  -8.911  12.376  1.00  0.88           C  
ATOM    441  CD1 PHE B  56      44.216  -8.034  12.075  1.00  0.88           C  
ATOM    442  CD2 PHE B  56      43.462 -10.184  12.889  1.00  0.88           C  
ATOM    443  CE1 PHE B  56      45.544  -8.417  12.305  1.00  0.88           C  
ATOM    444  CE2 PHE B  56      44.785 -10.565  13.128  1.00  0.88           C  
ATOM    445  CZ  PHE B  56      45.829  -9.681  12.829  1.00  0.88           C  
ATOM    446  N   LEU B  57      38.787  -6.908  13.128  1.00  0.87           N  
ATOM    447  CA  LEU B  57      37.395  -6.663  12.812  1.00  0.87           C  
ATOM    448  C   LEU B  57      37.167  -5.295  12.177  1.00  0.87           C  
ATOM    449  O   LEU B  57      36.997  -4.302  12.882  1.00  0.87           O  
ATOM    450  CB  LEU B  57      36.558  -6.739  14.111  1.00  0.87           C  
ATOM    451  CG  LEU B  57      36.588  -8.096  14.836  1.00  0.87           C  
ATOM    452  CD1 LEU B  57      35.676  -8.043  16.059  1.00  0.87           C  
ATOM    453  CD2 LEU B  57      36.159  -9.262  13.948  1.00  0.87           C  
ATOM    454  N   PRO B  58      37.088  -5.183  10.854  1.00  0.89           N  
ATOM    455  CA  PRO B  58      37.615  -6.125   9.879  1.00  0.89           C  
ATOM    456  C   PRO B  58      39.116  -5.959   9.683  1.00  0.89           C  
ATOM    457  O   PRO B  58      39.728  -4.993  10.141  1.00  0.89           O  
ATOM    458  CB  PRO B  58      36.885  -5.672   8.615  1.00  0.89           C  
ATOM    459  CG  PRO B  58      36.906  -4.148   8.719  1.00  0.89           C  
ATOM    460  CD  PRO B  58      36.748  -3.903  10.225  1.00  0.89           C  
ATOM    461  N   ALA B  59      39.735  -6.903   8.970  1.00  0.89           N  
ATOM    462  CA  ALA B  59      41.118  -6.834   8.580  1.00  0.89           C  
ATOM    463  C   ALA B  59      41.374  -5.878   7.406  1.00  0.89           C  
ATOM    464  O   ALA B  59      40.505  -5.645   6.557  1.00  0.89           O  
ATOM    465  CB  ALA B  59      41.560  -8.269   8.263  1.00  0.89           C  
ATOM    466  N   ALA B  60      42.579  -5.280   7.330  1.00  0.87           N  
ATOM    467  CA  ALA B  60      42.999  -4.457   6.215  1.00  0.87           C  
ATOM    468  C   ALA B  60      44.415  -4.830   5.814  1.00  0.87           C  
ATOM    469  O   ALA B  60      45.168  -5.422   6.579  1.00  0.87           O  
ATOM    470  CB  ALA B  60      42.963  -2.960   6.571  1.00  0.87           C  
ATOM    471  N   VAL B  61      44.850  -4.486   4.585  1.00  0.82           N  
ATOM    472  CA  VAL B  61      46.131  -4.948   4.044  1.00  0.82           C  
ATOM    473  C   VAL B  61      47.334  -4.392   4.800  1.00  0.82           C  
ATOM    474  O   VAL B  61      48.412  -4.985   4.845  1.00  0.82           O  
ATOM    475  CB  VAL B  61      46.250  -4.683   2.545  1.00  0.82           C  
ATOM    476  CG1 VAL B  61      44.970  -5.150   1.824  1.00  0.82           C  
ATOM    477  CG2 VAL B  61      46.514  -3.199   2.248  1.00  0.82           C  
ATOM    478  N   ALA B  62      47.136  -3.254   5.491  1.00  0.82           N  
ATOM    479  CA  ALA B  62      48.110  -2.613   6.342  1.00  0.82           C  
ATOM    480  C   ALA B  62      48.405  -3.414   7.596  1.00  0.82           C  
ATOM    481  O   ALA B  62      49.443  -3.238   8.222  1.00  0.82           O  
ATOM    482  CB  ALA B  62      47.563  -1.234   6.744  1.00  0.82           C  
ATOM    483  N   ASP B  63      47.519  -4.363   7.952  1.00  0.82           N  
ATOM    484  CA  ASP B  63      47.692  -5.171   9.136  1.00  0.82           C  
ATOM    485  C   ASP B  63      48.562  -6.396   8.879  1.00  0.82           C  
ATOM    486  O   ASP B  63      48.816  -7.195   9.776  1.00  0.82           O  
ATOM    487  CB  ASP B  63      46.352  -5.723   9.663  1.00  0.82           C  
ATOM    488  CG  ASP B  63      45.364  -4.642   9.969  1.00  0.82           C  
ATOM    489  OD1 ASP B  63      45.668  -3.661  10.701  1.00  0.82           O  
ATOM    490  OD2 ASP B  63      44.207  -4.753   9.475  1.00  0.82           O  
ATOM    491  N   SER B  64      49.074  -6.594   7.655  1.00  0.83           N  
ATOM    492  CA  SER B  64      50.035  -7.652   7.371  1.00  0.83           C  
ATOM    493  C   SER B  64      51.316  -7.504   8.181  1.00  0.83           C  
ATOM    494  O   SER B  64      51.787  -6.402   8.466  1.00  0.83           O  
ATOM    495  CB  SER B  64      50.425  -7.749   5.878  1.00  0.83           C  
ATOM    496  OG  SER B  64      49.266  -7.943   5.063  1.00  0.83           O  
ATOM    497  N   GLY B  65      51.912  -8.630   8.604  1.00  0.87           N  
ATOM    498  CA  GLY B  65      53.056  -8.599   9.501  1.00  0.87           C  
ATOM    499  C   GLY B  65      53.130  -9.836  10.337  1.00  0.87           C  
ATOM    500  O   GLY B  65      52.323 -10.751  10.200  1.00  0.87           O  
ATOM    501  N   ILE B  66      54.121  -9.914  11.243  1.00  0.81           N  
ATOM    502  CA  ILE B  66      54.220 -11.040  12.158  1.00  0.81           C  
ATOM    503  C   ILE B  66      53.713 -10.602  13.510  1.00  0.81           C  
ATOM    504  O   ILE B  66      54.137  -9.593  14.067  1.00  0.81           O  
ATOM    505  CB  ILE B  66      55.618 -11.642  12.279  1.00  0.81           C  
ATOM    506  CG1 ILE B  66      56.131 -12.072  10.887  1.00  0.81           C  
ATOM    507  CG2 ILE B  66      55.580 -12.851  13.241  1.00  0.81           C  
ATOM    508  CD1 ILE B  66      57.549 -12.654  10.891  1.00  0.81           C  
ATOM    509  N   TYR B  67      52.763 -11.362  14.069  1.00  0.80           N  
ATOM    510  CA  TYR B  67      52.161 -11.032  15.337  1.00  0.80           C  
ATOM    511  C   TYR B  67      52.599 -12.091  16.321  1.00  0.80           C  
ATOM    512  O   TYR B  67      52.229 -13.262  16.230  1.00  0.80           O  
ATOM    513  CB  TYR B  67      50.618 -10.970  15.246  1.00  0.80           C  
ATOM    514  CG  TYR B  67      50.176  -9.754  14.468  1.00  0.80           C  
ATOM    515  CD1 TYR B  67      49.544  -8.678  15.122  1.00  0.80           C  
ATOM    516  CD2 TYR B  67      50.372  -9.674  13.077  1.00  0.80           C  
ATOM    517  CE1 TYR B  67      49.078  -7.574  14.397  1.00  0.80           C  
ATOM    518  CE2 TYR B  67      49.943  -8.556  12.358  1.00  0.80           C  
ATOM    519  CZ  TYR B  67      49.269  -7.526  13.018  1.00  0.80           C  
ATOM    520  OH  TYR B  67      48.763  -6.447  12.291  1.00  0.80           O  
ATOM    521  N   THR B  68      53.457 -11.723  17.283  1.00  0.80           N  
ATOM    522  CA  THR B  68      53.973 -12.654  18.280  1.00  0.80           C  
ATOM    523  C   THR B  68      52.960 -12.793  19.412  1.00  0.80           C  
ATOM    524  O   THR B  68      52.234 -11.846  19.712  1.00  0.80           O  
ATOM    525  CB  THR B  68      55.411 -12.337  18.757  1.00  0.80           C  
ATOM    526  OG1 THR B  68      55.499 -11.924  20.119  1.00  0.80           O  
ATOM    527  CG2 THR B  68      56.028 -11.207  17.912  1.00  0.80           C  
ATOM    528  N   CYS B  69      52.881 -13.970  20.063  1.00  0.84           N  
ATOM    529  CA  CYS B  69      52.015 -14.204  21.208  1.00  0.84           C  
ATOM    530  C   CYS B  69      52.748 -14.974  22.281  1.00  0.84           C  
ATOM    531  O   CYS B  69      53.582 -15.833  21.994  1.00  0.84           O  
ATOM    532  CB  CYS B  69      50.684 -14.952  20.898  1.00  0.84           C  
ATOM    533  SG  CYS B  69      50.871 -16.625  20.176  1.00  0.84           S  
ATOM    534  N   ILE B  70      52.462 -14.675  23.562  1.00  0.82           N  
ATOM    535  CA  ILE B  70      53.118 -15.322  24.687  1.00  0.82           C  
ATOM    536  C   ILE B  70      52.065 -15.844  25.655  1.00  0.82           C  
ATOM    537  O   ILE B  70      51.243 -15.082  26.148  1.00  0.82           O  
ATOM    538  CB  ILE B  70      54.091 -14.407  25.447  1.00  0.82           C  
ATOM    539  CG1 ILE B  70      55.021 -13.607  24.501  1.00  0.82           C  
ATOM    540  CG2 ILE B  70      54.918 -15.269  26.425  1.00  0.82           C  
ATOM    541  CD1 ILE B  70      55.903 -12.570  25.208  1.00  0.82           C  
ATOM    542  N   VAL B  71      52.087 -17.158  25.965  1.00  0.81           N  
ATOM    543  CA  VAL B  71      51.217 -17.845  26.915  1.00  0.81           C  
ATOM    544  C   VAL B  71      51.984 -18.080  28.204  1.00  0.81           C  
ATOM    545  O   VAL B  71      53.035 -18.722  28.212  1.00  0.81           O  
ATOM    546  CB  VAL B  71      50.786 -19.222  26.406  1.00  0.81           C  
ATOM    547  CG1 VAL B  71      49.990 -20.018  27.462  1.00  0.81           C  
ATOM    548  CG2 VAL B  71      49.944 -19.081  25.132  1.00  0.81           C  
ATOM    549  N   ARG B  72      51.486 -17.568  29.342  1.00  0.71           N  
ATOM    550  CA  ARG B  72      52.227 -17.551  30.594  1.00  0.71           C  
ATOM    551  C   ARG B  72      51.472 -18.288  31.699  1.00  0.71           C  
ATOM    552  O   ARG B  72      50.295 -18.022  31.941  1.00  0.71           O  
ATOM    553  CB  ARG B  72      52.517 -16.081  31.028  1.00  0.71           C  
ATOM    554  CG  ARG B  72      52.629 -15.092  29.841  1.00  0.71           C  
ATOM    555  CD  ARG B  72      52.837 -13.613  30.212  1.00  0.71           C  
ATOM    556  NE  ARG B  72      54.267 -13.218  29.924  1.00  0.71           N  
ATOM    557  CZ  ARG B  72      54.635 -12.347  28.968  1.00  0.71           C  
ATOM    558  NH1 ARG B  72      53.777 -11.711  28.187  1.00  0.71           N  
ATOM    559  NH2 ARG B  72      55.932 -12.103  28.793  1.00  0.71           N  
ATOM    560  N   SER B  73      52.118 -19.260  32.383  1.00  0.75           N  
ATOM    561  CA  SER B  73      51.478 -20.035  33.456  1.00  0.75           C  
ATOM    562  C   SER B  73      51.560 -19.576  34.904  1.00  0.75           C  
ATOM    563  O   SER B  73      50.493 -19.630  35.512  1.00  0.75           O  
ATOM    564  CB  SER B  73      51.850 -21.527  33.432  1.00  0.75           C  
ATOM    565  OG  SER B  73      53.232 -21.673  33.197  1.00  0.75           O  
ATOM    566  N   PRO B  74      52.619 -19.149  35.590  1.00  0.72           N  
ATOM    567  CA  PRO B  74      53.966 -18.916  35.101  1.00  0.72           C  
ATOM    568  C   PRO B  74      54.961 -19.925  35.681  1.00  0.72           C  
ATOM    569  O   PRO B  74      55.891 -19.559  36.391  1.00  0.72           O  
ATOM    570  CB  PRO B  74      54.222 -17.500  35.641  1.00  0.72           C  
ATOM    571  CG  PRO B  74      53.480 -17.437  36.988  1.00  0.72           C  
ATOM    572  CD  PRO B  74      52.413 -18.529  36.898  1.00  0.72           C  
ATOM    573  N   THR B  75      54.835 -21.206  35.306  1.00  0.75           N  
ATOM    574  CA  THR B  75      55.870 -22.236  35.376  1.00  0.75           C  
ATOM    575  C   THR B  75      56.579 -22.287  34.034  1.00  0.75           C  
ATOM    576  O   THR B  75      57.564 -22.992  33.829  1.00  0.75           O  
ATOM    577  CB  THR B  75      55.299 -23.638  35.615  1.00  0.75           C  
ATOM    578  OG1 THR B  75      54.181 -23.920  34.773  1.00  0.75           O  
ATOM    579  CG2 THR B  75      54.797 -23.756  37.057  1.00  0.75           C  
ATOM    580  N   PHE B  76      56.071 -21.503  33.077  1.00  0.73           N  
ATOM    581  CA  PHE B  76      56.603 -21.362  31.755  1.00  0.73           C  
ATOM    582  C   PHE B  76      56.130 -20.058  31.133  1.00  0.73           C  
ATOM    583  O   PHE B  76      55.072 -19.521  31.476  1.00  0.73           O  
ATOM    584  CB  PHE B  76      56.206 -22.568  30.848  1.00  0.73           C  
ATOM    585  CG  PHE B  76      54.737 -22.934  30.859  1.00  0.73           C  
ATOM    586  CD1 PHE B  76      54.328 -24.128  31.478  1.00  0.73           C  
ATOM    587  CD2 PHE B  76      53.766 -22.146  30.211  1.00  0.73           C  
ATOM    588  CE1 PHE B  76      52.987 -24.528  31.454  1.00  0.73           C  
ATOM    589  CE2 PHE B  76      52.428 -22.556  30.154  1.00  0.73           C  
ATOM    590  CZ  PHE B  76      52.038 -23.747  30.782  1.00  0.73           C  
ATOM    591  N   ASN B  77      56.867 -19.540  30.133  1.00  0.79           N  
ATOM    592  CA  ASN B  77      56.271 -18.652  29.154  1.00  0.79           C  
ATOM    593  C   ASN B  77      56.443 -19.322  27.798  1.00  0.79           C  
ATOM    594  O   ASN B  77      57.554 -19.480  27.299  1.00  0.79           O  
ATOM    595  CB  ASN B  77      56.872 -17.221  29.098  1.00  0.79           C  
ATOM    596  CG  ASN B  77      57.255 -16.679  30.469  1.00  0.79           C  
ATOM    597  OD1 ASN B  77      58.321 -16.995  30.993  1.00  0.79           O  
ATOM    598  ND2 ASN B  77      56.427 -15.789  31.060  1.00  0.79           N  
ATOM    599  N   ARG B  78      55.354 -19.763  27.150  1.00  0.72           N  
ATOM    600  CA  ARG B  78      55.426 -20.358  25.828  1.00  0.72           C  
ATOM    601  C   ARG B  78      55.151 -19.265  24.821  1.00  0.72           C  
ATOM    602  O   ARG B  78      54.187 -18.526  24.952  1.00  0.72           O  
ATOM    603  CB  ARG B  78      54.375 -21.483  25.611  1.00  0.72           C  
ATOM    604  CG  ARG B  78      54.834 -22.926  25.908  1.00  0.72           C  
ATOM    605  CD  ARG B  78      55.281 -23.158  27.347  1.00  0.72           C  
ATOM    606  NE  ARG B  78      55.295 -24.632  27.665  1.00  0.72           N  
ATOM    607  CZ  ARG B  78      54.199 -25.356  27.947  1.00  0.72           C  
ATOM    608  NH1 ARG B  78      52.976 -24.848  27.843  1.00  0.72           N  
ATOM    609  NH2 ARG B  78      54.326 -26.627  28.325  1.00  0.72           N  
ATOM    610  N   THR B  79      55.984 -19.128  23.781  1.00  0.84           N  
ATOM    611  CA  THR B  79      55.850 -18.039  22.814  1.00  0.84           C  
ATOM    612  C   THR B  79      55.767 -18.587  21.401  1.00  0.84           C  
ATOM    613  O   THR B  79      56.501 -19.499  21.011  1.00  0.84           O  
ATOM    614  CB  THR B  79      56.862 -16.892  23.006  1.00  0.84           C  
ATOM    615  OG1 THR B  79      57.424 -16.387  21.796  1.00  0.84           O  
ATOM    616  CG2 THR B  79      58.011 -17.322  23.930  1.00  0.84           C  
ATOM    617  N   GLY B  80      54.793 -18.092  20.613  1.00  0.84           N  
ATOM    618  CA  GLY B  80      54.560 -18.512  19.244  1.00  0.84           C  
ATOM    619  C   GLY B  80      54.185 -17.335  18.410  1.00  0.84           C  
ATOM    620  O   GLY B  80      53.843 -16.277  18.918  1.00  0.84           O  
ATOM    621  N   TYR B  81      54.256 -17.466  17.083  1.00  0.80           N  
ATOM    622  CA  TYR B  81      54.153 -16.329  16.194  1.00  0.80           C  
ATOM    623  C   TYR B  81      53.092 -16.600  15.145  1.00  0.80           C  
ATOM    624  O   TYR B  81      52.942 -17.730  14.676  1.00  0.80           O  
ATOM    625  CB  TYR B  81      55.493 -16.026  15.450  1.00  0.80           C  
ATOM    626  CG  TYR B  81      56.698 -15.794  16.342  1.00  0.80           C  
ATOM    627  CD1 TYR B  81      57.412 -14.586  16.233  1.00  0.80           C  
ATOM    628  CD2 TYR B  81      57.206 -16.782  17.213  1.00  0.80           C  
ATOM    629  CE1 TYR B  81      58.570 -14.362  16.991  1.00  0.80           C  
ATOM    630  CE2 TYR B  81      58.335 -16.546  18.004  1.00  0.80           C  
ATOM    631  CZ  TYR B  81      59.018 -15.333  17.888  1.00  0.80           C  
ATOM    632  OH  TYR B  81      60.158 -15.083  18.671  1.00  0.80           O  
ATOM    633  N   ALA B  82      52.340 -15.579  14.725  1.00  0.79           N  
ATOM    634  CA  ALA B  82      51.458 -15.677  13.587  1.00  0.79           C  
ATOM    635  C   ALA B  82      52.004 -14.844  12.441  1.00  0.79           C  
ATOM    636  O   ALA B  82      52.131 -13.626  12.549  1.00  0.79           O  
ATOM    637  CB  ALA B  82      50.050 -15.196  13.967  1.00  0.79           C  
ATOM    638  N   ASN B  83      52.345 -15.477  11.303  1.00  0.82           N  
ATOM    639  CA  ASN B  83      52.751 -14.769  10.097  1.00  0.82           C  
ATOM    640  C   ASN B  83      51.472 -14.469   9.322  1.00  0.82           C  
ATOM    641  O   ASN B  83      50.706 -15.377   9.005  1.00  0.82           O  
ATOM    642  CB  ASN B  83      53.778 -15.638   9.314  1.00  0.82           C  
ATOM    643  CG  ASN B  83      54.402 -14.928   8.113  1.00  0.82           C  
ATOM    644  OD1 ASN B  83      54.080 -13.788   7.790  1.00  0.82           O  
ATOM    645  ND2 ASN B  83      55.363 -15.612   7.448  1.00  0.82           N  
ATOM    646  N   VAL B  84      51.150 -13.187   9.085  1.00  0.87           N  
ATOM    647  CA  VAL B  84      49.800 -12.801   8.698  1.00  0.87           C  
ATOM    648  C   VAL B  84      49.802 -11.889   7.489  1.00  0.87           C  
ATOM    649  O   VAL B  84      50.490 -10.869   7.469  1.00  0.87           O  
ATOM    650  CB  VAL B  84      49.052 -12.144   9.860  1.00  0.87           C  
ATOM    651  CG1 VAL B  84      47.691 -11.577   9.427  1.00  0.87           C  
ATOM    652  CG2 VAL B  84      48.830 -13.179  10.975  1.00  0.87           C  
ATOM    653  N   THR B  85      49.001 -12.229   6.449  1.00  0.85           N  
ATOM    654  CA  THR B  85      48.943 -11.443   5.212  1.00  0.85           C  
ATOM    655  C   THR B  85      47.512 -11.187   4.788  1.00  0.85           C  
ATOM    656  O   THR B  85      46.716 -12.114   4.638  1.00  0.85           O  
ATOM    657  CB  THR B  85      49.650 -12.086   4.020  1.00  0.85           C  
ATOM    658  OG1 THR B  85      50.951 -12.512   4.395  1.00  0.85           O  
ATOM    659  CG2 THR B  85      49.820 -11.078   2.872  1.00  0.85           C  
ATOM    660  N   ILE B  86      47.138  -9.910   4.564  1.00  0.83           N  
ATOM    661  CA  ILE B  86      45.801  -9.526   4.127  1.00  0.83           C  
ATOM    662  C   ILE B  86      45.857  -8.936   2.723  1.00  0.83           C  
ATOM    663  O   ILE B  86      46.776  -8.204   2.356  1.00  0.83           O  
ATOM    664  CB  ILE B  86      45.069  -8.619   5.119  1.00  0.83           C  
ATOM    665  CG1 ILE B  86      44.544  -9.421   6.327  1.00  0.83           C  
ATOM    666  CG2 ILE B  86      43.830  -7.965   4.480  1.00  0.83           C  
ATOM    667  CD1 ILE B  86      45.549  -9.650   7.448  1.00  0.83           C  
ATOM    668  N   TYR B  87      44.866  -9.294   1.879  1.00  0.79           N  
ATOM    669  CA  TYR B  87      44.883  -9.091   0.444  1.00  0.79           C  
ATOM    670  C   TYR B  87      43.719  -8.227  -0.031  1.00  0.79           C  
ATOM    671  O   TYR B  87      42.655  -8.163   0.582  1.00  0.79           O  
ATOM    672  CB  TYR B  87      44.730 -10.449  -0.292  1.00  0.79           C  
ATOM    673  CG  TYR B  87      45.893 -11.374  -0.066  1.00  0.79           C  
ATOM    674  CD1 TYR B  87      46.911 -11.505  -1.028  1.00  0.79           C  
ATOM    675  CD2 TYR B  87      45.950 -12.170   1.091  1.00  0.79           C  
ATOM    676  CE1 TYR B  87      47.963 -12.413  -0.832  1.00  0.79           C  
ATOM    677  CE2 TYR B  87      47.005 -13.067   1.290  1.00  0.79           C  
ATOM    678  CZ  TYR B  87      48.003 -13.197   0.323  1.00  0.79           C  
ATOM    679  OH  TYR B  87      49.040 -14.126   0.517  1.00  0.79           O  
ATOM    680  N   LYS B  88      43.897  -7.557  -1.185  1.00  0.73           N  
ATOM    681  CA  LYS B  88      42.859  -6.798  -1.862  1.00  0.73           C  
ATOM    682  C   LYS B  88      42.133  -7.699  -2.854  1.00  0.73           C  
ATOM    683  O   LYS B  88      42.764  -8.365  -3.672  1.00  0.73           O  
ATOM    684  CB  LYS B  88      43.543  -5.611  -2.592  1.00  0.73           C  
ATOM    685  CG  LYS B  88      42.688  -4.388  -2.960  1.00  0.73           C  
ATOM    686  CD  LYS B  88      41.771  -4.564  -4.173  1.00  0.73           C  
ATOM    687  CE  LYS B  88      41.172  -3.239  -4.634  1.00  0.73           C  
ATOM    688  NZ  LYS B  88      40.370  -2.672  -3.527  1.00  0.73           N  
ATOM    689  N   LYS B  89      40.788  -7.770  -2.807  1.00  0.68           N  
ATOM    690  CA  LYS B  89      39.995  -8.539  -3.761  1.00  0.68           C  
ATOM    691  C   LYS B  89      40.059  -7.962  -5.180  1.00  0.68           C  
ATOM    692  O   LYS B  89      39.824  -6.776  -5.407  1.00  0.68           O  
ATOM    693  CB  LYS B  89      38.528  -8.693  -3.279  1.00  0.68           C  
ATOM    694  CG  LYS B  89      38.029  -7.483  -2.476  1.00  0.68           C  
ATOM    695  CD  LYS B  89      36.552  -7.566  -2.059  1.00  0.68           C  
ATOM    696  CE  LYS B  89      36.220  -6.445  -1.072  1.00  0.68           C  
ATOM    697  NZ  LYS B  89      34.793  -6.453  -0.687  1.00  0.68           N  
ATOM    698  N   GLN B  90      40.415  -8.794  -6.180  1.00  0.61           N  
ATOM    699  CA  GLN B  90      40.972  -8.294  -7.431  1.00  0.61           C  
ATOM    700  C   GLN B  90      39.972  -8.127  -8.556  1.00  0.61           C  
ATOM    701  O   GLN B  90      40.292  -7.544  -9.588  1.00  0.61           O  
ATOM    702  CB  GLN B  90      42.113  -9.253  -7.874  1.00  0.61           C  
ATOM    703  CG  GLN B  90      43.329  -9.175  -6.922  1.00  0.61           C  
ATOM    704  CD  GLN B  90      44.342 -10.307  -7.096  1.00  0.61           C  
ATOM    705  OE1 GLN B  90      44.352 -11.093  -8.041  1.00  0.61           O  
ATOM    706  NE2 GLN B  90      45.289 -10.368  -6.129  1.00  0.61           N  
ATOM    707  N   SER B  91      38.722  -8.602  -8.372  1.00  0.67           N  
ATOM    708  CA  SER B  91      37.654  -8.560  -9.380  1.00  0.67           C  
ATOM    709  C   SER B  91      37.949  -9.511 -10.537  1.00  0.67           C  
ATOM    710  O   SER B  91      37.448  -9.425 -11.656  1.00  0.67           O  
ATOM    711  CB  SER B  91      37.286  -7.139  -9.867  1.00  0.67           C  
ATOM    712  OG  SER B  91      35.981  -7.115 -10.450  1.00  0.67           O  
ATOM    713  N   ASP B  92      38.783 -10.498 -10.206  1.00  0.68           N  
ATOM    714  CA  ASP B  92      39.116 -11.717 -10.881  1.00  0.68           C  
ATOM    715  C   ASP B  92      37.926 -12.641 -10.979  1.00  0.68           C  
ATOM    716  O   ASP B  92      37.710 -13.268 -12.013  1.00  0.68           O  
ATOM    717  CB  ASP B  92      40.260 -12.406 -10.072  1.00  0.68           C  
ATOM    718  CG  ASP B  92      40.099 -12.389  -8.541  1.00  0.68           C  
ATOM    719  OD1 ASP B  92      39.029 -11.966  -8.019  1.00  0.68           O  
ATOM    720  OD2 ASP B  92      41.083 -12.744  -7.857  1.00  0.68           O  
ATOM    721  N   CYS B  93      37.172 -12.770  -9.861  1.00  0.71           N  
ATOM    722  CA  CYS B  93      35.949 -13.552  -9.691  1.00  0.71           C  
ATOM    723  C   CYS B  93      36.309 -14.966  -9.275  1.00  0.71           C  
ATOM    724  O   CYS B  93      35.591 -15.651  -8.545  1.00  0.71           O  
ATOM    725  CB  CYS B  93      35.014 -13.513 -10.933  1.00  0.71           C  
ATOM    726  SG  CYS B  93      33.243 -13.899 -10.668  1.00  0.71           S  
ATOM    727  N   ASN B  94      37.509 -15.394  -9.694  1.00  0.75           N  
ATOM    728  CA  ASN B  94      38.135 -16.649  -9.382  1.00  0.75           C  
ATOM    729  C   ASN B  94      39.100 -16.454  -8.243  1.00  0.75           C  
ATOM    730  O   ASN B  94      40.139 -15.824  -8.402  1.00  0.75           O  
ATOM    731  CB  ASN B  94      38.973 -17.155 -10.577  1.00  0.75           C  
ATOM    732  CG  ASN B  94      38.054 -17.444 -11.750  1.00  0.75           C  
ATOM    733  OD1 ASN B  94      37.018 -18.095 -11.616  1.00  0.75           O  
ATOM    734  ND2 ASN B  94      38.442 -16.961 -12.953  1.00  0.75           N  
ATOM    735  N   VAL B  95      38.793 -17.023  -7.070  1.00  0.76           N  
ATOM    736  CA  VAL B  95      39.663 -17.016  -5.913  1.00  0.76           C  
ATOM    737  C   VAL B  95      41.074 -17.527  -6.232  1.00  0.76           C  
ATOM    738  O   VAL B  95      41.176 -18.646  -6.734  1.00  0.76           O  
ATOM    739  CB  VAL B  95      39.080 -17.897  -4.814  1.00  0.76           C  
ATOM    740  CG1 VAL B  95      39.706 -17.482  -3.473  1.00  0.76           C  
ATOM    741  CG2 VAL B  95      37.538 -17.791  -4.807  1.00  0.76           C  
ATOM    742  N   PRO B  96      42.172 -16.803  -6.001  1.00  0.75           N  
ATOM    743  CA  PRO B  96      43.512 -17.320  -6.271  1.00  0.75           C  
ATOM    744  C   PRO B  96      43.853 -18.537  -5.426  1.00  0.75           C  
ATOM    745  O   PRO B  96      43.263 -18.703  -4.359  1.00  0.75           O  
ATOM    746  CB  PRO B  96      44.425 -16.121  -5.970  1.00  0.75           C  
ATOM    747  CG  PRO B  96      43.548 -14.895  -6.222  1.00  0.75           C  
ATOM    748  CD  PRO B  96      42.174 -15.356  -5.752  1.00  0.75           C  
ATOM    749  N   ASP B  97      44.824 -19.373  -5.856  1.00  0.74           N  
ATOM    750  CA  ASP B  97      45.217 -20.636  -5.235  1.00  0.74           C  
ATOM    751  C   ASP B  97      45.599 -20.562  -3.750  1.00  0.74           C  
ATOM    752  O   ASP B  97      45.697 -21.568  -3.054  1.00  0.74           O  
ATOM    753  CB  ASP B  97      46.419 -21.208  -6.042  1.00  0.74           C  
ATOM    754  CG  ASP B  97      45.989 -22.264  -7.047  1.00  0.74           C  
ATOM    755  OD1 ASP B  97      46.653 -23.330  -7.085  1.00  0.74           O  
ATOM    756  OD2 ASP B  97      45.039 -21.987  -7.817  1.00  0.74           O  
ATOM    757  N   TYR B  98      45.784 -19.359  -3.185  1.00  0.71           N  
ATOM    758  CA  TYR B  98      46.054 -19.180  -1.779  1.00  0.71           C  
ATOM    759  C   TYR B  98      44.791 -18.877  -0.984  1.00  0.71           C  
ATOM    760  O   TYR B  98      44.682 -17.851  -0.314  1.00  0.71           O  
ATOM    761  CB  TYR B  98      47.162 -18.127  -1.508  1.00  0.71           C  
ATOM    762  CG  TYR B  98      47.103 -16.938  -2.431  1.00  0.71           C  
ATOM    763  CD1 TYR B  98      46.477 -15.738  -2.053  1.00  0.71           C  
ATOM    764  CD2 TYR B  98      47.747 -17.008  -3.678  1.00  0.71           C  
ATOM    765  CE1 TYR B  98      46.482 -14.635  -2.919  1.00  0.71           C  
ATOM    766  CE2 TYR B  98      47.753 -15.907  -4.544  1.00  0.71           C  
ATOM    767  CZ  TYR B  98      47.112 -14.722  -4.162  1.00  0.71           C  
ATOM    768  OH  TYR B  98      47.092 -13.610  -5.026  1.00  0.71           O  
ATOM    769  N   LEU B  99      43.819 -19.805  -0.997  1.00  0.63           N  
ATOM    770  CA  LEU B  99      42.806 -19.918   0.029  1.00  0.63           C  
ATOM    771  C   LEU B  99      42.610 -21.403   0.289  1.00  0.63           C  
ATOM    772  O   LEU B  99      42.326 -22.187  -0.611  1.00  0.63           O  
ATOM    773  CB  LEU B  99      41.471 -19.198  -0.311  1.00  0.63           C  
ATOM    774  CG  LEU B  99      40.918 -18.259   0.797  1.00  0.63           C  
ATOM    775  CD1 LEU B  99      41.742 -16.987   0.997  1.00  0.63           C  
ATOM    776  CD2 LEU B  99      39.485 -17.802   0.509  1.00  0.63           C  
ATOM    777  N   MET B 100      42.780 -21.800   1.558  1.00  0.64           N  
ATOM    778  CA  MET B 100      42.688 -23.144   2.100  1.00  0.64           C  
ATOM    779  C   MET B 100      43.207 -24.340   1.291  1.00  0.64           C  
ATOM    780  O   MET B 100      44.281 -24.264   0.702  1.00  0.64           O  
ATOM    781  CB  MET B 100      41.352 -23.332   2.855  1.00  0.64           C  
ATOM    782  CG  MET B 100      41.475 -22.763   4.280  1.00  0.64           C  
ATOM    783  SD  MET B 100      41.543 -20.953   4.413  1.00  0.64           S  
ATOM    784  CE  MET B 100      42.527 -21.063   5.931  1.00  0.64           C  
ATOM    785  N   TYR B 101      42.543 -25.519   1.340  1.00  0.63           N  
ATOM    786  CA  TYR B 101      43.122 -26.735   0.788  1.00  0.63           C  
ATOM    787  C   TYR B 101      42.111 -27.787   0.361  1.00  0.63           C  
ATOM    788  O   TYR B 101      41.024 -27.930   0.953  1.00  0.63           O  
ATOM    789  CB  TYR B 101      44.206 -27.391   1.701  1.00  0.63           C  
ATOM    790  CG  TYR B 101      43.680 -28.016   2.971  1.00  0.63           C  
ATOM    791  CD1 TYR B 101      43.777 -29.406   3.150  1.00  0.63           C  
ATOM    792  CD2 TYR B 101      43.120 -27.237   3.996  1.00  0.63           C  
ATOM    793  CE1 TYR B 101      43.284 -30.012   4.314  1.00  0.63           C  
ATOM    794  CE2 TYR B 101      42.640 -27.837   5.168  1.00  0.63           C  
ATOM    795  CZ  TYR B 101      42.706 -29.228   5.316  1.00  0.63           C  
ATOM    796  OH  TYR B 101      42.165 -29.837   6.464  1.00  0.63           O  
ATOM    797  N   SER B 102      42.467 -28.540  -0.689  1.00  0.71           N  
ATOM    798  CA  SER B 102      41.651 -29.473  -1.438  1.00  0.71           C  
ATOM    799  C   SER B 102      41.023 -30.626  -0.670  1.00  0.71           C  
ATOM    800  O   SER B 102      41.599 -31.194   0.253  1.00  0.71           O  
ATOM    801  CB  SER B 102      42.425 -30.037  -2.665  1.00  0.71           C  
ATOM    802  OG  SER B 102      43.803 -29.648  -2.610  1.00  0.71           O  
ATOM    803  N   THR B 103      39.801 -31.008  -1.088  1.00  0.69           N  
ATOM    804  CA  THR B 103      38.920 -31.932  -0.384  1.00  0.69           C  
ATOM    805  C   THR B 103      38.319 -32.871  -1.410  1.00  0.69           C  
ATOM    806  O   THR B 103      38.010 -32.461  -2.527  1.00  0.69           O  
ATOM    807  CB  THR B 103      37.807 -31.164   0.324  1.00  0.69           C  
ATOM    808  OG1 THR B 103      38.331 -30.531   1.483  1.00  0.69           O  
ATOM    809  CG2 THR B 103      36.639 -32.037   0.795  1.00  0.69           C  
ATOM    810  N   VAL B 104      38.157 -34.173  -1.095  1.00  0.60           N  
ATOM    811  CA  VAL B 104      37.711 -35.185  -2.047  1.00  0.60           C  
ATOM    812  C   VAL B 104      36.349 -35.737  -1.659  1.00  0.60           C  
ATOM    813  O   VAL B 104      35.955 -35.670  -0.497  1.00  0.60           O  
ATOM    814  CB  VAL B 104      38.693 -36.355  -2.195  1.00  0.60           C  
ATOM    815  CG1 VAL B 104      40.095 -35.790  -2.469  1.00  0.60           C  
ATOM    816  CG2 VAL B 104      38.690 -37.240  -0.934  1.00  0.60           C  
ATOM    817  N   SER B 105      35.601 -36.346  -2.600  1.00  0.61           N  
ATOM    818  CA  SER B 105      34.331 -36.984  -2.265  1.00  0.61           C  
ATOM    819  C   SER B 105      33.990 -38.063  -3.268  1.00  0.61           C  
ATOM    820  O   SER B 105      34.549 -38.091  -4.353  1.00  0.61           O  
ATOM    821  CB  SER B 105      33.171 -35.961  -2.105  1.00  0.61           C  
ATOM    822  OG  SER B 105      32.230 -35.928  -3.184  1.00  0.61           O  
ATOM    823  N   GLY B 106      33.088 -39.012  -2.953  1.00  0.59           N  
ATOM    824  CA  GLY B 106      32.585 -39.962  -3.947  1.00  0.59           C  
ATOM    825  C   GLY B 106      31.477 -39.367  -4.763  1.00  0.59           C  
ATOM    826  O   GLY B 106      31.134 -38.218  -4.560  1.00  0.59           O  
ATOM    827  N   SER B 107      30.852 -40.164  -5.661  1.00  0.58           N  
ATOM    828  CA  SER B 107      29.777 -39.719  -6.570  1.00  0.58           C  
ATOM    829  C   SER B 107      28.515 -39.315  -5.799  1.00  0.58           C  
ATOM    830  O   SER B 107      28.445 -38.248  -5.211  1.00  0.58           O  
ATOM    831  CB  SER B 107      29.497 -40.835  -7.622  1.00  0.58           C  
ATOM    832  OG  SER B 107      28.677 -40.413  -8.703  1.00  0.58           O  
ATOM    833  N   GLU B 108      27.527 -40.198  -5.585  1.00  0.56           N  
ATOM    834  CA  GLU B 108      26.546 -39.928  -4.529  1.00  0.56           C  
ATOM    835  C   GLU B 108      27.083 -40.477  -3.202  1.00  0.56           C  
ATOM    836  O   GLU B 108      26.433 -40.524  -2.163  1.00  0.56           O  
ATOM    837  CB  GLU B 108      25.184 -40.596  -4.836  1.00  0.56           C  
ATOM    838  CG  GLU B 108      24.717 -40.432  -6.308  1.00  0.56           C  
ATOM    839  CD  GLU B 108      23.329 -39.802  -6.480  1.00  0.56           C  
ATOM    840  OE1 GLU B 108      22.414 -40.149  -5.690  1.00  0.56           O  
ATOM    841  OE2 GLU B 108      23.158 -39.029  -7.460  1.00  0.56           O  
ATOM    842  N   LYS B 109      28.343 -40.952  -3.246  1.00  0.69           N  
ATOM    843  CA  LYS B 109      28.930 -41.869  -2.297  1.00  0.69           C  
ATOM    844  C   LYS B 109      29.707 -41.166  -1.190  1.00  0.69           C  
ATOM    845  O   LYS B 109      29.954 -41.734  -0.125  1.00  0.69           O  
ATOM    846  CB  LYS B 109      29.854 -42.831  -3.100  1.00  0.69           C  
ATOM    847  CG  LYS B 109      29.153 -43.505  -4.304  1.00  0.69           C  
ATOM    848  CD  LYS B 109      30.033 -44.529  -5.054  1.00  0.69           C  
ATOM    849  CE  LYS B 109      29.310 -45.261  -6.197  1.00  0.69           C  
ATOM    850  NZ  LYS B 109      30.122 -46.395  -6.708  1.00  0.69           N  
ATOM    851  N   ASN B 110      30.061 -39.881  -1.377  1.00  0.72           N  
ATOM    852  CA  ASN B 110      30.360 -39.003  -0.260  1.00  0.72           C  
ATOM    853  C   ASN B 110      30.078 -37.591  -0.667  1.00  0.72           C  
ATOM    854  O   ASN B 110      30.415 -37.195  -1.773  1.00  0.72           O  
ATOM    855  CB  ASN B 110      31.814 -39.117   0.269  1.00  0.72           C  
ATOM    856  CG  ASN B 110      31.767 -39.424   1.758  1.00  0.72           C  
ATOM    857  OD1 ASN B 110      31.924 -38.535   2.599  1.00  0.72           O  
ATOM    858  ND2 ASN B 110      31.505 -40.704   2.089  1.00  0.72           N  
ATOM    859  N   SER B 111      29.446 -36.802   0.202  1.00  0.71           N  
ATOM    860  CA  SER B 111      28.767 -35.603  -0.267  1.00  0.71           C  
ATOM    861  C   SER B 111      29.268 -34.330   0.357  1.00  0.71           C  
ATOM    862  O   SER B 111      28.752 -33.262   0.052  1.00  0.71           O  
ATOM    863  CB  SER B 111      27.263 -35.672   0.115  1.00  0.71           C  
ATOM    864  OG  SER B 111      26.704 -36.960  -0.131  1.00  0.71           O  
ATOM    865  N   LYS B 112      30.250 -34.384   1.277  1.00  0.76           N  
ATOM    866  CA  LYS B 112      30.424 -33.306   2.246  1.00  0.76           C  
ATOM    867  C   LYS B 112      31.634 -32.402   2.063  1.00  0.76           C  
ATOM    868  O   LYS B 112      32.786 -32.824   2.130  1.00  0.76           O  
ATOM    869  CB  LYS B 112      30.453 -33.848   3.704  1.00  0.76           C  
ATOM    870  CG  LYS B 112      29.067 -33.920   4.366  1.00  0.76           C  
ATOM    871  CD  LYS B 112      29.145 -33.840   5.901  1.00  0.76           C  
ATOM    872  CE  LYS B 112      29.600 -35.114   6.614  1.00  0.76           C  
ATOM    873  NZ  LYS B 112      28.452 -36.028   6.798  1.00  0.76           N  
ATOM    874  N   ILE B 113      31.375 -31.085   1.926  1.00  0.83           N  
ATOM    875  CA  ILE B 113      32.414 -30.064   1.890  1.00  0.83           C  
ATOM    876  C   ILE B 113      32.309 -29.191   3.125  1.00  0.83           C  
ATOM    877  O   ILE B 113      31.365 -28.425   3.286  1.00  0.83           O  
ATOM    878  CB  ILE B 113      32.320 -29.166   0.654  1.00  0.83           C  
ATOM    879  CG1 ILE B 113      32.195 -30.032  -0.614  1.00  0.83           C  
ATOM    880  CG2 ILE B 113      33.541 -28.219   0.583  1.00  0.83           C  
ATOM    881  CD1 ILE B 113      32.076 -29.243  -1.919  1.00  0.83           C  
ATOM    882  N   TYR B 114      33.281 -29.273   4.055  1.00  0.84           N  
ATOM    883  CA  TYR B 114      33.298 -28.409   5.227  1.00  0.84           C  
ATOM    884  C   TYR B 114      33.798 -27.005   4.945  1.00  0.84           C  
ATOM    885  O   TYR B 114      34.754 -26.803   4.190  1.00  0.84           O  
ATOM    886  CB  TYR B 114      34.167 -29.005   6.359  1.00  0.84           C  
ATOM    887  CG  TYR B 114      33.373 -30.062   7.064  1.00  0.84           C  
ATOM    888  CD1 TYR B 114      32.474 -29.682   8.072  1.00  0.84           C  
ATOM    889  CD2 TYR B 114      33.470 -31.416   6.705  1.00  0.84           C  
ATOM    890  CE1 TYR B 114      31.661 -30.640   8.694  1.00  0.84           C  
ATOM    891  CE2 TYR B 114      32.663 -32.376   7.335  1.00  0.84           C  
ATOM    892  CZ  TYR B 114      31.758 -31.986   8.329  1.00  0.84           C  
ATOM    893  OH  TYR B 114      30.973 -32.954   8.984  1.00  0.84           O  
ATOM    894  N   CYS B 115      33.175 -25.999   5.595  1.00  0.86           N  
ATOM    895  CA  CYS B 115      33.610 -24.614   5.543  1.00  0.86           C  
ATOM    896  C   CYS B 115      34.845 -24.434   6.425  1.00  0.86           C  
ATOM    897  O   CYS B 115      34.753 -24.678   7.632  1.00  0.86           O  
ATOM    898  CB  CYS B 115      32.490 -23.651   6.009  1.00  0.86           C  
ATOM    899  SG  CYS B 115      32.842 -21.877   5.730  1.00  0.86           S  
ATOM    900  N   PRO B 116      36.025 -24.081   5.920  1.00  0.86           N  
ATOM    901  CA  PRO B 116      37.228 -24.018   6.740  1.00  0.86           C  
ATOM    902  C   PRO B 116      37.210 -22.928   7.784  1.00  0.86           C  
ATOM    903  O   PRO B 116      36.488 -21.955   7.609  1.00  0.86           O  
ATOM    904  CB  PRO B 116      38.348 -23.736   5.740  1.00  0.86           C  
ATOM    905  CG  PRO B 116      37.798 -24.104   4.365  1.00  0.86           C  
ATOM    906  CD  PRO B 116      36.309 -23.828   4.504  1.00  0.86           C  
ATOM    907  N   THR B 117      37.998 -23.093   8.871  1.00  0.85           N  
ATOM    908  CA  THR B 117      38.289 -22.073   9.891  1.00  0.85           C  
ATOM    909  C   THR B 117      37.109 -21.625  10.735  1.00  0.85           C  
ATOM    910  O   THR B 117      37.290 -20.914  11.719  1.00  0.85           O  
ATOM    911  CB  THR B 117      39.088 -20.844   9.429  1.00  0.85           C  
ATOM    912  OG1 THR B 117      38.296 -19.913   8.705  1.00  0.85           O  
ATOM    913  CG2 THR B 117      40.232 -21.270   8.510  1.00  0.85           C  
ATOM    914  N   ILE B 118      35.884 -22.077  10.408  1.00  0.83           N  
ATOM    915  CA  ILE B 118      34.614 -21.612  10.940  1.00  0.83           C  
ATOM    916  C   ILE B 118      34.499 -21.673  12.468  1.00  0.83           C  
ATOM    917  O   ILE B 118      33.928 -20.789  13.098  1.00  0.83           O  
ATOM    918  CB  ILE B 118      33.467 -22.276  10.178  1.00  0.83           C  
ATOM    919  CG1 ILE B 118      32.222 -21.372  10.215  1.00  0.83           C  
ATOM    920  CG2 ILE B 118      33.212 -23.708  10.676  1.00  0.83           C  
ATOM    921  CD1 ILE B 118      30.987 -21.898   9.484  1.00  0.83           C  
ATOM    922  N   ASP B 119      35.146 -22.673  13.100  1.00  0.80           N  
ATOM    923  CA  ASP B 119      35.309 -22.864  14.537  1.00  0.80           C  
ATOM    924  C   ASP B 119      35.918 -21.667  15.283  1.00  0.80           C  
ATOM    925  O   ASP B 119      35.559 -21.349  16.413  1.00  0.80           O  
ATOM    926  CB  ASP B 119      36.219 -24.110  14.657  1.00  0.80           C  
ATOM    927  CG  ASP B 119      36.271 -24.723  16.043  1.00  0.80           C  
ATOM    928  OD1 ASP B 119      35.544 -25.725  16.241  1.00  0.80           O  
ATOM    929  OD2 ASP B 119      37.077 -24.249  16.887  1.00  0.80           O  
ATOM    930  N   LEU B 120      36.846 -20.927  14.635  1.00  0.83           N  
ATOM    931  CA  LEU B 120      37.492 -19.765  15.221  1.00  0.83           C  
ATOM    932  C   LEU B 120      36.544 -18.586  15.440  1.00  0.83           C  
ATOM    933  O   LEU B 120      36.825 -17.675  16.220  1.00  0.83           O  
ATOM    934  CB  LEU B 120      38.616 -19.224  14.291  1.00  0.83           C  
ATOM    935  CG  LEU B 120      39.776 -20.166  13.915  1.00  0.83           C  
ATOM    936  CD1 LEU B 120      40.856 -19.368  13.178  1.00  0.83           C  
ATOM    937  CD2 LEU B 120      40.394 -20.847  15.131  1.00  0.83           C  
ATOM    938  N   TYR B 121      35.412 -18.568  14.720  1.00  0.84           N  
ATOM    939  CA  TYR B 121      34.509 -17.445  14.642  1.00  0.84           C  
ATOM    940  C   TYR B 121      33.227 -17.735  15.397  1.00  0.84           C  
ATOM    941  O   TYR B 121      32.885 -18.869  15.715  1.00  0.84           O  
ATOM    942  CB  TYR B 121      34.111 -17.147  13.175  1.00  0.84           C  
ATOM    943  CG  TYR B 121      35.312 -16.818  12.328  1.00  0.84           C  
ATOM    944  CD1 TYR B 121      35.700 -15.491  12.082  1.00  0.84           C  
ATOM    945  CD2 TYR B 121      36.074 -17.853  11.766  1.00  0.84           C  
ATOM    946  CE1 TYR B 121      36.863 -15.210  11.350  1.00  0.84           C  
ATOM    947  CE2 TYR B 121      37.249 -17.577  11.060  1.00  0.84           C  
ATOM    948  CZ  TYR B 121      37.659 -16.257  10.882  1.00  0.84           C  
ATOM    949  OH  TYR B 121      38.885 -15.984  10.259  1.00  0.84           O  
ATOM    950  N   ASN B 122      32.449 -16.684  15.686  1.00  0.80           N  
ATOM    951  CA  ASN B 122      31.170 -16.800  16.345  1.00  0.80           C  
ATOM    952  C   ASN B 122      30.058 -16.578  15.330  1.00  0.80           C  
ATOM    953  O   ASN B 122      29.754 -15.456  14.925  1.00  0.80           O  
ATOM    954  CB  ASN B 122      31.128 -15.743  17.467  1.00  0.80           C  
ATOM    955  CG  ASN B 122      29.806 -15.733  18.223  1.00  0.80           C  
ATOM    956  OD1 ASN B 122      29.281 -16.761  18.644  1.00  0.80           O  
ATOM    957  ND2 ASN B 122      29.238 -14.520  18.400  1.00  0.80           N  
ATOM    958  N   TRP B 123      29.414 -17.677  14.921  1.00  0.76           N  
ATOM    959  CA  TRP B 123      28.400 -17.702  13.894  1.00  0.76           C  
ATOM    960  C   TRP B 123      27.198 -18.477  14.410  1.00  0.76           C  
ATOM    961  O   TRP B 123      27.309 -19.613  14.861  1.00  0.76           O  
ATOM    962  CB  TRP B 123      28.944 -18.349  12.588  1.00  0.76           C  
ATOM    963  CG  TRP B 123      29.530 -19.739  12.759  1.00  0.76           C  
ATOM    964  CD1 TRP B 123      30.708 -20.097  13.352  1.00  0.76           C  
ATOM    965  CD2 TRP B 123      28.866 -20.964  12.402  1.00  0.76           C  
ATOM    966  NE1 TRP B 123      30.805 -21.466  13.432  1.00  0.76           N  
ATOM    967  CE2 TRP B 123      29.698 -22.017  12.835  1.00  0.76           C  
ATOM    968  CE3 TRP B 123      27.649 -21.220  11.770  1.00  0.76           C  
ATOM    969  CZ2 TRP B 123      29.341 -23.339  12.629  1.00  0.76           C  
ATOM    970  CZ3 TRP B 123      27.293 -22.560  11.553  1.00  0.76           C  
ATOM    971  CH2 TRP B 123      28.128 -23.605  11.976  1.00  0.76           C  
ATOM    972  N   THR B 124      25.998 -17.876  14.375  1.00  0.62           N  
ATOM    973  CA  THR B 124      24.771 -18.551  14.807  1.00  0.62           C  
ATOM    974  C   THR B 124      23.834 -18.804  13.642  1.00  0.62           C  
ATOM    975  O   THR B 124      22.698 -19.238  13.822  1.00  0.62           O  
ATOM    976  CB  THR B 124      24.001 -17.763  15.867  1.00  0.62           C  
ATOM    977  OG1 THR B 124      23.771 -16.420  15.443  1.00  0.62           O  
ATOM    978  CG2 THR B 124      24.821 -17.708  17.167  1.00  0.62           C  
ATOM    979  N   ALA B 125      24.291 -18.554  12.401  1.00  0.65           N  
ATOM    980  CA  ALA B 125      23.435 -18.513  11.237  1.00  0.65           C  
ATOM    981  C   ALA B 125      23.767 -19.603  10.217  1.00  0.65           C  
ATOM    982  O   ALA B 125      24.943 -19.945  10.073  1.00  0.65           O  
ATOM    983  CB  ALA B 125      23.587 -17.155  10.523  1.00  0.65           C  
ATOM    984  N   PRO B 126      22.804 -20.170   9.473  1.00  0.78           N  
ATOM    985  CA  PRO B 126      23.045 -20.777   8.157  1.00  0.78           C  
ATOM    986  C   PRO B 126      23.878 -19.934   7.199  1.00  0.78           C  
ATOM    987  O   PRO B 126      23.633 -18.735   7.076  1.00  0.78           O  
ATOM    988  CB  PRO B 126      21.633 -21.046   7.597  1.00  0.78           C  
ATOM    989  CG  PRO B 126      20.714 -20.094   8.362  1.00  0.78           C  
ATOM    990  CD  PRO B 126      21.366 -20.037   9.736  1.00  0.78           C  
ATOM    991  N   LEU B 127      24.861 -20.550   6.511  1.00  0.82           N  
ATOM    992  CA  LEU B 127      25.770 -19.867   5.606  1.00  0.82           C  
ATOM    993  C   LEU B 127      25.556 -20.115   4.112  1.00  0.82           C  
ATOM    994  O   LEU B 127      24.888 -21.053   3.676  1.00  0.82           O  
ATOM    995  CB  LEU B 127      27.278 -20.048   5.961  1.00  0.82           C  
ATOM    996  CG  LEU B 127      27.835 -21.340   6.607  1.00  0.82           C  
ATOM    997  CD1 LEU B 127      27.651 -21.347   8.129  1.00  0.82           C  
ATOM    998  CD2 LEU B 127      27.348 -22.635   5.958  1.00  0.82           C  
ATOM    999  N   GLU B 128      26.140 -19.217   3.285  1.00  0.79           N  
ATOM   1000  CA  GLU B 128      25.966 -19.153   1.847  1.00  0.79           C  
ATOM   1001  C   GLU B 128      27.109 -19.870   1.150  1.00  0.79           C  
ATOM   1002  O   GLU B 128      28.262 -19.750   1.563  1.00  0.79           O  
ATOM   1003  CB  GLU B 128      25.998 -17.680   1.351  1.00  0.79           C  
ATOM   1004  CG  GLU B 128      25.026 -16.714   2.075  1.00  0.79           C  
ATOM   1005  CD  GLU B 128      25.351 -15.246   1.809  1.00  0.79           C  
ATOM   1006  OE1 GLU B 128      25.580 -14.847   0.634  1.00  0.79           O  
ATOM   1007  OE2 GLU B 128      25.425 -14.475   2.800  1.00  0.79           O  
ATOM   1008  N   TRP B 129      26.845 -20.618   0.060  1.00  0.83           N  
ATOM   1009  CA  TRP B 129      27.905 -21.286  -0.669  1.00  0.83           C  
ATOM   1010  C   TRP B 129      27.901 -20.871  -2.125  1.00  0.83           C  
ATOM   1011  O   TRP B 129      26.855 -20.741  -2.764  1.00  0.83           O  
ATOM   1012  CB  TRP B 129      27.815 -22.824  -0.590  1.00  0.83           C  
ATOM   1013  CG  TRP B 129      28.001 -23.399   0.795  1.00  0.83           C  
ATOM   1014  CD1 TRP B 129      27.094 -23.519   1.810  1.00  0.83           C  
ATOM   1015  CD2 TRP B 129      29.229 -23.974   1.274  1.00  0.83           C  
ATOM   1016  NE1 TRP B 129      27.671 -24.150   2.890  1.00  0.83           N  
ATOM   1017  CE2 TRP B 129      28.985 -24.412   2.592  1.00  0.83           C  
ATOM   1018  CE3 TRP B 129      30.478 -24.139   0.675  1.00  0.83           C  
ATOM   1019  CZ2 TRP B 129      29.986 -25.004   3.342  1.00  0.83           C  
ATOM   1020  CZ3 TRP B 129      31.486 -24.756   1.429  1.00  0.83           C  
ATOM   1021  CH2 TRP B 129      31.240 -25.179   2.741  1.00  0.83           C  
ATOM   1022  N   PHE B 130      29.105 -20.669  -2.680  1.00  0.84           N  
ATOM   1023  CA  PHE B 130      29.333 -20.275  -4.053  1.00  0.84           C  
ATOM   1024  C   PHE B 130      30.314 -21.249  -4.688  1.00  0.84           C  
ATOM   1025  O   PHE B 130      31.376 -21.520  -4.136  1.00  0.84           O  
ATOM   1026  CB  PHE B 130      29.940 -18.847  -4.153  1.00  0.84           C  
ATOM   1027  CG  PHE B 130      29.100 -17.863  -3.396  1.00  0.84           C  
ATOM   1028  CD1 PHE B 130      27.947 -17.307  -3.969  1.00  0.84           C  
ATOM   1029  CD2 PHE B 130      29.439 -17.524  -2.076  1.00  0.84           C  
ATOM   1030  CE1 PHE B 130      27.122 -16.455  -3.226  1.00  0.84           C  
ATOM   1031  CE2 PHE B 130      28.610 -16.685  -1.326  1.00  0.84           C  
ATOM   1032  CZ  PHE B 130      27.447 -16.157  -1.898  1.00  0.84           C  
ATOM   1033  N   LYS B 131      30.022 -21.803  -5.877  1.00  0.80           N  
ATOM   1034  CA  LYS B 131      31.018 -22.539  -6.653  1.00  0.80           C  
ATOM   1035  C   LYS B 131      31.494 -21.619  -7.749  1.00  0.80           C  
ATOM   1036  O   LYS B 131      30.694 -21.226  -8.592  1.00  0.80           O  
ATOM   1037  CB  LYS B 131      30.448 -23.830  -7.308  1.00  0.80           C  
ATOM   1038  CG  LYS B 131      31.478 -24.633  -8.137  1.00  0.80           C  
ATOM   1039  CD  LYS B 131      30.861 -25.744  -9.015  1.00  0.80           C  
ATOM   1040  CE  LYS B 131      31.879 -26.332 -10.009  1.00  0.80           C  
ATOM   1041  NZ  LYS B 131      31.237 -27.126 -11.087  1.00  0.80           N  
ATOM   1042  N   ASN B 132      32.786 -21.223  -7.770  1.00  0.76           N  
ATOM   1043  CA  ASN B 132      33.351 -20.344  -8.800  1.00  0.76           C  
ATOM   1044  C   ASN B 132      32.495 -19.110  -9.167  1.00  0.76           C  
ATOM   1045  O   ASN B 132      32.057 -18.967 -10.304  1.00  0.76           O  
ATOM   1046  CB  ASN B 132      33.715 -21.156 -10.072  1.00  0.76           C  
ATOM   1047  CG  ASN B 132      34.747 -22.228  -9.744  1.00  0.76           C  
ATOM   1048  OD1 ASN B 132      34.464 -23.430  -9.694  1.00  0.76           O  
ATOM   1049  ND2 ASN B 132      35.980 -21.746  -9.494  1.00  0.76           N  
ATOM   1050  N   CYS B 133      32.182 -18.248  -8.167  1.00  0.78           N  
ATOM   1051  CA  CYS B 133      31.270 -17.095  -8.233  1.00  0.78           C  
ATOM   1052  C   CYS B 133      29.837 -17.357  -8.694  1.00  0.78           C  
ATOM   1053  O   CYS B 133      29.120 -16.461  -9.132  1.00  0.78           O  
ATOM   1054  CB  CYS B 133      31.847 -15.772  -8.841  1.00  0.78           C  
ATOM   1055  SG  CYS B 133      32.929 -15.877 -10.304  1.00  0.78           S  
ATOM   1056  N   GLN B 134      29.342 -18.589  -8.507  1.00  0.73           N  
ATOM   1057  CA  GLN B 134      27.967 -18.942  -8.809  1.00  0.73           C  
ATOM   1058  C   GLN B 134      27.280 -19.433  -7.542  1.00  0.73           C  
ATOM   1059  O   GLN B 134      27.686 -20.435  -6.952  1.00  0.73           O  
ATOM   1060  CB  GLN B 134      27.916 -20.079  -9.857  1.00  0.73           C  
ATOM   1061  CG  GLN B 134      28.702 -19.775 -11.157  1.00  0.73           C  
ATOM   1062  CD  GLN B 134      29.145 -21.052 -11.874  1.00  0.73           C  
ATOM   1063  OE1 GLN B 134      28.716 -21.384 -12.976  1.00  0.73           O  
ATOM   1064  NE2 GLN B 134      30.057 -21.806 -11.218  1.00  0.73           N  
ATOM   1065  N   ALA B 135      26.229 -18.736  -7.062  1.00  0.82           N  
ATOM   1066  CA  ALA B 135      25.514 -19.135  -5.859  1.00  0.82           C  
ATOM   1067  C   ALA B 135      24.792 -20.476  -5.968  1.00  0.82           C  
ATOM   1068  O   ALA B 135      24.038 -20.722  -6.910  1.00  0.82           O  
ATOM   1069  CB  ALA B 135      24.519 -18.039  -5.439  1.00  0.82           C  
ATOM   1070  N   LEU B 136      25.006 -21.386  -4.993  1.00  0.82           N  
ATOM   1071  CA  LEU B 136      24.312 -22.660  -4.975  1.00  0.82           C  
ATOM   1072  C   LEU B 136      22.877 -22.536  -4.467  1.00  0.82           C  
ATOM   1073  O   LEU B 136      22.510 -21.644  -3.707  1.00  0.82           O  
ATOM   1074  CB  LEU B 136      25.048 -23.782  -4.194  1.00  0.82           C  
ATOM   1075  CG  LEU B 136      26.380 -24.306  -4.786  1.00  0.82           C  
ATOM   1076  CD1 LEU B 136      26.474 -24.249  -6.311  1.00  0.82           C  
ATOM   1077  CD2 LEU B 136      27.584 -23.577  -4.207  1.00  0.82           C  
ATOM   1078  N   GLN B 137      22.009 -23.446  -4.933  1.00  0.72           N  
ATOM   1079  CA  GLN B 137      20.574 -23.318  -4.822  1.00  0.72           C  
ATOM   1080  C   GLN B 137      19.934 -24.670  -5.018  1.00  0.72           C  
ATOM   1081  O   GLN B 137      20.606 -25.636  -5.368  1.00  0.72           O  
ATOM   1082  CB  GLN B 137      19.985 -22.310  -5.859  1.00  0.72           C  
ATOM   1083  CG  GLN B 137      19.838 -22.796  -7.330  1.00  0.72           C  
ATOM   1084  CD  GLN B 137      21.157 -23.066  -8.056  1.00  0.72           C  
ATOM   1085  OE1 GLN B 137      21.908 -23.994  -7.745  1.00  0.72           O  
ATOM   1086  NE2 GLN B 137      21.400 -22.317  -9.151  1.00  0.72           N  
ATOM   1087  N   GLY B 138      18.601 -24.764  -4.865  1.00  0.69           N  
ATOM   1088  CA  GLY B 138      17.813 -25.909  -5.319  1.00  0.69           C  
ATOM   1089  C   GLY B 138      17.989 -27.232  -4.609  1.00  0.69           C  
ATOM   1090  O   GLY B 138      18.405 -27.315  -3.462  1.00  0.69           O  
ATOM   1091  N   SER B 139      17.586 -28.322  -5.298  1.00  0.75           N  
ATOM   1092  CA  SER B 139      17.495 -29.658  -4.699  1.00  0.75           C  
ATOM   1093  C   SER B 139      18.841 -30.321  -4.413  1.00  0.75           C  
ATOM   1094  O   SER B 139      19.130 -30.733  -3.298  1.00  0.75           O  
ATOM   1095  CB  SER B 139      16.665 -30.604  -5.617  1.00  0.75           C  
ATOM   1096  OG  SER B 139      16.157 -31.722  -4.894  1.00  0.75           O  
ATOM   1097  N   ARG B 140      19.731 -30.371  -5.429  1.00  0.71           N  
ATOM   1098  CA  ARG B 140      20.976 -31.135  -5.412  1.00  0.71           C  
ATOM   1099  C   ARG B 140      22.075 -30.610  -4.508  1.00  0.71           C  
ATOM   1100  O   ARG B 140      23.029 -31.323  -4.192  1.00  0.71           O  
ATOM   1101  CB  ARG B 140      21.568 -31.181  -6.846  1.00  0.71           C  
ATOM   1102  CG  ARG B 140      21.838 -29.808  -7.495  1.00  0.71           C  
ATOM   1103  CD  ARG B 140      20.879 -29.422  -8.622  1.00  0.71           C  
ATOM   1104  NE  ARG B 140      21.493 -28.251  -9.327  1.00  0.71           N  
ATOM   1105  CZ  ARG B 140      21.483 -26.998  -8.865  1.00  0.71           C  
ATOM   1106  NH1 ARG B 140      20.822 -26.655  -7.772  1.00  0.71           N  
ATOM   1107  NH2 ARG B 140      22.129 -26.037  -9.517  1.00  0.71           N  
ATOM   1108  N   TYR B 141      22.005 -29.341  -4.106  1.00  0.80           N  
ATOM   1109  CA  TYR B 141      22.987 -28.772  -3.227  1.00  0.80           C  
ATOM   1110  C   TYR B 141      22.240 -28.396  -1.989  1.00  0.80           C  
ATOM   1111  O   TYR B 141      21.533 -27.387  -1.968  1.00  0.80           O  
ATOM   1112  CB  TYR B 141      23.590 -27.471  -3.800  1.00  0.80           C  
ATOM   1113  CG  TYR B 141      24.396 -27.717  -5.037  1.00  0.80           C  
ATOM   1114  CD1 TYR B 141      25.541 -28.519  -4.986  1.00  0.80           C  
ATOM   1115  CD2 TYR B 141      24.087 -27.048  -6.229  1.00  0.80           C  
ATOM   1116  CE1 TYR B 141      26.411 -28.594  -6.086  1.00  0.80           C  
ATOM   1117  CE2 TYR B 141      24.939 -27.144  -7.339  1.00  0.80           C  
ATOM   1118  CZ  TYR B 141      26.122 -27.883  -7.251  1.00  0.80           C  
ATOM   1119  OH  TYR B 141      27.060 -27.831  -8.299  1.00  0.80           O  
ATOM   1120  N   ARG B 142      22.387 -29.165  -0.902  1.00  0.71           N  
ATOM   1121  CA  ARG B 142      21.727 -28.797   0.323  1.00  0.71           C  
ATOM   1122  C   ARG B 142      22.717 -28.596   1.438  1.00  0.71           C  
ATOM   1123  O   ARG B 142      23.364 -29.496   1.963  1.00  0.71           O  
ATOM   1124  CB  ARG B 142      20.529 -29.708   0.712  1.00  0.71           C  
ATOM   1125  CG  ARG B 142      19.133 -29.150   0.318  1.00  0.71           C  
ATOM   1126  CD  ARG B 142      18.858 -27.670   0.637  1.00  0.71           C  
ATOM   1127  NE  ARG B 142      19.300 -27.408   2.051  1.00  0.71           N  
ATOM   1128  CZ  ARG B 142      18.490 -27.194   3.090  1.00  0.71           C  
ATOM   1129  NH1 ARG B 142      17.168 -27.270   2.986  1.00  0.71           N  
ATOM   1130  NH2 ARG B 142      19.039 -26.915   4.270  1.00  0.71           N  
ATOM   1131  N   ALA B 143      22.851 -27.323   1.842  1.00  0.82           N  
ATOM   1132  CA  ALA B 143      23.718 -26.927   2.919  1.00  0.82           C  
ATOM   1133  C   ALA B 143      23.077 -27.166   4.276  1.00  0.82           C  
ATOM   1134  O   ALA B 143      21.859 -27.017   4.455  1.00  0.82           O  
ATOM   1135  CB  ALA B 143      24.130 -25.458   2.738  1.00  0.82           C  
ATOM   1136  N   HIS B 144      23.898 -27.582   5.252  1.00  0.77           N  
ATOM   1137  CA  HIS B 144      23.470 -27.872   6.602  1.00  0.77           C  
ATOM   1138  C   HIS B 144      24.637 -27.589   7.527  1.00  0.77           C  
ATOM   1139  O   HIS B 144      25.776 -27.914   7.207  1.00  0.77           O  
ATOM   1140  CB  HIS B 144      23.000 -29.338   6.741  1.00  0.77           C  
ATOM   1141  CG  HIS B 144      22.353 -29.664   8.055  1.00  0.77           C  
ATOM   1142  ND1 HIS B 144      23.032 -30.417   8.993  1.00  0.77           N  
ATOM   1143  CD2 HIS B 144      21.111 -29.354   8.514  1.00  0.77           C  
ATOM   1144  CE1 HIS B 144      22.191 -30.559   9.995  1.00  0.77           C  
ATOM   1145  NE2 HIS B 144      21.015 -29.930   9.762  1.00  0.77           N  
ATOM   1146  N   LYS B 145      24.402 -26.958   8.698  1.00  0.77           N  
ATOM   1147  CA  LYS B 145      25.467 -26.598   9.631  1.00  0.77           C  
ATOM   1148  C   LYS B 145      26.671 -25.854   9.030  1.00  0.77           C  
ATOM   1149  O   LYS B 145      26.559 -24.751   8.504  1.00  0.77           O  
ATOM   1150  CB  LYS B 145      25.932 -27.828  10.460  1.00  0.77           C  
ATOM   1151  CG  LYS B 145      24.861 -28.400  11.400  1.00  0.77           C  
ATOM   1152  CD  LYS B 145      25.423 -29.558  12.243  1.00  0.77           C  
ATOM   1153  CE  LYS B 145      24.566 -29.919  13.459  1.00  0.77           C  
ATOM   1154  NZ  LYS B 145      25.363 -30.725  14.414  1.00  0.77           N  
ATOM   1155  N   SER B 146      27.870 -26.447   9.150  1.00  0.85           N  
ATOM   1156  CA  SER B 146      29.152 -25.893   8.756  1.00  0.85           C  
ATOM   1157  C   SER B 146      29.655 -26.511   7.474  1.00  0.85           C  
ATOM   1158  O   SER B 146      30.827 -26.380   7.113  1.00  0.85           O  
ATOM   1159  CB  SER B 146      30.203 -26.175   9.860  1.00  0.85           C  
ATOM   1160  OG  SER B 146      30.127 -27.533  10.316  1.00  0.85           O  
ATOM   1161  N   PHE B 147      28.774 -27.207   6.744  1.00  0.80           N  
ATOM   1162  CA  PHE B 147      29.147 -27.944   5.564  1.00  0.80           C  
ATOM   1163  C   PHE B 147      28.102 -27.861   4.466  1.00  0.80           C  
ATOM   1164  O   PHE B 147      26.962 -27.430   4.639  1.00  0.80           O  
ATOM   1165  CB  PHE B 147      29.482 -29.432   5.860  1.00  0.80           C  
ATOM   1166  CG  PHE B 147      28.365 -30.163   6.546  1.00  0.80           C  
ATOM   1167  CD1 PHE B 147      27.383 -30.825   5.795  1.00  0.80           C  
ATOM   1168  CD2 PHE B 147      28.292 -30.195   7.945  1.00  0.80           C  
ATOM   1169  CE1 PHE B 147      26.321 -31.478   6.436  1.00  0.80           C  
ATOM   1170  CE2 PHE B 147      27.241 -30.854   8.589  1.00  0.80           C  
ATOM   1171  CZ  PHE B 147      26.247 -31.485   7.833  1.00  0.80           C  
ATOM   1172  N   LEU B 148      28.501 -28.307   3.270  1.00  0.83           N  
ATOM   1173  CA  LEU B 148      27.628 -28.432   2.132  1.00  0.83           C  
ATOM   1174  C   LEU B 148      27.495 -29.891   1.765  1.00  0.83           C  
ATOM   1175  O   LEU B 148      28.494 -30.602   1.657  1.00  0.83           O  
ATOM   1176  CB  LEU B 148      28.216 -27.623   0.954  1.00  0.83           C  
ATOM   1177  CG  LEU B 148      27.423 -27.617  -0.366  1.00  0.83           C  
ATOM   1178  CD1 LEU B 148      25.957 -27.234  -0.161  1.00  0.83           C  
ATOM   1179  CD2 LEU B 148      28.077 -26.646  -1.356  1.00  0.83           C  
ATOM   1180  N   VAL B 149      26.253 -30.385   1.588  1.00  0.84           N  
ATOM   1181  CA  VAL B 149      25.995 -31.720   1.084  1.00  0.84           C  
ATOM   1182  C   VAL B 149      25.627 -31.605  -0.365  1.00  0.84           C  
ATOM   1183  O   VAL B 149      24.721 -30.865  -0.755  1.00  0.84           O  
ATOM   1184  CB  VAL B 149      24.919 -32.454   1.875  1.00  0.84           C  
ATOM   1185  CG1 VAL B 149      24.344 -33.704   1.187  1.00  0.84           C  
ATOM   1186  CG2 VAL B 149      25.548 -32.849   3.214  1.00  0.84           C  
ATOM   1187  N   ILE B 150      26.368 -32.326  -1.211  1.00  0.81           N  
ATOM   1188  CA  ILE B 150      26.038 -32.441  -2.603  1.00  0.81           C  
ATOM   1189  C   ILE B 150      25.751 -33.910  -2.880  1.00  0.81           C  
ATOM   1190  O   ILE B 150      26.663 -34.732  -2.886  1.00  0.81           O  
ATOM   1191  CB  ILE B 150      27.186 -32.001  -3.500  1.00  0.81           C  
ATOM   1192  CG1 ILE B 150      27.949 -30.737  -3.037  1.00  0.81           C  
ATOM   1193  CG2 ILE B 150      26.555 -31.835  -4.883  1.00  0.81           C  
ATOM   1194  CD1 ILE B 150      29.158 -30.405  -3.923  1.00  0.81           C  
ATOM   1195  N   ASP B 151      24.488 -34.314  -3.095  1.00  0.74           N  
ATOM   1196  CA  ASP B 151      24.160 -35.709  -3.364  1.00  0.74           C  
ATOM   1197  C   ASP B 151      24.369 -36.064  -4.825  1.00  0.74           C  
ATOM   1198  O   ASP B 151      24.669 -37.200  -5.159  1.00  0.74           O  
ATOM   1199  CB  ASP B 151      22.710 -36.081  -2.943  1.00  0.74           C  
ATOM   1200  CG  ASP B 151      22.217 -35.119  -1.882  1.00  0.74           C  
ATOM   1201  OD1 ASP B 151      22.199 -35.491  -0.685  1.00  0.74           O  
ATOM   1202  OD2 ASP B 151      21.924 -33.955  -2.271  1.00  0.74           O  
ATOM   1203  N   ASN B 152      24.280 -35.063  -5.726  1.00  0.69           N  
ATOM   1204  CA  ASN B 152      24.294 -35.258  -7.175  1.00  0.69           C  
ATOM   1205  C   ASN B 152      25.609 -35.739  -7.785  1.00  0.69           C  
ATOM   1206  O   ASN B 152      25.666 -35.965  -8.994  1.00  0.69           O  
ATOM   1207  CB  ASN B 152      23.834 -33.957  -7.942  1.00  0.69           C  
ATOM   1208  CG  ASN B 152      24.857 -32.811  -7.947  1.00  0.69           C  
ATOM   1209  OD1 ASN B 152      25.978 -32.933  -7.469  1.00  0.69           O  
ATOM   1210  ND2 ASN B 152      24.521 -31.632  -8.501  1.00  0.69           N  
ATOM   1211  N   VAL B 153      26.695 -35.754  -6.984  1.00  0.80           N  
ATOM   1212  CA  VAL B 153      28.041 -35.492  -7.466  1.00  0.80           C  
ATOM   1213  C   VAL B 153      28.504 -36.344  -8.632  1.00  0.80           C  
ATOM   1214  O   VAL B 153      28.628 -37.566  -8.598  1.00  0.80           O  
ATOM   1215  CB  VAL B 153      29.073 -35.407  -6.334  1.00  0.80           C  
ATOM   1216  CG1 VAL B 153      30.478 -35.861  -6.731  1.00  0.80           C  
ATOM   1217  CG2 VAL B 153      29.208 -33.980  -5.801  1.00  0.80           C  
ATOM   1218  N   MET B 154      28.825 -35.656  -9.726  1.00  0.77           N  
ATOM   1219  CA  MET B 154      29.428 -36.230 -10.893  1.00  0.77           C  
ATOM   1220  C   MET B 154      30.890 -35.893 -10.796  1.00  0.77           C  
ATOM   1221  O   MET B 154      31.355 -35.254  -9.866  1.00  0.77           O  
ATOM   1222  CB  MET B 154      28.869 -35.599 -12.189  1.00  0.77           C  
ATOM   1223  CG  MET B 154      27.450 -36.043 -12.571  1.00  0.77           C  
ATOM   1224  SD  MET B 154      27.011 -35.621 -14.290  1.00  0.77           S  
ATOM   1225  CE  MET B 154      28.309 -36.546 -15.172  1.00  0.77           C  
ATOM   1226  N   THR B 155      31.687 -36.211 -11.819  1.00  0.78           N  
ATOM   1227  CA  THR B 155      32.985 -35.563 -11.998  1.00  0.78           C  
ATOM   1228  C   THR B 155      32.857 -34.066 -12.334  1.00  0.78           C  
ATOM   1229  O   THR B 155      33.828 -33.316 -12.270  1.00  0.78           O  
ATOM   1230  CB  THR B 155      33.855 -36.280 -13.030  1.00  0.78           C  
ATOM   1231  OG1 THR B 155      33.048 -36.943 -13.998  1.00  0.78           O  
ATOM   1232  CG2 THR B 155      34.691 -37.363 -12.327  1.00  0.78           C  
ATOM   1233  N   GLU B 156      31.636 -33.582 -12.641  1.00  0.78           N  
ATOM   1234  CA  GLU B 156      31.316 -32.202 -12.999  1.00  0.78           C  
ATOM   1235  C   GLU B 156      31.344 -31.195 -11.855  1.00  0.78           C  
ATOM   1236  O   GLU B 156      31.464 -29.975 -12.023  1.00  0.78           O  
ATOM   1237  CB  GLU B 156      29.877 -32.161 -13.556  1.00  0.78           C  
ATOM   1238  CG  GLU B 156      29.754 -32.761 -14.970  1.00  0.78           C  
ATOM   1239  CD  GLU B 156      30.296 -31.837 -16.059  1.00  0.78           C  
ATOM   1240  OE1 GLU B 156      30.794 -30.728 -15.735  1.00  0.78           O  
ATOM   1241  OE2 GLU B 156      30.201 -32.249 -17.243  1.00  0.78           O  
ATOM   1242  N   ASP B 157      31.255 -31.684 -10.615  1.00  0.81           N  
ATOM   1243  CA  ASP B 157      31.173 -30.834  -9.456  1.00  0.81           C  
ATOM   1244  C   ASP B 157      32.564 -30.513  -8.921  1.00  0.81           C  
ATOM   1245  O   ASP B 157      32.720 -29.788  -7.950  1.00  0.81           O  
ATOM   1246  CB  ASP B 157      30.277 -31.525  -8.415  1.00  0.81           C  
ATOM   1247  CG  ASP B 157      28.897 -31.745  -9.017  1.00  0.81           C  
ATOM   1248  OD1 ASP B 157      28.701 -32.856  -9.575  1.00  0.81           O  
ATOM   1249  OD2 ASP B 157      28.066 -30.796  -8.994  1.00  0.81           O  
ATOM   1250  N   ALA B 158      33.635 -30.937  -9.626  1.00  0.84           N  
ATOM   1251  CA  ALA B 158      34.976 -30.416  -9.437  1.00  0.84           C  
ATOM   1252  C   ALA B 158      35.029 -28.893  -9.577  1.00  0.84           C  
ATOM   1253  O   ALA B 158      34.433 -28.298 -10.482  1.00  0.84           O  
ATOM   1254  CB  ALA B 158      35.943 -31.076 -10.438  1.00  0.84           C  
ATOM   1255  N   GLY B 159      35.711 -28.210  -8.646  1.00  0.84           N  
ATOM   1256  CA  GLY B 159      35.695 -26.757  -8.638  1.00  0.84           C  
ATOM   1257  C   GLY B 159      35.968 -26.191  -7.286  1.00  0.84           C  
ATOM   1258  O   GLY B 159      36.090 -26.906  -6.292  1.00  0.84           O  
ATOM   1259  N   ASP B 160      36.068 -24.861  -7.217  1.00  0.80           N  
ATOM   1260  CA  ASP B 160      36.465 -24.174  -6.009  1.00  0.80           C  
ATOM   1261  C   ASP B 160      35.213 -23.693  -5.293  1.00  0.80           C  
ATOM   1262  O   ASP B 160      34.467 -22.831  -5.770  1.00  0.80           O  
ATOM   1263  CB  ASP B 160      37.461 -23.025  -6.291  1.00  0.80           C  
ATOM   1264  CG  ASP B 160      38.331 -23.429  -7.459  1.00  0.80           C  
ATOM   1265  OD1 ASP B 160      38.171 -22.835  -8.549  1.00  0.80           O  
ATOM   1266  OD2 ASP B 160      39.103 -24.406  -7.312  1.00  0.80           O  
ATOM   1267  N   TYR B 161      34.932 -24.279  -4.116  1.00  0.84           N  
ATOM   1268  CA  TYR B 161      33.728 -23.983  -3.371  1.00  0.84           C  
ATOM   1269  C   TYR B 161      34.082 -22.996  -2.302  1.00  0.84           C  
ATOM   1270  O   TYR B 161      34.978 -23.215  -1.487  1.00  0.84           O  
ATOM   1271  CB  TYR B 161      33.073 -25.214  -2.698  1.00  0.84           C  
ATOM   1272  CG  TYR B 161      32.350 -26.037  -3.719  1.00  0.84           C  
ATOM   1273  CD1 TYR B 161      33.090 -26.847  -4.586  1.00  0.84           C  
ATOM   1274  CD2 TYR B 161      30.946 -26.018  -3.832  1.00  0.84           C  
ATOM   1275  CE1 TYR B 161      32.450 -27.613  -5.562  1.00  0.84           C  
ATOM   1276  CE2 TYR B 161      30.300 -26.798  -4.806  1.00  0.84           C  
ATOM   1277  CZ  TYR B 161      31.057 -27.596  -5.670  1.00  0.84           C  
ATOM   1278  OH  TYR B 161      30.432 -28.369  -6.666  1.00  0.84           O  
ATOM   1279  N   THR B 162      33.374 -21.865  -2.295  1.00  0.86           N  
ATOM   1280  CA  THR B 162      33.576 -20.792  -1.351  1.00  0.86           C  
ATOM   1281  C   THR B 162      32.359 -20.725  -0.465  1.00  0.86           C  
ATOM   1282  O   THR B 162      31.224 -20.833  -0.932  1.00  0.86           O  
ATOM   1283  CB  THR B 162      33.980 -19.434  -1.967  1.00  0.86           C  
ATOM   1284  OG1 THR B 162      33.186 -18.321  -1.555  1.00  0.86           O  
ATOM   1285  CG2 THR B 162      33.995 -19.463  -3.506  1.00  0.86           C  
ATOM   1286  N   CYS B 163      32.560 -20.556   0.847  1.00  0.88           N  
ATOM   1287  CA  CYS B 163      31.490 -20.348   1.796  1.00  0.88           C  
ATOM   1288  C   CYS B 163      31.636 -18.955   2.355  1.00  0.88           C  
ATOM   1289  O   CYS B 163      32.728 -18.546   2.751  1.00  0.88           O  
ATOM   1290  CB  CYS B 163      31.477 -21.357   2.982  1.00  0.88           C  
ATOM   1291  SG  CYS B 163      33.125 -21.667   3.723  1.00  0.88           S  
ATOM   1292  N   LYS B 164      30.534 -18.191   2.414  1.00  0.83           N  
ATOM   1293  CA  LYS B 164      30.500 -16.906   3.079  1.00  0.83           C  
ATOM   1294  C   LYS B 164      29.636 -17.047   4.302  1.00  0.83           C  
ATOM   1295  O   LYS B 164      28.553 -17.632   4.264  1.00  0.83           O  
ATOM   1296  CB  LYS B 164      29.915 -15.766   2.211  1.00  0.83           C  
ATOM   1297  CG  LYS B 164      29.870 -14.400   2.933  1.00  0.83           C  
ATOM   1298  CD  LYS B 164      29.497 -13.216   2.023  1.00  0.83           C  
ATOM   1299  CE  LYS B 164      28.066 -13.374   1.520  1.00  0.83           C  
ATOM   1300  NZ  LYS B 164      27.542 -12.202   0.791  1.00  0.83           N  
ATOM   1301  N   PHE B 165      30.103 -16.512   5.432  1.00  0.85           N  
ATOM   1302  CA  PHE B 165      29.365 -16.549   6.664  1.00  0.85           C  
ATOM   1303  C   PHE B 165      29.607 -15.266   7.420  1.00  0.85           C  
ATOM   1304  O   PHE B 165      30.426 -14.434   7.029  1.00  0.85           O  
ATOM   1305  CB  PHE B 165      29.693 -17.826   7.479  1.00  0.85           C  
ATOM   1306  CG  PHE B 165      31.102 -17.911   7.983  1.00  0.85           C  
ATOM   1307  CD1 PHE B 165      31.375 -17.567   9.313  1.00  0.85           C  
ATOM   1308  CD2 PHE B 165      32.146 -18.373   7.164  1.00  0.85           C  
ATOM   1309  CE1 PHE B 165      32.680 -17.640   9.806  1.00  0.85           C  
ATOM   1310  CE2 PHE B 165      33.454 -18.455   7.659  1.00  0.85           C  
ATOM   1311  CZ  PHE B 165      33.722 -18.076   8.979  1.00  0.85           C  
ATOM   1312  N   ILE B 166      28.863 -15.047   8.514  1.00  0.83           N  
ATOM   1313  CA  ILE B 166      29.018 -13.846   9.309  1.00  0.83           C  
ATOM   1314  C   ILE B 166      29.576 -14.221  10.654  1.00  0.83           C  
ATOM   1315  O   ILE B 166      29.078 -15.110  11.346  1.00  0.83           O  
ATOM   1316  CB  ILE B 166      27.719 -13.051   9.440  1.00  0.83           C  
ATOM   1317  CG1 ILE B 166      27.348 -12.494   8.048  1.00  0.83           C  
ATOM   1318  CG2 ILE B 166      27.846 -11.895  10.454  1.00  0.83           C  
ATOM   1319  CD1 ILE B 166      26.098 -11.612   8.020  1.00  0.83           C  
ATOM   1320  N   HIS B 167      30.645 -13.520  11.053  1.00  0.82           N  
ATOM   1321  CA  HIS B 167      31.113 -13.522  12.416  1.00  0.82           C  
ATOM   1322  C   HIS B 167      30.478 -12.354  13.146  1.00  0.82           C  
ATOM   1323  O   HIS B 167      30.514 -11.211  12.677  1.00  0.82           O  
ATOM   1324  CB  HIS B 167      32.645 -13.401  12.476  1.00  0.82           C  
ATOM   1325  CG  HIS B 167      33.173 -13.085  13.837  1.00  0.82           C  
ATOM   1326  ND1 HIS B 167      32.919 -13.938  14.887  1.00  0.82           N  
ATOM   1327  CD2 HIS B 167      33.781 -11.956  14.278  1.00  0.82           C  
ATOM   1328  CE1 HIS B 167      33.372 -13.307  15.955  1.00  0.82           C  
ATOM   1329  NE2 HIS B 167      33.905 -12.110  15.637  1.00  0.82           N  
ATOM   1330  N   ASN B 168      29.880 -12.607  14.314  1.00  0.80           N  
ATOM   1331  CA  ASN B 168      29.259 -11.586  15.132  1.00  0.80           C  
ATOM   1332  C   ASN B 168      30.112 -11.394  16.372  1.00  0.80           C  
ATOM   1333  O   ASN B 168      30.359 -12.356  17.100  1.00  0.80           O  
ATOM   1334  CB  ASN B 168      27.812 -12.032  15.507  1.00  0.80           C  
ATOM   1335  CG  ASN B 168      27.130 -11.205  16.597  1.00  0.80           C  
ATOM   1336  OD1 ASN B 168      26.420 -10.233  16.359  1.00  0.80           O  
ATOM   1337  ND2 ASN B 168      27.326 -11.614  17.870  1.00  0.80           N  
ATOM   1338  N   GLU B 169      30.547 -10.159  16.691  1.00  0.76           N  
ATOM   1339  CA  GLU B 169      31.325  -9.945  17.912  1.00  0.76           C  
ATOM   1340  C   GLU B 169      30.399  -9.588  19.073  1.00  0.76           C  
ATOM   1341  O   GLU B 169      29.771 -10.456  19.673  1.00  0.76           O  
ATOM   1342  CB  GLU B 169      32.453  -8.898  17.707  1.00  0.76           C  
ATOM   1343  CG  GLU B 169      33.552  -8.848  18.817  1.00  0.76           C  
ATOM   1344  CD  GLU B 169      34.444 -10.088  18.907  1.00  0.76           C  
ATOM   1345  OE1 GLU B 169      34.569 -10.799  17.876  1.00  0.76           O  
ATOM   1346  OE2 GLU B 169      35.055 -10.354  19.982  1.00  0.76           O  
ATOM   1347  N   ASN B 170      30.213  -8.290  19.394  1.00  0.75           N  
ATOM   1348  CA  ASN B 170      29.356  -7.868  20.503  1.00  0.75           C  
ATOM   1349  C   ASN B 170      27.929  -7.561  20.045  1.00  0.75           C  
ATOM   1350  O   ASN B 170      27.176  -6.860  20.717  1.00  0.75           O  
ATOM   1351  CB  ASN B 170      29.947  -6.595  21.179  1.00  0.75           C  
ATOM   1352  CG  ASN B 170      29.611  -6.520  22.671  1.00  0.75           C  
ATOM   1353  OD1 ASN B 170      29.449  -7.522  23.365  1.00  0.75           O  
ATOM   1354  ND2 ASN B 170      29.522  -5.278  23.201  1.00  0.75           N  
ATOM   1355  N   GLY B 171      27.538  -8.045  18.852  1.00  0.79           N  
ATOM   1356  CA  GLY B 171      26.349  -7.588  18.128  1.00  0.79           C  
ATOM   1357  C   GLY B 171      26.707  -6.875  16.855  1.00  0.79           C  
ATOM   1358  O   GLY B 171      25.863  -6.512  16.043  1.00  0.79           O  
ATOM   1359  N   ALA B 172      28.012  -6.660  16.644  1.00  0.80           N  
ATOM   1360  CA  ALA B 172      28.545  -6.177  15.395  1.00  0.80           C  
ATOM   1361  C   ALA B 172      28.792  -7.323  14.422  1.00  0.80           C  
ATOM   1362  O   ALA B 172      29.520  -8.267  14.728  1.00  0.80           O  
ATOM   1363  CB  ALA B 172      29.843  -5.403  15.665  1.00  0.80           C  
ATOM   1364  N   ASN B 173      28.178  -7.248  13.225  1.00  0.80           N  
ATOM   1365  CA  ASN B 173      28.274  -8.278  12.206  1.00  0.80           C  
ATOM   1366  C   ASN B 173      29.344  -7.959  11.176  1.00  0.80           C  
ATOM   1367  O   ASN B 173      29.403  -6.867  10.615  1.00  0.80           O  
ATOM   1368  CB  ASN B 173      26.932  -8.458  11.442  1.00  0.80           C  
ATOM   1369  CG  ASN B 173      25.944  -9.290  12.249  1.00  0.80           C  
ATOM   1370  OD1 ASN B 173      26.193  -9.698  13.379  1.00  0.80           O  
ATOM   1371  ND2 ASN B 173      24.785  -9.615  11.630  1.00  0.80           N  
ATOM   1372  N   TYR B 174      30.204  -8.949  10.883  1.00  0.84           N  
ATOM   1373  CA  TYR B 174      31.288  -8.811   9.935  1.00  0.84           C  
ATOM   1374  C   TYR B 174      31.258  -9.982   8.973  1.00  0.84           C  
ATOM   1375  O   TYR B 174      30.939 -11.113   9.335  1.00  0.84           O  
ATOM   1376  CB  TYR B 174      32.680  -8.824  10.609  1.00  0.84           C  
ATOM   1377  CG  TYR B 174      32.819  -7.774  11.672  1.00  0.84           C  
ATOM   1378  CD1 TYR B 174      33.418  -6.532  11.398  1.00  0.84           C  
ATOM   1379  CD2 TYR B 174      32.361  -8.038  12.973  1.00  0.84           C  
ATOM   1380  CE1 TYR B 174      33.509  -5.554  12.401  1.00  0.84           C  
ATOM   1381  CE2 TYR B 174      32.453  -7.064  13.973  1.00  0.84           C  
ATOM   1382  CZ  TYR B 174      33.018  -5.820  13.685  1.00  0.84           C  
ATOM   1383  OH  TYR B 174      33.122  -4.845  14.695  1.00  0.84           O  
ATOM   1384  N   SER B 175      31.605  -9.742   7.701  1.00  0.85           N  
ATOM   1385  CA  SER B 175      31.614 -10.770   6.668  1.00  0.85           C  
ATOM   1386  C   SER B 175      32.896 -11.582   6.709  1.00  0.85           C  
ATOM   1387  O   SER B 175      33.945 -11.046   7.064  1.00  0.85           O  
ATOM   1388  CB  SER B 175      31.480 -10.092   5.282  1.00  0.85           C  
ATOM   1389  OG  SER B 175      30.949 -10.961   4.285  1.00  0.85           O  
ATOM   1390  N   VAL B 176      32.852 -12.887   6.386  1.00  0.88           N  
ATOM   1391  CA  VAL B 176      34.050 -13.719   6.295  1.00  0.88           C  
ATOM   1392  C   VAL B 176      33.845 -14.716   5.168  1.00  0.88           C  
ATOM   1393  O   VAL B 176      32.760 -15.296   5.064  1.00  0.88           O  
ATOM   1394  CB  VAL B 176      34.356 -14.545   7.555  1.00  0.88           C  
ATOM   1395  CG1 VAL B 176      35.838 -14.960   7.542  1.00  0.88           C  
ATOM   1396  CG2 VAL B 176      34.057 -13.763   8.842  1.00  0.88           C  
ATOM   1397  N   THR B 177      34.853 -14.972   4.299  1.00  0.85           N  
ATOM   1398  CA  THR B 177      34.777 -16.047   3.307  1.00  0.85           C  
ATOM   1399  C   THR B 177      35.900 -17.056   3.452  1.00  0.85           C  
ATOM   1400  O   THR B 177      36.972 -16.789   3.998  1.00  0.85           O  
ATOM   1401  CB  THR B 177      34.544 -15.672   1.831  1.00  0.85           C  
ATOM   1402  OG1 THR B 177      35.648 -15.082   1.131  1.00  0.85           O  
ATOM   1403  CG2 THR B 177      33.525 -14.573   1.721  1.00  0.85           C  
ATOM   1404  N   ALA B 178      35.671 -18.300   2.991  1.00  0.87           N  
ATOM   1405  CA  ALA B 178      36.730 -19.276   2.875  1.00  0.87           C  
ATOM   1406  C   ALA B 178      36.463 -20.174   1.681  1.00  0.87           C  
ATOM   1407  O   ALA B 178      35.329 -20.556   1.409  1.00  0.87           O  
ATOM   1408  CB  ALA B 178      36.909 -20.088   4.171  1.00  0.87           C  
ATOM   1409  N   THR B 179      37.509 -20.516   0.908  1.00  0.83           N  
ATOM   1410  CA  THR B 179      37.383 -21.210  -0.370  1.00  0.83           C  
ATOM   1411  C   THR B 179      38.234 -22.426  -0.282  1.00  0.83           C  
ATOM   1412  O   THR B 179      39.294 -22.393   0.334  1.00  0.83           O  
ATOM   1413  CB  THR B 179      37.880 -20.450  -1.609  1.00  0.83           C  
ATOM   1414  OG1 THR B 179      37.319 -19.152  -1.664  1.00  0.83           O  
ATOM   1415  CG2 THR B 179      37.499 -21.149  -2.926  1.00  0.83           C  
ATOM   1416  N   ARG B 180      37.815 -23.540  -0.890  1.00  0.74           N  
ATOM   1417  CA  ARG B 180      38.701 -24.667  -1.028  1.00  0.74           C  
ATOM   1418  C   ARG B 180      38.329 -25.463  -2.256  1.00  0.74           C  
ATOM   1419  O   ARG B 180      37.183 -25.457  -2.709  1.00  0.74           O  
ATOM   1420  CB  ARG B 180      38.677 -25.542   0.243  1.00  0.74           C  
ATOM   1421  CG  ARG B 180      37.477 -26.498   0.318  1.00  0.74           C  
ATOM   1422  CD  ARG B 180      37.113 -26.976   1.720  1.00  0.74           C  
ATOM   1423  NE  ARG B 180      38.351 -27.499   2.375  1.00  0.74           N  
ATOM   1424  CZ  ARG B 180      38.398 -27.902   3.651  1.00  0.74           C  
ATOM   1425  NH1 ARG B 180      37.317 -27.920   4.428  1.00  0.74           N  
ATOM   1426  NH2 ARG B 180      39.572 -28.284   4.147  1.00  0.74           N  
ATOM   1427  N   SER B 181      39.305 -26.160  -2.856  1.00  0.78           N  
ATOM   1428  CA  SER B 181      39.049 -26.931  -4.056  1.00  0.78           C  
ATOM   1429  C   SER B 181      38.387 -28.256  -3.741  1.00  0.78           C  
ATOM   1430  O   SER B 181      38.674 -28.909  -2.737  1.00  0.78           O  
ATOM   1431  CB  SER B 181      40.322 -27.272  -4.860  1.00  0.78           C  
ATOM   1432  OG  SER B 181      41.189 -26.157  -5.013  1.00  0.78           O  
ATOM   1433  N   PHE B 182      37.481 -28.705  -4.613  1.00  0.79           N  
ATOM   1434  CA  PHE B 182      36.780 -29.956  -4.445  1.00  0.79           C  
ATOM   1435  C   PHE B 182      37.015 -30.902  -5.613  1.00  0.79           C  
ATOM   1436  O   PHE B 182      37.009 -30.518  -6.783  1.00  0.79           O  
ATOM   1437  CB  PHE B 182      35.294 -29.634  -4.241  1.00  0.79           C  
ATOM   1438  CG  PHE B 182      34.432 -30.838  -4.059  1.00  0.79           C  
ATOM   1439  CD1 PHE B 182      34.370 -31.504  -2.830  1.00  0.79           C  
ATOM   1440  CD2 PHE B 182      33.607 -31.247  -5.111  1.00  0.79           C  
ATOM   1441  CE1 PHE B 182      33.395 -32.484  -2.622  1.00  0.79           C  
ATOM   1442  CE2 PHE B 182      32.656 -32.252  -4.923  1.00  0.79           C  
ATOM   1443  CZ  PHE B 182      32.532 -32.847  -3.663  1.00  0.79           C  
ATOM   1444  N   THR B 183      37.250 -32.177  -5.273  1.00  0.76           N  
ATOM   1445  CA  THR B 183      37.706 -33.239  -6.154  1.00  0.76           C  
ATOM   1446  C   THR B 183      36.774 -34.405  -6.022  1.00  0.76           C  
ATOM   1447  O   THR B 183      36.382 -34.783  -4.922  1.00  0.76           O  
ATOM   1448  CB  THR B 183      39.097 -33.723  -5.742  1.00  0.76           C  
ATOM   1449  OG1 THR B 183      40.086 -32.872  -6.294  1.00  0.76           O  
ATOM   1450  CG2 THR B 183      39.447 -35.157  -6.183  1.00  0.76           C  
ATOM   1451  N   VAL B 184      36.423 -35.073  -7.130  1.00  0.77           N  
ATOM   1452  CA  VAL B 184      35.563 -36.236  -7.059  1.00  0.77           C  
ATOM   1453  C   VAL B 184      36.379 -37.498  -7.270  1.00  0.77           C  
ATOM   1454  O   VAL B 184      37.193 -37.599  -8.180  1.00  0.77           O  
ATOM   1455  CB  VAL B 184      34.394 -36.119  -8.014  1.00  0.77           C  
ATOM   1456  CG1 VAL B 184      33.389 -37.255  -7.755  1.00  0.77           C  
ATOM   1457  CG2 VAL B 184      33.756 -34.738  -7.762  1.00  0.77           C  
ATOM   1458  N   LYS B 185      36.212 -38.479  -6.367  1.00  0.68           N  
ATOM   1459  CA  LYS B 185      36.793 -39.800  -6.409  1.00  0.68           C  
ATOM   1460  C   LYS B 185      36.056 -40.657  -7.428  1.00  0.68           C  
ATOM   1461  O   LYS B 185      34.848 -40.871  -7.306  1.00  0.68           O  
ATOM   1462  CB  LYS B 185      36.636 -40.484  -5.015  1.00  0.68           C  
ATOM   1463  CG  LYS B 185      37.910 -40.992  -4.331  1.00  0.68           C  
ATOM   1464  CD  LYS B 185      38.810 -39.851  -3.837  1.00  0.68           C  
ATOM   1465  CE  LYS B 185      40.030 -40.362  -3.071  1.00  0.68           C  
ATOM   1466  NZ  LYS B 185      40.941 -39.243  -2.753  1.00  0.68           N  
ATOM   1467  N   ASP B 186      36.774 -41.185  -8.427  1.00  0.55           N  
ATOM   1468  CA  ASP B 186      36.252 -41.972  -9.527  1.00  0.55           C  
ATOM   1469  C   ASP B 186      35.451 -43.216  -9.127  1.00  0.55           C  
ATOM   1470  O   ASP B 186      34.302 -43.399  -9.529  1.00  0.55           O  
ATOM   1471  CB  ASP B 186      37.467 -42.416 -10.377  1.00  0.55           C  
ATOM   1472  CG  ASP B 186      38.338 -41.214 -10.702  1.00  0.55           C  
ATOM   1473  OD1 ASP B 186      38.227 -40.692 -11.835  1.00  0.55           O  
ATOM   1474  OD2 ASP B 186      39.103 -40.804  -9.785  1.00  0.55           O  
ATOM   1475  N   GLU B 187      36.023 -44.076  -8.261  1.00  0.51           N  
ATOM   1476  CA  GLU B 187      35.307 -45.178  -7.648  1.00  0.51           C  
ATOM   1477  C   GLU B 187      35.404 -45.040  -6.148  1.00  0.51           C  
ATOM   1478  O   GLU B 187      36.448 -44.702  -5.585  1.00  0.51           O  
ATOM   1479  CB  GLU B 187      35.806 -46.584  -8.080  1.00  0.51           C  
ATOM   1480  CG  GLU B 187      35.062 -47.813  -7.457  1.00  0.51           C  
ATOM   1481  CD  GLU B 187      33.553 -47.947  -7.673  1.00  0.51           C  
ATOM   1482  OE1 GLU B 187      33.082 -48.978  -8.224  1.00  0.51           O  
ATOM   1483  OE2 GLU B 187      32.760 -47.090  -7.185  1.00  0.51           O  
ATOM   1484  N   GLN B 188      34.295 -45.321  -5.449  1.00  0.75           N  
ATOM   1485  CA  GLN B 188      34.320 -45.500  -4.020  1.00  0.75           C  
ATOM   1486  C   GLN B 188      33.798 -46.885  -3.744  1.00  0.75           C  
ATOM   1487  O   GLN B 188      32.618 -47.201  -3.926  1.00  0.75           O  
ATOM   1488  CB  GLN B 188      33.521 -44.439  -3.236  1.00  0.75           C  
ATOM   1489  CG  GLN B 188      34.238 -43.070  -3.191  1.00  0.75           C  
ATOM   1490  CD  GLN B 188      33.840 -42.266  -1.953  1.00  0.75           C  
ATOM   1491  OE1 GLN B 188      32.759 -42.428  -1.390  1.00  0.75           O  
ATOM   1492  NE2 GLN B 188      34.732 -41.351  -1.511  1.00  0.75           N  
ATOM   1493  N   GLY B 189      34.726 -47.759  -3.320  1.00  0.70           N  
ATOM   1494  CA  GLY B 189      34.459 -49.155  -3.058  1.00  0.70           C  
ATOM   1495  C   GLY B 189      34.561 -49.487  -1.605  1.00  0.70           C  
ATOM   1496  O   GLY B 189      35.200 -48.805  -0.813  1.00  0.70           O  
ATOM   1497  N   PHE B 190      33.930 -50.598  -1.229  1.00  0.72           N  
ATOM   1498  CA  PHE B 190      33.849 -51.067   0.135  1.00  0.72           C  
ATOM   1499  C   PHE B 190      34.984 -52.007   0.516  1.00  0.72           C  
ATOM   1500  O   PHE B 190      35.764 -52.464  -0.326  1.00  0.72           O  
ATOM   1501  CB  PHE B 190      32.473 -51.738   0.416  1.00  0.72           C  
ATOM   1502  CG  PHE B 190      31.802 -52.255  -0.832  1.00  0.72           C  
ATOM   1503  CD1 PHE B 190      32.042 -53.552  -1.315  1.00  0.72           C  
ATOM   1504  CD2 PHE B 190      30.909 -51.422  -1.529  1.00  0.72           C  
ATOM   1505  CE1 PHE B 190      31.376 -54.017  -2.459  1.00  0.72           C  
ATOM   1506  CE2 PHE B 190      30.251 -51.878  -2.676  1.00  0.72           C  
ATOM   1507  CZ  PHE B 190      30.476 -53.181  -3.134  1.00  0.72           C  
ATOM   1508  N   SER B 191      35.076 -52.317   1.823  1.00  0.84           N  
ATOM   1509  CA  SER B 191      36.043 -53.222   2.411  1.00  0.84           C  
ATOM   1510  C   SER B 191      35.399 -53.972   3.564  1.00  0.84           C  
ATOM   1511  O   SER B 191      34.390 -53.522   4.115  1.00  0.84           O  
ATOM   1512  CB  SER B 191      37.305 -52.505   2.956  1.00  0.84           C  
ATOM   1513  OG  SER B 191      37.015 -51.644   4.063  1.00  0.84           O  
ATOM   1514  N   LEU B 192      35.968 -55.125   3.963  1.00  0.87           N  
ATOM   1515  CA  LEU B 192      35.579 -55.832   5.177  1.00  0.87           C  
ATOM   1516  C   LEU B 192      36.731 -56.668   5.708  1.00  0.87           C  
ATOM   1517  O   LEU B 192      37.865 -56.577   5.246  1.00  0.87           O  
ATOM   1518  CB  LEU B 192      34.244 -56.641   5.132  1.00  0.87           C  
ATOM   1519  CG  LEU B 192      33.458 -56.580   6.472  1.00  0.87           C  
ATOM   1520  CD1 LEU B 192      32.656 -55.278   6.596  1.00  0.87           C  
ATOM   1521  CD2 LEU B 192      32.555 -57.804   6.687  1.00  0.87           C  
ATOM   1522  N   PHE B 193      36.495 -57.469   6.763  1.00  0.86           N  
ATOM   1523  CA  PHE B 193      37.495 -58.264   7.446  1.00  0.86           C  
ATOM   1524  C   PHE B 193      38.264 -59.200   6.503  1.00  0.86           C  
ATOM   1525  O   PHE B 193      37.638 -59.833   5.653  1.00  0.86           O  
ATOM   1526  CB  PHE B 193      36.806 -59.082   8.567  1.00  0.86           C  
ATOM   1527  CG  PHE B 193      37.737 -59.376   9.708  1.00  0.86           C  
ATOM   1528  CD1 PHE B 193      37.890 -58.442  10.744  1.00  0.86           C  
ATOM   1529  CD2 PHE B 193      38.464 -60.576   9.760  1.00  0.86           C  
ATOM   1530  CE1 PHE B 193      38.751 -58.697  11.816  1.00  0.86           C  
ATOM   1531  CE2 PHE B 193      39.315 -60.842  10.841  1.00  0.86           C  
ATOM   1532  CZ  PHE B 193      39.455 -59.903  11.870  1.00  0.86           C  
ATOM   1533  N   PRO B 194      39.587 -59.310   6.583  1.00  0.88           N  
ATOM   1534  CA  PRO B 194      40.354 -59.887   5.488  1.00  0.88           C  
ATOM   1535  C   PRO B 194      40.168 -61.373   5.330  1.00  0.88           C  
ATOM   1536  O   PRO B 194      40.222 -62.116   6.311  1.00  0.88           O  
ATOM   1537  CB  PRO B 194      41.818 -59.581   5.839  1.00  0.88           C  
ATOM   1538  CG  PRO B 194      41.813 -59.052   7.275  1.00  0.88           C  
ATOM   1539  CD  PRO B 194      40.422 -58.480   7.448  1.00  0.88           C  
ATOM   1540  N   VAL B 195      39.998 -61.848   4.091  1.00  0.84           N  
ATOM   1541  CA  VAL B 195      39.683 -63.234   3.840  1.00  0.84           C  
ATOM   1542  C   VAL B 195      40.795 -63.906   3.104  1.00  0.84           C  
ATOM   1543  O   VAL B 195      41.026 -63.693   1.917  1.00  0.84           O  
ATOM   1544  CB  VAL B 195      38.389 -63.402   3.067  1.00  0.84           C  
ATOM   1545  CG1 VAL B 195      38.163 -64.865   2.634  1.00  0.84           C  
ATOM   1546  CG2 VAL B 195      37.252 -62.936   3.985  1.00  0.84           C  
ATOM   1547  N   ILE B 196      41.503 -64.792   3.811  1.00  0.83           N  
ATOM   1548  CA  ILE B 196      42.547 -65.611   3.240  1.00  0.83           C  
ATOM   1549  C   ILE B 196      41.931 -66.746   2.434  1.00  0.83           C  
ATOM   1550  O   ILE B 196      41.167 -67.545   2.981  1.00  0.83           O  
ATOM   1551  CB  ILE B 196      43.512 -66.159   4.288  1.00  0.83           C  
ATOM   1552  CG1 ILE B 196      43.671 -65.207   5.493  1.00  0.83           C  
ATOM   1553  CG2 ILE B 196      44.868 -66.404   3.613  1.00  0.83           C  
ATOM   1554  CD1 ILE B 196      44.691 -65.686   6.524  1.00  0.83           C  
ATOM   1555  N   GLY B 197      42.215 -66.787   1.112  1.00  0.83           N  
ATOM   1556  CA  GLY B 197      41.748 -67.815   0.182  1.00  0.83           C  
ATOM   1557  C   GLY B 197      42.710 -68.960   0.037  1.00  0.83           C  
ATOM   1558  O   GLY B 197      42.324 -70.096  -0.222  1.00  0.83           O  
ATOM   1559  N   ALA B 198      44.007 -68.680   0.213  1.00  0.83           N  
ATOM   1560  CA  ALA B 198      45.019 -69.697   0.328  1.00  0.83           C  
ATOM   1561  C   ALA B 198      45.947 -69.254   1.436  1.00  0.83           C  
ATOM   1562  O   ALA B 198      46.325 -68.081   1.437  1.00  0.83           O  
ATOM   1563  CB  ALA B 198      45.848 -69.861  -0.959  1.00  0.83           C  
ATOM   1564  N   PRO B 199      46.362 -70.089   2.365  1.00  0.78           N  
ATOM   1565  CA  PRO B 199      45.930 -71.471   2.564  1.00  0.78           C  
ATOM   1566  C   PRO B 199      44.586 -71.569   3.277  1.00  0.78           C  
ATOM   1567  O   PRO B 199      43.856 -70.588   3.378  1.00  0.78           O  
ATOM   1568  CB  PRO B 199      47.068 -71.996   3.455  1.00  0.78           C  
ATOM   1569  CG  PRO B 199      47.413 -70.810   4.354  1.00  0.78           C  
ATOM   1570  CD  PRO B 199      47.282 -69.631   3.404  1.00  0.78           C  
ATOM   1571  N   ALA B 200      44.256 -72.762   3.795  1.00  0.76           N  
ATOM   1572  CA  ALA B 200      43.331 -72.907   4.897  1.00  0.76           C  
ATOM   1573  C   ALA B 200      44.204 -73.093   6.136  1.00  0.76           C  
ATOM   1574  O   ALA B 200      45.380 -72.738   6.139  1.00  0.76           O  
ATOM   1575  CB  ALA B 200      42.412 -74.115   4.643  1.00  0.76           C  
ATOM   1576  N   GLN B 201      43.720 -73.704   7.234  1.00  0.61           N  
ATOM   1577  CA  GLN B 201      44.681 -74.373   8.104  1.00  0.61           C  
ATOM   1578  C   GLN B 201      45.015 -75.741   7.506  1.00  0.61           C  
ATOM   1579  O   GLN B 201      44.124 -76.572   7.332  1.00  0.61           O  
ATOM   1580  CB  GLN B 201      44.193 -74.524   9.567  1.00  0.61           C  
ATOM   1581  CG  GLN B 201      45.113 -75.464  10.391  1.00  0.61           C  
ATOM   1582  CD  GLN B 201      44.918 -75.390  11.901  1.00  0.61           C  
ATOM   1583  OE1 GLN B 201      44.075 -74.679  12.446  1.00  0.61           O  
ATOM   1584  NE2 GLN B 201      45.776 -76.149  12.628  1.00  0.61           N  
ATOM   1585  N   ASN B 202      46.292 -76.003   7.143  1.00  0.63           N  
ATOM   1586  CA  ASN B 202      46.621 -77.237   6.439  1.00  0.63           C  
ATOM   1587  C   ASN B 202      48.091 -77.629   6.483  1.00  0.63           C  
ATOM   1588  O   ASN B 202      48.969 -76.832   6.804  1.00  0.63           O  
ATOM   1589  CB  ASN B 202      46.118 -77.232   4.953  1.00  0.63           C  
ATOM   1590  CG  ASN B 202      46.979 -76.443   3.962  1.00  0.63           C  
ATOM   1591  OD1 ASN B 202      46.737 -75.265   3.705  1.00  0.63           O  
ATOM   1592  ND2 ASN B 202      47.975 -77.117   3.337  1.00  0.63           N  
ATOM   1593  N   GLU B 203      48.384 -78.875   6.074  1.00  0.52           N  
ATOM   1594  CA  GLU B 203      49.732 -79.388   5.988  1.00  0.52           C  
ATOM   1595  C   GLU B 203      50.313 -79.300   4.574  1.00  0.52           C  
ATOM   1596  O   GLU B 203      49.650 -79.552   3.566  1.00  0.52           O  
ATOM   1597  CB  GLU B 203      49.798 -80.841   6.525  1.00  0.52           C  
ATOM   1598  CG  GLU B 203      50.192 -80.961   8.026  1.00  0.52           C  
ATOM   1599  CD  GLU B 203      49.183 -80.552   9.106  1.00  0.52           C  
ATOM   1600  OE1 GLU B 203      49.385 -81.009  10.265  1.00  0.52           O  
ATOM   1601  OE2 GLU B 203      48.264 -79.735   8.852  1.00  0.52           O  
ATOM   1602  N   ILE B 204      51.598 -78.925   4.470  1.00  0.55           N  
ATOM   1603  CA  ILE B 204      52.413 -79.051   3.276  1.00  0.55           C  
ATOM   1604  C   ILE B 204      53.540 -80.055   3.503  1.00  0.55           C  
ATOM   1605  O   ILE B 204      53.959 -80.743   2.571  1.00  0.55           O  
ATOM   1606  CB  ILE B 204      52.965 -77.715   2.786  1.00  0.55           C  
ATOM   1607  CG1 ILE B 204      53.813 -76.988   3.852  1.00  0.55           C  
ATOM   1608  CG2 ILE B 204      51.783 -76.851   2.290  1.00  0.55           C  
ATOM   1609  CD1 ILE B 204      54.523 -75.750   3.307  1.00  0.55           C  
ATOM   1610  N   LYS B 205      53.998 -80.269   4.764  1.00  0.38           N  
ATOM   1611  CA  LYS B 205      55.055 -81.227   5.082  1.00  0.38           C  
ATOM   1612  C   LYS B 205      54.754 -82.660   4.693  1.00  0.38           C  
ATOM   1613  O   LYS B 205      55.631 -83.418   4.290  1.00  0.38           O  
ATOM   1614  CB  LYS B 205      55.443 -81.207   6.583  1.00  0.38           C  
ATOM   1615  CG  LYS B 205      54.444 -81.890   7.537  1.00  0.38           C  
ATOM   1616  CD  LYS B 205      54.816 -81.791   9.020  1.00  0.38           C  
ATOM   1617  CE  LYS B 205      53.796 -82.527   9.889  1.00  0.38           C  
ATOM   1618  NZ  LYS B 205      54.097 -82.306  11.316  1.00  0.38           N  
ATOM   1619  N   GLU B 206      53.479 -83.063   4.809  1.00  0.34           N  
ATOM   1620  CA  GLU B 206      53.033 -84.406   4.543  1.00  0.34           C  
ATOM   1621  C   GLU B 206      52.966 -84.719   3.067  1.00  0.34           C  
ATOM   1622  O   GLU B 206      52.925 -85.881   2.673  1.00  0.34           O  
ATOM   1623  CB  GLU B 206      51.619 -84.573   5.128  1.00  0.34           C  
ATOM   1624  CG  GLU B 206      51.598 -84.551   6.672  1.00  0.34           C  
ATOM   1625  CD  GLU B 206      50.219 -84.857   7.253  1.00  0.34           C  
ATOM   1626  OE1 GLU B 206      49.216 -84.782   6.502  1.00  0.34           O  
ATOM   1627  OE2 GLU B 206      50.194 -85.171   8.471  1.00  0.34           O  
ATOM   1628  N   VAL B 207      52.952 -83.685   2.206  1.00  0.33           N  
ATOM   1629  CA  VAL B 207      52.683 -83.895   0.796  1.00  0.33           C  
ATOM   1630  C   VAL B 207      53.835 -83.499  -0.093  1.00  0.33           C  
ATOM   1631  O   VAL B 207      54.138 -84.191  -1.064  1.00  0.33           O  
ATOM   1632  CB  VAL B 207      51.409 -83.165   0.368  1.00  0.33           C  
ATOM   1633  CG1 VAL B 207      50.212 -83.793   1.104  1.00  0.33           C  
ATOM   1634  CG2 VAL B 207      51.440 -81.652   0.666  1.00  0.33           C  
ATOM   1635  N   GLU B 208      54.543 -82.409   0.229  1.00  0.33           N  
ATOM   1636  CA  GLU B 208      55.543 -81.854  -0.652  1.00  0.33           C  
ATOM   1637  C   GLU B 208      56.713 -81.338   0.159  1.00  0.33           C  
ATOM   1638  O   GLU B 208      57.204 -80.237  -0.080  1.00  0.33           O  
ATOM   1639  CB  GLU B 208      54.985 -80.692  -1.503  1.00  0.33           C  
ATOM   1640  CG  GLU B 208      53.972 -81.120  -2.589  1.00  0.33           C  
ATOM   1641  CD  GLU B 208      53.742 -79.995  -3.589  1.00  0.33           C  
ATOM   1642  OE1 GLU B 208      52.964 -79.068  -3.258  1.00  0.33           O  
ATOM   1643  OE2 GLU B 208      54.373 -80.045  -4.685  1.00  0.33           O  
ATOM   1644  N   ILE B 209      57.239 -82.134   1.121  1.00  0.37           N  
ATOM   1645  CA  ILE B 209      58.297 -81.736   2.053  1.00  0.37           C  
ATOM   1646  C   ILE B 209      59.476 -81.022   1.428  1.00  0.37           C  
ATOM   1647  O   ILE B 209      59.870 -79.967   1.918  1.00  0.37           O  
ATOM   1648  CB  ILE B 209      58.756 -82.925   2.901  1.00  0.37           C  
ATOM   1649  CG1 ILE B 209      59.638 -82.545   4.111  1.00  0.37           C  
ATOM   1650  CG2 ILE B 209      59.469 -84.016   2.072  1.00  0.37           C  
ATOM   1651  CD1 ILE B 209      58.878 -81.869   5.250  1.00  0.37           C  
ATOM   1652  N   GLY B 210      59.992 -81.509   0.280  1.00  0.43           N  
ATOM   1653  CA  GLY B 210      61.109 -80.928  -0.464  1.00  0.43           C  
ATOM   1654  C   GLY B 210      60.816 -79.666  -1.226  1.00  0.43           C  
ATOM   1655  O   GLY B 210      61.706 -79.042  -1.788  1.00  0.43           O  
ATOM   1656  N   LYS B 211      59.543 -79.265  -1.293  1.00  0.35           N  
ATOM   1657  CA  LYS B 211      59.103 -78.130  -2.066  1.00  0.35           C  
ATOM   1658  C   LYS B 211      58.309 -77.146  -1.227  1.00  0.35           C  
ATOM   1659  O   LYS B 211      57.676 -76.249  -1.781  1.00  0.35           O  
ATOM   1660  CB  LYS B 211      58.222 -78.602  -3.245  1.00  0.35           C  
ATOM   1661  CG  LYS B 211      58.966 -79.398  -4.331  1.00  0.35           C  
ATOM   1662  CD  LYS B 211      58.031 -79.734  -5.505  1.00  0.35           C  
ATOM   1663  CE  LYS B 211      58.706 -80.517  -6.629  1.00  0.35           C  
ATOM   1664  NZ  LYS B 211      57.706 -80.789  -7.682  1.00  0.35           N  
ATOM   1665  N   ASN B 212      58.374 -77.225   0.123  1.00  0.34           N  
ATOM   1666  CA  ASN B 212      57.588 -76.412   1.060  1.00  0.34           C  
ATOM   1667  C   ASN B 212      57.780 -74.894   0.895  1.00  0.34           C  
ATOM   1668  O   ASN B 212      56.974 -74.058   1.293  1.00  0.34           O  
ATOM   1669  CB  ASN B 212      57.990 -76.798   2.510  1.00  0.34           C  
ATOM   1670  CG  ASN B 212      57.398 -78.127   2.975  1.00  0.34           C  
ATOM   1671  OD1 ASN B 212      56.475 -78.687   2.393  1.00  0.34           O  
ATOM   1672  ND2 ASN B 212      57.915 -78.636   4.118  1.00  0.34           N  
ATOM   1673  N   ALA B 213      58.843 -74.531   0.202  1.00  0.41           N  
ATOM   1674  CA  ALA B 213      59.182 -73.260  -0.363  1.00  0.41           C  
ATOM   1675  C   ALA B 213      58.175 -72.606  -1.296  1.00  0.41           C  
ATOM   1676  O   ALA B 213      58.011 -71.390  -1.321  1.00  0.41           O  
ATOM   1677  CB  ALA B 213      60.382 -73.656  -1.186  1.00  0.41           C  
ATOM   1678  N   ASN B 214      57.442 -73.398  -2.081  1.00  0.61           N  
ATOM   1679  CA  ASN B 214      56.631 -72.962  -3.220  1.00  0.61           C  
ATOM   1680  C   ASN B 214      55.207 -72.598  -2.764  1.00  0.61           C  
ATOM   1681  O   ASN B 214      54.283 -72.347  -3.535  1.00  0.61           O  
ATOM   1682  CB  ASN B 214      56.648 -74.089  -4.295  1.00  0.61           C  
ATOM   1683  CG  ASN B 214      58.055 -74.299  -4.861  1.00  0.61           C  
ATOM   1684  OD1 ASN B 214      58.521 -73.561  -5.729  1.00  0.61           O  
ATOM   1685  ND2 ASN B 214      58.774 -75.341  -4.384  1.00  0.61           N  
ATOM   1686  N   LEU B 215      55.091 -72.522  -1.430  1.00  0.72           N  
ATOM   1687  CA  LEU B 215      54.026 -72.075  -0.557  1.00  0.72           C  
ATOM   1688  C   LEU B 215      53.623 -70.624  -0.735  1.00  0.72           C  
ATOM   1689  O   LEU B 215      54.429 -69.701  -0.819  1.00  0.72           O  
ATOM   1690  CB  LEU B 215      54.506 -72.326   0.897  1.00  0.72           C  
ATOM   1691  CG  LEU B 215      53.738 -71.679   2.066  1.00  0.72           C  
ATOM   1692  CD1 LEU B 215      52.303 -72.202   2.181  1.00  0.72           C  
ATOM   1693  CD2 LEU B 215      54.488 -71.879   3.394  1.00  0.72           C  
ATOM   1694  N   THR B 216      52.302 -70.388  -0.747  1.00  0.78           N  
ATOM   1695  CA  THR B 216      51.728 -69.111  -1.115  1.00  0.78           C  
ATOM   1696  C   THR B 216      50.579 -68.772  -0.186  1.00  0.78           C  
ATOM   1697  O   THR B 216      49.936 -69.642   0.403  1.00  0.78           O  
ATOM   1698  CB  THR B 216      51.292 -69.101  -2.582  1.00  0.78           C  
ATOM   1699  OG1 THR B 216      50.765 -67.841  -2.977  1.00  0.78           O  
ATOM   1700  CG2 THR B 216      50.233 -70.184  -2.839  1.00  0.78           C  
ATOM   1701  N   CYS B 217      50.347 -67.469   0.016  1.00  0.83           N  
ATOM   1702  CA  CYS B 217      49.340 -66.906   0.892  1.00  0.83           C  
ATOM   1703  C   CYS B 217      48.608 -65.831   0.107  1.00  0.83           C  
ATOM   1704  O   CYS B 217      49.217 -64.860  -0.325  1.00  0.83           O  
ATOM   1705  CB  CYS B 217      50.049 -66.334   2.150  1.00  0.83           C  
ATOM   1706  SG  CYS B 217      49.199 -65.155   3.242  1.00  0.83           S  
ATOM   1707  N   SER B 218      47.289 -65.953  -0.122  1.00  0.82           N  
ATOM   1708  CA  SER B 218      46.512 -64.954  -0.861  1.00  0.82           C  
ATOM   1709  C   SER B 218      45.295 -64.568  -0.058  1.00  0.82           C  
ATOM   1710  O   SER B 218      44.575 -65.425   0.457  1.00  0.82           O  
ATOM   1711  CB  SER B 218      46.078 -65.403  -2.290  1.00  0.82           C  
ATOM   1712  OG  SER B 218      45.051 -64.568  -2.848  1.00  0.82           O  
ATOM   1713  N   ALA B 219      45.016 -63.256   0.049  1.00  0.85           N  
ATOM   1714  CA  ALA B 219      43.879 -62.785   0.796  1.00  0.85           C  
ATOM   1715  C   ALA B 219      43.202 -61.565   0.215  1.00  0.85           C  
ATOM   1716  O   ALA B 219      43.795 -60.690  -0.416  1.00  0.85           O  
ATOM   1717  CB  ALA B 219      44.232 -62.512   2.260  1.00  0.85           C  
ATOM   1718  N   CYS B 220      41.886 -61.506   0.436  1.00  0.79           N  
ATOM   1719  CA  CYS B 220      40.984 -60.537  -0.154  1.00  0.79           C  
ATOM   1720  C   CYS B 220      40.426 -59.563   0.856  1.00  0.79           C  
ATOM   1721  O   CYS B 220      40.110 -59.931   1.993  1.00  0.79           O  
ATOM   1722  CB  CYS B 220      39.825 -61.227  -0.879  1.00  0.79           C  
ATOM   1723  SG  CYS B 220      40.439 -62.216  -2.272  1.00  0.79           S  
ATOM   1724  N   PHE B 221      40.323 -58.273   0.497  1.00  0.80           N  
ATOM   1725  CA  PHE B 221      40.003 -57.264   1.505  1.00  0.80           C  
ATOM   1726  C   PHE B 221      38.745 -56.479   1.203  1.00  0.80           C  
ATOM   1727  O   PHE B 221      38.170 -55.831   2.078  1.00  0.80           O  
ATOM   1728  CB  PHE B 221      41.154 -56.236   1.665  1.00  0.80           C  
ATOM   1729  CG  PHE B 221      42.438 -56.905   2.050  1.00  0.80           C  
ATOM   1730  CD1 PHE B 221      42.838 -56.956   3.395  1.00  0.80           C  
ATOM   1731  CD2 PHE B 221      43.273 -57.467   1.069  1.00  0.80           C  
ATOM   1732  CE1 PHE B 221      44.022 -57.601   3.760  1.00  0.80           C  
ATOM   1733  CE2 PHE B 221      44.467 -58.094   1.435  1.00  0.80           C  
ATOM   1734  CZ  PHE B 221      44.825 -58.176   2.782  1.00  0.80           C  
ATOM   1735  N   GLY B 222      38.258 -56.520  -0.048  1.00  0.81           N  
ATOM   1736  CA  GLY B 222      37.135 -55.683  -0.428  1.00  0.81           C  
ATOM   1737  C   GLY B 222      37.000 -55.517  -1.912  1.00  0.81           C  
ATOM   1738  O   GLY B 222      37.531 -56.292  -2.699  1.00  0.81           O  
ATOM   1739  N   LYS B 223      36.244 -54.478  -2.313  1.00  0.73           N  
ATOM   1740  CA  LYS B 223      36.062 -54.077  -3.702  1.00  0.73           C  
ATOM   1741  C   LYS B 223      37.003 -52.954  -4.090  1.00  0.73           C  
ATOM   1742  O   LYS B 223      37.593 -52.929  -5.164  1.00  0.73           O  
ATOM   1743  CB  LYS B 223      34.604 -53.565  -3.917  1.00  0.73           C  
ATOM   1744  CG  LYS B 223      34.282 -53.168  -5.370  1.00  0.73           C  
ATOM   1745  CD  LYS B 223      32.945 -52.444  -5.589  1.00  0.73           C  
ATOM   1746  CE  LYS B 223      32.757 -52.109  -7.074  1.00  0.73           C  
ATOM   1747  NZ  LYS B 223      31.578 -51.246  -7.278  1.00  0.73           N  
ATOM   1748  N   GLY B 224      37.116 -51.937  -3.217  1.00  0.74           N  
ATOM   1749  CA  GLY B 224      37.823 -50.712  -3.561  1.00  0.74           C  
ATOM   1750  C   GLY B 224      39.310 -50.766  -3.451  1.00  0.74           C  
ATOM   1751  O   GLY B 224      39.914 -51.736  -2.996  1.00  0.74           O  
ATOM   1752  N   THR B 225      39.960 -49.649  -3.799  1.00  0.61           N  
ATOM   1753  CA  THR B 225      41.376 -49.464  -3.514  1.00  0.61           C  
ATOM   1754  C   THR B 225      41.529 -49.156  -2.028  1.00  0.61           C  
ATOM   1755  O   THR B 225      40.894 -48.260  -1.471  1.00  0.61           O  
ATOM   1756  CB  THR B 225      42.094 -48.474  -4.437  1.00  0.61           C  
ATOM   1757  OG1 THR B 225      43.451 -48.296  -4.062  1.00  0.61           O  
ATOM   1758  CG2 THR B 225      41.413 -47.106  -4.452  1.00  0.61           C  
ATOM   1759  N   GLN B 226      42.309 -49.984  -1.317  1.00  0.69           N  
ATOM   1760  CA  GLN B 226      42.394 -49.945   0.125  1.00  0.69           C  
ATOM   1761  C   GLN B 226      43.447 -48.950   0.569  1.00  0.69           C  
ATOM   1762  O   GLN B 226      44.533 -48.884   0.003  1.00  0.69           O  
ATOM   1763  CB  GLN B 226      42.755 -51.346   0.686  1.00  0.69           C  
ATOM   1764  CG  GLN B 226      41.849 -52.494   0.182  1.00  0.69           C  
ATOM   1765  CD  GLN B 226      40.400 -52.316   0.621  1.00  0.69           C  
ATOM   1766  OE1 GLN B 226      40.060 -52.529   1.781  1.00  0.69           O  
ATOM   1767  NE2 GLN B 226      39.514 -51.934  -0.321  1.00  0.69           N  
ATOM   1768  N   PHE B 227      43.171 -48.161   1.631  1.00  0.72           N  
ATOM   1769  CA  PHE B 227      44.207 -47.377   2.297  1.00  0.72           C  
ATOM   1770  C   PHE B 227      45.282 -48.297   2.878  1.00  0.72           C  
ATOM   1771  O   PHE B 227      46.484 -48.095   2.728  1.00  0.72           O  
ATOM   1772  CB  PHE B 227      43.566 -46.531   3.445  1.00  0.72           C  
ATOM   1773  CG  PHE B 227      44.589 -45.950   4.398  1.00  0.72           C  
ATOM   1774  CD1 PHE B 227      45.554 -45.032   3.953  1.00  0.72           C  
ATOM   1775  CD2 PHE B 227      44.676 -46.450   5.708  1.00  0.72           C  
ATOM   1776  CE1 PHE B 227      46.609 -44.649   4.793  1.00  0.72           C  
ATOM   1777  CE2 PHE B 227      45.723 -46.066   6.553  1.00  0.72           C  
ATOM   1778  CZ  PHE B 227      46.697 -45.173   6.089  1.00  0.72           C  
ATOM   1779  N   LEU B 228      44.816 -49.346   3.566  1.00  0.81           N  
ATOM   1780  CA  LEU B 228      45.667 -50.291   4.224  1.00  0.81           C  
ATOM   1781  C   LEU B 228      45.107 -51.650   3.929  1.00  0.81           C  
ATOM   1782  O   LEU B 228      43.999 -51.979   4.331  1.00  0.81           O  
ATOM   1783  CB  LEU B 228      45.683 -49.997   5.748  1.00  0.81           C  
ATOM   1784  CG  LEU B 228      46.617 -50.829   6.652  1.00  0.81           C  
ATOM   1785  CD1 LEU B 228      45.945 -52.098   7.179  1.00  0.81           C  
ATOM   1786  CD2 LEU B 228      47.949 -51.155   5.979  1.00  0.81           C  
ATOM   1787  N   ALA B 229      45.872 -52.464   3.205  1.00  0.84           N  
ATOM   1788  CA  ALA B 229      45.625 -53.867   3.068  1.00  0.84           C  
ATOM   1789  C   ALA B 229      46.993 -54.473   2.962  1.00  0.84           C  
ATOM   1790  O   ALA B 229      47.841 -53.974   2.223  1.00  0.84           O  
ATOM   1791  CB  ALA B 229      44.837 -54.182   1.793  1.00  0.84           C  
ATOM   1792  N   ALA B 230      47.268 -55.545   3.706  1.00  0.85           N  
ATOM   1793  CA  ALA B 230      48.510 -56.245   3.529  1.00  0.85           C  
ATOM   1794  C   ALA B 230      48.288 -57.699   3.843  1.00  0.85           C  
ATOM   1795  O   ALA B 230      47.615 -58.052   4.813  1.00  0.85           O  
ATOM   1796  CB  ALA B 230      49.634 -55.656   4.403  1.00  0.85           C  
ATOM   1797  N   VAL B 231      48.872 -58.586   3.026  1.00  0.84           N  
ATOM   1798  CA  VAL B 231      49.030 -59.978   3.389  1.00  0.84           C  
ATOM   1799  C   VAL B 231      50.509 -60.142   3.592  1.00  0.84           C  
ATOM   1800  O   VAL B 231      51.314 -59.481   2.937  1.00  0.84           O  
ATOM   1801  CB  VAL B 231      48.470 -61.034   2.433  1.00  0.84           C  
ATOM   1802  CG1 VAL B 231      47.231 -60.518   1.711  1.00  0.84           C  
ATOM   1803  CG2 VAL B 231      49.473 -61.514   1.390  1.00  0.84           C  
ATOM   1804  N   LEU B 232      50.919 -60.987   4.533  1.00  0.82           N  
ATOM   1805  CA  LEU B 232      52.319 -61.136   4.827  1.00  0.82           C  
ATOM   1806  C   LEU B 232      52.540 -62.494   5.438  1.00  0.82           C  
ATOM   1807  O   LEU B 232      51.621 -63.129   5.959  1.00  0.82           O  
ATOM   1808  CB  LEU B 232      52.884 -60.015   5.738  1.00  0.82           C  
ATOM   1809  CG  LEU B 232      52.235 -59.901   7.130  1.00  0.82           C  
ATOM   1810  CD1 LEU B 232      53.316 -59.693   8.197  1.00  0.82           C  
ATOM   1811  CD2 LEU B 232      51.202 -58.770   7.199  1.00  0.82           C  
ATOM   1812  N   TRP B 233      53.785 -62.985   5.370  1.00  0.78           N  
ATOM   1813  CA  TRP B 233      54.161 -64.218   6.020  1.00  0.78           C  
ATOM   1814  C   TRP B 233      54.841 -63.930   7.331  1.00  0.78           C  
ATOM   1815  O   TRP B 233      55.695 -63.051   7.453  1.00  0.78           O  
ATOM   1816  CB  TRP B 233      55.110 -65.102   5.180  1.00  0.78           C  
ATOM   1817  CG  TRP B 233      54.384 -65.892   4.120  1.00  0.78           C  
ATOM   1818  CD1 TRP B 233      54.273 -65.678   2.776  1.00  0.78           C  
ATOM   1819  CD2 TRP B 233      53.629 -67.073   4.416  1.00  0.78           C  
ATOM   1820  NE1 TRP B 233      53.473 -66.643   2.209  1.00  0.78           N  
ATOM   1821  CE2 TRP B 233      53.081 -67.518   3.192  1.00  0.78           C  
ATOM   1822  CE3 TRP B 233      53.384 -67.752   5.608  1.00  0.78           C  
ATOM   1823  CZ2 TRP B 233      52.278 -68.640   3.149  1.00  0.78           C  
ATOM   1824  CZ3 TRP B 233      52.529 -68.860   5.564  1.00  0.78           C  
ATOM   1825  CH2 TRP B 233      51.980 -69.291   4.350  1.00  0.78           C  
ATOM   1826  N   GLN B 234      54.462 -64.705   8.347  1.00  0.77           N  
ATOM   1827  CA  GLN B 234      55.079 -64.706   9.638  1.00  0.77           C  
ATOM   1828  C   GLN B 234      55.548 -66.122   9.922  1.00  0.77           C  
ATOM   1829  O   GLN B 234      55.012 -67.106   9.419  1.00  0.77           O  
ATOM   1830  CB  GLN B 234      54.088 -64.179  10.696  1.00  0.77           C  
ATOM   1831  CG  GLN B 234      54.765 -63.355  11.803  1.00  0.77           C  
ATOM   1832  CD  GLN B 234      53.767 -62.669  12.738  1.00  0.77           C  
ATOM   1833  OE1 GLN B 234      52.739 -63.206  13.158  1.00  0.77           O  
ATOM   1834  NE2 GLN B 234      54.086 -61.396  13.078  1.00  0.77           N  
ATOM   1835  N   LEU B 235      56.627 -66.252  10.688  1.00  0.77           N  
ATOM   1836  CA  LEU B 235      57.359 -67.478  10.880  1.00  0.77           C  
ATOM   1837  C   LEU B 235      57.569 -67.665  12.373  1.00  0.77           C  
ATOM   1838  O   LEU B 235      58.236 -66.850  13.010  1.00  0.77           O  
ATOM   1839  CB  LEU B 235      58.727 -67.302  10.176  1.00  0.77           C  
ATOM   1840  CG  LEU B 235      59.310 -68.565   9.536  1.00  0.77           C  
ATOM   1841  CD1 LEU B 235      58.630 -68.821   8.187  1.00  0.77           C  
ATOM   1842  CD2 LEU B 235      60.822 -68.403   9.371  1.00  0.77           C  
ATOM   1843  N   ASN B 236      56.961 -68.691  13.014  1.00  0.74           N  
ATOM   1844  CA  ASN B 236      56.965 -68.859  14.473  1.00  0.74           C  
ATOM   1845  C   ASN B 236      56.301 -67.649  15.167  1.00  0.74           C  
ATOM   1846  O   ASN B 236      56.610 -67.271  16.292  1.00  0.74           O  
ATOM   1847  CB  ASN B 236      58.432 -69.130  14.951  1.00  0.74           C  
ATOM   1848  CG  ASN B 236      58.651 -69.648  16.370  1.00  0.74           C  
ATOM   1849  OD1 ASN B 236      59.011 -70.807  16.573  1.00  0.74           O  
ATOM   1850  ND2 ASN B 236      58.567 -68.749  17.366  1.00  0.74           N  
ATOM   1851  N   GLY B 237      55.385 -66.948  14.477  1.00  0.82           N  
ATOM   1852  CA  GLY B 237      54.866 -65.683  14.991  1.00  0.82           C  
ATOM   1853  C   GLY B 237      55.806 -64.489  14.941  1.00  0.82           C  
ATOM   1854  O   GLY B 237      55.488 -63.419  15.454  1.00  0.82           O  
ATOM   1855  N   THR B 238      56.984 -64.600  14.296  1.00  0.75           N  
ATOM   1856  CA  THR B 238      57.920 -63.485  14.118  1.00  0.75           C  
ATOM   1857  C   THR B 238      58.202 -63.354  12.631  1.00  0.75           C  
ATOM   1858  O   THR B 238      57.864 -64.227  11.851  1.00  0.75           O  
ATOM   1859  CB  THR B 238      59.220 -63.557  14.940  1.00  0.75           C  
ATOM   1860  OG1 THR B 238      60.307 -64.190  14.276  1.00  0.75           O  
ATOM   1861  CG2 THR B 238      58.988 -64.306  16.258  1.00  0.75           C  
ATOM   1862  N   LYS B 239      58.777 -62.251  12.126  1.00  0.68           N  
ATOM   1863  CA  LYS B 239      59.039 -62.179  10.685  1.00  0.68           C  
ATOM   1864  C   LYS B 239      60.390 -62.734  10.240  1.00  0.68           C  
ATOM   1865  O   LYS B 239      60.586 -62.957   9.051  1.00  0.68           O  
ATOM   1866  CB  LYS B 239      58.938 -60.725  10.123  1.00  0.68           C  
ATOM   1867  CG  LYS B 239      58.411 -59.653  11.086  1.00  0.68           C  
ATOM   1868  CD  LYS B 239      58.409 -58.257  10.430  1.00  0.68           C  
ATOM   1869  CE  LYS B 239      57.476 -57.270  11.136  1.00  0.68           C  
ATOM   1870  NZ  LYS B 239      57.414 -55.989  10.394  1.00  0.68           N  
ATOM   1871  N   ILE B 240      61.358 -62.915  11.163  1.00  0.50           N  
ATOM   1872  CA  ILE B 240      62.769 -62.802  10.771  1.00  0.50           C  
ATOM   1873  C   ILE B 240      63.692 -63.908  11.284  1.00  0.50           C  
ATOM   1874  O   ILE B 240      64.918 -63.790  11.261  1.00  0.50           O  
ATOM   1875  CB  ILE B 240      63.278 -61.372  11.079  1.00  0.50           C  
ATOM   1876  CG1 ILE B 240      64.262 -60.848  10.008  1.00  0.50           C  
ATOM   1877  CG2 ILE B 240      63.853 -61.230  12.504  1.00  0.50           C  
ATOM   1878  CD1 ILE B 240      63.594 -60.616   8.649  1.00  0.50           C  
ATOM   1879  N   THR B 241      63.166 -65.063  11.749  1.00  0.64           N  
ATOM   1880  CA  THR B 241      64.044 -66.207  12.043  1.00  0.64           C  
ATOM   1881  C   THR B 241      64.530 -66.871  10.759  1.00  0.64           C  
ATOM   1882  O   THR B 241      63.730 -67.194   9.884  1.00  0.64           O  
ATOM   1883  CB  THR B 241      63.516 -67.269  13.022  1.00  0.64           C  
ATOM   1884  OG1 THR B 241      62.579 -68.170  12.441  1.00  0.64           O  
ATOM   1885  CG2 THR B 241      62.791 -66.582  14.182  1.00  0.64           C  
ATOM   1886  N   ASP B 242      65.852 -67.075  10.605  1.00  0.69           N  
ATOM   1887  CA  ASP B 242      66.418 -67.290   9.282  1.00  0.69           C  
ATOM   1888  C   ASP B 242      67.489 -68.385   9.249  1.00  0.69           C  
ATOM   1889  O   ASP B 242      68.352 -68.474  10.129  1.00  0.69           O  
ATOM   1890  CB  ASP B 242      67.054 -65.942   8.797  1.00  0.69           C  
ATOM   1891  CG  ASP B 242      66.390 -65.356   7.556  1.00  0.69           C  
ATOM   1892  OD1 ASP B 242      65.488 -66.014   6.989  1.00  0.69           O  
ATOM   1893  OD2 ASP B 242      66.795 -64.224   7.176  1.00  0.69           O  
ATOM   1894  N   PHE B 243      67.493 -69.234   8.188  1.00  0.62           N  
ATOM   1895  CA  PHE B 243      68.732 -69.719   7.588  1.00  0.62           C  
ATOM   1896  C   PHE B 243      68.976 -68.798   6.382  1.00  0.62           C  
ATOM   1897  O   PHE B 243      68.583 -67.645   6.398  1.00  0.62           O  
ATOM   1898  CB  PHE B 243      68.816 -71.289   7.408  1.00  0.62           C  
ATOM   1899  CG  PHE B 243      68.083 -71.966   6.263  1.00  0.62           C  
ATOM   1900  CD1 PHE B 243      66.905 -72.706   6.491  1.00  0.62           C  
ATOM   1901  CD2 PHE B 243      68.640 -72.008   4.968  1.00  0.62           C  
ATOM   1902  CE1 PHE B 243      66.236 -73.333   5.429  1.00  0.62           C  
ATOM   1903  CE2 PHE B 243      67.974 -72.614   3.903  1.00  0.62           C  
ATOM   1904  CZ  PHE B 243      66.762 -73.260   4.134  1.00  0.62           C  
ATOM   1905  N   GLY B 244      69.615 -69.212   5.273  1.00  0.67           N  
ATOM   1906  CA  GLY B 244      69.556 -68.422   4.035  1.00  0.67           C  
ATOM   1907  C   GLY B 244      68.172 -68.280   3.429  1.00  0.67           C  
ATOM   1908  O   GLY B 244      67.928 -67.387   2.627  1.00  0.67           O  
ATOM   1909  N   GLU B 245      67.245 -69.169   3.810  1.00  0.64           N  
ATOM   1910  CA  GLU B 245      65.831 -69.016   3.569  1.00  0.64           C  
ATOM   1911  C   GLU B 245      65.169 -69.358   4.919  1.00  0.64           C  
ATOM   1912  O   GLU B 245      65.890 -69.883   5.773  1.00  0.64           O  
ATOM   1913  CB  GLU B 245      65.347 -69.997   2.472  1.00  0.64           C  
ATOM   1914  CG  GLU B 245      65.949 -69.894   1.035  1.00  0.64           C  
ATOM   1915  CD  GLU B 245      65.423 -68.783   0.108  1.00  0.64           C  
ATOM   1916  OE1 GLU B 245      64.186 -68.703  -0.090  1.00  0.64           O  
ATOM   1917  OE2 GLU B 245      66.236 -68.060  -0.521  1.00  0.64           O  
ATOM   1918  N   PRO B 246      63.888 -69.164   5.238  1.00  0.67           N  
ATOM   1919  CA  PRO B 246      62.814 -68.631   4.407  1.00  0.67           C  
ATOM   1920  C   PRO B 246      63.020 -67.248   3.868  1.00  0.67           C  
ATOM   1921  O   PRO B 246      63.727 -66.438   4.454  1.00  0.67           O  
ATOM   1922  CB  PRO B 246      61.579 -68.676   5.319  1.00  0.67           C  
ATOM   1923  CG  PRO B 246      61.902 -69.830   6.258  1.00  0.67           C  
ATOM   1924  CD  PRO B 246      63.381 -69.613   6.532  1.00  0.67           C  
ATOM   1925  N   ARG B 247      62.380 -66.917   2.752  1.00  0.65           N  
ATOM   1926  CA  ARG B 247      62.479 -65.575   2.243  1.00  0.65           C  
ATOM   1927  C   ARG B 247      61.188 -65.215   1.525  1.00  0.65           C  
ATOM   1928  O   ARG B 247      60.493 -66.068   0.976  1.00  0.65           O  
ATOM   1929  CB  ARG B 247      63.725 -65.438   1.350  1.00  0.65           C  
ATOM   1930  CG  ARG B 247      64.224 -63.990   1.182  1.00  0.65           C  
ATOM   1931  CD  ARG B 247      65.075 -63.784  -0.079  1.00  0.65           C  
ATOM   1932  NE  ARG B 247      64.382 -64.431  -1.242  1.00  0.65           N  
ATOM   1933  CZ  ARG B 247      63.174 -64.055  -1.688  1.00  0.65           C  
ATOM   1934  NH1 ARG B 247      62.624 -62.897  -1.337  1.00  0.65           N  
ATOM   1935  NH2 ARG B 247      62.518 -64.863  -2.513  1.00  0.65           N  
ATOM   1936  N   ILE B 248      60.783 -63.936   1.542  1.00  0.71           N  
ATOM   1937  CA  ILE B 248      59.421 -63.503   1.254  1.00  0.71           C  
ATOM   1938  C   ILE B 248      59.323 -62.729  -0.061  1.00  0.71           C  
ATOM   1939  O   ILE B 248      60.239 -62.008  -0.460  1.00  0.71           O  
ATOM   1940  CB  ILE B 248      58.894 -62.700   2.447  1.00  0.71           C  
ATOM   1941  CG1 ILE B 248      57.381 -62.419   2.367  1.00  0.71           C  
ATOM   1942  CG2 ILE B 248      59.732 -61.420   2.659  1.00  0.71           C  
ATOM   1943  CD1 ILE B 248      56.806 -61.820   3.658  1.00  0.71           C  
ATOM   1944  N   GLN B 249      58.230 -62.904  -0.829  1.00  0.67           N  
ATOM   1945  CA  GLN B 249      58.040 -62.240  -2.119  1.00  0.67           C  
ATOM   1946  C   GLN B 249      56.575 -61.979  -2.463  1.00  0.67           C  
ATOM   1947  O   GLN B 249      55.687 -62.673  -1.991  1.00  0.67           O  
ATOM   1948  CB  GLN B 249      58.742 -62.976  -3.297  1.00  0.67           C  
ATOM   1949  CG  GLN B 249      58.937 -64.506  -3.114  1.00  0.67           C  
ATOM   1950  CD  GLN B 249      59.667 -65.171  -4.281  1.00  0.67           C  
ATOM   1951  OE1 GLN B 249      59.886 -66.382  -4.329  1.00  0.67           O  
ATOM   1952  NE2 GLN B 249      60.197 -64.347  -5.211  1.00  0.67           N  
ATOM   1953  N   GLN B 250      56.281 -60.943  -3.276  1.00  0.65           N  
ATOM   1954  CA  GLN B 250      54.950 -60.358  -3.414  1.00  0.65           C  
ATOM   1955  C   GLN B 250      54.472 -60.375  -4.845  1.00  0.65           C  
ATOM   1956  O   GLN B 250      55.299 -60.449  -5.759  1.00  0.65           O  
ATOM   1957  CB  GLN B 250      54.995 -58.856  -2.987  1.00  0.65           C  
ATOM   1958  CG  GLN B 250      53.641 -58.253  -2.522  1.00  0.65           C  
ATOM   1959  CD  GLN B 250      53.169 -57.028  -3.322  1.00  0.65           C  
ATOM   1960  OE1 GLN B 250      53.957 -56.306  -3.938  1.00  0.65           O  
ATOM   1961  NE2 GLN B 250      51.847 -56.765  -3.234  1.00  0.65           N  
ATOM   1962  N   GLU B 251      53.158 -60.234  -5.074  1.00  0.61           N  
ATOM   1963  CA  GLU B 251      52.627 -60.031  -6.396  1.00  0.61           C  
ATOM   1964  C   GLU B 251      51.372 -59.171  -6.306  1.00  0.61           C  
ATOM   1965  O   GLU B 251      50.884 -58.849  -5.220  1.00  0.61           O  
ATOM   1966  CB  GLU B 251      52.386 -61.378  -7.133  1.00  0.61           C  
ATOM   1967  CG  GLU B 251      53.142 -61.507  -8.485  1.00  0.61           C  
ATOM   1968  CD  GLU B 251      53.963 -62.794  -8.649  1.00  0.61           C  
ATOM   1969  OE1 GLU B 251      53.414 -63.904  -8.443  1.00  0.61           O  
ATOM   1970  OE2 GLU B 251      55.153 -62.672  -9.049  1.00  0.61           O  
ATOM   1971  N   GLU B 252      50.865 -58.716  -7.466  1.00  0.60           N  
ATOM   1972  CA  GLU B 252      49.701 -57.859  -7.578  1.00  0.60           C  
ATOM   1973  C   GLU B 252      48.973 -58.281  -8.829  1.00  0.60           C  
ATOM   1974  O   GLU B 252      49.576 -58.455  -9.888  1.00  0.60           O  
ATOM   1975  CB  GLU B 252      50.038 -56.367  -7.826  1.00  0.60           C  
ATOM   1976  CG  GLU B 252      50.593 -55.598  -6.608  1.00  0.60           C  
ATOM   1977  CD  GLU B 252      49.513 -55.174  -5.615  1.00  0.60           C  
ATOM   1978  OE1 GLU B 252      48.383 -54.853  -6.071  1.00  0.60           O  
ATOM   1979  OE2 GLU B 252      49.829 -55.123  -4.400  1.00  0.60           O  
ATOM   1980  N   GLY B 253      47.637 -58.414  -8.776  1.00  0.70           N  
ATOM   1981  CA  GLY B 253      46.852 -58.750  -9.959  1.00  0.70           C  
ATOM   1982  C   GLY B 253      46.067 -57.593 -10.499  1.00  0.70           C  
ATOM   1983  O   GLY B 253      44.857 -57.605 -10.435  1.00  0.70           O  
ATOM   1984  N   GLN B 254      46.702 -56.557 -11.082  1.00  0.31           N  
ATOM   1985  CA  GLN B 254      46.014 -55.294 -11.361  1.00  0.31           C  
ATOM   1986  C   GLN B 254      44.750 -55.364 -12.235  1.00  0.31           C  
ATOM   1987  O   GLN B 254      43.733 -54.748 -11.925  1.00  0.31           O  
ATOM   1988  CB  GLN B 254      46.996 -54.284 -11.992  1.00  0.31           C  
ATOM   1989  CG  GLN B 254      48.154 -53.862 -11.052  1.00  0.31           C  
ATOM   1990  CD  GLN B 254      49.144 -52.933 -11.763  1.00  0.31           C  
ATOM   1991  OE1 GLN B 254      49.294 -52.953 -12.983  1.00  0.31           O  
ATOM   1992  NE2 GLN B 254      49.861 -52.097 -10.976  1.00  0.31           N  
ATOM   1993  N   ASN B 255      44.737 -56.174 -13.313  1.00  0.35           N  
ATOM   1994  CA  ASN B 255      43.523 -56.437 -14.085  1.00  0.35           C  
ATOM   1995  C   ASN B 255      42.386 -57.067 -13.268  1.00  0.35           C  
ATOM   1996  O   ASN B 255      41.205 -56.814 -13.475  1.00  0.35           O  
ATOM   1997  CB  ASN B 255      43.823 -57.379 -15.278  1.00  0.35           C  
ATOM   1998  CG  ASN B 255      44.692 -56.679 -16.316  1.00  0.35           C  
ATOM   1999  OD1 ASN B 255      44.723 -55.455 -16.419  1.00  0.35           O  
ATOM   2000  ND2 ASN B 255      45.421 -57.478 -17.129  1.00  0.35           N  
ATOM   2001  N   GLN B 256      42.720 -57.922 -12.296  1.00  0.27           N  
ATOM   2002  CA  GLN B 256      41.738 -58.410 -11.357  1.00  0.27           C  
ATOM   2003  C   GLN B 256      41.391 -57.395 -10.261  1.00  0.27           C  
ATOM   2004  O   GLN B 256      40.220 -57.079 -10.017  1.00  0.27           O  
ATOM   2005  CB  GLN B 256      42.310 -59.690 -10.674  1.00  0.27           C  
ATOM   2006  CG  GLN B 256      42.605 -60.877 -11.625  1.00  0.27           C  
ATOM   2007  CD  GLN B 256      41.335 -61.268 -12.377  1.00  0.27           C  
ATOM   2008  OE1 GLN B 256      40.228 -61.269 -11.844  1.00  0.27           O  
ATOM   2009  NE2 GLN B 256      41.474 -61.567 -13.687  1.00  0.27           N  
ATOM   2010  N   SER B 257      42.374 -56.818  -9.578  1.00  0.41           N  
ATOM   2011  CA  SER B 257      42.222 -56.012  -8.362  1.00  0.41           C  
ATOM   2012  C   SER B 257      41.658 -54.608  -8.614  1.00  0.41           C  
ATOM   2013  O   SER B 257      41.312 -53.862  -7.688  1.00  0.41           O  
ATOM   2014  CB  SER B 257      43.516 -55.864  -7.538  1.00  0.41           C  
ATOM   2015  OG  SER B 257      43.993 -57.146  -7.124  1.00  0.41           O  
ATOM   2016  N   PHE B 258      41.570 -54.171  -9.872  1.00  0.28           N  
ATOM   2017  CA  PHE B 258      41.033 -52.858 -10.203  1.00  0.28           C  
ATOM   2018  C   PHE B 258      40.035 -52.958 -11.344  1.00  0.28           C  
ATOM   2019  O   PHE B 258      38.872 -52.602 -11.195  1.00  0.28           O  
ATOM   2020  CB  PHE B 258      42.139 -51.821 -10.553  1.00  0.28           C  
ATOM   2021  CG  PHE B 258      43.073 -51.634  -9.383  1.00  0.28           C  
ATOM   2022  CD1 PHE B 258      42.678 -50.906  -8.247  1.00  0.28           C  
ATOM   2023  CD2 PHE B 258      44.322 -52.278  -9.374  1.00  0.28           C  
ATOM   2024  CE1 PHE B 258      43.505 -50.860  -7.116  1.00  0.28           C  
ATOM   2025  CE2 PHE B 258      45.152 -52.222  -8.248  1.00  0.28           C  
ATOM   2026  CZ  PHE B 258      44.745 -51.504  -7.119  1.00  0.28           C  
ATOM   2027  N   SER B 259      40.450 -53.466 -12.525  1.00  0.38           N  
ATOM   2028  CA  SER B 259      39.632 -53.466 -13.742  1.00  0.38           C  
ATOM   2029  C   SER B 259      38.352 -54.295 -13.661  1.00  0.38           C  
ATOM   2030  O   SER B 259      37.320 -53.920 -14.209  1.00  0.38           O  
ATOM   2031  CB  SER B 259      40.415 -53.957 -14.984  1.00  0.38           C  
ATOM   2032  OG  SER B 259      41.639 -53.238 -15.137  1.00  0.38           O  
ATOM   2033  N   ASN B 260      38.392 -55.449 -12.961  1.00  0.29           N  
ATOM   2034  CA  ASN B 260      37.220 -56.302 -12.745  1.00  0.29           C  
ATOM   2035  C   ASN B 260      36.534 -56.017 -11.408  1.00  0.29           C  
ATOM   2036  O   ASN B 260      35.494 -56.587 -11.088  1.00  0.29           O  
ATOM   2037  CB  ASN B 260      37.617 -57.798 -12.719  1.00  0.29           C  
ATOM   2038  CG  ASN B 260      38.078 -58.301 -14.067  1.00  0.29           C  
ATOM   2039  OD1 ASN B 260      37.640 -57.823 -15.111  1.00  0.29           O  
ATOM   2040  ND2 ASN B 260      38.972 -59.318 -14.079  1.00  0.29           N  
ATOM   2041  N   GLY B 261      37.095 -55.108 -10.594  1.00  0.52           N  
ATOM   2042  CA  GLY B 261      36.473 -54.645  -9.355  1.00  0.52           C  
ATOM   2043  C   GLY B 261      36.541 -55.538  -8.138  1.00  0.52           C  
ATOM   2044  O   GLY B 261      35.892 -55.272  -7.127  1.00  0.52           O  
ATOM   2045  N   LEU B 262      37.303 -56.626  -8.152  1.00  0.56           N  
ATOM   2046  CA  LEU B 262      37.688 -57.373  -6.969  1.00  0.56           C  
ATOM   2047  C   LEU B 262      38.925 -56.741  -6.395  1.00  0.56           C  
ATOM   2048  O   LEU B 262      39.577 -55.978  -7.107  1.00  0.56           O  
ATOM   2049  CB  LEU B 262      37.851 -58.888  -7.272  1.00  0.56           C  
ATOM   2050  CG  LEU B 262      38.802 -59.269  -8.426  1.00  0.56           C  
ATOM   2051  CD1 LEU B 262      39.299 -60.715  -8.352  1.00  0.56           C  
ATOM   2052  CD2 LEU B 262      38.201 -59.048  -9.816  1.00  0.56           C  
ATOM   2053  N   ALA B 263      39.261 -56.899  -5.112  1.00  0.78           N  
ATOM   2054  CA  ALA B 263      40.551 -56.470  -4.590  1.00  0.78           C  
ATOM   2055  C   ALA B 263      41.156 -57.442  -3.582  1.00  0.78           C  
ATOM   2056  O   ALA B 263      40.678 -57.637  -2.453  1.00  0.78           O  
ATOM   2057  CB  ALA B 263      40.504 -55.037  -4.033  1.00  0.78           C  
ATOM   2058  N   CYS B 264      42.274 -58.073  -3.990  1.00  0.75           N  
ATOM   2059  CA  CYS B 264      42.973 -59.100  -3.247  1.00  0.75           C  
ATOM   2060  C   CYS B 264      44.458 -58.975  -3.504  1.00  0.75           C  
ATOM   2061  O   CYS B 264      44.862 -58.491  -4.561  1.00  0.75           O  
ATOM   2062  CB  CYS B 264      42.580 -60.546  -3.651  1.00  0.75           C  
ATOM   2063  SG  CYS B 264      40.788 -60.837  -3.710  1.00  0.75           S  
ATOM   2064  N   LEU B 265      45.285 -59.411  -2.538  1.00  0.76           N  
ATOM   2065  CA  LEU B 265      46.737 -59.300  -2.548  1.00  0.76           C  
ATOM   2066  C   LEU B 265      47.284 -60.653  -2.148  1.00  0.76           C  
ATOM   2067  O   LEU B 265      46.602 -61.439  -1.484  1.00  0.76           O  
ATOM   2068  CB  LEU B 265      47.258 -58.311  -1.467  1.00  0.76           C  
ATOM   2069  CG  LEU B 265      47.429 -56.829  -1.853  1.00  0.76           C  
ATOM   2070  CD1 LEU B 265      46.565 -56.351  -3.017  1.00  0.76           C  
ATOM   2071  CD2 LEU B 265      47.188 -55.939  -0.628  1.00  0.76           C  
ATOM   2072  N   ASP B 266      48.543 -60.945  -2.502  1.00  0.76           N  
ATOM   2073  CA  ASP B 266      49.160 -62.210  -2.207  1.00  0.76           C  
ATOM   2074  C   ASP B 266      50.607 -62.039  -1.752  1.00  0.76           C  
ATOM   2075  O   ASP B 266      51.217 -60.971  -1.866  1.00  0.76           O  
ATOM   2076  CB  ASP B 266      49.011 -63.157  -3.417  1.00  0.76           C  
ATOM   2077  CG  ASP B 266      49.749 -62.597  -4.614  1.00  0.76           C  
ATOM   2078  OD1 ASP B 266      49.135 -61.802  -5.368  1.00  0.76           O  
ATOM   2079  OD2 ASP B 266      50.943 -62.951  -4.748  1.00  0.76           O  
ATOM   2080  N   MET B 267      51.165 -63.094  -1.145  1.00  0.77           N  
ATOM   2081  CA  MET B 267      52.536 -63.137  -0.723  1.00  0.77           C  
ATOM   2082  C   MET B 267      52.999 -64.570  -0.796  1.00  0.77           C  
ATOM   2083  O   MET B 267      52.331 -65.502  -0.344  1.00  0.77           O  
ATOM   2084  CB  MET B 267      52.705 -62.609   0.718  1.00  0.77           C  
ATOM   2085  CG  MET B 267      54.145 -62.294   1.147  1.00  0.77           C  
ATOM   2086  SD  MET B 267      54.903 -60.835   0.367  1.00  0.77           S  
ATOM   2087  CE  MET B 267      53.663 -59.576   0.732  1.00  0.77           C  
ATOM   2088  N   VAL B 268      54.183 -64.794  -1.352  1.00  0.81           N  
ATOM   2089  CA  VAL B 268      54.733 -66.106  -1.582  1.00  0.81           C  
ATOM   2090  C   VAL B 268      55.904 -66.269  -0.641  1.00  0.81           C  
ATOM   2091  O   VAL B 268      56.688 -65.338  -0.429  1.00  0.81           O  
ATOM   2092  CB  VAL B 268      55.174 -66.323  -3.029  1.00  0.81           C  
ATOM   2093  CG1 VAL B 268      55.034 -67.813  -3.370  1.00  0.81           C  
ATOM   2094  CG2 VAL B 268      54.329 -65.477  -4.001  1.00  0.81           C  
ATOM   2095  N   LEU B 269      56.063 -67.448  -0.017  1.00  0.75           N  
ATOM   2096  CA  LEU B 269      57.282 -67.738   0.712  1.00  0.75           C  
ATOM   2097  C   LEU B 269      58.284 -68.315  -0.280  1.00  0.75           C  
ATOM   2098  O   LEU B 269      57.985 -68.493  -1.449  1.00  0.75           O  
ATOM   2099  CB  LEU B 269      57.062 -68.736   1.887  1.00  0.75           C  
ATOM   2100  CG  LEU B 269      57.280 -68.176   3.313  1.00  0.75           C  
ATOM   2101  CD1 LEU B 269      57.385 -69.305   4.346  1.00  0.75           C  
ATOM   2102  CD2 LEU B 269      58.516 -67.280   3.448  1.00  0.75           C  
ATOM   2103  N   ARG B 270      59.528 -68.589   0.165  1.00  0.67           N  
ATOM   2104  CA  ARG B 270      60.466 -69.345  -0.633  1.00  0.67           C  
ATOM   2105  C   ARG B 270      61.458 -70.074   0.285  1.00  0.67           C  
ATOM   2106  O   ARG B 270      61.778 -69.583   1.348  1.00  0.67           O  
ATOM   2107  CB  ARG B 270      61.234 -68.402  -1.572  1.00  0.67           C  
ATOM   2108  CG  ARG B 270      61.647 -69.108  -2.876  1.00  0.67           C  
ATOM   2109  CD  ARG B 270      62.797 -68.492  -3.684  1.00  0.67           C  
ATOM   2110  NE  ARG B 270      62.249 -67.521  -4.680  1.00  0.67           N  
ATOM   2111  CZ  ARG B 270      62.935 -67.057  -5.734  1.00  0.67           C  
ATOM   2112  NH1 ARG B 270      64.244 -67.254  -5.849  1.00  0.67           N  
ATOM   2113  NH2 ARG B 270      62.290 -66.380  -6.682  1.00  0.67           N  
ATOM   2114  N   ILE B 271      61.952 -71.273  -0.080  1.00  0.69           N  
ATOM   2115  CA  ILE B 271      62.769 -72.145   0.828  1.00  0.69           C  
ATOM   2116  C   ILE B 271      63.501 -73.232   0.058  1.00  0.69           C  
ATOM   2117  O   ILE B 271      63.068 -74.363  -0.032  1.00  0.69           O  
ATOM   2118  CB  ILE B 271      62.072 -72.898   2.014  1.00  0.69           C  
ATOM   2119  CG1 ILE B 271      61.426 -72.007   3.086  1.00  0.69           C  
ATOM   2120  CG2 ILE B 271      63.102 -73.716   2.829  1.00  0.69           C  
ATOM   2121  CD1 ILE B 271      60.577 -72.733   4.147  1.00  0.69           C  
ATOM   2122  N   ALA B 272      64.668 -72.947  -0.541  1.00  0.75           N  
ATOM   2123  CA  ALA B 272      65.257 -73.933  -1.445  1.00  0.75           C  
ATOM   2124  C   ALA B 272      65.568 -75.322  -0.873  1.00  0.75           C  
ATOM   2125  O   ALA B 272      65.325 -76.326  -1.545  1.00  0.75           O  
ATOM   2126  CB  ALA B 272      66.539 -73.397  -2.112  1.00  0.75           C  
ATOM   2127  N   ASP B 273      66.086 -75.409   0.362  1.00  0.67           N  
ATOM   2128  CA  ASP B 273      66.496 -76.657   0.978  1.00  0.67           C  
ATOM   2129  C   ASP B 273      65.769 -76.882   2.303  1.00  0.67           C  
ATOM   2130  O   ASP B 273      65.774 -76.028   3.187  1.00  0.67           O  
ATOM   2131  CB  ASP B 273      68.031 -76.583   1.165  1.00  0.67           C  
ATOM   2132  CG  ASP B 273      68.639 -77.787   1.862  1.00  0.67           C  
ATOM   2133  OD1 ASP B 273      68.369 -78.927   1.412  1.00  0.67           O  
ATOM   2134  OD2 ASP B 273      69.405 -77.547   2.835  1.00  0.67           O  
ATOM   2135  N   VAL B 274      65.103 -78.038   2.461  1.00  0.68           N  
ATOM   2136  CA  VAL B 274      64.451 -78.448   3.699  1.00  0.68           C  
ATOM   2137  C   VAL B 274      65.434 -78.833   4.774  1.00  0.68           C  
ATOM   2138  O   VAL B 274      66.365 -79.605   4.530  1.00  0.68           O  
ATOM   2139  CB  VAL B 274      63.575 -79.674   3.515  1.00  0.68           C  
ATOM   2140  CG1 VAL B 274      62.714 -79.968   4.764  1.00  0.68           C  
ATOM   2141  CG2 VAL B 274      62.673 -79.434   2.320  1.00  0.68           C  
ATOM   2142  N   LYS B 275      65.224 -78.394   6.017  1.00  0.65           N  
ATOM   2143  CA  LYS B 275      66.023 -78.866   7.121  1.00  0.65           C  
ATOM   2144  C   LYS B 275      65.159 -79.469   8.209  1.00  0.65           C  
ATOM   2145  O   LYS B 275      63.948 -79.637   8.073  1.00  0.65           O  
ATOM   2146  CB  LYS B 275      66.926 -77.752   7.630  1.00  0.65           C  
ATOM   2147  CG  LYS B 275      67.895 -77.290   6.544  1.00  0.65           C  
ATOM   2148  CD  LYS B 275      68.631 -76.053   7.017  1.00  0.65           C  
ATOM   2149  CE  LYS B 275      69.506 -75.474   5.932  1.00  0.65           C  
ATOM   2150  NZ  LYS B 275      70.172 -74.320   6.543  1.00  0.65           N  
ATOM   2151  N   GLU B 276      65.771 -79.926   9.318  1.00  0.61           N  
ATOM   2152  CA  GLU B 276      65.019 -80.537  10.399  1.00  0.61           C  
ATOM   2153  C   GLU B 276      64.142 -79.555  11.167  1.00  0.61           C  
ATOM   2154  O   GLU B 276      62.988 -79.858  11.490  1.00  0.61           O  
ATOM   2155  CB  GLU B 276      65.949 -81.346  11.329  1.00  0.61           C  
ATOM   2156  CG  GLU B 276      65.209 -82.114  12.453  1.00  0.61           C  
ATOM   2157  CD  GLU B 276      65.532 -81.580  13.848  1.00  0.61           C  
ATOM   2158  OE1 GLU B 276      65.677 -80.342  14.005  1.00  0.61           O  
ATOM   2159  OE2 GLU B 276      65.646 -82.428  14.769  1.00  0.61           O  
ATOM   2160  N   GLU B 277      64.639 -78.319  11.398  1.00  0.66           N  
ATOM   2161  CA  GLU B 277      63.984 -77.309  12.209  1.00  0.66           C  
ATOM   2162  C   GLU B 277      62.598 -76.935  11.714  1.00  0.66           C  
ATOM   2163  O   GLU B 277      61.672 -76.674  12.490  1.00  0.66           O  
ATOM   2164  CB  GLU B 277      64.879 -76.055  12.408  1.00  0.66           C  
ATOM   2165  CG  GLU B 277      65.241 -75.204  11.155  1.00  0.66           C  
ATOM   2166  CD  GLU B 277      66.525 -75.640  10.446  1.00  0.66           C  
ATOM   2167  OE1 GLU B 277      66.877 -76.846  10.542  1.00  0.66           O  
ATOM   2168  OE2 GLU B 277      67.197 -74.778   9.814  1.00  0.66           O  
ATOM   2169  N   ASP B 278      62.410 -77.000  10.389  1.00  0.72           N  
ATOM   2170  CA  ASP B 278      61.191 -76.719   9.673  1.00  0.72           C  
ATOM   2171  C   ASP B 278      59.969 -77.512  10.154  1.00  0.72           C  
ATOM   2172  O   ASP B 278      58.833 -77.066  10.022  1.00  0.72           O  
ATOM   2173  CB  ASP B 278      61.440 -77.000   8.173  1.00  0.72           C  
ATOM   2174  CG  ASP B 278      62.591 -76.174   7.619  1.00  0.72           C  
ATOM   2175  OD1 ASP B 278      62.851 -75.067   8.146  1.00  0.72           O  
ATOM   2176  OD2 ASP B 278      63.207 -76.654   6.634  1.00  0.72           O  
ATOM   2177  N   LEU B 279      60.160 -78.710  10.745  1.00  0.67           N  
ATOM   2178  CA  LEU B 279      59.067 -79.515  11.265  1.00  0.67           C  
ATOM   2179  C   LEU B 279      58.301 -78.951  12.456  1.00  0.67           C  
ATOM   2180  O   LEU B 279      57.117 -79.259  12.618  1.00  0.67           O  
ATOM   2181  CB  LEU B 279      59.564 -80.928  11.672  1.00  0.67           C  
ATOM   2182  CG  LEU B 279      59.850 -81.890  10.503  1.00  0.67           C  
ATOM   2183  CD1 LEU B 279      60.535 -83.162  11.022  1.00  0.67           C  
ATOM   2184  CD2 LEU B 279      58.567 -82.265   9.751  1.00  0.67           C  
ATOM   2185  N   LEU B 280      58.946 -78.190  13.364  1.00  0.73           N  
ATOM   2186  CA  LEU B 280      58.305 -77.853  14.629  1.00  0.73           C  
ATOM   2187  C   LEU B 280      57.216 -76.781  14.521  1.00  0.73           C  
ATOM   2188  O   LEU B 280      56.023 -77.055  14.681  1.00  0.73           O  
ATOM   2189  CB  LEU B 280      59.354 -77.406  15.695  1.00  0.73           C  
ATOM   2190  CG  LEU B 280      58.975 -77.518  17.203  1.00  0.73           C  
ATOM   2191  CD1 LEU B 280      59.585 -76.367  18.018  1.00  0.73           C  
ATOM   2192  CD2 LEU B 280      57.483 -77.628  17.545  1.00  0.73           C  
ATOM   2193  N   LEU B 281      57.607 -75.505  14.316  1.00  0.74           N  
ATOM   2194  CA  LEU B 281      56.767 -74.384  14.703  1.00  0.74           C  
ATOM   2195  C   LEU B 281      56.201 -73.612  13.538  1.00  0.74           C  
ATOM   2196  O   LEU B 281      56.651 -73.696  12.401  1.00  0.74           O  
ATOM   2197  CB  LEU B 281      57.394 -73.482  15.799  1.00  0.74           C  
ATOM   2198  CG  LEU B 281      56.898 -73.844  17.215  1.00  0.74           C  
ATOM   2199  CD1 LEU B 281      57.699 -73.111  18.287  1.00  0.74           C  
ATOM   2200  CD2 LEU B 281      55.409 -73.543  17.424  1.00  0.74           C  
ATOM   2201  N   GLN B 282      55.088 -72.912  13.822  1.00  0.74           N  
ATOM   2202  CA  GLN B 282      54.098 -72.500  12.857  1.00  0.74           C  
ATOM   2203  C   GLN B 282      54.561 -71.579  11.741  1.00  0.74           C  
ATOM   2204  O   GLN B 282      55.375 -70.670  11.908  1.00  0.74           O  
ATOM   2205  CB  GLN B 282      52.864 -71.926  13.595  1.00  0.74           C  
ATOM   2206  CG  GLN B 282      52.260 -72.930  14.611  1.00  0.74           C  
ATOM   2207  CD  GLN B 282      50.873 -72.527  15.120  1.00  0.74           C  
ATOM   2208  OE1 GLN B 282      50.311 -71.474  14.842  1.00  0.74           O  
ATOM   2209  NE2 GLN B 282      50.232 -73.462  15.862  1.00  0.74           N  
ATOM   2210  N   TYR B 283      54.017 -71.831  10.539  1.00  0.78           N  
ATOM   2211  CA  TYR B 283      54.192 -70.989   9.383  1.00  0.78           C  
ATOM   2212  C   TYR B 283      52.889 -70.241   9.209  1.00  0.78           C  
ATOM   2213  O   TYR B 283      51.873 -70.808   8.799  1.00  0.78           O  
ATOM   2214  CB  TYR B 283      54.460 -71.828   8.108  1.00  0.78           C  
ATOM   2215  CG  TYR B 283      55.868 -72.369   8.058  1.00  0.78           C  
ATOM   2216  CD1 TYR B 283      56.769 -71.834   7.125  1.00  0.78           C  
ATOM   2217  CD2 TYR B 283      56.303 -73.423   8.886  1.00  0.78           C  
ATOM   2218  CE1 TYR B 283      58.071 -72.333   7.022  1.00  0.78           C  
ATOM   2219  CE2 TYR B 283      57.614 -73.926   8.783  1.00  0.78           C  
ATOM   2220  CZ  TYR B 283      58.494 -73.380   7.840  1.00  0.78           C  
ATOM   2221  OH  TYR B 283      59.812 -73.838   7.657  1.00  0.78           O  
ATOM   2222  N   ASP B 284      52.885 -68.942   9.526  1.00  0.82           N  
ATOM   2223  CA  ASP B 284      51.663 -68.203   9.734  1.00  0.82           C  
ATOM   2224  C   ASP B 284      51.449 -67.192   8.625  1.00  0.82           C  
ATOM   2225  O   ASP B 284      52.145 -66.189   8.471  1.00  0.82           O  
ATOM   2226  CB  ASP B 284      51.656 -67.507  11.115  1.00  0.82           C  
ATOM   2227  CG  ASP B 284      51.787 -68.520  12.233  1.00  0.82           C  
ATOM   2228  OD1 ASP B 284      52.636 -68.280  13.130  1.00  0.82           O  
ATOM   2229  OD2 ASP B 284      51.015 -69.513  12.215  1.00  0.82           O  
ATOM   2230  N   CYS B 285      50.424 -67.437   7.802  1.00  0.84           N  
ATOM   2231  CA  CYS B 285      49.973 -66.507   6.787  1.00  0.84           C  
ATOM   2232  C   CYS B 285      49.038 -65.542   7.462  1.00  0.84           C  
ATOM   2233  O   CYS B 285      48.126 -65.948   8.181  1.00  0.84           O  
ATOM   2234  CB  CYS B 285      49.251 -67.263   5.645  1.00  0.84           C  
ATOM   2235  SG  CYS B 285      48.139 -66.331   4.511  1.00  0.84           S  
ATOM   2236  N   LEU B 286      49.253 -64.235   7.271  1.00  0.86           N  
ATOM   2237  CA  LEU B 286      48.419 -63.237   7.895  1.00  0.86           C  
ATOM   2238  C   LEU B 286      47.883 -62.290   6.854  1.00  0.86           C  
ATOM   2239  O   LEU B 286      48.565 -61.939   5.895  1.00  0.86           O  
ATOM   2240  CB  LEU B 286      49.146 -62.380   8.955  1.00  0.86           C  
ATOM   2241  CG  LEU B 286      50.272 -63.044   9.757  1.00  0.86           C  
ATOM   2242  CD1 LEU B 286      51.039 -61.925  10.458  1.00  0.86           C  
ATOM   2243  CD2 LEU B 286      49.795 -64.070  10.787  1.00  0.86           C  
ATOM   2244  N   ALA B 287      46.644 -61.826   7.040  1.00  0.88           N  
ATOM   2245  CA  ALA B 287      46.088 -60.753   6.259  1.00  0.88           C  
ATOM   2246  C   ALA B 287      45.527 -59.722   7.214  1.00  0.88           C  
ATOM   2247  O   ALA B 287      44.776 -60.069   8.127  1.00  0.88           O  
ATOM   2248  CB  ALA B 287      44.998 -61.313   5.341  1.00  0.88           C  
ATOM   2249  N   LEU B 288      45.887 -58.430   7.056  1.00  0.86           N  
ATOM   2250  CA  LEU B 288      45.404 -57.401   7.962  1.00  0.86           C  
ATOM   2251  C   LEU B 288      44.937 -56.139   7.275  1.00  0.86           C  
ATOM   2252  O   LEU B 288      45.266 -55.841   6.125  1.00  0.86           O  
ATOM   2253  CB  LEU B 288      46.359 -57.111   9.147  1.00  0.86           C  
ATOM   2254  CG  LEU B 288      47.341 -55.931   9.062  1.00  0.86           C  
ATOM   2255  CD1 LEU B 288      48.190 -55.898  10.337  1.00  0.86           C  
ATOM   2256  CD2 LEU B 288      48.256 -56.005   7.843  1.00  0.86           C  
ATOM   2257  N   ASN B 289      44.093 -55.388   7.988  1.00  0.83           N  
ATOM   2258  CA  ASN B 289      43.197 -54.410   7.432  1.00  0.83           C  
ATOM   2259  C   ASN B 289      42.917 -53.470   8.581  1.00  0.83           C  
ATOM   2260  O   ASN B 289      43.304 -53.754   9.713  1.00  0.83           O  
ATOM   2261  CB  ASN B 289      41.874 -55.108   6.998  1.00  0.83           C  
ATOM   2262  CG  ASN B 289      41.263 -54.452   5.771  1.00  0.83           C  
ATOM   2263  OD1 ASN B 289      41.843 -53.573   5.151  1.00  0.83           O  
ATOM   2264  ND2 ASN B 289      40.054 -54.892   5.374  1.00  0.83           N  
ATOM   2265  N   LEU B 290      42.203 -52.349   8.369  1.00  0.83           N  
ATOM   2266  CA  LEU B 290      41.761 -51.538   9.499  1.00  0.83           C  
ATOM   2267  C   LEU B 290      40.681 -52.234  10.328  1.00  0.83           C  
ATOM   2268  O   LEU B 290      40.541 -52.016  11.526  1.00  0.83           O  
ATOM   2269  CB  LEU B 290      41.248 -50.149   9.060  1.00  0.83           C  
ATOM   2270  CG  LEU B 290      42.242 -49.289   8.254  1.00  0.83           C  
ATOM   2271  CD1 LEU B 290      41.684 -47.867   8.133  1.00  0.83           C  
ATOM   2272  CD2 LEU B 290      43.648 -49.241   8.863  1.00  0.83           C  
ATOM   2273  N   HIS B 291      39.919 -53.152   9.703  1.00  0.82           N  
ATOM   2274  CA  HIS B 291      38.990 -54.041  10.376  1.00  0.82           C  
ATOM   2275  C   HIS B 291      39.628 -55.000  11.372  1.00  0.82           C  
ATOM   2276  O   HIS B 291      38.998 -55.403  12.346  1.00  0.82           O  
ATOM   2277  CB  HIS B 291      38.211 -54.896   9.355  1.00  0.82           C  
ATOM   2278  CG  HIS B 291      37.265 -54.097   8.513  1.00  0.82           C  
ATOM   2279  ND1 HIS B 291      37.757 -53.255   7.536  1.00  0.82           N  
ATOM   2280  CD2 HIS B 291      35.910 -54.016   8.569  1.00  0.82           C  
ATOM   2281  CE1 HIS B 291      36.690 -52.674   7.017  1.00  0.82           C  
ATOM   2282  NE2 HIS B 291      35.548 -53.099   7.607  1.00  0.82           N  
ATOM   2283  N   GLY B 292      40.884 -55.421  11.131  1.00  0.87           N  
ATOM   2284  CA  GLY B 292      41.589 -56.338  12.013  1.00  0.87           C  
ATOM   2285  C   GLY B 292      42.414 -57.333  11.254  1.00  0.87           C  
ATOM   2286  O   GLY B 292      42.774 -57.128  10.098  1.00  0.87           O  
ATOM   2287  N   LEU B 293      42.764 -58.440  11.923  1.00  0.85           N  
ATOM   2288  CA  LEU B 293      43.758 -59.388  11.470  1.00  0.85           C  
ATOM   2289  C   LEU B 293      43.147 -60.767  11.357  1.00  0.85           C  
ATOM   2290  O   LEU B 293      42.470 -61.236  12.271  1.00  0.85           O  
ATOM   2291  CB  LEU B 293      44.902 -59.424  12.517  1.00  0.85           C  
ATOM   2292  CG  LEU B 293      46.044 -60.434  12.290  1.00  0.85           C  
ATOM   2293  CD1 LEU B 293      46.830 -60.125  11.025  1.00  0.85           C  
ATOM   2294  CD2 LEU B 293      47.028 -60.428  13.466  1.00  0.85           C  
ATOM   2295  N   ARG B 294      43.388 -61.478  10.240  1.00  0.77           N  
ATOM   2296  CA  ARG B 294      43.052 -62.885  10.146  1.00  0.77           C  
ATOM   2297  C   ARG B 294      44.331 -63.654   9.864  1.00  0.77           C  
ATOM   2298  O   ARG B 294      45.153 -63.239   9.049  1.00  0.77           O  
ATOM   2299  CB  ARG B 294      41.937 -63.145   9.096  1.00  0.77           C  
ATOM   2300  CG  ARG B 294      41.018 -64.350   9.411  1.00  0.77           C  
ATOM   2301  CD  ARG B 294      39.592 -64.209   8.837  1.00  0.77           C  
ATOM   2302  NE  ARG B 294      39.054 -65.559   8.451  1.00  0.77           N  
ATOM   2303  CZ  ARG B 294      39.377 -66.190   7.312  1.00  0.77           C  
ATOM   2304  NH1 ARG B 294      40.316 -65.707   6.512  1.00  0.77           N  
ATOM   2305  NH2 ARG B 294      38.760 -67.321   6.986  1.00  0.77           N  
ATOM   2306  N   ARG B 295      44.557 -64.780  10.567  1.00  0.77           N  
ATOM   2307  CA  ARG B 295      45.741 -65.600  10.375  1.00  0.77           C  
ATOM   2308  C   ARG B 295      45.354 -67.015  10.023  1.00  0.77           C  
ATOM   2309  O   ARG B 295      44.315 -67.507  10.461  1.00  0.77           O  
ATOM   2310  CB  ARG B 295      46.698 -65.633  11.595  1.00  0.77           C  
ATOM   2311  CG  ARG B 295      46.129 -66.209  12.905  1.00  0.77           C  
ATOM   2312  CD  ARG B 295      47.198 -66.627  13.935  1.00  0.77           C  
ATOM   2313  NE  ARG B 295      48.399 -65.730  13.832  1.00  0.77           N  
ATOM   2314  CZ  ARG B 295      48.649 -64.652  14.584  1.00  0.77           C  
ATOM   2315  NH1 ARG B 295      47.842 -64.255  15.564  1.00  0.77           N  
ATOM   2316  NH2 ARG B 295      49.749 -63.943  14.337  1.00  0.77           N  
ATOM   2317  N   HIS B 296      46.189 -67.705   9.233  1.00  0.80           N  
ATOM   2318  CA  HIS B 296      46.041 -69.124   8.978  1.00  0.80           C  
ATOM   2319  C   HIS B 296      47.380 -69.811   9.096  1.00  0.80           C  
ATOM   2320  O   HIS B 296      48.430 -69.256   8.773  1.00  0.80           O  
ATOM   2321  CB  HIS B 296      45.498 -69.443   7.569  1.00  0.80           C  
ATOM   2322  CG  HIS B 296      44.032 -69.203   7.364  1.00  0.80           C  
ATOM   2323  ND1 HIS B 296      43.560 -69.189   6.073  1.00  0.80           N  
ATOM   2324  CD2 HIS B 296      42.997 -69.079   8.231  1.00  0.80           C  
ATOM   2325  CE1 HIS B 296      42.258 -69.055   6.163  1.00  0.80           C  
ATOM   2326  NE2 HIS B 296      41.859 -68.978   7.455  1.00  0.80           N  
ATOM   2327  N   THR B 297      47.355 -71.063   9.576  1.00  0.81           N  
ATOM   2328  CA  THR B 297      48.550 -71.767  10.014  1.00  0.81           C  
ATOM   2329  C   THR B 297      48.849 -72.916   9.069  1.00  0.81           C  
ATOM   2330  O   THR B 297      48.015 -73.800   8.870  1.00  0.81           O  
ATOM   2331  CB  THR B 297      48.398 -72.420  11.388  1.00  0.81           C  
ATOM   2332  OG1 THR B 297      48.045 -71.504  12.420  1.00  0.81           O  
ATOM   2333  CG2 THR B 297      49.732 -72.934  11.866  1.00  0.81           C  
ATOM   2334  N   VAL B 298      50.063 -72.971   8.488  1.00  0.81           N  
ATOM   2335  CA  VAL B 298      50.508 -74.105   7.684  1.00  0.81           C  
ATOM   2336  C   VAL B 298      51.399 -75.036   8.511  1.00  0.81           C  
ATOM   2337  O   VAL B 298      51.795 -74.706   9.635  1.00  0.81           O  
ATOM   2338  CB  VAL B 298      51.189 -73.698   6.377  1.00  0.81           C  
ATOM   2339  CG1 VAL B 298      50.846 -74.710   5.269  1.00  0.81           C  
ATOM   2340  CG2 VAL B 298      50.684 -72.321   5.926  1.00  0.81           C  
ATOM   2341  N   ARG B 299      51.713 -76.249   8.010  1.00  0.70           N  
ATOM   2342  CA  ARG B 299      52.685 -77.120   8.653  1.00  0.70           C  
ATOM   2343  C   ARG B 299      53.462 -78.060   7.721  1.00  0.70           C  
ATOM   2344  O   ARG B 299      53.005 -78.333   6.586  1.00  0.70           O  
ATOM   2345  CB  ARG B 299      52.073 -77.950   9.804  1.00  0.70           C  
ATOM   2346  CG  ARG B 299      53.045 -78.025  11.003  1.00  0.70           C  
ATOM   2347  CD  ARG B 299      52.401 -77.954  12.385  1.00  0.70           C  
ATOM   2348  NE  ARG B 299      51.420 -76.828  12.334  1.00  0.70           N  
ATOM   2349  CZ  ARG B 299      50.445 -76.664  13.230  1.00  0.70           C  
ATOM   2350  NH1 ARG B 299      50.549 -77.153  14.461  1.00  0.70           N  
ATOM   2351  NH2 ARG B 299      49.347 -76.001  12.884  1.00  0.70           N  
ATOM   2352  OXT ARG B 299      54.538 -78.547   8.151  1.00  0.70           O  
TER    2353      ARG B 299                                                      
HETATM 2354  C1  NAG _   1      57.708 -15.226  31.673  1.00110.00           C  
HETATM 2355  C2  NAG _   1      57.833 -13.729  32.103  1.00110.00           C  
HETATM 2356  C3  NAG _   1      58.568 -13.475  33.444  1.00110.00           C  
HETATM 2357  C4  NAG _   1      58.623 -14.707  34.369  1.00110.00           C  
HETATM 2358  C5  NAG _   1      59.013 -15.888  33.488  1.00110.00           C  
HETATM 2359  C6  NAG _   1      59.515 -17.146  34.191  1.00110.00           C  
HETATM 2360  C7  NAG _   1      58.758 -11.614  31.098  1.00110.00           C  
HETATM 2361  C8  NAG _   1      60.220 -11.272  30.883  1.00110.00           C  
HETATM 2362  N2  NAG _   1      58.435 -12.924  31.028  1.00110.00           N  
HETATM 2363  O3  NAG _   1      57.942 -12.398  34.106  1.00110.00           O  
HETATM 2364  O4  NAG _   1      59.538 -14.553  35.441  1.00110.00           O  
HETATM 2365  O5  NAG _   1      57.827 -16.131  32.771  1.00110.00           O  
HETATM 2366  O6  NAG _   1      58.422 -18.015  34.404  1.00110.00           O  
HETATM 2367  O7  NAG _   1      57.919 -10.713  31.289  1.00110.00           O  
CONECT 2354 2355 2365
CONECT 2355 2354 2356 2362
CONECT 2356 2355 2357 2363
CONECT 2357 2356 2358 2364
CONECT 2358 2357 2359 2365
CONECT 2359 2358 2366
CONECT 2360 2361 2362 2367
CONECT 2361 2360
CONECT 2362 2355 2360
CONECT 2363 2356
CONECT 2364 2357
CONECT 2365 2354 2358
CONECT 2366 2359
CONECT 2367 2360
END   



If you find results from this site helpful for your research, please cite one of our papers:

elNémo is maintained by Yves-Henri Sanejouand.
It was developed by Karsten Suhre.
Between 2003 and 2014, it was hosted by IGS (Marseille).
Last modification: October 18th, 2018.